1NTIA

Rdc-refined nmr structure of bovine acyl-coenzyme a binding protein, acbp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title Subtle structural response to ligand binding revealed by residual dipolar coupling refined NMR structures of acyl coenzyme A binding protein
rcsb
source organism Bos taurus
molecule tags Lipid binding protein
total genus 30
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ntiA00
2RQ1A 1ACAA 2FJ9A 1SGHA 2J0MA 4ZRIA 2LBBA 3EPYA 2AL6A 3AU4A 3U8ZA 2WH5A 2D2QA 1ISNA 2EMTA 3QIJA 2CQUA 3WA0A 1MK9B 1GC6A 1Y19B 2J0KA 4F7GA 4HDOA 3PZDA 1EF1A 1HB6A 3U7DA 1NVLA 3BINA 3ZDTA 5IJMA 1E5WA 1NI2A 2ABDA 1MK7B 3FP5A 2D11A 2AEHA 3AU5A 2HRJA 2COPA 2YVCA 1J19A 3FLVA 1ST7A 3G9WA 3PVLA 1NTIA 1H4RA 4ZRKA 2HE7A 3IVFA 4YL8A 2I1JA 2FDQA 4EKUA 2I1KA 2CB8A 4NY0A 1GG3A 2ZPYA 2J0JA 4P7IA 3X23A 1HB8A 2D10A 1HBKA 4ZRJA 4DXAB 4HDQA 4CYEA 1MIZB 1MIXA 2EMSA 1GC7A
chains in the Genus database with same CATH superfamily
2J0MA 2LBBA 4TKNA 2AL6A 1JDEA 4JKAA 2EMTA 2J0KA 1Y19B 4JKBA 3E9LA 3PZDA 1EF1A 3BINA 5IJMA 1NI2A 2ABDA 1MK7B 1ST7A 1NTIA 4ZRKA 2HE7A 3IVFA 4YL8A 2CB8A 4JKDA 4P7IA 3X23A 4ZRJA 1HBKA 4DXAB 1ACAA 4ZRIA 2EMSA 1VBGA 3EPYA 3AU4A 2R82A 1GGOA 2D2QA 4JKFA 1ISNA 2CQUA 1KBLA 4F7GA 3ZDTA 1NVLA 2COPA 1DIKA 1J19A 2YVCA 3PVLA 4JKHA 4EKUA 2FDQA 4JKCA 4ILJA 2ZPYA 4HDQA 4ILHA 4JKEA 4CYEA 2RQ1A 1SGHA 3U8ZA 2X0SA 3WA0A 1GC6A 4GXBA 2DIKA 1E5WA 3FP5A 2D11A 2HRJA 3E9PA 1H4RA 5JVLA 1KC7A 3E9OA 4JK8A 3SBGA 4NY0A 1GG3A 2WH5A 3E66A 1MIXA 1GC7A 2FJ9A 4JK9A 3ENBA 3QIJA 1MK9B 1VBHA 1HB6A 3U7DA 4JKGB 3AU5A 2AEHA 3G9WA 3FLVA 4ILGB 4JK7A 2I1JA 4JKGA 2I1KA 3SBTA 2J0JA 1HB8A 2D10A 1MIZB 4HDOA
chains in the Genus database with same CATH topology
2J0MA 2LBBA 4TKNA 2AL6A 1JDEA 4JKAA 2EMTA 2J0KA 1Y19B 4JKBA 3E9LA 3PZDA 1EF1A 3BINA 5IJMA 1NI2A 2ABDA 1MK7B 1ST7A 1NTIA 4ZRKA 2HE7A 3IVFA 4YL8A 2CB8A 4JKDA 4P7IA 3X23A 4ZRJA 1HBKA 4DXAB 1ACAA 4ZRIA 2EMSA 1VBGA 3EPYA 3AU4A 2R82A 1GGOA 2D2QA 4JKFA 1ISNA 2CQUA 1KBLA 4F7GA 3ZDTA 1NVLA 2COPA 1DIKA 1J19A 2YVCA 3PVLA 4JKHA 4EKUA 2FDQA 4JKCA 4ILJA 2ZPYA 4HDQA 4ILHA 4JKEA 4CYEA 2RQ1A 1SGHA 3U8ZA 2X0SA 3WA0A 1GC6A 4GXBA 2DIKA 1E5WA 3FP5A 2D11A 2HRJA 3E9PA 1H4RA 5JVLA 1KC7A 3E9OA 4JK8A 3SBGA 4NY0A 1GG3A 2WH5A 3E66A 1MIXA 1GC7A 2FJ9A 4JK9A 3ENBA 3QIJA 1MK9B 1VBHA 1HB6A 3U7DA 4JKGB 3AU5A 2AEHA 3G9WA 3FLVA 4ILGB 4JK7A 2I1JA 4JKGA 2I1KA 3SBTA 2J0JA 1HB8A 2D10A 1MIZB 4HDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQ1 A;  1ACA A;  2FJ9 A;  1SGH A;  2J0M A;  4ZRI A;  2LBB A;  3EPY A;  2AL6 A;  3AU4 A;  3U8Z A;  2WH5 A;  2D2Q A;  1ISN A;  2EMT A;  3QIJ A;  2CQU A;  3WA0 A;  1MK9 B;  1GC6 A;  1Y19 B;  2J0K A;  4F7G A;  4HDO A;  3PZD A;  1EF1 A;  1HB6 A;  3U7D A;  1NVL A;  3BIN A;  3ZDT A;  5IJM A;  1E5W A;  1NI2 A;  2ABD A;  1MK7 B;  3FP5 A;  2D11 A;  2AEH A;  3AU5 A;  2HRJ A;  2COP A;  2YVC A;  1J19 A;  3FLV A;  1ST7 A;  3G9W A;  3PVL A;  1NTI A;  1H4R A;  4ZRK A;  2HE7 A;  3IVF A;  4YL8 A;  2I1J A;  2FDQ A;  4EKU A;  2I1K A;  2CB8 A;  4NY0 A;  1GG3 A;  2ZPY A;  2J0J A;  4P7I A;  3X23 A;  1HB8 A;  2D10 A;  1HBK A;  4ZRJ A;  4DXA B;  4HDQ A;  4CYE A;  1MIZ B;  1MIX A;  2EMS A;  1GC7 A; 
#chains in the Genus database with same CATH topology
 2J0M A;  2LBB A;  4TKN A;  2AL6 A;  1JDE A;  4JKA A;  2EMT A;  2J0K A;  1Y19 B;  4JKB A;  3E9L A;  3PZD A;  1EF1 A;  3BIN A;  5IJM A;  1NI2 A;  2ABD A;  1MK7 B;  1ST7 A;  1NTI A;  4ZRK A;  2HE7 A;  3IVF A;  4YL8 A;  2CB8 A;  4JKD A;  4P7I A;  3X23 A;  4ZRJ A;  1HBK A;  4DXA B;  1ACA A;  4ZRI A;  2EMS A;  1VBG A;  3EPY A;  3AU4 A;  2R82 A;  1GGO A;  2D2Q A;  4JKF A;  1ISN A;  2CQU A;  1KBL A;  4F7G A;  3ZDT A;  1NVL A;  2COP A;  1DIK A;  1J19 A;  2YVC A;  3PVL A;  4JKH A;  4EKU A;  2FDQ A;  4JKC A;  4ILJ A;  2ZPY A;  4HDQ A;  4ILH A;  4JKE A;  4CYE A;  2RQ1 A;  1SGH A;  3U8Z A;  2X0S A;  3WA0 A;  1GC6 A;  4GXB A;  2DIK A;  1E5W A;  3FP5 A;  2D11 A;  2HRJ A;  3E9P A;  1H4R A;  5JVL A;  1KC7 A;  3E9O A;  4JK8 A;  3SBG A;  4NY0 A;  1GG3 A;  2WH5 A;  3E66 A;  1MIX A;  1GC7 A;  2FJ9 A;  4JK9 A;  3ENB A;  3QIJ A;  1MK9 B;  1VBH A;  1HB6 A;  3U7D A;  4JKG B;  3AU5 A;  2AEH A;  3G9W A;  3FLV A;  4ILG B;  4JK7 A;  2I1J A;  4JKG A;  2I1K A;  3SBT A;  2J0J A;  1HB8 A;  2D10 A;  1MIZ B;  4HDO A; 
#chains in the Genus database with same CATH homology
 2J0M A;  2LBB A;  4TKN A;  2AL6 A;  1JDE A;  4JKA A;  2EMT A;  2J0K A;  1Y19 B;  4JKB A;  3E9L A;  3PZD A;  1EF1 A;  3BIN A;  5IJM A;  1NI2 A;  2ABD A;  1MK7 B;  1ST7 A;  1NTI A;  4ZRK A;  2HE7 A;  3IVF A;  4YL8 A;  2CB8 A;  4JKD A;  4P7I A;  3X23 A;  4ZRJ A;  1HBK A;  4DXA B;  1ACA A;  4ZRI A;  2EMS A;  1VBG A;  3EPY A;  3AU4 A;  2R82 A;  1GGO A;  2D2Q A;  4JKF A;  1ISN A;  2CQU A;  1KBL A;  4F7G A;  3ZDT A;  1NVL A;  2COP A;  1DIK A;  1J19 A;  2YVC A;  3PVL A;  4JKH A;  4EKU A;  2FDQ A;  4JKC A;  4ILJ A;  2ZPY A;  4HDQ A;  4ILH A;  4JKE A;  4CYE A;  2RQ1 A;  1SGH A;  3U8Z A;  2X0S A;  3WA0 A;  1GC6 A;  4GXB A;  2DIK A;  1E5W A;  3FP5 A;  2D11 A;  2HRJ A;  3E9P A;  1H4R A;  5JVL A;  1KC7 A;  3E9O A;  4JK8 A;  3SBG A;  4NY0 A;  1GG3 A;  2WH5 A;  3E66 A;  1MIX A;  1GC7 A;  2FJ9 A;  4JK9 A;  3ENB A;  3QIJ A;  1MK9 B;  1VBH A;  1HB6 A;  3U7D A;  4JKG B;  3AU5 A;  2AEH A;  3G9W A;  3FLV A;  4ILG B;  4JK7 A;  2I1J A;  4JKG A;  2I1K A;  3SBT A;  2J0J A;  1HB8 A;  2D10 A;  1MIZ B;  4HDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...