1NTIA

Rdc-refined nmr structure of bovine acyl-coenzyme a binding protein, acbp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subtle structural response to ligand binding revealed by residual dipolar coupling refined NMR structures of acyl coenzyme A binding protein
rcsb
source organism Bos taurus
molecule tags Lipid binding protein
molecule keywords Acyl-CoA-binding protein
total genus 30
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ntiA00
1NI2A 2WH5A 2CQUA 2RQ1A 3X23A 1MK7B 3AU5A 2CB8A 2J0JA 1ST7A 2EMTA 1HB6A 1HBKA 1MIZB 2D10A 2LBBA 4HDQA 1EF1A 2AL6A 4ZRKA 3WA0A 4EKUA 2HE7A 1GC7A 1NVLA 2HRJA 2YVCA 1NTIA 3PVLA 1GC6A 2FJ9A 2J0KA 3IVFA 2COPA 4P7IA 1J19A 3G9WA 3BINA 1E5WA 1ISNA 1ACAA 2D2QA 4ZRIA 1H4RA 4F7GA 2D11A 3PZDA 3QIJA 2EMSA 3FP5A 1Y19B 3U8ZA 2FDQA 4ZRJA 2I1JA 1HB8A 4HDOA 2AEHA 1GG3A 4DXAB 3U7DA 2I1KA 3AU4A 4YL8A 3FLVA 1MK9B 2J0MA 4NY0A 1MIXA 3ZDTA 2ABDA 4CYEA 3EPYA 1SGHA 2ZPYA 5IJMA
chains in the Genus database with same CATH superfamily
1NI2A 2WH5A 3AU5A 4JKGB 2EMTA 1HB6A 2D10A 2HE7A 2HRJA 1GC6A 2J0KA 2COPA 1J19A 4JKHA 1E5WA 1ISNA 3E9OA 4JKFA 1H4RA 4ILGB 4JKEA 2FDQA 4TKNA 1VBGA 1KBLA 5JVLA 4GXBA 3FLVA 2ABDA 1SGHA 1ST7A 2LBBA 4ZRKA 1EF1A 1GC7A 2YVCA 4JK9A 1KC7A 2FJ9A 3G9WA 3BINA 3E9LA 4ZRIA 2D11A 3QIJA 3FP5A 1Y19B 1GG3A 4DXAB 4NY0A 1MIXA 3ZDTA 2DIKA 4CYEA 3PZDA 2CQUA 4JKAA 2RQ1A 3X23A 2J0JA 1HBKA 2AL6A 1JDEA 4ILJA 4EKUA 3SBGA 3ENBA 4P7IA 1VBHA 4JKDA 4F7GA 2EMSA 3U8ZA 4ZRJA 1HB8A 4JKCA 3U7DA 3AU4A 4JK7A 4YL8A 1MK9B 4JKBA 3EPYA 3PVLA 4JK8A 3SBTA 1MK7B 2CB8A 4HDQA 3E66A 1MIZB 5IJMA 3WA0A 1NVLA 1NTIA 3IVFA 1DIKA 2X0SA 4JKGA 1ACAA 2D2QA 2I1JA 4HDOA 2AEHA 3E9PA 2I1KA 1GGOA 4ILHA 2J0MA 2ZPYA 2R82A
chains in the Genus database with same CATH topology
1NI2A 2WH5A 3AU5A 4JKGB 2EMTA 1HB6A 2D10A 2HE7A 2HRJA 1GC6A 2J0KA 2COPA 1J19A 4JKHA 1E5WA 1ISNA 3E9OA 4JKFA 1H4RA 4ILGB 4JKEA 2FDQA 4TKNA 1VBGA 1KBLA 5JVLA 4GXBA 3FLVA 2ABDA 1SGHA 1ST7A 2LBBA 4ZRKA 1EF1A 1GC7A 2YVCA 4JK9A 1KC7A 2FJ9A 3G9WA 3BINA 3E9LA 4ZRIA 2D11A 3QIJA 3FP5A 1Y19B 1GG3A 4DXAB 4NY0A 1MIXA 3ZDTA 2DIKA 4CYEA 3PZDA 2CQUA 4JKAA 2RQ1A 3X23A 2J0JA 1HBKA 2AL6A 1JDEA 4ILJA 4EKUA 3SBGA 3ENBA 4P7IA 1VBHA 4JKDA 4F7GA 2EMSA 3U8ZA 4ZRJA 1HB8A 4JKCA 3U7DA 3AU4A 4JK7A 4YL8A 1MK9B 4JKBA 3EPYA 3PVLA 4JK8A 3SBTA 1MK7B 2CB8A 4HDQA 3E66A 1MIZB 5IJMA 3WA0A 1NVLA 1NTIA 3IVFA 1DIKA 2X0SA 4JKGA 1ACAA 2D2QA 2I1JA 4HDOA 2AEHA 3E9PA 2I1KA 1GGOA 4ILHA 2J0MA 2ZPYA 2R82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  2WH5 A;  2CQU A;  2RQ1 A;  3X23 A;  1MK7 B;  3AU5 A;  2CB8 A;  2J0J A;  1ST7 A;  2EMT A;  1HB6 A;  1HBK A;  1MIZ B;  2D10 A;  2LBB A;  4HDQ A;  1EF1 A;  2AL6 A;  4ZRK A;  3WA0 A;  4EKU A;  2HE7 A;  1GC7 A;  1NVL A;  2HRJ A;  2YVC A;  1NTI A;  3PVL A;  1GC6 A;  2FJ9 A;  2J0K A;  3IVF A;  2COP A;  4P7I A;  1J19 A;  3G9W A;  3BIN A;  1E5W A;  1ISN A;  1ACA A;  2D2Q A;  4ZRI A;  1H4R A;  4F7G A;  2D11 A;  3PZD A;  3QIJ A;  2EMS A;  3FP5 A;  1Y19 B;  3U8Z A;  2FDQ A;  4ZRJ A;  2I1J A;  1HB8 A;  4HDO A;  2AEH A;  1GG3 A;  4DXA B;  3U7D A;  2I1K A;  3AU4 A;  4YL8 A;  3FLV A;  1MK9 B;  2J0M A;  4NY0 A;  1MIX A;  3ZDT A;  2ABD A;  4CYE A;  3EPY A;  1SGH A;  2ZPY A;  5IJM A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  2WH5 A;  3AU5 A;  4JKG B;  2EMT A;  1HB6 A;  2D10 A;  2HE7 A;  2HRJ A;  1GC6 A;  2J0K A;  2COP A;  1J19 A;  4JKH A;  1E5W A;  1ISN A;  3E9O A;  4JKF A;  1H4R A;  4ILG B;  4JKE A;  2FDQ A;  4TKN A;  1VBG A;  1KBL A;  5JVL A;  4GXB A;  3FLV A;  2ABD A;  1SGH A;  1ST7 A;  2LBB A;  4ZRK A;  1EF1 A;  1GC7 A;  2YVC A;  4JK9 A;  1KC7 A;  2FJ9 A;  3G9W A;  3BIN A;  3E9L A;  4ZRI A;  2D11 A;  3QIJ A;  3FP5 A;  1Y19 B;  1GG3 A;  4DXA B;  4NY0 A;  1MIX A;  3ZDT A;  2DIK A;  4CYE A;  3PZD A;  2CQU A;  4JKA A;  2RQ1 A;  3X23 A;  2J0J A;  1HBK A;  2AL6 A;  1JDE A;  4ILJ A;  4EKU A;  3SBG A;  3ENB A;  4P7I A;  1VBH A;  4JKD A;  4F7G A;  2EMS A;  3U8Z A;  4ZRJ A;  1HB8 A;  4JKC A;  3U7D A;  3AU4 A;  4JK7 A;  4YL8 A;  1MK9 B;  4JKB A;  3EPY A;  3PVL A;  4JK8 A;  3SBT A;  1MK7 B;  2CB8 A;  4HDQ A;  3E66 A;  1MIZ B;  5IJM A;  3WA0 A;  1NVL A;  1NTI A;  3IVF A;  1DIK A;  2X0S A;  4JKG A;  1ACA A;  2D2Q A;  2I1J A;  4HDO A;  2AEH A;  3E9P A;  2I1K A;  1GGO A;  4ILH A;  2J0M A;  2ZPY A;  2R82 A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  2WH5 A;  3AU5 A;  4JKG B;  2EMT A;  1HB6 A;  2D10 A;  2HE7 A;  2HRJ A;  1GC6 A;  2J0K A;  2COP A;  1J19 A;  4JKH A;  1E5W A;  1ISN A;  3E9O A;  4JKF A;  1H4R A;  4ILG B;  4JKE A;  2FDQ A;  4TKN A;  1VBG A;  1KBL A;  5JVL A;  4GXB A;  3FLV A;  2ABD A;  1SGH A;  1ST7 A;  2LBB A;  4ZRK A;  1EF1 A;  1GC7 A;  2YVC A;  4JK9 A;  1KC7 A;  2FJ9 A;  3G9W A;  3BIN A;  3E9L A;  4ZRI A;  2D11 A;  3QIJ A;  3FP5 A;  1Y19 B;  1GG3 A;  4DXA B;  4NY0 A;  1MIX A;  3ZDT A;  2DIK A;  4CYE A;  3PZD A;  2CQU A;  4JKA A;  2RQ1 A;  3X23 A;  2J0J A;  1HBK A;  2AL6 A;  1JDE A;  4ILJ A;  4EKU A;  3SBG A;  3ENB A;  4P7I A;  1VBH A;  4JKD A;  4F7G A;  2EMS A;  3U8Z A;  4ZRJ A;  1HB8 A;  4JKC A;  3U7D A;  3AU4 A;  4JK7 A;  4YL8 A;  1MK9 B;  4JKB A;  3EPY A;  3PVL A;  4JK8 A;  3SBT A;  1MK7 B;  2CB8 A;  4HDQ A;  3E66 A;  1MIZ B;  5IJM A;  3WA0 A;  1NVL A;  1NTI A;  3IVF A;  1DIK A;  2X0S A;  4JKG A;  1ACA A;  2D2Q A;  2I1J A;  4HDO A;  2AEH A;  3E9P A;  2I1K A;  1GGO A;  4ILH A;  2J0M A;  2ZPY A;  2R82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...