4CYEA

Crystal structure of avian fak ferm domain fak31-405 at 3.2a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4cyeA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4cyeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4cyeA01
3VAWA 4KVGB 1WJ6A 4F7GA 4HATB 2P0FA 5CHFA 1V80A 1H10A 1BAKA 1E90A 5TR5A 1WR1A 3T8MA 2P0DA 1YJ1A 4IG7B 1T0YA 2FCQA 3ZLZA 2EC1A 2L76A 3W1SC 2O6VB 4KIKB 4ASWC 2JP2A 5L95C 3VIAA 4GZUA 3FM8C 4A3PA 3DVNV 4MGIE 1GG3A 1LXDA 2LOZA 2C60A 4W9IA 2Y7BA 3CMMB 3PEGA 3RYTA 2ELAA 3D32A 1EF5A 1TJ6A 1JRUA 4MGKE 3ZNHB 5JHHA 2AEHA 4HK2A 5D7GA 5CLQB 3RULA 3ZDTA 2ELBA 3SUZA 4HAXB 2RVBB 3GZNI 2EMTA 4E3CA 3GYPA 3PHXB 1P98A 3M1IB 2KX0A 4F7ZA 3TFMA 1WZ0A 2NMBA 1V2YA 2WX0A 2CODA 2GCLA 4E74A 1U29A 4HAWB 3ENEA 1NI2A 2CY5A 4II3B 1OTRB 3ODOA 1OEYA 2BYFA 2RD0A 1J0WA 2NS5A 2I1KA 3AJ4A 2LZ6A 1MG8A 2O2VA 3SDLC 3RZWC 3X23A 4AJYB 2LRWA 3EPYA 2C7MB 1WXSA 1GNUA 1ISNA 2XBBC 2REXA 1QC6A 1NTVA 4HPLB 4HAUB 2BPSA 2COPA 4NSWA 2XEWA 4B95A 3H1UA 4AP4C 2JZ3B 2CHXA 5D94A 1GC7A 3PVUA 2KDEB 3H7SA 3S2AA 2WH5A 2LGYA 4DWFA 1XD3B 1HB8A 2YS3A 2UZSA 3H6NA 3PGEA 1WGYA 2KTFA 3SU8X 1V5PA 2IFSA 2HRJA 3PTFC 2MCNB 5KCVA 1J19A 2VRWB 3DBSA 4GN1A 3KH0A 4HDOA 2OQBA 1V6EA 2N9PC 2OOBB 3U8ZA 1E5WA 2COAA 1OY2A 3ULBA 3VH4B 1XR0B 2LG1A 3CSTA 3SV1A 3O96A 2JWZA 2DFKA 1U5GA 4KHBB 3VHTC 4W9FA 1KOTA 1IRSA 4WJPA 4HPMB 1XD4A 3QBVB 3VH3B 4TYZA 4C0AA 4XWXA 5D3VA 1MIXA 3MPXA 2KZRA 5JZEB 2KDIA 1S3SG 1PQSA 4H8SA 2ROVA 3V6CB 4DBBA 4MY6A 3VTWA 2KVRA 2K2UA 4MJSB 2J0JA 4PS3A 2GS0A 2P8VA 5D3XA 2MRPA 1EF1A 3VUWA 4HAYB 3A9KA 2FJ9A 4LDTD 3D8EA 2PJHA 2KWCA 1UD7A 2LUEA 4LJPB 1GJZA 4ZYNA 2CHWA 4HB0B 3PHWB 2NBVB 1IPGA 3QWMA 1M94A 2YVCA 3C0RB 5GMVA 2LASA 4KDLB 4M8NA 3BJIA 2KTRB 3WIMA 3PT2B 4GMXB 3H7PA 3QCAA 3IG3A 4JLCA 5BO4B 2HTHB 4DHJB 1UEFA 3ML9A 3KW5B 1WVHA 1WJ1A 2N1VA 3KSYA 3R7RA 2FJLA 4G11A 3PPAA 2WYQA 1Q1OA 4MELA 4NJ6A 4XC2A 3PZDA 4NAWB 2BGFA 4IM2A 2PPHA 2ABDA 3ALBA 2J7QB 3SD5A 3L17A 1XODA 2G35A 1LM8B 2K6QA 3A33B 2CAYA 3ODWA 3PV1A 2KLGA 3R3MA 4NQKE 3PRZA 2K6DB 1ZW7A 2CHZA 2KXJA 1V88A 4URKA 3HK0A 2VKIA 1EO6A 4DXAB 1KI1B 1UBQA 1X1GA 1BT0A 4FULA 2LJ5A 3ZIMA 1WXMA 4DHZE 2YSZA 4FN2A 4IOYX 2L1CA 4BOZB 2RGNB 5JLJB 4K2OA 4EMOA 4ICVA 1P5TA 1TQZA 2LULA 5C79A 3OANA 2DLWA 3UIOB 3ZRFA 2NPTA 4II2B 1LQBA 1N3HA 4K1RB 2IYBA 2KC2A 2PEAA 3EECA 3R66C 2LBBA 4G0NB 1MPHA 1WE6A 3IVFA 2D9YA 2CRFA 2IY0B 2V3SA 2Z0EB 1VD2A 4B6HA 3T9LA 2KLCA 5J3TA 1PFJA 3TBLD 1SIFA 5JH5C 4PS8A 1V9JA 4D0NB 2YS5A 2NZ8B 4GDLA 2KC1A 4MGZE 3JW0X 4FHKA 3I3TB 3WAPA 1WR6E 4HXDA 1ST7A 5C5BB 3M62B 4DHZB 4W9CA 5CHWA 4BKTA 2G4SA 3U7DA 3FSSA 3L16A 3EHVA 5DI9B 3WYFB 1HE8A 3G9WA 4Z2NA 1FXTB 4HVBA 2G4DB 1ZC4B 2W2WA 3RCZA 3BY4B 4DX8A 2A5UA 3LJUX 1DROA 2N9XA 4DDID 3DBHI 2ZPNA 2D9VA 2MKRA 2DX5A 3A1QB 4WJNA 1J0GA 1E8YA 4EKUA 4ANXA 2IY1B 2YT0A 4GB9A 1DDMA 1V61A 2ZVNA 2MA9B 4A3OA 5DH9B 4FBJB 3QIJA 4CHMA 1OMWA 2MBQA 3IBEA 2ZEQA 2KHWB 4MT7A 5C23A 4DK5A 2M38A 4ANWA 2DAFA 1YX5B 3DVNU 4M0WB 3VXWA 2V4LA 4GU2A 1DYNA 2KQSA 2KFKA 2N7DA 2MFQA 4AWJA 3WA0A 1WX7A 1X86A 4IM0A 1WJMA 2D9ZA 3K9OB 4IW0A 5AZGA 2DN6A 3V6EB 2DHJA 1WIAA 2YS1A 2R09A 1I35A 3P2BA 4JGHB 2DYBA 1DDWA 2KANA 4NJ7A 1Q67A 1WJUA 2ASQA 4FLHA 2MBHA 3KRWA 4RMAA 1Y5OA 1AWEA 3QQ8B 1OQYA 4W9KA 4GGQA 2GBMA 3MDBC 2OTXA 5C16A 2IBIB 1NTIA 4KHAA 4CO7A 2DENB 2GJYA 3GOEA 3APDA 4AJWA 2YRYA 2N9EB 5HE3A 1G6JA 3RCPA 1RJ2A 4EJNA 3PVWA 2CKHB 3VUYA 3QJZA 3A8QA 3T06A 3VTUA 4PQ0A 3V62A 2Z0DB 4KZCA 2BWFA 2MP2B 4ANUA 5KHQA 2LVOA 4FJZA 1NU2A 2NCNA 1UNQA 2D3GA 1UPRA 4EFOA 4IM3A 1S1QB 2IO3B 1C1YB 3CF6E 3OJ4B 1NBFC 1E8WA 1X1MA 2FCMA 2KCJA 1LFDA 3A9JA 1WI0A 4PS7A 2FUHB 2ZJDA 3IHPC 2FCSA 4G3XB 2KWUB 4GMVA 2L3ZA 4KDIC 2GBRA 1Q0WB 3ZVRA 4I6NB 2J59M 1WMHA 4K2PA 4WSFA 3DVGY 3JSVB 3ECIA 1WGRA 3A98B 2IYDB 5CLLB 3W1SA 4EOYA 2D11A 3SO6A 2AYOB 2DZJA 3AI5A 3WAMA 1Z5SB 3TCAA 2CU1A 2GCJA 3QARA 2O6VA 4KIKA 2KJHB 1NVLA 2BYVE 2BKFA 2KJRA 2LXAA 2G45B 2B3AA 1U2BA 5FI0A 4BVUC 4PNKA 1UZXB 2KFJA 4F7HA 2N4FA 1KZ7A 5L81A 2E2XA 3TL5A 4FA6A 3FP5A 5HE0A 2L0FA 3ODXA 1WI1A 5LOPB 3N3KB 4I6LB 3TJPA 2W9NA 2K00A 2CS4A 3NHEB 2JUOA 2RUKB 3SHQA 3ULCA 1WX8A 1W1HA 5CTRC 4YONA 2MQJA 2KNBA 3FEHA 1UH6A 4Y94A 3QC8B 5DHAB 1NDDA 2ZPYA 1KJTA 1UBIA 1X11A 1PLSA 4B9KA 2LGDA 2KX3A 2LGXA 4ICUA 3AULA 1A5RA 2BCJA 3BINA 5DCNA 4K81A 3NY5A 1WZ3A 5D3YA 1VCBA 2BF8B 2M0XA 2DYQA 3QAQA 1UNPA 5IAAC 2VSZA 2DHZA 3D8FA 1YIWA 4IUMB 2CQUA 3NS8A 4MH0E 3PP2A 1RFAA 2N1WA 2MX2A 2DA0A 1FGZA 1KM7A 3KYCD 4CHJA 3PS6A 2G3QB 4A5KA 3ZW3A 1WFYA 1MKEA 1V5MA 3ZKJC 4W9LA 2JPHA 3GYOA 3PLVA 1TGZB 5DPWA 4EEWA 1PMSA 3X0WA 3CXBB 3OAWA 3HW2B 1ZKHA 4K7UA 1BTNA 4KZ0A 2FNJB 3DCGA 5CX3A 4K7SA 2WX1A 2FDQA 2K39A 4X57B 2VRRB 1UELA 2V76A 4P7IA 1W1DA 3PVLA 3LJ3A 4A6FB 1EUVB 4BBNC 5KQ1A 5FI1A 2KOXA 4W9JA 1SHCA 1FGYA 5EFXA 2DHIA 3PSEB 1TZ1A 4K7WA 4YL8A 1AARA 1OGWA 4FJVB 3TMPB 3MHSD 1K5DB 1XT9B 4DHJD 1I7AA 1WGQA 1V49A 2I5CA 1FHOA 2V1YA 2CY4A 2RGFA 4K17A 2N0YA 2DYOA 2XK5B 1YX6B 1XX0A 4MJSA 3UGBB 3TIXA 5J18A 4BBNF 3IFWB 3RT3B 4HJKA 4JIOU 4WQOB 2JF5A 3PREA 3VOQA 4GDKB 4NY0A 1YD8U 2M4NA 1X1FA 3EFUA 4WVFB 5D2MB 2LVPA 5DPSA 4F8CB 1W1GA 1M7EA 5EDSA 1P1AA 2C9WB 2GMIC 1AQCA 3PSCA 2JZZA 1P3RA 2PZ1A 2ZCBA 2KTRA 1V81A 2HE7A 2ADZA 2DYNA 4HCPB 2K1FA 2IO2B 5E6OA 2KDBA 2D9XA 2R0DA 2HTHA 3VTVA 2AL3A 1H4RA 5G2NA 2C7HA 3KUCB 1V5UA 2DKQA 1UPQA 2ZVOA 5J3YA 2KMCA 2BKRB 2UVMA 3DPDA 4OVVA 3ZNZB 5CHVC 1R4MI 2H7DA 4MSQB 2I1JA 4NAWA 4W9DA 2L8JA 4RM9A 3M3JA 2EMSA 5E6PA 2DZMA 1LB1A 4XX5A 3JVZX 2MSED 1NTYA 1CMXB 2RSUA 4KV2A 3UF8A 2AWTA 4HLEA 1FAOA 2D4QA 4BBKA 2ROZB 3ZO5B 2IZVB 2D9WA 5AZFA 2RSGA 3CIKA 2RQ1A 3KYDD 3DXDA 4IAPA 2NR2A 3RUIB 3PRMB 4WAAA 3HHMA 3A8PA 2KWVB 3KVFB 5C6RA 3OJ3A 2K25A 4MGYE 3ZNID 3UINB 4XZ4A 3LDZE 2Y8GA 1TTNA 3AU5A 2CR5A 1WRDB 3AXCA 1WM3A 4ZDVA 1FHXA 3PRPB 2KN5A 5G55A 1BTKA 2KDFB 5L83A 1WJ4A 2L05A 2XQNM 4DBGA 4HB2B 2DX1A 3KUDB 3N30A 2JRIB 1MK7B 1GUAB 2D07B 2GBKA 3O65B 2O2VB 3A4SC 3UQBA 4ZRJA 3DOWA 4AOFA 1WM2A 2GBNA 5AEKB 4GSWA 5LXHA 2YT1A 2LI5A 1ZM0A 4W9GA 4GXBA 1E7UA 1FHWA 3QA8A 3D8DA 5C5BA 4EZJA 1E7VA 2HJ8A 5HE2A 1F9JA 3DDCB 1KLVA 1RRBA 2JVCA 3L13A 2UYZB 1WGGA 2Z59B 2AL6A 5D3WA 2MBOA 2X18A 2JY6A 3B1LX 3PLUA 2QKLA 1HB6A 2Q13A 1EAZA 4MDKE 3A1QA 3QX1A 2O6VD 3CSFA 1YQBA 4I6PA 2J0MA 2YF0A 3EC8A 1WG7A 2Y8FA 1J8CA 3MJWA 4EZLA 1RAXA 4CYEA 4HCNB 1Y19B 1H8CA 1FOEA 3APCA 1ZGUB 2RNRB 5DPTA 2BWES 4IWQA 2W2XC 3PG7A 2IO0B 2R2QA 3QWZB 3QHTA 1TXDA 2COFA 1U4AA 1DDVA 1E8XA 4HAVB 3ZVVA 1SGHA 2PE6B 2W2XD 1WGHA 2Z0PA 2FCNA 4HAZB 5JP4A 5C1ZA 1X05A 2N23A 1MAIA 5DHFB 2P0HA 4DDGD 3R7QA 3OLMD 5FR6A 4EUTA 1EVHA 1XQQA 2BYEA 1UGMA 1WXVA 2UWQA 1K8RB 3A9KB 4WWNA 4W9HA 1U5EA 3WANA 2RR9A 2MWNB 2J0KA 3HQCA 1WH3A 1V5TA 3SYXA 2MW5A 3ZNGC 4PYUA 4WJOA 3DBLI 3UQAA 2MP2A 3VUXA 2M17A 3U30A 3WAOA 3H7PB 4IWPA 2Z0QA 5DPRA 5JHBA 3UZTA 1ZSQA 4NPNA 4MEMA 1WY8A 5KHOA 1P3QU 3MTNB 3Q3JA 4ZRIA 1V89A 3DXCA 3V61A 2LD9A 1BWNA 1OQNA 1XKEA 2L2IA 3ZDMC 4FADA 1QZEA 5IA7A 2D10A 1UNRA 2M8SA 3QK0A 3F0WA 1U27A 3VVWB 2LOXA 3ML4A 2I5FA 1RLFA 1R4NI 4TV3A 2QKMA 1M7RA 4L6EA 4WJ7A 1WF9A 3DVGX 5LXIB 5J2RA 2RLOA 1L7YA 1Q5WB 4TQ0A 3JSVA 2DHKA 3TW1A 3V5WA 3RZFA 5JHAA 2MBBB 4LDTB 2L0TA 2DTCA 3W1YA 4HB4B 1V86A 4TUUA 2JRHA 1DBHA 2NBWB 3L10B 2C7NB 4WWOA 1WE7A 1WGUA 2LXCA 1K5GB 1ACAA 2NPTB 1WJNA 4A6KA 3WALA 1E8ZA 2LWPA 5LLIA 4GPTB 4HDQA 1HBKA 4A6HA 1QQGA 2CB8A 4GIVA 3L54A 3HIZA 5D6JB 1KZGA 1EGXA 2M1MA 2MBEA 3L0WB 3ZUNA 5GOWB 2KK8A 4B6WA 1SE9A 2MDXA 3HM6X 2K8HA 2DZIA 2KD0A 3N32A 4GDLB 5E6NA 2K2JA 2N7EA 2JXXA 5AZHA 1Y8RC 2LYDA 1TBEA 3ONSA 5J3QA 3NSUA 2H7EA 1IP9A 4TQ1A 5D27A 3FLVA 4ZRKA 3P6AA 2QHOA 2DYMA 2FAZA 4EZKA 1Z87A 2C5LC 2Y5BB 4LJOB 5JHGA 2KQ7A 1U5FA 1FB8A 2DAJA 3DQVA 2L00B 3A4RA 3TVVA 4KSKC 3H9DA 3B08A 2DZKA 1MK9B 3KRXA 1P6SA 2DX5B 2WWZA 3L08A 4FJYA 3DBRI 4BKSD 1D3ZA 3NZUA 1I2HA 4MK0A 1IYFA 4F1SA 4M8MA 4PYZA 4KAXB 4W9EA 4N9F4 3APFA 1WXAA 2KFKB 2MWSB 3VDZA 4JL9A 4CHKA 4G50A 2LRUA 1I42A 4KSLC 2ZNVB 4J6IA 4E71A 3JYUA 2RPQA 3AU4A 4IFSA 2PE9A 4A6FA 3N7CA 2NVUI 4JQWC 4NQLB 4BKGA 1RRPB 3UIPB 4RM8A 1WGDA 4DX90 4LCDE 2EKEC 2ZNVC 1P9DU 5HKHA 4TKNA 4WWPA 1P0RA 2JT4B 4FHJA 2DKPA 3VQIA 1WYWB 3NOBA 2ZZPB 4HB3B 3M63B 5IJMA 4KHOA 2KKCA 1Z2MA 2LVQA 2OJRA 2K8BA 3F5RA 3Q3FA 1WX9A 3DXEA 1ZVRA 4BKSA 2KJ6A 4IC7B 2FIFA 3ZRCA 2XK5A 2D2QA 5HE1A 4A20A 3V60A 3ZTCA 2FIDA 4WJQA 4F7UP 1OEYJ 3ML8A 2YLMA 4IWOA 2KMAA 3RD2A 2HD5B 2L7RA 3SNHA 3B0AA 2K8CA 3VFKA 4GDKA 1GC6A 3KUZA 4MSMB 1U5DA 4HHVA 3K9PB 2GBJA 4BOSC 3NZSA 2R2OA 2IO1B 2A4ZA 1L2NA 3KZ1A 2WDTB 4NNJB 1B55A 3KY9A 2EJ8A 2KUPA 1ZC3B 3A9JB 2NBUA 3P7ZA 1LW3A 2COCA 1C3TA 4Z2MB 2M14A 5DIFB 4MM3A 3TO1A 4GOCA 2GOWA 2ZCCA 5LONB 4HWIB 5J17A 2Z0OA 2LKOA 1XCGA 2UZRA 2KGXB 3ZTDA 3M95A 2KO3A 4AUQC 4BFRA 1MIZB 5KQ4A 1WMHB 4OVUA 1V5OA 3HM3A 2MLBA 4ANVA
chains in the Genus database with same CATH superfamily
3LB8C 3VAWA 4RGOS 1YQ4B 4KVGB 1WJ6A 4F7GA 3CIRB 4HATB 3DHGC 2P0FA 4N6EB 5CHFA 1V80A 2VZKB 3NWDA 1H10A 1BAKA 1E90A 2IPKD 5FK9C 2LJIA 5TR5A 2R2YA 1WR1A 3T8MA 1C4CA 2P0DA 1YJ1A 4IG7B 1T0YA 3HUIA 1SBBB 2FCQA 2M56B 3ZLZA 2EC1A 2L76A 2PMVA 3W1SC 2O6VB 4KIKB 4JX1C 4ASWC 3R2TA 2JP2A 2WXHA 5L95C 3VIAA 4GZUA 3FM8C 4A3PA 3DVNV 4MGIE 1GG3A 4EE2A 1LXDA 1QOFA 2LOZA 2C60A 1C9FA 2DBYA 1E7PB 4W9IA 2TSSA 2Y7BA 1VJKA 2KQ4X 3CMMB 3PEGA 3RYTA 2ELAA 3D32A 1EF5A 1TJ6A 1JRUA 4MGKE 3ZNHB 5JHHA 2AEHA 3E9PA 1MVKA 4HK2A 5D7GA 2KDMA 5CLQB 3RULA 3NRZA 4L2YA 3NWAA 4OZAA 3ZDTA 2ELBA 3SUZA 4HAXB 3BYTB 2RVBB 3GZNI 2EMTA 4E3CA 4B0EA 3GYPA 3PHXB 1IGCA 1P98A 1WGKA 3GE8C 3M1IB 2KX0A 4JWSC 4F7ZA 3TFMA 1WZ0A 4CQNA 2NMBA 1TKYA 1V2YA 2WX0A 2CODA 2GCLA 4E74A 1U29A 3AE1B 3RMKC 2ONQA 1JROA 4HAWB 2XN9C 1J7AA 3ENEA 1NI2A 3RNBC 2CY5A 2KMMA 4II3B 2WNMA 4TMAB 1OTRB 3ODOA 4JE3B 1OEYA 2BYFA 3R2IA 4ACFA 3P1MA 1HZ6A 2RD0A 1J0WA 2NS5A 1HEZE 2I1KA 3AJ4A 2LZ6A 1MG8A 2O2VA 3ZXVA 2ACZB 3HSAA 3SDLC 3RZWC 1YOVB 3X23A 4AJYB 2LRWA 3EPYA 3DHHC 2C7MB 1WXSA 1GNUA 1ISNA 2XBBC 1CZPA 2WXJA 5D3IB 2REXA 1QC6A 1NTVA 4HPLB 3OHMB 4HAUB 1CJEA 2BPSA 4LNIA 2COPA 2V9HA 4NSWA 2XEWA 1FM0D 4B95A 3H1UA 1IUEA 2PTLA 3HIEA 1UF0A 4KGSA 2Z59A 4AP4C 2JZ3B 2CHXA 3N1ZC 5D94A 5I4DA 1UWXA 4L1RA 2WDVB 5JVLA 1GC7A 3PVUA 2KDEB 3H7SA 2FUG1 1ZDXA 3S2AA 2WH5A 3W5VB 2LGYA 4DWFA 1XD3B 1HB8A 2YS3A 2DLBA 2UZSA 3B2FA 3H6NA 3PGEA 1WGYA 2KTFA 2JYTA 3SU8X 1YN3A 4ZHOA 1V5PA 2IFSA 2K0PA 2HRJA 3PTFC 1UGJA 1JDEA 2MCNB 5KCVA 4DQOC 1J19A 4LTUA 2VRWB 2K5PA 1TY2A 3DBSA 4GN1A 3KH0A 4HDOA 2OQBA 1V6EA 1DOXA 2N9PC 2OOBB 3ETRA 3U8ZA 1E5WA 2COAA 1OY2A 2MH7A 3ULBA 3OWEB 3VH4B 3IXSA 3GB1A 3O13A 1XR0B 2LG1A 1TZOA 4Q2JA 3CSTA 5EE1A 3EUB2 3SV1A 3O96A 1QKZA 4HJGE 4C56C 2JWZA 4C7YA 2DFKA 3AEBB 4RF0A 1U5GA 4KHBB 3VHTC 4W9FA 3TEWA 1KOTA 1IRSA 4WJPA 4HPMB 1TIFA 1XD4A 3QBVB 3VH3B 4TYZA 1GOZA 4C0AA 4M00A 3A58A 4XWXA 5D3VA 1KTKA 1STEA 3MC0B 1MIXA 3MPXA 1V1OA 2KZRA 2PIAA 5AUKA 5JZEB 2KDIA 1S3SG 1PQSA 1F0ZA 4H8SA 2ROVA 4A55A 3V6CB 4DBBA 4MY6A 3VTWA 2KVRA 2WDQB 3AEEB 1WXQA 2K2UA 5HHDG 4MJSB 2J0JA 1NEKB 4PS3A 2WLBA 2W55A 2GS0A 5G5GA 2P8VA 3Q8BA 4KGTA 5D3XA 2MRPA 1EF1A 3VUWA 4HAYB 2AX5A 2ON8A 3A9KA 1F2RC 2FJ9A 4LDTD 3D8EA 1KF6B 2PJHA 2KWCA 1R4NB 1MHHE 5FR3A 1UD7A 2LUEA 1YN4A 4LJPB 1GJZA 4ZYNA 2CHWA 2I38A 4HB0B 2DWQA 2SEBD 3PHWB 2NBVB 2UU7A 1IPGA 4P1BC 3QWMA 1L0YB 1M94A 3AEAB 1ZDVA 2YVCA 3C0RB 5GMVA 2LASA 4KDLB 1VZ7A 2DNFA 1D4BA 4M8NA 3BJIA 4OT1A 3ZYYX 2KTRB 3WIMA 3PT2B 4GMXB 4C4VB 3AEFB 2NTSA 3H7PA 3QCAA 3IG3A 4JLCA 5BO4B 3TEZA 4JKHA 2HTHB 4DHJB 1UEFA 1ROEA 1EWCA 3ML9A 3KW5B 2Z4DA 1WVHA 2N0SB 4P6VF 1WJ1A 2N1VA 4DXFA 1XLQA 1SF0A 3KSYA 3R7RA 3SBGA 2FJLA 2BB5A 4G11A 4JWUC 3PPAA 2WYQA 3WCQA 1Q1OA 4MELA 3KLSX 4NJ6A 2G9HD 4XC2A 3ZQ4A 1XXGA 1TKEA 3PZDA 4NAWB 2BGFA 2PPHA 4IM2A 2ABDA 4K3BA 3ALBA 2J7QB 2IJ0A 3SD5A 3L17A 1XODA 2G35A 1LM8B 2K6QA 5BMIA 3A33B 4YSYB 2CAYA 3ODWA 3PV1A 2KLGA 3R3MA 4NQKE 4RCOA 1AW7A 2IGDA 4HKQA 1AWDA 3PRZA 2K6DB 1ZW7A 2WXGA 2CHZA 2KXJA 1V88A 4URKA 1HA5A 1T77A 3HK0A 2VKIA 1EO6A 4DXAB 2PKOA 4ARCA 1KI1B 5MPOA 2K22A 1UBQA 1X1GA 1BT0A 4FULA 2LJ5A 3AE7B 3ZIMA 1TYGB 3TUOA 1PGBA 1WXMA 4DHZE 2YSZA 4FN2A 4IOYX 5FKAC 2L1CA 4BOZB 4USAA 2RGNB 5JLJB 1M4VA 3BIID 4K2OA 4EMOA 4ICVA 1ZE3D 1P5TA 1TQZA 2LULA 5C79A 3OANA 2DLWA 4RF1A 3UIOB 3ZRFA 2NPTA 4II2B 1LQBA 1N3HA 4K1RB 3BK2A 3L4PA 1CQVA 2IYBA 2KC2A 2PEAA 3EECA 3R66C 1IBXB 2LBBA 2BYTA 4G0NB 1MPHA 1WE6A 3IVFA 2D9YA 3DHIC 1SIJA 2CRFA 3ABVB 3NVWA 2IY0B 2JXTA 2V3SA 2Z0EB 3U12A 1VD2A 4B6HA 3T9LA 2KLCA 5J3TA 1JALA 1PFJA 1F77A 3FAHA 2CJOA 3TBLD 1HXYD 1SIFA 3E56A 1K52A 5JH5C 2KVZA 4PS8A 1V9JA 4D0NB 2OHFA 2YS5A 4HPPA 2NZ8B 4GDLA 2KC1A 4MGZE 3JW0X 4FHKA 5HFYA 3I3TB 3WAPA 1VLBA 1WR6E 4OW0A 4HXDA 3RNAC 1ST7A 5C5BB 3M62B 4M01A 4W9CA 4DHZB 5CHWA 4BKTA 1MFWA 2G4SA 3U7DA 3FSSA 3L16A 3EHVA 1OQQA 5DI9B 4OHJA 3WYFB 1HE8A 2FBWB 3G9WA 4Z2NA 1FXTB 2L52A 4HVBA 2G4DB 2PVGC 1FCLA 1VZ8A 1ZC4B 2FE8A 2Y3AA 4YTMB 2W2WA 3RCZA 2X8XX 3BY4B 4DX8A 2A5UA 3LJUX 1DROA 2N9XA 4DDID 3DBHI 2ZPNA 2D9VA 2MKRA 4JKDA 2DX5A 3N1XC 3A1QB 2QCZA 1DOIA 4WJNA 1J0GA 1E8YA 4EKUA 1VRAB 3IT6B 2M19A 4ANXA 2IY1B 2YT0A 4GB9A 1R4MB 1DDMA 1V61A 2ZVNA 2MA9B 4A3OA 5DH9B 4FBJB 2WP9B 2WQYB 2PVOD 3QIJA 4CHMA 1OMWA 2MBQA 3IBEA 2ZEQA 2KHWB 1Y56A 4MT7A 1SE2A 1FNWA 5C23A 4DK5A 2M38A 4ANWA 3T3OA 2DAFA 1YX5B 2X38A 3DVNU 4ZHPA 4M0WB 3VXWA 2R82A 4BAXA 1E0ZA 2V4LA 4GU2A 5BMHA 2D3AA 1DYNA 2KQSA 2KFKA 2N7DA 2R61A 2MFQA 4AWJA 3WA0A 1V1PB 1WX7A 4L1BA 1X86A 4JK9A 2AQ2B 4IM0A 3BVGA 1WJMA 3BVMA 1BMLC 1ACCA 2D9ZA 3K9OB 4IW0A 5AZGA 2CJNA 2DN6A 3V6EB 2DHJA 1WIAA 2YS1A 4QJ3B 2R09A 1I35A 3P2BA 2QSDA 4JGHB 2DYBA 4S17A 1DDWA 2KANA 4NJ7A 2D5GA 1Q67A 1WJUA 2ASQA 4FLHA 2MBHA 4YXDB 3KRWA 4RMAA 1Y5OA 3RPFC 5H8YE 1AWEA 5BYQA 3QQ8B 1N6ZA 3NS1A 1OQYA 4W9KA 4GGQA 2GBMA 2V3NA 3MDBC 4MH8A 5T8IA 2OTXA 4ZOHC 5C16A 2IBIB 1NTIA 3AN1A 4KHAA 4CO7A 2DENB 2GJYA 3GOEA 4IDIA 5IRSA 3APDA 4AJWA 2YRYA 2N9EB 5HE3A 1G6JA 2ZKMX 3NUHB 1DGJA 3RCPA 1RJ2A 3V05A 4EJNA 3PVWA 2CKHB 2VZKD 3VUYA 3QJZA 3A8QA 3T06A 3VTUA 1F1HA 2L1AA 4PQ0A 3V62A 2RDGA 2KIEA 2Z0DB 3P42A 2BWFA 4KZCA 2MP2B 4ZRQA 4ANUA 5KHQA 1UUPA 1VR9A 2LVOA 3U7ZA 4ILJA 2Q5WD 4FJZA 1NU2A 2NCNA 3AE9B 1UNQA 2D3GA 2WXRA 1UPRA 4EFOA 4IM3A 1S1QB 3PO0A 1GGOA 1RWSA 2MEKA 3ZGZA 1EU4A 2IO3B 1C1YB 3CF6E 3OJ4B 2SAKA 1NBFC 1E8WA 1X1MA 2V3PA 2FCMA 1FFVA 2KCJA 2LFIA 1I4GA 1L6UA 1LFDA 3A9JA 1WI0A 4PS7A 3P4PB 2FUHB 1XF5L 2ZJDA 3IHPC 2FCSA 4G3XB 4IKGA 1JQ4A 1P7FA 2KWUB 1HQRD 4GMVA 2L3ZA 2BS4B 4KDIC 2GBRA 1Q0WB 1JWMD 3ZVRA 3VR9B 4I6NB 2J59M 1WMHA 1L5PA 1MPEA 4K2PA 4WSFA 3DVGY 3JSVB 4WQMA 1E10A 4JKAA 3ECIA 5HI1A 5E6JA 1WGRA 3E9SA 3A98B 2J53A 1BUIC 1YN5A 3GZNB 1LO5D 2IYDB 1FRRA 4OZBA 5CLLB 3W1SA 1T0QC 4EOYA 2D11A 2WXPA 1PFDA 3AE6B 3SO6A 2AYOB 2DZJA 4ILHA 3AI5A 3WAMA 1Z5SB 2KACA 2LUMA 3TCAA 2CU1A 2GCJA 3QARA 2O6VA 4KIKA 4CSQA 2KJHB 2INDC 1NVLA 2BYVE 2K3UA 2KUQA 1PUTA 1L6VA 2BKFA 1SB3C 2KJRA 1XO3A 2LXAA 2G45B 2QJLA 1KFYB 2B3AA 4JKGB 1U2BA 5FI0A 4BVUC 1JCKB 4PNKA 1XLOA 1B1ZA 1UZXB 1SSNA 2XNAC 2INCC 1VZ6A 2KFJA 4F7HA 1P7EA 3MC9A 2N4FA 2NMQA 2WXNA 1KZ7A 1QOGA 5L81A 2E2XA 3TL5A 4FA6A 3FP5A 5HE0A 2L0FA 3ODXA 1WI1A 4A9AA 5LOPB 2VH1A 3N3KB 4I6LB 4LNKA 3TJPA 2W9NA 2K00A 3T3NA 2CS4A 5BMGA 1KRHA 3NHEB 1WRIA 2JUOA 2RUKB 1YJJA 2VH2A 3ULCA 1WX8A 3SHQA 1W1HA 5CTRC 4YONA 1F2RI 2MQJA 2KNBA 2W82A 3FEHA 1UH6A 4Y94A 1KLGD 4US8A 1KLUD 3QC8B 1T3QA 5DHAB 1NDDA 2ZPYA 4N58A 1TY0A 1KJTA 1UBIA 5BYRA 1V97A 1UWMA 2MHJA 1X11A 1HZ5A 1PLSA 4B9KA 2LGDA 2KX3A 2LGXA 2BVCA 4ICUA 3SFEB 3AULA 1A5RA 2EKIA 4JKFA 2BCJA 2JZPA 1C4PA 2NTTA 3BINA 3DBLB 3KQ4A 5DCNA 3RNCC 1N61A 4K81A 1N5XA 3ZXRA 3NY5A 1WZ3A 1D5ZC 2RPVA 5D3YA 1VCBA 2BF8B 2M0XA 2DYQA 3QAQA 1UNPA 5IAAC 2VSZA 2K49A 2QMTA 2DHZA 3D8FA 4GOUA 1YIWA 4IUMB 1SJED 3I57A 4XGAB 2PLPA 4B0MA 2CQUA 1ZYIA 4AS1A 3NS8A 4MH0E 1NYQA 3PP2A 1RFAA 3IT4B 1K51A 2N1WA 2MX2A 2DA0A 1PYWD 1FGZA 1KM7A 2GLSA 2OJWA 3KYCD 4CHJA 2D3CA 3PS6A 2G3QB 2J42A 4A5KA 3ZW3A 1WFYA 1SE3A 1MKEA 3BZDB 1L0XB 1K53A 1V5MA 3ZKJC 1VDVA 2JPHA 3GYOA 3PLVA 4W9LA 1TGZB 5DPWA 2CU3A 4EEWA 2E3TA 1PMSA 3X0WA 1GPXA 1ZOYB 3CXBB 5TSSA 3OAWA 4P1CC 2GUMA 3HW2B 3SFDB 1ZKHA 1MJDA 3UI3A 4K7UA 2IGGA 3N20C 1KBLA 4WWMA 3RN9C 1BTNA 4KZ0A 5HG2A 2FNJB 3DCGA 2HJ1A 5CX3A 1PDXA 4K7SA 2WX1A 5IO9A 2FDQA 2K39A 4N59A 4X57B 3N9YC 2VRRB 1FCCC 1UELA 2KIGA 2V76A 4P7IA 1W1DA 3PVLA 3LJ3A 4A6FB 1EUVB 4JKEA 4IOIE 3DCXA 4BBNC 5KQ1A 3E66A 5FI1A 1K50A 2KOXA 4W9JA 1SHCA 1FGYA 1JW9D 5EFXA 1QILA 2DHIA 3B9JA 3PSEB 1MI0A 4C80A 3RI7C 2WXOA 5LNK1 4FXCA 1TZ1A 4K7WA 4YL8A 4KHBA 1AARA 1OGWA 4FJVB 3Q6BA 5IP4D 3TMPB 2QC8A 3MHSD 2RDBC 1K5DB 1XT9B 1TKGA 2KT7A 4DHJD 1I7AA 3VR8B 2K8EA 1WGQA 3Q69A 1V49A 2I5CA 1FHOA 2V1YA 3AB5A 2CY4A 2Y5PA 3FILB 4JPSA 2RGFA 3R8BA 4K17A 3P63A 2N0YA 3DWGC 2DYOA 2XK5B 1VBHA 3I9V1 1YX6B 3AH7A 1XX0A 4MJSA 3UGBB 3TIXA 5J18A 4HROA 1I4XA 4BBNF 1QLBB 2PW9A 4MACA 3IFWB 3RT3B 5C2TB 1T0RC 4HJKA 4JIOU 4WQOB 2JF5A 3PREA 3AECB 3VOQA 4GDKB 5EE3A 4NY0A 3B77A 4YWGG 1YD8U 2KN4A 2M4NA 2I2YA 1X1FA 3EFUA 4WVFB 5D2MB 1XEEA 2LVPA 5DPSA 4F8CB 2WDRB 1W1GA 1M7EA 5EDSA 2NBVA 2AQ1B 2Z13A 1P1AA 2C9WB 3MFGA 1ZXIA 2GMIC 1AQCA 3PSCA 2JZZA 3U4EG 1QF6A 1P3RA 2PZ1A 4LNFA 2ZCBA 2KTRA 3Q8FA 1V81A 2HE7A 2ADZA 1I4RA 4MM3B 5I2SA 1JWUD 4C4VA 3AE4B 2DYNA 4HCPB 2RDHA 2K1FA 2IO2B 1AN8A 5E6OA 2KDBA 3MC8A 2D9XA 2R0DA 3TEYA 2HTHA 4KGRA 3VTVA 4REZA 2AL3A 1H4RA 3HRDD 5G2NA 2C7HA 3KUCB 2JU6X 1V5UA 2DKQA 1UPQA 2LHDA 2ZVOA 5J3YA 4GLSC 3Q14C 5GXGB 2BW2A 1BXTA 2KMCA 1C76A 2UVMA 2BKRB 3DBRB 3DPDA 2QILA 3E9OA 3LXFA 4OVVA 3Q8CA 1N63A 3ZNZB 5CHVC 1R4MI 2H7DA 1J7CA 4MSQB 2I1JA 1C78A 4NAWA 4W9DA 2L8JA 3C19A 4RM9A 1PGXA 3M3JA 2MJEA 1Q10A 4QXAB 4YTPB 1I7HA 3FC4A 2EMSA 5E6PA 2DZMA 4ZRPA 1LB1A 4XX5A 3JVZX 4PT5A 2MSED 1NTYA 1SXTA 3J9CA 1CMXB 2RSUA 3RFZB 4KV2A 2JSVX 2Z8LA 2AWTA 3UF8A 2V4IB 4HLEA 1QQRA 1FAOA 2DIKA 2D4QA 4BBKA 2ROZB 1YQ3B 1HTOA 4OVZA 3ZO5B 3NWFA 4P16A 4DXGA 1FD6A 2IZVB 2D9WA 5AZFA 2RSGA 1MHXA 3CIKA 4UDUC 2RQ1A 1YJIA 2YEPB 1SE4A 2KR0A 3KYDD 1SEBD 3DXDA 2WXMA 4LNNA 4MT5A 2H88B 4IAPA 2NR2A 3RUIB 4RH6A 1QOBA 3PRMB 4WAAA 1AYFA 3HHMA 1YMHE 1ESFA 2QEJC 3A8PA 4PK1A 3P4QB 2KWVB 3KVFB 5C6RA 3OJ3A 2K25A 4KKJA 4MGYE 3ZNID 1V8CA 2WXKA 3UINB 1NENB 3IAS1 4XZ4A 1SJHD 3LDZE 2Y8GA 4LK0M 1TTNA 1XLNA 2WXIA 3Q2AC 3AU5A 4M02A 2CR5A 2K9XA 1D5MC 2V0GA 1WRDB 1GAQB 3H8HA 3AXCA 1WM3A 4ZDVA 1FHXA 3PRPB 2GRIA 2KN5A 1IBXA 5G55A 2E6XA 3Q3MC 1BTKA 2KDFB 4YSZB 4HKZE 1JRPA 5L83A 1WJ4A 3GP7A 2L05A 2XQNM 3EFCA 4DBGA 2W54A 3PZ7A 4HB2B 2DX1A 3DBHB 3KUDB 3N30A 1DYQA 3KWLA 2JRIB 1MK7B 1GUAB 3MJ5A 2D07B 2GBKA 3O65B 2O2VB 1I4PA 3A4SC 2J4XA 3UQBA 4XDDA 4ZRJA 3DOWA 3NW8A 4C00A 5M4YB 3EA6A 4AOFA 1WM2A 2GBNA 5AEKB 4GSWA 5LXHA 2YT1A 3W5UB 2LI5A 3PZ8A 1ZM0A 4W9GA 1NVID 4GXBA 1E7UA 1FHWA 4RGTA 4O1NA 3QA8A 3D8DA 5C5BA 4EZJA 3U2SC 2L32A 1E7VA 2HJ8A 5HE2A 1F9JA 2KWDA 3DDCB 1KLVA 1RRBA 2JVCA 3L13A 2UYZB 1N5WA 1WGGA 2Z59B 3BYYB 2AL6A 5D3WA 2MBOA 2X18A 2JY6A 3B1LX 3PLUA 1TT5B 1TJEA 2QKLA 1HB6A 1ZP0B 2Q13A 3TEXA 1KH0A 1EAZA 4MDKE 3A1QA 3OG5A 3QX1A 1A70A 2O6VD 2N9KA 3SEBA 3CSFA 3W9CB 1YQBA 4XDCA 4I6PA 2J0MA 4NZLB 2YF0A 3KWVA 3EC8A 1WG7A 3V3XA 2Y8FA 2KAJA 3Q8AA 1LGRA 3P4RB 1J8CA 3MJWA 4RNAA 2EELA 4EZLA 1RAXA 4CYEA 1ZXHA 4HCNB 1UNSA 5I2MA 1Y19B 1H8CA 4WIPA 1TS5A 1FOEA 4M0WA 5AUIA 3TSSA 5IOIA 3APCA 1ZGUB 3ZJTA 2RNRB 1V1PA 3GS2A 5DPTA 2BWES 2INPE 4R3DA 4IWQA 2W2XC 3PG7A 2IO0B 1I4QA 2R2QA 3QWZB 1E6EB 3QHTA 1TXDA 2COFA 1EM7A 1U4AA 1DDVA 1E8XA 4HAVB 3ZVVA 3AE2B 4A90A 1DIKA 1SGHA 2PE6B 4XYCA 2W2XD 1WGHA 2WXQA 2Z0PA 2FCNA 4HAZB 2LMCA 2GI9A 5JP4A 5C1ZA 1TS3A 1PGAA 2OEDA 3AE3B 4OSNA 2ZW0A 1X05A 4HSIA 4JKCA 2N23A 3U52E 3URYA 1MAIA 3AEDB 5DHFB 1FNVA 2P0HA 4DDGD 3R7QA 3OLMD 1T6BX 1FPYA 5FR6A 4EUTA 1EVHA 5G5HA 1XQQA 2BYEA 4QJ4B 1UGMA 3RNFC 2W3RA 5H92C 1WYGA 1WXVA 1J7BA 2UWQA 1K8RB 2JX5A 3A9KB 4WWNA 2INNE 4W9HA 1U5EA 3WANA 2QDFA 4ARIA 2RR9A 2RMMA 2MWNB 2J0KA 3HQCA 1WH3A 1V5TA 3SYXA 2MW5A 4A8XC 3ZNGC 4PYUA 1L0VB 3DBLI 4WJOA 1R7SA 2BQQA 3UQAA 2MP2A 3VUXA 2M17A 1F52A 3Q8EA 4H2AA 3U30A 2LGSA 3WAOA 3H7PB 4IWPA 2Z0QA 5DPRA 5JHBA 4WURA 3UZTA 1ZSQA 4NPNA 4MEMA 1WY8A 1ET9A 1P3QU 5KHOA 3MTNB 3Q3JA 4ZRIA 1V89A 2LEKA 3DXCA 3V61A 3NVYA 2LD9A 1BWNA 1OQNA 1XKEA 2L2IA 1WSPA 3ZDMC 4FADA 1QZEA 5IA7A 2D10A 1UNRA 2M8SA 3QK0A 3F0WA 1U27A 3VVWB 1MI1A 1TS2A 2LOXA 3ML4A 4YSXB 2I5FA 1RLFA 1R4NI 1CK1A 4TV3A 2QKMA 1N60A 1D6EC 1M7RA 3W2DA 4L6EA 3NZ3A 4WJ7A 4S0RA 1WF9A 3DVGX 5LXIB 5J2RA 2RLOA 4OZCA 1ET6A 1L7YA 1WWTA 1B9RA 1Q5WB 4TQ0A 3JSVA 2DHKA 3TW1A 1FFUA 3IAM1 3V5WA 1TS4A 2IGHA 3RZFA 2M0AA 5JHAA 2MBBB 4LDTB 2N9LA 4KX6B 3RNEC 2L0TA 4ILGB 2JYEA 2KYWA 2DTCA 3W1YA 3B2GA 4HB4B 1FXAA 1V86A 3RNGC 1FMAD 4TUUA 2JRHA 2JQRB 1DBHA 2NBWB 3L10B 1MG4A 1QT9A 2C7NB 4WWOA 4NAMA 1WE7A 1WGUA 2LXCA 4JKGA 1K5GB 2WXFA 1ACAA 2NPTB 3AEGB 1WJNA 4A6KA 2BT6A 3WALA 3AM9A 1E8ZA 2LWPA 5LLIA 2BB6A 3AE5B 3AMZA 4GPTB 4HDQA 4YTNB 4TSSA 1HBKA 2AQ3B 1FRDA 4A6HA 2BTEA 3NVZA 1QQGA 3I63C 1IGDA 2BS3B 2CB8A 4GNKB 1I4HA 4GIVA 1C4AA 3L54A 4AQ7A 3HIZA 2HDEA 5D6JB 1KZGA 1EGXA 2M1MA 3E9LA 2MBEA 4JK8A 3L0WB 3ZUNA 2ICIA 1FEHA 5GOWB 2KK8A 4B6WA 4ZYSA 1SE9A 4US9A 3BVZA 2X0SA 2G1EA 4XE0A 2MDXA 3HM6X 3DWMA 2WGSA 2K8HA 1KC7A 3N1YC 2DZIA 3C8YA 2KD0A 1EWYC 3ZJVA 3N32A 4GDLB 5E6NA 3SR6A 2QIEB 2K2JA 5LG4B 2H89B 2N7EA 2JXXA 5AZHA 2WS3B 4RFBA 1Y8RC 4D2KA 2LYDA 4K3CA 1TBEA 3ONSA 1EU3A 5J3QA 3NSUA 1N62A 5D3DA 3P4SB 5JXVA 2H7EA 1IP9A 4TQ1A 5IKCM 5D27A 3ZJUA 3FLVA 4ZRKA 3P6AA 2MJ3A 2QHOA 2DYMA 1FNUA 2FAZA 2WU2B 3MHZA 4EZKA 5IN7A 1Z87A 2C5LC 3AE8B 2Y5BB 4LJOB 1C77A 1JWBD 2ZW1A 5JHGA 2KQ7A 1U5FA 1FB8A 2DAJA 3DQVA 2L00B 3A4RA 3TVVA 4LLGM 4KSKC 3H9DA 3B08A 1JMLA 3HVDA 1NYRA 2DZKA 4DIXA 4YT0B 2WXLA 1MK9B 3KRXA 1L4DB 1P6SA 2BS2B 2DX5B 5BYSA 2Y5CA 1GB4A 3BK1A 2WWZA 1T0SC 1HTQA 3L08A 3ENBA 4HRSA 4FJYA 3DBRI 2WU5B 4BKSD 2J52A 1D3ZA 3NZUA 5EE0A 1VBGA 3MP9A 1C79A 3NVVA 1I2HA 3HVZA 4JK7A 4MK0A 1IYFA 1XLPA 1ZUD2 4F1SA 4M8MA 4PYZA 1FXIA 4KAXB 4W9EA 4N9F4 3APFA 1WXAA 2KFKB 2MWSB 2YT2A 3VDZA 2FJUB 4JL9A 4CHKA 4G50A 2LHEA 1D5XC 2LRUA 3GE3C 4LNOA 4HEA1 3NG0A 1I42A 4KSLC 2ZNVB 2N7JA 4J6IA 4E71A 4BZAA 3JYUA 2RPQA 3AU4A 4IFSA 2GB1A 4A6FA 2PE9A 4A6QA 3N7CA 2NVUI 4JQWC 4NQLB 4BKGA 1RRPB 1XCTL 3UIPB 4RM8A 3Q3OC 1WGDA 4DX90 4LCDE 2EKEC 2ZNVC 1P9DU 5HKHA 4TKNA 5EE9A 1XCQL 3FVCA 4XWTA 4WWPA 1P0RA 2JT4B 4FHJA 1OFFA 2DKPA 3VQIA 1WYWB 3NOBA 2ZZPB 2D3BA 1GB1A 2Z14A 4HB3B 3M63B 5IJMA 4KHOA 1DOYA 1JWAD 2KKCA 1Z2MA 2LVQA 2OJRA 2K8BA 3F5RA 4ITKA 3Q3FA 1WX9A 3FILA 3DXEA 3AV8A 1NI3A 1ZVRA 1QOAA 4BKSA 2KJ6A 4WH4A 2HTME 2FIFA 4IC7B 3ZRCA 2XK5A 2D2QA 1T5XD 4KKIA 5HE1A 4A20A 3V60A 3ZTCA 3FKYA 2FIDA 1RM6C 4WJQA 4QAYA 4F7UP 2BBCA 1OEYJ 3ML8A 4XWWA 3EGRA 2YLMA 4RGNA 4IWOA 1FO4A 2KMAA 3VRBB 3RD2A 1L4ZB 2HD5B 2L7RA 3SNHA 3B0AA 2K8CA 3NJTA 3Q3NC 4GDKA 3LYYA 3VFKA 1GC6A 1FIQA 3KUZA 4MSMB 2LGIA 1U5DA 4HHVA 3K9PB 4QJ5B 2GBJA 4WAFA 4RGMA 1RFKA 4BOSC 3NZSA 2R2OA 2IO1B 2A4ZA 3I5JC 1L2NA 1RYJA 3KZ1A 4JKBA 2WDTB 4NNJB 1E9MA 1B55A 3KY9A 1JWSD 2EJ8A 4D6WA 4NJCA 2KUPA 1ZC3B 2IDYA 2RRFA 2NBUA 3A9JB 3P7ZA 1LW3A 3BWUD 2WHIA 2COCA 1C3TA 4Z2MB 1OQRA 1YNTE 2M14A 5DIFB 4J3OD 4MM3A 3TO1A 4GOCA 2GOWA 1ENFA 2ZCCA 5LONB 4HWIB 2B76B 5J17A 2Z0OA 2LKOA 1XCGA 2JWUA 4L23A 2UZRA 2KGXB 3ZTDA 2L83A 2MJDA 3M95A 1ZPSA 2KO3A 4AUQC 4BFRA 1MIZB 2YEPF 3VRAB 5KQ4A 1WMHB 3SBTA 2W3SA 3CWIA 5C3JB 4OVUA 1V5OA 4C7ZA 3HM3A 2MLBA 4ANVA
chains in the Genus database with same CATH topology
3VAWA 4KVGB 1WJ6A 4F7GA 4HATB 2P0FA 5CHFA 1V80A 1H10A 1BAKA 1E90A 5TR5A 1WR1A 3T8MA 2P0DA 1YJ1A 4IG7B 1T0YA 2FCQA 3ZLZA 2EC1A 2L76A 3W1SC 2O6VB 4KIKB 4ASWC 2JP2A 5L95C 3VIAA 4GZUA 3FM8C 4A3PA 3DVNV 4MGIE 1GG3A 1LXDA 2LOZA 2C60A 4W9IA 2Y7BA 3CMMB 3PEGA 3RYTA 2ELAA 3D32A 1EF5A 1TJ6A 1JRUA 4MGKE 3ZNHB 5JHHA 2AEHA 3E9PA 4HK2A 5D7GA 5CLQB 3RULA 3ZDTA 2ELBA 3SUZA 4HAXB 2RVBB 3GZNI 2EMTA 4E3CA 3GYPA 3PHXB 1P98A 3M1IB 2KX0A 4F7ZA 3TFMA 1WZ0A 2NMBA 1V2YA 2WX0A 2CODA 2GCLA 4E74A 1U29A 4HAWB 3ENEA 1NI2A 2CY5A 4II3B 1OTRB 3ODOA 1OEYA 2BYFA 2RD0A 1J0WA 2NS5A 2I1KA 3AJ4A 2LZ6A 1MG8A 2O2VA 3SDLC 3RZWC 3X23A 4AJYB 2LRWA 3EPYA 2C7MB 1WXSA 1GNUA 1ISNA 2XBBC 2REXA 1QC6A 1NTVA 4HPLB 4HAUB 2BPSA 2COPA 4NSWA 2XEWA 4B95A 3H1UA 4AP4C 2JZ3B 2CHXA 5D94A 5JVLA 1GC7A 3PVUA 2KDEB 3H7SA 3S2AA 2WH5A 2LGYA 4DWFA 1XD3B 1HB8A 2YS3A 2UZSA 3H6NA 3PGEA 1WGYA 2KTFA 3SU8X 1V5PA 2IFSA 2HRJA 3PTFC 1JDEA 2MCNB 5KCVA 1J19A 2VRWB 3DBSA 4GN1A 3KH0A 4HDOA 2OQBA 1V6EA 2N9PC 2OOBB 3U8ZA 1E5WA 2COAA 1OY2A 3ULBA 3VH4B 1XR0B 2LG1A 3CSTA 3SV1A 3O96A 2JWZA 2DFKA 1U5GA 4KHBB 3VHTC 4W9FA 1KOTA 1IRSA 4WJPA 4HPMB 1XD4A 3QBVB 3VH3B 4TYZA 4C0AA 4XWXA 5D3VA 1MIXA 3MPXA 2KZRA 5JZEB 2KDIA 1S3SG 1PQSA 4H8SA 2ROVA 3V6CB 4DBBA 4MY6A 3VTWA 2KVRA 2K2UA 4MJSB 2J0JA 4PS3A 2GS0A 2P8VA 5D3XA 2MRPA 1EF1A 3VUWA 4HAYB 3A9KA 2FJ9A 4LDTD 3D8EA 2PJHA 2KWCA 1UD7A 2LUEA 4LJPB 1GJZA 4ZYNA 2CHWA 4HB0B 3PHWB 2NBVB 1IPGA 3QWMA 1M94A 2YVCA 3C0RB 5GMVA 2LASA 4KDLB 4M8NA 3BJIA 2KTRB 3WIMA 3PT2B 4GMXB 3H7PA 3QCAA 3IG3A 4JLCA 5BO4B 4JKHA 2HTHB 4DHJB 1UEFA 3ML9A 3KW5B 1WVHA 1WJ1A 2N1VA 3KSYA 3R7RA 3SBGA 2FJLA 4G11A 3PPAA 2WYQA 1Q1OA 4MELA 4NJ6A 4XC2A 3PZDA 4NAWB 2BGFA 4IM2A 2PPHA 2ABDA 3ALBA 2J7QB 3SD5A 3L17A 1XODA 2G35A 1LM8B 2K6QA 3A33B 2CAYA 3ODWA 3PV1A 2KLGA 3R3MA 4NQKE 3PRZA 2K6DB 1ZW7A 2CHZA 2KXJA 1V88A 4URKA 3HK0A 2VKIA 1EO6A 4DXAB 1KI1B 1UBQA 1X1GA 1BT0A 4FULA 2LJ5A 3ZIMA 1WXMA 4DHZE 2YSZA 4FN2A 4IOYX 2L1CA 4BOZB 2RGNB 5JLJB 4K2OA 4EMOA 4ICVA 1P5TA 1TQZA 2LULA 5C79A 3OANA 2DLWA 3UIOB 3ZRFA 2NPTA 4II2B 1LQBA 1N3HA 4K1RB 2IYBA 2KC2A 2PEAA 3EECA 3R66C 2LBBA 4G0NB 1MPHA 1WE6A 3IVFA 2D9YA 2CRFA 2IY0B 2V3SA 2Z0EB 1VD2A 4B6HA 3T9LA 2KLCA 5J3TA 1PFJA 3TBLD 1SIFA 5JH5C 4PS8A 1V9JA 4D0NB 2YS5A 2NZ8B 4GDLA 2KC1A 4MGZE 3JW0X 4FHKA 3I3TB 3WAPA 1WR6E 4HXDA 1ST7A 5C5BB 3M62B 4DHZB 4W9CA 5CHWA 4BKTA 2G4SA 3U7DA 3FSSA 3L16A 3EHVA 5DI9B 3WYFB 1HE8A 3G9WA 4Z2NA 1FXTB 4HVBA 2G4DB 1ZC4B 2W2WA 3RCZA 3BY4B 4DX8A 2A5UA 3LJUX 1DROA 2N9XA 4DDID 3DBHI 2ZPNA 2D9VA 2MKRA 4JKDA 2DX5A 3A1QB 4WJNA 1J0GA 1E8YA 4EKUA 4ANXA 2IY1B 2YT0A 4GB9A 1DDMA 1V61A 2ZVNA 2MA9B 4A3OA 5DH9B 4FBJB 3QIJA 4CHMA 1OMWA 2MBQA 3IBEA 2ZEQA 2KHWB 4MT7A 5C23A 4DK5A 2M38A 4ANWA 2DAFA 1YX5B 3DVNU 4M0WB 3VXWA 2R82A 2V4LA 4GU2A 1DYNA 2KQSA 2KFKA 2N7DA 2MFQA 4AWJA 3WA0A 1WX7A 1X86A 4JK9A 4IM0A 1WJMA 2D9ZA 3K9OB 4IW0A 5AZGA 2DN6A 3V6EB 2DHJA 1WIAA 2YS1A 2R09A 1I35A 3P2BA 4JGHB 2DYBA 1DDWA 2KANA 4NJ7A 1Q67A 1WJUA 2ASQA 4FLHA 2MBHA 3KRWA 4RMAA 1Y5OA 1AWEA 3QQ8B 1OQYA 4W9KA 4GGQA 2GBMA 3MDBC 2OTXA 5C16A 2IBIB 1NTIA 4KHAA 4CO7A 2DENB 2GJYA 3GOEA 3APDA 4AJWA 2YRYA 2N9EB 5HE3A 1G6JA 3RCPA 1RJ2A 4EJNA 3PVWA 2CKHB 3VUYA 3QJZA 3A8QA 3T06A 3VTUA 4PQ0A 3V62A 2Z0DB 4KZCA 2BWFA 2MP2B 4ANUA 5KHQA 2LVOA 4ILJA 4FJZA 1NU2A 2NCNA 1UNQA 2D3GA 1UPRA 4EFOA 4IM3A 1S1QB 1GGOA 2IO3B 1C1YB 3CF6E 3OJ4B 1NBFC 1E8WA 1X1MA 2FCMA 2KCJA 1LFDA 3A9JA 1WI0A 4PS7A 2FUHB 2ZJDA 3IHPC 2FCSA 4G3XB 2KWUB 4GMVA 2L3ZA 4KDIC 2GBRA 1Q0WB 3ZVRA 4I6NB 2J59M 1WMHA 4K2PA 4WSFA 3DVGY 3JSVB 4JKAA 3ECIA 1WGRA 3A98B 2IYDB 5CLLB 3W1SA 4EOYA 2D11A 3SO6A 2AYOB 2DZJA 4ILHA 3AI5A 3WAMA 1Z5SB 3TCAA 2CU1A 2GCJA 3QARA 2O6VA 4KIKA 2KJHB 1NVLA 2BYVE 2BKFA 2KJRA 2LXAA 2G45B 2B3AA 4JKGB 1U2BA 5FI0A 4BVUC 4PNKA 1UZXB 2KFJA 4F7HA 2N4FA 1KZ7A 5L81A 2E2XA 3TL5A 4FA6A 3FP5A 5HE0A 2L0FA 3ODXA 1WI1A 5LOPB 3N3KB 4I6LB 3TJPA 2W9NA 2K00A 2CS4A 3NHEB 2JUOA 2RUKB 3SHQA 3ULCA 1WX8A 1W1HA 5CTRC 4YONA 2MQJA 2KNBA 3FEHA 1UH6A 4Y94A 3QC8B 5DHAB 1NDDA 2ZPYA 1KJTA 1UBIA 1X11A 1PLSA 4B9KA 2LGDA 2KX3A 2LGXA 4ICUA 3AULA 1A5RA 4JKFA 2BCJA 3BINA 5DCNA 4K81A 3NY5A 1WZ3A 5D3YA 1VCBA 2BF8B 2M0XA 2DYQA 3QAQA 1UNPA 5IAAC 2VSZA 2DHZA 3D8FA 1YIWA 4IUMB 2CQUA 3NS8A 4MH0E 3PP2A 1RFAA 2N1WA 2MX2A 2DA0A 1FGZA 1KM7A 3KYCD 4CHJA 3PS6A 2G3QB 4A5KA 3ZW3A 1WFYA 1MKEA 1V5MA 3ZKJC 4W9LA 2JPHA 3GYOA 3PLVA 1TGZB 5DPWA 4EEWA 1PMSA 3X0WA 3CXBB 3OAWA 3HW2B 1ZKHA 4K7UA 1KBLA 1BTNA 4KZ0A 2FNJB 3DCGA 5CX3A 4K7SA 2WX1A 2FDQA 2K39A 4X57B 2VRRB 1UELA 2V76A 4P7IA 1W1DA 3PVLA 3LJ3A 4A6FB 1EUVB 4JKEA 4BBNC 5KQ1A 3E66A 5FI1A 2KOXA 4W9JA 1SHCA 1FGYA 5EFXA 2DHIA 3PSEB 1TZ1A 4K7WA 4YL8A 1AARA 1OGWA 4FJVB 3TMPB 3MHSD 1K5DB 1XT9B 4DHJD 1I7AA 1WGQA 1V49A 2I5CA 1FHOA 2V1YA 2CY4A 2RGFA 4K17A 2N0YA 2DYOA 2XK5B 1VBHA 1YX6B 1XX0A 4MJSA 3UGBB 3TIXA 5J18A 4BBNF 3IFWB 3RT3B 4HJKA 4JIOU 4WQOB 2JF5A 3PREA 3VOQA 4GDKB 4NY0A 1YD8U 2M4NA 1X1FA 3EFUA 4WVFB 5D2MB 2LVPA 5DPSA 4F8CB 1W1GA 1M7EA 5EDSA 1P1AA 2C9WB 2GMIC 1AQCA 3PSCA 2JZZA 1P3RA 2PZ1A 2ZCBA 2KTRA 1V81A 2HE7A 2ADZA 2DYNA 4HCPB 2K1FA 2IO2B 5E6OA 2KDBA 2D9XA 2R0DA 2HTHA 3VTVA 2AL3A 1H4RA 5G2NA 2C7HA 3KUCB 1V5UA 2DKQA 1UPQA 2ZVOA 5J3YA 2KMCA 2BKRB 2UVMA 3DPDA 3E9OA 4OVVA 3ZNZB 5CHVC 1R4MI 2H7DA 4MSQB 2I1JA 4NAWA 4W9DA 2L8JA 4RM9A 3M3JA 2EMSA 5E6PA 2DZMA 1LB1A 4XX5A 3JVZX 2MSED 1NTYA 1CMXB 2RSUA 4KV2A 3UF8A 2AWTA 4HLEA 1FAOA 2DIKA 2D4QA 4BBKA 2ROZB 3ZO5B 2IZVB 2D9WA 5AZFA 2RSGA 3CIKA 2RQ1A 3KYDD 3DXDA 4IAPA 2NR2A 3RUIB 3PRMB 4WAAA 3HHMA 3A8PA 2KWVB 3KVFB 5C6RA 3OJ3A 2K25A 4MGYE 3ZNID 3UINB 4XZ4A 3LDZE 2Y8GA 1TTNA 3AU5A 2CR5A 1WRDB 3AXCA 1WM3A 4ZDVA 1FHXA 3PRPB 2KN5A 5G55A 1BTKA 2KDFB 5L83A 1WJ4A 2L05A 2XQNM 4DBGA 4HB2B 2DX1A 3KUDB 3N30A 2JRIB 1MK7B 1GUAB 2D07B 2GBKA 3O65B 2O2VB 3A4SC 3UQBA 4ZRJA 3DOWA 4AOFA 1WM2A 2GBNA 5AEKB 4GSWA 5LXHA 2YT1A 2LI5A 1ZM0A 4W9GA 4GXBA 1E7UA 1FHWA 3QA8A 3D8DA 5C5BA 4EZJA 1E7VA 2HJ8A 5HE2A 1F9JA 3DDCB 1KLVA 1RRBA 2JVCA 3L13A 2UYZB 1WGGA 2Z59B 2AL6A 5D3WA 2MBOA 2X18A 2JY6A 3B1LX 3PLUA 2QKLA 1HB6A 2Q13A 1EAZA 4MDKE 3A1QA 3QX1A 2O6VD 3CSFA 1YQBA 4I6PA 2J0MA 2YF0A 3EC8A 1WG7A 2Y8FA 1J8CA 3MJWA 4EZLA 1RAXA 4CYEA 4HCNB 1Y19B 1H8CA 1FOEA 3APCA 1ZGUB 2RNRB 5DPTA 2BWES 4IWQA 2W2XC 3PG7A 2IO0B 2R2QA 3QWZB 3QHTA 1TXDA 2COFA 1U4AA 1DDVA 1E8XA 4HAVB 3ZVVA 1DIKA 1SGHA 2PE6B 2W2XD 1WGHA 2Z0PA 2FCNA 4HAZB 5JP4A 5C1ZA 1X05A 4JKCA 2N23A 1MAIA 5DHFB 2P0HA 4DDGD 3R7QA 3OLMD 5FR6A 4EUTA 1EVHA 1XQQA 2BYEA 1UGMA 1WXVA 2UWQA 1K8RB 3A9KB 4WWNA 4W9HA 1U5EA 3WANA 2RR9A 2MWNB 2J0KA 3HQCA 1WH3A 1V5TA 3SYXA 2MW5A 3ZNGC 4PYUA 4WJOA 3DBLI 3UQAA 2MP2A 3VUXA 2M17A 3U30A 3WAOA 3H7PB 4IWPA 2Z0QA 5DPRA 5JHBA 3UZTA 1ZSQA 4NPNA 4MEMA 1WY8A 5KHOA 1P3QU 3MTNB 3Q3JA 4ZRIA 1V89A 3DXCA 3V61A 2LD9A 1BWNA 1OQNA 1XKEA 2L2IA 3ZDMC 4FADA 1QZEA 5IA7A 2D10A 1UNRA 2M8SA 3QK0A 3F0WA 1U27A 3VVWB 2LOXA 3ML4A 2I5FA 1RLFA 1R4NI 4TV3A 2QKMA 1M7RA 4L6EA 4WJ7A 1WF9A 3DVGX 5LXIB 5J2RA 2RLOA 1L7YA 1Q5WB 4TQ0A 3JSVA 2DHKA 3TW1A 3V5WA 3RZFA 5JHAA 2MBBB 4LDTB 2L0TA 4ILGB 2DTCA 3W1YA 4HB4B 1V86A 4TUUA 2JRHA 1DBHA 2NBWB 3L10B 2C7NB 4WWOA 1WE7A 1WGUA 2LXCA 4JKGA 1K5GB 1ACAA 2NPTB 1WJNA 4A6KA 3WALA 1E8ZA 2LWPA 5LLIA 4GPTB 4HDQA 1HBKA 4A6HA 1QQGA 2CB8A 4GIVA 3L54A 3HIZA 5D6JB 1KZGA 1EGXA 2M1MA 3E9LA 2MBEA 4JK8A 3L0WB 3ZUNA 5GOWB 2KK8A 4B6WA 1SE9A 2X0SA 2MDXA 3HM6X 2K8HA 1KC7A 2DZIA 2KD0A 3N32A 4GDLB 5E6NA 2K2JA 2N7EA 2JXXA 5AZHA 1Y8RC 2LYDA 1TBEA 3ONSA 5J3QA 3NSUA 2H7EA 1IP9A 4TQ1A 5D27A 3FLVA 4ZRKA 3P6AA 2QHOA 2DYMA 2FAZA 4EZKA 1Z87A 2C5LC 2Y5BB 4LJOB 5JHGA 2KQ7A 1U5FA 1FB8A 2DAJA 3DQVA 2L00B 3A4RA 3TVVA 4KSKC 3H9DA 3B08A 2DZKA 1MK9B 3KRXA 1P6SA 2DX5B 2WWZA 3L08A 3ENBA 4FJYA 3DBRI 4BKSD 1D3ZA 3NZUA 1VBGA 1I2HA 4JK7A 4MK0A 1IYFA 4F1SA 4M8MA 4PYZA 4KAXB 4W9EA 4N9F4 3APFA 1WXAA 2KFKB 2MWSB 3VDZA 4JL9A 4CHKA 4G50A 2LRUA 1I42A 4KSLC 2ZNVB 4J6IA 4E71A 3JYUA 2RPQA 3AU4A 4IFSA 2PE9A 4A6FA 3N7CA 2NVUI 4JQWC 4NQLB 4BKGA 1RRPB 3UIPB 4RM8A 1WGDA 4DX90 4LCDE 2EKEC 2ZNVC 1P9DU 5HKHA 4TKNA 4WWPA 1P0RA 2JT4B 4FHJA 2DKPA 3VQIA 1WYWB 3NOBA 2ZZPB 4HB3B 3M63B 5IJMA 4KHOA 2KKCA 1Z2MA 2LVQA 2OJRA 2K8BA 3F5RA 3Q3FA 1WX9A 3DXEA 1ZVRA 4BKSA 2KJ6A 4IC7B 2FIFA 3ZRCA 2XK5A 2D2QA 5HE1A 4A20A 3V60A 3ZTCA 2FIDA 4WJQA 4F7UP 1OEYJ 3ML8A 2YLMA 4IWOA 2KMAA 3RD2A 2HD5B 2L7RA 3SNHA 3B0AA 2K8CA 3VFKA 4GDKA 1GC6A 3KUZA 4MSMB 1U5DA 4HHVA 3K9PB 2GBJA 4BOSC 3NZSA 2R2OA 2IO1B 2A4ZA 1L2NA 3KZ1A 4JKBA 2WDTB 4NNJB 1B55A 3KY9A 2EJ8A 2KUPA 1ZC3B 3A9JB 2NBUA 3P7ZA 1LW3A 2COCA 1C3TA 4Z2MB 2M14A 5DIFB 4MM3A 3TO1A 4GOCA 2GOWA 2ZCCA 5LONB 4HWIB 5J17A 2Z0OA 2LKOA 1XCGA 2UZRA 2KGXB 3ZTDA 3M95A 2KO3A 4AUQC 4BFRA 1MIZB 5KQ4A 1WMHB 3SBTA 4OVUA 1V5OA 3HM3A 2MLBA 4ANVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  4KVG B;  1WJ6 A;  4F7G A;  4HAT B;  2P0F A;  5CHF A;  1V80 A;  1H10 A;  1BAK A;  1E90 A;  5TR5 A;  1WR1 A;  3T8M A;  2P0D A;  1YJ1 A;  4IG7 B;  1T0Y A;  2FCQ A;  3ZLZ A;  2EC1 A;  2L76 A;  3W1S C;  2O6V B;  4KIK B;  4ASW C;  2JP2 A;  5L95 C;  3VIA A;  4GZU A;  3FM8 C;  4A3P A;  3DVN V;  4MGI E;  1GG3 A;  1LXD A;  2LOZ A;  2C60 A;  4W9I A;  2Y7B A;  3CMM B;  3PEG A;  3RYT A;  2ELA A;  3D32 A;  1EF5 A;  1TJ6 A;  1JRU A;  4MGK E;  3ZNH B;  5JHH A;  2AEH A;  4HK2 A;  5D7G A;  5CLQ B;  3RUL A;  3ZDT A;  2ELB A;  3SUZ A;  4HAX B;  2RVB B;  3GZN I;  2EMT A;  4E3C A;  3GYP A;  3PHX B;  1P98 A;  3M1I B;  2KX0 A;  4F7Z A;  3TFM A;  1WZ0 A;  2NMB A;  1V2Y A;  2WX0 A;  2COD A;  2GCL A;  4E74 A;  1U29 A;  4HAW B;  3ENE A;  1NI2 A;  2CY5 A;  4II3 B;  1OTR B;  3ODO A;  1OEY A;  2BYF A;  2RD0 A;  1J0W A;  2NS5 A;  2I1K A;  3AJ4 A;  2LZ6 A;  1MG8 A;  2O2V A;  3SDL C;  3RZW C;  3X23 A;  4AJY B;  2LRW A;  3EPY A;  2C7M B;  1WXS A;  1GNU A;  1ISN A;  2XBB C;  2REX A;  1QC6 A;  1NTV A;  4HPL B;  4HAU B;  2BPS A;  2COP A;  4NSW A;  2XEW A;  4B95 A;  3H1U A;  4AP4 C;  2JZ3 B;  2CHX A;  5D94 A;  1GC7 A;  3PVU A;  2KDE B;  3H7S A;  3S2A A;  2WH5 A;  2LGY A;  4DWF A;  1XD3 B;  1HB8 A;  2YS3 A;  2UZS A;  3H6N A;  3PGE A;  1WGY A;  2KTF A;  3SU8 X;  1V5P A;  2IFS A;  2HRJ A;  3PTF C;  2MCN B;  5KCV A;  1J19 A;  2VRW B;  3DBS A;  4GN1 A;  3KH0 A;  4HDO A;  2OQB A;  1V6E A;  2N9P C;  2OOB B;  3U8Z A;  1E5W A;  2COA A;  1OY2 A;  3ULB A;  3VH4 B;  1XR0 B;  2LG1 A;  3CST A;  3SV1 A;  3O96 A;  2JWZ A;  2DFK A;  1U5G A;  4KHB B;  3VHT C;  4W9F A;  1KOT A;  1IRS A;  4WJP A;  4HPM B;  1XD4 A;  3QBV B;  3VH3 B;  4TYZ A;  4C0A A;  4XWX A;  5D3V A;  1MIX A;  3MPX A;  2KZR A;  5JZE B;  2KDI A;  1S3S G;  1PQS A;  4H8S A;  2ROV A;  3V6C B;  4DBB A;  4MY6 A;  3VTW A;  2KVR A;  2K2U A;  4MJS B;  2J0J A;  4PS3 A;  2GS0 A;  2P8V A;  5D3X A;  2MRP A;  1EF1 A;  3VUW A;  4HAY B;  3A9K A;  2FJ9 A;  4LDT D;  3D8E A;  2PJH A;  2KWC A;  1UD7 A;  2LUE A;  4LJP B;  1GJZ A;  4ZYN A;  2CHW A;  4HB0 B;  3PHW B;  2NBV B;  1IPG A;  3QWM A;  1M94 A;  2YVC A;  3C0R B;  5GMV A;  2LAS A;  4KDL B;  4M8N A;  3BJI A;  2KTR B;  3WIM A;  3PT2 B;  4GMX B;  3H7P A;  3QCA A;  3IG3 A;  4JLC A;  5BO4 B;  2HTH B;  4DHJ B;  1UEF A;  3ML9 A;  3KW5 B;  1WVH A;  1WJ1 A;  2N1V A;  3KSY A;  3R7R A;  2FJL A;  4G11 A;  3PPA A;  2WYQ A;  1Q1O A;  4MEL A;  4NJ6 A;  4XC2 A;  3PZD A;  4NAW B;  2BGF A;  4IM2 A;  2PPH A;  2ABD A;  3ALB A;  2J7Q B;  3SD5 A;  3L17 A;  1XOD A;  2G35 A;  1LM8 B;  2K6Q A;  3A33 B;  2CAY A;  3ODW A;  3PV1 A;  2KLG A;  3R3M A;  4NQK E;  3PRZ A;  2K6D B;  1ZW7 A;  2CHZ A;  2KXJ A;  1V88 A;  4URK A;  3HK0 A;  2VKI A;  1EO6 A;  4DXA B;  1KI1 B;  1UBQ A;  1X1G A;  1BT0 A;  4FUL A;  2LJ5 A;  3ZIM A;  1WXM A;  4DHZ E;  2YSZ A;  4FN2 A;  4IOY X;  2L1C A;  4BOZ B;  2RGN B;  5JLJ B;  4K2O A;  4EMO A;  4ICV A;  1P5T A;  1TQZ A;  2LUL A;  5C79 A;  3OAN A;  2DLW A;  3UIO B;  3ZRF A;  2NPT A;  4II2 B;  1LQB A;  1N3H A;  4K1R B;  2IYB A;  2KC2 A;  2PEA A;  3EEC A;  3R66 C;  2LBB A;  4G0N B;  1MPH A;  1WE6 A;  3IVF A;  2D9Y A;  2CRF A;  2IY0 B;  2V3S A;  2Z0E B;  1VD2 A;  4B6H A;  3T9L A;  2KLC A;  5J3T A;  1PFJ A;  3TBL D;  1SIF A;  5JH5 C;  4PS8 A;  1V9J A;  4D0N B;  2YS5 A;  2NZ8 B;  4GDL A;  2KC1 A;  4MGZ E;  3JW0 X;  4FHK A;  3I3T B;  3WAP A;  1WR6 E;  4HXD A;  1ST7 A;  5C5B B;  3M62 B;  4DHZ B;  4W9C A;  5CHW A;  4BKT A;  2G4S A;  3U7D A;  3FSS A;  3L16 A;  3EHV A;  5DI9 B;  3WYF B;  1HE8 A;  3G9W A;  4Z2N A;  1FXT B;  4HVB A;  2G4D B;  1ZC4 B;  2W2W A;  3RCZ A;  3BY4 B;  4DX8 A;  2A5U A;  3LJU X;  1DRO A;  2N9X A;  4DDI D;  3DBH I;  2ZPN A;  2D9V A;  2MKR A;  2DX5 A;  3A1Q B;  4WJN A;  1J0G A;  1E8Y A;  4EKU A;  4ANX A;  2IY1 B;  2YT0 A;  4GB9 A;  1DDM A;  1V61 A;  2ZVN A;  2MA9 B;  4A3O A;  5DH9 B;  4FBJ B;  3QIJ A;  4CHM A;  1OMW A;  2MBQ A;  3IBE A;  2ZEQ A;  2KHW B;  4MT7 A;  5C23 A;  4DK5 A;  2M38 A;  4ANW A;  2DAF A;  1YX5 B;  3DVN U;  4M0W B;  3VXW A;  2V4L A;  4GU2 A;  1DYN A;  2KQS A;  2KFK A;  2N7D A;  2MFQ A;  4AWJ A;  3WA0 A;  1WX7 A;  1X86 A;  4IM0 A;  1WJM A;  2D9Z A;  3K9O B;  4IW0 A;  5AZG A;  2DN6 A;  3V6E B;  2DHJ A;  1WIA A;  2YS1 A;  2R09 A;  1I35 A;  3P2B A;  4JGH B;  2DYB A;  1DDW A;  2KAN A;  4NJ7 A;  1Q67 A;  1WJU A;  2ASQ A;  4FLH A;  2MBH A;  3KRW A;  4RMA A;  1Y5O A;  1AWE A;  3QQ8 B;  1OQY A;  4W9K A;  4GGQ A;  2GBM A;  3MDB C;  2OTX A;  5C16 A;  2IBI B;  1NTI A;  4KHA A;  4CO7 A;  2DEN B;  2GJY A;  3GOE A;  3APD A;  4AJW A;  2YRY A;  2N9E B;  5HE3 A;  1G6J A;  3RCP A;  1RJ2 A;  4EJN A;  3PVW A;  2CKH B;  3VUY A;  3QJZ A;  3A8Q A;  3T06 A;  3VTU A;  4PQ0 A;  3V62 A;  2Z0D B;  4KZC A;  2BWF A;  2MP2 B;  4ANU A;  5KHQ A;  2LVO A;  4FJZ A;  1NU2 A;  2NCN A;  1UNQ A;  2D3G A;  1UPR A;  4EFO A;  4IM3 A;  1S1Q B;  2IO3 B;  1C1Y B;  3CF6 E;  3OJ4 B;  1NBF C;  1E8W A;  1X1M A;  2FCM A;  2KCJ A;  1LFD A;  3A9J A;  1WI0 A;  4PS7 A;  2FUH B;  2ZJD A;  3IHP C;  2FCS A;  4G3X B;  2KWU B;  4GMV A;  2L3Z A;  4KDI C;  2GBR A;  1Q0W B;  3ZVR A;  4I6N B;  2J59 M;  1WMH A;  4K2P A;  4WSF A;  3DVG Y;  3JSV B;  3ECI A;  1WGR A;  3A98 B;  2IYD B;  5CLL B;  3W1S A;  4EOY A;  2D11 A;  3SO6 A;  2AYO B;  2DZJ A;  3AI5 A;  3WAM A;  1Z5S B;  3TCA A;  2CU1 A;  2GCJ A;  3QAR A;  2O6V A;  4KIK A;  2KJH B;  1NVL A;  2BYV E;  2BKF A;  2KJR A;  2LXA A;  2G45 B;  2B3A A;  1U2B A;  5FI0 A;  4BVU C;  4PNK A;  1UZX B;  2KFJ A;  4F7H A;  2N4F A;  1KZ7 A;  5L81 A;  2E2X A;  3TL5 A;  4FA6 A;  3FP5 A;  5HE0 A;  2L0F A;  3ODX A;  1WI1 A;  5LOP B;  3N3K B;  4I6L B;  3TJP A;  2W9N A;  2K00 A;  2CS4 A;  3NHE B;  2JUO A;  2RUK B;  3SHQ A;  3ULC A;  1WX8 A;  1W1H A;  5CTR C;  4YON A;  2MQJ A;  2KNB A;  3FEH A;  1UH6 A;  4Y94 A;  3QC8 B;  5DHA B;  1NDD A;  2ZPY A;  1KJT A;  1UBI A;  1X11 A;  1PLS A;  4B9K A;  2LGD A;  2KX3 A;  2LGX A;  4ICU A;  3AUL A;  1A5R A;  2BCJ A;  3BIN A;  5DCN A;  4K81 A;  3NY5 A;  1WZ3 A;  5D3Y A;  1VCB A;  2BF8 B;  2M0X A;  2DYQ A;  3QAQ A;  1UNP A;  5IAA C;  2VSZ A;  2DHZ A;  3D8F A;  1YIW A;  4IUM B;  2CQU A;  3NS8 A;  4MH0 E;  3PP2 A;  1RFA A;  2N1W A;  2MX2 A;  2DA0 A;  1FGZ A;  1KM7 A;  3KYC D;  4CHJ A;  3PS6 A;  2G3Q B;  4A5K A;  3ZW3 A;  1WFY A;  1MKE A;  1V5M A;  3ZKJ C;  4W9L A;  2JPH A;  3GYO A;  3PLV A;  1TGZ B;  5DPW A;  4EEW A;  1PMS A;  3X0W A;  3CXB B;  3OAW A;  3HW2 B;  1ZKH A;  4K7U A;  1BTN A;  4KZ0 A;  2FNJ B;  3DCG A;  5CX3 A;  4K7S A;  2WX1 A;  2FDQ A;  2K39 A;  4X57 B;  2VRR B;  1UEL A;  2V76 A;  4P7I A;  1W1D A;  3PVL A;  3LJ3 A;  4A6F B;  1EUV B;  4BBN C;  5KQ1 A;  5FI1 A;  2KOX A;  4W9J A;  1SHC A;  1FGY A;  5EFX A;  2DHI A;  3PSE B;  1TZ1 A;  4K7W A;  4YL8 A;  1AAR A;  1OGW A;  4FJV B;  3TMP B;  3MHS D;  1K5D B;  1XT9 B;  4DHJ D;  1I7A A;  1WGQ A;  1V49 A;  2I5C A;  1FHO A;  2V1Y A;  2CY4 A;  2RGF A;  4K17 A;  2N0Y A;  2DYO A;  2XK5 B;  1YX6 B;  1XX0 A;  4MJS A;  3UGB B;  3TIX A;  5J18 A;  4BBN F;  3IFW B;  3RT3 B;  4HJK A;  4JIO U;  4WQO B;  2JF5 A;  3PRE A;  3VOQ A;  4GDK B;  4NY0 A;  1YD8 U;  2M4N A;  1X1F A;  3EFU A;  4WVF B;  5D2M B;  2LVP A;  5DPS A;  4F8C B;  1W1G A;  1M7E A;  5EDS A;  1P1A A;  2C9W B;  2GMI C;  1AQC A;  3PSC A;  2JZZ A;  1P3R A;  2PZ1 A;  2ZCB A;  2KTR A;  1V81 A;  2HE7 A;  2ADZ A;  2DYN A;  4HCP B;  2K1F A;  2IO2 B;  5E6O A;  2KDB A;  2D9X A;  2R0D A;  2HTH A;  3VTV A;  2AL3 A;  1H4R A;  5G2N A;  2C7H A;  3KUC B;  1V5U A;  2DKQ A;  1UPQ A;  2ZVO A;  5J3Y A;  2KMC A;  2BKR B;  2UVM A;  3DPD A;  4OVV A;  3ZNZ B;  5CHV C;  1R4M I;  2H7D A;  4MSQ B;  2I1J A;  4NAW A;  4W9D A;  2L8J A;  4RM9 A;  3M3J A;  2EMS A;  5E6P A;  2DZM A;  1LB1 A;  4XX5 A;  3JVZ X;  2MSE D;  1NTY A;  1CMX B;  2RSU A;  4KV2 A;  3UF8 A;  2AWT A;  4HLE A;  1FAO A;  2D4Q A;  4BBK A;  2ROZ B;  3ZO5 B;  2IZV B;  2D9W A;  5AZF A;  2RSG A;  3CIK A;  2RQ1 A;  3KYD D;  3DXD A;  4IAP A;  2NR2 A;  3RUI B;  3PRM B;  4WAA A;  3HHM A;  3A8P A;  2KWV B;  3KVF B;  5C6R A;  3OJ3 A;  2K25 A;  4MGY E;  3ZNI D;  3UIN B;  4XZ4 A;  3LDZ E;  2Y8G A;  1TTN A;  3AU5 A;  2CR5 A;  1WRD B;  3AXC A;  1WM3 A;  4ZDV A;  1FHX A;  3PRP B;  2KN5 A;  5G55 A;  1BTK A;  2KDF B;  5L83 A;  1WJ4 A;  2L05 A;  2XQN M;  4DBG A;  4HB2 B;  2DX1 A;  3KUD B;  3N30 A;  2JRI B;  1MK7 B;  1GUA B;  2D07 B;  2GBK A;  3O65 B;  2O2V B;  3A4S C;  3UQB A;  4ZRJ A;  3DOW A;  4AOF A;  1WM2 A;  2GBN A;  5AEK B;  4GSW A;  5LXH A;  2YT1 A;  2LI5 A;  1ZM0 A;  4W9G A;  4GXB A;  1E7U A;  1FHW A;  3QA8 A;  3D8D A;  5C5B A;  4EZJ A;  1E7V A;  2HJ8 A;  5HE2 A;  1F9J A;  3DDC B;  1KLV A;  1RRB A;  2JVC A;  3L13 A;  2UYZ B;  1WGG A;  2Z59 B;  2AL6 A;  5D3W A;  2MBO A;  2X18 A;  2JY6 A;  3B1L X;  3PLU A;  2QKL A;  1HB6 A;  2Q13 A;  1EAZ A;  4MDK E;  3A1Q A;  3QX1 A;  2O6V D;  3CSF A;  1YQB A;  4I6P A;  2J0M A;  2YF0 A;  3EC8 A;  1WG7 A;  2Y8F A;  1J8C A;  3MJW A;  4EZL A;  1RAX A;  4CYE A;  4HCN B;  1Y19 B;  1H8C A;  1FOE A;  3APC A;  1ZGU B;  2RNR B;  5DPT A;  2BWE S;  4IWQ A;  2W2X C;  3PG7 A;  2IO0 B;  2R2Q A;  3QWZ B;  3QHT A;  1TXD A;  2COF A;  1U4A A;  1DDV A;  1E8X A;  4HAV B;  3ZVV A;  1SGH A;  2PE6 B;  2W2X D;  1WGH A;  2Z0P A;  2FCN A;  4HAZ B;  5JP4 A;  5C1Z A;  1X05 A;  2N23 A;  1MAI A;  5DHF B;  2P0H A;  4DDG D;  3R7Q A;  3OLM D;  5FR6 A;  4EUT A;  1EVH A;  1XQQ A;  2BYE A;  1UGM A;  1WXV A;  2UWQ A;  1K8R B;  3A9K B;  4WWN A;  4W9H A;  1U5E A;  3WAN A;  2RR9 A;  2MWN B;  2J0K A;  3HQC A;  1WH3 A;  1V5T A;  3SYX A;  2MW5 A;  3ZNG C;  4PYU A;  4WJO A;  3DBL I;  3UQA A;  2MP2 A;  3VUX A;  2M17 A;  3U30 A;  3WAO A;  3H7P B;  4IWP A;  2Z0Q A;  5DPR A;  5JHB A;  3UZT A;  1ZSQ A;  4NPN A;  4MEM A;  1WY8 A;  5KHO A;  1P3Q U;  3MTN B;  3Q3J A;  4ZRI A;  1V89 A;  3DXC A;  3V61 A;  2LD9 A;  1BWN A;  1OQN A;  1XKE A;  2L2I A;  3ZDM C;  4FAD A;  1QZE A;  5IA7 A;  2D10 A;  1UNR A;  2M8S A;  3QK0 A;  3F0W A;  1U27 A;  3VVW B;  2LOX A;  3ML4 A;  2I5F A;  1RLF A;  1R4N I;  4TV3 A;  2QKM A;  1M7R A;  4L6E A;  4WJ7 A;  1WF9 A;  3DVG X;  5LXI B;  5J2R A;  2RLO A;  1L7Y A;  1Q5W B;  4TQ0 A;  3JSV A;  2DHK A;  3TW1 A;  3V5W A;  3RZF A;  5JHA A;  2MBB B;  4LDT B;  2L0T A;  2DTC A;  3W1Y A;  4HB4 B;  1V86 A;  4TUU A;  2JRH A;  1DBH A;  2NBW B;  3L10 B;  2C7N B;  4WWO A;  1WE7 A;  1WGU A;  2LXC A;  1K5G B;  1ACA A;  2NPT B;  1WJN A;  4A6K A;  3WAL A;  1E8Z A;  2LWP A;  5LLI A;  4GPT B;  4HDQ A;  1HBK A;  4A6H A;  1QQG A;  2CB8 A;  4GIV A;  3L54 A;  3HIZ A;  5D6J B;  1KZG A;  1EGX A;  2M1M A;  2MBE A;  3L0W B;  3ZUN A;  5GOW B;  2KK8 A;  4B6W A;  1SE9 A;  2MDX A;  3HM6 X;  2K8H A;  2DZI A;  2KD0 A;  3N32 A;  4GDL B;  5E6N A;  2K2J A;  2N7E A;  2JXX A;  5AZH A;  1Y8R C;  2LYD A;  1TBE A;  3ONS A;  5J3Q A;  3NSU A;  2H7E A;  1IP9 A;  4TQ1 A;  5D27 A;  3FLV A;  4ZRK A;  3P6A A;  2QHO A;  2DYM A;  2FAZ A;  4EZK A;  1Z87 A;  2C5L C;  2Y5B B;  4LJO B;  5JHG A;  2KQ7 A;  1U5F A;  1FB8 A;  2DAJ A;  3DQV A;  2L00 B;  3A4R A;  3TVV A;  4KSK C;  3H9D A;  3B08 A;  2DZK A;  1MK9 B;  3KRX A;  1P6S A;  2DX5 B;  2WWZ A;  3L08 A;  4FJY A;  3DBR I;  4BKS D;  1D3Z A;  3NZU A;  1I2H A;  4MK0 A;  1IYF A;  4F1S A;  4M8M A;  4PYZ A;  4KAX B;  4W9E A;  4N9F 4;  3APF A;  1WXA A;  2KFK B;  2MWS B;  3VDZ A;  4JL9 A;  4CHK A;  4G50 A;  2LRU A;  1I42 A;  4KSL C;  2ZNV B;  4J6I A;  4E71 A;  3JYU A;  2RPQ A;  3AU4 A;  4IFS A;  2PE9 A;  4A6F A;  3N7C A;  2NVU I;  4JQW C;  4NQL B;  4BKG A;  1RRP B;  3UIP B;  4RM8 A;  1WGD A;  4DX9 0;  4LCD E;  2EKE C;  2ZNV C;  1P9D U;  5HKH A;  4TKN A;  4WWP A;  1P0R A;  2JT4 B;  4FHJ A;  2DKP A;  3VQI A;  1WYW B;  3NOB A;  2ZZP B;  4HB3 B;  3M63 B;  5IJM A;  4KHO A;  2KKC A;  1Z2M A;  2LVQ A;  2OJR A;  2K8B A;  3F5R A;  3Q3F A;  1WX9 A;  3DXE A;  1ZVR A;  4BKS A;  2KJ6 A;  4IC7 B;  2FIF A;  3ZRC A;  2XK5 A;  2D2Q A;  5HE1 A;  4A20 A;  3V60 A;  3ZTC A;  2FID A;  4WJQ A;  4F7U P;  1OEY J;  3ML8 A;  2YLM A;  4IWO A;  2KMA A;  3RD2 A;  2HD5 B;  2L7R A;  3SNH A;  3B0A A;  2K8C A;  3VFK A;  4GDK A;  1GC6 A;  3KUZ A;  4MSM B;  1U5D A;  4HHV A;  3K9P B;  2GBJ A;  4BOS C;  3NZS A;  2R2O A;  2IO1 B;  2A4Z A;  1L2N A;  3KZ1 A;  2WDT B;  4NNJ B;  1B55 A;  3KY9 A;  2EJ8 A;  2KUP A;  1ZC3 B;  3A9J B;  2NBU A;  3P7Z A;  1LW3 A;  2COC A;  1C3T A;  4Z2M B;  2M14 A;  5DIF B;  4MM3 A;  3TO1 A;  4GOC A;  2GOW A;  2ZCC A;  5LON B;  4HWI B;  5J17 A;  2Z0O A;  2LKO A;  1XCG A;  2UZR A;  2KGX B;  3ZTD A;  3M95 A;  2KO3 A;  4AUQ C;  4BFR A;  1MIZ B;  5KQ4 A;  1WMH B;  4OVU A;  1V5O A;  3HM3 A;  2MLB A;  4ANV A; 
#chains in the Genus database with same CATH topology
 3LB8 C;  3VAW A;  4RGO S;  1YQ4 B;  4KVG B;  1WJ6 A;  4F7G A;  3CIR B;  4HAT B;  3DHG C;  2P0F A;  4N6E B;  5CHF A;  1V80 A;  2VZK B;  3NWD A;  1H10 A;  1BAK A;  1E90 A;  2IPK D;  5FK9 C;  2LJI A;  5TR5 A;  2R2Y A;  1WR1 A;  3T8M A;  1C4C A;  2P0D A;  1YJ1 A;  4IG7 B;  1T0Y A;  3HUI A;  1SBB B;  2FCQ A;  2M56 B;  3ZLZ A;  2EC1 A;  2L76 A;  2PMV A;  3W1S C;  2O6V B;  4KIK B;  4JX1 C;  4ASW C;  3R2T A;  2JP2 A;  2WXH A;  5L95 C;  3VIA A;  4GZU A;  3FM8 C;  4A3P A;  3DVN V;  4MGI E;  1GG3 A;  4EE2 A;  1LXD A;  1QOF A;  2LOZ A;  2C60 A;  1C9F A;  2DBY A;  1E7P B;  4W9I A;  2TSS A;  2Y7B A;  1VJK A;  2KQ4 X;  3CMM B;  3PEG A;  3RYT A;  2ELA A;  3D32 A;  1EF5 A;  1TJ6 A;  1JRU A;  4MGK E;  3ZNH B;  5JHH A;  2AEH A;  3E9P A;  1MVK A;  4HK2 A;  5D7G A;  2KDM A;  5CLQ B;  3RUL A;  3NRZ A;  4L2Y A;  3NWA A;  4OZA A;  3ZDT A;  2ELB A;  3SUZ A;  4HAX B;  3BYT B;  2RVB B;  3GZN I;  2EMT A;  4E3C A;  4B0E A;  3GYP A;  3PHX B;  1IGC A;  1P98 A;  1WGK A;  3GE8 C;  3M1I B;  2KX0 A;  4JWS C;  4F7Z A;  3TFM A;  1WZ0 A;  4CQN A;  2NMB A;  1TKY A;  1V2Y A;  2WX0 A;  2COD A;  2GCL A;  4E74 A;  1U29 A;  3AE1 B;  3RMK C;  2ONQ A;  1JRO A;  4HAW B;  2XN9 C;  1J7A A;  3ENE A;  1NI2 A;  3RNB C;  2CY5 A;  2KMM A;  4II3 B;  2WNM A;  4TMA B;  1OTR B;  3ODO A;  4JE3 B;  1OEY A;  2BYF A;  3R2I A;  4ACF A;  3P1M A;  1HZ6 A;  2RD0 A;  1J0W A;  2NS5 A;  1HEZ E;  2I1K A;  3AJ4 A;  2LZ6 A;  1MG8 A;  2O2V A;  3ZXV A;  2ACZ B;  3HSA A;  3SDL C;  3RZW C;  1YOV B;  3X23 A;  4AJY B;  2LRW A;  3EPY A;  3DHH C;  2C7M B;  1WXS A;  1GNU A;  1ISN A;  2XBB C;  1CZP A;  2WXJ A;  5D3I B;  2REX A;  1QC6 A;  1NTV A;  4HPL B;  3OHM B;  4HAU B;  1CJE A;  2BPS A;  4LNI A;  2COP A;  2V9H A;  4NSW A;  2XEW A;  1FM0 D;  4B95 A;  3H1U A;  1IUE A;  2PTL A;  3HIE A;  1UF0 A;  4KGS A;  2Z59 A;  4AP4 C;  2JZ3 B;  2CHX A;  3N1Z C;  5D94 A;  5I4D A;  1UWX A;  4L1R A;  2WDV B;  5JVL A;  1GC7 A;  3PVU A;  2KDE B;  3H7S A;  2FUG 1;  1ZDX A;  3S2A A;  2WH5 A;  3W5V B;  2LGY A;  4DWF A;  1XD3 B;  1HB8 A;  2YS3 A;  2DLB A;  2UZS A;  3B2F A;  3H6N A;  3PGE A;  1WGY A;  2KTF A;  2JYT A;  3SU8 X;  1YN3 A;  4ZHO A;  1V5P A;  2IFS A;  2K0P A;  2HRJ A;  3PTF C;  1UGJ A;  1JDE A;  2MCN B;  5KCV A;  4DQO C;  1J19 A;  4LTU A;  2VRW B;  2K5P A;  1TY2 A;  3DBS A;  4GN1 A;  3KH0 A;  4HDO A;  2OQB A;  1V6E A;  1DOX A;  2N9P C;  2OOB B;  3ETR A;  3U8Z A;  1E5W A;  2COA A;  1OY2 A;  2MH7 A;  3ULB A;  3OWE B;  3VH4 B;  3IXS A;  3GB1 A;  3O13 A;  1XR0 B;  2LG1 A;  1TZO A;  4Q2J A;  3CST A;  5EE1 A;  3EUB 2;  3SV1 A;  3O96 A;  1QKZ A;  4HJG E;  4C56 C;  2JWZ A;  4C7Y A;  2DFK A;  3AEB B;  4RF0 A;  1U5G A;  4KHB B;  3VHT C;  4W9F A;  3TEW A;  1KOT A;  1IRS A;  4WJP A;  4HPM B;  1TIF A;  1XD4 A;  3QBV B;  3VH3 B;  4TYZ A;  1GOZ A;  4C0A A;  4M00 A;  3A58 A;  4XWX A;  5D3V A;  1KTK A;  1STE A;  3MC0 B;  1MIX A;  3MPX A;  1V1O A;  2KZR A;  2PIA A;  5AUK A;  5JZE B;  2KDI A;  1S3S G;  1PQS A;  1F0Z A;  4H8S A;  2ROV A;  4A55 A;  3V6C B;  4DBB A;  4MY6 A;  3VTW A;  2KVR A;  2WDQ B;  3AEE B;  1WXQ A;  2K2U A;  5HHD G;  4MJS B;  2J0J A;  1NEK B;  4PS3 A;  2WLB A;  2W55 A;  2GS0 A;  5G5G A;  2P8V A;  3Q8B A;  4KGT A;  5D3X A;  2MRP A;  1EF1 A;  3VUW A;  4HAY B;  2AX5 A;  2ON8 A;  3A9K A;  1F2R C;  2FJ9 A;  4LDT D;  3D8E A;  1KF6 B;  2PJH A;  2KWC A;  1R4N B;  1MHH E;  5FR3 A;  1UD7 A;  2LUE A;  1YN4 A;  4LJP B;  1GJZ A;  4ZYN A;  2CHW A;  2I38 A;  4HB0 B;  2DWQ A;  2SEB D;  3PHW B;  2NBV B;  2UU7 A;  1IPG A;  4P1B C;  3QWM A;  1L0Y B;  1M94 A;  3AEA B;  1ZDV A;  2YVC A;  3C0R B;  5GMV A;  2LAS A;  4KDL B;  1VZ7 A;  2DNF A;  1D4B A;  4M8N A;  3BJI A;  4OT1 A;  3ZYY X;  2KTR B;  3WIM A;  3PT2 B;  4GMX B;  4C4V B;  3AEF B;  2NTS A;  3H7P A;  3QCA A;  3IG3 A;  4JLC A;  5BO4 B;  3TEZ A;  4JKH A;  2HTH B;  4DHJ B;  1UEF A;  1ROE A;  1EWC A;  3ML9 A;  3KW5 B;  2Z4D A;  1WVH A;  2N0S B;  4P6V F;  1WJ1 A;  2N1V A;  4DXF A;  1XLQ A;  1SF0 A;  3KSY A;  3R7R A;  3SBG A;  2FJL A;  2BB5 A;  4G11 A;  4JWU C;  3PPA A;  2WYQ A;  3WCQ A;  1Q1O A;  4MEL A;  3KLS X;  4NJ6 A;  2G9H D;  4XC2 A;  3ZQ4 A;  1XXG A;  1TKE A;  3PZD A;  4NAW B;  2BGF A;  2PPH A;  4IM2 A;  2ABD A;  4K3B A;  3ALB A;  2J7Q B;  2IJ0 A;  3SD5 A;  3L17 A;  1XOD A;  2G35 A;  1LM8 B;  2K6Q A;  5BMI A;  3A33 B;  4YSY B;  2CAY A;  3ODW A;  3PV1 A;  2KLG A;  3R3M A;  4NQK E;  4RCO A;  1AW7 A;  2IGD A;  4HKQ A;  1AWD A;  3PRZ A;  2K6D B;  1ZW7 A;  2WXG A;  2CHZ A;  2KXJ A;  1V88 A;  4URK A;  1HA5 A;  1T77 A;  3HK0 A;  2VKI A;  1EO6 A;  4DXA B;  2PKO A;  4ARC A;  1KI1 B;  5MPO A;  2K22 A;  1UBQ A;  1X1G A;  1BT0 A;  4FUL A;  2LJ5 A;  3AE7 B;  3ZIM A;  1TYG B;  3TUO A;  1PGB A;  1WXM A;  4DHZ E;  2YSZ A;  4FN2 A;  4IOY X;  5FKA C;  2L1C A;  4BOZ B;  4USA A;  2RGN B;  5JLJ B;  1M4V A;  3BII D;  4K2O A;  4EMO A;  4ICV A;  1ZE3 D;  1P5T A;  1TQZ A;  2LUL A;  5C79 A;  3OAN A;  2DLW A;  4RF1 A;  3UIO B;  3ZRF A;  2NPT A;  4II2 B;  1LQB A;  1N3H A;  4K1R B;  3BK2 A;  3L4P A;  1CQV A;  2IYB A;  2KC2 A;  2PEA A;  3EEC A;  3R66 C;  1IBX B;  2LBB A;  2BYT A;  4G0N B;  1MPH A;  1WE6 A;  3IVF A;  2D9Y A;  3DHI C;  1SIJ A;  2CRF A;  3ABV B;  3NVW A;  2IY0 B;  2JXT A;  2V3S A;  2Z0E B;  3U12 A;  1VD2 A;  4B6H A;  3T9L A;  2KLC A;  5J3T A;  1JAL A;  1PFJ A;  1F77 A;  3FAH A;  2CJO A;  3TBL D;  1HXY D;  1SIF A;  3E56 A;  1K52 A;  5JH5 C;  2KVZ A;  4PS8 A;  1V9J A;  4D0N B;  2OHF A;  2YS5 A;  4HPP A;  2NZ8 B;  4GDL A;  2KC1 A;  4MGZ E;  3JW0 X;  4FHK A;  5HFY A;  3I3T B;  3WAP A;  1VLB A;  1WR6 E;  4OW0 A;  4HXD A;  3RNA C;  1ST7 A;  5C5B B;  3M62 B;  4M01 A;  4W9C A;  4DHZ B;  5CHW A;  4BKT A;  1MFW A;  2G4S A;  3U7D A;  3FSS A;  3L16 A;  3EHV A;  1OQQ A;  5DI9 B;  4OHJ A;  3WYF B;  1HE8 A;  2FBW B;  3G9W A;  4Z2N A;  1FXT B;  2L52 A;  4HVB A;  2G4D B;  2PVG C;  1FCL A;  1VZ8 A;  1ZC4 B;  2FE8 A;  2Y3A A;  4YTM B;  2W2W A;  3RCZ A;  2X8X X;  3BY4 B;  4DX8 A;  2A5U A;  3LJU X;  1DRO A;  2N9X A;  4DDI D;  3DBH I;  2ZPN A;  2D9V A;  2MKR A;  4JKD A;  2DX5 A;  3N1X C;  3A1Q B;  2QCZ A;  1DOI A;  4WJN A;  1J0G A;  1E8Y A;  4EKU A;  1VRA B;  3IT6 B;  2M19 A;  4ANX A;  2IY1 B;  2YT0 A;  4GB9 A;  1R4M B;  1DDM A;  1V61 A;  2ZVN A;  2MA9 B;  4A3O A;  5DH9 B;  4FBJ B;  2WP9 B;  2WQY B;  2PVO D;  3QIJ A;  4CHM A;  1OMW A;  2MBQ A;  3IBE A;  2ZEQ A;  2KHW B;  1Y56 A;  4MT7 A;  1SE2 A;  1FNW A;  5C23 A;  4DK5 A;  2M38 A;  4ANW A;  3T3O A;  2DAF A;  1YX5 B;  2X38 A;  3DVN U;  4ZHP A;  4M0W B;  3VXW A;  2R82 A;  4BAX A;  1E0Z A;  2V4L A;  4GU2 A;  5BMH A;  2D3A A;  1DYN A;  2KQS A;  2KFK A;  2N7D A;  2R61 A;  2MFQ A;  4AWJ A;  3WA0 A;  1V1P B;  1WX7 A;  4L1B A;  1X86 A;  4JK9 A;  2AQ2 B;  4IM0 A;  3BVG A;  1WJM A;  3BVM A;  1BML C;  1ACC A;  2D9Z A;  3K9O B;  4IW0 A;  5AZG A;  2CJN A;  2DN6 A;  3V6E B;  2DHJ A;  1WIA A;  2YS1 A;  4QJ3 B;  2R09 A;  1I35 A;  3P2B A;  2QSD A;  4JGH B;  2DYB A;  4S17 A;  1DDW A;  2KAN A;  4NJ7 A;  2D5G A;  1Q67 A;  1WJU A;  2ASQ A;  4FLH A;  2MBH A;  4YXD B;  3KRW A;  4RMA A;  1Y5O A;  3RPF C;  5H8Y E;  1AWE A;  5BYQ A;  3QQ8 B;  1N6Z A;  3NS1 A;  1OQY A;  4W9K A;  4GGQ A;  2GBM A;  2V3N A;  3MDB C;  4MH8 A;  5T8I A;  2OTX A;  4ZOH C;  5C16 A;  2IBI B;  1NTI A;  3AN1 A;  4KHA A;  4CO7 A;  2DEN B;  2GJY A;  3GOE A;  4IDI A;  5IRS A;  3APD A;  4AJW A;  2YRY A;  2N9E B;  5HE3 A;  1G6J A;  2ZKM X;  3NUH B;  1DGJ A;  3RCP A;  1RJ2 A;  3V05 A;  4EJN A;  3PVW A;  2CKH B;  2VZK D;  3VUY A;  3QJZ A;  3A8Q A;  3T06 A;  3VTU A;  1F1H A;  2L1A A;  4PQ0 A;  3V62 A;  2RDG A;  2KIE A;  2Z0D B;  3P42 A;  2BWF A;  4KZC A;  2MP2 B;  4ZRQ A;  4ANU A;  5KHQ A;  1UUP A;  1VR9 A;  2LVO A;  3U7Z A;  4ILJ A;  2Q5W D;  4FJZ A;  1NU2 A;  2NCN A;  3AE9 B;  1UNQ A;  2D3G A;  2WXR A;  1UPR A;  4EFO A;  4IM3 A;  1S1Q B;  3PO0 A;  1GGO A;  1RWS A;  2MEK A;  3ZGZ A;  1EU4 A;  2IO3 B;  1C1Y B;  3CF6 E;  3OJ4 B;  2SAK A;  1NBF C;  1E8W A;  1X1M A;  2V3P A;  2FCM A;  1FFV A;  2KCJ A;  2LFI A;  1I4G A;  1L6U A;  1LFD A;  3A9J A;  1WI0 A;  4PS7 A;  3P4P B;  2FUH B;  1XF5 L;  2ZJD A;  3IHP C;  2FCS A;  4G3X B;  4IKG A;  1JQ4 A;  1P7F A;  2KWU B;  1HQR D;  4GMV A;  2L3Z A;  2BS4 B;  4KDI C;  2GBR A;  1Q0W B;  1JWM D;  3ZVR A;  3VR9 B;  4I6N B;  2J59 M;  1WMH A;  1L5P A;  1MPE A;  4K2P A;  4WSF A;  3DVG Y;  3JSV B;  4WQM A;  1E10 A;  4JKA A;  3ECI A;  5HI1 A;  5E6J A;  1WGR A;  3E9S A;  3A98 B;  2J53 A;  1BUI C;  1YN5 A;  3GZN B;  1LO5 D;  2IYD B;  1FRR A;  4OZB A;  5CLL B;  3W1S A;  1T0Q C;  4EOY A;  2D11 A;  2WXP A;  1PFD A;  3AE6 B;  3SO6 A;  2AYO B;  2DZJ A;  4ILH A;  3AI5 A;  3WAM A;  1Z5S B;  2KAC A;  2LUM A;  3TCA A;  2CU1 A;  2GCJ A;  3QAR A;  2O6V A;  4KIK A;  4CSQ A;  2KJH B;  2IND C;  1NVL A;  2BYV E;  2K3U A;  2KUQ A;  1PUT A;  1L6V A;  2BKF A;  1SB3 C;  2KJR A;  1XO3 A;  2LXA A;  2G45 B;  2QJL A;  1KFY B;  2B3A A;  4JKG B;  1U2B A;  5FI0 A;  4BVU C;  1JCK B;  4PNK A;  1XLO A;  1B1Z A;  1UZX B;  1SSN A;  2XNA C;  2INC C;  1VZ6 A;  2KFJ A;  4F7H A;  1P7E A;  3MC9 A;  2N4F A;  2NMQ A;  2WXN A;  1KZ7 A;  1QOG A;  5L81 A;  2E2X A;  3TL5 A;  4FA6 A;  3FP5 A;  5HE0 A;  2L0F A;  3ODX A;  1WI1 A;  4A9A A;  5LOP B;  2VH1 A;  3N3K B;  4I6L B;  4LNK A;  3TJP A;  2W9N A;  2K00 A;  3T3N A;  2CS4 A;  5BMG A;  1KRH A;  3NHE B;  1WRI A;  2JUO A;  2RUK B;  1YJJ A;  2VH2 A;  3ULC A;  1WX8 A;  3SHQ A;  1W1H A;  5CTR C;  4YON A;  1F2R I;  2MQJ A;  2KNB A;  2W82 A;  3FEH A;  1UH6 A;  4Y94 A;  1KLG D;  4US8 A;  1KLU D;  3QC8 B;  1T3Q A;  5DHA B;  1NDD A;  2ZPY A;  4N58 A;  1TY0 A;  1KJT A;  1UBI A;  5BYR A;  1V97 A;  1UWM A;  2MHJ A;  1X11 A;  1HZ5 A;  1PLS A;  4B9K A;  2LGD A;  2KX3 A;  2LGX A;  2BVC A;  4ICU A;  3SFE B;  3AUL A;  1A5R A;  2EKI A;  4JKF A;  2BCJ A;  2JZP A;  1C4P A;  2NTT A;  3BIN A;  3DBL B;  3KQ4 A;  5DCN A;  3RNC C;  1N61 A;  4K81 A;  1N5X A;  3ZXR A;  3NY5 A;  1WZ3 A;  1D5Z C;  2RPV A;  5D3Y A;  1VCB A;  2BF8 B;  2M0X A;  2DYQ A;  3QAQ A;  1UNP A;  5IAA C;  2VSZ A;  2K49 A;  2QMT A;  2DHZ A;  3D8F A;  4GOU A;  1YIW A;  4IUM B;  1SJE D;  3I57 A;  4XGA B;  2PLP A;  4B0M A;  2CQU A;  1ZYI A;  4AS1 A;  3NS8 A;  4MH0 E;  1NYQ A;  3PP2 A;  1RFA A;  3IT4 B;  1K51 A;  2N1W A;  2MX2 A;  2DA0 A;  1PYW D;  1FGZ A;  1KM7 A;  2GLS A;  2OJW A;  3KYC D;  4CHJ A;  2D3C A;  3PS6 A;  2G3Q B;  2J42 A;  4A5K A;  3ZW3 A;  1WFY A;  1SE3 A;  1MKE A;  3BZD B;  1L0X B;  1K53 A;  1V5M A;  3ZKJ C;  1VDV A;  2JPH A;  3GYO A;  3PLV A;  4W9L A;  1TGZ B;  5DPW A;  2CU3 A;  4EEW A;  2E3T A;  1PMS A;  3X0W A;  1GPX A;  1ZOY B;  3CXB B;  5TSS A;  3OAW A;  4P1C C;  2GUM A;  3HW2 B;  3SFD B;  1ZKH A;  1MJD A;  3UI3 A;  4K7U A;  2IGG A;  3N20 C;  1KBL A;  4WWM A;  3RN9 C;  1BTN A;  4KZ0 A;  5HG2 A;  2FNJ B;  3DCG A;  2HJ1 A;  5CX3 A;  1PDX A;  4K7S A;  2WX1 A;  5IO9 A;  2FDQ A;  2K39 A;  4N59 A;  4X57 B;  3N9Y C;  2VRR B;  1FCC C;  1UEL A;  2KIG A;  2V76 A;  4P7I A;  1W1D A;  3PVL A;  3LJ3 A;  4A6F B;  1EUV B;  4JKE A;  4IOI E;  3DCX A;  4BBN C;  5KQ1 A;  3E66 A;  5FI1 A;  1K50 A;  2KOX A;  4W9J A;  1SHC A;  1FGY A;  1JW9 D;  5EFX A;  1QIL A;  2DHI A;  3B9J A;  3PSE B;  1MI0 A;  4C80 A;  3RI7 C;  2WXO A;  5LNK 1;  4FXC A;  1TZ1 A;  4K7W A;  4YL8 A;  4KHB A;  1AAR A;  1OGW A;  4FJV B;  3Q6B A;  5IP4 D;  3TMP B;  2QC8 A;  3MHS D;  2RDB C;  1K5D B;  1XT9 B;  1TKG A;  2KT7 A;  4DHJ D;  1I7A A;  3VR8 B;  2K8E A;  1WGQ A;  3Q69 A;  1V49 A;  2I5C A;  1FHO A;  2V1Y A;  3AB5 A;  2CY4 A;  2Y5P A;  3FIL B;  4JPS A;  2RGF A;  3R8B A;  4K17 A;  3P63 A;  2N0Y A;  3DWG C;  2DYO A;  2XK5 B;  1VBH A;  3I9V 1;  1YX6 B;  3AH7 A;  1XX0 A;  4MJS A;  3UGB B;  3TIX A;  5J18 A;  4HRO A;  1I4X A;  4BBN F;  1QLB B;  2PW9 A;  4MAC A;  3IFW B;  3RT3 B;  5C2T B;  1T0R C;  4HJK A;  4JIO U;  4WQO B;  2JF5 A;  3PRE A;  3AEC B;  3VOQ A;  4GDK B;  5EE3 A;  4NY0 A;  3B77 A;  4YWG G;  1YD8 U;  2KN4 A;  2M4N A;  2I2Y A;  1X1F A;  3EFU A;  4WVF B;  5D2M B;  1XEE A;  2LVP A;  5DPS A;  4F8C B;  2WDR B;  1W1G A;  1M7E A;  5EDS A;  2NBV A;  2AQ1 B;  2Z13 A;  1P1A A;  2C9W B;  3MFG A;  1ZXI A;  2GMI C;  1AQC A;  3PSC A;  2JZZ A;  3U4E G;  1QF6 A;  1P3R A;  2PZ1 A;  4LNF A;  2ZCB A;  2KTR A;  3Q8F A;  1V81 A;  2HE7 A;  2ADZ A;  1I4R A;  4MM3 B;  5I2S A;  1JWU D;  4C4V A;  3AE4 B;  2DYN A;  4HCP B;  2RDH A;  2K1F A;  2IO2 B;  1AN8 A;  5E6O A;  2KDB A;  3MC8 A;  2D9X A;  2R0D A;  3TEY A;  2HTH A;  4KGR A;  3VTV A;  4REZ A;  2AL3 A;  1H4R A;  3HRD D;  5G2N A;  2C7H A;  3KUC B;  2JU6 X;  1V5U A;  2DKQ A;  1UPQ A;  2LHD A;  2ZVO A;  5J3Y A;  4GLS C;  3Q14 C;  5GXG B;  2BW2 A;  1BXT A;  2KMC A;  1C76 A;  2UVM A;  2BKR B;  3DBR B;  3DPD A;  2QIL A;  3E9O A;  3LXF A;  4OVV A;  3Q8C A;  1N63 A;  3ZNZ B;  5CHV C;  1R4M I;  2H7D A;  1J7C A;  4MSQ B;  2I1J A;  1C78 A;  4NAW A;  4W9D A;  2L8J A;  3C19 A;  4RM9 A;  1PGX A;  3M3J A;  2MJE A;  1Q10 A;  4QXA B;  4YTP B;  1I7H A;  3FC4 A;  2EMS A;  5E6P A;  2DZM A;  4ZRP A;  1LB1 A;  4XX5 A;  3JVZ X;  4PT5 A;  2MSE D;  1NTY A;  1SXT A;  3J9C A;  1CMX B;  2RSU A;  3RFZ B;  4KV2 A;  2JSV X;  2Z8L A;  2AWT A;  3UF8 A;  2V4I B;  4HLE A;  1QQR A;  1FAO A;  2DIK A;  2D4Q A;  4BBK A;  2ROZ B;  1YQ3 B;  1HTO A;  4OVZ A;  3ZO5 B;  3NWF A;  4P16 A;  4DXG A;  1FD6 A;  2IZV B;  2D9W A;  5AZF A;  2RSG A;  1MHX A;  3CIK A;  4UDU C;  2RQ1 A;  1YJI A;  2YEP B;  1SE4 A;  2KR0 A;  3KYD D;  1SEB D;  3DXD A;  2WXM A;  4LNN A;  4MT5 A;  2H88 B;  4IAP A;  2NR2 A;  3RUI B;  4RH6 A;  1QOB A;  3PRM B;  4WAA A;  1AYF A;  3HHM A;  1YMH E;  1ESF A;  2QEJ C;  3A8P A;  4PK1 A;  3P4Q B;  2KWV B;  3KVF B;  5C6R A;  3OJ3 A;  2K25 A;  4KKJ A;  4MGY E;  3ZNI D;  1V8C A;  2WXK A;  3UIN B;  1NEN B;  3IAS 1;  4XZ4 A;  1SJH D;  3LDZ E;  2Y8G A;  4LK0 M;  1TTN A;  1XLN A;  2WXI A;  3Q2A C;  3AU5 A;  4M02 A;  2CR5 A;  2K9X A;  1D5M C;  2V0G A;  1WRD B;  1GAQ B;  3H8H A;  3AXC A;  1WM3 A;  4ZDV A;  1FHX A;  3PRP B;  2GRI A;  2KN5 A;  1IBX A;  5G55 A;  2E6X A;  3Q3M C;  1BTK A;  2KDF B;  4YSZ B;  4HKZ E;  1JRP A;  5L83 A;  1WJ4 A;  3GP7 A;  2L05 A;  2XQN M;  3EFC A;  4DBG A;  2W54 A;  3PZ7 A;  4HB2 B;  2DX1 A;  3DBH B;  3KUD B;  3N30 A;  1DYQ A;  3KWL A;  2JRI B;  1MK7 B;  1GUA B;  3MJ5 A;  2D07 B;  2GBK A;  3O65 B;  2O2V B;  1I4P A;  3A4S C;  2J4X A;  3UQB A;  4XDD A;  4ZRJ A;  3DOW A;  3NW8 A;  4C00 A;  5M4Y B;  3EA6 A;  4AOF A;  1WM2 A;  2GBN A;  5AEK B;  4GSW A;  5LXH A;  2YT1 A;  3W5U B;  2LI5 A;  3PZ8 A;  1ZM0 A;  4W9G A;  1NVI D;  4GXB A;  1E7U A;  1FHW A;  4RGT A;  4O1N A;  3QA8 A;  3D8D A;  5C5B A;  4EZJ A;  3U2S C;  2L32 A;  1E7V A;  2HJ8 A;  5HE2 A;  1F9J A;  2KWD A;  3DDC B;  1KLV A;  1RRB A;  2JVC A;  3L13 A;  2UYZ B;  1N5W A;  1WGG A;  2Z59 B;  3BYY B;  2AL6 A;  5D3W A;  2MBO A;  2X18 A;  2JY6 A;  3B1L X;  3PLU A;  1TT5 B;  1TJE A;  2QKL A;  1HB6 A;  1ZP0 B;  2Q13 A;  3TEX A;  1KH0 A;  1EAZ A;  4MDK E;  3A1Q A;  3OG5 A;  3QX1 A;  1A70 A;  2O6V D;  2N9K A;  3SEB A;  3CSF A;  3W9C B;  1YQB A;  4XDC A;  4I6P A;  2J0M A;  4NZL B;  2YF0 A;  3KWV A;  3EC8 A;  1WG7 A;  3V3X A;  2Y8F A;  2KAJ A;  3Q8A A;  1LGR A;  3P4R B;  1J8C A;  3MJW A;  4RNA A;  2EEL A;  4EZL A;  1RAX A;  4CYE A;  1ZXH A;  4HCN B;  1UNS A;  5I2M A;  1Y19 B;  1H8C A;  4WIP A;  1TS5 A;  1FOE A;  4M0W A;  5AUI A;  3TSS A;  5IOI A;  3APC A;  1ZGU B;  3ZJT A;  2RNR B;  1V1P A;  3GS2 A;  5DPT A;  2BWE S;  2INP E;  4R3D A;  4IWQ A;  2W2X C;  3PG7 A;  2IO0 B;  1I4Q A;  2R2Q A;  3QWZ B;  1E6E B;  3QHT A;  1TXD A;  2COF A;  1EM7 A;  1U4A A;  1DDV A;  1E8X A;  4HAV B;  3ZVV A;  3AE2 B;  4A90 A;  1DIK A;  1SGH A;  2PE6 B;  4XYC A;  2W2X D;  1WGH A;  2WXQ A;  2Z0P A;  2FCN A;  4HAZ B;  2LMC A;  2GI9 A;  5JP4 A;  5C1Z A;  1TS3 A;  1PGA A;  2OED A;  3AE3 B;  4OSN A;  2ZW0 A;  1X05 A;  4HSI A;  4JKC A;  2N23 A;  3U52 E;  3URY A;  1MAI A;  3AED B;  5DHF B;  1FNV A;  2P0H A;  4DDG D;  3R7Q A;  3OLM D;  1T6B X;  1FPY A;  5FR6 A;  4EUT A;  1EVH A;  5G5H A;  1XQQ A;  2BYE A;  4QJ4 B;  1UGM A;  3RNF C;  2W3R A;  5H92 C;  1WYG A;  1WXV A;  1J7B A;  2UWQ A;  1K8R B;  2JX5 A;  3A9K B;  4WWN A;  2INN E;  4W9H A;  1U5E A;  3WAN A;  2QDF A;  4ARI A;  2RR9 A;  2RMM A;  2MWN B;  2J0K A;  3HQC A;  1WH3 A;  1V5T A;  3SYX A;  2MW5 A;  4A8X C;  3ZNG C;  4PYU A;  1L0V B;  3DBL I;  4WJO A;  1R7S A;  2BQQ A;  3UQA A;  2MP2 A;  3VUX A;  2M17 A;  1F52 A;  3Q8E A;  4H2A A;  3U30 A;  2LGS A;  3WAO A;  3H7P B;  4IWP A;  2Z0Q A;  5DPR A;  5JHB A;  4WUR A;  3UZT A;  1ZSQ A;  4NPN A;  4MEM A;  1WY8 A;  1ET9 A;  1P3Q U;  5KHO A;  3MTN B;  3Q3J A;  4ZRI A;  1V89 A;  2LEK A;  3DXC A;  3V61 A;  3NVY A;  2LD9 A;  1BWN A;  1OQN A;  1XKE A;  2L2I A;  1WSP A;  3ZDM C;  4FAD A;  1QZE A;  5IA7 A;  2D10 A;  1UNR A;  2M8S A;  3QK0 A;  3F0W A;  1U27 A;  3VVW B;  1MI1 A;  1TS2 A;  2LOX A;  3ML4 A;  4YSX B;  2I5F A;  1RLF A;  1R4N I;  1CK1 A;  4TV3 A;  2QKM A;  1N60 A;  1D6E C;  1M7R A;  3W2D A;  4L6E A;  3NZ3 A;  4WJ7 A;  4S0R A;  1WF9 A;  3DVG X;  5LXI B;  5J2R A;  2RLO A;  4OZC A;  1ET6 A;  1L7Y A;  1WWT A;  1B9R A;  1Q5W B;  4TQ0 A;  3JSV A;  2DHK A;  3TW1 A;  1FFU A;  3IAM 1;  3V5W A;  1TS4 A;  2IGH A;  3RZF A;  2M0A A;  5JHA A;  2MBB B;  4LDT B;  2N9L A;  4KX6 B;  3RNE C;  2L0T A;  4ILG B;  2JYE A;  2KYW A;  2DTC A;  3W1Y A;  3B2G A;  4HB4 B;  1FXA A;  1V86 A;  3RNG C;  1FMA D;  4TUU A;  2JRH A;  2JQR B;  1DBH A;  2NBW B;  3L10 B;  1MG4 A;  1QT9 A;  2C7N B;  4WWO A;  4NAM A;  1WE7 A;  1WGU A;  2LXC A;  4JKG A;  1K5G B;  2WXF A;  1ACA A;  2NPT B;  3AEG B;  1WJN A;  4A6K A;  2BT6 A;  3WAL A;  3AM9 A;  1E8Z A;  2LWP A;  5LLI A;  2BB6 A;  3AE5 B;  3AMZ A;  4GPT B;  4HDQ A;  4YTN B;  4TSS A;  1HBK A;  2AQ3 B;  1FRD A;  4A6H A;  2BTE A;  3NVZ A;  1QQG A;  3I63 C;  1IGD A;  2BS3 B;  2CB8 A;  4GNK B;  1I4H A;  4GIV A;  1C4A A;  3L54 A;  4AQ7 A;  3HIZ A;  2HDE A;  5D6J B;  1KZG A;  1EGX A;  2M1M A;  3E9L A;  2MBE A;  4JK8 A;  3L0W B;  3ZUN A;  2ICI A;  1FEH A;  5GOW B;  2KK8 A;  4B6W A;  4ZYS A;  1SE9 A;  4US9 A;  3BVZ A;  2X0S A;  2G1E A;  4XE0 A;  2MDX A;  3HM6 X;  3DWM A;  2WGS A;  2K8H A;  1KC7 A;  3N1Y C;  2DZI A;  3C8Y A;  2KD0 A;  1EWY C;  3ZJV A;  3N32 A;  4GDL B;  5E6N A;  3SR6 A;  2QIE B;  2K2J A;  5LG4 B;  2H89 B;  2N7E A;  2JXX A;  5AZH A;  2WS3 B;  4RFB A;  1Y8R C;  4D2K A;  2LYD A;  4K3C A;  1TBE A;  3ONS A;  1EU3 A;  5J3Q A;  3NSU A;  1N62 A;  5D3D A;  3P4S B;  5JXV A;  2H7E A;  1IP9 A;  4TQ1 A;  5IKC M;  5D27 A;  3ZJU A;  3FLV A;  4ZRK A;  3P6A A;  2MJ3 A;  2QHO A;  2DYM A;  1FNU A;  2FAZ A;  2WU2 B;  3MHZ A;  4EZK A;  5IN7 A;  1Z87 A;  2C5L C;  3AE8 B;  2Y5B B;  4LJO B;  1C77 A;  1JWB D;  2ZW1 A;  5JHG A;  2KQ7 A;  1U5F A;  1FB8 A;  2DAJ A;  3DQV A;  2L00 B;  3A4R A;  3TVV A;  4LLG M;  4KSK C;  3H9D A;  3B08 A;  1JML A;  3HVD A;  1NYR A;  2DZK A;  4DIX A;  4YT0 B;  2WXL A;  1MK9 B;  3KRX A;  1L4D B;  1P6S A;  2BS2 B;  2DX5 B;  5BYS A;  2Y5C A;  1GB4 A;  3BK1 A;  2WWZ A;  1T0S C;  1HTQ A;  3L08 A;  3ENB A;  4HRS A;  4FJY A;  3DBR I;  2WU5 B;  4BKS D;  2J52 A;  1D3Z A;  3NZU A;  5EE0 A;  1VBG A;  3MP9 A;  1C79 A;  3NVV A;  1I2H A;  3HVZ A;  4JK7 A;  4MK0 A;  1IYF A;  1XLP A;  1ZUD 2;  4F1S A;  4M8M A;  4PYZ A;  1FXI A;  4KAX B;  4W9E A;  4N9F 4;  3APF A;  1WXA A;  2KFK B;  2MWS B;  2YT2 A;  3VDZ A;  2FJU B;  4JL9 A;  4CHK A;  4G50 A;  2LHE A;  1D5X C;  2LRU A;  3GE3 C;  4LNO A;  4HEA 1;  3NG0 A;  1I42 A;  4KSL C;  2ZNV B;  2N7J A;  4J6I A;  4E71 A;  4BZA A;  3JYU A;  2RPQ A;  3AU4 A;  4IFS A;  2GB1 A;  4A6F A;  2PE9 A;  4A6Q A;  3N7C A;  2NVU I;  4JQW C;  4NQL B;  4BKG A;  1RRP B;  1XCT L;  3UIP B;  4RM8 A;  3Q3O C;  1WGD A;  4DX9 0;  4LCD E;  2EKE C;  2ZNV C;  1P9D U;  5HKH A;  4TKN A;  5EE9 A;  1XCQ L;  3FVC A;  4XWT A;  4WWP A;  1P0R A;  2JT4 B;  4FHJ A;  1OFF A;  2DKP A;  3VQI A;  1WYW B;  3NOB A;  2ZZP B;  2D3B A;  1GB1 A;  2Z14 A;  4HB3 B;  3M63 B;  5IJM A;  4KHO A;  1DOY A;  1JWA D;  2KKC A;  1Z2M A;  2LVQ A;  2OJR A;  2K8B A;  3F5R A;  4ITK A;  3Q3F A;  1WX9 A;  3FIL A;  3DXE A;  3AV8 A;  1NI3 A;  1ZVR A;  1QOA A;  4BKS A;  2KJ6 A;  4WH4 A;  2HTM E;  2FIF A;  4IC7 B;  3ZRC A;  2XK5 A;  2D2Q A;  1T5X D;  4KKI A;  5HE1 A;  4A20 A;  3V60 A;  3ZTC A;  3FKY A;  2FID A;  1RM6 C;  4WJQ A;  4QAY A;  4F7U P;  2BBC A;  1OEY J;  3ML8 A;  4XWW A;  3EGR A;  2YLM A;  4RGN A;  4IWO A;  1FO4 A;  2KMA A;  3VRB B;  3RD2 A;  1L4Z B;  2HD5 B;  2L7R A;  3SNH A;  3B0A A;  2K8C A;  3NJT A;  3Q3N C;  4GDK A;  3LYY A;  3VFK A;  1GC6 A;  1FIQ A;  3KUZ A;  4MSM B;  2LGI A;  1U5D A;  4HHV A;  3K9P B;  4QJ5 B;  2GBJ A;  4WAF A;  4RGM A;  1RFK A;  4BOS C;  3NZS A;  2R2O A;  2IO1 B;  2A4Z A;  3I5J C;  1L2N A;  1RYJ A;  3KZ1 A;  4JKB A;  2WDT B;  4NNJ B;  1E9M A;  1B55 A;  3KY9 A;  1JWS D;  2EJ8 A;  4D6W A;  4NJC A;  2KUP A;  1ZC3 B;  2IDY A;  2RRF A;  2NBU A;  3A9J B;  3P7Z A;  1LW3 A;  3BWU D;  2WHI A;  2COC A;  1C3T A;  4Z2M B;  1OQR A;  1YNT E;  2M14 A;  5DIF B;  4J3O D;  4MM3 A;  3TO1 A;  4GOC A;  2GOW A;  1ENF A;  2ZCC A;  5LON B;  4HWI B;  2B76 B;  5J17 A;  2Z0O A;  2LKO A;  1XCG A;  2JWU A;  4L23 A;  2UZR A;  2KGX B;  3ZTD A;  2L83 A;  2MJD A;  3M95 A;  1ZPS A;  2KO3 A;  4AUQ C;  4BFR A;  1MIZ B;  2YEP F;  3VRA B;  5KQ4 A;  1WMH B;  3SBT A;  2W3S A;  3CWI A;  5C3J B;  4OVU A;  1V5O A;  4C7Z A;  3HM3 A;  2MLB A;  4ANV A; 
#chains in the Genus database with same CATH homology
 3VAW A;  4KVG B;  1WJ6 A;  4F7G A;  4HAT B;  2P0F A;  5CHF A;  1V80 A;  1H10 A;  1BAK A;  1E90 A;  5TR5 A;  1WR1 A;  3T8M A;  2P0D A;  1YJ1 A;  4IG7 B;  1T0Y A;  2FCQ A;  3ZLZ A;  2EC1 A;  2L76 A;  3W1S C;  2O6V B;  4KIK B;  4ASW C;  2JP2 A;  5L95 C;  3VIA A;  4GZU A;  3FM8 C;  4A3P A;  3DVN V;  4MGI E;  1GG3 A;  1LXD A;  2LOZ A;  2C60 A;  4W9I A;  2Y7B A;  3CMM B;  3PEG A;  3RYT A;  2ELA A;  3D32 A;  1EF5 A;  1TJ6 A;  1JRU A;  4MGK E;  3ZNH B;  5JHH A;  2AEH A;  3E9P A;  4HK2 A;  5D7G A;  5CLQ B;  3RUL A;  3ZDT A;  2ELB A;  3SUZ A;  4HAX B;  2RVB B;  3GZN I;  2EMT A;  4E3C A;  3GYP A;  3PHX B;  1P98 A;  3M1I B;  2KX0 A;  4F7Z A;  3TFM A;  1WZ0 A;  2NMB A;  1V2Y A;  2WX0 A;  2COD A;  2GCL A;  4E74 A;  1U29 A;  4HAW B;  3ENE A;  1NI2 A;  2CY5 A;  4II3 B;  1OTR B;  3ODO A;  1OEY A;  2BYF A;  2RD0 A;  1J0W A;  2NS5 A;  2I1K A;  3AJ4 A;  2LZ6 A;  1MG8 A;  2O2V A;  3SDL C;  3RZW C;  3X23 A;  4AJY B;  2LRW A;  3EPY A;  2C7M B;  1WXS A;  1GNU A;  1ISN A;  2XBB C;  2REX A;  1QC6 A;  1NTV A;  4HPL B;  4HAU B;  2BPS A;  2COP A;  4NSW A;  2XEW A;  4B95 A;  3H1U A;  4AP4 C;  2JZ3 B;  2CHX A;  5D94 A;  5JVL A;  1GC7 A;  3PVU A;  2KDE B;  3H7S A;  3S2A A;  2WH5 A;  2LGY A;  4DWF A;  1XD3 B;  1HB8 A;  2YS3 A;  2UZS A;  3H6N A;  3PGE A;  1WGY A;  2KTF A;  3SU8 X;  1V5P A;  2IFS A;  2HRJ A;  3PTF C;  1JDE A;  2MCN B;  5KCV A;  1J19 A;  2VRW B;  3DBS A;  4GN1 A;  3KH0 A;  4HDO A;  2OQB A;  1V6E A;  2N9P C;  2OOB B;  3U8Z A;  1E5W A;  2COA A;  1OY2 A;  3ULB A;  3VH4 B;  1XR0 B;  2LG1 A;  3CST A;  3SV1 A;  3O96 A;  2JWZ A;  2DFK A;  1U5G A;  4KHB B;  3VHT C;  4W9F A;  1KOT A;  1IRS A;  4WJP A;  4HPM B;  1XD4 A;  3QBV B;  3VH3 B;  4TYZ A;  4C0A A;  4XWX A;  5D3V A;  1MIX A;  3MPX A;  2KZR A;  5JZE B;  2KDI A;  1S3S G;  1PQS A;  4H8S A;  2ROV A;  3V6C B;  4DBB A;  4MY6 A;  3VTW A;  2KVR A;  2K2U A;  4MJS B;  2J0J A;  4PS3 A;  2GS0 A;  2P8V A;  5D3X A;  2MRP A;  1EF1 A;  3VUW A;  4HAY B;  3A9K A;  2FJ9 A;  4LDT D;  3D8E A;  2PJH A;  2KWC A;  1UD7 A;  2LUE A;  4LJP B;  1GJZ A;  4ZYN A;  2CHW A;  4HB0 B;  3PHW B;  2NBV B;  1IPG A;  3QWM A;  1M94 A;  2YVC A;  3C0R B;  5GMV A;  2LAS A;  4KDL B;  4M8N A;  3BJI A;  2KTR B;  3WIM A;  3PT2 B;  4GMX B;  3H7P A;  3QCA A;  3IG3 A;  4JLC A;  5BO4 B;  4JKH A;  2HTH B;  4DHJ B;  1UEF A;  3ML9 A;  3KW5 B;  1WVH A;  1WJ1 A;  2N1V A;  3KSY A;  3R7R A;  3SBG A;  2FJL A;  4G11 A;  3PPA A;  2WYQ A;  1Q1O A;  4MEL A;  4NJ6 A;  4XC2 A;  3PZD A;  4NAW B;  2BGF A;  4IM2 A;  2PPH A;  2ABD A;  3ALB A;  2J7Q B;  3SD5 A;  3L17 A;  1XOD A;  2G35 A;  1LM8 B;  2K6Q A;  3A33 B;  2CAY A;  3ODW A;  3PV1 A;  2KLG A;  3R3M A;  4NQK E;  3PRZ A;  2K6D B;  1ZW7 A;  2CHZ A;  2KXJ A;  1V88 A;  4URK A;  3HK0 A;  2VKI A;  1EO6 A;  4DXA B;  1KI1 B;  1UBQ A;  1X1G A;  1BT0 A;  4FUL A;  2LJ5 A;  3ZIM A;  1WXM A;  4DHZ E;  2YSZ A;  4FN2 A;  4IOY X;  2L1C A;  4BOZ B;  2RGN B;  5JLJ B;  4K2O A;  4EMO A;  4ICV A;  1P5T A;  1TQZ A;  2LUL A;  5C79 A;  3OAN A;  2DLW A;  3UIO B;  3ZRF A;  2NPT A;  4II2 B;  1LQB A;  1N3H A;  4K1R B;  2IYB A;  2KC2 A;  2PEA A;  3EEC A;  3R66 C;  2LBB A;  4G0N B;  1MPH A;  1WE6 A;  3IVF A;  2D9Y A;  2CRF A;  2IY0 B;  2V3S A;  2Z0E B;  1VD2 A;  4B6H A;  3T9L A;  2KLC A;  5J3T A;  1PFJ A;  3TBL D;  1SIF A;  5JH5 C;  4PS8 A;  1V9J A;  4D0N B;  2YS5 A;  2NZ8 B;  4GDL A;  2KC1 A;  4MGZ E;  3JW0 X;  4FHK A;  3I3T B;  3WAP A;  1WR6 E;  4HXD A;  1ST7 A;  5C5B B;  3M62 B;  4DHZ B;  4W9C A;  5CHW A;  4BKT A;  2G4S A;  3U7D A;  3FSS A;  3L16 A;  3EHV A;  5DI9 B;  3WYF B;  1HE8 A;  3G9W A;  4Z2N A;  1FXT B;  4HVB A;  2G4D B;  1ZC4 B;  2W2W A;  3RCZ A;  3BY4 B;  4DX8 A;  2A5U A;  3LJU X;  1DRO A;  2N9X A;  4DDI D;  3DBH I;  2ZPN A;  2D9V A;  2MKR A;  4JKD A;  2DX5 A;  3A1Q B;  4WJN A;  1J0G A;  1E8Y A;  4EKU A;  4ANX A;  2IY1 B;  2YT0 A;  4GB9 A;  1DDM A;  1V61 A;  2ZVN A;  2MA9 B;  4A3O A;  5DH9 B;  4FBJ B;  3QIJ A;  4CHM A;  1OMW A;  2MBQ A;  3IBE A;  2ZEQ A;  2KHW B;  4MT7 A;  5C23 A;  4DK5 A;  2M38 A;  4ANW A;  2DAF A;  1YX5 B;  3DVN U;  4M0W B;  3VXW A;  2R82 A;  2V4L A;  4GU2 A;  1DYN A;  2KQS A;  2KFK A;  2N7D A;  2MFQ A;  4AWJ A;  3WA0 A;  1WX7 A;  1X86 A;  4JK9 A;  4IM0 A;  1WJM A;  2D9Z A;  3K9O B;  4IW0 A;  5AZG A;  2DN6 A;  3V6E B;  2DHJ A;  1WIA A;  2YS1 A;  2R09 A;  1I35 A;  3P2B A;  4JGH B;  2DYB A;  1DDW A;  2KAN A;  4NJ7 A;  1Q67 A;  1WJU A;  2ASQ A;  4FLH A;  2MBH A;  3KRW A;  4RMA A;  1Y5O A;  1AWE A;  3QQ8 B;  1OQY A;  4W9K A;  4GGQ A;  2GBM A;  3MDB C;  2OTX A;  5C16 A;  2IBI B;  1NTI A;  4KHA A;  4CO7 A;  2DEN B;  2GJY A;  3GOE A;  3APD A;  4AJW A;  2YRY A;  2N9E B;  5HE3 A;  1G6J A;  3RCP A;  1RJ2 A;  4EJN A;  3PVW A;  2CKH B;  3VUY A;  3QJZ A;  3A8Q A;  3T06 A;  3VTU A;  4PQ0 A;  3V62 A;  2Z0D B;  4KZC A;  2BWF A;  2MP2 B;  4ANU A;  5KHQ A;  2LVO A;  4ILJ A;  4FJZ A;  1NU2 A;  2NCN A;  1UNQ A;  2D3G A;  1UPR A;  4EFO A;  4IM3 A;  1S1Q B;  1GGO A;  2IO3 B;  1C1Y B;  3CF6 E;  3OJ4 B;  1NBF C;  1E8W A;  1X1M A;  2FCM A;  2KCJ A;  1LFD A;  3A9J A;  1WI0 A;  4PS7 A;  2FUH B;  2ZJD A;  3IHP C;  2FCS A;  4G3X B;  2KWU B;  4GMV A;  2L3Z A;  4KDI C;  2GBR A;  1Q0W B;  3ZVR A;  4I6N B;  2J59 M;  1WMH A;  4K2P A;  4WSF A;  3DVG Y;  3JSV B;  4JKA A;  3ECI A;  1WGR A;  3A98 B;  2IYD B;  5CLL B;  3W1S A;  4EOY A;  2D11 A;  3SO6 A;  2AYO B;  2DZJ A;  4ILH A;  3AI5 A;  3WAM A;  1Z5S B;  3TCA A;  2CU1 A;  2GCJ A;  3QAR A;  2O6V A;  4KIK A;  2KJH B;  1NVL A;  2BYV E;  2BKF A;  2KJR A;  2LXA A;  2G45 B;  2B3A A;  4JKG B;  1U2B A;  5FI0 A;  4BVU C;  4PNK A;  1UZX B;  2KFJ A;  4F7H A;  2N4F A;  1KZ7 A;  5L81 A;  2E2X A;  3TL5 A;  4FA6 A;  3FP5 A;  5HE0 A;  2L0F A;  3ODX A;  1WI1 A;  5LOP B;  3N3K B;  4I6L B;  3TJP A;  2W9N A;  2K00 A;  2CS4 A;  3NHE B;  2JUO A;  2RUK B;  3SHQ A;  3ULC A;  1WX8 A;  1W1H A;  5CTR C;  4YON A;  2MQJ A;  2KNB A;  3FEH A;  1UH6 A;  4Y94 A;  3QC8 B;  5DHA B;  1NDD A;  2ZPY A;  1KJT A;  1UBI A;  1X11 A;  1PLS A;  4B9K A;  2LGD A;  2KX3 A;  2LGX A;  4ICU A;  3AUL A;  1A5R A;  4JKF A;  2BCJ A;  3BIN A;  5DCN A;  4K81 A;  3NY5 A;  1WZ3 A;  5D3Y A;  1VCB A;  2BF8 B;  2M0X A;  2DYQ A;  3QAQ A;  1UNP A;  5IAA C;  2VSZ A;  2DHZ A;  3D8F A;  1YIW A;  4IUM B;  2CQU A;  3NS8 A;  4MH0 E;  3PP2 A;  1RFA A;  2N1W A;  2MX2 A;  2DA0 A;  1FGZ A;  1KM7 A;  3KYC D;  4CHJ A;  3PS6 A;  2G3Q B;  4A5K A;  3ZW3 A;  1WFY A;  1MKE A;  1V5M A;  3ZKJ C;  4W9L A;  2JPH A;  3GYO A;  3PLV A;  1TGZ B;  5DPW A;  4EEW A;  1PMS A;  3X0W A;  3CXB B;  3OAW A;  3HW2 B;  1ZKH A;  4K7U A;  1KBL A;  1BTN A;  4KZ0 A;  2FNJ B;  3DCG A;  5CX3 A;  4K7S A;  2WX1 A;  2FDQ A;  2K39 A;  4X57 B;  2VRR B;  1UEL A;  2V76 A;  4P7I A;  1W1D A;  3PVL A;  3LJ3 A;  4A6F B;  1EUV B;  4JKE A;  4BBN C;  5KQ1 A;  3E66 A;  5FI1 A;  2KOX A;  4W9J A;  1SHC A;  1FGY A;  5EFX A;  2DHI A;  3PSE B;  1TZ1 A;  4K7W A;  4YL8 A;  1AAR A;  1OGW A;  4FJV B;  3TMP B;  3MHS D;  1K5D B;  1XT9 B;  4DHJ D;  1I7A A;  1WGQ A;  1V49 A;  2I5C A;  1FHO A;  2V1Y A;  2CY4 A;  2RGF A;  4K17 A;  2N0Y A;  2DYO A;  2XK5 B;  1VBH A;  1YX6 B;  1XX0 A;  4MJS A;  3UGB B;  3TIX A;  5J18 A;  4BBN F;  3IFW B;  3RT3 B;  4HJK A;  4JIO U;  4WQO B;  2JF5 A;  3PRE A;  3VOQ A;  4GDK B;  4NY0 A;  1YD8 U;  2M4N A;  1X1F A;  3EFU A;  4WVF B;  5D2M B;  2LVP A;  5DPS A;  4F8C B;  1W1G A;  1M7E A;  5EDS A;  1P1A A;  2C9W B;  2GMI C;  1AQC A;  3PSC A;  2JZZ A;  1P3R A;  2PZ1 A;  2ZCB A;  2KTR A;  1V81 A;  2HE7 A;  2ADZ A;  2DYN A;  4HCP B;  2K1F A;  2IO2 B;  5E6O A;  2KDB A;  2D9X A;  2R0D A;  2HTH A;  3VTV A;  2AL3 A;  1H4R A;  5G2N A;  2C7H A;  3KUC B;  1V5U A;  2DKQ A;  1UPQ A;  2ZVO A;  5J3Y A;  2KMC A;  2BKR B;  2UVM A;  3DPD A;  3E9O A;  4OVV A;  3ZNZ B;  5CHV C;  1R4M I;  2H7D A;  4MSQ B;  2I1J A;  4NAW A;  4W9D A;  2L8J A;  4RM9 A;  3M3J A;  2EMS A;  5E6P A;  2DZM A;  1LB1 A;  4XX5 A;  3JVZ X;  2MSE D;  1NTY A;  1CMX B;  2RSU A;  4KV2 A;  3UF8 A;  2AWT A;  4HLE A;  1FAO A;  2DIK A;  2D4Q A;  4BBK A;  2ROZ B;  3ZO5 B;  2IZV B;  2D9W A;  5AZF A;  2RSG A;  3CIK A;  2RQ1 A;  3KYD D;  3DXD A;  4IAP A;  2NR2 A;  3RUI B;  3PRM B;  4WAA A;  3HHM A;  3A8P A;  2KWV B;  3KVF B;  5C6R A;  3OJ3 A;  2K25 A;  4MGY E;  3ZNI D;  3UIN B;  4XZ4 A;  3LDZ E;  2Y8G A;  1TTN A;  3AU5 A;  2CR5 A;  1WRD B;  3AXC A;  1WM3 A;  4ZDV A;  1FHX A;  3PRP B;  2KN5 A;  5G55 A;  1BTK A;  2KDF B;  5L83 A;  1WJ4 A;  2L05 A;  2XQN M;  4DBG A;  4HB2 B;  2DX1 A;  3KUD B;  3N30 A;  2JRI B;  1MK7 B;  1GUA B;  2D07 B;  2GBK A;  3O65 B;  2O2V B;  3A4S C;  3UQB A;  4ZRJ A;  3DOW A;  4AOF A;  1WM2 A;  2GBN A;  5AEK B;  4GSW A;  5LXH A;  2YT1 A;  2LI5 A;  1ZM0 A;  4W9G A;  4GXB A;  1E7U A;  1FHW A;  3QA8 A;  3D8D A;  5C5B A;  4EZJ A;  1E7V A;  2HJ8 A;  5HE2 A;  1F9J A;  3DDC B;  1KLV A;  1RRB A;  2JVC A;  3L13 A;  2UYZ B;  1WGG A;  2Z59 B;  2AL6 A;  5D3W A;  2MBO A;  2X18 A;  2JY6 A;  3B1L X;  3PLU A;  2QKL A;  1HB6 A;  2Q13 A;  1EAZ A;  4MDK E;  3A1Q A;  3QX1 A;  2O6V D;  3CSF A;  1YQB A;  4I6P A;  2J0M A;  2YF0 A;  3EC8 A;  1WG7 A;  2Y8F A;  1J8C A;  3MJW A;  4EZL A;  1RAX A;  4CYE A;  4HCN B;  1Y19 B;  1H8C A;  1FOE A;  3APC A;  1ZGU B;  2RNR B;  5DPT A;  2BWE S;  4IWQ A;  2W2X C;  3PG7 A;  2IO0 B;  2R2Q A;  3QWZ B;  3QHT A;  1TXD A;  2COF A;  1U4A A;  1DDV A;  1E8X A;  4HAV B;  3ZVV A;  1DIK A;  1SGH A;  2PE6 B;  2W2X D;  1WGH A;  2Z0P A;  2FCN A;  4HAZ B;  5JP4 A;  5C1Z A;  1X05 A;  4JKC A;  2N23 A;  1MAI A;  5DHF B;  2P0H A;  4DDG D;  3R7Q A;  3OLM D;  5FR6 A;  4EUT A;  1EVH A;  1XQQ A;  2BYE A;  1UGM A;  1WXV A;  2UWQ A;  1K8R B;  3A9K B;  4WWN A;  4W9H A;  1U5E A;  3WAN A;  2RR9 A;  2MWN B;  2J0K A;  3HQC A;  1WH3 A;  1V5T A;  3SYX A;  2MW5 A;  3ZNG C;  4PYU A;  4WJO A;  3DBL I;  3UQA A;  2MP2 A;  3VUX A;  2M17 A;  3U30 A;  3WAO A;  3H7P B;  4IWP A;  2Z0Q A;  5DPR A;  5JHB A;  3UZT A;  1ZSQ A;  4NPN A;  4MEM A;  1WY8 A;  5KHO A;  1P3Q U;  3MTN B;  3Q3J A;  4ZRI A;  1V89 A;  3DXC A;  3V61 A;  2LD9 A;  1BWN A;  1OQN A;  1XKE A;  2L2I A;  3ZDM C;  4FAD A;  1QZE A;  5IA7 A;  2D10 A;  1UNR A;  2M8S A;  3QK0 A;  3F0W A;  1U27 A;  3VVW B;  2LOX A;  3ML4 A;  2I5F A;  1RLF A;  1R4N I;  4TV3 A;  2QKM A;  1M7R A;  4L6E A;  4WJ7 A;  1WF9 A;  3DVG X;  5LXI B;  5J2R A;  2RLO A;  1L7Y A;  1Q5W B;  4TQ0 A;  3JSV A;  2DHK A;  3TW1 A;  3V5W A;  3RZF A;  5JHA A;  2MBB B;  4LDT B;  2L0T A;  4ILG B;  2DTC A;  3W1Y A;  4HB4 B;  1V86 A;  4TUU A;  2JRH A;  1DBH A;  2NBW B;  3L10 B;  2C7N B;  4WWO A;  1WE7 A;  1WGU A;  2LXC A;  4JKG A;  1K5G B;  1ACA A;  2NPT B;  1WJN A;  4A6K A;  3WAL A;  1E8Z A;  2LWP A;  5LLI A;  4GPT B;  4HDQ A;  1HBK A;  4A6H A;  1QQG A;  2CB8 A;  4GIV A;  3L54 A;  3HIZ A;  5D6J B;  1KZG A;  1EGX A;  2M1M A;  3E9L A;  2MBE A;  4JK8 A;  3L0W B;  3ZUN A;  5GOW B;  2KK8 A;  4B6W A;  1SE9 A;  2X0S A;  2MDX A;  3HM6 X;  2K8H A;  1KC7 A;  2DZI A;  2KD0 A;  3N32 A;  4GDL B;  5E6N A;  2K2J A;  2N7E A;  2JXX A;  5AZH A;  1Y8R C;  2LYD A;  1TBE A;  3ONS A;  5J3Q A;  3NSU A;  2H7E A;  1IP9 A;  4TQ1 A;  5D27 A;  3FLV A;  4ZRK A;  3P6A A;  2QHO A;  2DYM A;  2FAZ A;  4EZK A;  1Z87 A;  2C5L C;  2Y5B B;  4LJO B;  5JHG A;  2KQ7 A;  1U5F A;  1FB8 A;  2DAJ A;  3DQV A;  2L00 B;  3A4R A;  3TVV A;  4KSK C;  3H9D A;  3B08 A;  2DZK A;  1MK9 B;  3KRX A;  1P6S A;  2DX5 B;  2WWZ A;  3L08 A;  3ENB A;  4FJY A;  3DBR I;  4BKS D;  1D3Z A;  3NZU A;  1VBG A;  1I2H A;  4JK7 A;  4MK0 A;  1IYF A;  4F1S A;  4M8M A;  4PYZ A;  4KAX B;  4W9E A;  4N9F 4;  3APF A;  1WXA A;  2KFK B;  2MWS B;  3VDZ A;  4JL9 A;  4CHK A;  4G50 A;  2LRU A;  1I42 A;  4KSL C;  2ZNV B;  4J6I A;  4E71 A;  3JYU A;  2RPQ A;  3AU4 A;  4IFS A;  2PE9 A;  4A6F A;  3N7C A;  2NVU I;  4JQW C;  4NQL B;  4BKG A;  1RRP B;  3UIP B;  4RM8 A;  1WGD A;  4DX9 0;  4LCD E;  2EKE C;  2ZNV C;  1P9D U;  5HKH A;  4TKN A;  4WWP A;  1P0R A;  2JT4 B;  4FHJ A;  2DKP A;  3VQI A;  1WYW B;  3NOB A;  2ZZP B;  4HB3 B;  3M63 B;  5IJM A;  4KHO A;  2KKC A;  1Z2M A;  2LVQ A;  2OJR A;  2K8B A;  3F5R A;  3Q3F A;  1WX9 A;  3DXE A;  1ZVR A;  4BKS A;  2KJ6 A;  4IC7 B;  2FIF A;  3ZRC A;  2XK5 A;  2D2Q A;  5HE1 A;  4A20 A;  3V60 A;  3ZTC A;  2FID A;  4WJQ A;  4F7U P;  1OEY J;  3ML8 A;  2YLM A;  4IWO A;  2KMA A;  3RD2 A;  2HD5 B;  2L7R A;  3SNH A;  3B0A A;  2K8C A;  3VFK A;  4GDK A;  1GC6 A;  3KUZ A;  4MSM B;  1U5D A;  4HHV A;  3K9P B;  2GBJ A;  4BOS C;  3NZS A;  2R2O A;  2IO1 B;  2A4Z A;  1L2N A;  3KZ1 A;  4JKB A;  2WDT B;  4NNJ B;  1B55 A;  3KY9 A;  2EJ8 A;  2KUP A;  1ZC3 B;  3A9J B;  2NBU A;  3P7Z A;  1LW3 A;  2COC A;  1C3T A;  4Z2M B;  2M14 A;  5DIF B;  4MM3 A;  3TO1 A;  4GOC A;  2GOW A;  2ZCC A;  5LON B;  4HWI B;  5J17 A;  2Z0O A;  2LKO A;  1XCG A;  2UZR A;  2KGX B;  3ZTD A;  3M95 A;  2KO3 A;  4AUQ C;  4BFR A;  1MIZ B;  5KQ4 A;  1WMH B;  3SBT A;  4OVU A;  1V5O A;  3HM3 A;  2MLB A;  4ANV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...