4CYEA

Crystal structure of avian fak ferm domain fak31-405 at 3.2a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4cyeA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4cyeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4cyeA01
1WR6E 2BYVE 2K39A 2E2XA 3A8PA 1V5PA 2KN5A 2KX0A 5JHBA 1IP9A 2K2JA 3R3MA 2O6VB 3QIJA 5HE0A 1MIZB 3H9DA 4HATB 2K8HA 3PTFC 4E74A 2GCJA 5J17A 2LASA 2P0FA 3F0WA 2DZKA 3KUDB 3M95A 4X57B 1J0GA 1KOTA 4DHZB 5D3YA 3BINA 3WYFB 2RGNB 3HK0A 2XEWA 3ONSA 4GDLA 4DDID 4ASWC 1FAOA 2GOWA 3N32A 1DDVA 1IYFA 5CX3A 2LVQA 1NBFC 2N9EB 1HB8A 1NTVA 4A20A 1V5TA 1YJ1A 4MH0E 2J0JA 1KJTA 4HDQA 4HB0B 1ZC4B 3F5RA 1V6EA 3EFUA 4KSKC 1Q67A 1L7YA 3UF8A 4ZRIA 2MBEA 1E8YA 2PJHA 3VUWA 4PNKA 2DZMA 3TCAA 1MG8A 2FCMA 3X0WA 3ZDMC 4EKUA 3APFA 1WM2A 2D07B 3PGEA 1WGHA 1MAIA 3D8FA 1GC7A 1OQNA 2CHZA 4IWQA 5GOWB 2KDFB 1UD7A 4EOYA 1BTKA 4RMAA 5L95C 3L13A 2KZRA 1K5DB 1E7VA 2KNBA 4F7UP 2FIFA 3A1QB 2MP2A 2YT0A 4H8SA 4EUTA 1FHXA 2NMBA 4NQLB 3KW5B 2EC1A 3WANA 1UBQA 4FHJA 2M17A 2MLBA 4HB4B 4FJYA 4G11A 4JGHB 5TR5A 3ZKJC 1GNUA 3WALA 4EZJA 2KC2A 2MDXA 2DKQA 2RLOA 3DXDA 1WJ4A 2GBRA 2JF5A 4F1SA 1WG7A 3MPXA 1W1HA 2Y7BA 1UELA 4MEMA 4RM9A 1TXDA 2D9YA 4B6HA 3PRZA 3DBSA 4K81A 2BWES 4ANWA 1ACAA 2P0HA 5D3VA 1HE8A 4MGYE 4KHBB 1AARA 2G35A 3BY4B 4M8NA 5D2MB 5C23A 3ZO5B 1WI0A 2GS0A 4CO7A 2MSED 5C6RA 3GZNI 4BKSA 1X86A 3ZNGC 2L0FA 5L83A 3PSEB 4PYUA 1XODA 3ZVRA 2J59M 5CHWA 2JP2A 1Q5WB 1Z5SB 2ZEQA 2IO0B 4GOCA 2FCSA 4FJZA 4HPMB 4NNJB 3KZ1A 1KI1B 4E3CA 3D8DA 3ML4A 3FSSA 2PE9A 1S3SG 2RD0A 4BOSC 1UZXB 5LXHA 3GOEA 1WZ0A 1B55A 1WGYA 2L7RA 3NS8A 3MDBC 5FR6A 3R7RA 1E8XA 4HHVA 3R66C 4A6FA 4KHOA 4WAAA 2JVCA 2WDTB 4NQKE 1IRSA 3VAWA 1BAKA 2A5UA 2L00B 4XZ4A 4GSWA 3UGBB 4TUUA 1MKEA 2C9WB 1G6JA 2Q13A 3KUCB 4AJWA 3ZW3A 1MK9B 2R0DA 2KCJA 2DHIA 1UNQA 4JQWC 3RD2A 1L2NA 4MK0A 2PZ1A 1I2HA 2KK8A 2N7EA 4ZRJA 1U5GA 1V61A 2H7DA 2RNRB 3RCPA 1QC6A 2FCNA 2RGFA 2ROZB 3SNHA 2JZZA 3H6NA 1LXDA 4ICUA 1V80A 4IM2A 4M8MA 4TKNA 2BYFA 5CTRC 5C16A 5DPSA 1F9JA 3VHTC 5DH9B 3PVLA 2UWQA 4K7SA 4W9HA 1AQCA 1P9DU 2YVCA 1PLSA 2GJYA 2Z0OA 1S1QB 2DYNA 4J6IA 2R2QA 2J7QB 3CSFA 4AUQC 4DWFA 2UZSA 2D3GA 3EPYA 2D9WA 1FHOA 3L10B 4FA6A 2HE7A 1V5OA 1WMHB 2QHOA 2OOBB 2Z0EB 2KXJA 2LI5A 4FBJB 2Y5BB 2N9XA 2EMTA 3ENEA 1E8WA 1EF1A 4BBKA 3N30A 2X18A 4W9JA 5D6JB 5GMVA 4E71A 4WWOA 5IA7A 3DVGY 1H8CA 1UPQA 2KUPA 1M94A 1WGGA 3PREA 3QWMA 2KTRA 3ODOA 1NVLA 3LJUX 3ML8A 2DX5B 3CIKA 4K2OA 3S2AA 2KDBA 3TO1A 1UNRA 2ELAA 2FIDA 3QARA 3U30A 4FLHA 3HM3A 1BWNA 1MIXA 1X1GA 4PQ0A 2KC1A 3CMMB 3M62B 2CRFA 4GU2A 2G4DB 1E5WA 1H4RA 2PPHA 4MM3A 4NAWA 3IFWB 5KHQA 4AJYB 4NY0A 1KZ7A 1K8RB 2KFJA 3W1SC 4XX5A 3PHWB 4IWPA 4AOFA 1VD2A 3DOWA 4IWOA 5JP4A 2HTHA 3A98B 1FB8A 3ALBA 4Z2NA 1KM7A 2NPTA 1J19A 2P8VA 2DX1A 1WXSA 1YX5B 2YSZA 4HAUB 3UZTA 1ZKHA 2L05A 2RSUA 5KHOA 1J8CA 4B6WA 2V3SA 2LGDA 2K25A 2K2UA 3KH0A 4F7GA 3FLVA 4ANVA 4A6FB 2M1MA 4FADA 3UINB 5CHFA 2KFKB 4RM8A 3JSVA 4BBNF 3VTVA 1OEYA 2P0DA 2HJ8A 5JH5C 2NCNA 1P3RA 1P0RA 1EO6A 5DI9B 2YLMA 1YQBA 2ZVNA 4LCDE 3M1IB 2KJRA 3HQCA 3EC8A 4HCNB 1FOEA 3MTNB 1SHCA 3OANA 2BPSA 3DBHI 4MGIE 5AZGA 1Z2MA 3WA0A 2LOXA 1UPRA 3CSTA 2O2VA 4HXDA 2K8CA 3U8ZA 3PV1A 4K7UA 1VCBA 2AYOB 3RZFA 2LVPA 2LULA 2EJ8A 3B1LX 2V76A 5KQ4A 2JT4B 4KDLB 5AZFA 1XX0A 4WWNA 2DHJA 2LJ5A 3DVNU 3V60A 3VH3B 3K9OB 3K9PB 3FP5A 3W1YA 2M14A 3L16A 2KQSA 1V9JA 2CHXA 4MSMB 3RCZA 1I35A 5D3WA 2L1CA 2PE6B 2V1YA 3DVNV 4W9GA 2GCLA 1YD8U 1XKEA 4GN1A 3QQ8B 3NHEB 4AP4C 3OJ3A 1D3ZA 2RPQA 4JLCA 2EMSA 2BKRB 1J0WA 4GZUA 2WH5A 3L0WB 3DCGA 3ZDTA 4ZDVA 2GBJA 2CY4A 4C0AA 1FXTB 3JVZX 2DHZA 2CU1A 2MBQA 3PT2B 3QHTA 2MW5A 3PP2A 2KDEB 2BWFA 4GDKB 4BKGA 1X11A 2MWSB 2HRJA 1WRDB 3KUZA 4URKA 4EZKA 2I5FA 1I42A 4EJNA 4W9IA 4DHJB 3SUZA 3ECIA 2DLWA 2VRWB 1AWEA 2KMAA 3P6AA 1WE7A 3QC8B 3QK0A 3SD5A 1WJUA 2GBNA 1W1GA 4GB9A 4I6NB 4MT7A 3A4SC 1Y5OA 2G3QB 3AULA 3VUYA 5IJMA 2D9ZA 4KIKB 2XK5A 1OMWA 5DHAB 4I6LB 3DBRI 4KZCA 2Z0PA 3Q3FA 3NSUA 1WI1A 2L3ZA 3UIPB 3P7ZA 2UYZB 2QKLA 1WZ3A 4W9CA 4NSWA 4JIOU 1WF9A 5G2NA 3T8MA 1U27A 4XC2A 4GDKA 1EVHA 2NR2A 4HLEA 3L17A 4KDIC 4IUMB 1E8ZA 1WY8A 5JHGA 3HM6X 3UQBA 1QQGA 3PZDA 4NJ6A 2O6VD 2V4LA 2JXXA 2MFQA 5C5BA 2ZCCA 4LDTB 4PS3A 5DCNA 4DK5A 2IO1B 4G50A 4JL9A 1V86A 1RAXA 2YS5A 4W9KA 2K8BA 1TGZB 2CAYA 4F7HA 4EEWA 1WX7A 2CHWA 2C7HA 2M8SA 1UNPA 1ZW7A 2KMCA 2M38A 1WM3A 2Y8GA 5EFXA 2BKFA 2NBVB 2OQBA 4A6KA 3PS6A 2AL6A 3A4RA 3GYPA 5J3QA 2RVBB 2ELBA 3AJ4A 1LB1A 3DXCA 1TTNA 1FGZA 1ZGUB 1XCGA 1DBHA 2EKEC 2G4SA 2JZ3B 2R2OA 3AI5A 3N3KB 4GIVA 3WAMA 4MJSB 1V88A 1WGUA 3ULCA 1FHWA 2KGXB 2JUOA 3L54A 1P1AA 1X05A 4MELA 1V81A 5C5BB 2LD9A 1H10A 2IO3B 3EECA 2I1JA 3C0RB 2YRYA 3TVVA 3TJPA 3ZVVA 2KJHB 1Y19B 4CHJA 1WFYA 3KRXA 1U5FA 2KO3A 4WJNA 3VUXA 3H1UA 3IVFA 3A33B 2VSZA 4HDOA 2AWTA 3O65B 2KANA 2IO2B 3PG7A 2KTFA 3W1SA 1DROA 2KQ7A 1WX9A 3QBVB 3T06A 4IG7B 4ICVA 5D3XA 3QCAA 1WGDA 2MQJA 5D94A 4A3PA 2COFA 1WYWB 2C7NB 2MP2B 3DBLI 2KVRA 4F8CB 4GPTB 2Z0DB 3IHPC 1UBIA 4GDLB 5LOPB 3A9KA 1XD3B 5KQ1A 1MK7B 4PYZA 2COAA 4HPLB 2JPHA 1OTRB 3APDA 1DDWA 2AEHA 1WGQA 2FJ9A 1A5RA 4KZ0A 1LFDA 1WXAA 2G45B 4YONA 2LVOA 2LYDA 2KKCA 3DDCB 2O2VB 4KHAA 2LRWA 3ZUNA 2LUEA 1V89A 3PEGA 1Q0WB 2LGXA 3H7PB 1ZM0A 4CHMA 2OTXA 5J3TA 2DENB 2N23A 5KCVA 3A8QA 2CKHB 3KYDD 3R7QA 2C60A 4A3OA 4B95A 4WJ7A 1U29A 4ANUA 3KY9A 2FAZA 2D2QA 3RUIB 4HAWB 2ZJDA 4WQOB 3V61A 1UEFA 1EGXA 3QA8A 5DHFB 1PMSA 3ZNZB 1U5EA 4K17A 1LQBA 1QZEA 3IBEA 3NOBA 4II2B 3ML9A 3TW1A 1XT9B 2R09A 1SE9A 3BJIA 1PQSA 4BVUC 1U4AA 1GG3A 5DIFB 4DBBA 2UZRA 2LBBA 1ZSQA 1RRPB 3SYXA 3M3JA 4HJKA 2XQNM 2CB8A 2ADZA 3PLUA 3APCA 1Y8RC 1HBKA 4CYEA 3QX1A 4FULA 4TQ0A 2MX2A 1Z87A 2BYEA 1XR0B 1OEYJ 2BF8B 2LGYA 4W9EA 2JRHA 2GBKA 4CHKA 3ZNID 2IYBA 2M0XA 2ZVOA 5CHVC 1C1YB 4WJOA 3ZRFA 2D4QA 4Y94A 2IFSA 2QKMA 2KHWB 4GXBA 2O6VA 3PPAA 1SIFA 2DYMA 2Z0QA 5AEKB 4FJVB 1OY2A 2KTRB 2DYOA 3WAPA 4WVFB 2OJRA 4EFOA 2DKPA 4DX8A 1WJ6A 3VXWA 2WYQA 4A6HA 1GC6A 3PRPB 3KRWA 4BOZB 2LWPA 2W2XC 4GMVA 1RLFA 4OVVA 2N1WA 2IYDB 2L76A 4AWJA 5HE1A 3SV1A 2DAFA 2ZZPB 2CR5A 5HE3A 2KWVB 3U7DA 1DYNA 1X1FA 5CLQB 4MGZE 2RQ1A 4WJQA 2NS5A 2IY0B 4ZYNA 2K6DB 2MA9B 2BGFA 3TFMA 1T0YA 3PLVA 4DXAB 3MJWA 4L6EA 3G9WA 2YT1A 3X23A 4OVUA 1WH3A 3IG3A 3WAOA 3PSCA 4TYZA 1UH6A 4LDTD 4LJOB 1KLVA 2KX3A 1MPHA 3EHVA 4NJ7A 2ASQA 3UQAA 2K6QA 2LXCA 2GMIC 3AXCA 2C5LC 2DA0A 3N7CA 5J3YA 1BTNA 3HW2B 1YIWA 2ZNVC 4BFRA 4WWPA 4M0WB 2H7EA 3TIXA 5LXIB 3OAWA 3PVWA 2REXA 4K2PA 4GGQA 4D0NB 3SO6A 1OGWA 1WXVA 3ULBA 3SDLC 3ZNHB 2HD5B 4DHZE 2KWCA 5LONB 3VH4B 3A9JB 1LW3A 1TQZA 5D27A 5BO4B 2KWUB 1M7EA 3AU5A 4K1RB 2LKOA 2WWZA 5DPWA 1WJNA 4PS8A 5JHAA 1XD4A 2UVMA 1P3QU 1NTYA 1TJ6A 4NAWB 3V5WA 4W9LA 4A5KA 2MRPA 2D10A 3P2BA 4W9DA 1PFJA 3PVUA 1GJZA 1X1MA 3CXBB 1RJ2A 2DN6A 4MDKE 4DHJD 1IPGA 3NY5A 5CLLB 2COPA 4MY6A 1P98A 2K1FA 2RSGA 3MHSD 2D9VA 2MCNB 4DDGD 4ZRKA 2D9XA 2KFKA 2DTCA 2M4NA 3NZUA 1ST7A 3ZLZA 1C3TA 3V6CB 4I6PA 3TMPB 5L81A 3D8EA 4BKTA 5FI0A 3LDZE 3O96A 1WVHA 1WMHA 1WXMA 2AL3A 2DZIA 3DQVA 4FN2A 4W9FA 1WR1A 2KD0A 1Q1OA 4HAXB 1HB6A 2YS1A 2WX1A 4II3B 2BCJA 1EUVB 5E6PA 3B08A 1BT0A 3ZRCA 1WE6A 2MBBB 3VIAA 3B0AA 1OQYA 2ROVA 3FM8C 4EMOA 2J0KA 2XK5B 2I5CA 2MBOA 2YS3A 3Q3JA 1TBEA 4HVBA 1UGMA 4KSLC 2ABDA 2C7MB 2L8JA 3VVWB 3TL5A 2YF0A 3H7SA 2Z59B 2W9NA 5DPTA 3AU4A 2LG1A 1ISNA 1DDMA 5C79A 4PS7A 2NBUA 1N3HA 1V5UA 1V2YA 2D11A 4WJPA 5J18A 4G3XB 4IOYX 1GUAB 4YL8A 4NPNA 4DBGA 1EF5A 1R4NI 2IZVB 4MGKE 3VOQA 3RT3B 3SU8X 3ZTDA 2MKRA 2COCA 3I3TB 4HK2A 4HAZB 4HB2B 1P5TA 4HAVB 5E6OA 5C1ZA 2KLGA 5FI1A 3HHMA 4G0NB 4MSQB 3PRMB 1U2BA 2DYQA 4FHKA 1TZ1A 3ZTCA 2J0MA 4F7ZA 4ANXA 2MBHA 2N9PC 4HAYB 3ODXA 2N1VA 3A9KB 5JLJB 3D32A 1WIAA 2JY6A 2VRRB 3H7PA 1CMXB 2RR9A 3JSVB 3JW0X 4BBNC 2B3AA 2ZPNA 2NBWB 3A9JA 4Z2MB 2LOZA 5G55A 1V5MA 2CY5A 2WX0A 2N0YA 1NU2A 1WJMA 3FEHA 4GMXB 4DX90 2ZCBA 3VTWA 2FUHB 4K7WA 5EDSA 2NZ8B 4KAXB 2DZJA 5E6NA 1FGYA 1I7AA 1XQQA 3RULA 2W2WA 2CQUA 2KDIA 2N7DA 4N9F4 1WX8A 2NVUI 3DPDA 3OJ4B 3VDZA 1WJ1A 2IY1B 3VTUA 5HKHA 2KJ6A 1RRBA 3QJZA 4KV2A 2VKIA 3UIOB 1NDDA 4KIKA 3KSYA 1V49A 3CF6E 3OLMD 2NPTB 4MJSA 2FDQA 1K5GB 2JWZA 4BKSD 1E7UA 3PHXB 3DVGX 4LJPB 5DPRA 5LLIA 3V62A 1NTIA 1LM8B 2RUKB 2KLCA 1KZGA 1ZC3B 4HCPB 2IBIB 3SHQA 4IAPA 1NI2A 4XWXA 2LZ6A 3ZIMA 4KVGB 3VQIA 2I1KA 1W1DA 4WSFA 3RZWC 4HWIB 1SGHA 1M7RA 2FJLA 3A1QA 5D7GA 3T9LA 2K00A 5JZEB 2ZPYA 2PEAA 3VFKA 3WIMA 2DYBA 2N4FA 2XBBC 1YX6B 5HE2A 4IC7B 1ZVRA 2MWNB 3NZSA 2DFKA 5JHHA 2DAJA 4P7IA 4IM3A 2HTHB 3QAQA 2L2IA 2ZNVB 3ODWA 2KOXA 2Y8FA 2CODA 3L08A 5IAAC 3TBLD 5J2RA 4TQ1A 3HIZA 3LJ3A 1U5DA 2FCQA 1WGRA 1E90A 4HB3B 2JRIB 2DHKA 2L0TA 1P6SA 1JRUA 3JYUA 3V6EB 1RFAA 4B9KA 1R4MI 2LRUA 3M63B 3QWZB 2W2XD 2CS4A 3KVFB 4IM0A 4TV3A 5AZHA 3GYOA 4EZLA 4IW0A 4IFSA 2LXAA 2FNJB 2DX5A 3KYCD 3RYTA 2GBMA 1EAZA 3DXEA 2A4ZA
chains in the Genus database with same CATH superfamily
2K39A 3AEDB 5JHBA 2O6VB 5J17A 4P1CC 1J0GA 2D3AA 1JALA 2DZKA 3M95A 4DHZB 3WYFB 1M4VA 3HK0A 4JKFA 4DDID 1FAOA 2GOWA 1DDVA 2WXKA 2V3PA 4C4VB 4JPSA 4HDQA 4HB0B 1ZC4B 3F5RA 1V6EA 1Q67A 1BUIC 3UF8A 4ZRIA 1YJJA 4LNNA 4PNKA 1WGKA 1MG8A 2NMQA 3RN9C 1WGHA 1E9MA 1OQNA 4IWQA 4L1RA 1K5DB 1E7VA 1LGRA 1C78A 4H8SA 4B0EA 1JWBD 2K9XA 1AYFA 4JGHB 1D5XC 3ZKJC 1EM7A 3DXDA 3P42A 2GBRA 1W1HA 2D9YA 3DBSA 4OW0A 4MGYE 1HE8A 3EGRA 1ET6A 1Q10A 1WI0A 2KN4A 4KKJA 3GZNI 4BKSA 3AE7B 2L0FA 4BZAA 3BIID 2MEKA 2INCC 5FR3A 1UWMA 3NS8A 3MDBC 5JXVA 4A6FA 4KHOA 4WAAA 2WDTB 5C2TB 4RF1A 4N58A 2Z8LA 4JKHA 1UNSA 2V9HA 2A5UA 4GSWA 3KUCB 1MK9B 5E6JA 2RNRB 2HDEA 2RGFA 1QC6A 2ROZB 1DGJA 1E0ZA 1ZPSA 1KF6B 3P4PB 1FD6A 4J3OD 3PVLA 2UWQA 3RNCC 1XXGA 2V0GA 2Z0OA 1PLSA 4J6IA 4MACA 1D3ZA 2DYNA 2R2QA 2PTLA 2D9WA 3BVZA 3GZNB 2KXJA 2LI5A 3Q69A 3ENEA 4W9JA 5D6JB 5GMVA 3SFDB 4KGRA 4ILJA 4E71A 4JK9A 1H8CA 2KUPA 3PREA 1WGGA 4YTNB 3S2AA 3ML8A 3CIKA 1UNRA 3HM3A 1MI1A 1MIXA 1X1GA 3M62B 3N1XC 1E5WA 1H4RA 1PYWD 3DWGC 4MM3A 1EU3A 1K8RB 4RGTA 1N61A 4IWPA 5EE3A 4IDIA 1CK1A 1VD2A 4XWWA 4JWSC 2HTHA 2NPTA 1N6ZA 2P8VA 1J8CA 4HAUB 2RSUA 2AQ3B 2L05A 2AQ2B 3Q8EA 3RI7C 4ANVA 3FLVA 4A6FB 3JSVA 4BBNF 3VTVA 1OEYA 2NCNA 4DIXA 1P0RA 1EO6A 1ESFA 5DI9B 2YLMA 5HHDG 3M1IB 4HCNB 1FOEA 4MGIE 5AZGA 4D2KA 3Q14C 3WA0A 4K7UA 1F2RC 2AYOB 4ZYSA 3RZFA 2EJ8A 2V76A 5KQ4A 1TYGB 1YMHE 2JT4B 4WWNA 3VH3B 2BYTA 3RCZA 1FEHA 2V1YA 1VZ8A 4GN1A 3OJ3A 3O13A 1EWCA 1J0WA 2W3RA 2QC8A 4ZDVA 4C0AA 1FXTB 3JVZX 2DHZA 3PT2B 2ON8A 2MWSB 1I42A 2K5PA 1R4MB 1NYRA 3BYYB 1F1HA 1WXQA 3QK0A 2MJEA 1PGAA 4MT7A 3BVMA 5G5GA 1SB3C 3AE6B 1AW7A 5DHAB 3DBRI 2Z0PA 2I2YA 5G2NA 4XC2A 4GDKA 2NR2A 3L17A 2V4IB 1QQGA 4NJ6A 2MFQA 5C5BA 5DCNA 2YS5A 4W9KA 3ZJTA 1WX7A 1FCCC 2KIEA 2KMCA 2WS3B 3B9JA 4A6KA 5J3QA 3P4SB 2ELBA 1ZGUB 3AV8A 2G4SA 2JZ3B 3N3KB 3KWVA 4CQNA 2KGXB 2JUOA 3L54A 3NWAA 2I1JA 3EECA 2YRYA 3TJPA 3ZVVA 4CHJA 1HTQA 2VSZA 2AWTA 1ZUD2 2PVGC 1WGDA 5D94A 3IT4B 3DBLI 3IHPC 1QOFA 3RNEC 1XD3B 2EKIA 5KQ1A 1MK7B 3AECB 4ZOHC 1OTRB 4A55A 3GS2A 4OVZA 1A5RA 2FJ9A 2GLSA 2KKCA 3ZUNA 3PEGA 3H7PB 5J3TA 4QJ5B 5KCVA 3ZGZA 4HJGE 4US8A 1T5XD 4WJ7A 2FAZA 1OQQA 3AE9B 3QA8A 5DHFB 1PMSA 1XLOA 1RFKA 1HZ6A 2X38A 3LYYA 1F2RI 4DBBA 2UZRA 2CB8A 3PLUA 3QX1A 5H8YE 1Y8RC 4TQ0A 4HSIA 2BYEA 1XR0B 1OEYJ 2BF8B 4W9EA 2G9HD 5BMIA 4Y94A 2IFSA 3PPAA 5AEKB 1GGOA 1TKYA 1OY2A 4JKDA 2DYOA 3WAPA 2DNFA 2WXFA 2DKPA 4RCOA 2WYQA 4A6HA 1GC6A 1I4RA 2KMMA 2W2XC 3NVZA 2IYDB 2L76A 3SV1A 4RF0A 3LXFA 5HE3A 3U7DA 2RQ1A 3DCXA 3PLVA 4UDUC 1QOBA 3IG3A 1I4PA 2KX3A 3EHVA 2BVCA 3AXCA 3AE2B 3IAS1 2DA0A 3N7CA 1YIWA 3HW2B 1E6EB 2H7EA 5LXIB 4TMAB 1VRAB 3PVWA 2W55A 4IOIE 3ZNHB 2KWCA 1T77A 2G1EA 3A9JB 1LW3A 1TQZA 3AE5B 5D27A 3AEAB 5BO4B 3AU5A 3Q8CA 3W5VB 4PK1A 5JHAA 3MJ5A 1P3QU 4NAWB 1N60A 2MRPA 4YTMB 1DOYA 3PVUA 5I2SA 3NY5A 5CLLB 2COPA 2MCNB 3U52E 2KQ4X 4XE0A 1GB4A 4FN2A 1WR1A 1HZ5A 2KACA 1WE6A 3H8HA 3VIAA 3B0AA 3ENBA 1ENFA 1OQYA 2J0KA 4GNKB 1UGMA 2WU2B 2ABDA 3NJTA 2L8JA 2Z4DA 4EE2A 2YF0A 1SE4A 3AU4A 1DDMA 4YSXB 3OG5A 1FO4A 1N3HA 3BYTB 2N9KA 4IOYX 2R61A 4YL8A 3HVDA 5EE1A 3RT3B 2COCA 1K52A 4RGMA 1JWAD 4LK0M 1KLUD 4MSQB 1JWUD 3PRMB 2DYQA 2MBHA 2ONQA 2JY6A 2VRRB 1CMXB 3N20C 1J7CA 2ZPNA 2KAJA 4Z2MB 5G55A 2R82A 2CY5A 2N0YA 1NU2A 1C79A 3VTWA 1FGYA 1T6BX 3RULA 2KDIA 2NVUI 3DPDA 2IY1B 1SE3A 5HKHA 1IGCA 3QJZA 4TSSA 1V49A 3CF6E 2GRIA 2NPTB 4L1BA 4MJSA 1E7UA 3DVGX 4LJPB 3VR9B 2RDHA 3V62A 1LM8B 1ZC3B 2IBIB 4KVGB 1V1PB 1M7RA 3A1QA 2K00A 3IXSA 2XBBC 4IC7B 1ZVRA 2MWNB 2DWQA 3NZSA 5C3JB 2LGIA 3QAQA 2ZNVB 3L08A 2Y8FA 2MHJA 1N5XA 2FCQA 4HB3B 2DHKA 1P6SA 3M63B 2W2XD 2FJUB 1ZP0B 2FE8A 2FNJB 3RYTA 2IDYA 2MJ3A 2IGGA 3DXEA 1L4ZB 2K49A 1WR6E 2KX0A 2E2XA 2KN5A 1V5PA 2BB6A 5LG4B 2QIEB 1VR9A 5HE0A 4E74A 2LASA 3F0WA 4X57B 3BINA 3SEBA 2RGNB 3N32A 1TT5B 2KT7A 4IKGA 4MT5A 4MH0E 1KJTA 1RYJA 2FCMA 3ZDMC 3PGEA 1MAIA 2YEPF 4OZCA 1UD7A 3B77A 4F7UP 2FIFA 2MP2A 2YT0A 2M19A 4EUTA 2NMBA 4NQLB 3WANA 4FJYA 2M17A 2MLBA 4G11A 1KRHA 2KC2A 2DKQA 1WJ4A 2W82A 2IJ0A 3RPFC 4RM9A 3UGBB 2BWES 2P0HA 1VJKA 4KHBB 2G35A 1AWDA 3BY4B 5D2MB 5C23A 3ZO5B 4CO7A 3RNFC 1X86A 3ZNGC 5L83A 5H92C 2GI9A 3PSEB 1XODA 2J59M 5CHWA 2JP2A 4FJZA 1KI1B 3D8DA 3ML4A 3FSSA 1UZXB 1LO5D 3GOEA 2L7RA 2BTEA 1YQ3B 5FR6A 1SBBB 3Q8BA 1IRSA 3TEZA 1BAKA 4ITKA 1MKEA 2VH2A 3U4EG 4C56C 1D4BA 2R0DA 2DHIA 1DIKA 1MFWA 4JQWC 3RD2A 4K3BA 2PZ1A 1JCKB 2H7DA 4JX1C 1V61A 3RCPA 2FCNA 3SNHA 3E9SA 4IM2A 5CTRC 2BYFA 5C16A 1F9JA 1B9RA 2LJIA 5DH9B 4K7SA 1P9DU 2RMMA 2CJNA 1J7AA 3CSFA 1ZDXA 2D3GA 3EPYA 3L10B 1FHOA 5IP4D 2HE7A 1V5OA 2Y5BB 3N30A 4BBNC 2WGSA 2X18A 3DVGY 1UPQA 4ILHA 3LJUX 2DX5B 5M4YB 2KDBA 3QARA 1VBHA 2FIDA 4BAXA 4PQ0A 2CRFA 2G4DB 3IFWB 4OT1A 1KZ7A 2KFJA 1HEZE 4XX5A 3AM9A 5JP4A 4YSYB 3ALBA 1KM7A 1J19A 1ACCA 1IBXB 3C8YA 4C7ZA 4CSQA 1FM0D 1ZKHA 1ZXHA 4P6VF 2V3SA 2K25A 2K2UA 3KH0A 3RNBC 2M1MA 5FK9C 4RM8A 1XLPA 2W54A 4MM3B 2PVOD 3NVYA 1FMAD 5MPOA 2ZVNA 1R4NB 3TUOA 4LCDE 3MTNB 3NWDA 5GXGB 2WXOA 3U8ZA 4QJ4B 4L23A 5AZFA 4KDLB 3LB8C 2KYWA 1XX0A 2LJ5A 3DVNU 3FP5A 2D3CA 4A90A 2M56B 1V9JA 2CHXA 1ZOYB 2PE6B 3DVNV 2GCLA 1YD8U 3QQ8B 4AP4C 3NHEB 2N9LA 1V97A 2WDRB 1QILA 2EMSA 2BKRB 3DCGA 2MBQA 2CU1A 2MW5A 3W2DA 2KDEB 4WQMA 2HRJA 3KUZA 3ZYYX 4EZKA 4EJNA 4W9IA 3EA6A 3ECIA 1PGBA 2VRWB 1WE7A 3SD5A 1N5WA 1WJUA 2GBNA 1Y5OA 1C4AA 1A70A 3VUYA 5IJMA 1YJIA 3T3NA 4I6LB 2UYZB 4D6WA 1PDXA 4JIOU 1WF9A 1U27A 1V8CA 3N1YC 4HLEA 4KDIC 1E8ZA 5JHGA 3GP7A 2WHIA 2O6VD 1V86A 2K8BA 1TGZB 4F7HA 2CHWA 2OEDA 2KDMA 1NI3A 4XGAB 2OQBA 3PS6A 3A4RA 3P4QB 2RVBB 3R8BA 1LB1A 2TSSA 2EKEC 1XCGA 1DBHA 3Q8FA 3AE8B 3ULCA 4MELA 1V81A 5C5BB 3C0RB 2KJHB 3RFZB 1U5FA 2KO3A 1F52A 3URYA 3IVFA 3A33B 4HDOA 2KTFA 5I2MA 3PZ7A 2KQ7A 1V1OA 1K50A 4ICVA 5D3XA 1WSPA 3QCAA 4A3PA 5JVLA 3P1MA 2Z0DB 2COAA 2JPHA 4NAMA 1LFDA 1WXAA 4KGTA 2B76B 1Q0WB 1YQ4B 2LGXA 4DXGA 3Q3OC 2DENB 3KYDD 2BT6A 2D2QA 4JKGB 2ZJDA 1UEFA 1EGXA 1TS4A 1JWMD 1U5EA 1QZEA 4DXFA 3ML9A 3TW1A 1BXTA 1HXYD 1PQSA 4US9A 3HIEA 2LBBA 3SYXA 2XQNM 2MX2A 2LGYA 3NVVA 2J53A 1SJHD 2M0XA 2ZVOA 3ZNID 1D5ZC 1C1YB 4WJOA 2KIGA 2Z0QA 4FJVB 2KTRB 4NJCA 2OJRA 1IBXA 3VXWA 2JQRB 4BOZB 3Q8AA 4GMVA 4AWJA 2CR5A 4MGZE 4ZYNA 2BGFA 3TFMA 3MJWA 3G9WA 1TS3A 4LDTD 3UQAA 2GMIC 1SF0A 4AS1A 1BTNA 3TIXA 1T0SC 2L83A 3FVCA 2REXA 4D0NB 3SDLC 3ULBA 1VDVA 1T0QC 1M7EA 1D6EC 3SBTA 2WWZA 2UVMA 4W9DA 3AE4B 1RJ2A 2QMTA 1IPGA 1P98A 2K1FA 5BYQA 2KFKA 3NZUA 1ST7A 1T0RC 5L81A 2SEBD 4BKTA 3RNAC 1WXMA 2AL3A 3C19A 4HAXB 1C77A 2BCJA 1TY0A 3B08A 4EMOA 2I5CA 2MBOA 2YS3A 1TBEA 4XWTA 4DQOC 3VVWB 3TL5A 2Z59B 1I4HA 1ISNA 1TKGA 2NBUA 5J18A 1GUAB 3E9OA 3NWFA 1EF5A 4N6EB 1QF6A 2MKRA 4HAZB 4HAVB 5C1ZA 3NS1A 3HRDD 4G0NB 1TKEA 2IPKD 3P4RB 2N7JA 4FHKA 3ZTCA 2J0MA 5G5HA 1HQRD 4C80A 3ODXA 1UGJA 3A9KB 5TSSA 3D32A 1WIAA 3H7PA 4KKIA 1EU4A 2B3AA 2PW9A 1XO3A 3A9JA 2LOZA 1V5MA 4DX90 2Z13A 2ZCBA 2YT2A 2FUHB 4K7WA 4KAXB 3Q3MC 2W2WA 4WWMA 1WX8A 3OJ4B 3VTUA 1WJ1A 3AE3B 2KJ6A 4KV2A 2VKIA 4KIKA 3KSYA 3A58A 2FDQA 2JWZA 4BKSD 3PHXB 5LLIA 5DPRA 2RUKB 2Z14A 4HPPA 1NI2A 2PKOA 3RZWC 4HWIB 5JZEB 2KR0A 4RGNA 2PLPA 3WIMA 1EWYC 5IN7A 2JSVX 3MHZA 3NZ3A 2DAJA 4P7IA 4YSZB 3TBLD 2CODA 2YEPB 2ZW1A 5J2RA 3FAHA 3HIZA 3LJ3A 1MHXA 1WGRA 2JRIB 4ARIA 3V6EB 1RFAA 1R4MI 3KVFB 2LHEA 2E6XA 5D3IB 5AZHA 4L2YA 3GYOA 4IFSA 4OZAA 2DX5A 1TS5A 2WNMA 4JKCA 2AX5A 3R3MA 4HATB 4M01A 2K8HA 3PTFC 2GCJA 3KUDB 1KOTA 1I4QA 3ONSA 3U2SC 4ASWC 5IOIA 4YT0B 5CX3A 2LVQA 1HB8A 1WYGA 4OHJA 3DHIC 1YJ1A 1VLBA 3N9YC 1WWTA 1L7YA 3RNGC 2MBEA 2J42A 3NG0A 3P63A 3TCAA 3X0WA 4EKUA 3APFA 1WM2A 2D07B 3HVZA 1P7FA 2LGSA 2K0PA 3D8FA 2CHZA 5GOWB 3B2FA 4EOYA 4RMAA 3ZQ4A 2KZRA 2KNBA 2KVZA 3A1QB 1UBQA 1KC7A 1GNUA 3WALA 2MDXA 5FKAC 2JF5A 2DIKA 1WG7A 1D5MC 1NYQA 1UUPA 1ACAA 1AARA 4M8NA 2GS0A 2MSED 4C00A 1FXAA 2JX5A 1K53A 1GB1A 4PYUA 3ZVRA 1Q5WB 4RFBA 2IO0B 2FCSA 1P7EA 3W5UB 4NNJB 3KZ1A 4E3CA 2RD0A 2PE9A 1S3SG 1JWSD 1WGYA 3SFEB 5BYSA 3R7RA 4HHVA 3R66C 1GPXA 2JVCA 3VAWA 2XN9C 2L00B 4TUUA 2C9WB 1G6JA 3ZW3A 4HKQA 1KLGD 2KCJA 1TJEA 2MH7A 2N7EA 1QLBB 2KK8A 3TEXA 1U5GA 2Z59A 3FILA 2JZZA 1HA5A 1LXDA 1V80A 4ICUA 4M8MA 3VHTC 3V05A 2YVCA 1ZXIA 4AUQC 2J7QB 4QJ3B 2PIAA 2OOBB 2Z0EB 4FBJB 2EMTA 1E8WA 4JWUC 3V3XA 4OZBA 2RRFA 3ODOA 3TO1A 3U30A 3N1ZC 2KC1A 4GU2A 2ACZB 3CMMB 2PPHA 2HTME 1VBGA 4NY0A 2Y5PA 3PHWB 4AOFA 1C9FA 1CZPA 4IWOA 4Z2NA 2DX1A 1WXSA 1YX5B 2EELA 4YTPB 3UZTA 3EUB2 4RH6A 4F7GA 3UINB 4WH4A 2HJ8A 5JH5C 4GOUA 1TZOA 1YQBA 2QEJC 1JDEA 2KJRA 3HQCA 3EC8A 3TEWA 1SHCA 3OANA 2BPSA 3DBHI 1YN5A 1UPRA 5EE9A 2O2VA 4HXDA 4JK7A 2K8CA 1QOAA 2LVPA 1XCQL 2LHDA 4YXDB 1FNWA 2DHJA 3K9PB 3W1YA 3L16A 2BS3B 2KQSA 4MSMB 1I35A 4JKEA 5D3WA 4RGOS 1XKEA 2WDVB 2WXMA 5IKCM 2RPQA 3E66A 4GZUA 1I4GA 3L0WB 3GE3C 3ZDTA 4YWGG 2GBJA 4ZHPA 5KHQA 4BKGA 3KLSX 1PUTA 2I5FA 3BZDB 4DHJB 3SUZA 2DLWA 1AWEA 2KMAA 1XLQA 4I6NB 4KHBA 4S17A 2JYEA 2QCZA 2D9ZA 4KIKB 3Q3FA 3NSUA 3UIPB 3AEFB 2QKLA 1WZ3A 2LEKA 1N63A 4W9CA 1KH0A 3FKYA 5HFYA 2X0SA 1EVHA 2INNE 2V3NA 1ROEA 3PZDA 2ZCCA 2JXXA 4LDTB 4PS3A 2IO1B 4JL9A 2CAYA 1UNPA 1ZW7A 2M38A 1WM3A 5EFXA 2BKFA 3RMKC 1MVKA 2AL6A 4A8XC 3AJ4A 1TTNA 1FGZA 2WDQB 3WAMA 2BQQA 1V88A 5T8IA 1FHWA 4AQ7A 1X05A 1H10A 2IO3B 3TVVA 1Y19B 3KRXA 4WJNA 3VUXA 2L1AA 3UI3A 4LTUA 3W1SA 1C76A 2KANA 2IO2B 3PG7A 2CJOA 2BBCA 1DROA 1WX9A 1SXTA 4IG7B 1L5PA 1WYWB 2C7NB 3Q3NC 2KVRA 1FRRA 1UBIA 3A9KA 4PYZA 4HPLB 3APDA 1NEKB 2AEHA 4KZ0A 2G45B 1DOXA 3DDCB 4LNOA 2O2VB 4KHAA 4URKA 2BB5A 1VZ7A 4CHMA 1I4XA 2OTXA 1FNUA 3AEGB 2N23A 2CKHB 4HROA 3R7QA 2C60A 4ANUA 4HAWB 4WQOB 3V61A 3ZNZB 2K8EA 1MG4A 4K17A 4II2B 3NOBA 1SE9A 3BJIA 1V1PA 2D3BA 2XNAC 4C7YA 1ZSQA 3I57A 3M3JA 4FULA 1HBKA 1QKZA 3KQ4A 1KBLA 3AEEB 2GB1A 1YOVB 4WIPA 2JRHA 4REZA 2I38A 5CHVC 3ZRFA 1ET9A 3E56A 2QKMA 4GXBA 1SIFA 2DYMA 4WVFB 2LFIA 3I63C 2INPE 2L52A 4DX8A 1WJ6A 2FUG1 1OFFA 3KRWA 2LWPA 1RLFA 4OVVA 1ZE3D 5HE1A 1B1ZA 2KWVB 1X1FA 5CLQB 2WQYB 4WJQA 2K6DB 2MA9B 4HKZE 1T0YA 2JWUA 4DXAB 2YT1A 3X23A 1WH3A 3WAOA 1UH6A 3DBRB 3MFGA 1MPHA 2ASQA 1HTOA 5J3YA 2ZNVC 4BFRA 1JRPA 4M0WB 4WWPA 4PT5A 2W3SA 3OAWA 2CU3A 4GGQA 3SO6A 3ZJUA 4DHZE 5LONB 2WXIA 3U12A 3BK2A 2LKOA 4ILGB 3SBGA 4W9LA 4A5KA 2D10A 2DN6A 2BS2B 4MDKE 4DHJD 3AE1B 4MY6A 3MHSD 2D9XA 2M4NA 1C3TA 4I6PA 3DBHB 3D8EA 5FI0A 3LDZE 3O96A 1WMHA 4FXCA 3DQVA 1Q1OA 2YS1A 2WX1A 3E9LA 1BMLC 1SSNA 1BT0A 2MBBB 2WXNA 3Q3JA 4HVBA 2C7MB 2RDBC 5DPTA 2DBYA 1C4PA 1V5UA 1V2YA 2D11A 3DWMA 4G3XB 2MJDA 4NPNA 3SU8X 3VOQA 5IRSA 4OSNA 3I3TB 1FPYA 5E6OA 1QQRA 2KLGA 5FI1A 3HHMA 2QSDA 3VRAB 1YN3A 1IUEA 2WXRA 1UWXA 4HAYB 4NZLB 2OHFA 1JROA 3JW0X 2RR9A 2NBWB 4LNFA 2WX0A 4USAA 3FEHA 1WJMA 4GMXB 1FFVA 5E6NA 4XYCA 1XQQA 2CQUA 3VRBB 3VDZA 4C4VA 1SJED 3UIOB 1NDDA 3OHMB 3OLMD 1YN4A 1NTIA 2WU5B 4XWXA 2LZ6A 3ZIMA 3VQIA 2KWDA 1SGHA 2FJLA 5D7GA 3T9LA 2PEAA 3VFKA 1YNTE 1F0ZA 4M0WA 2DFKA 5JHHA 2NBVA 1ZDVA 2HTHB 5IAAC 4TQ1A 1L0XB 5AUIA 3IT6B 4B9KA 2L32A 2LRUA 2LUMA 3QWZB 3FC4A 2CS4A 1Y56A 3MC8A 2VH1A 1EAZA 4LJOB 2BYVE 3A8PA 3R2TA 2WXGA 1IP9A 2K2JA 3QIJA 1MIZB 3H9DA 2P0FA 5D3YA 2XEWA 4GDLA 3NRZA 5D3DA 2QJLA 1IYFA 1NBFC 2N9EB 2WXQA 1NTVA 4A20A 1V5TA 2J0JA 2LMCA 3EFUA 4KSKC 1E8YA 1FXIA 2D5GA 2PJHA 3VUWA 2DZMA 2ICIA 3PZ8A 3DBLB 1GC7A 3ABVB 2KDFB 1BTKA 5L95C 3L13A 1FHXA 3KW5B 2EC1A 4FHJA 4FADA 4HB4B 4EZJA 5TR5A 1C4CA 2RLOA 3ETRA 2IGDA 1UELA 3MPXA 2Y7BA 4MEMA 4WWOA 4F1SA 1MHHE 1TXDA 4B6HA 3MC9A 3PRZA 4K81A 4ANWA 5D3VA 4B0MA 3AEBB 2M0AA 5C6RA 1PFDA 4JE3B 2E3TA 1Z5SB 2ZEQA 1FRDA 4GOCA 2VZKB 3PO0A 4HPMB 4QAYA 4BOSC 4JKGA 5LXHA 1WZ0A 1B55A 4M02A 1E8XA 1F77A 3BVGA 2NTSA 4NQKE 4XZ4A 5LNK1 2J52A 2Q13A 2WXHA 4AJWA 2RPVA 1UNQA 1L2NA 4MK0A 1I2HA 2Y3AA 4ZRJA 1L0YB 5BMHA 3E9PA 3H6NA 4LLGM 4TKNA 5DPSA 3Q6BA 4W9HA 1AQCA 1FIQA 2NTTA 1S1QB 2GJYA 3VR8B 1CQVA 2UZSA 4DWFA 4FA6A 1WMHB 2QHOA 1R7SA 2N9XA 4XDDA 1EF1A 4BBKA 5IA7A 2JU6X 1M94A 1ZYIA 5AUKA 1WRIA 3QWMA 2KTRA 5HG2A 1NVLA 4K2OA 2ELAA 2K22A 4FLHA 1IGDA 3AMZA 3W9CB 1BWNA 3T8MA 4NAWA 2JZPA 2J4XA 3GE8C 4AJYB 1MJDA 3W1SC 2SAKA 3DOWA 3A98B 1SIJA 1FB8A 1RWSA 2FBWB 4O1NA 3BWUD 5IO9A 1FCLA 2YSZA 5KHOA 4B6WA 2LGDA 1XLNA 4P16A 4ZHOA 4QXAB 5CHFA 2KFKB 3DHGC 3I5JC 2P0DA 1P3RA 5EE0A 1OQRA 5I4DA 4A9AA 1T3QA 4HEA1 3L4PA 3HSAA 1Z2MA 2PMVA 3FILB 2LOXA 3CSTA 3CWIA 3PV1A 1VCBA 2R2YA 2LULA 3B1LX 3V60A 4LNIA 3K9OB 3SR6A 2M14A 2INDC 3MP9A 2RDGA 4H2AA 2L1CA 4W9GA 1TY2A 4JLCA 3TSSA 2WH5A 4HRSA 2CY4A 3TEYA 4GDKB 3QHTA 3PP2A 3HUIA 2BWFA 4WAFA 1X11A 2AQ1B 1WRDB 2HJ1A 3WCQA 3OWEB 3QC8B 3P6AA 1W1GA 4GB9A 1JMLA 3A4SC 2G3QB 3AULA 1DYQA 2XK5A 2BW2A 1OMWA 4KZCA 3ZJVA 2ZKMX 1WI1A 2GUMA 2L3ZA 3P7ZA 4NSWA 1MI0A 4IUMB 1WY8A 3HM6X 3UQBA 2H89B 1I7HA 2V4LA 4DK5A 4G50A 1RAXA 4EEWA 2C7HA 2M8SA 2Y8GA 2NBVB 3GYPA 3DXCA 3AI5A 1PGXA 2R2OA 4MH8A 4GIVA 4MJSB 1WGUA 2ZW0A 1P1AA 3U7ZA 2LD9A 1J7BA 2DLBA 2WP9B 1WFYA 3H1UA 3O65B 1L6VA 2QILA 4ACFA 3QBVB 3T06A 2WLBA 2MQJA 2COFA 2MP2B 3EFCA 4F8CB 4GPTB 4GDLB 4S0RA 4GLSC 5LOPB 2JXTA 2WXPA 1DDWA 1WGQA 1JQ4A 4YONA 2LVOA 2LYDA 2LRWA 2LUEA 1V89A 1ZM0A 1E10A 3A8QA 1KTKA 2K3UA 4A3OA 4B95A 1U29A 4JKBA 3KY9A 2WXJA 3RUIB 3ZXVA 3AN1A 1L6UA 1LQBA 3IBEA 1XT9B 2R09A 4P1BC 4BVUC 1U4AA 1GG3A 5DIFB 3KWLA 1RRPB 4HJKA 4ZRQA 5BMGA 2ADZA 3APCA 4CYEA 1Z87A 3R2IA 1XF5L 4CHKA 1TS2A 2GBKA 2IYBA 2D4QA 2UU7A 2KHWB 2O6VA 3B2GA 3CIRB 4JKAA 4EFOA 3GB1A 3NVWA 1L4DB 3PRPB 2N1WA 3AB5A 1TIFA 2DAFA 2ZZPB 1SEBD 1DYNA 2NS5A 2IY0B 3Q2AC 3NUHB 1DOIA 3NW8A 2Q5WD 4L6EA 2N0SB 4OVUA 3PSCA 4TYZA 4M00A 1KLVA 4NJ7A 2K6QA 2LXCA 5BYRA 1QT9A 2C5LC 4K2PA 2OJWA 1K51A 1OGWA 1WXVA 2HD5B 3VH4B 2JYTA 2H88B 2KWUB 4K1RB 4R3DA 4ARCA 5DPWA 1WJNA 4PS8A 1XD4A 1NTYA 1TJ6A 2Y5CA 3BK1A 3V5WA 1L0VB 2VZKD 4Q2JA 3P2BA 1PFJA 4RNAA 1GJZA 1X1MA 3CXBB 1KFYB 2RSGA 2D9VA 4DDGD 4ZRKA 3ZLZA 2DTCA 3V6CB 4XDCA 3TMPB 1WVHA 4W9FA 2DZIA 2KD0A 1HB6A 4II3B 1EUVB 5E6PA 1NENB 3ZRCA 1SE2A 4ZRPA 2ROVA 3FM8C 2XK5B 4KSLC 3H7SA 1NVID 2W9NA 3AH7A 2LG1A 4LNKA 4PS7A 5C79A 3ZXRA 4WJPA 4JK8A 1STEA 1XCTL 4DBGA 1R4NI 2IZVB 4MGKE 3ZTDA 1GOZA 4HK2A 3T3OA 4HB2B 4KX6B 1P5TA 1U2BA 1TZ1A 4F7ZA 4ANXA 2N9PC 2N1VA 5JLJB 3JSVB 4KGSA 1UF0A 4A6QA 5EDSA 2NZ8B 2DZJA 3MC0B 1I7AA 1VZ6A 4N9F4 2N7DA 2X8XX 1QOGA 2IGHA 1RRBA 1AN8A 1E7PB 2WXLA 1K5GB 3J9CA 4N59A 2KUQA 5HI1A 4HCPB 2KLCA 1KZGA 3SHQA 4WURA 4IAPA 2I1KA 1W1DA 4WSFA 2BS4B 2ZPYA 2DYBA 2N4FA 4K3CA 1YX6B 2QDFA 5HE2A 1FFUA 1GAQB 4IM3A 1MPEA 3IAM1 2L2IA 3DHHC 3ODWA 2KOXA 3I9V1 1U5DA 1N62A 1E90A 2L0TA 3JYUA 1JRUA 1XEEA 4IM0A 4TV3A 1RM6C 4EZLA 4IW0A 1JW9D 3KYCD 1CJEA 2LXAA 2GBMA 1FNVA 2A4ZA
chains in the Genus database with same CATH topology
2K39A 5JHBA 2O6VB 5J17A 1J0GA 2DZKA 3M95A 4DHZB 3WYFB 3HK0A 4JKFA 4DDID 1FAOA 2GOWA 1DDVA 4HDQA 4HB0B 1ZC4B 3F5RA 1V6EA 1Q67A 3UF8A 4ZRIA 4PNKA 1MG8A 1WGHA 1OQNA 4IWQA 1K5DB 1E7VA 4H8SA 4JGHB 3ZKJC 3DXDA 2GBRA 1W1HA 2D9YA 3DBSA 4MGYE 1HE8A 1WI0A 3GZNI 4BKSA 2L0FA 3NS8A 3MDBC 4A6FA 4KHOA 4WAAA 2WDTB 4JKHA 2A5UA 4GSWA 3KUCB 1MK9B 2RNRB 2RGFA 1QC6A 2ROZB 3PVLA 2UWQA 2Z0OA 1PLSA 4J6IA 1D3ZA 2DYNA 2R2QA 2D9WA 2KXJA 2LI5A 3ENEA 4W9JA 5D6JB 5GMVA 4ILJA 4E71A 4JK9A 1H8CA 2KUPA 3PREA 1WGGA 3S2AA 3ML8A 3CIKA 1UNRA 3HM3A 1MIXA 1X1GA 3M62B 1E5WA 1H4RA 4MM3A 1K8RB 4IWPA 1VD2A 2HTHA 2NPTA 2P8VA 1J8CA 4HAUB 2RSUA 2L05A 4ANVA 3FLVA 4A6FB 3JSVA 4BBNF 3VTVA 1OEYA 2NCNA 1P0RA 1EO6A 5DI9B 2YLMA 3M1IB 4HCNB 1FOEA 4MGIE 5AZGA 3WA0A 4K7UA 2AYOB 3RZFA 2EJ8A 2V76A 5KQ4A 2JT4B 4WWNA 3VH3B 3RCZA 2V1YA 4GN1A 3OJ3A 1J0WA 4ZDVA 4C0AA 1FXTB 3JVZX 2DHZA 3PT2B 2MWSB 1I42A 3QK0A 4MT7A 5DHAB 3DBRI 2Z0PA 5G2NA 4XC2A 4GDKA 2NR2A 3L17A 1QQGA 4NJ6A 2MFQA 5C5BA 5DCNA 2YS5A 4W9KA 1WX7A 2KMCA 4A6KA 5J3QA 2ELBA 1ZGUB 2G4SA 2JZ3B 3N3KB 2KGXB 2JUOA 3L54A 3EECA 2I1JA 3ZVVA 2YRYA 3TJPA 4CHJA 2VSZA 2AWTA 5D94A 1WGDA 3DBLI 3IHPC 1XD3B 5KQ1A 1MK7B 1OTRB 1A5RA 2FJ9A 2KKCA 3ZUNA 3PEGA 3H7PB 5J3TA 5KCVA 4WJ7A 2FAZA 3QA8A 5DHFB 1PMSA 4DBBA 2UZRA 2CB8A 3PLUA 3QX1A 1Y8RC 4TQ0A 2BYEA 1XR0B 1OEYJ 2BF8B 4W9EA 4Y94A 2IFSA 3PPAA 5AEKB 1GGOA 1OY2A 4JKDA 2DYOA 3WAPA 2DKPA 2WYQA 4A6HA 1GC6A 2W2XC 2IYDB 2L76A 3SV1A 5HE3A 3U7DA 2RQ1A 3PLVA 3IG3A 2KX3A 3EHVA 3AXCA 2DA0A 3N7CA 1YIWA 3HW2B 2H7EA 5LXIB 3PVWA 3ZNHB 2KWCA 3A9JB 1LW3A 1TQZA 5D27A 5BO4B 3AU5A 5JHAA 1P3QU 4NAWB 2MRPA 3PVUA 3NY5A 5CLLB 2COPA 2MCNB 4FN2A 1WR1A 1WE6A 3VIAA 3B0AA 3ENBA 1OQYA 2J0KA 1UGMA 2ABDA 2L8JA 2YF0A 3AU4A 1DDMA 1N3HA 4IOYX 4YL8A 3RT3B 2COCA 4MSQB 3PRMB 2DYQA 2MBHA 2JY6A 2VRRB 1CMXB 2ZPNA 4Z2MB 5G55A 2R82A 2CY5A 2N0YA 1NU2A 3VTWA 1FGYA 3RULA 2KDIA 2NVUI 3DPDA 2IY1B 5HKHA 3QJZA 1V49A 3CF6E 2NPTB 4MJSA 1E7UA 3DVGX 4LJPB 3V62A 1LM8B 1ZC3B 2IBIB 4KVGB 1M7RA 3A1QA 2K00A 2XBBC 4IC7B 1ZVRA 2MWNB 3NZSA 3QAQA 2ZNVB 3L08A 2Y8FA 2FCQA 4HB3B 2DHKA 1P6SA 3M63B 2W2XD 2FNJB 3RYTA 3DXEA 1WR6E 2KX0A 2E2XA 2KN5A 1V5PA 5HE0A 4E74A 2LASA 3F0WA 4X57B 3BINA 2RGNB 3N32A 4MH0E 1KJTA 2FCMA 3ZDMC 3PGEA 1MAIA 1UD7A 4F7UP 2FIFA 2MP2A 2YT0A 4EUTA 2NMBA 4NQLB 3WANA 4FJYA 2M17A 2MLBA 4G11A 2KC2A 2DKQA 1WJ4A 4RM9A 3UGBB 2BWES 2P0HA 4KHBB 2G35A 3BY4B 5D2MB 5C23A 3ZO5B 4CO7A 1X86A 3ZNGC 5L83A 3PSEB 1XODA 2J59M 5CHWA 2JP2A 4FJZA 1KI1B 3D8DA 3ML4A 3FSSA 1UZXB 3GOEA 2L7RA 5FR6A 1IRSA 1BAKA 1MKEA 2R0DA 2DHIA 1DIKA 3RD2A 4JQWC 2PZ1A 2H7DA 1V61A 3RCPA 2FCNA 3SNHA 4IM2A 5CTRC 2BYFA 5C16A 1F9JA 5DH9B 4K7SA 1P9DU 3CSFA 2D3GA 3EPYA 3L10B 1FHOA 2HE7A 1V5OA 2Y5BB 3N30A 4BBNC 2X18A 3DVGY 1UPQA 4ILHA 3LJUX 2DX5B 2KDBA 3QARA 1VBHA 2FIDA 4PQ0A 2CRFA 2G4DB 3IFWB 1KZ7A 2KFJA 4XX5A 5JP4A 3ALBA 1KM7A 1J19A 1ZKHA 2V3SA 2K25A 2K2UA 3KH0A 2M1MA 4RM8A 2ZVNA 4LCDE 3MTNB 3U8ZA 5AZFA 4KDLB 1XX0A 2LJ5A 3DVNU 3FP5A 1V9JA 2CHXA 2PE6B 3DVNV 2GCLA 1YD8U 3QQ8B 4AP4C 3NHEB 2EMSA 2BKRB 3DCGA 2MBQA 2CU1A 2MW5A 2KDEB 2HRJA 3KUZA 4EZKA 4EJNA 4W9IA 3ECIA 2VRWB 1WE7A 3SD5A 1WJUA 2GBNA 1Y5OA 3VUYA 5IJMA 4I6LB 2UYZB 4JIOU 1WF9A 1U27A 4HLEA 4KDIC 1E8ZA 5JHGA 2O6VD 1V86A 2K8BA 1TGZB 4F7HA 2CHWA 2OQBA 3PS6A 3A4RA 2RVBB 1LB1A 2EKEC 1XCGA 1DBHA 3ULCA 4MELA 1V81A 5C5BB 3C0RB 2KJHB 1U5FA 2KO3A 3IVFA 3A33B 4HDOA 2KTFA 2KQ7A 4ICVA 5D3XA 3QCAA 4A3PA 5JVLA 2Z0DB 2COAA 2JPHA 1LFDA 1WXAA 1Q0WB 2LGXA 2DENB 3KYDD 2D2QA 4JKGB 2ZJDA 1UEFA 1EGXA 1U5EA 1QZEA 3ML9A 3TW1A 1PQSA 2LBBA 3SYXA 2XQNM 2MX2A 2LGYA 3ZNID 2M0XA 2ZVOA 1C1YB 4WJOA 2Z0QA 4FJVB 2KTRB 2OJRA 3VXWA 4BOZB 4GMVA 4AWJA 2CR5A 4MGZE 4ZYNA 2BGFA 3TFMA 3MJWA 3G9WA 4LDTD 3UQAA 2GMIC 1BTNA 3TIXA 2REXA 4D0NB 3SDLC 3ULBA 1M7EA 3SBTA 2WWZA 2UVMA 4W9DA 1RJ2A 1IPGA 1P98A 2K1FA 2KFKA 3NZUA 1ST7A 5L81A 4BKTA 1WXMA 2AL3A 4HAXB 2BCJA 3B08A 4EMOA 2I5CA 2MBOA 2YS3A 1TBEA 3VVWB 3TL5A 2Z59B 1ISNA 2NBUA 5J18A 1GUAB 3E9OA 1EF5A 2MKRA 4HAZB 4HAVB 5C1ZA 4G0NB 4FHKA 3ZTCA 2J0MA 3ODXA 3A9KB 3D32A 1WIAA 3H7PA 2B3AA 3A9JA 2LOZA 1V5MA 4DX90 2ZCBA 2FUHB 4K7WA 4KAXB 2W2WA 1WX8A 3OJ4B 3VTUA 1WJ1A 2KJ6A 4KV2A 2VKIA 4KIKA 3KSYA 2FDQA 2JWZA 4BKSD 3PHXB 5LLIA 5DPRA 2RUKB 1NI2A 3RZWC 4HWIB 5JZEB 3WIMA 2DAJA 4P7IA 3TBLD 2CODA 5J2RA 3HIZA 3LJ3A 1WGRA 2JRIB 3V6EB 1RFAA 1R4MI 3KVFB 5AZHA 3GYOA 4IFSA 2DX5A 4JKCA 3R3MA 4HATB 2K8HA 3PTFC 2GCJA 3KUDB 1KOTA 3ONSA 4ASWC 5CX3A 2LVQA 1HB8A 1YJ1A 1L7YA 2MBEA 3TCAA 3X0WA 4EKUA 3APFA 1WM2A 2D07B 3D8FA 2CHZA 5GOWB 4EOYA 4RMAA 2KZRA 2KNBA 3A1QB 1UBQA 1KC7A 1GNUA 3WALA 2MDXA 2JF5A 2DIKA 1WG7A 1ACAA 1AARA 4M8NA 2GS0A 2MSED 4PYUA 3ZVRA 1Q5WB 2IO0B 2FCSA 4NNJB 3KZ1A 4E3CA 2RD0A 2PE9A 1S3SG 1WGYA 3R7RA 4HHVA 3R66C 2JVCA 3VAWA 2L00B 4TUUA 2C9WB 1G6JA 3ZW3A 2KCJA 2KK8A 2N7EA 1U5GA 2JZZA 1LXDA 4ICUA 1V80A 4M8MA 3VHTC 2YVCA 4AUQC 2J7QB 2OOBB 2Z0EB 4FBJB 2EMTA 1E8WA 3ODOA 3TO1A 3U30A 2KC1A 4GU2A 3CMMB 2PPHA 1VBGA 4NY0A 3PHWB 4AOFA 4IWOA 4Z2NA 2DX1A 1WXSA 1YX5B 3UZTA 4F7GA 3UINB 2HJ8A 5JH5C 1YQBA 1JDEA 2KJRA 3HQCA 3EC8A 1SHCA 3OANA 2BPSA 3DBHI 1UPRA 2O2VA 4HXDA 4JK7A 2K8CA 2LVPA 2DHJA 3K9PB 3W1YA 3L16A 2KQSA 4MSMB 1I35A 4JKEA 5D3WA 1XKEA 2RPQA 3E66A 4GZUA 3L0WB 3ZDTA 2GBJA 5KHQA 4BKGA 2I5FA 4DHJB 3SUZA 2DLWA 1AWEA 2KMAA 4I6NB 2D9ZA 4KIKB 3Q3FA 3NSUA 3UIPB 2QKLA 1WZ3A 4W9CA 2X0SA 1EVHA 3PZDA 2ZCCA 2JXXA 4LDTB 4PS3A 2IO1B 4JL9A 2CAYA 1UNPA 1ZW7A 2M38A 1WM3A 5EFXA 2BKFA 2AL6A 3AJ4A 1TTNA 1FGZA 3WAMA 1V88A 1FHWA 1X05A 1H10A 2IO3B 3TVVA 1Y19B 3KRXA 4WJNA 3VUXA 3W1SA 2KANA 2IO2B 3PG7A 1DROA 1WX9A 4IG7B 1WYWB 2C7NB 2KVRA 1UBIA 3A9KA 4PYZA 4HPLB 3APDA 2AEHA 4KZ0A 2G45B 3DDCB 4URKA 2O2VB 4KHAA 4CHMA 2OTXA 2N23A 2CKHB 3R7QA 2C60A 4ANUA 4HAWB 4WQOB 3V61A 3ZNZB 4K17A 4II2B 3NOBA 1SE9A 3BJIA 1ZSQA 3M3JA 4FULA 1HBKA 1KBLA 2JRHA 5CHVC 3ZRFA 2QKMA 4GXBA 1SIFA 2DYMA 4WVFB 4DX8A 1WJ6A 3KRWA 2LWPA 1RLFA 4OVVA 5HE1A 2KWVB 1X1FA 5CLQB 4WJQA 2K6DB 2MA9B 1T0YA 4DXAB 2YT1A 3X23A 1WH3A 3WAOA 1UH6A 1MPHA 2ASQA 5J3YA 2ZNVC 4BFRA 4WWPA 4M0WB 3OAWA 4GGQA 3SO6A 4DHZE 5LONB 2LKOA 4ILGB 3SBGA 4W9LA 4A5KA 2D10A 2DN6A 4MDKE 4DHJD 4MY6A 3MHSD 2D9XA 2M4NA 1C3TA 4I6PA 3D8EA 5FI0A 3LDZE 3O96A 1WMHA 3DQVA 1Q1OA 2YS1A 2WX1A 3E9LA 1BT0A 2MBBB 3Q3JA 4HVBA 2C7MB 5DPTA 1V5UA 1V2YA 2D11A 4G3XB 4NPNA 3SU8X 3VOQA 3I3TB 5E6OA 2KLGA 5FI1A 3HHMA 4HAYB 3JW0X 2RR9A 2NBWB 2WX0A 3FEHA 1WJMA 4GMXB 5E6NA 1XQQA 2CQUA 3VDZA 3UIOB 1NDDA 3OLMD 1NTIA 4XWXA 2LZ6A 3ZIMA 3VQIA 1SGHA 2FJLA 5D7GA 3T9LA 2PEAA 3VFKA 2DFKA 5JHHA 2HTHB 5IAAC 4TQ1A 4B9KA 2LRUA 3QWZB 2CS4A 4LJOB 1EAZA 2BYVE 3A8PA 1IP9A 2K2JA 3QIJA 1MIZB 3H9DA 2P0FA 5D3YA 2XEWA 4GDLA 1IYFA 1NBFC 2N9EB 1NTVA 4A20A 1V5TA 2J0JA 3EFUA 4KSKC 1E8YA 2PJHA 3VUWA 2DZMA 1GC7A 2KDFB 1BTKA 5L95C 3L13A 1FHXA 3KW5B 2EC1A 4FHJA 4FADA 4HB4B 4EZJA 5TR5A 2RLOA 4F1SA 1UELA 3MPXA 2Y7BA 4MEMA 4WWOA 1TXDA 4B6HA 3PRZA 4ANWA 4K81A 5D3VA 5C6RA 1Z5SB 2ZEQA 4GOCA 4HPMB 4BOSC 4JKGA 5LXHA 1WZ0A 1B55A 1E8XA 4NQKE 4XZ4A 2Q13A 4AJWA 1UNQA 1L2NA 4MK0A 1I2HA 4ZRJA 3E9PA 3H6NA 4TKNA 5DPSA 4W9HA 1AQCA 1S1QB 2GJYA 4DWFA 2UZSA 4FA6A 1WMHB 2QHOA 2N9XA 1EF1A 4BBKA 5IA7A 1M94A 3QWMA 2KTRA 1NVLA 4K2OA 2ELAA 4FLHA 1BWNA 3T8MA 4NAWA 4AJYB 3W1SC 3DOWA 3A98B 1FB8A 2YSZA 5KHOA 4B6WA 2LGDA 5CHFA 2KFKB 2P0DA 1P3RA 1Z2MA 2LOXA 3CSTA 3PV1A 1VCBA 2LULA 3B1LX 3V60A 3K9OB 2M14A 2L1CA 4W9GA 4JLCA 2WH5A 2CY4A 4GDKB 3QHTA 3PP2A 2BWFA 1X11A 1WRDB 3QC8B 3P6AA 1W1GA 4GB9A 3A4SC 2G3QB 3AULA 2XK5A 1OMWA 4KZCA 1WI1A 2L3ZA 3P7ZA 4NSWA 4IUMB 1WY8A 3HM6X 3UQBA 2V4LA 4DK5A 4G50A 1RAXA 4EEWA 2C7HA 2M8SA 2Y8GA 2NBVB 3GYPA 3DXCA 3AI5A 2R2OA 4GIVA 4MJSB 1WGUA 1P1AA 2LD9A 1WFYA 3H1UA 3O65B 3QBVB 3T06A 2MQJA 2COFA 2MP2B 4F8CB 4GPTB 4GDLB 5LOPB 1DDWA 1WGQA 4YONA 2LVOA 2LYDA 2LRWA 2LUEA 1V89A 1ZM0A 3A8QA 4A3OA 4B95A 1U29A 4JKBA 3KY9A 3RUIB 1LQBA 3IBEA 1XT9B 2R09A 4BVUC 1U4AA 1GG3A 5DIFB 1RRPB 4HJKA 2ADZA 3APCA 4CYEA 1Z87A 4CHKA 2GBKA 2IYBA 2D4QA 2KHWB 2O6VA 4JKAA 4EFOA 3PRPB 2N1WA 2DAFA 2ZZPB 1DYNA 2NS5A 2IY0B 4L6EA 4OVUA 3PSCA 4TYZA 1KLVA 4NJ7A 2K6QA 2LXCA 2C5LC 4K2PA 1OGWA 1WXVA 2HD5B 3VH4B 2KWUB 4K1RB 1WJNA 4PS8A 1XD4A 1NTYA 1TJ6A 3V5WA 3P2BA 1PFJA 1GJZA 1X1MA 3CXBB 2RSGA 2D9VA 4DDGD 4ZRKA 3ZLZA 2DTCA 3V6CB 3TMPB 1WVHA 4W9FA 2DZIA 2KD0A 1HB6A 4II3B 1EUVB 5E6PA 3ZRCA 2ROVA 3FM8C 2XK5B 4KSLC 3H7SA 2W9NA 2LG1A 4PS7A 5C79A 4WJPA 4JK8A 4DBGA 1R4NI 2IZVB 4MGKE 3ZTDA 4HK2A 4HB2B 1P5TA 1U2BA 1TZ1A 4F7ZA 4ANXA 2N9PC 2N1VA 5JLJB 3JSVB 2A4ZA 5EDSA 2NZ8B 2DZJA 1I7AA 4N9F4 2N7DA 1RRBA 1K5GB 4HCPB 2KLCA 1KZGA 3SHQA 4IAPA 2I1KA 1W1DA 4WSFA 2ZPYA 2DYBA 2N4FA 1YX6B 5HE2A 4IM3A 2L2IA 3ODWA 2KOXA 1U5DA 1E90A 2L0TA 3JYUA 1JRUA 4IM0A 4TV3A 4EZLA 4IW0A 3KYCD 2LXAA 2GBMA 5DPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR6 E;  2BYV E;  2K39 A;  2E2X A;  3A8P A;  1V5P A;  2KN5 A;  2KX0 A;  5JHB A;  1IP9 A;  2K2J A;  3R3M A;  2O6V B;  3QIJ A;  5HE0 A;  1MIZ B;  3H9D A;  4HAT B;  2K8H A;  3PTF C;  4E74 A;  2GCJ A;  5J17 A;  2LAS A;  2P0F A;  3F0W A;  2DZK A;  3KUD B;  3M95 A;  4X57 B;  1J0G A;  1KOT A;  4DHZ B;  5D3Y A;  3BIN A;  3WYF B;  2RGN B;  3HK0 A;  2XEW A;  3ONS A;  4GDL A;  4DDI D;  4ASW C;  1FAO A;  2GOW A;  3N32 A;  1DDV A;  1IYF A;  5CX3 A;  2LVQ A;  1NBF C;  2N9E B;  1HB8 A;  1NTV A;  4A20 A;  1V5T A;  1YJ1 A;  4MH0 E;  2J0J A;  1KJT A;  4HDQ A;  4HB0 B;  1ZC4 B;  3F5R A;  1V6E A;  3EFU A;  4KSK C;  1Q67 A;  1L7Y A;  3UF8 A;  4ZRI A;  2MBE A;  1E8Y A;  2PJH A;  3VUW A;  4PNK A;  2DZM A;  3TCA A;  1MG8 A;  2FCM A;  3X0W A;  3ZDM C;  4EKU A;  3APF A;  1WM2 A;  2D07 B;  3PGE A;  1WGH A;  1MAI A;  3D8F A;  1GC7 A;  1OQN A;  2CHZ A;  4IWQ A;  5GOW B;  2KDF B;  1UD7 A;  4EOY A;  1BTK A;  4RMA A;  5L95 C;  3L13 A;  2KZR A;  1K5D B;  1E7V A;  2KNB A;  4F7U P;  2FIF A;  3A1Q B;  2MP2 A;  2YT0 A;  4H8S A;  4EUT A;  1FHX A;  2NMB A;  4NQL B;  3KW5 B;  2EC1 A;  3WAN A;  1UBQ A;  4FHJ A;  2M17 A;  2MLB A;  4HB4 B;  4FJY A;  4G11 A;  4JGH B;  5TR5 A;  3ZKJ C;  1GNU A;  3WAL A;  4EZJ A;  2KC2 A;  2MDX A;  2DKQ A;  2RLO A;  3DXD A;  1WJ4 A;  2GBR A;  2JF5 A;  4F1S A;  1WG7 A;  3MPX A;  1W1H A;  2Y7B A;  1UEL A;  4MEM A;  4RM9 A;  1TXD A;  2D9Y A;  4B6H A;  3PRZ A;  3DBS A;  4K81 A;  2BWE S;  4ANW A;  1ACA A;  2P0H A;  5D3V A;  1HE8 A;  4MGY E;  4KHB B;  1AAR A;  2G35 A;  3BY4 B;  4M8N A;  5D2M B;  5C23 A;  3ZO5 B;  1WI0 A;  2GS0 A;  4CO7 A;  2MSE D;  5C6R A;  3GZN I;  4BKS A;  1X86 A;  3ZNG C;  2L0F A;  5L83 A;  3PSE B;  4PYU A;  1XOD A;  3ZVR A;  2J59 M;  5CHW A;  2JP2 A;  1Q5W B;  1Z5S B;  2ZEQ A;  2IO0 B;  4GOC A;  2FCS A;  4FJZ A;  4HPM B;  4NNJ B;  3KZ1 A;  1KI1 B;  4E3C A;  3D8D A;  3ML4 A;  3FSS A;  2PE9 A;  1S3S G;  2RD0 A;  4BOS C;  1UZX B;  5LXH A;  3GOE A;  1WZ0 A;  1B55 A;  1WGY A;  2L7R A;  3NS8 A;  3MDB C;  5FR6 A;  3R7R A;  1E8X A;  4HHV A;  3R66 C;  4A6F A;  4KHO A;  4WAA A;  2JVC A;  2WDT B;  4NQK E;  1IRS A;  3VAW A;  1BAK A;  2A5U A;  2L00 B;  4XZ4 A;  4GSW A;  3UGB B;  4TUU A;  1MKE A;  2C9W B;  1G6J A;  2Q13 A;  3KUC B;  4AJW A;  3ZW3 A;  1MK9 B;  2R0D A;  2KCJ A;  2DHI A;  1UNQ A;  4JQW C;  3RD2 A;  1L2N A;  4MK0 A;  2PZ1 A;  1I2H A;  2KK8 A;  2N7E A;  4ZRJ A;  1U5G A;  1V61 A;  2H7D A;  2RNR B;  3RCP A;  1QC6 A;  2FCN A;  2RGF A;  2ROZ B;  3SNH A;  2JZZ A;  3H6N A;  1LXD A;  4ICU A;  1V80 A;  4IM2 A;  4M8M A;  4TKN A;  2BYF A;  5CTR C;  5C16 A;  5DPS A;  1F9J A;  3VHT C;  5DH9 B;  3PVL A;  2UWQ A;  4K7S A;  4W9H A;  1AQC A;  1P9D U;  2YVC A;  1PLS A;  2GJY A;  2Z0O A;  1S1Q B;  2DYN A;  4J6I A;  2R2Q A;  2J7Q B;  3CSF A;  4AUQ C;  4DWF A;  2UZS A;  2D3G A;  3EPY A;  2D9W A;  1FHO A;  3L10 B;  4FA6 A;  2HE7 A;  1V5O A;  1WMH B;  2QHO A;  2OOB B;  2Z0E B;  2KXJ A;  2LI5 A;  4FBJ B;  2Y5B B;  2N9X A;  2EMT A;  3ENE A;  1E8W A;  1EF1 A;  4BBK A;  3N30 A;  2X18 A;  4W9J A;  5D6J B;  5GMV A;  4E71 A;  4WWO A;  5IA7 A;  3DVG Y;  1H8C A;  1UPQ A;  2KUP A;  1M94 A;  1WGG A;  3PRE A;  3QWM A;  2KTR A;  3ODO A;  1NVL A;  3LJU X;  3ML8 A;  2DX5 B;  3CIK A;  4K2O A;  3S2A A;  2KDB A;  3TO1 A;  1UNR A;  2ELA A;  2FID A;  3QAR A;  3U30 A;  4FLH A;  3HM3 A;  1BWN A;  1MIX A;  1X1G A;  4PQ0 A;  2KC1 A;  3CMM B;  3M62 B;  2CRF A;  4GU2 A;  2G4D B;  1E5W A;  1H4R A;  2PPH A;  4MM3 A;  4NAW A;  3IFW B;  5KHQ A;  4AJY B;  4NY0 A;  1KZ7 A;  1K8R B;  2KFJ A;  3W1S C;  4XX5 A;  3PHW B;  4IWP A;  4AOF A;  1VD2 A;  3DOW A;  4IWO A;  5JP4 A;  2HTH A;  3A98 B;  1FB8 A;  3ALB A;  4Z2N A;  1KM7 A;  2NPT A;  1J19 A;  2P8V A;  2DX1 A;  1WXS A;  1YX5 B;  2YSZ A;  4HAU B;  3UZT A;  1ZKH A;  2L05 A;  2RSU A;  5KHO A;  1J8C A;  4B6W A;  2V3S A;  2LGD A;  2K25 A;  2K2U A;  3KH0 A;  4F7G A;  3FLV A;  4ANV A;  4A6F B;  2M1M A;  4FAD A;  3UIN B;  5CHF A;  2KFK B;  4RM8 A;  3JSV A;  4BBN F;  3VTV A;  1OEY A;  2P0D A;  2HJ8 A;  5JH5 C;  2NCN A;  1P3R A;  1P0R A;  1EO6 A;  5DI9 B;  2YLM A;  1YQB A;  2ZVN A;  4LCD E;  3M1I B;  2KJR A;  3HQC A;  3EC8 A;  4HCN B;  1FOE A;  3MTN B;  1SHC A;  3OAN A;  2BPS A;  3DBH I;  4MGI E;  5AZG A;  1Z2M A;  3WA0 A;  2LOX A;  1UPR A;  3CST A;  2O2V A;  4HXD A;  2K8C A;  3U8Z A;  3PV1 A;  4K7U A;  1VCB A;  2AYO B;  3RZF A;  2LVP A;  2LUL A;  2EJ8 A;  3B1L X;  2V76 A;  5KQ4 A;  2JT4 B;  4KDL B;  5AZF A;  1XX0 A;  4WWN A;  2DHJ A;  2LJ5 A;  3DVN U;  3V60 A;  3VH3 B;  3K9O B;  3K9P B;  3FP5 A;  3W1Y A;  2M14 A;  3L16 A;  2KQS A;  1V9J A;  2CHX A;  4MSM B;  3RCZ A;  1I35 A;  5D3W A;  2L1C A;  2PE6 B;  2V1Y A;  3DVN V;  4W9G A;  2GCL A;  1YD8 U;  1XKE A;  4GN1 A;  3QQ8 B;  3NHE B;  4AP4 C;  3OJ3 A;  1D3Z A;  2RPQ A;  4JLC A;  2EMS A;  2BKR B;  1J0W A;  4GZU A;  2WH5 A;  3L0W B;  3DCG A;  3ZDT A;  4ZDV A;  2GBJ A;  2CY4 A;  4C0A A;  1FXT B;  3JVZ X;  2DHZ A;  2CU1 A;  2MBQ A;  3PT2 B;  3QHT A;  2MW5 A;  3PP2 A;  2KDE B;  2BWF A;  4GDK B;  4BKG A;  1X11 A;  2MWS B;  2HRJ A;  1WRD B;  3KUZ A;  4URK A;  4EZK A;  2I5F A;  1I42 A;  4EJN A;  4W9I A;  4DHJ B;  3SUZ A;  3ECI A;  2DLW A;  2VRW B;  1AWE A;  2KMA A;  3P6A A;  1WE7 A;  3QC8 B;  3QK0 A;  3SD5 A;  1WJU A;  2GBN A;  1W1G A;  4GB9 A;  4I6N B;  4MT7 A;  3A4S C;  1Y5O A;  2G3Q B;  3AUL A;  3VUY A;  5IJM A;  2D9Z A;  4KIK B;  2XK5 A;  1OMW A;  5DHA B;  4I6L B;  3DBR I;  4KZC A;  2Z0P A;  3Q3F A;  3NSU A;  1WI1 A;  2L3Z A;  3UIP B;  3P7Z A;  2UYZ B;  2QKL A;  1WZ3 A;  4W9C A;  4NSW A;  4JIO U;  1WF9 A;  5G2N A;  3T8M A;  1U27 A;  4XC2 A;  4GDK A;  1EVH A;  2NR2 A;  4HLE A;  3L17 A;  4KDI C;  4IUM B;  1E8Z A;  1WY8 A;  5JHG A;  3HM6 X;  3UQB A;  1QQG A;  3PZD A;  4NJ6 A;  2O6V D;  2V4L A;  2JXX A;  2MFQ A;  5C5B A;  2ZCC A;  4LDT B;  4PS3 A;  5DCN A;  4DK5 A;  2IO1 B;  4G50 A;  4JL9 A;  1V86 A;  1RAX A;  2YS5 A;  4W9K A;  2K8B A;  1TGZ B;  2CAY A;  4F7H A;  4EEW A;  1WX7 A;  2CHW A;  2C7H A;  2M8S A;  1UNP A;  1ZW7 A;  2KMC A;  2M38 A;  1WM3 A;  2Y8G A;  5EFX A;  2BKF A;  2NBV B;  2OQB A;  4A6K A;  3PS6 A;  2AL6 A;  3A4R A;  3GYP A;  5J3Q A;  2RVB B;  2ELB A;  3AJ4 A;  1LB1 A;  3DXC A;  1TTN A;  1FGZ A;  1ZGU B;  1XCG A;  1DBH A;  2EKE C;  2G4S A;  2JZ3 B;  2R2O A;  3AI5 A;  3N3K B;  4GIV A;  3WAM A;  4MJS B;  1V88 A;  1WGU A;  3ULC A;  1FHW A;  2KGX B;  2JUO A;  3L54 A;  1P1A A;  1X05 A;  4MEL A;  1V81 A;  5C5B B;  2LD9 A;  1H10 A;  2IO3 B;  3EEC A;  2I1J A;  3C0R B;  2YRY A;  3TVV A;  3TJP A;  3ZVV A;  2KJH B;  1Y19 B;  4CHJ A;  1WFY A;  3KRX A;  1U5F A;  2KO3 A;  4WJN A;  3VUX A;  3H1U A;  3IVF A;  3A33 B;  2VSZ A;  4HDO A;  2AWT A;  3O65 B;  2KAN A;  2IO2 B;  3PG7 A;  2KTF A;  3W1S A;  1DRO A;  2KQ7 A;  1WX9 A;  3QBV B;  3T06 A;  4IG7 B;  4ICV A;  5D3X A;  3QCA A;  1WGD A;  2MQJ A;  5D94 A;  4A3P A;  2COF A;  1WYW B;  2C7N B;  2MP2 B;  3DBL I;  2KVR A;  4F8C B;  4GPT B;  2Z0D B;  3IHP C;  1UBI A;  4GDL B;  5LOP B;  3A9K A;  1XD3 B;  5KQ1 A;  1MK7 B;  4PYZ A;  2COA A;  4HPL B;  2JPH A;  1OTR B;  3APD A;  1DDW A;  2AEH A;  1WGQ A;  2FJ9 A;  1A5R A;  4KZ0 A;  1LFD A;  1WXA A;  2G45 B;  4YON A;  2LVO A;  2LYD A;  2KKC A;  3DDC B;  2O2V B;  4KHA A;  2LRW A;  3ZUN A;  2LUE A;  1V89 A;  3PEG A;  1Q0W B;  2LGX A;  3H7P B;  1ZM0 A;  4CHM A;  2OTX A;  5J3T A;  2DEN B;  2N23 A;  5KCV A;  3A8Q A;  2CKH B;  3KYD D;  3R7Q A;  2C60 A;  4A3O A;  4B95 A;  4WJ7 A;  1U29 A;  4ANU A;  3KY9 A;  2FAZ A;  2D2Q A;  3RUI B;  4HAW B;  2ZJD A;  4WQO B;  3V61 A;  1UEF A;  1EGX A;  3QA8 A;  5DHF B;  1PMS A;  3ZNZ B;  1U5E A;  4K17 A;  1LQB A;  1QZE A;  3IBE A;  3NOB A;  4II2 B;  3ML9 A;  3TW1 A;  1XT9 B;  2R09 A;  1SE9 A;  3BJI A;  1PQS A;  4BVU C;  1U4A A;  1GG3 A;  5DIF B;  4DBB A;  2UZR A;  2LBB A;  1ZSQ A;  1RRP B;  3SYX A;  3M3J A;  4HJK A;  2XQN M;  2CB8 A;  2ADZ A;  3PLU A;  3APC A;  1Y8R C;  1HBK A;  4CYE A;  3QX1 A;  4FUL A;  4TQ0 A;  2MX2 A;  1Z87 A;  2BYE A;  1XR0 B;  1OEY J;  2BF8 B;  2LGY A;  4W9E A;  2JRH A;  2GBK A;  4CHK A;  3ZNI D;  2IYB A;  2M0X A;  2ZVO A;  5CHV C;  1C1Y B;  4WJO A;  3ZRF A;  2D4Q A;  4Y94 A;  2IFS A;  2QKM A;  2KHW B;  4GXB A;  2O6V A;  3PPA A;  1SIF A;  2DYM A;  2Z0Q A;  5AEK B;  4FJV B;  1OY2 A;  2KTR B;  2DYO A;  3WAP A;  4WVF B;  2OJR A;  4EFO A;  2DKP A;  4DX8 A;  1WJ6 A;  3VXW A;  2WYQ A;  4A6H A;  1GC6 A;  3PRP B;  3KRW A;  4BOZ B;  2LWP A;  2W2X C;  4GMV A;  1RLF A;  4OVV A;  2N1W A;  2IYD B;  2L76 A;  4AWJ A;  5HE1 A;  3SV1 A;  2DAF A;  2ZZP B;  2CR5 A;  5HE3 A;  2KWV B;  3U7D A;  1DYN A;  1X1F A;  5CLQ B;  4MGZ E;  2RQ1 A;  4WJQ A;  2NS5 A;  2IY0 B;  4ZYN A;  2K6D B;  2MA9 B;  2BGF A;  3TFM A;  1T0Y A;  3PLV A;  4DXA B;  3MJW A;  4L6E A;  3G9W A;  2YT1 A;  3X23 A;  4OVU A;  1WH3 A;  3IG3 A;  3WAO A;  3PSC A;  4TYZ A;  1UH6 A;  4LDT D;  4LJO B;  1KLV A;  2KX3 A;  1MPH A;  3EHV A;  4NJ7 A;  2ASQ A;  3UQA A;  2K6Q A;  2LXC A;  2GMI C;  3AXC A;  2C5L C;  2DA0 A;  3N7C A;  5J3Y A;  1BTN A;  3HW2 B;  1YIW A;  2ZNV C;  4BFR A;  4WWP A;  4M0W B;  2H7E A;  3TIX A;  5LXI B;  3OAW A;  3PVW A;  2REX A;  4K2P A;  4GGQ A;  4D0N B;  3SO6 A;  1OGW A;  1WXV A;  3ULB A;  3SDL C;  3ZNH B;  2HD5 B;  4DHZ E;  2KWC A;  5LON B;  3VH4 B;  3A9J B;  1LW3 A;  1TQZ A;  5D27 A;  5BO4 B;  2KWU B;  1M7E A;  3AU5 A;  4K1R B;  2LKO A;  2WWZ A;  5DPW A;  1WJN A;  4PS8 A;  5JHA A;  1XD4 A;  2UVM A;  1P3Q U;  1NTY A;  1TJ6 A;  4NAW B;  3V5W A;  4W9L A;  4A5K A;  2MRP A;  2D10 A;  3P2B A;  4W9D A;  1PFJ A;  3PVU A;  1GJZ A;  1X1M A;  3CXB B;  1RJ2 A;  2DN6 A;  4MDK E;  4DHJ D;  1IPG A;  3NY5 A;  5CLL B;  2COP A;  4MY6 A;  1P98 A;  2K1F A;  2RSG A;  3MHS D;  2D9V A;  2MCN B;  4DDG D;  4ZRK A;  2D9X A;  2KFK A;  2DTC A;  2M4N A;  3NZU A;  1ST7 A;  3ZLZ A;  1C3T A;  3V6C B;  4I6P A;  3TMP B;  5L81 A;  3D8E A;  4BKT A;  5FI0 A;  3LDZ E;  3O96 A;  1WVH A;  1WMH A;  1WXM A;  2AL3 A;  2DZI A;  3DQV A;  4FN2 A;  4W9F A;  1WR1 A;  2KD0 A;  1Q1O A;  4HAX B;  1HB6 A;  2YS1 A;  2WX1 A;  4II3 B;  2BCJ A;  1EUV B;  5E6P A;  3B08 A;  1BT0 A;  3ZRC A;  1WE6 A;  2MBB B;  3VIA A;  3B0A A;  1OQY A;  2ROV A;  3FM8 C;  4EMO A;  2J0K A;  2XK5 B;  2I5C A;  2MBO A;  2YS3 A;  3Q3J A;  1TBE A;  4HVB A;  1UGM A;  4KSL C;  2ABD A;  2C7M B;  2L8J A;  3VVW B;  3TL5 A;  2YF0 A;  3H7S A;  2Z59 B;  2W9N A;  5DPT A;  3AU4 A;  2LG1 A;  1ISN A;  1DDM A;  5C79 A;  4PS7 A;  2NBU A;  1N3H A;  1V5U A;  1V2Y A;  2D11 A;  4WJP A;  5J18 A;  4G3X B;  4IOY X;  1GUA B;  4YL8 A;  4NPN A;  4DBG A;  1EF5 A;  1R4N I;  2IZV B;  4MGK E;  3VOQ A;  3RT3 B;  3SU8 X;  3ZTD A;  2MKR A;  2COC A;  3I3T B;  4HK2 A;  4HAZ B;  4HB2 B;  1P5T A;  4HAV B;  5E6O A;  5C1Z A;  2KLG A;  5FI1 A;  3HHM A;  4G0N B;  4MSQ B;  3PRM B;  1U2B A;  2DYQ A;  4FHK A;  1TZ1 A;  3ZTC A;  2J0M A;  4F7Z A;  4ANX A;  2MBH A;  2N9P C;  4HAY B;  3ODX A;  2N1V A;  3A9K B;  5JLJ B;  3D32 A;  1WIA A;  2JY6 A;  2VRR B;  3H7P A;  1CMX B;  2RR9 A;  3JSV B;  3JW0 X;  4BBN C;  2B3A A;  2ZPN A;  2NBW B;  3A9J A;  4Z2M B;  2LOZ A;  5G55 A;  1V5M A;  2CY5 A;  2WX0 A;  2N0Y A;  1NU2 A;  1WJM A;  3FEH A;  4GMX B;  4DX9 0;  2ZCB A;  3VTW A;  2FUH B;  4K7W A;  5EDS A;  2NZ8 B;  4KAX B;  2DZJ A;  5E6N A;  1FGY A;  1I7A A;  1XQQ A;  3RUL A;  2W2W A;  2CQU A;  2KDI A;  2N7D A;  4N9F 4;  1WX8 A;  2NVU I;  3DPD A;  3OJ4 B;  3VDZ A;  1WJ1 A;  2IY1 B;  3VTU A;  5HKH A;  2KJ6 A;  1RRB A;  3QJZ A;  4KV2 A;  2VKI A;  3UIO B;  1NDD A;  4KIK A;  3KSY A;  1V49 A;  3CF6 E;  3OLM D;  2NPT B;  4MJS A;  2FDQ A;  1K5G B;  2JWZ A;  4BKS D;  1E7U A;  3PHX B;  3DVG X;  4LJP B;  5DPR A;  5LLI A;  3V62 A;  1NTI A;  1LM8 B;  2RUK B;  2KLC A;  1KZG A;  1ZC3 B;  4HCP B;  2IBI B;  3SHQ A;  4IAP A;  1NI2 A;  4XWX A;  2LZ6 A;  3ZIM A;  4KVG B;  3VQI A;  2I1K A;  1W1D A;  4WSF A;  3RZW C;  4HWI B;  1SGH A;  1M7R A;  2FJL A;  3A1Q A;  5D7G A;  3T9L A;  2K00 A;  5JZE B;  2ZPY A;  2PEA A;  3VFK A;  3WIM A;  2DYB A;  2N4F A;  2XBB C;  1YX6 B;  5HE2 A;  4IC7 B;  1ZVR A;  2MWN B;  3NZS A;  2DFK A;  5JHH A;  2DAJ A;  4P7I A;  4IM3 A;  2HTH B;  3QAQ A;  2L2I A;  2ZNV B;  3ODW A;  2KOX A;  2Y8F A;  2COD A;  3L08 A;  5IAA C;  3TBL D;  5J2R A;  4TQ1 A;  3HIZ A;  3LJ3 A;  1U5D A;  2FCQ A;  1WGR A;  1E90 A;  4HB3 B;  2JRI B;  2DHK A;  2L0T A;  1P6S A;  1JRU A;  3JYU A;  3V6E B;  1RFA A;  4B9K A;  1R4M I;  2LRU A;  3M63 B;  3QWZ B;  2W2X D;  2CS4 A;  3KVF B;  4IM0 A;  4TV3 A;  5AZH A;  3GYO A;  4EZL A;  4IW0 A;  4IFS A;  2LXA A;  2FNJ B;  2DX5 A;  3KYC D;  3RYT A;  2GBM A;  1EAZ A;  3DXE A;  2A4Z A; 
#chains in the Genus database with same CATH topology
 2K39 A;  3AED B;  5JHB A;  2O6V B;  5J17 A;  4P1C C;  1J0G A;  2D3A A;  1JAL A;  2DZK A;  3M95 A;  4DHZ B;  3WYF B;  1M4V A;  3HK0 A;  4JKF A;  4DDI D;  1FAO A;  2GOW A;  1DDV A;  2WXK A;  2V3P A;  4C4V B;  4JPS A;  4HDQ A;  4HB0 B;  1ZC4 B;  3F5R A;  1V6E A;  1Q67 A;  1BUI C;  3UF8 A;  4ZRI A;  1YJJ A;  4LNN A;  4PNK A;  1WGK A;  1MG8 A;  2NMQ A;  3RN9 C;  1WGH A;  1E9M A;  1OQN A;  4IWQ A;  4L1R A;  1K5D B;  1E7V A;  1LGR A;  1C78 A;  4H8S A;  4B0E A;  1JWB D;  2K9X A;  1AYF A;  4JGH B;  1D5X C;  3ZKJ C;  1EM7 A;  3DXD A;  3P42 A;  2GBR A;  1W1H A;  2D9Y A;  3DBS A;  4OW0 A;  4MGY E;  1HE8 A;  3EGR A;  1ET6 A;  1Q10 A;  1WI0 A;  2KN4 A;  4KKJ A;  3GZN I;  4BKS A;  3AE7 B;  2L0F A;  4BZA A;  3BII D;  2MEK A;  2INC C;  5FR3 A;  1UWM A;  3NS8 A;  3MDB C;  5JXV A;  4A6F A;  4KHO A;  4WAA A;  2WDT B;  5C2T B;  4RF1 A;  4N58 A;  2Z8L A;  4JKH A;  1UNS A;  2V9H A;  2A5U A;  4GSW A;  3KUC B;  1MK9 B;  5E6J A;  2RNR B;  2HDE A;  2RGF A;  1QC6 A;  2ROZ B;  1DGJ A;  1E0Z A;  1ZPS A;  1KF6 B;  3P4P B;  1FD6 A;  4J3O D;  3PVL A;  2UWQ A;  3RNC C;  1XXG A;  2V0G A;  2Z0O A;  1PLS A;  4J6I A;  4MAC A;  1D3Z A;  2DYN A;  2R2Q A;  2PTL A;  2D9W A;  3BVZ A;  3GZN B;  2KXJ A;  2LI5 A;  3Q69 A;  3ENE A;  4W9J A;  5D6J B;  5GMV A;  3SFD B;  4KGR A;  4ILJ A;  4E71 A;  4JK9 A;  1H8C A;  2KUP A;  3PRE A;  1WGG A;  4YTN B;  3S2A A;  3ML8 A;  3CIK A;  1UNR A;  3HM3 A;  1MI1 A;  1MIX A;  1X1G A;  3M62 B;  3N1X C;  1E5W A;  1H4R A;  1PYW D;  3DWG C;  4MM3 A;  1EU3 A;  1K8R B;  4RGT A;  1N61 A;  4IWP A;  5EE3 A;  4IDI A;  1CK1 A;  1VD2 A;  4XWW A;  4JWS C;  2HTH A;  2NPT A;  1N6Z A;  2P8V A;  1J8C A;  4HAU B;  2RSU A;  2AQ3 B;  2L05 A;  2AQ2 B;  3Q8E A;  3RI7 C;  4ANV A;  3FLV A;  4A6F B;  3JSV A;  4BBN F;  3VTV A;  1OEY A;  2NCN A;  4DIX A;  1P0R A;  1EO6 A;  1ESF A;  5DI9 B;  2YLM A;  5HHD G;  3M1I B;  4HCN B;  1FOE A;  4MGI E;  5AZG A;  4D2K A;  3Q14 C;  3WA0 A;  4K7U A;  1F2R C;  2AYO B;  4ZYS A;  3RZF A;  2EJ8 A;  2V76 A;  5KQ4 A;  1TYG B;  1YMH E;  2JT4 B;  4WWN A;  3VH3 B;  2BYT A;  3RCZ A;  1FEH A;  2V1Y A;  1VZ8 A;  4GN1 A;  3OJ3 A;  3O13 A;  1EWC A;  1J0W A;  2W3R A;  2QC8 A;  4ZDV A;  4C0A A;  1FXT B;  3JVZ X;  2DHZ A;  3PT2 B;  2ON8 A;  2MWS B;  1I42 A;  2K5P A;  1R4M B;  1NYR A;  3BYY B;  1F1H A;  1WXQ A;  3QK0 A;  2MJE A;  1PGA A;  4MT7 A;  3BVM A;  5G5G A;  1SB3 C;  3AE6 B;  1AW7 A;  5DHA B;  3DBR I;  2Z0P A;  2I2Y A;  5G2N A;  4XC2 A;  4GDK A;  2NR2 A;  3L17 A;  2V4I B;  1QQG A;  4NJ6 A;  2MFQ A;  5C5B A;  5DCN A;  2YS5 A;  4W9K A;  3ZJT A;  1WX7 A;  1FCC C;  2KIE A;  2KMC A;  2WS3 B;  3B9J A;  4A6K A;  5J3Q A;  3P4S B;  2ELB A;  1ZGU B;  3AV8 A;  2G4S A;  2JZ3 B;  3N3K B;  3KWV A;  4CQN A;  2KGX B;  2JUO A;  3L54 A;  3NWA A;  2I1J A;  3EEC A;  2YRY A;  3TJP A;  3ZVV A;  4CHJ A;  1HTQ A;  2VSZ A;  2AWT A;  1ZUD 2;  2PVG C;  1WGD A;  5D94 A;  3IT4 B;  3DBL I;  3IHP C;  1QOF A;  3RNE C;  1XD3 B;  2EKI A;  5KQ1 A;  1MK7 B;  3AEC B;  4ZOH C;  1OTR B;  4A55 A;  3GS2 A;  4OVZ A;  1A5R A;  2FJ9 A;  2GLS A;  2KKC A;  3ZUN A;  3PEG A;  3H7P B;  5J3T A;  4QJ5 B;  5KCV A;  3ZGZ A;  4HJG E;  4US8 A;  1T5X D;  4WJ7 A;  2FAZ A;  1OQQ A;  3AE9 B;  3QA8 A;  5DHF B;  1PMS A;  1XLO A;  1RFK A;  1HZ6 A;  2X38 A;  3LYY A;  1F2R I;  4DBB A;  2UZR A;  2CB8 A;  3PLU A;  3QX1 A;  5H8Y E;  1Y8R C;  4TQ0 A;  4HSI A;  2BYE A;  1XR0 B;  1OEY J;  2BF8 B;  4W9E A;  2G9H D;  5BMI A;  4Y94 A;  2IFS A;  3PPA A;  5AEK B;  1GGO A;  1TKY A;  1OY2 A;  4JKD A;  2DYO A;  3WAP A;  2DNF A;  2WXF A;  2DKP A;  4RCO A;  2WYQ A;  4A6H A;  1GC6 A;  1I4R A;  2KMM A;  2W2X C;  3NVZ A;  2IYD B;  2L76 A;  3SV1 A;  4RF0 A;  3LXF A;  5HE3 A;  3U7D A;  2RQ1 A;  3DCX A;  3PLV A;  4UDU C;  1QOB A;  3IG3 A;  1I4P A;  2KX3 A;  3EHV A;  2BVC A;  3AXC A;  3AE2 B;  3IAS 1;  2DA0 A;  3N7C A;  1YIW A;  3HW2 B;  1E6E B;  2H7E A;  5LXI B;  4TMA B;  1VRA B;  3PVW A;  2W55 A;  4IOI E;  3ZNH B;  2KWC A;  1T77 A;  2G1E A;  3A9J B;  1LW3 A;  1TQZ A;  3AE5 B;  5D27 A;  3AEA B;  5BO4 B;  3AU5 A;  3Q8C A;  3W5V B;  4PK1 A;  5JHA A;  3MJ5 A;  1P3Q U;  4NAW B;  1N60 A;  2MRP A;  4YTM B;  1DOY A;  3PVU A;  5I2S A;  3NY5 A;  5CLL B;  2COP A;  2MCN B;  3U52 E;  2KQ4 X;  4XE0 A;  1GB4 A;  4FN2 A;  1WR1 A;  1HZ5 A;  2KAC A;  1WE6 A;  3H8H A;  3VIA A;  3B0A A;  3ENB A;  1ENF A;  1OQY A;  2J0K A;  4GNK B;  1UGM A;  2WU2 B;  2ABD A;  3NJT A;  2L8J A;  2Z4D A;  4EE2 A;  2YF0 A;  1SE4 A;  3AU4 A;  1DDM A;  4YSX B;  3OG5 A;  1FO4 A;  1N3H A;  3BYT B;  2N9K A;  4IOY X;  2R61 A;  4YL8 A;  3HVD A;  5EE1 A;  3RT3 B;  2COC A;  1K52 A;  4RGM A;  1JWA D;  4LK0 M;  1KLU D;  4MSQ B;  1JWU D;  3PRM B;  2DYQ A;  2MBH A;  2ONQ A;  2JY6 A;  2VRR B;  1CMX B;  3N20 C;  1J7C A;  2ZPN A;  2KAJ A;  4Z2M B;  5G55 A;  2R82 A;  2CY5 A;  2N0Y A;  1NU2 A;  1C79 A;  3VTW A;  1FGY A;  1T6B X;  3RUL A;  2KDI A;  2NVU I;  3DPD A;  2IY1 B;  1SE3 A;  5HKH A;  1IGC A;  3QJZ A;  4TSS A;  1V49 A;  3CF6 E;  2GRI A;  2NPT B;  4L1B A;  4MJS A;  1E7U A;  3DVG X;  4LJP B;  3VR9 B;  2RDH A;  3V62 A;  1LM8 B;  1ZC3 B;  2IBI B;  4KVG B;  1V1P B;  1M7R A;  3A1Q A;  2K00 A;  3IXS A;  2XBB C;  4IC7 B;  1ZVR A;  2MWN B;  2DWQ A;  3NZS A;  5C3J B;  2LGI A;  3QAQ A;  2ZNV B;  3L08 A;  2Y8F A;  2MHJ A;  1N5X A;  2FCQ A;  4HB3 B;  2DHK A;  1P6S A;  3M63 B;  2W2X D;  2FJU B;  1ZP0 B;  2FE8 A;  2FNJ B;  3RYT A;  2IDY A;  2MJ3 A;  2IGG A;  3DXE A;  1L4Z B;  2K49 A;  1WR6 E;  2KX0 A;  2E2X A;  2KN5 A;  1V5P A;  2BB6 A;  5LG4 B;  2QIE B;  1VR9 A;  5HE0 A;  4E74 A;  2LAS A;  3F0W A;  4X57 B;  3BIN A;  3SEB A;  2RGN B;  3N32 A;  1TT5 B;  2KT7 A;  4IKG A;  4MT5 A;  4MH0 E;  1KJT A;  1RYJ A;  2FCM A;  3ZDM C;  3PGE A;  1MAI A;  2YEP F;  4OZC A;  1UD7 A;  3B77 A;  4F7U P;  2FIF A;  2MP2 A;  2YT0 A;  2M19 A;  4EUT A;  2NMB A;  4NQL B;  3WAN A;  4FJY A;  2M17 A;  2MLB A;  4G11 A;  1KRH A;  2KC2 A;  2DKQ A;  1WJ4 A;  2W82 A;  2IJ0 A;  3RPF C;  4RM9 A;  3UGB B;  2BWE S;  2P0H A;  1VJK A;  4KHB B;  2G35 A;  1AWD A;  3BY4 B;  5D2M B;  5C23 A;  3ZO5 B;  4CO7 A;  3RNF C;  1X86 A;  3ZNG C;  5L83 A;  5H92 C;  2GI9 A;  3PSE B;  1XOD A;  2J59 M;  5CHW A;  2JP2 A;  4FJZ A;  1KI1 B;  3D8D A;  3ML4 A;  3FSS A;  1UZX B;  1LO5 D;  3GOE A;  2L7R A;  2BTE A;  1YQ3 B;  5FR6 A;  1SBB B;  3Q8B A;  1IRS A;  3TEZ A;  1BAK A;  4ITK A;  1MKE A;  2VH2 A;  3U4E G;  4C56 C;  1D4B A;  2R0D A;  2DHI A;  1DIK A;  1MFW A;  4JQW C;  3RD2 A;  4K3B A;  2PZ1 A;  1JCK B;  2H7D A;  4JX1 C;  1V61 A;  3RCP A;  2FCN A;  3SNH A;  3E9S A;  4IM2 A;  5CTR C;  2BYF A;  5C16 A;  1F9J A;  1B9R A;  2LJI A;  5DH9 B;  4K7S A;  1P9D U;  2RMM A;  2CJN A;  1J7A A;  3CSF A;  1ZDX A;  2D3G A;  3EPY A;  3L10 B;  1FHO A;  5IP4 D;  2HE7 A;  1V5O A;  2Y5B B;  3N30 A;  4BBN C;  2WGS A;  2X18 A;  3DVG Y;  1UPQ A;  4ILH A;  3LJU X;  2DX5 B;  5M4Y B;  2KDB A;  3QAR A;  1VBH A;  2FID A;  4BAX A;  4PQ0 A;  2CRF A;  2G4D B;  3IFW B;  4OT1 A;  1KZ7 A;  2KFJ A;  1HEZ E;  4XX5 A;  3AM9 A;  5JP4 A;  4YSY B;  3ALB A;  1KM7 A;  1J19 A;  1ACC A;  1IBX B;  3C8Y A;  4C7Z A;  4CSQ A;  1FM0 D;  1ZKH A;  1ZXH A;  4P6V F;  2V3S A;  2K25 A;  2K2U A;  3KH0 A;  3RNB C;  2M1M A;  5FK9 C;  4RM8 A;  1XLP A;  2W54 A;  4MM3 B;  2PVO D;  3NVY A;  1FMA D;  5MPO A;  2ZVN A;  1R4N B;  3TUO A;  4LCD E;  3MTN B;  3NWD A;  5GXG B;  2WXO A;  3U8Z A;  4QJ4 B;  4L23 A;  5AZF A;  4KDL B;  3LB8 C;  2KYW A;  1XX0 A;  2LJ5 A;  3DVN U;  3FP5 A;  2D3C A;  4A90 A;  2M56 B;  1V9J A;  2CHX A;  1ZOY B;  2PE6 B;  3DVN V;  2GCL A;  1YD8 U;  3QQ8 B;  4AP4 C;  3NHE B;  2N9L A;  1V97 A;  2WDR B;  1QIL A;  2EMS A;  2BKR B;  3DCG A;  2MBQ A;  2CU1 A;  2MW5 A;  3W2D A;  2KDE B;  4WQM A;  2HRJ A;  3KUZ A;  3ZYY X;  4EZK A;  4EJN A;  4W9I A;  3EA6 A;  3ECI A;  1PGB A;  2VRW B;  1WE7 A;  3SD5 A;  1N5W A;  1WJU A;  2GBN A;  1Y5O A;  1C4A A;  1A70 A;  3VUY A;  5IJM A;  1YJI A;  3T3N A;  4I6L B;  2UYZ B;  4D6W A;  1PDX A;  4JIO U;  1WF9 A;  1U27 A;  1V8C A;  3N1Y C;  4HLE A;  4KDI C;  1E8Z A;  5JHG A;  3GP7 A;  2WHI A;  2O6V D;  1V86 A;  2K8B A;  1TGZ B;  4F7H A;  2CHW A;  2OED A;  2KDM A;  1NI3 A;  4XGA B;  2OQB A;  3PS6 A;  3A4R A;  3P4Q B;  2RVB B;  3R8B A;  1LB1 A;  2TSS A;  2EKE C;  1XCG A;  1DBH A;  3Q8F A;  3AE8 B;  3ULC A;  4MEL A;  1V81 A;  5C5B B;  3C0R B;  2KJH B;  3RFZ B;  1U5F A;  2KO3 A;  1F52 A;  3URY A;  3IVF A;  3A33 B;  4HDO A;  2KTF A;  5I2M A;  3PZ7 A;  2KQ7 A;  1V1O A;  1K50 A;  4ICV A;  5D3X A;  1WSP A;  3QCA A;  4A3P A;  5JVL A;  3P1M A;  2Z0D B;  2COA A;  2JPH A;  4NAM A;  1LFD A;  1WXA A;  4KGT A;  2B76 B;  1Q0W B;  1YQ4 B;  2LGX A;  4DXG A;  3Q3O C;  2DEN B;  3KYD D;  2BT6 A;  2D2Q A;  4JKG B;  2ZJD A;  1UEF A;  1EGX A;  1TS4 A;  1JWM D;  1U5E A;  1QZE A;  4DXF A;  3ML9 A;  3TW1 A;  1BXT A;  1HXY D;  1PQS A;  4US9 A;  3HIE A;  2LBB A;  3SYX A;  2XQN M;  2MX2 A;  2LGY A;  3NVV A;  2J53 A;  1SJH D;  2M0X A;  2ZVO A;  3ZNI D;  1D5Z C;  1C1Y B;  4WJO A;  2KIG A;  2Z0Q A;  4FJV B;  2KTR B;  4NJC A;  2OJR A;  1IBX A;  3VXW A;  2JQR B;  4BOZ B;  3Q8A A;  4GMV A;  4AWJ A;  2CR5 A;  4MGZ E;  4ZYN A;  2BGF A;  3TFM A;  3MJW A;  3G9W A;  1TS3 A;  4LDT D;  3UQA A;  2GMI C;  1SF0 A;  4AS1 A;  1BTN A;  3TIX A;  1T0S C;  2L83 A;  3FVC A;  2REX A;  4D0N B;  3SDL C;  3ULB A;  1VDV A;  1T0Q C;  1M7E A;  1D6E C;  3SBT A;  2WWZ A;  2UVM A;  4W9D A;  3AE4 B;  1RJ2 A;  2QMT A;  1IPG A;  1P98 A;  2K1F A;  5BYQ A;  2KFK A;  3NZU A;  1ST7 A;  1T0R C;  5L81 A;  2SEB D;  4BKT A;  3RNA C;  1WXM A;  2AL3 A;  3C19 A;  4HAX B;  1C77 A;  2BCJ A;  1TY0 A;  3B08 A;  4EMO A;  2I5C A;  2MBO A;  2YS3 A;  1TBE A;  4XWT A;  4DQO C;  3VVW B;  3TL5 A;  2Z59 B;  1I4H A;  1ISN A;  1TKG A;  2NBU A;  5J18 A;  1GUA B;  3E9O A;  3NWF A;  1EF5 A;  4N6E B;  1QF6 A;  2MKR A;  4HAZ B;  4HAV B;  5C1Z A;  3NS1 A;  3HRD D;  4G0N B;  1TKE A;  2IPK D;  3P4R B;  2N7J A;  4FHK A;  3ZTC A;  2J0M A;  5G5H A;  1HQR D;  4C80 A;  3ODX A;  1UGJ A;  3A9K B;  5TSS A;  3D32 A;  1WIA A;  3H7P A;  4KKI A;  1EU4 A;  2B3A A;  2PW9 A;  1XO3 A;  3A9J A;  2LOZ A;  1V5M A;  4DX9 0;  2Z13 A;  2ZCB A;  2YT2 A;  2FUH B;  4K7W A;  4KAX B;  3Q3M C;  2W2W A;  4WWM A;  1WX8 A;  3OJ4 B;  3VTU A;  1WJ1 A;  3AE3 B;  2KJ6 A;  4KV2 A;  2VKI A;  4KIK A;  3KSY A;  3A58 A;  2FDQ A;  2JWZ A;  4BKS D;  3PHX B;  5LLI A;  5DPR A;  2RUK B;  2Z14 A;  4HPP A;  1NI2 A;  2PKO A;  3RZW C;  4HWI B;  5JZE B;  2KR0 A;  4RGN A;  2PLP A;  3WIM A;  1EWY C;  5IN7 A;  2JSV X;  3MHZ A;  3NZ3 A;  2DAJ A;  4P7I A;  4YSZ B;  3TBL D;  2COD A;  2YEP B;  2ZW1 A;  5J2R A;  3FAH A;  3HIZ A;  3LJ3 A;  1MHX A;  1WGR A;  2JRI B;  4ARI A;  3V6E B;  1RFA A;  1R4M I;  3KVF B;  2LHE A;  2E6X A;  5D3I B;  5AZH A;  4L2Y A;  3GYO A;  4IFS A;  4OZA A;  2DX5 A;  1TS5 A;  2WNM A;  4JKC A;  2AX5 A;  3R3M A;  4HAT B;  4M01 A;  2K8H A;  3PTF C;  2GCJ A;  3KUD B;  1KOT A;  1I4Q A;  3ONS A;  3U2S C;  4ASW C;  5IOI A;  4YT0 B;  5CX3 A;  2LVQ A;  1HB8 A;  1WYG A;  4OHJ A;  3DHI C;  1YJ1 A;  1VLB A;  3N9Y C;  1WWT A;  1L7Y A;  3RNG C;  2MBE A;  2J42 A;  3NG0 A;  3P63 A;  3TCA A;  3X0W A;  4EKU A;  3APF A;  1WM2 A;  2D07 B;  3HVZ A;  1P7F A;  2LGS A;  2K0P A;  3D8F A;  2CHZ A;  5GOW B;  3B2F A;  4EOY A;  4RMA A;  3ZQ4 A;  2KZR A;  2KNB A;  2KVZ A;  3A1Q B;  1UBQ A;  1KC7 A;  1GNU A;  3WAL A;  2MDX A;  5FKA C;  2JF5 A;  2DIK A;  1WG7 A;  1D5M C;  1NYQ A;  1UUP A;  1ACA A;  1AAR A;  4M8N A;  2GS0 A;  2MSE D;  4C00 A;  1FXA A;  2JX5 A;  1K53 A;  1GB1 A;  4PYU A;  3ZVR A;  1Q5W B;  4RFB A;  2IO0 B;  2FCS A;  1P7E A;  3W5U B;  4NNJ B;  3KZ1 A;  4E3C A;  2RD0 A;  2PE9 A;  1S3S G;  1JWS D;  1WGY A;  3SFE B;  5BYS A;  3R7R A;  4HHV A;  3R66 C;  1GPX A;  2JVC A;  3VAW A;  2XN9 C;  2L00 B;  4TUU A;  2C9W B;  1G6J A;  3ZW3 A;  4HKQ A;  1KLG D;  2KCJ A;  1TJE A;  2MH7 A;  2N7E A;  1QLB B;  2KK8 A;  3TEX A;  1U5G A;  2Z59 A;  3FIL A;  2JZZ A;  1HA5 A;  1LXD A;  1V80 A;  4ICU A;  4M8M A;  3VHT C;  3V05 A;  2YVC A;  1ZXI A;  4AUQ C;  2J7Q B;  4QJ3 B;  2PIA A;  2OOB B;  2Z0E B;  4FBJ B;  2EMT A;  1E8W A;  4JWU C;  3V3X A;  4OZB A;  2RRF A;  3ODO A;  3TO1 A;  3U30 A;  3N1Z C;  2KC1 A;  4GU2 A;  2ACZ B;  3CMM B;  2PPH A;  2HTM E;  1VBG A;  4NY0 A;  2Y5P A;  3PHW B;  4AOF A;  1C9F A;  1CZP A;  4IWO A;  4Z2N A;  2DX1 A;  1WXS A;  1YX5 B;  2EEL A;  4YTP B;  3UZT A;  3EUB 2;  4RH6 A;  4F7G A;  3UIN B;  4WH4 A;  2HJ8 A;  5JH5 C;  4GOU A;  1TZO A;  1YQB A;  2QEJ C;  1JDE A;  2KJR A;  3HQC A;  3EC8 A;  3TEW A;  1SHC A;  3OAN A;  2BPS A;  3DBH I;  1YN5 A;  1UPR A;  5EE9 A;  2O2V A;  4HXD A;  4JK7 A;  2K8C A;  1QOA A;  2LVP A;  1XCQ L;  2LHD A;  4YXD B;  1FNW A;  2DHJ A;  3K9P B;  3W1Y A;  3L16 A;  2BS3 B;  2KQS A;  4MSM B;  1I35 A;  4JKE A;  5D3W A;  4RGO S;  1XKE A;  2WDV B;  2WXM A;  5IKC M;  2RPQ A;  3E66 A;  4GZU A;  1I4G A;  3L0W B;  3GE3 C;  3ZDT A;  4YWG G;  2GBJ A;  4ZHP A;  5KHQ A;  4BKG A;  3KLS X;  1PUT A;  2I5F A;  3BZD B;  4DHJ B;  3SUZ A;  2DLW A;  1AWE A;  2KMA A;  1XLQ A;  4I6N B;  4KHB A;  4S17 A;  2JYE A;  2QCZ A;  2D9Z A;  4KIK B;  3Q3F A;  3NSU A;  3UIP B;  3AEF B;  2QKL A;  1WZ3 A;  2LEK A;  1N63 A;  4W9C A;  1KH0 A;  3FKY A;  5HFY A;  2X0S A;  1EVH A;  2INN E;  2V3N A;  1ROE A;  3PZD A;  2ZCC A;  2JXX A;  4LDT B;  4PS3 A;  2IO1 B;  4JL9 A;  2CAY A;  1UNP A;  1ZW7 A;  2M38 A;  1WM3 A;  5EFX A;  2BKF A;  3RMK C;  1MVK A;  2AL6 A;  4A8X C;  3AJ4 A;  1TTN A;  1FGZ A;  2WDQ B;  3WAM A;  2BQQ A;  1V88 A;  5T8I A;  1FHW A;  4AQ7 A;  1X05 A;  1H10 A;  2IO3 B;  3TVV A;  1Y19 B;  3KRX A;  4WJN A;  3VUX A;  2L1A A;  3UI3 A;  4LTU A;  3W1S A;  1C76 A;  2KAN A;  2IO2 B;  3PG7 A;  2CJO A;  2BBC A;  1DRO A;  1WX9 A;  1SXT A;  4IG7 B;  1L5P A;  1WYW B;  2C7N B;  3Q3N C;  2KVR A;  1FRR A;  1UBI A;  3A9K A;  4PYZ A;  4HPL B;  3APD A;  1NEK B;  2AEH A;  4KZ0 A;  2G45 B;  1DOX A;  3DDC B;  4LNO A;  2O2V B;  4KHA A;  4URK A;  2BB5 A;  1VZ7 A;  4CHM A;  1I4X A;  2OTX A;  1FNU A;  3AEG B;  2N23 A;  2CKH B;  4HRO A;  3R7Q A;  2C60 A;  4ANU A;  4HAW B;  4WQO B;  3V61 A;  3ZNZ B;  2K8E A;  1MG4 A;  4K17 A;  4II2 B;  3NOB A;  1SE9 A;  3BJI A;  1V1P A;  2D3B A;  2XNA C;  4C7Y A;  1ZSQ A;  3I57 A;  3M3J A;  4FUL A;  1HBK A;  1QKZ A;  3KQ4 A;  1KBL A;  3AEE B;  2GB1 A;  1YOV B;  4WIP A;  2JRH A;  4REZ A;  2I38 A;  5CHV C;  3ZRF A;  1ET9 A;  3E56 A;  2QKM A;  4GXB A;  1SIF A;  2DYM A;  4WVF B;  2LFI A;  3I63 C;  2INP E;  2L52 A;  4DX8 A;  1WJ6 A;  2FUG 1;  1OFF A;  3KRW A;  2LWP A;  1RLF A;  4OVV A;  1ZE3 D;  5HE1 A;  1B1Z A;  2KWV B;  1X1F A;  5CLQ B;  2WQY B;  4WJQ A;  2K6D B;  2MA9 B;  4HKZ E;  1T0Y A;  2JWU A;  4DXA B;  2YT1 A;  3X23 A;  1WH3 A;  3WAO A;  1UH6 A;  3DBR B;  3MFG A;  1MPH A;  2ASQ A;  1HTO A;  5J3Y A;  2ZNV C;  4BFR A;  1JRP A;  4M0W B;  4WWP A;  4PT5 A;  2W3S A;  3OAW A;  2CU3 A;  4GGQ A;  3SO6 A;  3ZJU A;  4DHZ E;  5LON B;  2WXI A;  3U12 A;  3BK2 A;  2LKO A;  4ILG B;  3SBG A;  4W9L A;  4A5K A;  2D10 A;  2DN6 A;  2BS2 B;  4MDK E;  4DHJ D;  3AE1 B;  4MY6 A;  3MHS D;  2D9X A;  2M4N A;  1C3T A;  4I6P A;  3DBH B;  3D8E A;  5FI0 A;  3LDZ E;  3O96 A;  1WMH A;  4FXC A;  3DQV A;  1Q1O A;  2YS1 A;  2WX1 A;  3E9L A;  1BML C;  1SSN A;  1BT0 A;  2MBB B;  2WXN A;  3Q3J A;  4HVB A;  2C7M B;  2RDB C;  5DPT A;  2DBY A;  1C4P A;  1V5U A;  1V2Y A;  2D11 A;  3DWM A;  4G3X B;  2MJD A;  4NPN A;  3SU8 X;  3VOQ A;  5IRS A;  4OSN A;  3I3T B;  1FPY A;  5E6O A;  1QQR A;  2KLG A;  5FI1 A;  3HHM A;  2QSD A;  3VRA B;  1YN3 A;  1IUE A;  2WXR A;  1UWX A;  4HAY B;  4NZL B;  2OHF A;  1JRO A;  3JW0 X;  2RR9 A;  2NBW B;  4LNF A;  2WX0 A;  4USA A;  3FEH A;  1WJM A;  4GMX B;  1FFV A;  5E6N A;  4XYC A;  1XQQ A;  2CQU A;  3VRB B;  3VDZ A;  4C4V A;  1SJE D;  3UIO B;  1NDD A;  3OHM B;  3OLM D;  1YN4 A;  1NTI A;  2WU5 B;  4XWX A;  2LZ6 A;  3ZIM A;  3VQI A;  2KWD A;  1SGH A;  2FJL A;  5D7G A;  3T9L A;  2PEA A;  3VFK A;  1YNT E;  1F0Z A;  4M0W A;  2DFK A;  5JHH A;  2NBV A;  1ZDV A;  2HTH B;  5IAA C;  4TQ1 A;  1L0X B;  5AUI A;  3IT6 B;  4B9K A;  2L32 A;  2LRU A;  2LUM A;  3QWZ B;  3FC4 A;  2CS4 A;  1Y56 A;  3MC8 A;  2VH1 A;  1EAZ A;  4LJO B;  2BYV E;  3A8P A;  3R2T A;  2WXG A;  1IP9 A;  2K2J A;  3QIJ A;  1MIZ B;  3H9D A;  2P0F A;  5D3Y A;  2XEW A;  4GDL A;  3NRZ A;  5D3D A;  2QJL A;  1IYF A;  1NBF C;  2N9E B;  2WXQ A;  1NTV A;  4A20 A;  1V5T A;  2J0J A;  2LMC A;  3EFU A;  4KSK C;  1E8Y A;  1FXI A;  2D5G A;  2PJH A;  3VUW A;  2DZM A;  2ICI A;  3PZ8 A;  3DBL B;  1GC7 A;  3ABV B;  2KDF B;  1BTK A;  5L95 C;  3L13 A;  1FHX A;  3KW5 B;  2EC1 A;  4FHJ A;  4FAD A;  4HB4 B;  4EZJ A;  5TR5 A;  1C4C A;  2RLO A;  3ETR A;  2IGD A;  1UEL A;  3MPX A;  2Y7B A;  4MEM A;  4WWO A;  4F1S A;  1MHH E;  1TXD A;  4B6H A;  3MC9 A;  3PRZ A;  4K81 A;  4ANW A;  5D3V A;  4B0M A;  3AEB B;  2M0A A;  5C6R A;  1PFD A;  4JE3 B;  2E3T A;  1Z5S B;  2ZEQ A;  1FRD A;  4GOC A;  2VZK B;  3PO0 A;  4HPM B;  4QAY A;  4BOS C;  4JKG A;  5LXH A;  1WZ0 A;  1B55 A;  4M02 A;  1E8X A;  1F77 A;  3BVG A;  2NTS A;  4NQK E;  4XZ4 A;  5LNK 1;  2J52 A;  2Q13 A;  2WXH A;  4AJW A;  2RPV A;  1UNQ A;  1L2N A;  4MK0 A;  1I2H A;  2Y3A A;  4ZRJ A;  1L0Y B;  5BMH A;  3E9P A;  3H6N A;  4LLG M;  4TKN A;  5DPS A;  3Q6B A;  4W9H A;  1AQC A;  1FIQ A;  2NTT A;  1S1Q B;  2GJY A;  3VR8 B;  1CQV A;  2UZS A;  4DWF A;  4FA6 A;  1WMH B;  2QHO A;  1R7S A;  2N9X A;  4XDD A;  1EF1 A;  4BBK A;  5IA7 A;  2JU6 X;  1M94 A;  1ZYI A;  5AUK A;  1WRI A;  3QWM A;  2KTR A;  5HG2 A;  1NVL A;  4K2O A;  2ELA A;  2K22 A;  4FLH A;  1IGD A;  3AMZ A;  3W9C B;  1BWN A;  3T8M A;  4NAW A;  2JZP A;  2J4X A;  3GE8 C;  4AJY B;  1MJD A;  3W1S C;  2SAK A;  3DOW A;  3A98 B;  1SIJ A;  1FB8 A;  1RWS A;  2FBW B;  4O1N A;  3BWU D;  5IO9 A;  1FCL A;  2YSZ A;  5KHO A;  4B6W A;  2LGD A;  1XLN A;  4P16 A;  4ZHO A;  4QXA B;  5CHF A;  2KFK B;  3DHG C;  3I5J C;  2P0D A;  1P3R A;  5EE0 A;  1OQR A;  5I4D A;  4A9A A;  1T3Q A;  4HEA 1;  3L4P A;  3HSA A;  1Z2M A;  2PMV A;  3FIL B;  2LOX A;  3CST A;  3CWI A;  3PV1 A;  1VCB A;  2R2Y A;  2LUL A;  3B1L X;  3V60 A;  4LNI A;  3K9O B;  3SR6 A;  2M14 A;  2IND C;  3MP9 A;  2RDG A;  4H2A A;  2L1C A;  4W9G A;  1TY2 A;  4JLC A;  3TSS A;  2WH5 A;  4HRS A;  2CY4 A;  3TEY A;  4GDK B;  3QHT A;  3PP2 A;  3HUI A;  2BWF A;  4WAF A;  1X11 A;  2AQ1 B;  1WRD B;  2HJ1 A;  3WCQ A;  3OWE B;  3QC8 B;  3P6A A;  1W1G A;  4GB9 A;  1JML A;  3A4S C;  2G3Q B;  3AUL A;  1DYQ A;  2XK5 A;  2BW2 A;  1OMW A;  4KZC A;  3ZJV A;  2ZKM X;  1WI1 A;  2GUM A;  2L3Z A;  3P7Z A;  4NSW A;  1MI0 A;  4IUM B;  1WY8 A;  3HM6 X;  3UQB A;  2H89 B;  1I7H A;  2V4L A;  4DK5 A;  4G50 A;  1RAX A;  4EEW A;  2C7H A;  2M8S A;  2Y8G A;  2NBV B;  3GYP A;  3DXC A;  3AI5 A;  1PGX A;  2R2O A;  4MH8 A;  4GIV A;  4MJS B;  1WGU A;  2ZW0 A;  1P1A A;  3U7Z A;  2LD9 A;  1J7B A;  2DLB A;  2WP9 B;  1WFY A;  3H1U A;  3O65 B;  1L6V A;  2QIL A;  4ACF A;  3QBV B;  3T06 A;  2WLB A;  2MQJ A;  2COF A;  2MP2 B;  3EFC A;  4F8C B;  4GPT B;  4GDL B;  4S0R A;  4GLS C;  5LOP B;  2JXT A;  2WXP A;  1DDW A;  1WGQ A;  1JQ4 A;  4YON A;  2LVO A;  2LYD A;  2LRW A;  2LUE A;  1V89 A;  1ZM0 A;  1E10 A;  3A8Q A;  1KTK A;  2K3U A;  4A3O A;  4B95 A;  1U29 A;  4JKB A;  3KY9 A;  2WXJ A;  3RUI B;  3ZXV A;  3AN1 A;  1L6U A;  1LQB A;  3IBE A;  1XT9 B;  2R09 A;  4P1B C;  4BVU C;  1U4A A;  1GG3 A;  5DIF B;  3KWL A;  1RRP B;  4HJK A;  4ZRQ A;  5BMG A;  2ADZ A;  3APC A;  4CYE A;  1Z87 A;  3R2I A;  1XF5 L;  4CHK A;  1TS2 A;  2GBK A;  2IYB A;  2D4Q A;  2UU7 A;  2KHW B;  2O6V A;  3B2G A;  3CIR B;  4JKA A;  4EFO A;  3GB1 A;  3NVW A;  1L4D B;  3PRP B;  2N1W A;  3AB5 A;  1TIF A;  2DAF A;  2ZZP B;  1SEB D;  1DYN A;  2NS5 A;  2IY0 B;  3Q2A C;  3NUH B;  1DOI A;  3NW8 A;  2Q5W D;  4L6E A;  2N0S B;  4OVU A;  3PSC A;  4TYZ A;  4M00 A;  1KLV A;  4NJ7 A;  2K6Q A;  2LXC A;  5BYR A;  1QT9 A;  2C5L C;  4K2P A;  2OJW A;  1K51 A;  1OGW A;  1WXV A;  2HD5 B;  3VH4 B;  2JYT A;  2H88 B;  2KWU B;  4K1R B;  4R3D A;  4ARC A;  5DPW A;  1WJN A;  4PS8 A;  1XD4 A;  1NTY A;  1TJ6 A;  2Y5C A;  3BK1 A;  3V5W A;  1L0V B;  2VZK D;  4Q2J A;  3P2B A;  1PFJ A;  4RNA A;  1GJZ A;  1X1M A;  3CXB B;  1KFY B;  2RSG A;  2D9V A;  4DDG D;  4ZRK A;  3ZLZ A;  2DTC A;  3V6C B;  4XDC A;  3TMP B;  1WVH A;  4W9F A;  2DZI A;  2KD0 A;  1HB6 A;  4II3 B;  1EUV B;  5E6P A;  1NEN B;  3ZRC A;  1SE2 A;  4ZRP A;  2ROV A;  3FM8 C;  2XK5 B;  4KSL C;  3H7S A;  1NVI D;  2W9N A;  3AH7 A;  2LG1 A;  4LNK A;  4PS7 A;  5C79 A;  3ZXR A;  4WJP A;  4JK8 A;  1STE A;  1XCT L;  4DBG A;  1R4N I;  2IZV B;  4MGK E;  3ZTD A;  1GOZ A;  4HK2 A;  3T3O A;  4HB2 B;  4KX6 B;  1P5T A;  1U2B A;  1TZ1 A;  4F7Z A;  4ANX A;  2N9P C;  2N1V A;  5JLJ B;  3JSV B;  4KGS A;  1UF0 A;  4A6Q A;  5EDS A;  2NZ8 B;  2DZJ A;  3MC0 B;  1I7A A;  1VZ6 A;  4N9F 4;  2N7D A;  2X8X X;  1QOG A;  2IGH A;  1RRB A;  1AN8 A;  1E7P B;  2WXL A;  1K5G B;  3J9C A;  4N59 A;  2KUQ A;  5HI1 A;  4HCP B;  2KLC A;  1KZG A;  3SHQ A;  4WUR A;  4IAP A;  2I1K A;  1W1D A;  4WSF A;  2BS4 B;  2ZPY A;  2DYB A;  2N4F A;  4K3C A;  1YX6 B;  2QDF A;  5HE2 A;  1FFU A;  1GAQ B;  4IM3 A;  1MPE A;  3IAM 1;  2L2I A;  3DHH C;  3ODW A;  2KOX A;  3I9V 1;  1U5D A;  1N62 A;  1E90 A;  2L0T A;  3JYU A;  1JRU A;  1XEE A;  4IM0 A;  4TV3 A;  1RM6 C;  4EZL A;  4IW0 A;  1JW9 D;  3KYC D;  1CJE A;  2LXA A;  2GBM A;  1FNV A;  2A4Z A; 
#chains in the Genus database with same CATH homology
 2K39 A;  5JHB A;  2O6V B;  5J17 A;  1J0G A;  2DZK A;  3M95 A;  4DHZ B;  3WYF B;  3HK0 A;  4JKF A;  4DDI D;  1FAO A;  2GOW A;  1DDV A;  4HDQ A;  4HB0 B;  1ZC4 B;  3F5R A;  1V6E A;  1Q67 A;  3UF8 A;  4ZRI A;  4PNK A;  1MG8 A;  1WGH A;  1OQN A;  4IWQ A;  1K5D B;  1E7V A;  4H8S A;  4JGH B;  3ZKJ C;  3DXD A;  2GBR A;  1W1H A;  2D9Y A;  3DBS A;  4MGY E;  1HE8 A;  1WI0 A;  3GZN I;  4BKS A;  2L0F A;  3NS8 A;  3MDB C;  4A6F A;  4KHO A;  4WAA A;  2WDT B;  4JKH A;  2A5U A;  4GSW A;  3KUC B;  1MK9 B;  2RNR B;  2RGF A;  1QC6 A;  2ROZ B;  3PVL A;  2UWQ A;  2Z0O A;  1PLS A;  4J6I A;  1D3Z A;  2DYN A;  2R2Q A;  2D9W A;  2KXJ A;  2LI5 A;  3ENE A;  4W9J A;  5D6J B;  5GMV A;  4ILJ A;  4E71 A;  4JK9 A;  1H8C A;  2KUP A;  3PRE A;  1WGG A;  3S2A A;  3ML8 A;  3CIK A;  1UNR A;  3HM3 A;  1MIX A;  1X1G A;  3M62 B;  1E5W A;  1H4R A;  4MM3 A;  1K8R B;  4IWP A;  1VD2 A;  2HTH A;  2NPT A;  2P8V A;  1J8C A;  4HAU B;  2RSU A;  2L05 A;  4ANV A;  3FLV A;  4A6F B;  3JSV A;  4BBN F;  3VTV A;  1OEY A;  2NCN A;  1P0R A;  1EO6 A;  5DI9 B;  2YLM A;  3M1I B;  4HCN B;  1FOE A;  4MGI E;  5AZG A;  3WA0 A;  4K7U A;  2AYO B;  3RZF A;  2EJ8 A;  2V76 A;  5KQ4 A;  2JT4 B;  4WWN A;  3VH3 B;  3RCZ A;  2V1Y A;  4GN1 A;  3OJ3 A;  1J0W A;  4ZDV A;  4C0A A;  1FXT B;  3JVZ X;  2DHZ A;  3PT2 B;  2MWS B;  1I42 A;  3QK0 A;  4MT7 A;  5DHA B;  3DBR I;  2Z0P A;  5G2N A;  4XC2 A;  4GDK A;  2NR2 A;  3L17 A;  1QQG A;  4NJ6 A;  2MFQ A;  5C5B A;  5DCN A;  2YS5 A;  4W9K A;  1WX7 A;  2KMC A;  4A6K A;  5J3Q A;  2ELB A;  1ZGU B;  2G4S A;  2JZ3 B;  3N3K B;  2KGX B;  2JUO A;  3L54 A;  3EEC A;  2I1J A;  3ZVV A;  2YRY A;  3TJP A;  4CHJ A;  2VSZ A;  2AWT A;  5D94 A;  1WGD A;  3DBL I;  3IHP C;  1XD3 B;  5KQ1 A;  1MK7 B;  1OTR B;  1A5R A;  2FJ9 A;  2KKC A;  3ZUN A;  3PEG A;  3H7P B;  5J3T A;  5KCV A;  4WJ7 A;  2FAZ A;  3QA8 A;  5DHF B;  1PMS A;  4DBB A;  2UZR A;  2CB8 A;  3PLU A;  3QX1 A;  1Y8R C;  4TQ0 A;  2BYE A;  1XR0 B;  1OEY J;  2BF8 B;  4W9E A;  4Y94 A;  2IFS A;  3PPA A;  5AEK B;  1GGO A;  1OY2 A;  4JKD A;  2DYO A;  3WAP A;  2DKP A;  2WYQ A;  4A6H A;  1GC6 A;  2W2X C;  2IYD B;  2L76 A;  3SV1 A;  5HE3 A;  3U7D A;  2RQ1 A;  3PLV A;  3IG3 A;  2KX3 A;  3EHV A;  3AXC A;  2DA0 A;  3N7C A;  1YIW A;  3HW2 B;  2H7E A;  5LXI B;  3PVW A;  3ZNH B;  2KWC A;  3A9J B;  1LW3 A;  1TQZ A;  5D27 A;  5BO4 B;  3AU5 A;  5JHA A;  1P3Q U;  4NAW B;  2MRP A;  3PVU A;  3NY5 A;  5CLL B;  2COP A;  2MCN B;  4FN2 A;  1WR1 A;  1WE6 A;  3VIA A;  3B0A A;  3ENB A;  1OQY A;  2J0K A;  1UGM A;  2ABD A;  2L8J A;  2YF0 A;  3AU4 A;  1DDM A;  1N3H A;  4IOY X;  4YL8 A;  3RT3 B;  2COC A;  4MSQ B;  3PRM B;  2DYQ A;  2MBH A;  2JY6 A;  2VRR B;  1CMX B;  2ZPN A;  4Z2M B;  5G55 A;  2R82 A;  2CY5 A;  2N0Y A;  1NU2 A;  3VTW A;  1FGY A;  3RUL A;  2KDI A;  2NVU I;  3DPD A;  2IY1 B;  5HKH A;  3QJZ A;  1V49 A;  3CF6 E;  2NPT B;  4MJS A;  1E7U A;  3DVG X;  4LJP B;  3V62 A;  1LM8 B;  1ZC3 B;  2IBI B;  4KVG B;  1M7R A;  3A1Q A;  2K00 A;  2XBB C;  4IC7 B;  1ZVR A;  2MWN B;  3NZS A;  3QAQ A;  2ZNV B;  3L08 A;  2Y8F A;  2FCQ A;  4HB3 B;  2DHK A;  1P6S A;  3M63 B;  2W2X D;  2FNJ B;  3RYT A;  3DXE A;  1WR6 E;  2KX0 A;  2E2X A;  2KN5 A;  1V5P A;  5HE0 A;  4E74 A;  2LAS A;  3F0W A;  4X57 B;  3BIN A;  2RGN B;  3N32 A;  4MH0 E;  1KJT A;  2FCM A;  3ZDM C;  3PGE A;  1MAI A;  1UD7 A;  4F7U P;  2FIF A;  2MP2 A;  2YT0 A;  4EUT A;  2NMB A;  4NQL B;  3WAN A;  4FJY A;  2M17 A;  2MLB A;  4G11 A;  2KC2 A;  2DKQ A;  1WJ4 A;  4RM9 A;  3UGB B;  2BWE S;  2P0H A;  4KHB B;  2G35 A;  3BY4 B;  5D2M B;  5C23 A;  3ZO5 B;  4CO7 A;  1X86 A;  3ZNG C;  5L83 A;  3PSE B;  1XOD A;  2J59 M;  5CHW A;  2JP2 A;  4FJZ A;  1KI1 B;  3D8D A;  3ML4 A;  3FSS A;  1UZX B;  3GOE A;  2L7R A;  5FR6 A;  1IRS A;  1BAK A;  1MKE A;  2R0D A;  2DHI A;  1DIK A;  3RD2 A;  4JQW C;  2PZ1 A;  2H7D A;  1V61 A;  3RCP A;  2FCN A;  3SNH A;  4IM2 A;  5CTR C;  2BYF A;  5C16 A;  1F9J A;  5DH9 B;  4K7S A;  1P9D U;  3CSF A;  2D3G A;  3EPY A;  3L10 B;  1FHO A;  2HE7 A;  1V5O A;  2Y5B B;  3N30 A;  4BBN C;  2X18 A;  3DVG Y;  1UPQ A;  4ILH A;  3LJU X;  2DX5 B;  2KDB A;  3QAR A;  1VBH A;  2FID A;  4PQ0 A;  2CRF A;  2G4D B;  3IFW B;  1KZ7 A;  2KFJ A;  4XX5 A;  5JP4 A;  3ALB A;  1KM7 A;  1J19 A;  1ZKH A;  2V3S A;  2K25 A;  2K2U A;  3KH0 A;  2M1M A;  4RM8 A;  2ZVN A;  4LCD E;  3MTN B;  3U8Z A;  5AZF A;  4KDL B;  1XX0 A;  2LJ5 A;  3DVN U;  3FP5 A;  1V9J A;  2CHX A;  2PE6 B;  3DVN V;  2GCL A;  1YD8 U;  3QQ8 B;  4AP4 C;  3NHE B;  2EMS A;  2BKR B;  3DCG A;  2MBQ A;  2CU1 A;  2MW5 A;  2KDE B;  2HRJ A;  3KUZ A;  4EZK A;  4EJN A;  4W9I A;  3ECI A;  2VRW B;  1WE7 A;  3SD5 A;  1WJU A;  2GBN A;  1Y5O A;  3VUY A;  5IJM A;  4I6L B;  2UYZ B;  4JIO U;  1WF9 A;  1U27 A;  4HLE A;  4KDI C;  1E8Z A;  5JHG A;  2O6V D;  1V86 A;  2K8B A;  1TGZ B;  4F7H A;  2CHW A;  2OQB A;  3PS6 A;  3A4R A;  2RVB B;  1LB1 A;  2EKE C;  1XCG A;  1DBH A;  3ULC A;  4MEL A;  1V81 A;  5C5B B;  3C0R B;  2KJH B;  1U5F A;  2KO3 A;  3IVF A;  3A33 B;  4HDO A;  2KTF A;  2KQ7 A;  4ICV A;  5D3X A;  3QCA A;  4A3P A;  5JVL A;  2Z0D B;  2COA A;  2JPH A;  1LFD A;  1WXA A;  1Q0W B;  2LGX A;  2DEN B;  3KYD D;  2D2Q A;  4JKG B;  2ZJD A;  1UEF A;  1EGX A;  1U5E A;  1QZE A;  3ML9 A;  3TW1 A;  1PQS A;  2LBB A;  3SYX A;  2XQN M;  2MX2 A;  2LGY A;  3ZNI D;  2M0X A;  2ZVO A;  1C1Y B;  4WJO A;  2Z0Q A;  4FJV B;  2KTR B;  2OJR A;  3VXW A;  4BOZ B;  4GMV A;  4AWJ A;  2CR5 A;  4MGZ E;  4ZYN A;  2BGF A;  3TFM A;  3MJW A;  3G9W A;  4LDT D;  3UQA A;  2GMI C;  1BTN A;  3TIX A;  2REX A;  4D0N B;  3SDL C;  3ULB A;  1M7E A;  3SBT A;  2WWZ A;  2UVM A;  4W9D A;  1RJ2 A;  1IPG A;  1P98 A;  2K1F A;  2KFK A;  3NZU A;  1ST7 A;  5L81 A;  4BKT A;  1WXM A;  2AL3 A;  4HAX B;  2BCJ A;  3B08 A;  4EMO A;  2I5C A;  2MBO A;  2YS3 A;  1TBE A;  3VVW B;  3TL5 A;  2Z59 B;  1ISN A;  2NBU A;  5J18 A;  1GUA B;  3E9O A;  1EF5 A;  2MKR A;  4HAZ B;  4HAV B;  5C1Z A;  4G0N B;  4FHK A;  3ZTC A;  2J0M A;  3ODX A;  3A9K B;  3D32 A;  1WIA A;  3H7P A;  2B3A A;  3A9J A;  2LOZ A;  1V5M A;  4DX9 0;  2ZCB A;  2FUH B;  4K7W A;  4KAX B;  2W2W A;  1WX8 A;  3OJ4 B;  3VTU A;  1WJ1 A;  2KJ6 A;  4KV2 A;  2VKI A;  4KIK A;  3KSY A;  2FDQ A;  2JWZ A;  4BKS D;  3PHX B;  5LLI A;  5DPR A;  2RUK B;  1NI2 A;  3RZW C;  4HWI B;  5JZE B;  3WIM A;  2DAJ A;  4P7I A;  3TBL D;  2COD A;  5J2R A;  3HIZ A;  3LJ3 A;  1WGR A;  2JRI B;  3V6E B;  1RFA A;  1R4M I;  3KVF B;  5AZH A;  3GYO A;  4IFS A;  2DX5 A;  4JKC A;  3R3M A;  4HAT B;  2K8H A;  3PTF C;  2GCJ A;  3KUD B;  1KOT A;  3ONS A;  4ASW C;  5CX3 A;  2LVQ A;  1HB8 A;  1YJ1 A;  1L7Y A;  2MBE A;  3TCA A;  3X0W A;  4EKU A;  3APF A;  1WM2 A;  2D07 B;  3D8F A;  2CHZ A;  5GOW B;  4EOY A;  4RMA A;  2KZR A;  2KNB A;  3A1Q B;  1UBQ A;  1KC7 A;  1GNU A;  3WAL A;  2MDX A;  2JF5 A;  2DIK A;  1WG7 A;  1ACA A;  1AAR A;  4M8N A;  2GS0 A;  2MSE D;  4PYU A;  3ZVR A;  1Q5W B;  2IO0 B;  2FCS A;  4NNJ B;  3KZ1 A;  4E3C A;  2RD0 A;  2PE9 A;  1S3S G;  1WGY A;  3R7R A;  4HHV A;  3R66 C;  2JVC A;  3VAW A;  2L00 B;  4TUU A;  2C9W B;  1G6J A;  3ZW3 A;  2KCJ A;  2KK8 A;  2N7E A;  1U5G A;  2JZZ A;  1LXD A;  4ICU A;  1V80 A;  4M8M A;  3VHT C;  2YVC A;  4AUQ C;  2J7Q B;  2OOB B;  2Z0E B;  4FBJ B;  2EMT A;  1E8W A;  3ODO A;  3TO1 A;  3U30 A;  2KC1 A;  4GU2 A;  3CMM B;  2PPH A;  1VBG A;  4NY0 A;  3PHW B;  4AOF A;  4IWO A;  4Z2N A;  2DX1 A;  1WXS A;  1YX5 B;  3UZT A;  4F7G A;  3UIN B;  2HJ8 A;  5JH5 C;  1YQB A;  1JDE A;  2KJR A;  3HQC A;  3EC8 A;  1SHC A;  3OAN A;  2BPS A;  3DBH I;  1UPR A;  2O2V A;  4HXD A;  4JK7 A;  2K8C A;  2LVP A;  2DHJ A;  3K9P B;  3W1Y A;  3L16 A;  2KQS A;  4MSM B;  1I35 A;  4JKE A;  5D3W A;  1XKE A;  2RPQ A;  3E66 A;  4GZU A;  3L0W B;  3ZDT A;  2GBJ A;  5KHQ A;  4BKG A;  2I5F A;  4DHJ B;  3SUZ A;  2DLW A;  1AWE A;  2KMA A;  4I6N B;  2D9Z A;  4KIK B;  3Q3F A;  3NSU A;  3UIP B;  2QKL A;  1WZ3 A;  4W9C A;  2X0S A;  1EVH A;  3PZD A;  2ZCC A;  2JXX A;  4LDT B;  4PS3 A;  2IO1 B;  4JL9 A;  2CAY A;  1UNP A;  1ZW7 A;  2M38 A;  1WM3 A;  5EFX A;  2BKF A;  2AL6 A;  3AJ4 A;  1TTN A;  1FGZ A;  3WAM A;  1V88 A;  1FHW A;  1X05 A;  1H10 A;  2IO3 B;  3TVV A;  1Y19 B;  3KRX A;  4WJN A;  3VUX A;  3W1S A;  2KAN A;  2IO2 B;  3PG7 A;  1DRO A;  1WX9 A;  4IG7 B;  1WYW B;  2C7N B;  2KVR A;  1UBI A;  3A9K A;  4PYZ A;  4HPL B;  3APD A;  2AEH A;  4KZ0 A;  2G45 B;  3DDC B;  4URK A;  2O2V B;  4KHA A;  4CHM A;  2OTX A;  2N23 A;  2CKH B;  3R7Q A;  2C60 A;  4ANU A;  4HAW B;  4WQO B;  3V61 A;  3ZNZ B;  4K17 A;  4II2 B;  3NOB A;  1SE9 A;  3BJI A;  1ZSQ A;  3M3J A;  4FUL A;  1HBK A;  1KBL A;  2JRH A;  5CHV C;  3ZRF A;  2QKM A;  4GXB A;  1SIF A;  2DYM A;  4WVF B;  4DX8 A;  1WJ6 A;  3KRW A;  2LWP A;  1RLF A;  4OVV A;  5HE1 A;  2KWV B;  1X1F A;  5CLQ B;  4WJQ A;  2K6D B;  2MA9 B;  1T0Y A;  4DXA B;  2YT1 A;  3X23 A;  1WH3 A;  3WAO A;  1UH6 A;  1MPH A;  2ASQ A;  5J3Y A;  2ZNV C;  4BFR A;  4WWP A;  4M0W B;  3OAW A;  4GGQ A;  3SO6 A;  4DHZ E;  5LON B;  2LKO A;  4ILG B;  3SBG A;  4W9L A;  4A5K A;  2D10 A;  2DN6 A;  4MDK E;  4DHJ D;  4MY6 A;  3MHS D;  2D9X A;  2M4N A;  1C3T A;  4I6P A;  3D8E A;  5FI0 A;  3LDZ E;  3O96 A;  1WMH A;  3DQV A;  1Q1O A;  2YS1 A;  2WX1 A;  3E9L A;  1BT0 A;  2MBB B;  3Q3J A;  4HVB A;  2C7M B;  5DPT A;  1V5U A;  1V2Y A;  2D11 A;  4G3X B;  4NPN A;  3SU8 X;  3VOQ A;  3I3T B;  5E6O A;  2KLG A;  5FI1 A;  3HHM A;  4HAY B;  3JW0 X;  2RR9 A;  2NBW B;  2WX0 A;  3FEH A;  1WJM A;  4GMX B;  5E6N A;  1XQQ A;  2CQU A;  3VDZ A;  3UIO B;  1NDD A;  3OLM D;  1NTI A;  4XWX A;  2LZ6 A;  3ZIM A;  3VQI A;  1SGH A;  2FJL A;  5D7G A;  3T9L A;  2PEA A;  3VFK A;  2DFK A;  5JHH A;  2HTH B;  5IAA C;  4TQ1 A;  4B9K A;  2LRU A;  3QWZ B;  2CS4 A;  4LJO B;  1EAZ A;  2BYV E;  3A8P A;  1IP9 A;  2K2J A;  3QIJ A;  1MIZ B;  3H9D A;  2P0F A;  5D3Y A;  2XEW A;  4GDL A;  1IYF A;  1NBF C;  2N9E B;  1NTV A;  4A20 A;  1V5T A;  2J0J A;  3EFU A;  4KSK C;  1E8Y A;  2PJH A;  3VUW A;  2DZM A;  1GC7 A;  2KDF B;  1BTK A;  5L95 C;  3L13 A;  1FHX A;  3KW5 B;  2EC1 A;  4FHJ A;  4FAD A;  4HB4 B;  4EZJ A;  5TR5 A;  2RLO A;  4F1S A;  1UEL A;  3MPX A;  2Y7B A;  4MEM A;  4WWO A;  1TXD A;  4B6H A;  3PRZ A;  4ANW A;  4K81 A;  5D3V A;  5C6R A;  1Z5S B;  2ZEQ A;  4GOC A;  4HPM B;  4BOS C;  4JKG A;  5LXH A;  1WZ0 A;  1B55 A;  1E8X A;  4NQK E;  4XZ4 A;  2Q13 A;  4AJW A;  1UNQ A;  1L2N A;  4MK0 A;  1I2H A;  4ZRJ A;  3E9P A;  3H6N A;  4TKN A;  5DPS A;  4W9H A;  1AQC A;  1S1Q B;  2GJY A;  4DWF A;  2UZS A;  4FA6 A;  1WMH B;  2QHO A;  2N9X A;  1EF1 A;  4BBK A;  5IA7 A;  1M94 A;  3QWM A;  2KTR A;  1NVL A;  4K2O A;  2ELA A;  4FLH A;  1BWN A;  3T8M A;  4NAW A;  4AJY B;  3W1S C;  3DOW A;  3A98 B;  1FB8 A;  2YSZ A;  5KHO A;  4B6W A;  2LGD A;  5CHF A;  2KFK B;  2P0D A;  1P3R A;  1Z2M A;  2LOX A;  3CST A;  3PV1 A;  1VCB A;  2LUL A;  3B1L X;  3V60 A;  3K9O B;  2M14 A;  2L1C A;  4W9G A;  4JLC A;  2WH5 A;  2CY4 A;  4GDK B;  3QHT A;  3PP2 A;  2BWF A;  1X11 A;  1WRD B;  3QC8 B;  3P6A A;  1W1G A;  4GB9 A;  3A4S C;  2G3Q B;  3AUL A;  2XK5 A;  1OMW A;  4KZC A;  1WI1 A;  2L3Z A;  3P7Z A;  4NSW A;  4IUM B;  1WY8 A;  3HM6 X;  3UQB A;  2V4L A;  4DK5 A;  4G50 A;  1RAX A;  4EEW A;  2C7H A;  2M8S A;  2Y8G A;  2NBV B;  3GYP A;  3DXC A;  3AI5 A;  2R2O A;  4GIV A;  4MJS B;  1WGU A;  1P1A A;  2LD9 A;  1WFY A;  3H1U A;  3O65 B;  3QBV B;  3T06 A;  2MQJ A;  2COF A;  2MP2 B;  4F8C B;  4GPT B;  4GDL B;  5LOP B;  1DDW A;  1WGQ A;  4YON A;  2LVO A;  2LYD A;  2LRW A;  2LUE A;  1V89 A;  1ZM0 A;  3A8Q A;  4A3O A;  4B95 A;  1U29 A;  4JKB A;  3KY9 A;  3RUI B;  1LQB A;  3IBE A;  1XT9 B;  2R09 A;  4BVU C;  1U4A A;  1GG3 A;  5DIF B;  1RRP B;  4HJK A;  2ADZ A;  3APC A;  4CYE A;  1Z87 A;  4CHK A;  2GBK A;  2IYB A;  2D4Q A;  2KHW B;  2O6V A;  4JKA A;  4EFO A;  3PRP B;  2N1W A;  2DAF A;  2ZZP B;  1DYN A;  2NS5 A;  2IY0 B;  4L6E A;  4OVU A;  3PSC A;  4TYZ A;  1KLV A;  4NJ7 A;  2K6Q A;  2LXC A;  2C5L C;  4K2P A;  1OGW A;  1WXV A;  2HD5 B;  3VH4 B;  2KWU B;  4K1R B;  1WJN A;  4PS8 A;  1XD4 A;  1NTY A;  1TJ6 A;  3V5W A;  3P2B A;  1PFJ A;  1GJZ A;  1X1M A;  3CXB B;  2RSG A;  2D9V A;  4DDG D;  4ZRK A;  3ZLZ A;  2DTC A;  3V6C B;  3TMP B;  1WVH A;  4W9F A;  2DZI A;  2KD0 A;  1HB6 A;  4II3 B;  1EUV B;  5E6P A;  3ZRC A;  2ROV A;  3FM8 C;  2XK5 B;  4KSL C;  3H7S A;  2W9N A;  2LG1 A;  4PS7 A;  5C79 A;  4WJP A;  4JK8 A;  4DBG A;  1R4N I;  2IZV B;  4MGK E;  3ZTD A;  4HK2 A;  4HB2 B;  1P5T A;  1U2B A;  1TZ1 A;  4F7Z A;  4ANX A;  2N9P C;  2N1V A;  5JLJ B;  3JSV B;  2A4Z A;  5EDS A;  2NZ8 B;  2DZJ A;  1I7A A;  4N9F 4;  2N7D A;  1RRB A;  1K5G B;  4HCP B;  2KLC A;  1KZG A;  3SHQ A;  4IAP A;  2I1K A;  1W1D A;  4WSF A;  2ZPY A;  2DYB A;  2N4F A;  1YX6 B;  5HE2 A;  4IM3 A;  2L2I A;  3ODW A;  2KOX A;  1U5D A;  1E90 A;  2L0T A;  3JYU A;  1JRU A;  4IM0 A;  4TV3 A;  4EZL A;  4IW0 A;  3KYC D;  2LXA A;  2GBM A;  5DPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...