4CYEA

Crystal structure of avian fak ferm domain fak31-405 at 3.2a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4cyeA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4cyeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4cyeA01
2DYQA 4W9DA 1WJMA 4DX90 2L76A 4E74A 1V2YA 4I6PA 2UZRA 2KJHB 1Z87A 5L81A 2HTHB 4WQOB 5LONB 2ZJDA 4BBNC 1KOTA 1HB8A 1U2BA 4W9EA 4ZRIA 2KFJA 1MKEA 2IO2B 3HW2B 4HCPB 3UF8A 2NPTB 3OLMD 3V62A 2LG1A 1Y5OA 5FI0A 1NBFC 2KWCA 3APFA 2AYOB 1TBEA 4EKUA 1V81A 2FCQA 3I3TB 3NZSA 4GPTB 3PPAA 4EZLA 2DKPA 2RUKB 4WJOA 2Z0QA 3ULBA 1RRPB 5D3YA 3ZIMA 4BKSD 4HVBA 4I6NB 4K7SA 5DCNA 5DPWA 2KHWB 2DENB 5CHVC 4D0NB 4IAPA 2XK5A 2JXXA 3EC8A 3TVVA 4HB0B 1X1FA 1Y8RC 3L54A 4GDKA 3R3MA 4NJ7A 3A33B 2GCLA 2Y7BA 2VKIA 1UNRA 2OTXA 1MG8A 3KH0A 5D7GA 4GDLB 1X86A 1T0YA 5CHWA 2KLGA 2KWVB 5J18A 3DXDA 1K8RB 3PRMB 4W9FA 4MT7A 2DYMA 3ALBA 3P7ZA 2LZ6A 3TL5A 2CHZA 4GDLA 3WA0A 1DDVA 2G45B 4G3XB 4TV3A 1J8CA 1PQSA 4E3CA 4IW0A 3DPDA 3V6CB 4RM9A 1EF1A 4HCNB 5L83A 2D3GA 3T8MA 4DHZB 2YS1A 1YX5B 3L13A 4HXDA 1WX7A 1XODA 5C6RA 4KHOA 1RLFA 2KKCA 3ZNID 2MWNB 4F1SA 4M8NA 2D9WA 1P1AA 2CR5A 1WIAA 2Y8FA 2B3AA 2ZVOA 1U5DA 2IO3B 4DHJD 1EGXA 3SDLC 3SUZA 2MBHA 2YRYA 4AWJA 5KHOA 2P0HA 2KOXA 1FAOA 1AWEA 2KTRB 3IG3A 3PV1A 3T9LA 3QX1A 1LM8B 4BOZB 2XK5B 3PVUA 5EFXA 3AU5A 1QQGA 4ICVA 4MELA 2ZCCA 3N32A 3GZNI 2W9NA 4W9GA 1V49A 2L0FA 5J17A 4DBGA 1XD3B 2QKMA 4MSMB 4DWFA 2HTHA 4RM8A 3QK0A 2KXJA 3QC8B 3O65B 2JZZA 1C3TA 4JGHB 1PFJA 1U4AA 1NU2A 1WGYA 2M14A 4HPMB 1LQBA 1BWNA 2RQ1A 2VSZA 5LOPB 1RFAA 1XQQA 2ZCBA 4IG7B 4XX5A 2UVMA 4BFRA 2Z0EB 4HLEA 2JRHA 2I5CA 4IWPA 4A5KA 3ZW3A 3NHEB 1TQZA 3CXBB 3KRWA 3JW0X 4BOSC 4JL9A 5JH5C 4G50A 1VD2A 4Z2MB 2DYOA 2C9WB 3R66C 1WY8A 2R2QA 2J0KA 5JHHA 4XWXA 2KO3A 3PHXB 1E8ZA 2AL6A 3SV1A 1OQNA 2MP2A 3DVNV 2W2XD 3VH3B 2C5LC 2NBWB 1U27A 5D3VA 2LI5A 4II2B 4FHKA 3WANA 2NS5A 2EJ8A 2M0XA 4IM2A 2LVQA 2DHZA 1ISNA 3A4SC 4M0WB 3WAPA 1FB8A 2ZZPB 3A8QA 1WE7A 2LGDA 3OJ3A 2C7MB 1IPGA 5D6JB 5KCVA 1BAKA 1QZEA 1AARA 1WYWB 1WGQA 2KUPA 3ZDMC 1U5EA 1YX6B 2KD0A 1XKEA 4HAVB 2K25A 4K17A 1UNQA 2V3SA 3AXCA 4PS3A 3SHQA 5AZFA 3TO1A 2K8BA 3L16A 1IP9A 2D9YA 3M62B 1MAIA 3B08A 2O6VD 4CHMA 1WI1A 2ZVNA 3PSEB 3UIOB 4WVFB 3KUZA 3IFWB 3F0WA 2BWES 2KDBA 4EZJA 2LWPA 3UGBB 3ZNGC 3A1QB 2CKHB 4FADA 1KJTA 2H7DA 2EMSA 1SIFA 4NAWB 1WMHA 2X18A 1E7UA 2RNRB 3APCA 4GIVA 2G35A 3PRPB 2DX5A 4F7HA 1PLSA 3U30A 3VVWB 3QARA 4FHJA 2LXAA 2P0DA 1WXMA 2CHWA 3Q3FA 1OGWA 3V6EB 4EFOA 3S2AA 2FJ9A 3PEGA 5D3XA 4C0AA 2DN6A 2O2VB 3VIAA 3VFKA 2MX2A 1Q1OA 1WM3A 1C1YB 3B1LX 3AULA 5HE3A 4YL8A 1IRSA 2C7NB 1DROA 2CS4A 4CYEA 1WGUA 2IBIB 2IZVB 2N9EB 3R7RA 1UELA 4MGZE 2A5UA 3ODWA 2G4DB 1V61A 2PE6B 4FJYA 1J0GA 1LXDA 2J7QB 2PE9A 4XZ4A 1EO6A 2KVRA 4XC2A 2CQUA 5FI1A 2GMIC 1OEYJ 5GMVA 5TR5A 4F7ZA 2MRPA 1U5GA 3T06A 4JQWC 5KHQA 5DIFB 2NBVB 4W9JA 1B55A 3DVGY 1WR6E 4LDTB 3AU4A 4HB4B 4W9CA 1P6SA 5JHAA 3RZWC 3EFUA 1P3QU 3TMPB 3ZVVA 2Y5BB 2D9VA 2Y8GA 4EZKA 1NTYA 1DBHA 1P9DU 2BYVE 1UPRA 2BWFA 3WYFB 1E8WA 2KWUB 3X23A 4MK0A 2LD9A 3DVNU 3TW1A 2LULA 1V5MA 4PYUA 5IAAC 2C60A 2BGFA 1WG7A 3ZUNA 1E90A 5C1ZA 2LYDA 2MP2B 1FOEA 2EMTA 3ZTDA 1NI2A 3A9KB 1ZC3B 2GJYA 3A9KA 2FCNA 3HHMA 2P8VA 5DPTA 2Z0PA 4ANVA 2IYBA 1W1DA 3ULCA 1UD7A 1ZVRA 2DZKA 2ZEQA 1WJUA 2JF5A 2UYZB 2V4LA 3KYCD 2L0TA 3RYTA 4HHVA 4FBJB 3DXCA 2HRJA 4NY0A 3P6AA 3JVZX 2ELAA 3QQ8B 2MCNB 1U29A 2LRWA 3VUYA 3WAOA 4K7UA 4DDID 1WVHA 3D8EA 2JY6A 3DBLI 5DPRA 5AZGA 5LXIB 1MIXA 3IVFA 1TTNA 1WI0A 3SO6A 1DDMA 2RPQA 3Q3JA 4HB2B 2CAYA 2O6VA 4JLCA 2DHJA 3A98B 4KVGB 1EAZA 2ASQA 3DDCB 3MTNB 3QAQA 4IM3A 1UEFA 2UZSA 2CU1A 3ZRFA 2MQJA 1K5GB 2DAJA 4WJNA 1RAXA 3BY4B 3UIPB 1BT0A 3HK0A 3L10B 3O96A 2KGXB 1SE9A 2N9PC 4HAXB 5DI9B 4KZCA 2GS0A 2YT0A 1WJNA 2IY0B 3VHTC 2LXCA 1W1HA 1E8XA 3N3KB 2ELBA 2CY5A 3A1QA 4AP4C 3RCZA 3ZRCA 1GNUA 2D07B 2YSZA 4HAZB 2K39A 2MA9B 3VH4B 1WR1A 2KANA 1IYFA 2Z59B 4B6WA 3FLVA 1JRUA 3H7PB 2FIDA 2RLOA 5HKHA 1V86A 4B9KA 2PZ1A 3QWZB 1KLVA 2N1VA 3APDA 1DYNA 3HM6X 3CSTA 4F7GA 1XT9B 2BYFA 2GBNA 1W1GA 2D2QA 1FHXA 5AEKB 2LOXA 1SHCA 3MPXA 2MBOA 2YLMA 3OJ4B 3QCAA 3PREA 2IY1B 4PQ0A 4IC7B 5D94A 5LXHA 2FCSA 2JT4B 3JYUA 2I1JA 2R2OA 4KDIC 3VAWA 2OJRA 3WIMA 2MLBA 1ST7A 4PNKA 3A4RA 1ZC4B 2LUEA 4WSFA 1UZXB 3HM3A 2NR2A 4NSWA 3PLVA 2FDQA 2KNBA 5CLQB 4MSQB 3W1SA 3CSFA 5J3TA 3H9DA 3M3JA 1EF5A 2L3ZA 2DA0A 1G6JA 5KQ1A 2K2UA 5JHGA 3JSVB 1TGZB 4AJWA 2KZRA 4II3B 3SNHA 2GOWA 3ZKJC 4DHZE 1BTKA 1WJ6A 4GB9A 1XCGA 3SYXA 2BYEA 4W9IA 3GYOA 2Z0OA 1P0RA 4KIKB 1V5OA 5L95C 2HE7A 1X1GA 2GCJA 2N7EA 2XBBC 4IOYX 4FJVB 2GBJA 3CF6E 4ANWA 2DZJA 2BCJA 3NY5A 1J0WA 4MH0E 4NNJB 4E71A 3NSUA 2NPTA 3PLUA 2YVCA 2FJLA 2GBMA 1M7EA 5DH9B 1UBQA 3RZFA 2NZ8B 4X57B 1P98A 3ML4A 2ZNVB 5C5BB 1LW3A 3ZVRA 4NQKE 4LCDE 3U7DA 2LOZA 4K81A 1X05A 2D11A 1R4NI 3RUIB 4K2PA 2KC1A 3ZNHB 4P7IA 2NMBA 1NDDA 2K6QA 4MDKE 2Q13A 2KTRA 3SD5A 2W2WA 3ML9A 4CO7A 4MEMA 2C7HA 4HAUB 4HJKA 3GYPA 1RRBA 2OQBA 5D27A 2ZPYA 2ADZA 5J3YA 2M17A 4W9KA 1YIWA 2DYBA 3W1YA 1H8CA 1CMXB 2L8JA 4LJPB 4WJPA 5CTRC 5C79A 1FGYA 4L6EA 3ZLZA 5C16A 4DXAB 2I5FA 2JZ3B 4HAWB 3DVGX 3JSVA 4A3OA 1WMHB 2M1MA 4NAWA 1YD8U 4ASWC 1FGZA 1K5DB 5HE0A 5JZEB 3UQAA 4IM0A 3VUXA 2J59M 1UH6A 1WXAA 2J0MA 4MM3A 1FHOA 4HATB 1ZSQA 2R09A 2YS5A 2CHXA 1V5PA 1M7RA 4HWIB 4GXBA 3TBLD 1KZGA 1TJ6A 2COPA 2DTCA 1FXTB 3ZNZB 3VXWA 3FP5A 4GOCA 2LKOA 3PSCA 4KV2A 3WALA 2LJ5A 1M94A 3N7CA 2IO0B 1DDWA 2KK8A 2DZMA 3A9JA 3VUWA 2RGNB 4IUMB 1OY2A 2ZPNA 1NVLA 1WGRA 4CHKA 4BVUC 2KFKB 2LVPA 2L7RA 3DBSA 1NTVA 4W9HA 4BBKA 4MJSA 3KVFB 1P5TA 1GG3A 1Y19B 2MDXA 3MDBC 4OVVA 2FUHB 3H7PA 1U5FA 1V88A 1V5TA 2KMAA 4GU2A 2RVBB 3V61A 1WGGA 4A20A 3QIJA 3KYDD 1WJ4A 1H4RA 4DX8A 3UINB 3PS6A 5E6PA 3MHSD 3PGEA 3TIXA 2DFKA 2XEWA 1WX9A 4ZRKA 2FAZA 1GJZA 4MGKE 2AL3A 3W1SC 4BKTA 2OOBB 5CX3A 4FJZA 1A5RA 3AJ4A 1WF9A 3VDZA 1J19A 4ANUA 3OAWA 3R7QA 2WH5A 3FEHA 4TQ1A 2LGXA 3WAMA 3KZ1A 4JIOU 4IFSA 1E8YA 2AWTA 3D8FA 4HDQA 1MIZB 2ABDA 1XX0A 2WWZA 2ZNVC 3M95A 3QHTA 4PYZA 3ZDTA 2MBEA 2Z0DB 2RD0A 3PVLA 4RMAA 5D2MB 3FM8C 2IO1B 2BPSA 1OEYA 4KSLC 2N1WA 1YJ1A 3EPYA 2D4QA 1V6EA 2LBBA 2NCNA 3K9OB 2LRUA 4A3PA 1WJ1A 3PVWA 4LJOB 5CLLB 5DHFB 1LB1A 4OVUA 5CHFA 2CODA 2GBRA 1GC7A 1OQYA 5IA7A 3NOBA 4FA6A 4GSWA 4G0NB 3L17A 4KIKA 3F5RA 3PZDA 5IJMA 1E5WA 3A8PA 2KJ6A 3EHVA 3H6NA 1PMSA 1XR0B 1TXDA 5G55A 2KDEB 5BO4B 2KDFB 3PP2A 2KN5A 3KW5B 2RSGA 4PS7A 4WWOA 5FR6A 1UGMA 2JPHA 2K1FA 2BKRB 4FULA 4KZ0A 4MGIE 1N3HA 1FHWA 4G11A 3L08A 4F7UP 2LGYA 4KSKC 4ZYNA 2RR9A 4EOYA 4BKSA 1D3ZA 2M4NA 4WJQA 1H10A 2UWQA 4ANXA 3HIZA 2JVCA 1WGDA 3AI5A 4HPLB 3RD2A 2ROVA 2JP2A 2M38A 2WDTB 2K2JA 4URKA 2IFSA 1UNPA 2BF8B 3NS8A 3VTUA 2MW5A 1Z2MA 3PT2B 3DOWA 3LJ3A 4HDOA 3U8ZA 2LVOA 1Q5WB 4NPNA 2MSED 2L2IA 1WH3A 2YF0A 4KHAA 4LDTD 4IWOA 3LDZE 1R4MI 1WE6A 2DKQA 3VOQA 4TUUA 3G9WA 4A6HA 2WX0A 2DZIA 3V5WA 1GUAB 3CMMB 2LASA 3D32A 2COCA 2O6VB 3DBRI 2FIFA 2DHIA 1ZM0A 5GOWB 4EMOA 1VCBA 2KLCA 4GMXB 3QJZA 4MY6A 3RULA 2NBUA 3SU8X 2QKLA 1F9JA 1L2NA 2DYNA 3ZO5B 5C5BA 4BKGA 2DAFA 4B95A 1BTNA 2KDIA 2KQ7A 2WX1A 1ZW7A 2N4FA 3BINA 3EECA 2P0FA 3V60A 2COAA 1WX8A 2DLWA 1OTRB 2EKEC 3ONSA 4BBNF 1V80A 1ACAA 5HE1A 3IBEA 5E6OA 4F8CB 2EC1A 3N30A 2FNJB 1V9JA 3QWMA 5HE2A 2HD5B 4WWNA 1X11A 3VTWA 4A6FA 1S3SG 2CRFA 3KSYA 3DCGA 5E6NA 1L7YA 4AOFA 2V1YA 2KTFA 1WZ0A 1WXSA 3C0RB 4DHJB 3ODOA 2IYDB 2HJ8A 4Z2NA 5JP4A 3OANA 1WXVA 2MBBB 3X0WA 4AUQC 1XD4A 3TJPA 1I42A 1RJ2A 3QBVB 2RGFA 2JUOA 3ML8A 4H8SA 2WYQA 2JRIB 5G2NA 4K1RB 2K8HA 3DQVA 4Y94A 3KY9A 3ENEA 2L1CA 3HQCA 3M1IB 2M8SA 2R0DA 2YT1A 4EJNA 4A6FB 1QC6A 2PPHA 4GMVA 4TQ0A 4B6HA 2L00B 5LLIA 4DDGD 2NVUI 1P3RA 4J6IA 4NQLB 2XQNM 5DPSA 3LJUX 4PS8A 3TFMA 1I7AA 4EUTA 1I2HA 1KZ7A 4FN2A 5J3QA 2D9ZA 2I1KA 4ZRJA 2COFA 2KCJA 2KC2A 5JLJB 1Z5SB 2YS3A 2O2VA 1ZGUB 3K9PB 5J2RA 3VQIA 1TZ1A 2N9XA 5EDSA 2G4SA 2MWSB 4K7WA 4YONA 4WWPA 1KM7A 4KDLB 5AZHA 3RT3B 3H7SA 1MPHA 3TCAA 2A4ZA 1S1QB 3UQBA 3KUDB 1E7VA 2PJHA 1Q0WB 3NZUA 2RSUA 3QA8A 2KMCA 1V5UA 1V89A 2N0YA 1WM2A 2KJRA 1MK9B 3PG7A 2CB8A 3DBHI 5KQ4A 4KHBB 3ODXA 2L05A 3H1UA 1AQCA 1I35A 3KUCB 1LFDA 4EEWA 2MKRA 3ZTCA 1UPQA 4N9F4 5JHBA 2DX5B 2KX3A 3PTFC 1EUVB 3M63B 1HE8A 4MJSB 2VRRB 1KI1B 3UZTA 2KX0A 2QHOA 2KFKA 5C23A 2D9XA 1WGHA 3B0AA 1ZKHA 4I6LB 4ICUA 2K8CA 1SGHA 4KAXB 4TKNA 2PEAA 3A9JB 3PRZA 4GGQA 3VTVA 4ZDVA 3KRXA 3PHWB 2N23A 3CIKA 2V76A 4DBBA 4K2OA 3D8DA 4GZUA 5DHAB 1WRDB 2JWZA 4TYZA 2MBQA 5D3WA 2N7DA 1WFYA 3MJWA 2DX1A 2K00A 2E2XA 4HK2A 4FLHA 4MGYE 1OMWA 2GBKA 2G3QB 2CY4A 2KQSA 2D10A 1YQBA 4WAAA 2MFQA 2VRWB 3L0WB 4HAYB 3ECIA 2BKFA 4AJYB 1EVHA 4GDKB 1GC6A 3IHPC 4WJ7A 4NJ6A 1WZ3A 1X1MA 2REXA 1HB6A 2H7EA 4GN1A 3GOEA 4HB3B 4M8MA 2ROZB 1Q67A 3BJIA 1NTIA 4CHJA 1UBIA 2W2XC 2J0JA 3FSSA 4A6KA 3DXEA 2DHKA 2K6DB 3RCPA 4IWQA 4DK5A 1HBKA 2FCMA 3P2BA 4W9LA 1MK7B 2AEHA
chains in the Genus database with same CATH superfamily
3RNCC 2UZRA 2GRIA 1Z87A 1KOTA 5LONB 1HB8A 5BMGA 4ZRIA 2KFJA 2IO2B 3OLMD 1R4NB 2LG1A 1Y5OA 1YN4A 4K3BA 2AYOB 4EKUA 5D3YA 4I6NB 2KHWB 4D0NB 4IAPA 2AQ3B 1XXGA 4GDKA 3VRAB 2N9LA 1MG8A 3HVDA 1X86A 4W9FA 2DYMA 2JSVX 4ILGB 3P7ZA 1B1ZA 3I9V1 2CHZA 1FRRA 4IW0A 4RM9A 2WNMA 1YX5B 4HXDA 1OFFA 1XODA 1RLFA 2X38A 2MWNB 1BXTA 1AYFA 1P1AA 2IO3B 1EGXA 3AE9B 3SDLC 1C4AA 2MBHA 3EFCA 1ZOYB 5BYQA 3PV1A 4BOZB 3PVUA 4MELA 2W9NA 2QKMA 3QK0A 2KXJA 1C3TA 4JGHB 1NU2A 2PKOA 2VSZA 1QOAA 1PYWD 1ENFA 5GXGB 2UVMA 2LHEA 4HLEA 1F2RC 4A5KA 4ILHA 4BOSC 1HQRD 3R66C 1E9MA 2J0KA 2CJNA 1SBBB 3PHXB 4FHKA 3DHGC 4IM2A 1KRHA 3SFEB 4M0WB 1ISNA 1GOZA 5FR3A 4ZYSA 3FVCA 3PO0A 2KACA 1YX6B 1LO5D 1XKEA 4LLGM 2BS2B 1UNQA 4B0MA 2K8BA 4JE3B 2ZVNA 4CHMA 3UGBB 3ZNGC 2CKHB 1WWTA 1SIFA 2H7DA 1MI0A 3APCA 4M01A 2G35A 2DX5A 5BMIA 3U30A 3VVWB 4FHJA 3S2AA 2FJ9A 1I4RA 3VIAA 1I4XA 1WM3A 3AULA 4LNOA 5HE3A 2CS4A 2N9EB 1V61A 1FNWA 2PE6B 4XDCA 1JWBD 3KWVA 4XZ4A 2GMIC 3O13A 2MRPA 4JQWC 5KHQA 2K8EA 4M00A 1ZP0B 4DXFA 4HB4B 5JHAA 3P4RB 3EFUA 4HPPA 1KF6B 2BYVE 1QKZA 2PIAA 1FFVA 2LD9A 4A8XC 2LULA 1V5MA 1TYGB 4JWSC 5IAAC 2BGFA 3FAHA 3NVVA 1UWMA 2MP2B 1FOEA 3A9KB 1WGKA 1ZC3B 2GJYA 3SR6A 2GB1A 4LNKA 3HHMA 3VR8B 1UD7A 1ZVRA 4MH8A 4QJ3B 2V4LA 4OVZA 4HHVA 1I4GA 1L0VB 3JVZX 3QQ8B 2ELAA 4L2YA 4DDID 3GB1A 3FILB 5DPRA 5AZGA 1E0ZA 1WI0A 4JLCA 3IAM1 4HB2B 2O6VA 2DHJA 4KVGB 1EAZA 2N9KA 3Q69A 4KHBA 3O96A 2KGXB 1SE4A 4ZHOA 4KZCA 2YT0A 1DOIA 1E8XA 3N3KB 3ZRCA 2YSZA 1WR1A 4JKBA 3NVYA 2Z59B 1JRUA 5HKHA 2RLOA 2N1VA 3HM6X 1D5ZC 1XT9B 2GBNA 5AEKB 1EWYC 2WXOA 2LOXA 3PREA 2IY1B 1TY0A 5D94A 1FNUA 1TKEA 1XEEA 3VAWA 2OJRA 3IT6B 4H2AA 1R7SA 3HM3A 3PLVA 5CLQB 3AE3B 4MM3B 5J3TA 2WXJA 3R2IA 5KQ1A 2K2UA 5JHGA 2PTLA 4II3B 2GOWA 4GB9A 3SYXA 2Z0OA 1P0RA 4KIKB 3P63A 2N7EA 4RF0A 3RMKC 2GBJA 4E71A 4MH0E 2GBMA 1UBQA 3ZVRA 5C3JB 1Q10A 1Y56A 3N1XC 2D11A 1R4NI 4K2PA 2KC1A 2Q13A 4CO7A 1XLOA 4MEMA 2C7HA 1NVID 4HJKA 5J3YA 4W9KA 1SXTA 3W1YA 1YIWA 1UUPA 5C79A 5C16A 4DXAB 2Y3AA 4HAWB 2M1MA 1K5DB 5HE0A 2X0SA 1FHOA 3T3OA 2YS5A 4HWIB 4GXBA 1TJ6A 3FP5A 4GOCA 2LJ5A 2KK8A 3ZJVA 1DDWA 3KLSX 4D2KA 1I4HA 1NVLA 3DBSA 2G1EA 4MJSA 3KVFB 1XLQA 1Y19B 1NI3A 3Q2AC 4QXAB 3H7PA 2KMAA 3V61A 4GU2A 1UNSA 4A20A 2J4XA 1H4RA 4DX8A 2INDC 4P6VF 3PS6A 3AEFB 3PGEA 1MPEA 3BYTB 2XEWA 1WX9A 3AV8A 2LMCA 4MT5A 1FD6A 2AL3A 4HEA1 2OOBB 2IJ0A 5CX3A 3R7QA 2WH5A 1RM6C 4OT1A 2LEKA 2LGXA 4JIOU 4XC2A 1MIZB 2WWZA 2ZNVC 3DBRB 4Q2JA 4RMAA 2Z14A 5D2MB 4KSLC 2D4QA 4OZBA 2NCNA 3K9OB 2LRUA 2RRFA 2J52A 2CODA 2KUQA 5IJMA 3F5RA 2KJ6A 1E5WA 2YEPB 3H6NA 1PMSA 4HRSA 3PP2A 3KW5B 5FR6A 3Q8BA 3ZGZA 1J7BA 4FULA 1N3HA 1FHWA 4F7UP 2LGYA 4ZYNA 2RR9A 4GNKB 4BKSA 3VR9B 2OJWA 1HEZE 4WJQA 1H10A 1VLBA 1WGDA 3DCXA 3AI5A 4HPLB 2WDTB 3VTUA 4DXGA 2MW5A 1Z2MA 2BYTA 2Z4DA 3DOWA 4HDOA 3U8ZA 1F52A 2LVOA 4JK9A 2L32A 2LUMA 1IGDA 4LDTD 3LDZE 3G9WA 3V6EB 1JWSD 3V5WA 2DZIA 2O6VB 3DBRI 2FIFA 2JWUA 2DHIA 2H88B 1ZM0A 4MY6A 3E9LA 3GE8C 2DYNA 3ZO5B 5C5BA 3Q8FA 4B95A 2WX1A 2XNAC 3BINA 3KQ4A 3V60A 2COAA 4WURA 2VZKB 2WXGA 4KGTA 3Q3OC 4LTUA 2EC1A 1V9JA 5HE2A 3NWAA 2HD5B 2V1YA 4ZHPA 1WXSA 2IYDB 2HJ8A 4YSXB 3X0WA 1L0XB 1RJ2A 3BWUD 2QCZA 3DQVA 3W5UB 2SAKA 2BS4B 4GMVA 1T77A 2L00B 1TY2A 1SIJA 2XQNM 2K5PA 3Q14C 4KGRA 3TFMA 1BUIC 3ZXVA 1I2HA 1KLUD 2I1KA 4ZRJA 2KCJA 1YMHE 3TUOA 1E7PB 5J2RA 5EDSA 2G4SA 1C78A 5AZHA 3H7SA 3AEDB 3QA8A 1JCKB 2KJRA 1L0YB 4HKQA 1LFDA 2KX3A 1D6EC 1EUVB 1SE2A 4MJSB 1FCLA 1KI1B 2QHOA 1VZ6A 4I6LB 1ZKHA 2K8CA 4KAXB 4TKNA 3VTVA 3KRXA 2WLBA 3N20C 2ACZB 4DBBA 1XCTL 1CJEA 3D8DA 3PTFC 2MBQA 1WFYA 2FJUB 1OMWA 3ENBA 2G3QB 2CY4A 4WAAA 2BKFA 1AWDA 2YT2A 3RNEC 1HB6A 2H7EA 4HB3B 4M8MA 2ROZB 2RPVA 1UBIA 3B77A 5HHDG 4A6KA 3RNBC 1HBKA 1C4PA 2SEBD 1MK7B 2DYQA 1WJMA 2KVZA 2KJHB 2OHFA 5L81A 4WQOB 4BBNC 2ZKMX 1MKEA 3HW2B 3V62A 5C2TB 3APFA 4HSIA 4ZRPA 1TBEA 1V81A 3I3TB 4GPTB 2DKPA 2RUKB 4WJOA 3ZIMA 4K7SA 4JKGA 1DOXA 4RGMA 2XK5A 4NJ7A 3R3MA 3A33B 4QJ4B 2M56B 4IDIA 4JPSA 3KH0A 1T0YA 3NVWA 5CHWA 2KLGA 3PRMB 1EU3A 1KLGD 2LZ6A 2G45B 4G3XB 1PQSA 4E3CA 3DPDA 3V6CB 2ONQA 1HTOA 3GP7A 4OW0A 2KKCA 3ZNID 2D9WA 4DHJD 4AWJA 2P0HA 3IG3A 3AEGB 2KTRB 2WXPA 3QX1A 2CU3A 5EFXA 1SB3C 3AU5A 3E9PA 2ZCCA 3GZNI 3SEBA 1MVKA 3E56A 1FMAD 1U4AA 2M14A 4HPMB 2RQ1A 5LOPB 1RFAA 4BFRA 1WXQA 2L83A 2WGSA 2Z0EB 3NJTA 2BW2A 4IWPA 1TQZA 3JW0X 3ZXRA 4D6WA 4G50A 4DQOC 1WY8A 4XWXA 2KO3A 2KWDA 2AL6A 2MP2A 2EELA 5D3VA 4II2B 2NS5A 2LVQA 2LGSA 1V1PA 3WAPA 1FB8A 2ZZPB 3A8QA 2LGDA 1BAKA 1QZEA 3U4EG 3ZDMC 1U5EA 4A55A 2KD0A 4GLSC 2K25A 4K17A 2V3SA 3CWIA 4WAFA 4TSSA 3M62B 2O6VD 3NW8A 1WI1A 4WVFB 3KUZA 1A70A 2BWES 2KDBA 4LNFA 3A1QB 1KJTA 4NAWB 1E7UA 2TSSA 1ZDXA 1PLSA 4NAMA 5E6JA 3VRBB 2LXAA 2INNE 4FADA 1OGWA 2O2VB 3B1LX 4YL8A 3R7RA 5JXVA 4MGZE 1J0GA 4HKZE 4FJYA 5EE0A 1LXDA 2J7QB 4P16A 1EO6A 2CQUA 5FI1A 4F7ZA 4KX6B 5DIFB 4W9JA 2D3BA 3DVGY 1WR6E 1MI1A 3AU4A 4W9CA 1P6SA 3TMPB 4EZKA 2Y8GA 2OEDA 1UPRA 1L6VA 5BMHA 5AUIA 3TW1A 2MHJA 1WG7A 3ZUNA 5C1ZA 5T8IA 3ZTDA 1NI2A 3N1ZC 4ANVA 3ULCA 2ZEQA 2UYZB 3RYTA 2L0TA 2HRJA 3P6AA 2MCNB 1WVHA 3D8EA 3DBLI 3SO6A 3Q3JA 4WJPA 3A98B 4IM3A 3AEEB 2BBCA 2UZSA 2CU1A 4WJNA 3L10B 2YEPF 4HAXB 5DI9B 2GS0A 1WJNA 3AE8B 4LK0M 3VHTC 3AE1B 2ELBA 4QAYA 3A1QA 4AP4C 2WHIA 3VH4B 1NEKB 4B6WA 2FIDA 3QWZB 1DYNA 1W1GA 2D2QA 1FHXA 1SHCA 4IC7B 3QCAA 2YLMA 3U52E 2KMMA 4US8A 2JT4B 2WXKA 1V1PB 2MLBA 4PNKA 1TIFA 1ZC4B 1YJJA 3A4RA 1HTQA 1XO3A 2NR2A 4NSWA 2WXLA 2KNBA 5IO9A 5EE3A 1YQ3B 1EF5A 1TGZB 2KZRA 1XLPA 4DHZE 3MFGA 1WJ6A 1PGXA 4JWUC 3EA6A 1T6BX 1V5OA 3DBHB 2HE7A 5L95C 5G5GA 1ZPSA 2VH1A 2XBBC 3CF6E 5JH5C 2BCJA 3NY5A 1J0WA 4NNJB 1FPYA 3NSUA 2ICIA 2VH2A 3PLUA 1OQRA 3RZFA 1M7EA 4WIPA 2NZ8B 2MJEA 3ML4A 5C5BB 1LW3A 2DIKA 4LCDE 3U7DA 2FBWB 2LOZA 4K81A 3BZDB 2KTRA 2M0AA 3ML9A 3GYPA 4N59A 2INPE 1CMXB 4LJPB 3TEXA 3LXFA 2I5FA 1SJED 4A3OA 1WMHB 1YD8U 5JZEB 4IM0A 3VUXA 2ZW1A 1UH6A 2NTTA 2CHXA 1M7RA 1KZGA 3ZNZB 2LKOA 3WANA 2IO0B 3N7CA 3NWDA 2ZW0A 2KFKB 2LVPA 3OWEB 2FE8A 4BBKA 1GG3A 2MDXA 4GOUA 1TT5B 2RVBB 1V97A 1WGGA 3QIJA 3KYDD 2J53A 4KKIA 1E6EB 2JXTA 3UINB 2DFKA 4JKGB 2FAZA 4MGKE 4JKHA 3OAWA 4TQ1A 3WAMA 2N0SB 2MJ3A 4IFSA 1E8YA 2AWTA 2ABDA 3M95A 3W5VB 3ZJTA 3NUHB 3PVLA 4RNAA 3FM8C 1WSPA 1SSNA 1ZDVA 2EKIA 3EPYA 4P1BC 2LBBA 4IOIE 3PVWA 4LJOB 5CLLB 1LB1A 2JYEA 4FA6A 4JKFA 4GSWA 1ZE3D 3L17A 3PZDA 3EHVA 1XR0B 5G55A 2KDFB 2KN5A 2RSGA 1P7FA 2JPHA 2K1FA 2BKRB 4MGIE 5JVLA 4G11A 3E66A 1N5XA 1D3ZA 2M4NA 2NTSA 4ANXA 2JVCA 1J7CA 3NZ3A 3GE3C 2JP2A 2M38A 1UNPA 2BF8B 2W3RA 3H8HA 1Q5WB 2IDYA 3EGRA 1V1OA 2YF0A 3BYYB 4KHAA 1WE6A 3EUB2 2WX0A 1GUAB 2COCA 1GB4A 5GOWB 2KDMA 4EMOA 4GMXB 2W3SA 1F0ZA 4BKGA 2DAFA 2KQ7A 2RDHA 2P0FA 2DLWA 2BS3B 4NZLB 1ACAA 3N30A 3VTWA 1S3SG 1WYGA 5E6NA 3C8YA 3DCGA 1T0RC 2KTFA 1WZ0A 3C0RB 4RGTA 1I42A 4H8SA 2WYQA 5G2NA 2Z13A 2IGGA 2K8HA 2HTME 3ENEA 3HQCA 1VBHA 3N9YC 2PPHA 4DDGD 2MEKA 4J6IA 3IAS1 4NQLB 5DPSA 3LJUX 2INCC 3BK2A 2KC2A 1TZ1A 2N9XA 5TSSA 4K7WA 4YTNB 2LHDA 3RT3B 3KUDB 4C80A 2PJHA 1V5UA 2N0YA 3T3NA 4KHBB 3ODXA 3KUCB 2MKRA 4N9F4 1I4PA 1HE8A 1ZXIA 2WDQB 3UZTA 3BIID 5C23A 3B0AA 3PRZA 3A9JB 2R61A 4GGQA 4B0EA 3PHWB 2N23A 1FRDA 2V76A 4K2OA 4GZUA 5DHAB 3ETRA 1GPXA 4TYZA 5D3WA 2K00A 2GBKA 3OG5A 1JWUD 2VRWB 4HAYB 1EVHA 1QOBA 4WJ7A 1X1MA 2REXA 1NENB 1GGOA 1NTIA 4YXDB 2KYWA 3FSSA 2K6DB 3P4SB 4IWQA 3KWLA 2FCMA 3P2BA 1RYJA 2QEJC 2AEHA 3AH7A 2V9HA 4DX90 2L76A 4E74A 1V2YA 2HTHB 5EE9A 4EE2A 1U2BA 5IOIA 4W9EA 4K3CA 1VJKA 2GLSA 3UF8A 2NPTB 1ESFA 1NBFC 2KWCA 2L1AA 2QJLA 3PPAA 2FCQA 4EZLA 1N6ZA 1HZ6A 3ULBA 1RRPB 2LFIA 2WU2B 5FK9C 5DCNA 5CHVC 2JXXA 3TVVA 4HB0B 1MFWA 3Q6BA 2GCLA 2Y7BA 3ZQ4A 3A58A 1UNRA 2OTXA 5D7GA 4WH4A 2KWVB 4L1BA 1IGCA 4RH6A 3ALBA 1KH0A 4GDLA 3WA0A 4OHJA 4TV3A 1MHHE 4DHZB 1K50A 1WX7A 5C6RA 4KHOA 4F1SA 4M8NA 1T0QC 2Y8FA 2ZVOA 1U5DA 1UF0A 2YRYA 4ARCA 2KOXA 1AWEA 3OHMB 2RDBC 1PDXA 5HI1A 1QQGA 3N32A 2I38A 3I63C 4W9GA 4JK8A 4DBGA 1WRIA 4DWFA 3QC8B 2JZZA 1V8CA 2XN9C 1WGYA 2ON8A 4XX5A 1XQQA 3R8BA 4IG7B 3ZW3A 3NHEB 3CXBB 3KRWA 4JL9A 1VD2A 4Z2MB 1FM0D 2C9WB 2DYOA 2R2QA 5JHHA 1E8ZA 2W82A 3DVNV 3VH3B 2NBWB 2EJ8A 3A4SC 1WE7A 4LNNA 5KCVA 1VRAB 2WXNA 3UI3A 3WCQA 2WDVB 4PS3A 3L16A 4AQ7A 1IP9A 2D9YA 3PSEB 1F1HA 5BYRA 4EZJA 1WMHA 2X18A 1FFUA 2RNRB 1QT9A 3PRPB 3C19A 3AECB 3QARA 2E3TA 4C7YA 2P0DA 1WXMA 3Q3FA 2UU7A 2PVGC 5D3XA 2DN6A 2MX2A 1N60A 1C1YB 2QC8A 4XDDA 2C7NB 1FCCC 1WGUA 2IBIB 2IZVB 2G4DB 3MHZA 2PE9A 1KC7A 3RNFC 1OEYJ 3W9CB 1U5GA 3T06A 3ZVVA 1P3QU 5H92C 2Y5BB 2D9VA 1XF5L 4YTMB 1NTYA 3PZ8A 1DBHA 2KWUB 1RWSA 1FIQA 1E10A 4MK0A 3DVNU 4PYUA 2JZPA 2C60A 4REZA 3E9OA 1CK1A 1E90A 3HRDD 3A9KA 1EWCA 2FCNA 2P8VA 5DPTA 4A9AA 2DZKA 2JF5A 3KYCD 2IGHA 1TZOA 4NY0A 1TKGA 3WAOA 1M4VA 2JY6A 5LXIB 3IVFA 3RZWC 2Z8LA 1DDMA 2RPQA 4O1NA 5MPOA 2ASQA 3DDCB 3QAQA 3ZRFA 2MQJA 3UIPB 3HK0A 1STEA 2IY0B 3RCZA 1GNUA 2K39A 2KANA 4TMAB 3FLVA 3DBLB 3H7PB 1V86A 2PZ1A 1KLVA 3APDA 3CSTA 4F7GA 2BYFA 3MPXA 5LXHA 2FCSA 2QSDA 3I5JC 3WIMA 3B9JA 3P42A 4WSFA 1UZXB 3DWMA 2FDQA 1DGJA 5I2MA 3CSFA 3H9DA 3M3JA 2L3ZA 4RGOS 3Q8EA 4AJWA 1HZ5A 3SNHA 5LG4B 1XCGA 3SBGA 4W9IA 2BVCA 2GCJA 4IOYX 3BVGA 2YVCA 3SBTA 2HJ1A 1YN5A 4A90A 4X57B 2ZNVB 1AW7A 1X05A 3RUIB 3ZNHB 4ITKA 2NMBA 2K6QA 1NDDA 4MDKE 2D5GA 4HAUB 2ADZA 2M17A 2CJOA 1H8CA 2L8JA 5CTRC 1FGYA 3ZLZA 3R2TA 4RF1A 2JZ3B 3DVGX 4S0RA 4ASWC 3URYA 4NAWA 1FGZA 2J59M 4MM3A 4HATB 5BYSA 1V5PA 1FXTB 2DTCA 2COPA 4DHJB 4HROA 1K52A 2V3NA 3PSCA 1C77A 3VUWA 2DZMA 2RGNB 4IUMB 2ZPNA 1WGRA 4BVUC 1TS5A 1ROEA 1QLBB 4XGAB 3BVZA 4OVVA 3MDBC 1ET9A 3TEYA 1U5FA 1V88A 1XCQL 2IGDA 1HXYD 2D3AA 1WJ4A 1N61A 3P1MA 3N1YC 1ZYIA 2J42A 1QILA 4ZRKA 1GJZA 4BKTA 2D3CA 4FJZA 3MC8A 3Q3MC 1A5RA 3RN9C 3VDZA 1J19A 1C79A 3AM9A 4ANUA 3FEHA 3KZ1A 3D8FA 1XX0A 4JK7A 3FILA 3NVZA 3V3XA 3RFZB 5D3DA 2KIGA 2IO1B 2BPSA 5IN7A 1OEYA 2N1WA 1YJ1A 2K9XA 2JYTA 5DHFB 2HDEA 4OVUA 5CHFA 2GBRA 1OQYA 3NOBA 3A8PA 4OSNA 3Q8CA 3MC0B 1NYQA 3ZYYX 2R82A 1MHXA 1FXIA 4KZ0A 4PK1A 1JQ4A 3L08A 4R3DA 1MG4A 2H89B 1ZUD2 1N62A 2MH7A 2UWQA 3HIZA 2BT6A 3NWFA 3LB8C 3RD2A 2ROVA 2K2JA 2IFSA 3PT2B 4ARIA 4NPNA 1WH3A 2FUG1 2WS3B 4IWOA 5G5HA 1R4MI 3VOQA 4A6HA 4KGSA 1DYQA 2WXFA 1VCBA 1ZXHA 2KLCA 3QJZA 3RULA 2NBUA 2QKLA 1L2NA 3TEWA 2KDIA 1KBLA 1ZW7A 3PZ7A 1RFKA 1WX8A 1OTRB 2EKEC 3NS1A 4F8CB 5E6OA 4RCOA 3QWMA 4WWNA 4A6FA 2CRFA 4AOFA 5H8YE 1L6UA 2MBBB 4Z2NA 5JP4A 3OANA 1XD4A 1D5XC 3QBVB 2RGFA 2JUOA 3ML8A 1D5MC 2JRIB 1JMLA 2M8SA 2YT1A 3P4QB 4XE0A 4C00A 3MP9A 4N6EB 1QC6A 2V4IB 4LNIA 4B6HA 1QOFA 2NVUI 4ZRQA 3AE5B 2E6XA 4PS8A 1I7AA 1KZ7A 2KN4A 1Z5SB 4P1CC 2QDFA 3K9PB 5LNK1 2AQ1B 2MWSB 4KDLB 3TCAA 1S1QB 1E7VA 4KKJA 2WXQA 4USAA 3PG7A 3DHIC 3DBHI 1JWMD 3H1UA 3V05A 2L05A 2R2YA 1AQCA 1FEHA 2I2YA 5JHBA 4AS1A 2K3UA 2VRRB 2KX0A 4JKAA 1PFDA 4J3OD 3U12A 4ICUA 2PEAA 4ZDVA 4C4VB 1TKYA 4EOYA 3IHPC 2JWZA 5IKCM 4HK2A 2E2XA 2KQSA 1DOYA 2MJDA 2MFQA 3L0WB 3ECIA 3B2FA 4AJYB 2G9HD 4GDKB 1GC6A 1SE3A 4C56C 4NJ6A 3GOEA 1Q67A 2W2XC 1K51A 2K0PA 3DXEA 4MACA 3AEBB 4W9DA 1VZ7A 4I6PA 1HA5A 3BK1A 2ZJDA 4OZAA 4YT0B 4YSYB 3W2DA 4HCPB 5FI0A 3NZSA 2W54A 1C9FA 5J18A 4BKSD 2X8XX 2Z0QA 4HVBA 5DPWA 4WWMA 2DENB 1D4BA 3EC8A 1X1FA 1Y8RC 3L54A 3IXSA 1VBGA 4NJCA 2VKIA 4CSQA 4GDLB 2PMVA 3DXDA 1K8RB 3LYYA 4MT7A 1TS4A 3TL5A 1DDVA 4BZAA 1EF1A 4HCNB 5L83A 2D3GA 3T8MA 2YS1A 3L13A 2KIEA 3AE6B 2CR5A 1WIAA 2B3AA 2WXIA 4OZCA 1PUTA 3SUZA 5KHOA 1FAOA 1XLNA 3T9LA 2AQ2B 1LM8B 2XK5B 4PT5A 2QILA 4ICVA 1V49A 2L0FA 5J17A 1XD3B 4MSMB 2HTHA 1T0SC 4RM8A 3O65B 1PFJA 1LQBA 1BWNA 2Y5CA 2ZCBA 3AEAB 2KQ4X 2JRHA 4IKGA 2I5CA 3RPFC 1JDEA 1SJHD 5HG2A 3TSSA 3SV1A 1OQNA 2W2XD 1GAQB 2C5LC 1U27A 2LI5A 1J7AA 2M0XA 2DHZA 2KR0A 4RGNA 2WP9B 3OJ3A 2C7MB 1IPGA 5D6JB 1DIKA 1AARA 1WGQA 2KUPA 1WYWB 2L52A 3SHQA 4HAVB 3AXCA 5FKAC 3TO1A 2N7JA 5AZFA 3UIOB 1MAIA 3B08A 5I2SA 3IFWB 3F0WA 2V3PA 2EMSA 3RNAC 4GIVA 2WDRB 3RNGC 1N63A 2WXMA 3GZNB 4F7HA 4HJGE 2WQYB 3U7ZA 2CHWA 4US9A 4EFOA 3PEGA 4C0AA 3VFKA 1EU4A 1Q1OA 1YN3A 1IRSA 1IUEA 1DROA 1SEBD 4CYEA 3J9CA 1JALA 1UELA 2A5UA 3ODWA 2KVRA 4XWTA 5GMVA 5TR5A 1YJIA 2NBVB 1B55A 4LDTB 5M4YB 3HVZA 3MJ5A 2LGIA 1AN8A 1P9DU 2BWFA 3WYFB 1E8WA 3X23A 3Q3NC 1N5WA 1L5PA 4BAXA 2LYDA 1VDVA 2EMTA 1VR9A 1VZ8A 2Z0PA 2IYBA 1W1DA 4JX1C 2NBVA 1WJUA 4FBJB 3SFDB 3DXCA 3L4PA 4JKCA 1U29A 2LRWA 3VUYA 4K7UA 1JW9D 1FO4A 1MIXA 1CQVA 1TTNA 2CAYA 3MTNB 1UEFA 2WXRA 1K5GB 2DAJA 1RAXA 3BY4B 2Z59A 1BT0A 1SE9A 2N9PC 2LXCA 1W1HA 1UWXA 3CIRB 2CY5A 1C4CA 2D07B 2MA9B 4HAZB 2BB5A 1IYFA 2K49A 4B9KA 4RFBA 5IRSA 2MBOA 3OJ4B 1K53A 4PQ0A 1B9RA 3JYUA 2I1JA 2R2OA 4KDIC 1ST7A 5D3IB 2LUEA 2WXHA 4MSQB 3W1SA 2DA0A 2BQQA 1G6JA 1I4QA 3JSVB 3ZKJC 1BTKA 1JWAD 2BYEA 3GYOA 1X1GA 4N58A 4FJVB 4ANWA 2DZJA 1GB1A 2NPTA 2FJLA 5DH9B 4YSZB 1P98A 2QIEB 4NQKE 1L4DB 3AE7B 4P7IA 1YOVB 3SD5A 2W2WA 1RRBA 2OQBA 5D27A 2ZPYA 3AE4B 4A3PA 2DYBA 3FKYA 4L6EA 1JRPA 2LJIA 3JSVA 3UQAA 3HUIA 5AUKA 1WXAA 2J0MA 1LGRA 1ZSQA 2R09A 3TBLD 2KT7A 3VXWA 3WALA 4KV2A 1M94A 2GUMA 3A9JA 3AN1A 1OY2A 3AE2B 2RMMA 4CHKA 2L7RA 1NTVA 4W9HA 2KAJA 4YTPB 1P5TA 2FUHB 1V5TA 3E9SA 3MC9A 2AX5A 4ILJA 5E6PA 3MHSD 3TIXA 1PGAA 3RI7C 2DLBA 3P4PB 3W1SC 1JROA 3IT4B 3AJ4A 1WF9A 2PVOD 1PGBA 1T3QA 4HDQA 3BVMA 3DHHC 3Q8AA 1YQ4B 3QHTA 4PYZA 3ZDTA 1R4MB 2MBEA 2Z0DB 2RD0A 4JKEA 1V6EA 5EE1A 4DIXA 1WJ1A 5IA7A 1GC7A 2DNFA 4G0NB 4KIKA 4ZOHC 3ZJUA 1I7HA 1TXDA 2KDEB 2JX5A 5BO4B 4PS7A 4WWOA 2BTEA 2BB6A 1UGMA 3AB5A 5I4DA 1MJDA 4KSKC 2VZKD 2GI9A 2DWQA 4C4VA 4WQMA 2B76B 1L4ZB 2M19A 4URKA 3NS8A 4FXCA 1QOGA 1C76A 3NRZA 3LJ3A 2Y5PA 1QQRA 2MSED 2L2IA 3DWGC 2DKQA 4TUUA 5HFYA 1FNVA 3D32A 3CMMB 2LASA 2V0GA 3B2GA 1P7EA 3SU8X 2DBYA 1F9JA 3HIEA 4XYCA 1BTNA 1CZPA 3EECA 2N4FA 2QMTA 3ONSA 3AMZA 4BBNF 1V80A 5HE1A 3IBEA 4S17A 1NYRA 1ET6A 2FNJB 1X11A 3KSYA 1OQQA 1L7YA 2JU6X 1YNTE 4CQNA 3ODOA 1WXVA 4AUQC 1FXAA 3U2SC 3TJPA 2W55A 1ACCA 4K1RB 1IBXA 4Y94A 3KY9A 1SF0A 2L1CA 3M1IB 4L23A 2R0DA 4EJNA 3I57A 4A6FB 4TQ0A 5LLIA 1QF6A 1P3RA 2WU5B 1F2RI 4EUTA 3NG0A 4FN2A 5J3QA 2D9ZA 2COFA 2O2VA 5JLJB 2YS3A 1ZGUB 1TS3A 1EM7A 3VQIA 4WWPA 4A6QA 4YONA 1KM7A 1TS2A 1MPHA 2A4ZA 1UGJA 2RDGA 3UQBA 1Q0WB 3NZUA 2RSUA 4UDUC 2KMCA 1V89A 4XWWA 1WM2A 1MK9B 2NMQA 2IPKD 2CB8A 5KQ4A 1I35A 1F77A 5IP4D 4C7ZA 4EEWA 1T5XD 3ZTCA 1UPQA 2DX5B 3M63B 4JKDA 2PLPA 1KTKA 2JQRB 2KFKA 2PW9A 2D9XA 1WGHA 4YWGG 1J8CA 1SGHA 1BMLC 3CIKA 4QJ5B 1WRDB 2N7DA 2Q5WD 3MJWA 2DX1A 1KFYB 3TEZA 1IBXB 4FLHA 4MGYE 4ACFA 2D10A 1YQBA 3GS2A 3HSAA 1TJEA 4M0WA 1WZ3A 3ABVB 4M02A 4GN1A 3FC4A 3BJIA 4CHJA 2J0JA 4L1RA 2DHKA 3RCPA 4DK5A 2K22A 4W9LA 2LWPA
chains in the Genus database with same CATH topology
2UZRA 1Z87A 1KOTA 5LONB 1HB8A 4ZRIA 2KFJA 2IO2B 3OLMD 2LG1A 1Y5OA 2AYOB 4EKUA 5D3YA 4I6NB 2KHWB 4D0NB 4IAPA 4GDKA 1MG8A 1X86A 4W9FA 2DYMA 4ILGB 3P7ZA 2CHZA 4IW0A 4RM9A 1YX5B 4HXDA 1XODA 1RLFA 2MWNB 1P1AA 2IO3B 1EGXA 3SDLC 2MBHA 3PV1A 4BOZB 3PVUA 4MELA 2W9NA 2QKMA 3QK0A 2KXJA 1C3TA 4JGHB 1NU2A 2VSZA 2UVMA 4HLEA 4A5KA 4ILHA 4BOSC 3R66C 2J0KA 3PHXB 4FHKA 4IM2A 4M0WB 1ISNA 1YX6B 1XKEA 1UNQA 2K8BA 2ZVNA 4CHMA 3UGBB 3ZNGC 2CKHB 1SIFA 2H7DA 3APCA 2G35A 2DX5A 3U30A 3VVWB 4FHJA 3S2AA 2FJ9A 3VIAA 1WM3A 3AULA 5HE3A 2CS4A 2N9EB 1V61A 2PE6B 4XZ4A 2GMIC 2MRPA 4JQWC 5KHQA 4HB4B 5JHAA 3EFUA 2BYVE 2LD9A 2LULA 1V5MA 5IAAC 2BGFA 2MP2B 1FOEA 3A9KB 1ZC3B 2GJYA 3HHMA 1UD7A 1ZVRA 2V4LA 4HHVA 3QQ8B 3JVZX 2ELAA 4DDID 5DPRA 5AZGA 1WI0A 4JLCA 4HB2B 2O6VA 2DHJA 4KVGB 1EAZA 3O96A 2KGXB 4KZCA 2YT0A 1E8XA 3N3KB 3ZRCA 2YSZA 1WR1A 4JKBA 2Z59B 1JRUA 5HKHA 2RLOA 2N1VA 3HM6X 1XT9B 2GBNA 5AEKB 2LOXA 3PREA 2IY1B 5D94A 3VAWA 2OJRA 3HM3A 3PLVA 5CLQB 5J3TA 5KQ1A 2K2UA 5JHGA 4II3B 2GOWA 4GB9A 3SYXA 2Z0OA 1P0RA 4KIKB 2N7EA 2GBJA 4E71A 4MH0E 2GBMA 1UBQA 3ZVRA 2D11A 1R4NI 4K2PA 2KC1A 2Q13A 4CO7A 4MEMA 2C7HA 4HJKA 5J3YA 4W9KA 3W1YA 1YIWA 5C79A 5C16A 4DXAB 4HAWB 2M1MA 1K5DB 5HE0A 2X0SA 1FHOA 2YS5A 4HWIB 4GXBA 1TJ6A 3FP5A 4GOCA 2LJ5A 2KK8A 1DDWA 1NVLA 3DBSA 4MJSA 3KVFB 1Y19B 3H7PA 2KMAA 3V61A 4GU2A 4A20A 1H4RA 4DX8A 3PS6A 3PGEA 2XEWA 1WX9A 2AL3A 2OOBB 5CX3A 3R7QA 2WH5A 2LGXA 4JIOU 4XC2A 1MIZB 2WWZA 2ZNVC 4RMAA 5D2MB 4KSLC 2D4QA 2NCNA 3K9OB 2LRUA 2CODA 5IJMA 3F5RA 2KJ6A 1E5WA 3H6NA 1PMSA 3PP2A 3KW5B 5FR6A 4FULA 1N3HA 1FHWA 4F7UP 2LGYA 4ZYNA 2RR9A 4BKSA 4WJQA 1H10A 1WGDA 3AI5A 4HPLB 2WDTB 3VTUA 2MW5A 1Z2MA 3DOWA 4HDOA 3U8ZA 2LVOA 4JK9A 4LDTD 3LDZE 3G9WA 3V6EB 2DZIA 3V5WA 2O6VB 3DBRI 2FIFA 2DHIA 1ZM0A 4MY6A 3E9LA 2DYNA 3ZO5B 5C5BA 4B95A 2WX1A 3BINA 3V60A 2COAA 2EC1A 1V9JA 5HE2A 2HD5B 2V1YA 1WXSA 2IYDB 2HJ8A 3X0WA 1RJ2A 3DQVA 4GMVA 2L00B 2XQNM 3TFMA 1I2HA 2I1KA 4ZRJA 2KCJA 5J2RA 5EDSA 2G4SA 5AZHA 3H7SA 3QA8A 2KJRA 1LFDA 2KX3A 1EUVB 4MJSB 1KI1B 2QHOA 4I6LB 1ZKHA 2K8CA 4KAXB 4TKNA 3VTVA 3KRXA 4DBBA 3D8DA 3PTFC 2MBQA 1WFYA 1OMWA 3ENBA 2G3QB 2CY4A 4WAAA 2BKFA 1HB6A 2H7EA 4HB3B 4M8MA 2ROZB 1UBIA 4A6KA 1HBKA 1MK7B 2DYQA 1WJMA 2KJHB 4WQOB 5L81A 4BBNC 1MKEA 3HW2B 3V62A 3APFA 1TBEA 1V81A 3I3TB 4GPTB 2DKPA 2RUKB 4WJOA 3ZIMA 4K7SA 4JKGA 2XK5A 4NJ7A 3R3MA 3A33B 3KH0A 1T0YA 5CHWA 2KLGA 3PRMB 2LZ6A 2G45B 4G3XB 1PQSA 4E3CA 3DPDA 3V6CB 2KKCA 3ZNID 2D9WA 4DHJD 4AWJA 2P0HA 3IG3A 2KTRB 3QX1A 5EFXA 3AU5A 3E9PA 2ZCCA 3GZNI 1U4AA 2M14A 4HPMB 2RQ1A 5LOPB 1RFAA 4BFRA 2Z0EB 4IWPA 1TQZA 3JW0X 4G50A 1WY8A 4XWXA 2KO3A 2AL6A 2MP2A 5D3VA 4II2B 2NS5A 2LVQA 3WAPA 1FB8A 2ZZPB 3A8QA 2LGDA 1BAKA 1QZEA 3ZDMC 1U5EA 2KD0A 2K25A 4K17A 2V3SA 3M62B 2O6VD 1WI1A 4WVFB 3KUZA 2BWES 2KDBA 3A1QB 1KJTA 4NAWB 1E7UA 1PLSA 2LXAA 4FADA 1OGWA 2O2VB 3B1LX 4YL8A 3R7RA 4MGZE 1J0GA 4FJYA 1LXDA 2J7QB 1EO6A 2CQUA 5FI1A 4F7ZA 5DIFB 4W9JA 3DVGY 1WR6E 3AU4A 4W9CA 1P6SA 3TMPB 4EZKA 2Y8GA 1UPRA 3TW1A 1WG7A 3ZUNA 5C1ZA 3ZTDA 1NI2A 4ANVA 3ULCA 2ZEQA 2UYZB 3RYTA 2L0TA 2HRJA 3P6AA 2MCNB 1WVHA 3D8EA 3DBLI 3SO6A 3Q3JA 4WJPA 3A98B 4IM3A 2UZSA 2CU1A 4WJNA 3L10B 4HAXB 5DI9B 2GS0A 1WJNA 3VHTC 2ELBA 3A1QA 4AP4C 3VH4B 4B6WA 2FIDA 3QWZB 1DYNA 1W1GA 2D2QA 1FHXA 1SHCA 4IC7B 3QCAA 2YLMA 2JT4B 2MLBA 4PNKA 3A4RA 1ZC4B 2NR2A 4NSWA 2KNBA 1EF5A 1TGZB 2KZRA 4DHZE 1WJ6A 1V5OA 5L95C 2HE7A 2XBBC 3CF6E 5JH5C 2BCJA 3NY5A 1J0WA 4NNJB 3NSUA 3PLUA 3RZFA 1M7EA 2NZ8B 3ML4A 5C5BB 1LW3A 2DIKA 4LCDE 3U7DA 2LOZA 4K81A 2KTRA 3ML9A 3GYPA 1CMXB 4LJPB 2I5FA 4A3OA 1WMHB 1YD8U 5JZEB 4IM0A 3VUXA 1UH6A 2CHXA 1M7RA 1KZGA 3ZNZB 3WANA 2LKOA 2IO0B 3N7CA 2KFKB 2LVPA 4BBKA 1GG3A 2MDXA 2RVBB 1WGGA 3QIJA 3KYDD 3UINB 2DFKA 4JKGB 2FAZA 4MGKE 4JKHA 3OAWA 4TQ1A 3WAMA 4IFSA 1E8YA 2AWTA 2ABDA 3M95A 3PVLA 3FM8C 3EPYA 2LBBA 3PVWA 4LJOB 5CLLB 1LB1A 4FA6A 4JKFA 4GSWA 3L17A 3PZDA 3EHVA 1XR0B 5G55A 2KDFB 2KN5A 2RSGA 2JPHA 2K1FA 2BKRB 4MGIE 5JVLA 4G11A 3E66A 1D3ZA 2M4NA 4ANXA 2JVCA 2JP2A 2M38A 1UNPA 2BF8B 1Q5WB 2YF0A 4KHAA 1WE6A 2WX0A 1GUAB 2COCA 5GOWB 4EMOA 4GMXB 4BKGA 2DAFA 2KQ7A 2P0FA 2DLWA 1ACAA 3N30A 3VTWA 1S3SG 5E6NA 3DCGA 2KTFA 1WZ0A 3C0RB 1I42A 4H8SA 2WYQA 5G2NA 2K8HA 3ENEA 3HQCA 1VBHA 2PPHA 4DDGD 4J6IA 4NQLB 5DPSA 3LJUX 2KC2A 1TZ1A 2N9XA 4K7WA 3RT3B 3KUDB 2PJHA 1V5UA 2N0YA 4KHBB 3ODXA 3KUCB 2MKRA 4N9F4 1HE8A 3UZTA 5C23A 3B0AA 3PRZA 3A9JB 4GGQA 3PHWB 2N23A 2V76A 4K2OA 4GZUA 5DHAB 4TYZA 5D3WA 2K00A 2GBKA 2VRWB 4HAYB 1EVHA 4WJ7A 1X1MA 2REXA 1GGOA 1NTIA 3FSSA 2K6DB 4IWQA 2FCMA 3P2BA 2AEHA 4DX90 2L76A 4E74A 1V2YA 2HTHB 1U2BA 4W9EA 3UF8A 2NPTB 1NBFC 2KWCA 3PPAA 2FCQA 4EZLA 3ULBA 1RRPB 5DCNA 5CHVC 2JXXA 3TVVA 4HB0B 2GCLA 2Y7BA 1UNRA 2OTXA 5D7GA 2KWVB 3ALBA 4GDLA 3WA0A 4TV3A 4DHZB 1WX7A 5C6RA 4KHOA 4F1SA 4M8NA 2Y8FA 2ZVOA 1U5DA 2YRYA 2KOXA 1AWEA 1QQGA 3N32A 4W9GA 4JK8A 4DBGA 4DWFA 3QC8B 2JZZA 1WGYA 4XX5A 1XQQA 4IG7B 3ZW3A 3NHEB 3CXBB 3KRWA 4JL9A 1VD2A 4Z2MB 2DYOA 2C9WB 2R2QA 5JHHA 1E8ZA 3DVNV 3VH3B 2NBWB 2EJ8A 3A4SC 1WE7A 5KCVA 4PS3A 3L16A 1IP9A 2D9YA 3PSEB 4EZJA 1WMHA 2X18A 2RNRB 3PRPB 3QARA 2P0DA 1WXMA 3Q3FA 5D3XA 2DN6A 2MX2A 1C1YB 2C7NB 1WGUA 2IBIB 2IZVB 2G4DB 2PE9A 1KC7A 1OEYJ 1U5GA 3T06A 3ZVVA 1P3QU 2Y5BB 2D9VA 1NTYA 1DBHA 2KWUB 4MK0A 3DVNU 4PYUA 2C60A 3E9OA 1E90A 3A9KA 2FCNA 2P8VA 5DPTA 2DZKA 2JF5A 3KYCD 4NY0A 3WAOA 2JY6A 5LXIB 3RZWC 3IVFA 1DDMA 2RPQA 2ASQA 3DDCB 3QAQA 3ZRFA 2MQJA 3UIPB 3HK0A 2IY0B 3RCZA 1GNUA 2K39A 2KANA 3FLVA 3H7PB 1V86A 2PZ1A 1KLVA 3APDA 3CSTA 4F7GA 2BYFA 3MPXA 5LXHA 2FCSA 3WIMA 4WSFA 1UZXB 2FDQA 3CSFA 3H9DA 3M3JA 2L3ZA 4AJWA 3SNHA 1XCGA 3SBGA 4W9IA 2GCJA 4IOYX 2YVCA 3SBTA 4X57B 2ZNVB 1X05A 3RUIB 3ZNHB 2NMBA 2K6QA 1NDDA 4MDKE 4HAUB 2ADZA 2M17A 1H8CA 2L8JA 5CTRC 1FGYA 3ZLZA 2JZ3B 3DVGX 4ASWC 4NAWA 1FGZA 2J59M 4MM3A 4HATB 1V5PA 1FXTB 2DTCA 2COPA 4DHJB 3PSCA 3VUWA 2DZMA 2RGNB 4IUMB 2ZPNA 1WGRA 4BVUC 4OVVA 3MDBC 1U5FA 1V88A 1WJ4A 4ZRKA 1GJZA 4BKTA 4FJZA 1A5RA 3VDZA 1J19A 4ANUA 3FEHA 3KZ1A 3D8FA 1XX0A 4JK7A 2IO1B 2BPSA 1OEYA 2N1WA 1YJ1A 5DHFB 4OVUA 5CHFA 2GBRA 1OQYA 3NOBA 3A8PA 2R82A 4KZ0A 3L08A 2UWQA 3HIZA 3RD2A 2ROVA 2K2JA 2IFSA 3PT2B 4NPNA 1WH3A 4IWOA 1R4MI 3VOQA 4A6HA 1VCBA 2KLCA 3RULA 3QJZA 2NBUA 2QKLA 1L2NA 2KDIA 1KBLA 1ZW7A 1WX8A 1OTRB 2EKEC 4F8CB 5E6OA 3QWMA 4WWNA 4A6FA 2CRFA 4AOFA 2MBBB 4Z2NA 5JP4A 3OANA 1XD4A 3QBVB 2RGFA 2JUOA 3ML8A 2JRIB 2M8SA 2YT1A 1QC6A 4B6HA 2NVUI 4PS8A 1I7AA 1KZ7A 1Z5SB 3K9PB 2MWSB 4KDLB 3TCAA 1S1QB 1E7VA 3PG7A 3DBHI 3H1UA 2L05A 1AQCA 5JHBA 2VRRB 2KX0A 4JKAA 4ICUA 2PEAA 4ZDVA 4EOYA 3IHPC 2JWZA 4HK2A 2E2XA 2KQSA 2MFQA 3L0WB 3ECIA 4AJYB 4GDKB 1GC6A 4NJ6A 3GOEA 1Q67A 2W2XC 3DXEA 4W9DA 4I6PA 2ZJDA 4HCPB 5FI0A 3NZSA 5J18A 4BKSD 2Z0QA 4HVBA 5DPWA 2DENB 3EC8A 1X1FA 1Y8RC 3L54A 1VBGA 2VKIA 4GDLB 3DXDA 1K8RB 4MT7A 3TL5A 1DDVA 1EF1A 4HCNB 5L83A 2D3GA 3T8MA 2YS1A 3L13A 2CR5A 1WIAA 2B3AA 3SUZA 5KHOA 1FAOA 3T9LA 1LM8B 2XK5B 4ICVA 1V49A 2L0FA 5J17A 1XD3B 4MSMB 2HTHA 4RM8A 3O65B 1PFJA 1LQBA 1BWNA 2ZCBA 2JRHA 2I5CA 1JDEA 3SV1A 1OQNA 2W2XD 2C5LC 1U27A 2LI5A 2M0XA 2DHZA 3OJ3A 2C7MB 1IPGA 5D6JB 1DIKA 1AARA 1WGQA 2KUPA 1WYWB 3SHQA 4HAVB 3AXCA 5AZFA 3TO1A 3UIOB 1MAIA 3B08A 3IFWB 3F0WA 2EMSA 4GIVA 4F7HA 2CHWA 4EFOA 3PEGA 4C0AA 3VFKA 1Q1OA 1IRSA 1DROA 4CYEA 1UELA 2A5UA 3ODWA 2KVRA 5GMVA 5TR5A 2NBVB 1B55A 4LDTB 1P9DU 2BWFA 3WYFB 1E8WA 3X23A 2LYDA 2EMTA 2Z0PA 2IYBA 1W1DA 1WJUA 4FBJB 3DXCA 4JKCA 1U29A 2LRWA 3VUYA 4K7UA 1MIXA 1TTNA 2CAYA 3MTNB 1UEFA 1K5GB 2DAJA 1RAXA 3BY4B 1BT0A 1SE9A 2N9PC 2LXCA 1W1HA 2CY5A 2D07B 2MA9B 4HAZB 1IYFA 4B9KA 2MBOA 3OJ4B 4PQ0A 3JYUA 2I1JA 2R2OA 4KDIC 1ST7A 2LUEA 4MSQB 3W1SA 2DA0A 1G6JA 3JSVB 3ZKJC 1BTKA 2BYEA 3GYOA 1X1GA 4FJVB 4ANWA 2DZJA 2NPTA 2FJLA 5DH9B 1P98A 4NQKE 4P7IA 3SD5A 2W2WA 1RRBA 2OQBA 5D27A 2ZPYA 4A3PA 2DYBA 4L6EA 3JSVA 3UQAA 1WXAA 2J0MA 1ZSQA 2R09A 3TBLD 3VXWA 3WALA 4KV2A 1M94A 3A9JA 1OY2A 4CHKA 2L7RA 1NTVA 4W9HA 1P5TA 2FUHB 1V5TA 4ILJA 5E6PA 3MHSD 3TIXA 3W1SC 3AJ4A 1WF9A 4HDQA 3QHTA 4PYZA 3ZDTA 2MBEA 2Z0DB 2RD0A 4JKEA 1V6EA 1WJ1A 5IA7A 1GC7A 4G0NB 4KIKA 1TXDA 2KDEB 5BO4B 4PS7A 4WWOA 1UGMA 4KSKC 4URKA 3NS8A 3LJ3A 2MSED 2L2IA 2DKQA 4TUUA 3D32A 3CMMB 2LASA 3SU8X 1F9JA 1BTNA 3EECA 2N4FA 3ONSA 4BBNF 1V80A 5HE1A 3IBEA 2FNJB 1X11A 3KSYA 1L7YA 3ODOA 1WXVA 4AUQC 3TJPA 4K1RB 4Y94A 3KY9A 2L1CA 3M1IB 2R0DA 4EJNA 4A6FB 4TQ0A 5LLIA 1P3RA 4EUTA 4FN2A 5J3QA 2D9ZA 2COFA 2O2VA 5JLJB 2YS3A 1ZGUB 3VQIA 4WWPA 4YONA 1KM7A 1MPHA 2A4ZA 3UQBA 1Q0WB 3NZUA 2RSUA 2KMCA 1V89A 1WM2A 1MK9B 2CB8A 5KQ4A 1I35A 4EEWA 3ZTCA 1UPQA 2DX5B 3M63B 4JKDA 2KFKA 2D9XA 1WGHA 1J8CA 1SGHA 3CIKA 1WRDB 2N7DA 3MJWA 2DX1A 4FLHA 4MGYE 2D10A 1YQBA 1WZ3A 4GN1A 3BJIA 4CHJA 2J0JA 2DHKA 3RCPA 4DK5A 4W9LA 2LWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYQ A;  4W9D A;  1WJM A;  4DX9 0;  2L76 A;  4E74 A;  1V2Y A;  4I6P A;  2UZR A;  2KJH B;  1Z87 A;  5L81 A;  2HTH B;  4WQO B;  5LON B;  2ZJD A;  4BBN C;  1KOT A;  1HB8 A;  1U2B A;  4W9E A;  4ZRI A;  2KFJ A;  1MKE A;  2IO2 B;  3HW2 B;  4HCP B;  3UF8 A;  2NPT B;  3OLM D;  3V62 A;  2LG1 A;  1Y5O A;  5FI0 A;  1NBF C;  2KWC A;  3APF A;  2AYO B;  1TBE A;  4EKU A;  1V81 A;  2FCQ A;  3I3T B;  3NZS A;  4GPT B;  3PPA A;  4EZL A;  2DKP A;  2RUK B;  4WJO A;  2Z0Q A;  3ULB A;  1RRP B;  5D3Y A;  3ZIM A;  4BKS D;  4HVB A;  4I6N B;  4K7S A;  5DCN A;  5DPW A;  2KHW B;  2DEN B;  5CHV C;  4D0N B;  4IAP A;  2XK5 A;  2JXX A;  3EC8 A;  3TVV A;  4HB0 B;  1X1F A;  1Y8R C;  3L54 A;  4GDK A;  3R3M A;  4NJ7 A;  3A33 B;  2GCL A;  2Y7B A;  2VKI A;  1UNR A;  2OTX A;  1MG8 A;  3KH0 A;  5D7G A;  4GDL B;  1X86 A;  1T0Y A;  5CHW A;  2KLG A;  2KWV B;  5J18 A;  3DXD A;  1K8R B;  3PRM B;  4W9F A;  4MT7 A;  2DYM A;  3ALB A;  3P7Z A;  2LZ6 A;  3TL5 A;  2CHZ A;  4GDL A;  3WA0 A;  1DDV A;  2G45 B;  4G3X B;  4TV3 A;  1J8C A;  1PQS A;  4E3C A;  4IW0 A;  3DPD A;  3V6C B;  4RM9 A;  1EF1 A;  4HCN B;  5L83 A;  2D3G A;  3T8M A;  4DHZ B;  2YS1 A;  1YX5 B;  3L13 A;  4HXD A;  1WX7 A;  1XOD A;  5C6R A;  4KHO A;  1RLF A;  2KKC A;  3ZNI D;  2MWN B;  4F1S A;  4M8N A;  2D9W A;  1P1A A;  2CR5 A;  1WIA A;  2Y8F A;  2B3A A;  2ZVO A;  1U5D A;  2IO3 B;  4DHJ D;  1EGX A;  3SDL C;  3SUZ A;  2MBH A;  2YRY A;  4AWJ A;  5KHO A;  2P0H A;  2KOX A;  1FAO A;  1AWE A;  2KTR B;  3IG3 A;  3PV1 A;  3T9L A;  3QX1 A;  1LM8 B;  4BOZ B;  2XK5 B;  3PVU A;  5EFX A;  3AU5 A;  1QQG A;  4ICV A;  4MEL A;  2ZCC A;  3N32 A;  3GZN I;  2W9N A;  4W9G A;  1V49 A;  2L0F A;  5J17 A;  4DBG A;  1XD3 B;  2QKM A;  4MSM B;  4DWF A;  2HTH A;  4RM8 A;  3QK0 A;  2KXJ A;  3QC8 B;  3O65 B;  2JZZ A;  1C3T A;  4JGH B;  1PFJ A;  1U4A A;  1NU2 A;  1WGY A;  2M14 A;  4HPM B;  1LQB A;  1BWN A;  2RQ1 A;  2VSZ A;  5LOP B;  1RFA A;  1XQQ A;  2ZCB A;  4IG7 B;  4XX5 A;  2UVM A;  4BFR A;  2Z0E B;  4HLE A;  2JRH A;  2I5C A;  4IWP A;  4A5K A;  3ZW3 A;  3NHE B;  1TQZ A;  3CXB B;  3KRW A;  3JW0 X;  4BOS C;  4JL9 A;  5JH5 C;  4G50 A;  1VD2 A;  4Z2M B;  2DYO A;  2C9W B;  3R66 C;  1WY8 A;  2R2Q A;  2J0K A;  5JHH A;  4XWX A;  2KO3 A;  3PHX B;  1E8Z A;  2AL6 A;  3SV1 A;  1OQN A;  2MP2 A;  3DVN V;  2W2X D;  3VH3 B;  2C5L C;  2NBW B;  1U27 A;  5D3V A;  2LI5 A;  4II2 B;  4FHK A;  3WAN A;  2NS5 A;  2EJ8 A;  2M0X A;  4IM2 A;  2LVQ A;  2DHZ A;  1ISN A;  3A4S C;  4M0W B;  3WAP A;  1FB8 A;  2ZZP B;  3A8Q A;  1WE7 A;  2LGD A;  3OJ3 A;  2C7M B;  1IPG A;  5D6J B;  5KCV A;  1BAK A;  1QZE A;  1AAR A;  1WYW B;  1WGQ A;  2KUP A;  3ZDM C;  1U5E A;  1YX6 B;  2KD0 A;  1XKE A;  4HAV B;  2K25 A;  4K17 A;  1UNQ A;  2V3S A;  3AXC A;  4PS3 A;  3SHQ A;  5AZF A;  3TO1 A;  2K8B A;  3L16 A;  1IP9 A;  2D9Y A;  3M62 B;  1MAI A;  3B08 A;  2O6V D;  4CHM A;  1WI1 A;  2ZVN A;  3PSE B;  3UIO B;  4WVF B;  3KUZ A;  3IFW B;  3F0W A;  2BWE S;  2KDB A;  4EZJ A;  2LWP A;  3UGB B;  3ZNG C;  3A1Q B;  2CKH B;  4FAD A;  1KJT A;  2H7D A;  2EMS A;  1SIF A;  4NAW B;  1WMH A;  2X18 A;  1E7U A;  2RNR B;  3APC A;  4GIV A;  2G35 A;  3PRP B;  2DX5 A;  4F7H A;  1PLS A;  3U30 A;  3VVW B;  3QAR A;  4FHJ A;  2LXA A;  2P0D A;  1WXM A;  2CHW A;  3Q3F A;  1OGW A;  3V6E B;  4EFO A;  3S2A A;  2FJ9 A;  3PEG A;  5D3X A;  4C0A A;  2DN6 A;  2O2V B;  3VIA A;  3VFK A;  2MX2 A;  1Q1O A;  1WM3 A;  1C1Y B;  3B1L X;  3AUL A;  5HE3 A;  4YL8 A;  1IRS A;  2C7N B;  1DRO A;  2CS4 A;  4CYE A;  1WGU A;  2IBI B;  2IZV B;  2N9E B;  3R7R A;  1UEL A;  4MGZ E;  2A5U A;  3ODW A;  2G4D B;  1V61 A;  2PE6 B;  4FJY A;  1J0G A;  1LXD A;  2J7Q B;  2PE9 A;  4XZ4 A;  1EO6 A;  2KVR A;  4XC2 A;  2CQU A;  5FI1 A;  2GMI C;  1OEY J;  5GMV A;  5TR5 A;  4F7Z A;  2MRP A;  1U5G A;  3T06 A;  4JQW C;  5KHQ A;  5DIF B;  2NBV B;  4W9J A;  1B55 A;  3DVG Y;  1WR6 E;  4LDT B;  3AU4 A;  4HB4 B;  4W9C A;  1P6S A;  5JHA A;  3RZW C;  3EFU A;  1P3Q U;  3TMP B;  3ZVV A;  2Y5B B;  2D9V A;  2Y8G A;  4EZK A;  1NTY A;  1DBH A;  1P9D U;  2BYV E;  1UPR A;  2BWF A;  3WYF B;  1E8W A;  2KWU B;  3X23 A;  4MK0 A;  2LD9 A;  3DVN U;  3TW1 A;  2LUL A;  1V5M A;  4PYU A;  5IAA C;  2C60 A;  2BGF A;  1WG7 A;  3ZUN A;  1E90 A;  5C1Z A;  2LYD A;  2MP2 B;  1FOE A;  2EMT A;  3ZTD A;  1NI2 A;  3A9K B;  1ZC3 B;  2GJY A;  3A9K A;  2FCN A;  3HHM A;  2P8V A;  5DPT A;  2Z0P A;  4ANV A;  2IYB A;  1W1D A;  3ULC A;  1UD7 A;  1ZVR A;  2DZK A;  2ZEQ A;  1WJU A;  2JF5 A;  2UYZ B;  2V4L A;  3KYC D;  2L0T A;  3RYT A;  4HHV A;  4FBJ B;  3DXC A;  2HRJ A;  4NY0 A;  3P6A A;  3JVZ X;  2ELA A;  3QQ8 B;  2MCN B;  1U29 A;  2LRW A;  3VUY A;  3WAO A;  4K7U A;  4DDI D;  1WVH A;  3D8E A;  2JY6 A;  3DBL I;  5DPR A;  5AZG A;  5LXI B;  1MIX A;  3IVF A;  1TTN A;  1WI0 A;  3SO6 A;  1DDM A;  2RPQ A;  3Q3J A;  4HB2 B;  2CAY A;  2O6V A;  4JLC A;  2DHJ A;  3A98 B;  4KVG B;  1EAZ A;  2ASQ A;  3DDC B;  3MTN B;  3QAQ A;  4IM3 A;  1UEF A;  2UZS A;  2CU1 A;  3ZRF A;  2MQJ A;  1K5G B;  2DAJ A;  4WJN A;  1RAX A;  3BY4 B;  3UIP B;  1BT0 A;  3HK0 A;  3L10 B;  3O96 A;  2KGX B;  1SE9 A;  2N9P C;  4HAX B;  5DI9 B;  4KZC A;  2GS0 A;  2YT0 A;  1WJN A;  2IY0 B;  3VHT C;  2LXC A;  1W1H A;  1E8X A;  3N3K B;  2ELB A;  2CY5 A;  3A1Q A;  4AP4 C;  3RCZ A;  3ZRC A;  1GNU A;  2D07 B;  2YSZ A;  4HAZ B;  2K39 A;  2MA9 B;  3VH4 B;  1WR1 A;  2KAN A;  1IYF A;  2Z59 B;  4B6W A;  3FLV A;  1JRU A;  3H7P B;  2FID A;  2RLO A;  5HKH A;  1V86 A;  4B9K A;  2PZ1 A;  3QWZ B;  1KLV A;  2N1V A;  3APD A;  1DYN A;  3HM6 X;  3CST A;  4F7G A;  1XT9 B;  2BYF A;  2GBN A;  1W1G A;  2D2Q A;  1FHX A;  5AEK B;  2LOX A;  1SHC A;  3MPX A;  2MBO A;  2YLM A;  3OJ4 B;  3QCA A;  3PRE A;  2IY1 B;  4PQ0 A;  4IC7 B;  5D94 A;  5LXH A;  2FCS A;  2JT4 B;  3JYU A;  2I1J A;  2R2O A;  4KDI C;  3VAW A;  2OJR A;  3WIM A;  2MLB A;  1ST7 A;  4PNK A;  3A4R A;  1ZC4 B;  2LUE A;  4WSF A;  1UZX B;  3HM3 A;  2NR2 A;  4NSW A;  3PLV A;  2FDQ A;  2KNB A;  5CLQ B;  4MSQ B;  3W1S A;  3CSF A;  5J3T A;  3H9D A;  3M3J A;  1EF5 A;  2L3Z A;  2DA0 A;  1G6J A;  5KQ1 A;  2K2U A;  5JHG A;  3JSV B;  1TGZ B;  4AJW A;  2KZR A;  4II3 B;  3SNH A;  2GOW A;  3ZKJ C;  4DHZ E;  1BTK A;  1WJ6 A;  4GB9 A;  1XCG A;  3SYX A;  2BYE A;  4W9I A;  3GYO A;  2Z0O A;  1P0R A;  4KIK B;  1V5O A;  5L95 C;  2HE7 A;  1X1G A;  2GCJ A;  2N7E A;  2XBB C;  4IOY X;  4FJV B;  2GBJ A;  3CF6 E;  4ANW A;  2DZJ A;  2BCJ A;  3NY5 A;  1J0W A;  4MH0 E;  4NNJ B;  4E71 A;  3NSU A;  2NPT A;  3PLU A;  2YVC A;  2FJL A;  2GBM A;  1M7E A;  5DH9 B;  1UBQ A;  3RZF A;  2NZ8 B;  4X57 B;  1P98 A;  3ML4 A;  2ZNV B;  5C5B B;  1LW3 A;  3ZVR A;  4NQK E;  4LCD E;  3U7D A;  2LOZ A;  4K81 A;  1X05 A;  2D11 A;  1R4N I;  3RUI B;  4K2P A;  2KC1 A;  3ZNH B;  4P7I A;  2NMB A;  1NDD A;  2K6Q A;  4MDK E;  2Q13 A;  2KTR A;  3SD5 A;  2W2W A;  3ML9 A;  4CO7 A;  4MEM A;  2C7H A;  4HAU B;  4HJK A;  3GYP A;  1RRB A;  2OQB A;  5D27 A;  2ZPY A;  2ADZ A;  5J3Y A;  2M17 A;  4W9K A;  1YIW A;  2DYB A;  3W1Y A;  1H8C A;  1CMX B;  2L8J A;  4LJP B;  4WJP A;  5CTR C;  5C79 A;  1FGY A;  4L6E A;  3ZLZ A;  5C16 A;  4DXA B;  2I5F A;  2JZ3 B;  4HAW B;  3DVG X;  3JSV A;  4A3O A;  1WMH B;  2M1M A;  4NAW A;  1YD8 U;  4ASW C;  1FGZ A;  1K5D B;  5HE0 A;  5JZE B;  3UQA A;  4IM0 A;  3VUX A;  2J59 M;  1UH6 A;  1WXA A;  2J0M A;  4MM3 A;  1FHO A;  4HAT B;  1ZSQ A;  2R09 A;  2YS5 A;  2CHX A;  1V5P A;  1M7R A;  4HWI B;  4GXB A;  3TBL D;  1KZG A;  1TJ6 A;  2COP A;  2DTC A;  1FXT B;  3ZNZ B;  3VXW A;  3FP5 A;  4GOC A;  2LKO A;  3PSC A;  4KV2 A;  3WAL A;  2LJ5 A;  1M94 A;  3N7C A;  2IO0 B;  1DDW A;  2KK8 A;  2DZM A;  3A9J A;  3VUW A;  2RGN B;  4IUM B;  1OY2 A;  2ZPN A;  1NVL A;  1WGR A;  4CHK A;  4BVU C;  2KFK B;  2LVP A;  2L7R A;  3DBS A;  1NTV A;  4W9H A;  4BBK A;  4MJS A;  3KVF B;  1P5T A;  1GG3 A;  1Y19 B;  2MDX A;  3MDB C;  4OVV A;  2FUH B;  3H7P A;  1U5F A;  1V88 A;  1V5T A;  2KMA A;  4GU2 A;  2RVB B;  3V61 A;  1WGG A;  4A20 A;  3QIJ A;  3KYD D;  1WJ4 A;  1H4R A;  4DX8 A;  3UIN B;  3PS6 A;  5E6P A;  3MHS D;  3PGE A;  3TIX A;  2DFK A;  2XEW A;  1WX9 A;  4ZRK A;  2FAZ A;  1GJZ A;  4MGK E;  2AL3 A;  3W1S C;  4BKT A;  2OOB B;  5CX3 A;  4FJZ A;  1A5R A;  3AJ4 A;  1WF9 A;  3VDZ A;  1J19 A;  4ANU A;  3OAW A;  3R7Q A;  2WH5 A;  3FEH A;  4TQ1 A;  2LGX A;  3WAM A;  3KZ1 A;  4JIO U;  4IFS A;  1E8Y A;  2AWT A;  3D8F A;  4HDQ A;  1MIZ B;  2ABD A;  1XX0 A;  2WWZ A;  2ZNV C;  3M95 A;  3QHT A;  4PYZ A;  3ZDT A;  2MBE A;  2Z0D B;  2RD0 A;  3PVL A;  4RMA A;  5D2M B;  3FM8 C;  2IO1 B;  2BPS A;  1OEY A;  4KSL C;  2N1W A;  1YJ1 A;  3EPY A;  2D4Q A;  1V6E A;  2LBB A;  2NCN A;  3K9O B;  2LRU A;  4A3P A;  1WJ1 A;  3PVW A;  4LJO B;  5CLL B;  5DHF B;  1LB1 A;  4OVU A;  5CHF A;  2COD A;  2GBR A;  1GC7 A;  1OQY A;  5IA7 A;  3NOB A;  4FA6 A;  4GSW A;  4G0N B;  3L17 A;  4KIK A;  3F5R A;  3PZD A;  5IJM A;  1E5W A;  3A8P A;  2KJ6 A;  3EHV A;  3H6N A;  1PMS A;  1XR0 B;  1TXD A;  5G55 A;  2KDE B;  5BO4 B;  2KDF B;  3PP2 A;  2KN5 A;  3KW5 B;  2RSG A;  4PS7 A;  4WWO A;  5FR6 A;  1UGM A;  2JPH A;  2K1F A;  2BKR B;  4FUL A;  4KZ0 A;  4MGI E;  1N3H A;  1FHW A;  4G11 A;  3L08 A;  4F7U P;  2LGY A;  4KSK C;  4ZYN A;  2RR9 A;  4EOY A;  4BKS A;  1D3Z A;  2M4N A;  4WJQ A;  1H10 A;  2UWQ A;  4ANX A;  3HIZ A;  2JVC A;  1WGD A;  3AI5 A;  4HPL B;  3RD2 A;  2ROV A;  2JP2 A;  2M38 A;  2WDT B;  2K2J A;  4URK A;  2IFS A;  1UNP A;  2BF8 B;  3NS8 A;  3VTU A;  2MW5 A;  1Z2M A;  3PT2 B;  3DOW A;  3LJ3 A;  4HDO A;  3U8Z A;  2LVO A;  1Q5W B;  4NPN A;  2MSE D;  2L2I A;  1WH3 A;  2YF0 A;  4KHA A;  4LDT D;  4IWO A;  3LDZ E;  1R4M I;  1WE6 A;  2DKQ A;  3VOQ A;  4TUU A;  3G9W A;  4A6H A;  2WX0 A;  2DZI A;  3V5W A;  1GUA B;  3CMM B;  2LAS A;  3D32 A;  2COC A;  2O6V B;  3DBR I;  2FIF A;  2DHI A;  1ZM0 A;  5GOW B;  4EMO A;  1VCB A;  2KLC A;  4GMX B;  3QJZ A;  4MY6 A;  3RUL A;  2NBU A;  3SU8 X;  2QKL A;  1F9J A;  1L2N A;  2DYN A;  3ZO5 B;  5C5B A;  4BKG A;  2DAF A;  4B95 A;  1BTN A;  2KDI A;  2KQ7 A;  2WX1 A;  1ZW7 A;  2N4F A;  3BIN A;  3EEC A;  2P0F A;  3V60 A;  2COA A;  1WX8 A;  2DLW A;  1OTR B;  2EKE C;  3ONS A;  4BBN F;  1V80 A;  1ACA A;  5HE1 A;  3IBE A;  5E6O A;  4F8C B;  2EC1 A;  3N30 A;  2FNJ B;  1V9J A;  3QWM A;  5HE2 A;  2HD5 B;  4WWN A;  1X11 A;  3VTW A;  4A6F A;  1S3S G;  2CRF A;  3KSY A;  3DCG A;  5E6N A;  1L7Y A;  4AOF A;  2V1Y A;  2KTF A;  1WZ0 A;  1WXS A;  3C0R B;  4DHJ B;  3ODO A;  2IYD B;  2HJ8 A;  4Z2N A;  5JP4 A;  3OAN A;  1WXV A;  2MBB B;  3X0W A;  4AUQ C;  1XD4 A;  3TJP A;  1I42 A;  1RJ2 A;  3QBV B;  2RGF A;  2JUO A;  3ML8 A;  4H8S A;  2WYQ A;  2JRI B;  5G2N A;  4K1R B;  2K8H A;  3DQV A;  4Y94 A;  3KY9 A;  3ENE A;  2L1C A;  3HQC A;  3M1I B;  2M8S A;  2R0D A;  2YT1 A;  4EJN A;  4A6F B;  1QC6 A;  2PPH A;  4GMV A;  4TQ0 A;  4B6H A;  2L00 B;  5LLI A;  4DDG D;  2NVU I;  1P3R A;  4J6I A;  4NQL B;  2XQN M;  5DPS A;  3LJU X;  4PS8 A;  3TFM A;  1I7A A;  4EUT A;  1I2H A;  1KZ7 A;  4FN2 A;  5J3Q A;  2D9Z A;  2I1K A;  4ZRJ A;  2COF A;  2KCJ A;  2KC2 A;  5JLJ B;  1Z5S B;  2YS3 A;  2O2V A;  1ZGU B;  3K9P B;  5J2R A;  3VQI A;  1TZ1 A;  2N9X A;  5EDS A;  2G4S A;  2MWS B;  4K7W A;  4YON A;  4WWP A;  1KM7 A;  4KDL B;  5AZH A;  3RT3 B;  3H7S A;  1MPH A;  3TCA A;  2A4Z A;  1S1Q B;  3UQB A;  3KUD B;  1E7V A;  2PJH A;  1Q0W B;  3NZU A;  2RSU A;  3QA8 A;  2KMC A;  1V5U A;  1V89 A;  2N0Y A;  1WM2 A;  2KJR A;  1MK9 B;  3PG7 A;  2CB8 A;  3DBH I;  5KQ4 A;  4KHB B;  3ODX A;  2L05 A;  3H1U A;  1AQC A;  1I35 A;  3KUC B;  1LFD A;  4EEW A;  2MKR A;  3ZTC A;  1UPQ A;  4N9F 4;  5JHB A;  2DX5 B;  2KX3 A;  3PTF C;  1EUV B;  3M63 B;  1HE8 A;  4MJS B;  2VRR B;  1KI1 B;  3UZT A;  2KX0 A;  2QHO A;  2KFK A;  5C23 A;  2D9X A;  1WGH A;  3B0A A;  1ZKH A;  4I6L B;  4ICU A;  2K8C A;  1SGH A;  4KAX B;  4TKN A;  2PEA A;  3A9J B;  3PRZ A;  4GGQ A;  3VTV A;  4ZDV A;  3KRX A;  3PHW B;  2N23 A;  3CIK A;  2V76 A;  4DBB A;  4K2O A;  3D8D A;  4GZU A;  5DHA B;  1WRD B;  2JWZ A;  4TYZ A;  2MBQ A;  5D3W A;  2N7D A;  1WFY A;  3MJW A;  2DX1 A;  2K00 A;  2E2X A;  4HK2 A;  4FLH A;  4MGY E;  1OMW A;  2GBK A;  2G3Q B;  2CY4 A;  2KQS A;  2D10 A;  1YQB A;  4WAA A;  2MFQ A;  2VRW B;  3L0W B;  4HAY B;  3ECI A;  2BKF A;  4AJY B;  1EVH A;  4GDK B;  1GC6 A;  3IHP C;  4WJ7 A;  4NJ6 A;  1WZ3 A;  1X1M A;  2REX A;  1HB6 A;  2H7E A;  4GN1 A;  3GOE A;  4HB3 B;  4M8M A;  2ROZ B;  1Q67 A;  3BJI A;  1NTI A;  4CHJ A;  1UBI A;  2W2X C;  2J0J A;  3FSS A;  4A6K A;  3DXE A;  2DHK A;  2K6D B;  3RCP A;  4IWQ A;  4DK5 A;  1HBK A;  2FCM A;  3P2B A;  4W9L A;  1MK7 B;  2AEH A; 
#chains in the Genus database with same CATH topology
 3RNC C;  2UZR A;  2GRI A;  1Z87 A;  1KOT A;  5LON B;  1HB8 A;  5BMG A;  4ZRI A;  2KFJ A;  2IO2 B;  3OLM D;  1R4N B;  2LG1 A;  1Y5O A;  1YN4 A;  4K3B A;  2AYO B;  4EKU A;  5D3Y A;  4I6N B;  2KHW B;  4D0N B;  4IAP A;  2AQ3 B;  1XXG A;  4GDK A;  3VRA B;  2N9L A;  1MG8 A;  3HVD A;  1X86 A;  4W9F A;  2DYM A;  2JSV X;  4ILG B;  3P7Z A;  1B1Z A;  3I9V 1;  2CHZ A;  1FRR A;  4IW0 A;  4RM9 A;  2WNM A;  1YX5 B;  4HXD A;  1OFF A;  1XOD A;  1RLF A;  2X38 A;  2MWN B;  1BXT A;  1AYF A;  1P1A A;  2IO3 B;  1EGX A;  3AE9 B;  3SDL C;  1C4A A;  2MBH A;  3EFC A;  1ZOY B;  5BYQ A;  3PV1 A;  4BOZ B;  3PVU A;  4MEL A;  2W9N A;  2QKM A;  3QK0 A;  2KXJ A;  1C3T A;  4JGH B;  1NU2 A;  2PKO A;  2VSZ A;  1QOA A;  1PYW D;  1ENF A;  5GXG B;  2UVM A;  2LHE A;  4HLE A;  1F2R C;  4A5K A;  4ILH A;  4BOS C;  1HQR D;  3R66 C;  1E9M A;  2J0K A;  2CJN A;  1SBB B;  3PHX B;  4FHK A;  3DHG C;  4IM2 A;  1KRH A;  3SFE B;  4M0W B;  1ISN A;  1GOZ A;  5FR3 A;  4ZYS A;  3FVC A;  3PO0 A;  2KAC A;  1YX6 B;  1LO5 D;  1XKE A;  4LLG M;  2BS2 B;  1UNQ A;  4B0M A;  2K8B A;  4JE3 B;  2ZVN A;  4CHM A;  3UGB B;  3ZNG C;  2CKH B;  1WWT A;  1SIF A;  2H7D A;  1MI0 A;  3APC A;  4M01 A;  2G35 A;  2DX5 A;  5BMI A;  3U30 A;  3VVW B;  4FHJ A;  3S2A A;  2FJ9 A;  1I4R A;  3VIA A;  1I4X A;  1WM3 A;  3AUL A;  4LNO A;  5HE3 A;  2CS4 A;  2N9E B;  1V61 A;  1FNW A;  2PE6 B;  4XDC A;  1JWB D;  3KWV A;  4XZ4 A;  2GMI C;  3O13 A;  2MRP A;  4JQW C;  5KHQ A;  2K8E A;  4M00 A;  1ZP0 B;  4DXF A;  4HB4 B;  5JHA A;  3P4R B;  3EFU A;  4HPP A;  1KF6 B;  2BYV E;  1QKZ A;  2PIA A;  1FFV A;  2LD9 A;  4A8X C;  2LUL A;  1V5M A;  1TYG B;  4JWS C;  5IAA C;  2BGF A;  3FAH A;  3NVV A;  1UWM A;  2MP2 B;  1FOE A;  3A9K B;  1WGK A;  1ZC3 B;  2GJY A;  3SR6 A;  2GB1 A;  4LNK A;  3HHM A;  3VR8 B;  1UD7 A;  1ZVR A;  4MH8 A;  4QJ3 B;  2V4L A;  4OVZ A;  4HHV A;  1I4G A;  1L0V B;  3JVZ X;  3QQ8 B;  2ELA A;  4L2Y A;  4DDI D;  3GB1 A;  3FIL B;  5DPR A;  5AZG A;  1E0Z A;  1WI0 A;  4JLC A;  3IAM 1;  4HB2 B;  2O6V A;  2DHJ A;  4KVG B;  1EAZ A;  2N9K A;  3Q69 A;  4KHB A;  3O96 A;  2KGX B;  1SE4 A;  4ZHO A;  4KZC A;  2YT0 A;  1DOI A;  1E8X A;  3N3K B;  3ZRC A;  2YSZ A;  1WR1 A;  4JKB A;  3NVY A;  2Z59 B;  1JRU A;  5HKH A;  2RLO A;  2N1V A;  3HM6 X;  1D5Z C;  1XT9 B;  2GBN A;  5AEK B;  1EWY C;  2WXO A;  2LOX A;  3PRE A;  2IY1 B;  1TY0 A;  5D94 A;  1FNU A;  1TKE A;  1XEE A;  3VAW A;  2OJR A;  3IT6 B;  4H2A A;  1R7S A;  3HM3 A;  3PLV A;  5CLQ B;  3AE3 B;  4MM3 B;  5J3T A;  2WXJ A;  3R2I A;  5KQ1 A;  2K2U A;  5JHG A;  2PTL A;  4II3 B;  2GOW A;  4GB9 A;  3SYX A;  2Z0O A;  1P0R A;  4KIK B;  3P63 A;  2N7E A;  4RF0 A;  3RMK C;  2GBJ A;  4E71 A;  4MH0 E;  2GBM A;  1UBQ A;  3ZVR A;  5C3J B;  1Q10 A;  1Y56 A;  3N1X C;  2D11 A;  1R4N I;  4K2P A;  2KC1 A;  2Q13 A;  4CO7 A;  1XLO A;  4MEM A;  2C7H A;  1NVI D;  4HJK A;  5J3Y A;  4W9K A;  1SXT A;  3W1Y A;  1YIW A;  1UUP A;  5C79 A;  5C16 A;  4DXA B;  2Y3A A;  4HAW B;  2M1M A;  1K5D B;  5HE0 A;  2X0S A;  1FHO A;  3T3O A;  2YS5 A;  4HWI B;  4GXB A;  1TJ6 A;  3FP5 A;  4GOC A;  2LJ5 A;  2KK8 A;  3ZJV A;  1DDW A;  3KLS X;  4D2K A;  1I4H A;  1NVL A;  3DBS A;  2G1E A;  4MJS A;  3KVF B;  1XLQ A;  1Y19 B;  1NI3 A;  3Q2A C;  4QXA B;  3H7P A;  2KMA A;  3V61 A;  4GU2 A;  1UNS A;  4A20 A;  2J4X A;  1H4R A;  4DX8 A;  2IND C;  4P6V F;  3PS6 A;  3AEF B;  3PGE A;  1MPE A;  3BYT B;  2XEW A;  1WX9 A;  3AV8 A;  2LMC A;  4MT5 A;  1FD6 A;  2AL3 A;  4HEA 1;  2OOB B;  2IJ0 A;  5CX3 A;  3R7Q A;  2WH5 A;  1RM6 C;  4OT1 A;  2LEK A;  2LGX A;  4JIO U;  4XC2 A;  1MIZ B;  2WWZ A;  2ZNV C;  3DBR B;  4Q2J A;  4RMA A;  2Z14 A;  5D2M B;  4KSL C;  2D4Q A;  4OZB A;  2NCN A;  3K9O B;  2LRU A;  2RRF A;  2J52 A;  2COD A;  2KUQ A;  5IJM A;  3F5R A;  2KJ6 A;  1E5W A;  2YEP B;  3H6N A;  1PMS A;  4HRS A;  3PP2 A;  3KW5 B;  5FR6 A;  3Q8B A;  3ZGZ A;  1J7B A;  4FUL A;  1N3H A;  1FHW A;  4F7U P;  2LGY A;  4ZYN A;  2RR9 A;  4GNK B;  4BKS A;  3VR9 B;  2OJW A;  1HEZ E;  4WJQ A;  1H10 A;  1VLB A;  1WGD A;  3DCX A;  3AI5 A;  4HPL B;  2WDT B;  3VTU A;  4DXG A;  2MW5 A;  1Z2M A;  2BYT A;  2Z4D A;  3DOW A;  4HDO A;  3U8Z A;  1F52 A;  2LVO A;  4JK9 A;  2L32 A;  2LUM A;  1IGD A;  4LDT D;  3LDZ E;  3G9W A;  3V6E B;  1JWS D;  3V5W A;  2DZI A;  2O6V B;  3DBR I;  2FIF A;  2JWU A;  2DHI A;  2H88 B;  1ZM0 A;  4MY6 A;  3E9L A;  3GE8 C;  2DYN A;  3ZO5 B;  5C5B A;  3Q8F A;  4B95 A;  2WX1 A;  2XNA C;  3BIN A;  3KQ4 A;  3V60 A;  2COA A;  4WUR A;  2VZK B;  2WXG A;  4KGT A;  3Q3O C;  4LTU A;  2EC1 A;  1V9J A;  5HE2 A;  3NWA A;  2HD5 B;  2V1Y A;  4ZHP A;  1WXS A;  2IYD B;  2HJ8 A;  4YSX B;  3X0W A;  1L0X B;  1RJ2 A;  3BWU D;  2QCZ A;  3DQV A;  3W5U B;  2SAK A;  2BS4 B;  4GMV A;  1T77 A;  2L00 B;  1TY2 A;  1SIJ A;  2XQN M;  2K5P A;  3Q14 C;  4KGR A;  3TFM A;  1BUI C;  3ZXV A;  1I2H A;  1KLU D;  2I1K A;  4ZRJ A;  2KCJ A;  1YMH E;  3TUO A;  1E7P B;  5J2R A;  5EDS A;  2G4S A;  1C78 A;  5AZH A;  3H7S A;  3AED B;  3QA8 A;  1JCK B;  2KJR A;  1L0Y B;  4HKQ A;  1LFD A;  2KX3 A;  1D6E C;  1EUV B;  1SE2 A;  4MJS B;  1FCL A;  1KI1 B;  2QHO A;  1VZ6 A;  4I6L B;  1ZKH A;  2K8C A;  4KAX B;  4TKN A;  3VTV A;  3KRX A;  2WLB A;  3N20 C;  2ACZ B;  4DBB A;  1XCT L;  1CJE A;  3D8D A;  3PTF C;  2MBQ A;  1WFY A;  2FJU B;  1OMW A;  3ENB A;  2G3Q B;  2CY4 A;  4WAA A;  2BKF A;  1AWD A;  2YT2 A;  3RNE C;  1HB6 A;  2H7E A;  4HB3 B;  4M8M A;  2ROZ B;  2RPV A;  1UBI A;  3B77 A;  5HHD G;  4A6K A;  3RNB C;  1HBK A;  1C4P A;  2SEB D;  1MK7 B;  2DYQ A;  1WJM A;  2KVZ A;  2KJH B;  2OHF A;  5L81 A;  4WQO B;  4BBN C;  2ZKM X;  1MKE A;  3HW2 B;  3V62 A;  5C2T B;  3APF A;  4HSI A;  4ZRP A;  1TBE A;  1V81 A;  3I3T B;  4GPT B;  2DKP A;  2RUK B;  4WJO A;  3ZIM A;  4K7S A;  4JKG A;  1DOX A;  4RGM A;  2XK5 A;  4NJ7 A;  3R3M A;  3A33 B;  4QJ4 B;  2M56 B;  4IDI A;  4JPS A;  3KH0 A;  1T0Y A;  3NVW A;  5CHW A;  2KLG A;  3PRM B;  1EU3 A;  1KLG D;  2LZ6 A;  2G45 B;  4G3X B;  1PQS A;  4E3C A;  3DPD A;  3V6C B;  2ONQ A;  1HTO A;  3GP7 A;  4OW0 A;  2KKC A;  3ZNI D;  2D9W A;  4DHJ D;  4AWJ A;  2P0H A;  3IG3 A;  3AEG B;  2KTR B;  2WXP A;  3QX1 A;  2CU3 A;  5EFX A;  1SB3 C;  3AU5 A;  3E9P A;  2ZCC A;  3GZN I;  3SEB A;  1MVK A;  3E56 A;  1FMA D;  1U4A A;  2M14 A;  4HPM B;  2RQ1 A;  5LOP B;  1RFA A;  4BFR A;  1WXQ A;  2L83 A;  2WGS A;  2Z0E B;  3NJT A;  2BW2 A;  4IWP A;  1TQZ A;  3JW0 X;  3ZXR A;  4D6W A;  4G50 A;  4DQO C;  1WY8 A;  4XWX A;  2KO3 A;  2KWD A;  2AL6 A;  2MP2 A;  2EEL A;  5D3V A;  4II2 B;  2NS5 A;  2LVQ A;  2LGS A;  1V1P A;  3WAP A;  1FB8 A;  2ZZP B;  3A8Q A;  2LGD A;  1BAK A;  1QZE A;  3U4E G;  3ZDM C;  1U5E A;  4A55 A;  2KD0 A;  4GLS C;  2K25 A;  4K17 A;  2V3S A;  3CWI A;  4WAF A;  4TSS A;  3M62 B;  2O6V D;  3NW8 A;  1WI1 A;  4WVF B;  3KUZ A;  1A70 A;  2BWE S;  2KDB A;  4LNF A;  3A1Q B;  1KJT A;  4NAW B;  1E7U A;  2TSS A;  1ZDX A;  1PLS A;  4NAM A;  5E6J A;  3VRB B;  2LXA A;  2INN E;  4FAD A;  1OGW A;  2O2V B;  3B1L X;  4YL8 A;  3R7R A;  5JXV A;  4MGZ E;  1J0G A;  4HKZ E;  4FJY A;  5EE0 A;  1LXD A;  2J7Q B;  4P16 A;  1EO6 A;  2CQU A;  5FI1 A;  4F7Z A;  4KX6 B;  5DIF B;  4W9J A;  2D3B A;  3DVG Y;  1WR6 E;  1MI1 A;  3AU4 A;  4W9C A;  1P6S A;  3TMP B;  4EZK A;  2Y8G A;  2OED A;  1UPR A;  1L6V A;  5BMH A;  5AUI A;  3TW1 A;  2MHJ A;  1WG7 A;  3ZUN A;  5C1Z A;  5T8I A;  3ZTD A;  1NI2 A;  3N1Z C;  4ANV A;  3ULC A;  2ZEQ A;  2UYZ B;  3RYT A;  2L0T A;  2HRJ A;  3P6A A;  2MCN B;  1WVH A;  3D8E A;  3DBL I;  3SO6 A;  3Q3J A;  4WJP A;  3A98 B;  4IM3 A;  3AEE B;  2BBC A;  2UZS A;  2CU1 A;  4WJN A;  3L10 B;  2YEP F;  4HAX B;  5DI9 B;  2GS0 A;  1WJN A;  3AE8 B;  4LK0 M;  3VHT C;  3AE1 B;  2ELB A;  4QAY A;  3A1Q A;  4AP4 C;  2WHI A;  3VH4 B;  1NEK B;  4B6W A;  2FID A;  3QWZ B;  1DYN A;  1W1G A;  2D2Q A;  1FHX A;  1SHC A;  4IC7 B;  3QCA A;  2YLM A;  3U52 E;  2KMM A;  4US8 A;  2JT4 B;  2WXK A;  1V1P B;  2MLB A;  4PNK A;  1TIF A;  1ZC4 B;  1YJJ A;  3A4R A;  1HTQ A;  1XO3 A;  2NR2 A;  4NSW A;  2WXL A;  2KNB A;  5IO9 A;  5EE3 A;  1YQ3 B;  1EF5 A;  1TGZ B;  2KZR A;  1XLP A;  4DHZ E;  3MFG A;  1WJ6 A;  1PGX A;  4JWU C;  3EA6 A;  1T6B X;  1V5O A;  3DBH B;  2HE7 A;  5L95 C;  5G5G A;  1ZPS A;  2VH1 A;  2XBB C;  3CF6 E;  5JH5 C;  2BCJ A;  3NY5 A;  1J0W A;  4NNJ B;  1FPY A;  3NSU A;  2ICI A;  2VH2 A;  3PLU A;  1OQR A;  3RZF A;  1M7E A;  4WIP A;  2NZ8 B;  2MJE A;  3ML4 A;  5C5B B;  1LW3 A;  2DIK A;  4LCD E;  3U7D A;  2FBW B;  2LOZ A;  4K81 A;  3BZD B;  2KTR A;  2M0A A;  3ML9 A;  3GYP A;  4N59 A;  2INP E;  1CMX B;  4LJP B;  3TEX A;  3LXF A;  2I5F A;  1SJE D;  4A3O A;  1WMH B;  1YD8 U;  5JZE B;  4IM0 A;  3VUX A;  2ZW1 A;  1UH6 A;  2NTT A;  2CHX A;  1M7R A;  1KZG A;  3ZNZ B;  2LKO A;  3WAN A;  2IO0 B;  3N7C A;  3NWD A;  2ZW0 A;  2KFK B;  2LVP A;  3OWE B;  2FE8 A;  4BBK A;  1GG3 A;  2MDX A;  4GOU A;  1TT5 B;  2RVB B;  1V97 A;  1WGG A;  3QIJ A;  3KYD D;  2J53 A;  4KKI A;  1E6E B;  2JXT A;  3UIN B;  2DFK A;  4JKG B;  2FAZ A;  4MGK E;  4JKH A;  3OAW A;  4TQ1 A;  3WAM A;  2N0S B;  2MJ3 A;  4IFS A;  1E8Y A;  2AWT A;  2ABD A;  3M95 A;  3W5V B;  3ZJT A;  3NUH B;  3PVL A;  4RNA A;  3FM8 C;  1WSP A;  1SSN A;  1ZDV A;  2EKI A;  3EPY A;  4P1B C;  2LBB A;  4IOI E;  3PVW A;  4LJO B;  5CLL B;  1LB1 A;  2JYE A;  4FA6 A;  4JKF A;  4GSW A;  1ZE3 D;  3L17 A;  3PZD A;  3EHV A;  1XR0 B;  5G55 A;  2KDF B;  2KN5 A;  2RSG A;  1P7F A;  2JPH A;  2K1F A;  2BKR B;  4MGI E;  5JVL A;  4G11 A;  3E66 A;  1N5X A;  1D3Z A;  2M4N A;  2NTS A;  4ANX A;  2JVC A;  1J7C A;  3NZ3 A;  3GE3 C;  2JP2 A;  2M38 A;  1UNP A;  2BF8 B;  2W3R A;  3H8H A;  1Q5W B;  2IDY A;  3EGR A;  1V1O A;  2YF0 A;  3BYY B;  4KHA A;  1WE6 A;  3EUB 2;  2WX0 A;  1GUA B;  2COC A;  1GB4 A;  5GOW B;  2KDM A;  4EMO A;  4GMX B;  2W3S A;  1F0Z A;  4BKG A;  2DAF A;  2KQ7 A;  2RDH A;  2P0F A;  2DLW A;  2BS3 B;  4NZL B;  1ACA A;  3N30 A;  3VTW A;  1S3S G;  1WYG A;  5E6N A;  3C8Y A;  3DCG A;  1T0R C;  2KTF A;  1WZ0 A;  3C0R B;  4RGT A;  1I42 A;  4H8S A;  2WYQ A;  5G2N A;  2Z13 A;  2IGG A;  2K8H A;  2HTM E;  3ENE A;  3HQC A;  1VBH A;  3N9Y C;  2PPH A;  4DDG D;  2MEK A;  4J6I A;  3IAS 1;  4NQL B;  5DPS A;  3LJU X;  2INC C;  3BK2 A;  2KC2 A;  1TZ1 A;  2N9X A;  5TSS A;  4K7W A;  4YTN B;  2LHD A;  3RT3 B;  3KUD B;  4C80 A;  2PJH A;  1V5U A;  2N0Y A;  3T3N A;  4KHB B;  3ODX A;  3KUC B;  2MKR A;  4N9F 4;  1I4P A;  1HE8 A;  1ZXI A;  2WDQ B;  3UZT A;  3BII D;  5C23 A;  3B0A A;  3PRZ A;  3A9J B;  2R61 A;  4GGQ A;  4B0E A;  3PHW B;  2N23 A;  1FRD A;  2V76 A;  4K2O A;  4GZU A;  5DHA B;  3ETR A;  1GPX A;  4TYZ A;  5D3W A;  2K00 A;  2GBK A;  3OG5 A;  1JWU D;  2VRW B;  4HAY B;  1EVH A;  1QOB A;  4WJ7 A;  1X1M A;  2REX A;  1NEN B;  1GGO A;  1NTI A;  4YXD B;  2KYW A;  3FSS A;  2K6D B;  3P4S B;  4IWQ A;  3KWL A;  2FCM A;  3P2B A;  1RYJ A;  2QEJ C;  2AEH A;  3AH7 A;  2V9H A;  4DX9 0;  2L76 A;  4E74 A;  1V2Y A;  2HTH B;  5EE9 A;  4EE2 A;  1U2B A;  5IOI A;  4W9E A;  4K3C A;  1VJK A;  2GLS A;  3UF8 A;  2NPT B;  1ESF A;  1NBF C;  2KWC A;  2L1A A;  2QJL A;  3PPA A;  2FCQ A;  4EZL A;  1N6Z A;  1HZ6 A;  3ULB A;  1RRP B;  2LFI A;  2WU2 B;  5FK9 C;  5DCN A;  5CHV C;  2JXX A;  3TVV A;  4HB0 B;  1MFW A;  3Q6B A;  2GCL A;  2Y7B A;  3ZQ4 A;  3A58 A;  1UNR A;  2OTX A;  5D7G A;  4WH4 A;  2KWV B;  4L1B A;  1IGC A;  4RH6 A;  3ALB A;  1KH0 A;  4GDL A;  3WA0 A;  4OHJ A;  4TV3 A;  1MHH E;  4DHZ B;  1K50 A;  1WX7 A;  5C6R A;  4KHO A;  4F1S A;  4M8N A;  1T0Q C;  2Y8F A;  2ZVO A;  1U5D A;  1UF0 A;  2YRY A;  4ARC A;  2KOX A;  1AWE A;  3OHM B;  2RDB C;  1PDX A;  5HI1 A;  1QQG A;  3N32 A;  2I38 A;  3I63 C;  4W9G A;  4JK8 A;  4DBG A;  1WRI A;  4DWF A;  3QC8 B;  2JZZ A;  1V8C A;  2XN9 C;  1WGY A;  2ON8 A;  4XX5 A;  1XQQ A;  3R8B A;  4IG7 B;  3ZW3 A;  3NHE B;  3CXB B;  3KRW A;  4JL9 A;  1VD2 A;  4Z2M B;  1FM0 D;  2C9W B;  2DYO A;  2R2Q A;  5JHH A;  1E8Z A;  2W82 A;  3DVN V;  3VH3 B;  2NBW B;  2EJ8 A;  3A4S C;  1WE7 A;  4LNN A;  5KCV A;  1VRA B;  2WXN A;  3UI3 A;  3WCQ A;  2WDV B;  4PS3 A;  3L16 A;  4AQ7 A;  1IP9 A;  2D9Y A;  3PSE B;  1F1H A;  5BYR A;  4EZJ A;  1WMH A;  2X18 A;  1FFU A;  2RNR B;  1QT9 A;  3PRP B;  3C19 A;  3AEC B;  3QAR A;  2E3T A;  4C7Y A;  2P0D A;  1WXM A;  3Q3F A;  2UU7 A;  2PVG C;  5D3X A;  2DN6 A;  2MX2 A;  1N60 A;  1C1Y B;  2QC8 A;  4XDD A;  2C7N B;  1FCC C;  1WGU A;  2IBI B;  2IZV B;  2G4D B;  3MHZ A;  2PE9 A;  1KC7 A;  3RNF C;  1OEY J;  3W9C B;  1U5G A;  3T06 A;  3ZVV A;  1P3Q U;  5H92 C;  2Y5B B;  2D9V A;  1XF5 L;  4YTM B;  1NTY A;  3PZ8 A;  1DBH A;  2KWU B;  1RWS A;  1FIQ A;  1E10 A;  4MK0 A;  3DVN U;  4PYU A;  2JZP A;  2C60 A;  4REZ A;  3E9O A;  1CK1 A;  1E90 A;  3HRD D;  3A9K A;  1EWC A;  2FCN A;  2P8V A;  5DPT A;  4A9A A;  2DZK A;  2JF5 A;  3KYC D;  2IGH A;  1TZO A;  4NY0 A;  1TKG A;  3WAO A;  1M4V A;  2JY6 A;  5LXI B;  3IVF A;  3RZW C;  2Z8L A;  1DDM A;  2RPQ A;  4O1N A;  5MPO A;  2ASQ A;  3DDC B;  3QAQ A;  3ZRF A;  2MQJ A;  3UIP B;  3HK0 A;  1STE A;  2IY0 B;  3RCZ A;  1GNU A;  2K39 A;  2KAN A;  4TMA B;  3FLV A;  3DBL B;  3H7P B;  1V86 A;  2PZ1 A;  1KLV A;  3APD A;  3CST A;  4F7G A;  2BYF A;  3MPX A;  5LXH A;  2FCS A;  2QSD A;  3I5J C;  3WIM A;  3B9J A;  3P42 A;  4WSF A;  1UZX B;  3DWM A;  2FDQ A;  1DGJ A;  5I2M A;  3CSF A;  3H9D A;  3M3J A;  2L3Z A;  4RGO S;  3Q8E A;  4AJW A;  1HZ5 A;  3SNH A;  5LG4 B;  1XCG A;  3SBG A;  4W9I A;  2BVC A;  2GCJ A;  4IOY X;  3BVG A;  2YVC A;  3SBT A;  2HJ1 A;  1YN5 A;  4A90 A;  4X57 B;  2ZNV B;  1AW7 A;  1X05 A;  3RUI B;  3ZNH B;  4ITK A;  2NMB A;  2K6Q A;  1NDD A;  4MDK E;  2D5G A;  4HAU B;  2ADZ A;  2M17 A;  2CJO A;  1H8C A;  2L8J A;  5CTR C;  1FGY A;  3ZLZ A;  3R2T A;  4RF1 A;  2JZ3 B;  3DVG X;  4S0R A;  4ASW C;  3URY A;  4NAW A;  1FGZ A;  2J59 M;  4MM3 A;  4HAT B;  5BYS A;  1V5P A;  1FXT B;  2DTC A;  2COP A;  4DHJ B;  4HRO A;  1K52 A;  2V3N A;  3PSC A;  1C77 A;  3VUW A;  2DZM A;  2RGN B;  4IUM B;  2ZPN A;  1WGR A;  4BVU C;  1TS5 A;  1ROE A;  1QLB B;  4XGA B;  3BVZ A;  4OVV A;  3MDB C;  1ET9 A;  3TEY A;  1U5F A;  1V88 A;  1XCQ L;  2IGD A;  1HXY D;  2D3A A;  1WJ4 A;  1N61 A;  3P1M A;  3N1Y C;  1ZYI A;  2J42 A;  1QIL A;  4ZRK A;  1GJZ A;  4BKT A;  2D3C A;  4FJZ A;  3MC8 A;  3Q3M C;  1A5R A;  3RN9 C;  3VDZ A;  1J19 A;  1C79 A;  3AM9 A;  4ANU A;  3FEH A;  3KZ1 A;  3D8F A;  1XX0 A;  4JK7 A;  3FIL A;  3NVZ A;  3V3X A;  3RFZ B;  5D3D A;  2KIG A;  2IO1 B;  2BPS A;  5IN7 A;  1OEY A;  2N1W A;  1YJ1 A;  2K9X A;  2JYT A;  5DHF B;  2HDE A;  4OVU A;  5CHF A;  2GBR A;  1OQY A;  3NOB A;  3A8P A;  4OSN A;  3Q8C A;  3MC0 B;  1NYQ A;  3ZYY X;  2R82 A;  1MHX A;  1FXI A;  4KZ0 A;  4PK1 A;  1JQ4 A;  3L08 A;  4R3D A;  1MG4 A;  2H89 B;  1ZUD 2;  1N62 A;  2MH7 A;  2UWQ A;  3HIZ A;  2BT6 A;  3NWF A;  3LB8 C;  3RD2 A;  2ROV A;  2K2J A;  2IFS A;  3PT2 B;  4ARI A;  4NPN A;  1WH3 A;  2FUG 1;  2WS3 B;  4IWO A;  5G5H A;  1R4M I;  3VOQ A;  4A6H A;  4KGS A;  1DYQ A;  2WXF A;  1VCB A;  1ZXH A;  2KLC A;  3QJZ A;  3RUL A;  2NBU A;  2QKL A;  1L2N A;  3TEW A;  2KDI A;  1KBL A;  1ZW7 A;  3PZ7 A;  1RFK A;  1WX8 A;  1OTR B;  2EKE C;  3NS1 A;  4F8C B;  5E6O A;  4RCO A;  3QWM A;  4WWN A;  4A6F A;  2CRF A;  4AOF A;  5H8Y E;  1L6U A;  2MBB B;  4Z2N A;  5JP4 A;  3OAN A;  1XD4 A;  1D5X C;  3QBV B;  2RGF A;  2JUO A;  3ML8 A;  1D5M C;  2JRI B;  1JML A;  2M8S A;  2YT1 A;  3P4Q B;  4XE0 A;  4C00 A;  3MP9 A;  4N6E B;  1QC6 A;  2V4I B;  4LNI A;  4B6H A;  1QOF A;  2NVU I;  4ZRQ A;  3AE5 B;  2E6X A;  4PS8 A;  1I7A A;  1KZ7 A;  2KN4 A;  1Z5S B;  4P1C C;  2QDF A;  3K9P B;  5LNK 1;  2AQ1 B;  2MWS B;  4KDL B;  3TCA A;  1S1Q B;  1E7V A;  4KKJ A;  2WXQ A;  4USA A;  3PG7 A;  3DHI C;  3DBH I;  1JWM D;  3H1U A;  3V05 A;  2L05 A;  2R2Y A;  1AQC A;  1FEH A;  2I2Y A;  5JHB A;  4AS1 A;  2K3U A;  2VRR B;  2KX0 A;  4JKA A;  1PFD A;  4J3O D;  3U12 A;  4ICU A;  2PEA A;  4ZDV A;  4C4V B;  1TKY A;  4EOY A;  3IHP C;  2JWZ A;  5IKC M;  4HK2 A;  2E2X A;  2KQS A;  1DOY A;  2MJD A;  2MFQ A;  3L0W B;  3ECI A;  3B2F A;  4AJY B;  2G9H D;  4GDK B;  1GC6 A;  1SE3 A;  4C56 C;  4NJ6 A;  3GOE A;  1Q67 A;  2W2X C;  1K51 A;  2K0P A;  3DXE A;  4MAC A;  3AEB B;  4W9D A;  1VZ7 A;  4I6P A;  1HA5 A;  3BK1 A;  2ZJD A;  4OZA A;  4YT0 B;  4YSY B;  3W2D A;  4HCP B;  5FI0 A;  3NZS A;  2W54 A;  1C9F A;  5J18 A;  4BKS D;  2X8X X;  2Z0Q A;  4HVB A;  5DPW A;  4WWM A;  2DEN B;  1D4B A;  3EC8 A;  1X1F A;  1Y8R C;  3L54 A;  3IXS A;  1VBG A;  4NJC A;  2VKI A;  4CSQ A;  4GDL B;  2PMV A;  3DXD A;  1K8R B;  3LYY A;  4MT7 A;  1TS4 A;  3TL5 A;  1DDV A;  4BZA A;  1EF1 A;  4HCN B;  5L83 A;  2D3G A;  3T8M A;  2YS1 A;  3L13 A;  2KIE A;  3AE6 B;  2CR5 A;  1WIA A;  2B3A A;  2WXI A;  4OZC A;  1PUT A;  3SUZ A;  5KHO A;  1FAO A;  1XLN A;  3T9L A;  2AQ2 B;  1LM8 B;  2XK5 B;  4PT5 A;  2QIL A;  4ICV A;  1V49 A;  2L0F A;  5J17 A;  1XD3 B;  4MSM B;  2HTH A;  1T0S C;  4RM8 A;  3O65 B;  1PFJ A;  1LQB A;  1BWN A;  2Y5C A;  2ZCB A;  3AEA B;  2KQ4 X;  2JRH A;  4IKG A;  2I5C A;  3RPF C;  1JDE A;  1SJH D;  5HG2 A;  3TSS A;  3SV1 A;  1OQN A;  2W2X D;  1GAQ B;  2C5L C;  1U27 A;  2LI5 A;  1J7A A;  2M0X A;  2DHZ A;  2KR0 A;  4RGN A;  2WP9 B;  3OJ3 A;  2C7M B;  1IPG A;  5D6J B;  1DIK A;  1AAR A;  1WGQ A;  2KUP A;  1WYW B;  2L52 A;  3SHQ A;  4HAV B;  3AXC A;  5FKA C;  3TO1 A;  2N7J A;  5AZF A;  3UIO B;  1MAI A;  3B08 A;  5I2S A;  3IFW B;  3F0W A;  2V3P A;  2EMS A;  3RNA C;  4GIV A;  2WDR B;  3RNG C;  1N63 A;  2WXM A;  3GZN B;  4F7H A;  4HJG E;  2WQY B;  3U7Z A;  2CHW A;  4US9 A;  4EFO A;  3PEG A;  4C0A A;  3VFK A;  1EU4 A;  1Q1O A;  1YN3 A;  1IRS A;  1IUE A;  1DRO A;  1SEB D;  4CYE A;  3J9C A;  1JAL A;  1UEL A;  2A5U A;  3ODW A;  2KVR A;  4XWT A;  5GMV A;  5TR5 A;  1YJI A;  2NBV B;  1B55 A;  4LDT B;  5M4Y B;  3HVZ A;  3MJ5 A;  2LGI A;  1AN8 A;  1P9D U;  2BWF A;  3WYF B;  1E8W A;  3X23 A;  3Q3N C;  1N5W A;  1L5P A;  4BAX A;  2LYD A;  1VDV A;  2EMT A;  1VR9 A;  1VZ8 A;  2Z0P A;  2IYB A;  1W1D A;  4JX1 C;  2NBV A;  1WJU A;  4FBJ B;  3SFD B;  3DXC A;  3L4P A;  4JKC A;  1U29 A;  2LRW A;  3VUY A;  4K7U A;  1JW9 D;  1FO4 A;  1MIX A;  1CQV A;  1TTN A;  2CAY A;  3MTN B;  1UEF A;  2WXR A;  1K5G B;  2DAJ A;  1RAX A;  3BY4 B;  2Z59 A;  1BT0 A;  1SE9 A;  2N9P C;  2LXC A;  1W1H A;  1UWX A;  3CIR B;  2CY5 A;  1C4C A;  2D07 B;  2MA9 B;  4HAZ B;  2BB5 A;  1IYF A;  2K49 A;  4B9K A;  4RFB A;  5IRS A;  2MBO A;  3OJ4 B;  1K53 A;  4PQ0 A;  1B9R A;  3JYU A;  2I1J A;  2R2O A;  4KDI C;  1ST7 A;  5D3I B;  2LUE A;  2WXH A;  4MSQ B;  3W1S A;  2DA0 A;  2BQQ A;  1G6J A;  1I4Q A;  3JSV B;  3ZKJ C;  1BTK A;  1JWA D;  2BYE A;  3GYO A;  1X1G A;  4N58 A;  4FJV B;  4ANW A;  2DZJ A;  1GB1 A;  2NPT A;  2FJL A;  5DH9 B;  4YSZ B;  1P98 A;  2QIE B;  4NQK E;  1L4D B;  3AE7 B;  4P7I A;  1YOV B;  3SD5 A;  2W2W A;  1RRB A;  2OQB A;  5D27 A;  2ZPY A;  3AE4 B;  4A3P A;  2DYB A;  3FKY A;  4L6E A;  1JRP A;  2LJI A;  3JSV A;  3UQA A;  3HUI A;  5AUK A;  1WXA A;  2J0M A;  1LGR A;  1ZSQ A;  2R09 A;  3TBL D;  2KT7 A;  3VXW A;  3WAL A;  4KV2 A;  1M94 A;  2GUM A;  3A9J A;  3AN1 A;  1OY2 A;  3AE2 B;  2RMM A;  4CHK A;  2L7R A;  1NTV A;  4W9H A;  2KAJ A;  4YTP B;  1P5T A;  2FUH B;  1V5T A;  3E9S A;  3MC9 A;  2AX5 A;  4ILJ A;  5E6P A;  3MHS D;  3TIX A;  1PGA A;  3RI7 C;  2DLB A;  3P4P B;  3W1S C;  1JRO A;  3IT4 B;  3AJ4 A;  1WF9 A;  2PVO D;  1PGB A;  1T3Q A;  4HDQ A;  3BVM A;  3DHH C;  3Q8A A;  1YQ4 B;  3QHT A;  4PYZ A;  3ZDT A;  1R4M B;  2MBE A;  2Z0D B;  2RD0 A;  4JKE A;  1V6E A;  5EE1 A;  4DIX A;  1WJ1 A;  5IA7 A;  1GC7 A;  2DNF A;  4G0N B;  4KIK A;  4ZOH C;  3ZJU A;  1I7H A;  1TXD A;  2KDE B;  2JX5 A;  5BO4 B;  4PS7 A;  4WWO A;  2BTE A;  2BB6 A;  1UGM A;  3AB5 A;  5I4D A;  1MJD A;  4KSK C;  2VZK D;  2GI9 A;  2DWQ A;  4C4V A;  4WQM A;  2B76 B;  1L4Z B;  2M19 A;  4URK A;  3NS8 A;  4FXC A;  1QOG A;  1C76 A;  3NRZ A;  3LJ3 A;  2Y5P A;  1QQR A;  2MSE D;  2L2I A;  3DWG C;  2DKQ A;  4TUU A;  5HFY A;  1FNV A;  3D32 A;  3CMM B;  2LAS A;  2V0G A;  3B2G A;  1P7E A;  3SU8 X;  2DBY A;  1F9J A;  3HIE A;  4XYC A;  1BTN A;  1CZP A;  3EEC A;  2N4F A;  2QMT A;  3ONS A;  3AMZ A;  4BBN F;  1V80 A;  5HE1 A;  3IBE A;  4S17 A;  1NYR A;  1ET6 A;  2FNJ B;  1X11 A;  3KSY A;  1OQQ A;  1L7Y A;  2JU6 X;  1YNT E;  4CQN A;  3ODO A;  1WXV A;  4AUQ C;  1FXA A;  3U2S C;  3TJP A;  2W55 A;  1ACC A;  4K1R B;  1IBX A;  4Y94 A;  3KY9 A;  1SF0 A;  2L1C A;  3M1I B;  4L23 A;  2R0D A;  4EJN A;  3I57 A;  4A6F B;  4TQ0 A;  5LLI A;  1QF6 A;  1P3R A;  2WU5 B;  1F2R I;  4EUT A;  3NG0 A;  4FN2 A;  5J3Q A;  2D9Z A;  2COF A;  2O2V A;  5JLJ B;  2YS3 A;  1ZGU B;  1TS3 A;  1EM7 A;  3VQI A;  4WWP A;  4A6Q A;  4YON A;  1KM7 A;  1TS2 A;  1MPH A;  2A4Z A;  1UGJ A;  2RDG A;  3UQB A;  1Q0W B;  3NZU A;  2RSU A;  4UDU C;  2KMC A;  1V89 A;  4XWW A;  1WM2 A;  1MK9 B;  2NMQ A;  2IPK D;  2CB8 A;  5KQ4 A;  1I35 A;  1F77 A;  5IP4 D;  4C7Z A;  4EEW A;  1T5X D;  3ZTC A;  1UPQ A;  2DX5 B;  3M63 B;  4JKD A;  2PLP A;  1KTK A;  2JQR B;  2KFK A;  2PW9 A;  2D9X A;  1WGH A;  4YWG G;  1J8C A;  1SGH A;  1BML C;  3CIK A;  4QJ5 B;  1WRD B;  2N7D A;  2Q5W D;  3MJW A;  2DX1 A;  1KFY B;  3TEZ A;  1IBX B;  4FLH A;  4MGY E;  4ACF A;  2D10 A;  1YQB A;  3GS2 A;  3HSA A;  1TJE A;  4M0W A;  1WZ3 A;  3ABV B;  4M02 A;  4GN1 A;  3FC4 A;  3BJI A;  4CHJ A;  2J0J A;  4L1R A;  2DHK A;  3RCP A;  4DK5 A;  2K22 A;  4W9L A;  2LWP A; 
#chains in the Genus database with same CATH homology
 2UZR A;  1Z87 A;  1KOT A;  5LON B;  1HB8 A;  4ZRI A;  2KFJ A;  2IO2 B;  3OLM D;  2LG1 A;  1Y5O A;  2AYO B;  4EKU A;  5D3Y A;  4I6N B;  2KHW B;  4D0N B;  4IAP A;  4GDK A;  1MG8 A;  1X86 A;  4W9F A;  2DYM A;  4ILG B;  3P7Z A;  2CHZ A;  4IW0 A;  4RM9 A;  1YX5 B;  4HXD A;  1XOD A;  1RLF A;  2MWN B;  1P1A A;  2IO3 B;  1EGX A;  3SDL C;  2MBH A;  3PV1 A;  4BOZ B;  3PVU A;  4MEL A;  2W9N A;  2QKM A;  3QK0 A;  2KXJ A;  1C3T A;  4JGH B;  1NU2 A;  2VSZ A;  2UVM A;  4HLE A;  4A5K A;  4ILH A;  4BOS C;  3R66 C;  2J0K A;  3PHX B;  4FHK A;  4IM2 A;  4M0W B;  1ISN A;  1YX6 B;  1XKE A;  1UNQ A;  2K8B A;  2ZVN A;  4CHM A;  3UGB B;  3ZNG C;  2CKH B;  1SIF A;  2H7D A;  3APC A;  2G35 A;  2DX5 A;  3U30 A;  3VVW B;  4FHJ A;  3S2A A;  2FJ9 A;  3VIA A;  1WM3 A;  3AUL A;  5HE3 A;  2CS4 A;  2N9E B;  1V61 A;  2PE6 B;  4XZ4 A;  2GMI C;  2MRP A;  4JQW C;  5KHQ A;  4HB4 B;  5JHA A;  3EFU A;  2BYV E;  2LD9 A;  2LUL A;  1V5M A;  5IAA C;  2BGF A;  2MP2 B;  1FOE A;  3A9K B;  1ZC3 B;  2GJY A;  3HHM A;  1UD7 A;  1ZVR A;  2V4L A;  4HHV A;  3QQ8 B;  3JVZ X;  2ELA A;  4DDI D;  5DPR A;  5AZG A;  1WI0 A;  4JLC A;  4HB2 B;  2O6V A;  2DHJ A;  4KVG B;  1EAZ A;  3O96 A;  2KGX B;  4KZC A;  2YT0 A;  1E8X A;  3N3K B;  3ZRC A;  2YSZ A;  1WR1 A;  4JKB A;  2Z59 B;  1JRU A;  5HKH A;  2RLO A;  2N1V A;  3HM6 X;  1XT9 B;  2GBN A;  5AEK B;  2LOX A;  3PRE A;  2IY1 B;  5D94 A;  3VAW A;  2OJR A;  3HM3 A;  3PLV A;  5CLQ B;  5J3T A;  5KQ1 A;  2K2U A;  5JHG A;  4II3 B;  2GOW A;  4GB9 A;  3SYX A;  2Z0O A;  1P0R A;  4KIK B;  2N7E A;  2GBJ A;  4E71 A;  4MH0 E;  2GBM A;  1UBQ A;  3ZVR A;  2D11 A;  1R4N I;  4K2P A;  2KC1 A;  2Q13 A;  4CO7 A;  4MEM A;  2C7H A;  4HJK A;  5J3Y A;  4W9K A;  3W1Y A;  1YIW A;  5C79 A;  5C16 A;  4DXA B;  4HAW B;  2M1M A;  1K5D B;  5HE0 A;  2X0S A;  1FHO A;  2YS5 A;  4HWI B;  4GXB A;  1TJ6 A;  3FP5 A;  4GOC A;  2LJ5 A;  2KK8 A;  1DDW A;  1NVL A;  3DBS A;  4MJS A;  3KVF B;  1Y19 B;  3H7P A;  2KMA A;  3V61 A;  4GU2 A;  4A20 A;  1H4R A;  4DX8 A;  3PS6 A;  3PGE A;  2XEW A;  1WX9 A;  2AL3 A;  2OOB B;  5CX3 A;  3R7Q A;  2WH5 A;  2LGX A;  4JIO U;  4XC2 A;  1MIZ B;  2WWZ A;  2ZNV C;  4RMA A;  5D2M B;  4KSL C;  2D4Q A;  2NCN A;  3K9O B;  2LRU A;  2COD A;  5IJM A;  3F5R A;  2KJ6 A;  1E5W A;  3H6N A;  1PMS A;  3PP2 A;  3KW5 B;  5FR6 A;  4FUL A;  1N3H A;  1FHW A;  4F7U P;  2LGY A;  4ZYN A;  2RR9 A;  4BKS A;  4WJQ A;  1H10 A;  1WGD A;  3AI5 A;  4HPL B;  2WDT B;  3VTU A;  2MW5 A;  1Z2M A;  3DOW A;  4HDO A;  3U8Z A;  2LVO A;  4JK9 A;  4LDT D;  3LDZ E;  3G9W A;  3V6E B;  2DZI A;  3V5W A;  2O6V B;  3DBR I;  2FIF A;  2DHI A;  1ZM0 A;  4MY6 A;  3E9L A;  2DYN A;  3ZO5 B;  5C5B A;  4B95 A;  2WX1 A;  3BIN A;  3V60 A;  2COA A;  2EC1 A;  1V9J A;  5HE2 A;  2HD5 B;  2V1Y A;  1WXS A;  2IYD B;  2HJ8 A;  3X0W A;  1RJ2 A;  3DQV A;  4GMV A;  2L00 B;  2XQN M;  3TFM A;  1I2H A;  2I1K A;  4ZRJ A;  2KCJ A;  5J2R A;  5EDS A;  2G4S A;  5AZH A;  3H7S A;  3QA8 A;  2KJR A;  1LFD A;  2KX3 A;  1EUV B;  4MJS B;  1KI1 B;  2QHO A;  4I6L B;  1ZKH A;  2K8C A;  4KAX B;  4TKN A;  3VTV A;  3KRX A;  4DBB A;  3D8D A;  3PTF C;  2MBQ A;  1WFY A;  1OMW A;  3ENB A;  2G3Q B;  2CY4 A;  4WAA A;  2BKF A;  1HB6 A;  2H7E A;  4HB3 B;  4M8M A;  2ROZ B;  1UBI A;  4A6K A;  1HBK A;  1MK7 B;  2DYQ A;  1WJM A;  2KJH B;  4WQO B;  5L81 A;  4BBN C;  1MKE A;  3HW2 B;  3V62 A;  3APF A;  1TBE A;  1V81 A;  3I3T B;  4GPT B;  2DKP A;  2RUK B;  4WJO A;  3ZIM A;  4K7S A;  4JKG A;  2XK5 A;  4NJ7 A;  3R3M A;  3A33 B;  3KH0 A;  1T0Y A;  5CHW A;  2KLG A;  3PRM B;  2LZ6 A;  2G45 B;  4G3X B;  1PQS A;  4E3C A;  3DPD A;  3V6C B;  2KKC A;  3ZNI D;  2D9W A;  4DHJ D;  4AWJ A;  2P0H A;  3IG3 A;  2KTR B;  3QX1 A;  5EFX A;  3AU5 A;  3E9P A;  2ZCC A;  3GZN I;  1U4A A;  2M14 A;  4HPM B;  2RQ1 A;  5LOP B;  1RFA A;  4BFR A;  2Z0E B;  4IWP A;  1TQZ A;  3JW0 X;  4G50 A;  1WY8 A;  4XWX A;  2KO3 A;  2AL6 A;  2MP2 A;  5D3V A;  4II2 B;  2NS5 A;  2LVQ A;  3WAP A;  1FB8 A;  2ZZP B;  3A8Q A;  2LGD A;  1BAK A;  1QZE A;  3ZDM C;  1U5E A;  2KD0 A;  2K25 A;  4K17 A;  2V3S A;  3M62 B;  2O6V D;  1WI1 A;  4WVF B;  3KUZ A;  2BWE S;  2KDB A;  3A1Q B;  1KJT A;  4NAW B;  1E7U A;  1PLS A;  2LXA A;  4FAD A;  1OGW A;  2O2V B;  3B1L X;  4YL8 A;  3R7R A;  4MGZ E;  1J0G A;  4FJY A;  1LXD A;  2J7Q B;  1EO6 A;  2CQU A;  5FI1 A;  4F7Z A;  5DIF B;  4W9J A;  3DVG Y;  1WR6 E;  3AU4 A;  4W9C A;  1P6S A;  3TMP B;  4EZK A;  2Y8G A;  1UPR A;  3TW1 A;  1WG7 A;  3ZUN A;  5C1Z A;  3ZTD A;  1NI2 A;  4ANV A;  3ULC A;  2ZEQ A;  2UYZ B;  3RYT A;  2L0T A;  2HRJ A;  3P6A A;  2MCN B;  1WVH A;  3D8E A;  3DBL I;  3SO6 A;  3Q3J A;  4WJP A;  3A98 B;  4IM3 A;  2UZS A;  2CU1 A;  4WJN A;  3L10 B;  4HAX B;  5DI9 B;  2GS0 A;  1WJN A;  3VHT C;  2ELB A;  3A1Q A;  4AP4 C;  3VH4 B;  4B6W A;  2FID A;  3QWZ B;  1DYN A;  1W1G A;  2D2Q A;  1FHX A;  1SHC A;  4IC7 B;  3QCA A;  2YLM A;  2JT4 B;  2MLB A;  4PNK A;  3A4R A;  1ZC4 B;  2NR2 A;  4NSW A;  2KNB A;  1EF5 A;  1TGZ B;  2KZR A;  4DHZ E;  1WJ6 A;  1V5O A;  5L95 C;  2HE7 A;  2XBB C;  3CF6 E;  5JH5 C;  2BCJ A;  3NY5 A;  1J0W A;  4NNJ B;  3NSU A;  3PLU A;  3RZF A;  1M7E A;  2NZ8 B;  3ML4 A;  5C5B B;  1LW3 A;  2DIK A;  4LCD E;  3U7D A;  2LOZ A;  4K81 A;  2KTR A;  3ML9 A;  3GYP A;  1CMX B;  4LJP B;  2I5F A;  4A3O A;  1WMH B;  1YD8 U;  5JZE B;  4IM0 A;  3VUX A;  1UH6 A;  2CHX A;  1M7R A;  1KZG A;  3ZNZ B;  3WAN A;  2LKO A;  2IO0 B;  3N7C A;  2KFK B;  2LVP A;  4BBK A;  1GG3 A;  2MDX A;  2RVB B;  1WGG A;  3QIJ A;  3KYD D;  3UIN B;  2DFK A;  4JKG B;  2FAZ A;  4MGK E;  4JKH A;  3OAW A;  4TQ1 A;  3WAM A;  4IFS A;  1E8Y A;  2AWT A;  2ABD A;  3M95 A;  3PVL A;  3FM8 C;  3EPY A;  2LBB A;  3PVW A;  4LJO B;  5CLL B;  1LB1 A;  4FA6 A;  4JKF A;  4GSW A;  3L17 A;  3PZD A;  3EHV A;  1XR0 B;  5G55 A;  2KDF B;  2KN5 A;  2RSG A;  2JPH A;  2K1F A;  2BKR B;  4MGI E;  5JVL A;  4G11 A;  3E66 A;  1D3Z A;  2M4N A;  4ANX A;  2JVC A;  2JP2 A;  2M38 A;  1UNP A;  2BF8 B;  1Q5W B;  2YF0 A;  4KHA A;  1WE6 A;  2WX0 A;  1GUA B;  2COC A;  5GOW B;  4EMO A;  4GMX B;  4BKG A;  2DAF A;  2KQ7 A;  2P0F A;  2DLW A;  1ACA A;  3N30 A;  3VTW A;  1S3S G;  5E6N A;  3DCG A;  2KTF A;  1WZ0 A;  3C0R B;  1I42 A;  4H8S A;  2WYQ A;  5G2N A;  2K8H A;  3ENE A;  3HQC A;  1VBH A;  2PPH A;  4DDG D;  4J6I A;  4NQL B;  5DPS A;  3LJU X;  2KC2 A;  1TZ1 A;  2N9X A;  4K7W A;  3RT3 B;  3KUD B;  2PJH A;  1V5U A;  2N0Y A;  4KHB B;  3ODX A;  3KUC B;  2MKR A;  4N9F 4;  1HE8 A;  3UZT A;  5C23 A;  3B0A A;  3PRZ A;  3A9J B;  4GGQ A;  3PHW B;  2N23 A;  2V76 A;  4K2O A;  4GZU A;  5DHA B;  4TYZ A;  5D3W A;  2K00 A;  2GBK A;  2VRW B;  4HAY B;  1EVH A;  4WJ7 A;  1X1M A;  2REX A;  1GGO A;  1NTI A;  3FSS A;  2K6D B;  4IWQ A;  2FCM A;  3P2B A;  2AEH A;  4DX9 0;  2L76 A;  4E74 A;  1V2Y A;  2HTH B;  1U2B A;  4W9E A;  3UF8 A;  2NPT B;  1NBF C;  2KWC A;  3PPA A;  2FCQ A;  4EZL A;  3ULB A;  1RRP B;  5DCN A;  5CHV C;  2JXX A;  3TVV A;  4HB0 B;  2GCL A;  2Y7B A;  1UNR A;  2OTX A;  5D7G A;  2KWV B;  3ALB A;  4GDL A;  3WA0 A;  4TV3 A;  4DHZ B;  1WX7 A;  5C6R A;  4KHO A;  4F1S A;  4M8N A;  2Y8F A;  2ZVO A;  1U5D A;  2YRY A;  2KOX A;  1AWE A;  1QQG A;  3N32 A;  4W9G A;  4JK8 A;  4DBG A;  4DWF A;  3QC8 B;  2JZZ A;  1WGY A;  4XX5 A;  1XQQ A;  4IG7 B;  3ZW3 A;  3NHE B;  3CXB B;  3KRW A;  4JL9 A;  1VD2 A;  4Z2M B;  2DYO A;  2C9W B;  2R2Q A;  5JHH A;  1E8Z A;  3DVN V;  3VH3 B;  2NBW B;  2EJ8 A;  3A4S C;  1WE7 A;  5KCV A;  4PS3 A;  3L16 A;  1IP9 A;  2D9Y A;  3PSE B;  4EZJ A;  1WMH A;  2X18 A;  2RNR B;  3PRP B;  3QAR A;  2P0D A;  1WXM A;  3Q3F A;  5D3X A;  2DN6 A;  2MX2 A;  1C1Y B;  2C7N B;  1WGU A;  2IBI B;  2IZV B;  2G4D B;  2PE9 A;  1KC7 A;  1OEY J;  1U5G A;  3T06 A;  3ZVV A;  1P3Q U;  2Y5B B;  2D9V A;  1NTY A;  1DBH A;  2KWU B;  4MK0 A;  3DVN U;  4PYU A;  2C60 A;  3E9O A;  1E90 A;  3A9K A;  2FCN A;  2P8V A;  5DPT A;  2DZK A;  2JF5 A;  3KYC D;  4NY0 A;  3WAO A;  2JY6 A;  5LXI B;  3RZW C;  3IVF A;  1DDM A;  2RPQ A;  2ASQ A;  3DDC B;  3QAQ A;  3ZRF A;  2MQJ A;  3UIP B;  3HK0 A;  2IY0 B;  3RCZ A;  1GNU A;  2K39 A;  2KAN A;  3FLV A;  3H7P B;  1V86 A;  2PZ1 A;  1KLV A;  3APD A;  3CST A;  4F7G A;  2BYF A;  3MPX A;  5LXH A;  2FCS A;  3WIM A;  4WSF A;  1UZX B;  2FDQ A;  3CSF A;  3H9D A;  3M3J A;  2L3Z A;  4AJW A;  3SNH A;  1XCG A;  3SBG A;  4W9I A;  2GCJ A;  4IOY X;  2YVC A;  3SBT A;  4X57 B;  2ZNV B;  1X05 A;  3RUI B;  3ZNH B;  2NMB A;  2K6Q A;  1NDD A;  4MDK E;  4HAU B;  2ADZ A;  2M17 A;  1H8C A;  2L8J A;  5CTR C;  1FGY A;  3ZLZ A;  2JZ3 B;  3DVG X;  4ASW C;  4NAW A;  1FGZ A;  2J59 M;  4MM3 A;  4HAT B;  1V5P A;  1FXT B;  2DTC A;  2COP A;  4DHJ B;  3PSC A;  3VUW A;  2DZM A;  2RGN B;  4IUM B;  2ZPN A;  1WGR A;  4BVU C;  4OVV A;  3MDB C;  1U5F A;  1V88 A;  1WJ4 A;  4ZRK A;  1GJZ A;  4BKT A;  4FJZ A;  1A5R A;  3VDZ A;  1J19 A;  4ANU A;  3FEH A;  3KZ1 A;  3D8F A;  1XX0 A;  4JK7 A;  2IO1 B;  2BPS A;  1OEY A;  2N1W A;  1YJ1 A;  5DHF B;  4OVU A;  5CHF A;  2GBR A;  1OQY A;  3NOB A;  3A8P A;  2R82 A;  4KZ0 A;  3L08 A;  2UWQ A;  3HIZ A;  3RD2 A;  2ROV A;  2K2J A;  2IFS A;  3PT2 B;  4NPN A;  1WH3 A;  4IWO A;  1R4M I;  3VOQ A;  4A6H A;  1VCB A;  2KLC A;  3RUL A;  3QJZ A;  2NBU A;  2QKL A;  1L2N A;  2KDI A;  1KBL A;  1ZW7 A;  1WX8 A;  1OTR B;  2EKE C;  4F8C B;  5E6O A;  3QWM A;  4WWN A;  4A6F A;  2CRF A;  4AOF A;  2MBB B;  4Z2N A;  5JP4 A;  3OAN A;  1XD4 A;  3QBV B;  2RGF A;  2JUO A;  3ML8 A;  2JRI B;  2M8S A;  2YT1 A;  1QC6 A;  4B6H A;  2NVU I;  4PS8 A;  1I7A A;  1KZ7 A;  1Z5S B;  3K9P B;  2MWS B;  4KDL B;  3TCA A;  1S1Q B;  1E7V A;  3PG7 A;  3DBH I;  3H1U A;  2L05 A;  1AQC A;  5JHB A;  2VRR B;  2KX0 A;  4JKA A;  4ICU A;  2PEA A;  4ZDV A;  4EOY A;  3IHP C;  2JWZ A;  4HK2 A;  2E2X A;  2KQS A;  2MFQ A;  3L0W B;  3ECI A;  4AJY B;  4GDK B;  1GC6 A;  4NJ6 A;  3GOE A;  1Q67 A;  2W2X C;  3DXE A;  4W9D A;  4I6P A;  2ZJD A;  4HCP B;  5FI0 A;  3NZS A;  5J18 A;  4BKS D;  2Z0Q A;  4HVB A;  5DPW A;  2DEN B;  3EC8 A;  1X1F A;  1Y8R C;  3L54 A;  1VBG A;  2VKI A;  4GDL B;  3DXD A;  1K8R B;  4MT7 A;  3TL5 A;  1DDV A;  1EF1 A;  4HCN B;  5L83 A;  2D3G A;  3T8M A;  2YS1 A;  3L13 A;  2CR5 A;  1WIA A;  2B3A A;  3SUZ A;  5KHO A;  1FAO A;  3T9L A;  1LM8 B;  2XK5 B;  4ICV A;  1V49 A;  2L0F A;  5J17 A;  1XD3 B;  4MSM B;  2HTH A;  4RM8 A;  3O65 B;  1PFJ A;  1LQB A;  1BWN A;  2ZCB A;  2JRH A;  2I5C A;  1JDE A;  3SV1 A;  1OQN A;  2W2X D;  2C5L C;  1U27 A;  2LI5 A;  2M0X A;  2DHZ A;  3OJ3 A;  2C7M B;  1IPG A;  5D6J B;  1DIK A;  1AAR A;  1WGQ A;  2KUP A;  1WYW B;  3SHQ A;  4HAV B;  3AXC A;  5AZF A;  3TO1 A;  3UIO B;  1MAI A;  3B08 A;  3IFW B;  3F0W A;  2EMS A;  4GIV A;  4F7H A;  2CHW A;  4EFO A;  3PEG A;  4C0A A;  3VFK A;  1Q1O A;  1IRS A;  1DRO A;  4CYE A;  1UEL A;  2A5U A;  3ODW A;  2KVR A;  5GMV A;  5TR5 A;  2NBV B;  1B55 A;  4LDT B;  1P9D U;  2BWF A;  3WYF B;  1E8W A;  3X23 A;  2LYD A;  2EMT A;  2Z0P A;  2IYB A;  1W1D A;  1WJU A;  4FBJ B;  3DXC A;  4JKC A;  1U29 A;  2LRW A;  3VUY A;  4K7U A;  1MIX A;  1TTN A;  2CAY A;  3MTN B;  1UEF A;  1K5G B;  2DAJ A;  1RAX A;  3BY4 B;  1BT0 A;  1SE9 A;  2N9P C;  2LXC A;  1W1H A;  2CY5 A;  2D07 B;  2MA9 B;  4HAZ B;  1IYF A;  4B9K A;  2MBO A;  3OJ4 B;  4PQ0 A;  3JYU A;  2I1J A;  2R2O A;  4KDI C;  1ST7 A;  2LUE A;  4MSQ B;  3W1S A;  2DA0 A;  1G6J A;  3JSV B;  3ZKJ C;  1BTK A;  2BYE A;  3GYO A;  1X1G A;  4FJV B;  4ANW A;  2DZJ A;  2NPT A;  2FJL A;  5DH9 B;  1P98 A;  4NQK E;  4P7I A;  3SD5 A;  2W2W A;  1RRB A;  2OQB A;  5D27 A;  2ZPY A;  4A3P A;  2DYB A;  4L6E A;  3JSV A;  3UQA A;  1WXA A;  2J0M A;  1ZSQ A;  2R09 A;  3TBL D;  3VXW A;  3WAL A;  4KV2 A;  1M94 A;  3A9J A;  1OY2 A;  4CHK A;  2L7R A;  1NTV A;  4W9H A;  1P5T A;  2FUH B;  1V5T A;  4ILJ A;  5E6P A;  3MHS D;  3TIX A;  3W1S C;  3AJ4 A;  1WF9 A;  4HDQ A;  3QHT A;  4PYZ A;  3ZDT A;  2MBE A;  2Z0D B;  2RD0 A;  4JKE A;  1V6E A;  1WJ1 A;  5IA7 A;  1GC7 A;  4G0N B;  4KIK A;  1TXD A;  2KDE B;  5BO4 B;  4PS7 A;  4WWO A;  1UGM A;  4KSK C;  4URK A;  3NS8 A;  3LJ3 A;  2MSE D;  2L2I A;  2DKQ A;  4TUU A;  3D32 A;  3CMM B;  2LAS A;  3SU8 X;  1F9J A;  1BTN A;  3EEC A;  2N4F A;  3ONS A;  4BBN F;  1V80 A;  5HE1 A;  3IBE A;  2FNJ B;  1X11 A;  3KSY A;  1L7Y A;  3ODO A;  1WXV A;  4AUQ C;  3TJP A;  4K1R B;  4Y94 A;  3KY9 A;  2L1C A;  3M1I B;  2R0D A;  4EJN A;  4A6F B;  4TQ0 A;  5LLI A;  1P3R A;  4EUT A;  4FN2 A;  5J3Q A;  2D9Z A;  2COF A;  2O2V A;  5JLJ B;  2YS3 A;  1ZGU B;  3VQI A;  4WWP A;  4YON A;  1KM7 A;  1MPH A;  2A4Z A;  3UQB A;  1Q0W B;  3NZU A;  2RSU A;  2KMC A;  1V89 A;  1WM2 A;  1MK9 B;  2CB8 A;  5KQ4 A;  1I35 A;  4EEW A;  3ZTC A;  1UPQ A;  2DX5 B;  3M63 B;  4JKD A;  2KFK A;  2D9X A;  1WGH A;  1J8C A;  1SGH A;  3CIK A;  1WRD B;  2N7D A;  3MJW A;  2DX1 A;  4FLH A;  4MGY E;  2D10 A;  1YQB A;  1WZ3 A;  4GN1 A;  3BJI A;  4CHJ A;  2J0J A;  2DHK A;  3RCP A;  4DK5 A;  4W9L A;  2LWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...