4CYEA

Crystal structure of avian fak ferm domain fak31-405 at 3.2a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4cyeA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4cyeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4cyeA01
2GMIC 4OVUA 1U5EA 2KANA 4D0NB 4CHMA 2Y5BB 1ACAA 2BYVE 1RJ2A 1XCGA 3ZW3A 3QBVB 2QHOA 4HAVB 3APFA 2QKMA 4HHVA 1Q67A 2MP2B 3APCA 5KCVA 2KLGA 4LJPB 1WJMA 4K7UA 4NJ7A 1V6EA 3QIJA 2J59M 3NZSA 1FOEA 1BAKA 1Q5WB 5LXHA 5HE0A 2NCNA 2DYBA 4BBNC 2V4LA 3QQ8B 3DCGA 4HLEA 4KZCA 2ELAA 1D3ZA 4A6FA 2KO3A 2M1MA 4AOFA 2N7EA 2NVUI 4LDTB 3MPXA 2VKIA 4W9FA 3H9DA 4KHBB 3H7PA 1L2NA 2ZJDA 1TZ1A 3PTFC 5TR5A 5FI1A 2K6QA 4WWNA 2KGXB 2LG1A 2DX5B 1Y8RC 2JY6A 3W1SA 3PG7A 1NVLA 2LBBA 3HW2B 1UH6A 1MPHA 3JSVB 4JLCA 4KSLC 2Z0PA 2LRWA 2W2XC 3ZNHB 1FHXA 3ZNZB 2FCSA 3VIAA 2D9XA 3MJWA 3O96A 4TYZA 2EMTA 1QZEA 4B9KA 2FNJB 4DHJD 3DBRI 2MP2A 1M94A 4TQ1A 2R09A 2K8HA 3VVWB 1NTIA 2LXAA 4E3CA 1I7AA 5C1ZA 1WMHB 1YX5B 1X1FA 3DVNV 4DX8A 1UZXB 5KHOA 1WVHA 4HATB 4ANXA 1TQZA 2K25A 1J0WA 1T0YA 3AULA 4M0WB 5E6OA 3F0WA 4JL9A 3MTNB 4HPMB 5JH5C 3NOBA 4BKSD 1UNQA 1IP9A 2DYOA 2N7DA 4EZJA 5KQ4A 3ODOA 4HCNB 4F7HA 1KI1B 3I3TB 4DHZE 4KZ0A 2CRFA 1H4RA 2D9YA 2K8BA 1WIAA 4DDID 2DHIA 2DX5A 2N9EB 3DXEA 1XKEA 2FAZA 1LQBA 2ZEQA 3WAOA 2UZRA 1U5GA 1XR0B 3JSVA 4EOYA 3OJ4B 4MK0A 4YL8A 2R2OA 3VHTC 2KWCA 2WX1A 1RFAA 4BVUC 1FHWA 1DDVA 4F7GA 3X0WA 3DVGX 1UNRA 2Z59B 2KTFA 2COCA 3PZDA 2YT0A 3PHWB 4BFRA 2G45B 3KH0A 1GC6A 5IA7A 4K1RB 3PPAA 2KDEB 1SHCA 2CODA 2P0DA 2CHWA 3V6EB 2UYZB 2ELBA 1WMHA 4IWPA 3L10B 1P6SA 1BWNA 3H1UA 5D6JB 4EZLA 5DH9B 3N7CA 2KD0A 3L54A 2L0TA 3U7DA 2IZVB 4W9GA 3FM8C 1MAIA 1S1QB 2LASA 3TJPA 2Y7BA 4FHKA 5DPSA 2BYEA 5DPWA 4MGIE 4WQOB 4DBGA 2WWZA 2K2UA 5L81A 1V86A 3D8EA 3KSYA 3SD5A 3QJZA 3SDLC 2YLMA 2J0KA 3R66C 2NPTB 2LXCA 2P0HA 2UZSA 4JIOU 4KDIC 3DOWA 3ZLZA 2K6DB 4ANVA 2KFJA 3IBEA 4GDKB 3ODXA 2L0FA 4P7IA 1RLFA 1NI2A 1GUAB 3WALA 3R7RA 2C60A 1WGRA 3ZIMA 1WR1A 3WAMA 4ICUA 2DX1A 4F8CB 1V5PA 4MT7A 4JQWC 2X18A 2UWQA 1RRBA 2COFA 1H10A 3TFMA 5AZGA 2LULA 3ULBA 2NBWB 3SUZA 3AI5A 2DLWA 2JPHA 3VTUA 2GBJA 3RUIB 3VUXA 2BCJA 3UGBB 2C7HA 2LZ6A 2FUHB 4NY0A 5LOPB 2K1FA 1KOTA 2LGDA 2REXA 1MKEA 4II3B 3M1IB 4WJQA 1WYWB 2WYQA 2PZ1A 3X23A 4A20A 5JP4A 2COAA 2KZRA 1UD7A 3PV1A 3LDZE 4PYZA 3PVWA 4HB3B 2NPTA 2W9NA 1AARA 2YS5A 3A9KB 2FDQA 5DPTA 2LVQA 3QWZB 3H7SA 4AJWA 3PRPB 1V88A 3RT3B 2Y8GA 4GDKA 3DVNU 3RCPA 4HXDA 2KQ7A 1U29A 2MBOA 3BJIA 2V76A 1K5GB 5BO4B 4G3XB 2RVBB 4IAPA 1WX8A 4FJVB 3PREA 4FADA 3DXCA 4BKTA 2KX3A 3VH3B 2FIFA 2ZCBA 2DZKA 3CIKA 2P8VA 1F9JA 2OTXA 3D8FA 1DYNA 2DZIA 4HK2A 2DZMA 3ZVRA 4DHZB 3RYTA 4XC2A 2Q13A 1WZ0A 2MSED 4PNKA 3ODWA 3DQVA 2D4QA 1PFJA 4BBNF 1M7RA 1HBKA 1ZSQA 3DBHI 4HJKA 1WM3A 3ZTCA 5C79A 3UQBA 5C23A 5J3YA 4FJYA 3S2AA 5KHQA 1GG3A 4FA6A 4II2B 2BGFA 4L6EA 4K7SA 5IAAC 5GMVA 4EEWA 2BF8B 1Q0WB 5HKHA 3A9KA 3L0WB 4XX5A 5DHFB 4W9KA 1FXTB 1UPQA 4GOCA 4X57B 4LCDE 1ZW7A 5J3QA 1XQQA 3QARA 2N9PC 3VTVA 1FGZA 2MBHA 3ML9A 1S3SG 3VAWA 2LOZA 1WGYA 4E74A 1WM2A 3OANA 2MBQA 4FLHA 2DKQA 2KXJA 2ZVOA 3VUWA 1EVHA 2IY1B 1IRSA 4ICVA 1MK7B 4WSFA 4DK5A 3AU4A 3EFUA 1V49A 2ZNVC 2HD5B 2IYDB 1WJ6A 2RR9A 4DDGD 2KFKB 1J8CA 3A8PA 2ZNVB 5HE1A 1X11A 3GOEA 1UGMA 3KRWA 2JXXA 4ZRKA 2BYFA 3WAPA 1WGUA 1MK9B 4CO7A 1Z87A 2G4DB 3O65B 3UIOB 1SE9A 1ZM0A 2D07B 3VOQA 3F5RA 2IO0B 4EFOA 2IY0B 3MDBC 4IM3A 1P98A 4HAWB 4Z2MB 2HTHB 1V61A 2LGYA 1IPGA 4HDOA 2KMCA 1LW3A 3JW0X 1U5DA 2OJRA 2DHKA 4HAZB 2ZPNA 4FJZA 1ZVRA 1WXMA 5LXIB 1WH3A 3A98B 3RULA 2VRWB 4GGQA 2IO2B 2DAFA 1EGXA 3HK0A 1UPRA 4KIKB 3VQIA 2LUEA 3G9WA 1N3HA 2H7EA 4HWIB 2MLBA 3D8DA 1P0RA 1MG8A 5LLIA 1V5MA 3A9JB 1I42A 2O6VD 2KFKA 3TVVA 1B55A 3KY9A 4HCPB 4WAAA 2I5CA 1C3TA 1HE8A 2KKCA 4GZUA 3TCAA 3NZUA 3HM3A 2PJHA 1BT0A 3TMPB 1FGYA 3M63B 1Z2MA 1KJTA 1ZKHA 1WF9A 2LD9A 3PSCA 4IWOA 4FN2A 2HTHA 2CB8A 4MJSB 2CY4A 2CS4A 2NBVB 3N32A 5DI9B 3WANA 3PLVA 3KVFB 2JP2A 2OQBA 2CHXA 1SGHA 3Q3FA 4NAWB 2PPHA 2K8CA 4IWQA 3P7ZA 4KIKA 2FIDA 3PVUA 1V2YA 3PSEB 4GMXB 5J18A 3UZTA 1WE7A 2YT1A 3CF6E 2LVOA 2LWPA 3P6AA 4WJPA 4GPTB 4GN1A 4WWOA 2AL6A 2EJ8A 3HM6X 4A3OA 1YX6B 4I6NB 1RRPB 5EDSA 2PE6B 1KLVA 3ZRCA 3V5WA 1OQYA 4A6HA 3P2BA 1ZGUB 1V5OA 1BTKA 4K7WA 4IG7B 4NPNA 3M3JA 2KX0A 4MJSA 3HQCA 2LRUA 5DCNA 4B95A 4URKA 5JHAA 3L17A 4C0AA 3QX1A 1E8WA 3AU5A 4MGZE 2CU1A 2OOBB 2DAJA 4W9EA 5CX3A 1E7UA 1V80A 3UF8A 1W1GA 2ZPYA 4NAWA 2L00B 2ZVNA 4KVGB 2W2WA 2WX0A 4PS8A 1LM8B 4MGKE 2DTCA 3KUZA 2M8SA 2KDFB 1WXSA 2CR5A 2RQ1A 2IBIB 4HB0B 2GBRA 1DBHA 5EFXA 1WGQA 5CHWA 4KV2A 2Z0OA 1WI1A 2LYDA 2GCLA 4TUUA 2JRIB 1V5UA 1GJZA 1WJNA 1OTRB 4Y94A 2ADZA 4HAYB 3U8ZA 2LGXA 2IYBA 5HE3A 2EKEC 1FB8A 1Y19B 3TO1A 1NBFC 2H7DA 2D10A 2CY5A 2XK5B 4W9IA 1E90A 4HAXB 1DDMA 3A1QB 2JVCA 3KUDB 1V89A 2YRYA 3SYXA 4NSWA 2RNRB 4K2OA 3WA0A 4DXAB 2D9ZA 4RMAA 3V62A 1WI0A 2KDBA 4GU2A 4MSMB 5CLLB 2NR2A 2IFSA 4PS3A 4FBJB 4F7ZA 1J0GA 3DBSA 2J7QB 4EMOA 4W9JA 2KQSA 4ANWA 3BY4B 5L83A 1FHOA 1MIZB 4GXBA 2JZ3B 5L95C 4DHJB 1E8ZA 3ZTDA 2LJ5A 5AZFA 1HB6A 3B0AA 3A33B 2YVCA 3TBLD 1OEYJ 2D9VA 2M17A 5C6RA 3EC8A 3APDA 1V9JA 2D9WA 4GSWA 2COPA 4MELA 5CTRC 2XK5A 2YF0A 2G35A 3KW5B 3UIPB 2RD0A 4EZKA 3A1QA 1UBIA 4ZYNA 4ZRIA 3ULCA 4DX90 3EECA 5D2MB 2KWUB 3RZFA 5E6NA 2DYMA 3GYPA 1WJ4A 2BKRB 1FAOA 2ROZB 2GJYA 2KLCA 1TJ6A 2C5LC 2BWES 3V61A 2BPSA 1I35A 2HRJA 4I6LB 2ABDA 5J17A 2Z0EB 2KJ6A 2JZZA 3KYCD 3D32A 1WG7A 3M62B 1V5TA 4KHAA 1EUVB 3HHMA 3TIXA 1MIXA 1NTYA 5D7GA 3B1LX 4PYUA 4A5KA 3PHXB 4RM9A 1E7VA 5JHBA 3UQAA 1UEFA 2NS5A 2KWVB 2HJ8A 2LVPA 4WJNA 1WZ3A 3PGEA 2DKPA 3SO6A 1JRUA 1OY2A 1XD3B 2Z0DB 2KCJA 1TBEA 5GOWB 2DHZA 1M7EA 1TXDA 3ML8A 4AWJA 2BWFA 4MSQB 2KMAA 4YONA 3DPDA 1W1HA 2D2QA 3V6CB 2K39A 4I6PA 1R4MI 4ANUA 3ML4A 2RLOA 4BKSA 4GMVA 3ZKJC 3GYOA 2ZZPB 2CHZA 2JRHA 4HB4B 3SHQA 4A3PA 3PVLA 1OEYA 2M0XA 4KSKC 1WGHA 1GNUA 3HIZA 2ROVA 4F7UP 4ZRJA 4FULA 3BINA 1EF5A 2FCMA 2DN6A 2PE9A 2AYOB 1WE6A 2XQNM 3ZVVA 1YD8U 1WFYA 2ZCCA 3CSFA 4AUQC 2L7RA 5HE2A 2L05A 2K00A 1X1GA 4PS7A 3QC8B 4MGYE 2L1CA 4ASWC 5JZEB 1EF1A 1SIFA 1NU2A 3ZO5B 1E8XA 1TGZB 2WH5A 5E6PA 2DFKA 4BBKA 3VXWA 3PRMB 3QK0A 1LFDA 2N4FA 5J3TA 3VH4B 2MFQA 4WJOA 1NDDA 4KHOA 3ZRFA 3K9OB 2FCQA 2N1WA 4IFSA 5JHHA 3VFKA 2FJLA 3SU8X 3A4SC 1WJUA 4K2PA 4MH0E 5G55A 4DWFA 5JLJB 1Q1OA 4IOYX 4NNJB 2AEHA 3CSTA 1YQBA 4GDLB 4WWPA 4MEMA 3RZWC 3VDZA 3N3KB 1X86A 1BTNA 1K8RB 4MM3A 3LJUX 1WJ1A 5C5BB 2D3GA 2RUKB 4AJYB 3PEGA 1Z5SB 1U4AA 2I5FA 3GZNI 1UBQA 3U30A 4HDQA 4AP4C 2EC1A 4IM2A 2V3SA 2B3AA 1NTVA 3PS6A 4ZDVA 1E8YA 2YS3A 3OAWA 2MWNB 3FEHA 1LXDA 4TV3A 4W9DA 2M14A 1I2HA 2R0DA 1AQCA 2L3ZA 1P9DU 1EAZA 4G11A 5AEKB 1WXAA 4W9LA 3FSSA 2MA9B 4KAXB 1L7YA 4HPLB 2N9XA 2KC2A 4HVBA 1X1MA 2FCNA 5DIFB 3RCZA 3L13A 4BOZB 3T06A 4GDLA 5AZHA 3OJ3A 4A6KA 1XX0A 1W1DA 3A9JA 4TKNA 1TTNA 3W1YA 2L8JA 1LB1A 3JYUA 1C1YB 4HAUB 5KQ1A 3DVGY 4K81A 4OVVA 1U27A 4IUMB 3PP2A 5C5BA 1AWEA 2YSZA 3C0RB 2C9WB 5J2RA 2E2XA 1A5RA 2G4SA 1P3QU 1VD2A 1WRDB 1ZC3B 4EJNA 2RGNB 4EKUA 2KVRA 3DDCB 2MWSB 2I1JA 2JUOA 3NSUA 4H8SA 3L08A 3VTWA 2KK8A 2I1KA 2NMBA 3ZNGC 2Z0QA 4NJ6A 2K2JA 3PRZA 3NY5A 3PT2B 3LJ3A 3UINB 3IVFA 2MBEA 2XEWA 1CMXB 1X05A 2JT4B 5IJMA 4N9F4 4GB9A 4CYEA 2MRPA 2JF5A 3TW1A 3KYDD 1ST7A 3ENEA 2KTRB 1UELA 4NQKE 3N30A 3KRXA 1UNPA 2KC1A 3OLMD 3DBLI 4G0NB 2DYNA 3A4RA 3QCAA 4J6IA 2N1VA 1PQSA 2VSZA 4WJ7A 3EPYA 4K17A 1WR6E 3NS8A 1XT9B 4CHKA 1ISNA 3K9PB 4XZ4A 3CXBB 2KDIA 5CLQB 4M8NA 2KJRA 2RGFA 3ZDMC 3QA8A 4DBBA 4Z2NA 2XBBC 2MCNB 2MX2A 5CHFA 1XODA 2KUPA 3KZ1A 3WIMA 4F1SA 1Y5OA 3B08A 2KOXA 3QHTA 5CHVC 4LDTD 4LJOB 2GBKA 2LOXA 2GOWA 2O2VB 3MHSD 3R7QA 4TQ0A 2EMSA 5DHAB 2DYQA 2KNBA 4MY6A 1GC7A 5C16A 3Q3JA 5FI0A 2O6VB 4KDLB 3IHPC 1WGGA 1XD4A 2Y8FA 1P3RA 1RAXA 1H8CA 5D3YA 2LI5A 1U5FA 2MKRA 4HB2B 5D3VA 3QWMA 3ECIA 3FP5A 2KTRA 2QKLA 3NHEB 4BOSC 1ZC4B 3SV1A 2KHWB 3ALBA 2MQJA 1WY8A 5G2NA 4M8MA 4XWXA 1IYFA 2WDTB 5LONB 2L76A 1DROA 2AL3A 3WYFB 2W2XD 3QAQA 2UVMA 2KJHB 2L2IA 2N23A 1J19A 3AJ4A 1KZ7A 1HB8A 3DXDA 2GBNA 4JGHB 1VCBA 2GCJA 5FR6A 1WGDA 3CMMB 1QC6A 1YJ1A 4GIVA 4PQ0A 2FJ9A 3JVZX 3EHVA 3IFWB 4W9HA 1DDWA 3H6NA 3ONSA 2IO1B 1KM7A 5JHGA 2NZ8B 1U2BA 1P1AA 4CHJA 4MDKE 3R3MA 2ASQA 1EO6A 2O2VA 3T8MA 2DENB 2R2QA 3TL5A 5DPRA 2AWTA 2O6VA 3M95A 5D3WA 2PEAA 4NQLB 5D27A 1QQGA 2DA0A 3L16A 3RD2A 1YIWA 4FHJA 2CKHB 2IO3B 4IM0A 2YS1A 4B6WA 2D11A 1OGWA 2C7MB 4IC7B 3AXCA 1R4NI 4G50A 2J0MA 2P0FA 2A5UA 2A4ZA 4RM8A 2G3QB 2J0JA 2CAYA 4WVFB 1PMSA 2MDXA 1WX7A 1OQNA 4E71A 2JWZA 5D94A 1E5WA 2NBUA 3ZUNA 4IW0A 2M38A 5D3XA 2RPQA 4A6FB 2DZJA 3VUYA 3KUCB 2KN5A 2M4NA 4EUTA 2V1YA 1WX9A 2MW5A 3IG3A 3FLVA 2MBBB 2GBMA 4B6HA 3A8QA 2C7NB 3H7PB 1G6JA 2VRRB 1PLSA 1P5TA 3V60A 3SNHA 3T9LA 1OMWA 1WXVA 3W1SC 2HE7A 2DHJA 2RSUA 4W9CA 2CQUA 2RSGA 1V81A 3PLUA 3ZDTA 2N0YA 3ZNID 1K5DB 2BKFA 2GS0A 2LKOA 1KZGA 4BKGA
chains in the Genus database with same CATH superfamily
2WDVB 2GMIC 4OVUA 1U5EA 5G5HA 4C4VB 2KANA 4D0NB 3U7ZA 4CHMA 2Y5BB 1ACAA 2BYVE 1RJ2A 1XCGA 3ZW3A 3QBVB 2QHOA 4USAA 4HAVB 2OJWA 3APFA 2WXFA 2QKMA 4HHVA 1Q67A 5D3IB 2MP2B 5EE1A 3APCA 1SEBD 3MJ5A 5KCVA 1VZ8A 2KLGA 3MC8A 4LJPB 4P16A 1WJMA 4K7UA 4NJ7A 2N9KA 1FRRA 1V6EA 1JDEA 3QIJA 3DWMA 1T0RC 2J59M 4N59A 3NZSA 1FOEA 1L4DB 1BAKA 1Q5WB 2LGSA 5LXHA 5HE0A 2JYTA 4WAFA 1T5XD 3HVDA 2NCNA 2DYBA 3Q3MC 2V4LA 3QQ8B 4IKGA 4BBNC 3DCGA 4HLEA 2RMMA 4KZCA 2ELAA 1D3ZA 4A6FA 2KO3A 1JALA 2M1MA 4AOFA 3Q6BA 2N7EA 2NVUI 3DCXA 2NTSA 4LDTB 2LFIA 3MPXA 3C8YA 2VKIA 1QILA 4W9FA 1UGJA 2L32A 1QLBB 3H9DA 4KHBB 3H7PA 2OEDA 2LUMA 4RGOS 1L2NA 2ZJDA 3RN9C 1TZ1A 2CJOA 1V97A 3IAS1 3PTFC 5TR5A 5FI1A 1ENFA 1NVID 2K6QA 2BT6A 4WWNA 2KGXB 2LG1A 2DX5B 1Y8RC 2JY6A 3W1SA 4XDDA 3PG7A 1XCQL 1NVLA 2DNFA 2LBBA 3HW2B 2WXLA 1UH6A 1MPHA 3JSVB 4JLCA 4KSLC 2KDMA 2YEPF 1VLBA 3BVGA 2Z0PA 2QC8A 5BYRA 2LRWA 2W2XC 4C4VA 3ZNHB 1FHXA 1V1PB 4PT5A 1TY0A 3ZNZB 2ACZB 2FCSA 4P1CC 3VIAA 2D9XA 3MJWA 3O96A 3NW8A 4TYZA 2EMTA 1QZEA 1FCCC 4B9KA 2FNJB 3OG5A 4DHJD 2WXPA 3DBRI 2MP2A 1M94A 1B9RA 4TQ1A 2R09A 2K8HA 3VVWB 1NTIA 2LXAA 4E3CA 1I7AA 2VH2A 4A55A 5C1ZA 1WMHB 1YX5B 1MJDA 1X1FA 3AM9A 3DVNV 4DX8A 1EM7A 1UZXB 5KHOA 1WVHA 4HATB 4ANXA 1TQZA 3P4QB 2K25A 1ZDVA 1J0WA 1T0YA 3AULA 1N5XA 3DWGC 4M0WB 5E6OA 2ON8A 3F0WA 4JL9A 3MTNB 4HPMB 5JH5C 3NOBA 4BKSD 1TKYA 1UNQA 1WSPA 2KMMA 1IP9A 2DYOA 2N7DA 4EZJA 5KQ4A 3ODOA 4HCNB 4KHBA 2RDGA 4F7HA 4OVZA 3SFDB 1KI1B 3I3TB 4DHZE 3C19A 1KBLA 4KZ0A 2CRFA 4HRSA 1H4RA 2LMCA 2D9YA 2K8BA 1WIAA 4DDID 2DHIA 2DX5A 3NRZA 2IGHA 2N9EB 3DXEA 2JWUA 1XKEA 2FAZA 1QF6A 1LQBA 2ZEQA 3WAOA 2PTLA 3Q8EA 3EA6A 2UZRA 1D5ZC 1U5GA 1XR0B 4XDCA 3JSVA 1Q10A 4EOYA 3P4PB 4HPPA 3OJ4B 4MK0A 4YL8A 2R2OA 3VHTC 2KWCA 4REZA 2WX1A 2AQ3B 1RFAA 4BVUC 2INNE 1V1PA 3ZJUA 1FHWA 1JW9D 3HSAA 1RFKA 1PYWD 1DDVA 4F7GA 3X0WA 3DVGX 1UNRA 2Z59B 1L4ZB 2COCA 2KTFA 3PZDA 2WLBA 2YT0A 4YSZB 1STEA 2WXIA 3PHWB 4BFRA 2G45B 3KH0A 1GC6A 5IA7A 4K1RB 1HTOA 3PPAA 2KDEB 1SHCA 2CODA 2P0DA 2TSSA 2CHWA 2UYZB 1L0XB 3V6EB 2ELBA 1WMHA 2YEPB 1JWBD 4IWPA 3L10B 1P6SA 1BWNA 2RDHA 3H1UA 5IO9A 5D6JB 4DXFA 4EZLA 2HJ1A 2WXQA 5DH9B 4M00A 3N7CA 1TS3A 2CU3A 2KD0A 3TEXA 3L54A 4L2YA 2L0TA 3U7DA 3T3OA 1JQ4A 2IZVB 4M0WA 4W9GA 3FM8C 1MAIA 1JWMD 1GAQB 2N0SB 1S1QB 4JK8A 2LASA 3DBHB 3TJPA 2Y7BA 4FHKA 5DPSA 2BYEA 5DPWA 4MGIE 4S17A 3NVYA 2EELA 1JWUD 3AE7B 4WQOB 4DBGA 1IUEA 2WWZA 2K2UA 5L81A 2X38A 1RYJA 1V86A 1IBXB 1HXYD 3D8EA 3KSYA 1BUIC 3SD5A 5BYQA 3QJZA 3SDLC 3U2SC 2YLMA 2RDBC 3MC9A 2J0KA 3R66C 2M0AA 2NPTB 2LXCA 2P0HA 3ABVB 2UZSA 4JIOU 4KDIC 3DOWA 3ZLZA 1SF0A 4EE2A 2JXTA 2WXKA 2K6DB 4ANVA 2KFJA 2BW2A 3IBEA 4R3DA 3MFGA 4GDKB 3ODXA 2L0FA 1P7EA 3AH7A 4P7IA 1RLFA 1NI2A 3TEZA 1GUAB 3WALA 3R7RA 2C60A 1WGRA 3NVZA 3ZIMA 1WR1A 2VZKD 3WAMA 1CJEA 4ICUA 2DX1A 2Z59A 4F8CB 1NI3A 3GP7A 1V5PA 4YTMB 4MT7A 1HQRD 4JQWC 2X18A 2UWQA 1TKGA 1RRBA 2COFA 2K49A 1C77A 1H10A 3TFMA 5AZGA 4ILHA 2LULA 3ULBA 1XLOA 2NBWB 4ITKA 3SUZA 3AI5A 1YN4A 3B9JA 2DLWA 2JPHA 3VTUA 2GBJA 3RUIB 3VUXA 2BCJA 3UGBB 1N5WA 2C7HA 3KWVA 4NZLB 3KLSX 2LZ6A 2QILA 2FUHB 4NY0A 5LOPB 2K1FA 2SEBD 2LGDA 1KOTA 2REXA 1MKEA 4II3B 3M1IB 1T0SC 3AN1A 4WJQA 4MT5A 3BVZA 4C00A 1WYWB 2WYQA 2PZ1A 1WGKA 1TYGB 3L4PA 3X23A 4A20A 3N9YC 5JP4A 2COAA 2KZRA 2CJNA 1IBXA 1UD7A 3PV1A 3LDZE 2LHEA 4KGTA 2K3UA 4PYZA 3PVWA 1TZOA 4HB3B 2NPTA 2W9NA 4LK0M 3BZDB 1AARA 2YS5A 4YXDB 3A9KB 2FDQA 2WDQB 3BWUD 5DPTA 2LVQA 3H8HA 3QWZB 1UWXA 4L1RA 3H7SA 3FVCA 4AJWA 3PRPB 1V88A 3RT3B 3RPFC 2Y8GA 4GDKA 3MHZA 2QDFA 1YJJA 3DVNU 2GUMA 3RCPA 4HXDA 4ZHPA 2KQ7A 1U29A 2MBOA 2ONQA 2QEJC 4JKFA 4HJGE 3AE4B 3BJIA 1ZPSA 3A58A 2DIKA 2V76A 2GRIA 2MJ3A 2Y5CA 1K5GB 5BO4B 3DHIC 4G3XB 2D3BA 2RVBB 1VBHA 4IAPA 1WX8A 4FJVB 3PREA 2UU7A 1YN5A 3DXCA 4FADA 4BKTA 2KX3A 3VH3B 1ET9A 2FIFA 2V9HA 2ZCBA 3EUB2 2DZKA 4YTNB 3RNEC 3CIKA 3HRDD 2P8VA 1F9JA 2OTXA 3D8FA 2BVCA 1DYNA 2DZIA 4HK2A 2DZMA 3Q8CA 3ZVRA 4DHZB 4QJ4B 3RYTA 4XC2A 2Q13A 4JK7A 1WZ0A 4AS1A 3DHGC 2MSED 4PNKA 3ODWA 3DQVA 2D4QA 1PFJA 2WU5B 1NYRA 4BBNF 1M7RA 2ZKMX 3BYYB 1HBKA 1ZSQA 3DBHI 3TEYA 4HJKA 1WM3A 4CQNA 1Y56A 3CWIA 2BB5A 3B77A 3ZTCA 5C79A 5H8YE 1TS5A 3UQBA 1GB4A 5C23A 5J3YA 4FJYA 3S2AA 5KHQA 1GG3A 1CK1A 4FA6A 3RMKC 1VJKA 3U52E 4II2B 2BGFA 1ZYIA 4L6EA 4K7SA 2W82A 5IAAC 5GMVA 4EEWA 2BF8B 1Q0WB 4CSQA 5HKHA 3A9KA 1JWAD 4QXAB 3L0WB 1SSNA 4XX5A 5DHFB 4W9KA 1FXTB 1UPQA 4OSNA 4GOCA 4X57B 4LCDE 1ZW7A 5J3QA 1XQQA 3QARA 2N9PC 3B2GA 4ZHOA 5JXVA 3VTVA 5I2SA 3SBGA 1FGZA 2MBHA 3ML9A 1S3SG 1AW7A 1UNSA 1XCTL 3VAWA 2LOZA 1WGYA 4E74A 1WM2A 2PVOD 3ZXVA 3OANA 5BYSA 1N62A 2MBQA 1WRIA 1D6EC 4FLHA 2DKQA 2KXJA 1MI1A 4YTPB 2ZVOA 2KN4A 1A70A 3VUWA 1EVHA 4RCOA 4RGNA 2IY1B 1IRSA 4ICVA 1MK7B 1PGAA 5BMIA 3OHMB 1FFUA 4LLGM 4WSFA 4M01A 4DK5A 1JMLA 3AU4A 3EFUA 1V49A 2ZNVC 2HD5B 2IYDB 1WJ6A 2RR9A 4DDGD 2V3NA 2KFKB 1J8CA 1FD6A 2SAKA 1F2RI 3A8PA 2ZNVB 3NVWA 5HE1A 3SEBA 1X11A 3GOEA 1UGMA 2G1EA 3GE8C 4C56C 3KRWA 2N7JA 2JXXA 4US9A 3FILB 4ZRKA 2BYFA 3WAPA 2IJ0A 1WGUA 4BZAA 2IGDA 1HZ5A 3P4RB 1MK9B 3CIRB 4CO7A 3Q14C 1Z87A 1EWYC 4GLSC 4M02A 4OW0A 2G4DB 3O65B 3UIOB 1FCLA 1SE9A 1ZM0A 2KQ4X 2D07B 3LXFA 3VOQA 3VR8B 4C7ZA 3F5RA 2IO0B 4EFOA 2IY0B 3MDBC 4IM3A 1P98A 4HAWB 4Z2MB 1VR9A 2HTHB 2VZKB 1V61A 2LGYA 1IPGA 4HDOA 2KMCA 1LW3A 1YNTE 3JW0X 3BIID 1U5DA 2OJRA 3B2FA 2DHKA 4HAZB 3AE5B 2ZPNA 4FJZA 1C4PA 1ZVRA 4LNNA 1WXMA 5LXIB 2IDYA 1WH3A 3A98B 3RULA 2VRWB 4GGQA 2IO2B 2DAFA 1D5XC 4KGRA 1EGXA 2FJUB 1UPRA 3HK0A 4DQOC 4KIKB 3VQIA 2LUEA 3G9WA 1N3HA 2K5PA 2H7EA 5LNK1 4HWIB 2MLBA 3D8DA 4B0EA 1P0RA 5HI1A 1SE3A 2DBYA 4HKZE 4D2KA 1MG8A 3RNBC 2H89B 2WXNA 5LLIA 1XO3A 1V5MA 1SJHD 2KR0A 3A9JB 3ZXRA 1I42A 2O6VD 4LTUA 2KFKA 3VR9B 3TVVA 1B55A 1ZOYB 2JU6X 3KY9A 1MHHE 3P63A 4HCPB 4WAAA 2I5CA 1ZE3D 1C3TA 1HE8A 2KKCA 4GZUA 5G5GA 3P1MA 3TCAA 4RFBA 3NZUA 3HM3A 2PJHA 1BT0A 3TMPB 1FGYA 3M63B 1Z2MA 3R8BA 1KJTA 4WIPA 1ZKHA 1WF9A 2WXOA 2LD9A 1T3QA 3PSCA 4IWOA 4FN2A 1C4CA 3E56A 2WGSA 4C7YA 2HTHA 2CB8A 2GLSA 4MJSB 2K22A 4QJ5B 2CY4A 2CS4A 2NBVB 3N32A 5EE9A 5DI9B 1ZUD2 3WANA 3PLVA 1FRDA 3KVFB 3BVMA 2JP2A 2OQBA 1DOXA 2R2YA 3Q8AA 2CHXA 1SGHA 2WXJA 5IKCM 2WXRA 1I4GA 2KACA 3Q3FA 3SR6A 2Z8LA 3ZGZA 4NAWB 2NMQA 2PPHA 2K8CA 4ACFA 2YT2A 4S0RA 3RNCC 4IWQA 3P7ZA 4KIKA 4RF0A 2FIDA 3UI3A 3PVUA 4OZAA 1V2YA 3WCQA 3PSEB 3AE6B 1I4XA 1WXQA 4GMXB 5J18A 3UZTA 1PUTA 2BQQA 1WE7A 3NUHB 2YT1A 3CF6E 5FKAC 2LVOA 2LWPA 2HDEA 1DYQA 3P6AA 4WJPA 2L83A 4ARIA 2V3PA 4GPTB 1LO5D 4GN1A 3VRBB 1C78A 4WWOA 2AL6A 2EJ8A 3BK1A 3HM6X 4A3OA 2PLPA 4K3CA 1YX6B 4I6NB 1V8CA 1RRPB 5EDSA 2PE6B 1KLVA 3ZRCA 1I4RA 3V5WA 1OQYA 4A6HA 1FNUA 1SJED 3P2BA 1T77A 3HVZA 1ZGUB 1V5OA 4UDUC 1BTKA 4K7WA 4IG7B 3NZ3A 3M3JA 2KX0A 4NPNA 4OZCA 3AE1B 4JE3B 2WXGA 3HQCA 3I5JC 4MJSA 1FNVA 2WP9B 2LRUA 2NBVA 5DCNA 4B95A 4URKA 1IGCA 5JHAA 2ZW0A 2W54A 3L17A 4JKEA 4C0AA 3QX1A 1E8WA 2WQYB 3AU5A 1AN8A 1WWTA 4MGZE 2CU1A 2OOBB 2DAJA 4W9EA 1QQRA 5CX3A 1E7UA 1V80A 3UF8A 1W1GA 2ZPYA 4NAWA 2L52A 2L00B 2ZVNA 4KVGB 2W2WA 3LB8C 2Z13A 2EKIA 2WX0A 4PS8A 1LM8B 4MGKE 2DTCA 1E0ZA 3KUZA 2M8SA 2KDFB 1KTKA 1WXSA 2CR5A 1GOZA 3Q8FA 3AMZA 2RQ1A 2IBIB 2BTEA 2INDC 4HB0B 2GBRA 1DBHA 5EFXA 4JKAA 1QOFA 4A8XC 1WGQA 4KX6B 5CHWA 4KV2A 1I7HA 2Z0OA 1WI1A 2LYDA 2HTME 2GCLA 4TUUA 1MHXA 2JRIB 1V5UA 1GJZA 1WJNA 4QAYA 1OTRB 4Y94A 4N6EB 2ADZA 1L0VB 4HAYB 4K3BA 3U8ZA 3KWLA 2LGXA 2IYBA 5HE3A 2EKEC 4O1NA 2BB6A 1MPEA 1FB8A 1Y19B 3TO1A 1KLUD 2R82A 1NBFC 2H7DA 1F52A 2D10A 2CY5A 2XK5B 3HUIA 4AQ7A 4W9IA 1E90A 4HAXB 1DDMA 3A1QB 3RNFC 1HTQA 1J7CA 2JVCA 3KUDB 1V89A 2YRYA 3SYXA 2WXMA 4NSWA 1F2RC 2RNRB 4K2OA 1OQQA 1L6UA 3WA0A 4RNAA 4US8A 4DXAB 2D9ZA 4RMAA 3V62A 1WI0A 5HFYA 2KDBA 4GU2A 4LNKA 4MSMB 1SBBB 5CLLB 4D6WA 2NR2A 1XXGA 2IFSA 1ZP0B 2ICIA 4PS3A 4FBJB 4F7ZA 1J0GA 3N1YC 3DBSA 2J7QB 4EMOA 3ZJTA 4N58A 3E9PA 3IT4B 3ZYYX 1D4BA 4L1BA 4W9JA 5IP4D 1AYFA 1E7PB 1NEKB 2KQSA 4ANWA 2KWDA 3T3NA 3PZ7A 2B76B 2MHJA 3BY4B 3AEDB 5L83A 1FHOA 1MIZB 4GXBA 2JZ3B 5L95C 4DHJB 1E8ZA 3ZTDA 2LJ5A 1KC7A 3Q2AC 1HB6A 1I4HA 5AZFA 3U4EG 3B0AA 3A33B 4NAMA 2YVCA 2QCZA 3TBLD 2E6XA 2WDRB 1OEYJ 2AX5A 2D9VA 2QMTA 2M17A 2BS2B 5C6RA 3O13A 3RNAC 5E6JA 2BBCA 3EC8A 1FMAD 3APDA 1SE4A 1V9JA 2D9WA 4GSWA 2NTTA 2COPA 2JSVX 3AE3B 4MELA 5CTRC 3AEFB 2XK5A 2YF0A 2G35A 3KW5B 3UIPB 2RD0A 4EZKA 1KLGD 3A1QA 4HROA 1UBIA 4ZYNA 4ZRIA 3ULCA 4DX90 3EECA 3FC4A 2K9XA 4LNFA 5D2MB 3E9OA 2K0PA 4XWWA 2KWUB 3RZFA 5E6NA 2DYMA 3GYPA 1WJ4A 2BKRB 1FAOA 5FK9C 2ROZB 4LNIA 2GJYA 2KLCA 1VDVA 1TJ6A 2C5LC 2BWES 3V61A 3ENBA 2BPSA 1I35A 2HRJA 4I6LB 2ABDA 4P1BC 5J17A 2Z0EB 5BMHA 2KJ6A 2JZZA 3KYCD 3D32A 1WG7A 3M62B 1V5TA 4KHAA 1EUVB 1P7FA 3HHMA 3TIXA 1PGXA 1MIXA 1NTYA 2DLBA 5D7GA 3B1LX 3R2IA 4PYUA 2BYTA 2FE8A 4A5KA 3PHXB 4RM9A 1E7VA 5JHBA 3UQAA 1UEFA 5HG2A 2X8XX 2NS5A 2Q5WD 2KWVB 4JWSC 2HJ8A 3BYTB 1FXIA 1GB1A 2LVPA 4WJNA 1WZ3A 3PGEA 4XYCA 2DKPA 3SO6A 1JRUA 1OY2A 2JYEA 1UWMA 1XD3B 2IPKD 1HEZE 2Z0DB 2INCC 2KCJA 2WU2B 1TBEA 5GOWB 2DHZA 2R61A 1M7EA 1E9MA 1TXDA 3MP9A 3ML8A 1YJIA 2KAJA 4AWJA 5EE3A 2BWFA 5IOIA 4MSQB 1UF0A 4HSIA 2KMAA 4YONA 3DPDA 1W1HA 2D2QA 3V6CB 4JKGB 2K39A 4I6PA 3N1XC 3E9SA 1R4MI 4ANUA 4MH8A 3ML4A 2RLOA 4BKSA 4GMVA 3ZKJC 4ZRPA 3GYOA 2ZZPB 4LNOA 2CHZA 2JRHA 3Q8BA 4HB4B 3SHQA 4A3PA 3PVLA 4TSSA 1VBGA 1OEYA 2M0XA 4KGSA 4KSKC 1QKZA 5JVLA 1WGHA 1GNUA 4MM3B 2PKOA 4NJCA 3HIZA 2W55A 1EU4A 2ROVA 4F7UP 4ZRJA 4ILGB 1OFFA 2W3RA 4BAXA 4FULA 3BINA 3GE3C 1EF5A 2W3SA 3AE2B 1YN3A 2FCMA 2DN6A 4FXCA 2PE9A 2V4IB 2AYOB 1WE6A 3AB5A 2XQNM 3ZVVA 1YD8U 1WFYA 5I2MA 3SBTA 2ZCCA 3CSFA 5BMGA 4AUQC 5I4DA 2L7RA 5HE2A 2L05A 2K00A 1EU3A 3KQ4A 1X1GA 4PS7A 3QC8B 4MGYE 2L1CA 4ASWC 1FM0D 5JZEB 1EF1A 1SIFA 1NU2A 3J9CA 3ZO5B 4JKDA 1GPXA 1E8XA 1TGZB 2WH5A 2V0GA 5E6PA 1DOIA 2DFKA 2OHFA 2PMVA 4BBKA 3VXWA 1RM6C 3PRMB 3QK0A 1FEHA 1LFDA 3TUOA 1JWSD 2N4FA 3AEAB 4WQMA 5J3TA 3VH4B 5LG4B 2MFQA 4WJOA 1NDDA 4KHOA 1SB3C 3ZRFA 3K9OB 1TY2A 2FCQA 4XGAB 1JCKB 3NWDA 1PGBA 2N1WA 4IFSA 2KVZA 3NG0A 5JHHA 3VFKA 2FJLA 3SU8X 2J53A 3A4SC 1XLPA 1WJUA 4K2PA 4MH0E 5G55A 4DWFA 1F77A 4JKGA 5JLJB 1MG4A 1Q1OA 5GXGB 1K51A 4IOYX 4NNJB 2AEHA 3CSTA 1YQBA 3Q3OC 4GDLB 4WWPA 1VZ6A 4MEMA 3RZWC 4JK9A 3VDZA 5H92C 3OWEB 4KKJA 3N3KB 1X86A 4QJ3B 1RWSA 1C79A 2J52A 3DBLB 3VRAB 3V3XA 1BTNA 1K8RB 2MEKA 4MM3A 3LJUX 1WJ1A 5C3JB 5C5BB 4IDIA 2D3GA 1BXTA 2JQRB 3I9V1 2RUKB 4AJYB 3PEGA 5FR3A 1Z5SB 1U4AA 3FILA 2Y5PA 4B0MA 2I5FA 3GZNI 1UBQA 1I4QA 2XNAC 1E6EB 1FNWA 3W9CB 3U30A 1ZXIA 4HDQA 2AQ2B 2JZPA 4AP4C 2EC1A 4IM2A 3PZ8A 2V3SA 4TMAB 2FBWB 2IGGA 1UUPA 4OHJA 2B3AA 1NTVA 1FPYA 2QSDA 3PS6A 1L6VA 1QOAA 1YQ3B 4ZDVA 1E8YA 1SIJA 4DIXA 2YS3A 1VZ7A 3W2DA 3OAWA 2MWNB 3FEHA 1LXDA 4TV3A 4W9DA 1YOVB 2M14A 1T0QC 1PDXA 5EE0A 2J42A 2M19A 3IAM1 3AECB 1I2HA 2R0DA 3FAHA 1AQCA 2L3ZA 1P9DU 4RF1A 5TSSA 2LGIA 1EAZA 1ESFA 4G11A 1TJEA 5AEKB 1YQ4B 1WXAA 3PO0A 4W9LA 1C76A 2QIEB 3FSSA 1DIKA 2MA9B 4KAXB 1L7YA 1BMLC 4HPLB 4ZYSA 4J3OD 2N9XA 1NYQA 1IGDA 2KC2A 4A9AA 1TS4A 4HVBA 1X1MA 2FCNA 5DIFB 3RCZA 3L13A 4KKIA 4BOZB 3T06A 4OT1A 4GDLA 5AUKA 4HEA1 2LEKA 5AZHA 4C80A 3OJ3A 4A6KA 1XX0A 2M56B 1W1DA 3A9JA 4TKNA 1TTNA 2H88B 2L8JA 3W1YA 1LB1A 1JRPA 2J4XA 1C1YB 3JYUA 4HAUB 1ZXHA 1C9FA 1K50A 3RFZB 4ARCA 5KQ1A 3DVGY 4K81A 4Q2JA 4OVVA 1U27A 4IUMB 3PP2A 4IOIE 5C5BA 1J7BA 1AWEA 2YSZA 1NENB 2INPE 3C0RB 3ZQ4A 2C9WB 5J2RA 2RRFA 4OZBA 1XLQA 4WWMA 2E2XA 1A5RA 2G4SA 1P3QU 1VD2A 4JWUC 3RNGC 1WRDB 1ZC3B 1KH0A 4EJNA 2RGNB 3N20C 4EKUA 2KVRA 3AEEB 3DDCB 1FXAA 2MWSB 3TEWA 1MI0A 2WHIA 2I1JA 2KIEA 1M4VA 3W5UB 1DGJA 4ZRQA 3Q69A 2JUOA 3NSUA 4H8SA 3L08A 3DHHC 1KFYB 4WH4A 3VTWA 2KK8A 2I1KA 1QT9A 2NMBA 1I4PA 3ZNGC 2Z0QA 4NJ6A 2GI9A 2K2JA 3PRZA 2FUG1 3NY5A 3PT2B 1FFVA 3LJ3A 1WYGA 2WNMA 3IVFA 3UINB 3ZJVA 2MBEA 3E9LA 2XEWA 2ZW1A 1N60A 1CMXB 3Q3NC 1TT5B 1X05A 1TKEA 4XWTA 2JT4B 5IJMA 4N9F4 4GB9A 4CYEA 2MRPA 3AEBB 4DXGA 2JF5A 3TW1A 3KYDD 4ZOHC 1ST7A 1F0ZA 2PVGC 5T8IA 5M4YB 3ENEA 4XE0A 4H2AA 2KTRB 1UELA 1FIQA 1L5PA 4NQKE 5IN7A 1R4NB 4GNKB 3N30A 4JKBA 3KRXA 1UNPA 2KC1A 2KUQA 1K53A 2L1AA 2GB1A 3EFCA 4A90A 5C2TB 3OLMD 1XF5L 3DBLI 4G0NB 2KYWA 2DYNA 3A4RA 3TSSA 3QCAA 4J6IA 3BK2A 2N1VA 1PQSA 2VSZA 1LGRA 2Z4DA 3NWAA 2N9LA 2D3CA 4WJ7A 1QOGA 3EPYA 2DWQA 4K17A 1WR6E 3NS8A 1R4MB 1XT9B 1V1OA 4CHKA 1ISNA 3K9PB 4XZ4A 2LHDA 3CXBB 2KDIA 5CLQB 4M8NA 1MFWA 2KJRA 2VH1A 1FO4A 2JX5A 2RPVA 2RGFA 2G9HD 3ZDMC 1EWCA 3QA8A 1KF6B 4DBBA 4Z2NA 2XBBC 2MCNB 2MX2A 2Y3AA 5CHFA 1XODA 2KUPA 3E66A 3KZ1A 3WIMA 4F1SA 3AE8B 1Y5OA 3B08A 2KOXA 3QHTA 2MJDA 4LDTD 5CHVC 4LJOB 3AE9B 2GBKA 3P4SB 2LOXA 2GOWA 2O2VB 3MHSD 3R7QA 2BS4B 4JX1C 3SFEB 4TQ0A 2EMSA 5DHAB 2DYQA 2KNBA 4MY6A 1K52A 2KIGA 4RGTA 1KRHA 1GC7A 5C16A 1D5MC 5FI0A 3Q3JA 2D5GA 2O6VB 4KDLB 3N1ZC 3IHPC 1WGGA 3URYA 1XD4A 2Y8FA 1P3RA 1RAXA 1H8CA 5D3YA 2LI5A 2MJEA 1U5FA 2MKRA 4HB2B 1PFDA 5D3VA 1SXTA 1HA5A 3QWMA 3ECIA 3NJTA 1N63A 5MPOA 1DOYA 3FP5A 5IRSA 2KTRA 2QKLA 3EGRA 3NHEB 4BOSC 1ZDXA 2X0SA 4MACA 1ZC4B 1SE2A 3SV1A 4JPSA 2KHWB 3ALBA 2MQJA 1WY8A 5G2NA 4M8MA 4YT0B 4XWXA 3FKYA 5HHDG 2WDTB 1IYFA 5LONB 2L76A 1DROA 2AL3A 1YMHE 3WYFB 5AUIA 4L23A 2W2XD 3QAQA 2UVMA 2KJHB 1GGOA 2L2IA 2N23A 3R2TA 2LJIA 1J19A 1AWDA 3AJ4A 1KZ7A 1HB8A 1T6BX 3DXDA 1N6ZA 2GBNA 4JGHB 1VCBA 3IXSA 2I38A 1OQRA 2GCJA 2KT7A 3P42A 5FR6A 1WGDA 3NWFA 3CMMB 1E10A 1ROEA 4RH6A 1TS2A 1QC6A 3W5VB 1YJ1A 1CQVA 4JKCA 4GIVA 4PQ0A 2FJ9A 3JVZX 3EHVA 3IFWB 4W9HA 1DDWA 1QOBA 3H6NA 3ONSA 2IO1B 1KM7A 4JKHA 5JHGA 2NZ8B 1U2BA 1P1AA 4CHJA 3IT6B 4MDKE 3R3MA 2ASQA 1EO6A 2O2VA 3I57A 3T8MA 3GZNB 5D3DA 1HZ6A 2DENB 3I63C 2R2QA 2PW9A 1MVKA 3TL5A 2K8EA 2QJLA 5DPRA 2AWTA 1TIFA 2O6VA 2XN9C 3M95A 1ET6A 5D3WA 2PEAA 4NQLB 2PIAA 5D27A 1QQGA 2DA0A 3L16A 1B1ZA 3RD2A 1YIWA 3GS2A 4FHJA 2CKHB 4P6VF 2IO3B 4IM0A 2YS1A 3V05A 4B6WA 3DBRB 2D11A 1OGWA 2C7MB 1L0YB 4IC7B 2D3AA 3AXCA 1C4AA 1R4NI 2WS3B 4G50A 2J0MA 2P0FA 2A5UA 2A4ZA 3GB1A 4RM8A 3ETRA 2G3QB 2J0JA 4YSYB 2CAYA 4WVFB 1PMSA 2AQ1B 2MDXA 1WX7A 1OQNA 4RGMA 2JWZA 4E71A 1J7AA 4YWGG 3NVVA 1N61A 5D94A 2WXHA 1E5WA 2NBUA 3ZUNA 3LYYA 4IW0A 4YSXB 2M38A 5D3XA 2Z14A 2RPQA 4ILJA 4A6FB 2DZJA 4WURA 3MC0B 1CZPA 4GOUA 3VUYA 4PK1A 3HIEA 3KUCB 2KN5A 1XLNA 2M4NA 4EUTA 3NS1A 2I2YA 1XEEA 2V1YA 1WX9A 2MW5A 3IG3A 3FLVA 2MBBB 2GBMA 4B6HA 4A6QA 3A8QA 2C7NB 3H7PB 1G6JA 1VRAB 1F1HA 2VRRB 1PLSA 1P5TA 3V60A 3U12A 2MH7A 3SNHA 3T9LA 1OMWA 1WXVA 3W1SC 2HE7A 2E3TA 1R7SA 2DHJA 2RSUA 4W9CA 2CQUA 2RSGA 1V81A 3PLUA 3ZDTA 1JROA 2N0YA 3ZNID 3AEGB 1K5DB 2BKFA 2BS3B 2GS0A 3RI7C 2LKOA 4HKQA 3AV8A 1KZGA 1ACCA 4BKGA
chains in the Genus database with same CATH topology
2GMIC 4OVUA 1U5EA 2KANA 4D0NB 4CHMA 2Y5BB 1ACAA 2BYVE 1RJ2A 1XCGA 3ZW3A 3QBVB 2QHOA 4HAVB 3APFA 2QKMA 4HHVA 1Q67A 2MP2B 3APCA 5KCVA 2KLGA 4LJPB 1WJMA 4K7UA 4NJ7A 1V6EA 1JDEA 3QIJA 2J59M 3NZSA 1FOEA 1BAKA 1Q5WB 5LXHA 5HE0A 2NCNA 2DYBA 4BBNC 2V4LA 3QQ8B 3DCGA 4HLEA 4KZCA 2ELAA 1D3ZA 4A6FA 2KO3A 2M1MA 4AOFA 2N7EA 2NVUI 4LDTB 3MPXA 2VKIA 4W9FA 3H9DA 4KHBB 3H7PA 1L2NA 2ZJDA 1TZ1A 3PTFC 5TR5A 5FI1A 2K6QA 4WWNA 2KGXB 2LG1A 2DX5B 1Y8RC 2JY6A 3W1SA 3PG7A 1NVLA 2LBBA 3HW2B 1UH6A 1MPHA 3JSVB 4JLCA 4KSLC 2Z0PA 2LRWA 2W2XC 3ZNHB 1FHXA 3ZNZB 2FCSA 3VIAA 2D9XA 3MJWA 3O96A 4TYZA 2EMTA 1QZEA 4B9KA 2FNJB 4DHJD 3DBRI 2MP2A 1M94A 4TQ1A 2R09A 2K8HA 3VVWB 1NTIA 2LXAA 4E3CA 1I7AA 5C1ZA 1WMHB 1YX5B 1X1FA 3DVNV 4DX8A 1UZXB 5KHOA 1WVHA 4HATB 4ANXA 1TQZA 2K25A 1J0WA 1T0YA 3AULA 4M0WB 5E6OA 3F0WA 4JL9A 3MTNB 4HPMB 5JH5C 3NOBA 4BKSD 1UNQA 1IP9A 2DYOA 2N7DA 4EZJA 5KQ4A 3ODOA 4HCNB 4F7HA 1KI1B 3I3TB 4DHZE 1KBLA 4KZ0A 2CRFA 1H4RA 2D9YA 2K8BA 1WIAA 4DDID 2DHIA 2DX5A 2N9EB 3DXEA 1XKEA 2FAZA 1LQBA 2ZEQA 3WAOA 2UZRA 1U5GA 1XR0B 3JSVA 4EOYA 3OJ4B 4MK0A 4YL8A 2R2OA 3VHTC 2KWCA 2WX1A 1RFAA 4BVUC 1FHWA 1DDVA 4F7GA 3X0WA 3DVGX 1UNRA 2Z59B 2KTFA 2COCA 3PZDA 2YT0A 3PHWB 4BFRA 2G45B 3KH0A 1GC6A 5IA7A 4K1RB 3PPAA 2KDEB 1SHCA 2CODA 2P0DA 2CHWA 2UYZB 3V6EB 2ELBA 1WMHA 4IWPA 3L10B 1P6SA 1BWNA 3H1UA 5D6JB 4EZLA 5DH9B 3N7CA 2KD0A 3L54A 2L0TA 3U7DA 2IZVB 4W9GA 3FM8C 1MAIA 1S1QB 4JK8A 2LASA 3TJPA 2Y7BA 4FHKA 5DPSA 2BYEA 5DPWA 4MGIE 4WQOB 4DBGA 2WWZA 2K2UA 5L81A 1V86A 3D8EA 3KSYA 3SD5A 3QJZA 3SDLC 2YLMA 2J0KA 3R66C 2NPTB 2LXCA 2P0HA 2UZSA 4JIOU 4KDIC 3DOWA 3ZLZA 2K6DB 4ANVA 2KFJA 3IBEA 4GDKB 3ODXA 2L0FA 4P7IA 1RLFA 1NI2A 1GUAB 3WALA 3R7RA 2C60A 1WGRA 3ZIMA 1WR1A 3WAMA 4ICUA 2DX1A 4F8CB 1V5PA 4MT7A 4JQWC 2X18A 2UWQA 1RRBA 2COFA 1H10A 3TFMA 5AZGA 4ILHA 2LULA 3ULBA 2NBWB 3SUZA 3AI5A 2DLWA 2JPHA 3VTUA 2GBJA 3RUIB 3VUXA 2BCJA 3UGBB 2C7HA 2LZ6A 2FUHB 4NY0A 5LOPB 2K1FA 1KOTA 2LGDA 2REXA 1MKEA 4II3B 3M1IB 4WJQA 1WYWB 2WYQA 2PZ1A 3X23A 4A20A 5JP4A 2COAA 2KZRA 1UD7A 3PV1A 3LDZE 4PYZA 3PVWA 4HB3B 2NPTA 2W9NA 1AARA 2YS5A 3A9KB 2FDQA 5DPTA 2LVQA 3QWZB 3H7SA 4AJWA 3PRPB 1V88A 3RT3B 2Y8GA 4GDKA 3DVNU 3RCPA 4HXDA 2KQ7A 1U29A 2MBOA 4JKFA 3BJIA 2DIKA 2V76A 1K5GB 5BO4B 4G3XB 2RVBB 1VBHA 4IAPA 1WX8A 4FJVB 3PREA 4FADA 3DXCA 4BKTA 2KX3A 3VH3B 2FIFA 2ZCBA 2DZKA 3CIKA 2P8VA 1F9JA 2OTXA 3D8FA 1DYNA 2DZIA 4HK2A 2DZMA 3ZVRA 4DHZB 3RYTA 4XC2A 2Q13A 4JK7A 1WZ0A 2MSED 4PNKA 3ODWA 3DQVA 2D4QA 1PFJA 4BBNF 1M7RA 1HBKA 1ZSQA 3DBHI 4HJKA 1WM3A 3ZTCA 5C79A 3UQBA 5C23A 5J3YA 4FJYA 3S2AA 5KHQA 1GG3A 4FA6A 4II2B 2BGFA 4L6EA 4K7SA 5IAAC 5GMVA 4EEWA 2BF8B 1Q0WB 5HKHA 3A9KA 3L0WB 4XX5A 5DHFB 4W9KA 1FXTB 1UPQA 4GOCA 4X57B 4LCDE 1ZW7A 5J3QA 1XQQA 3QARA 2N9PC 3VTVA 3SBGA 1FGZA 2MBHA 3ML9A 1S3SG 3VAWA 2LOZA 1WGYA 4E74A 1WM2A 3OANA 2MBQA 4FLHA 2DKQA 2KXJA 2ZVOA 3VUWA 1EVHA 2IY1B 1IRSA 4ICVA 1MK7B 4WSFA 4DK5A 3AU4A 3EFUA 1V49A 2ZNVC 2HD5B 2IYDB 1WJ6A 2RR9A 4DDGD 2KFKB 1J8CA 3A8PA 2ZNVB 5HE1A 1X11A 3GOEA 1UGMA 3KRWA 2JXXA 4ZRKA 2BYFA 3WAPA 1WGUA 1MK9B 4CO7A 1Z87A 2G4DB 3O65B 3UIOB 1SE9A 1ZM0A 2D07B 3VOQA 3F5RA 2IO0B 4EFOA 2IY0B 3MDBC 4IM3A 1P98A 4HAWB 4Z2MB 2HTHB 1V61A 2LGYA 1IPGA 4HDOA 2KMCA 1LW3A 3JW0X 1U5DA 2OJRA 2DHKA 4HAZB 2ZPNA 4FJZA 1ZVRA 1WXMA 5LXIB 1WH3A 3A98B 3RULA 2VRWB 4GGQA 2IO2B 2DAFA 1EGXA 3HK0A 1UPRA 4KIKB 3VQIA 2LUEA 3G9WA 1N3HA 2H7EA 4HWIB 2MLBA 3D8DA 1P0RA 1MG8A 5LLIA 1V5MA 3A9JB 1I42A 2O6VD 2KFKA 3TVVA 1B55A 3KY9A 4HCPB 4WAAA 2I5CA 1C3TA 1HE8A 2KKCA 4GZUA 3TCAA 3NZUA 3HM3A 2PJHA 1BT0A 3TMPB 1FGYA 3M63B 1Z2MA 1KJTA 1ZKHA 1WF9A 2LD9A 3PSCA 4IWOA 4FN2A 2HTHA 2CB8A 4MJSB 2CY4A 2CS4A 2NBVB 3N32A 5DI9B 3WANA 3PLVA 3KVFB 2JP2A 2OQBA 2CHXA 1SGHA 3Q3FA 4NAWB 2PPHA 2K8CA 4IWQA 3P7ZA 4KIKA 2FIDA 3PVUA 1V2YA 3PSEB 4GMXB 5J18A 3UZTA 1WE7A 2YT1A 3CF6E 2LVOA 2LWPA 3P6AA 4WJPA 4GPTB 4GN1A 4WWOA 2AL6A 2EJ8A 3HM6X 4A3OA 1YX6B 4I6NB 1RRPB 5EDSA 2PE6B 1KLVA 3ZRCA 3V5WA 1OQYA 4A6HA 3P2BA 1ZGUB 1V5OA 1BTKA 4K7WA 4IG7B 4NPNA 3M3JA 2KX0A 4MJSA 3HQCA 2LRUA 5DCNA 4B95A 4URKA 5JHAA 3L17A 4JKEA 4C0AA 3QX1A 1E8WA 3AU5A 4MGZE 2CU1A 2OOBB 2DAJA 4W9EA 5CX3A 1E7UA 1V80A 3UF8A 1W1GA 2ZPYA 4NAWA 2L00B 2ZVNA 4KVGB 2W2WA 2WX0A 4PS8A 1LM8B 4MGKE 2DTCA 3KUZA 2M8SA 2KDFB 1WXSA 2CR5A 2RQ1A 2IBIB 4HB0B 2GBRA 1DBHA 5EFXA 4JKAA 1WGQA 5CHWA 4KV2A 2Z0OA 1WI1A 2LYDA 2GCLA 4TUUA 2JRIB 1V5UA 1GJZA 1WJNA 1OTRB 4Y94A 2ADZA 4HAYB 3U8ZA 2LGXA 2IYBA 5HE3A 2EKEC 1FB8A 1Y19B 3TO1A 2R82A 1NBFC 2H7DA 2D10A 2CY5A 2XK5B 4W9IA 1E90A 4HAXB 1DDMA 3A1QB 2JVCA 3KUDB 1V89A 2YRYA 3SYXA 4NSWA 2RNRB 4K2OA 3WA0A 4DXAB 2D9ZA 4RMAA 3V62A 1WI0A 2KDBA 4GU2A 4MSMB 5CLLB 2NR2A 2IFSA 4PS3A 4FBJB 4F7ZA 1J0GA 3DBSA 2J7QB 4EMOA 3E9PA 4W9JA 2KQSA 4ANWA 3BY4B 5L83A 1FHOA 1MIZB 4GXBA 2JZ3B 5L95C 4DHJB 1E8ZA 3ZTDA 2LJ5A 1KC7A 5AZFA 1HB6A 3B0AA 3A33B 2YVCA 3TBLD 1OEYJ 2D9VA 2M17A 5C6RA 3EC8A 3APDA 1V9JA 2D9WA 4GSWA 2COPA 4MELA 5CTRC 2XK5A 2YF0A 2G35A 3KW5B 3UIPB 2RD0A 4EZKA 3A1QA 1UBIA 4ZYNA 4ZRIA 3ULCA 4DX90 3EECA 5D2MB 3E9OA 2KWUB 3RZFA 5E6NA 2DYMA 3GYPA 1WJ4A 2BKRB 1FAOA 2ROZB 2GJYA 2KLCA 1TJ6A 2C5LC 2BWES 3V61A 3ENBA 2BPSA 1I35A 2HRJA 4I6LB 2ABDA 5J17A 2Z0EB 2KJ6A 2JZZA 3KYCD 3D32A 1WG7A 3M62B 1V5TA 4KHAA 1EUVB 3HHMA 3TIXA 1MIXA 1NTYA 5D7GA 3B1LX 4PYUA 4A5KA 3PHXB 4RM9A 1E7VA 5JHBA 3UQAA 1UEFA 2NS5A 2KWVB 2HJ8A 2LVPA 4WJNA 1WZ3A 3PGEA 2DKPA 3SO6A 1JRUA 1OY2A 1XD3B 2Z0DB 2KCJA 1TBEA 5GOWB 2DHZA 1M7EA 1TXDA 3ML8A 4AWJA 2BWFA 4MSQB 2KMAA 4YONA 3DPDA 1W1HA 2D2QA 3V6CB 4JKGB 2K39A 4I6PA 1R4MI 4ANUA 3ML4A 2RLOA 4BKSA 4GMVA 3ZKJC 3GYOA 2ZZPB 2CHZA 2JRHA 4HB4B 3SHQA 4A3PA 3PVLA 1VBGA 1OEYA 2M0XA 4KSKC 5JVLA 1WGHA 1GNUA 3HIZA 2ROVA 4F7UP 4ZRJA 4ILGB 4FULA 3BINA 1EF5A 2FCMA 2DN6A 2PE9A 2AYOB 1WE6A 2XQNM 3ZVVA 1YD8U 1WFYA 3SBTA 2ZCCA 3CSFA 4AUQC 2L7RA 5HE2A 2L05A 2K00A 1X1GA 4PS7A 3QC8B 4MGYE 2L1CA 4ASWC 5JZEB 1EF1A 1SIFA 1NU2A 3ZO5B 4JKDA 1E8XA 1TGZB 2WH5A 5E6PA 2DFKA 4BBKA 3VXWA 3PRMB 3QK0A 1LFDA 2N4FA 5J3TA 3VH4B 2MFQA 4WJOA 1NDDA 4KHOA 3ZRFA 3K9OB 2FCQA 2N1WA 4IFSA 5JHHA 3VFKA 2FJLA 3SU8X 3A4SC 1WJUA 4K2PA 4MH0E 5G55A 4DWFA 4JKGA 5JLJB 1Q1OA 4IOYX 4NNJB 2AEHA 3CSTA 1YQBA 4GDLB 4WWPA 4MEMA 3RZWC 4JK9A 3VDZA 3N3KB 1X86A 1BTNA 1K8RB 4MM3A 3LJUX 1WJ1A 5C5BB 2D3GA 2RUKB 4AJYB 3PEGA 1Z5SB 1U4AA 2I5FA 3GZNI 1UBQA 3U30A 4HDQA 4AP4C 2EC1A 4IM2A 2V3SA 2B3AA 1NTVA 3PS6A 4ZDVA 1E8YA 2YS3A 3OAWA 2MWNB 3FEHA 1LXDA 4TV3A 4W9DA 2M14A 1I2HA 2R0DA 1AQCA 2L3ZA 1P9DU 1EAZA 4G11A 5AEKB 1WXAA 4W9LA 3FSSA 1DIKA 2MA9B 4KAXB 1L7YA 4HPLB 2N9XA 2KC2A 4HVBA 1X1MA 2FCNA 5DIFB 3RCZA 3L13A 4BOZB 3T06A 4GDLA 5AZHA 3OJ3A 4A6KA 1XX0A 1W1DA 3A9JA 4TKNA 1TTNA 3W1YA 2L8JA 1LB1A 3JYUA 1C1YB 4HAUB 5KQ1A 3DVGY 4K81A 4OVVA 1U27A 4IUMB 3PP2A 5C5BA 1AWEA 2YSZA 3C0RB 2C9WB 5J2RA 2E2XA 1A5RA 2G4SA 1P3QU 1VD2A 1WRDB 1ZC3B 4EJNA 2RGNB 4EKUA 2KVRA 3DDCB 2MWSB 2I1JA 2JUOA 3NSUA 4H8SA 3L08A 3VTWA 2KK8A 2I1KA 2NMBA 3ZNGC 2Z0QA 4NJ6A 2K2JA 3PRZA 3NY5A 3PT2B 3LJ3A 3UINB 3IVFA 2MBEA 3E9LA 2XEWA 1CMXB 1X05A 2JT4B 5IJMA 4N9F4 4GB9A 4CYEA 2MRPA 2JF5A 3TW1A 3KYDD 1ST7A 3ENEA 2KTRB 1UELA 4NQKE 3N30A 4JKBA 3KRXA 1UNPA 2KC1A 3OLMD 3DBLI 4G0NB 2DYNA 3A4RA 3QCAA 4J6IA 2N1VA 1PQSA 2VSZA 4WJ7A 3EPYA 4K17A 1WR6E 3NS8A 1XT9B 4CHKA 1ISNA 3K9PB 4XZ4A 3CXBB 2KDIA 5CLQB 4M8NA 2KJRA 2RGFA 3ZDMC 3QA8A 4DBBA 4Z2NA 2XBBC 2MCNB 2MX2A 5CHFA 1XODA 2KUPA 3E66A 3KZ1A 3WIMA 4F1SA 1Y5OA 3B08A 2KOXA 3QHTA 5CHVC 4LDTD 4LJOB 2GBKA 2LOXA 2GOWA 2O2VB 3MHSD 3R7QA 4TQ0A 2EMSA 5DHAB 2DYQA 2KNBA 4MY6A 1GC7A 5C16A 3Q3JA 5FI0A 2O6VB 4KDLB 3IHPC 1WGGA 1XD4A 2Y8FA 1P3RA 1RAXA 1H8CA 5D3YA 2LI5A 1U5FA 2MKRA 4HB2B 5D3VA 3QWMA 3ECIA 3FP5A 2KTRA 2QKLA 3NHEB 4BOSC 2X0SA 1ZC4B 3SV1A 2KHWB 3ALBA 2MQJA 1WY8A 5G2NA 4M8MA 4XWXA 1IYFA 2WDTB 5LONB 2L76A 1DROA 2AL3A 3WYFB 2W2XD 3QAQA 2UVMA 2KJHB 1GGOA 2L2IA 2N23A 1J19A 3AJ4A 1KZ7A 1HB8A 3DXDA 2GBNA 4JGHB 1VCBA 2GCJA 5FR6A 1WGDA 3CMMB 1QC6A 1YJ1A 4JKCA 4GIVA 4PQ0A 2FJ9A 3JVZX 3EHVA 3IFWB 4W9HA 1DDWA 3H6NA 3ONSA 2IO1B 1KM7A 4JKHA 5JHGA 2NZ8B 1U2BA 1P1AA 4CHJA 4MDKE 3R3MA 2ASQA 1EO6A 2O2VA 3T8MA 2DENB 2R2QA 3TL5A 5DPRA 2AWTA 2O6VA 3M95A 5D3WA 2PEAA 4NQLB 5D27A 1QQGA 2DA0A 3L16A 3RD2A 1YIWA 4FHJA 2CKHB 2IO3B 4IM0A 2YS1A 4B6WA 2D11A 1OGWA 2C7MB 4IC7B 3AXCA 1R4NI 4G50A 2J0MA 2P0FA 2A5UA 2A4ZA 4RM8A 2G3QB 2J0JA 2CAYA 4WVFB 1PMSA 2MDXA 1WX7A 1OQNA 4E71A 2JWZA 5D94A 1E5WA 2NBUA 3ZUNA 4IW0A 2M38A 5D3XA 2RPQA 4ILJA 4A6FB 2DZJA 3VUYA 3KUCB 2KN5A 2M4NA 4EUTA 2V1YA 1WX9A 2MW5A 3IG3A 3FLVA 2MBBB 2GBMA 4B6HA 3A8QA 2C7NB 3H7PB 1G6JA 2VRRB 1PLSA 1P5TA 3V60A 3SNHA 3T9LA 1OMWA 1WXVA 3W1SC 2HE7A 2DHJA 2RSUA 4W9CA 2CQUA 2RSGA 1V81A 3PLUA 3ZDTA 2N0YA 3ZNID 1K5DB 2BKFA 2GS0A 2LKOA 1KZGA 4BKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMI C;  4OVU A;  1U5E A;  2KAN A;  4D0N B;  4CHM A;  2Y5B B;  1ACA A;  2BYV E;  1RJ2 A;  1XCG A;  3ZW3 A;  3QBV B;  2QHO A;  4HAV B;  3APF A;  2QKM A;  4HHV A;  1Q67 A;  2MP2 B;  3APC A;  5KCV A;  2KLG A;  4LJP B;  1WJM A;  4K7U A;  4NJ7 A;  1V6E A;  3QIJ A;  2J59 M;  3NZS A;  1FOE A;  1BAK A;  1Q5W B;  5LXH A;  5HE0 A;  2NCN A;  2DYB A;  4BBN C;  2V4L A;  3QQ8 B;  3DCG A;  4HLE A;  4KZC A;  2ELA A;  1D3Z A;  4A6F A;  2KO3 A;  2M1M A;  4AOF A;  2N7E A;  2NVU I;  4LDT B;  3MPX A;  2VKI A;  4W9F A;  3H9D A;  4KHB B;  3H7P A;  1L2N A;  2ZJD A;  1TZ1 A;  3PTF C;  5TR5 A;  5FI1 A;  2K6Q A;  4WWN A;  2KGX B;  2LG1 A;  2DX5 B;  1Y8R C;  2JY6 A;  3W1S A;  3PG7 A;  1NVL A;  2LBB A;  3HW2 B;  1UH6 A;  1MPH A;  3JSV B;  4JLC A;  4KSL C;  2Z0P A;  2LRW A;  2W2X C;  3ZNH B;  1FHX A;  3ZNZ B;  2FCS A;  3VIA A;  2D9X A;  3MJW A;  3O96 A;  4TYZ A;  2EMT A;  1QZE A;  4B9K A;  2FNJ B;  4DHJ D;  3DBR I;  2MP2 A;  1M94 A;  4TQ1 A;  2R09 A;  2K8H A;  3VVW B;  1NTI A;  2LXA A;  4E3C A;  1I7A A;  5C1Z A;  1WMH B;  1YX5 B;  1X1F A;  3DVN V;  4DX8 A;  1UZX B;  5KHO A;  1WVH A;  4HAT B;  4ANX A;  1TQZ A;  2K25 A;  1J0W A;  1T0Y A;  3AUL A;  4M0W B;  5E6O A;  3F0W A;  4JL9 A;  3MTN B;  4HPM B;  5JH5 C;  3NOB A;  4BKS D;  1UNQ A;  1IP9 A;  2DYO A;  2N7D A;  4EZJ A;  5KQ4 A;  3ODO A;  4HCN B;  4F7H A;  1KI1 B;  3I3T B;  4DHZ E;  4KZ0 A;  2CRF A;  1H4R A;  2D9Y A;  2K8B A;  1WIA A;  4DDI D;  2DHI A;  2DX5 A;  2N9E B;  3DXE A;  1XKE A;  2FAZ A;  1LQB A;  2ZEQ A;  3WAO A;  2UZR A;  1U5G A;  1XR0 B;  3JSV A;  4EOY A;  3OJ4 B;  4MK0 A;  4YL8 A;  2R2O A;  3VHT C;  2KWC A;  2WX1 A;  1RFA A;  4BVU C;  1FHW A;  1DDV A;  4F7G A;  3X0W A;  3DVG X;  1UNR A;  2Z59 B;  2KTF A;  2COC A;  3PZD A;  2YT0 A;  3PHW B;  4BFR A;  2G45 B;  3KH0 A;  1GC6 A;  5IA7 A;  4K1R B;  3PPA A;  2KDE B;  1SHC A;  2COD A;  2P0D A;  2CHW A;  3V6E B;  2UYZ B;  2ELB A;  1WMH A;  4IWP A;  3L10 B;  1P6S A;  1BWN A;  3H1U A;  5D6J B;  4EZL A;  5DH9 B;  3N7C A;  2KD0 A;  3L54 A;  2L0T A;  3U7D A;  2IZV B;  4W9G A;  3FM8 C;  1MAI A;  1S1Q B;  2LAS A;  3TJP A;  2Y7B A;  4FHK A;  5DPS A;  2BYE A;  5DPW A;  4MGI E;  4WQO B;  4DBG A;  2WWZ A;  2K2U A;  5L81 A;  1V86 A;  3D8E A;  3KSY A;  3SD5 A;  3QJZ A;  3SDL C;  2YLM A;  2J0K A;  3R66 C;  2NPT B;  2LXC A;  2P0H A;  2UZS A;  4JIO U;  4KDI C;  3DOW A;  3ZLZ A;  2K6D B;  4ANV A;  2KFJ A;  3IBE A;  4GDK B;  3ODX A;  2L0F A;  4P7I A;  1RLF A;  1NI2 A;  1GUA B;  3WAL A;  3R7R A;  2C60 A;  1WGR A;  3ZIM A;  1WR1 A;  3WAM A;  4ICU A;  2DX1 A;  4F8C B;  1V5P A;  4MT7 A;  4JQW C;  2X18 A;  2UWQ A;  1RRB A;  2COF A;  1H10 A;  3TFM A;  5AZG A;  2LUL A;  3ULB A;  2NBW B;  3SUZ A;  3AI5 A;  2DLW A;  2JPH A;  3VTU A;  2GBJ A;  3RUI B;  3VUX A;  2BCJ A;  3UGB B;  2C7H A;  2LZ6 A;  2FUH B;  4NY0 A;  5LOP B;  2K1F A;  1KOT A;  2LGD A;  2REX A;  1MKE A;  4II3 B;  3M1I B;  4WJQ A;  1WYW B;  2WYQ A;  2PZ1 A;  3X23 A;  4A20 A;  5JP4 A;  2COA A;  2KZR A;  1UD7 A;  3PV1 A;  3LDZ E;  4PYZ A;  3PVW A;  4HB3 B;  2NPT A;  2W9N A;  1AAR A;  2YS5 A;  3A9K B;  2FDQ A;  5DPT A;  2LVQ A;  3QWZ B;  3H7S A;  4AJW A;  3PRP B;  1V88 A;  3RT3 B;  2Y8G A;  4GDK A;  3DVN U;  3RCP A;  4HXD A;  2KQ7 A;  1U29 A;  2MBO A;  3BJI A;  2V76 A;  1K5G B;  5BO4 B;  4G3X B;  2RVB B;  4IAP A;  1WX8 A;  4FJV B;  3PRE A;  4FAD A;  3DXC A;  4BKT A;  2KX3 A;  3VH3 B;  2FIF A;  2ZCB A;  2DZK A;  3CIK A;  2P8V A;  1F9J A;  2OTX A;  3D8F A;  1DYN A;  2DZI A;  4HK2 A;  2DZM A;  3ZVR A;  4DHZ B;  3RYT A;  4XC2 A;  2Q13 A;  1WZ0 A;  2MSE D;  4PNK A;  3ODW A;  3DQV A;  2D4Q A;  1PFJ A;  4BBN F;  1M7R A;  1HBK A;  1ZSQ A;  3DBH I;  4HJK A;  1WM3 A;  3ZTC A;  5C79 A;  3UQB A;  5C23 A;  5J3Y A;  4FJY A;  3S2A A;  5KHQ A;  1GG3 A;  4FA6 A;  4II2 B;  2BGF A;  4L6E A;  4K7S A;  5IAA C;  5GMV A;  4EEW A;  2BF8 B;  1Q0W B;  5HKH A;  3A9K A;  3L0W B;  4XX5 A;  5DHF B;  4W9K A;  1FXT B;  1UPQ A;  4GOC A;  4X57 B;  4LCD E;  1ZW7 A;  5J3Q A;  1XQQ A;  3QAR A;  2N9P C;  3VTV A;  1FGZ A;  2MBH A;  3ML9 A;  1S3S G;  3VAW A;  2LOZ A;  1WGY A;  4E74 A;  1WM2 A;  3OAN A;  2MBQ A;  4FLH A;  2DKQ A;  2KXJ A;  2ZVO A;  3VUW A;  1EVH A;  2IY1 B;  1IRS A;  4ICV A;  1MK7 B;  4WSF A;  4DK5 A;  3AU4 A;  3EFU A;  1V49 A;  2ZNV C;  2HD5 B;  2IYD B;  1WJ6 A;  2RR9 A;  4DDG D;  2KFK B;  1J8C A;  3A8P A;  2ZNV B;  5HE1 A;  1X11 A;  3GOE A;  1UGM A;  3KRW A;  2JXX A;  4ZRK A;  2BYF A;  3WAP A;  1WGU A;  1MK9 B;  4CO7 A;  1Z87 A;  2G4D B;  3O65 B;  3UIO B;  1SE9 A;  1ZM0 A;  2D07 B;  3VOQ A;  3F5R A;  2IO0 B;  4EFO A;  2IY0 B;  3MDB C;  4IM3 A;  1P98 A;  4HAW B;  4Z2M B;  2HTH B;  1V61 A;  2LGY A;  1IPG A;  4HDO A;  2KMC A;  1LW3 A;  3JW0 X;  1U5D A;  2OJR A;  2DHK A;  4HAZ B;  2ZPN A;  4FJZ A;  1ZVR A;  1WXM A;  5LXI B;  1WH3 A;  3A98 B;  3RUL A;  2VRW B;  4GGQ A;  2IO2 B;  2DAF A;  1EGX A;  3HK0 A;  1UPR A;  4KIK B;  3VQI A;  2LUE A;  3G9W A;  1N3H A;  2H7E A;  4HWI B;  2MLB A;  3D8D A;  1P0R A;  1MG8 A;  5LLI A;  1V5M A;  3A9J B;  1I42 A;  2O6V D;  2KFK A;  3TVV A;  1B55 A;  3KY9 A;  4HCP B;  4WAA A;  2I5C A;  1C3T A;  1HE8 A;  2KKC A;  4GZU A;  3TCA A;  3NZU A;  3HM3 A;  2PJH A;  1BT0 A;  3TMP B;  1FGY A;  3M63 B;  1Z2M A;  1KJT A;  1ZKH A;  1WF9 A;  2LD9 A;  3PSC A;  4IWO A;  4FN2 A;  2HTH A;  2CB8 A;  4MJS B;  2CY4 A;  2CS4 A;  2NBV B;  3N32 A;  5DI9 B;  3WAN A;  3PLV A;  3KVF B;  2JP2 A;  2OQB A;  2CHX A;  1SGH A;  3Q3F A;  4NAW B;  2PPH A;  2K8C A;  4IWQ A;  3P7Z A;  4KIK A;  2FID A;  3PVU A;  1V2Y A;  3PSE B;  4GMX B;  5J18 A;  3UZT A;  1WE7 A;  2YT1 A;  3CF6 E;  2LVO A;  2LWP A;  3P6A A;  4WJP A;  4GPT B;  4GN1 A;  4WWO A;  2AL6 A;  2EJ8 A;  3HM6 X;  4A3O A;  1YX6 B;  4I6N B;  1RRP B;  5EDS A;  2PE6 B;  1KLV A;  3ZRC A;  3V5W A;  1OQY A;  4A6H A;  3P2B A;  1ZGU B;  1V5O A;  1BTK A;  4K7W A;  4IG7 B;  4NPN A;  3M3J A;  2KX0 A;  4MJS A;  3HQC A;  2LRU A;  5DCN A;  4B95 A;  4URK A;  5JHA A;  3L17 A;  4C0A A;  3QX1 A;  1E8W A;  3AU5 A;  4MGZ E;  2CU1 A;  2OOB B;  2DAJ A;  4W9E A;  5CX3 A;  1E7U A;  1V80 A;  3UF8 A;  1W1G A;  2ZPY A;  4NAW A;  2L00 B;  2ZVN A;  4KVG B;  2W2W A;  2WX0 A;  4PS8 A;  1LM8 B;  4MGK E;  2DTC A;  3KUZ A;  2M8S A;  2KDF B;  1WXS A;  2CR5 A;  2RQ1 A;  2IBI B;  4HB0 B;  2GBR A;  1DBH A;  5EFX A;  1WGQ A;  5CHW A;  4KV2 A;  2Z0O A;  1WI1 A;  2LYD A;  2GCL A;  4TUU A;  2JRI B;  1V5U A;  1GJZ A;  1WJN A;  1OTR B;  4Y94 A;  2ADZ A;  4HAY B;  3U8Z A;  2LGX A;  2IYB A;  5HE3 A;  2EKE C;  1FB8 A;  1Y19 B;  3TO1 A;  1NBF C;  2H7D A;  2D10 A;  2CY5 A;  2XK5 B;  4W9I A;  1E90 A;  4HAX B;  1DDM A;  3A1Q B;  2JVC A;  3KUD B;  1V89 A;  2YRY A;  3SYX A;  4NSW A;  2RNR B;  4K2O A;  3WA0 A;  4DXA B;  2D9Z A;  4RMA A;  3V62 A;  1WI0 A;  2KDB A;  4GU2 A;  4MSM B;  5CLL B;  2NR2 A;  2IFS A;  4PS3 A;  4FBJ B;  4F7Z A;  1J0G A;  3DBS A;  2J7Q B;  4EMO A;  4W9J A;  2KQS A;  4ANW A;  3BY4 B;  5L83 A;  1FHO A;  1MIZ B;  4GXB A;  2JZ3 B;  5L95 C;  4DHJ B;  1E8Z A;  3ZTD A;  2LJ5 A;  5AZF A;  1HB6 A;  3B0A A;  3A33 B;  2YVC A;  3TBL D;  1OEY J;  2D9V A;  2M17 A;  5C6R A;  3EC8 A;  3APD A;  1V9J A;  2D9W A;  4GSW A;  2COP A;  4MEL A;  5CTR C;  2XK5 A;  2YF0 A;  2G35 A;  3KW5 B;  3UIP B;  2RD0 A;  4EZK A;  3A1Q A;  1UBI A;  4ZYN A;  4ZRI A;  3ULC A;  4DX9 0;  3EEC A;  5D2M B;  2KWU B;  3RZF A;  5E6N A;  2DYM A;  3GYP A;  1WJ4 A;  2BKR B;  1FAO A;  2ROZ B;  2GJY A;  2KLC A;  1TJ6 A;  2C5L C;  2BWE S;  3V61 A;  2BPS A;  1I35 A;  2HRJ A;  4I6L B;  2ABD A;  5J17 A;  2Z0E B;  2KJ6 A;  2JZZ A;  3KYC D;  3D32 A;  1WG7 A;  3M62 B;  1V5T A;  4KHA A;  1EUV B;  3HHM A;  3TIX A;  1MIX A;  1NTY A;  5D7G A;  3B1L X;  4PYU A;  4A5K A;  3PHX B;  4RM9 A;  1E7V A;  5JHB A;  3UQA A;  1UEF A;  2NS5 A;  2KWV B;  2HJ8 A;  2LVP A;  4WJN A;  1WZ3 A;  3PGE A;  2DKP A;  3SO6 A;  1JRU A;  1OY2 A;  1XD3 B;  2Z0D B;  2KCJ A;  1TBE A;  5GOW B;  2DHZ A;  1M7E A;  1TXD A;  3ML8 A;  4AWJ A;  2BWF A;  4MSQ B;  2KMA A;  4YON A;  3DPD A;  1W1H A;  2D2Q A;  3V6C B;  2K39 A;  4I6P A;  1R4M I;  4ANU A;  3ML4 A;  2RLO A;  4BKS A;  4GMV A;  3ZKJ C;  3GYO A;  2ZZP B;  2CHZ A;  2JRH A;  4HB4 B;  3SHQ A;  4A3P A;  3PVL A;  1OEY A;  2M0X A;  4KSK C;  1WGH A;  1GNU A;  3HIZ A;  2ROV A;  4F7U P;  4ZRJ A;  4FUL A;  3BIN A;  1EF5 A;  2FCM A;  2DN6 A;  2PE9 A;  2AYO B;  1WE6 A;  2XQN M;  3ZVV A;  1YD8 U;  1WFY A;  2ZCC A;  3CSF A;  4AUQ C;  2L7R A;  5HE2 A;  2L05 A;  2K00 A;  1X1G A;  4PS7 A;  3QC8 B;  4MGY E;  2L1C A;  4ASW C;  5JZE B;  1EF1 A;  1SIF A;  1NU2 A;  3ZO5 B;  1E8X A;  1TGZ B;  2WH5 A;  5E6P A;  2DFK A;  4BBK A;  3VXW A;  3PRM B;  3QK0 A;  1LFD A;  2N4F A;  5J3T A;  3VH4 B;  2MFQ A;  4WJO A;  1NDD A;  4KHO A;  3ZRF A;  3K9O B;  2FCQ A;  2N1W A;  4IFS A;  5JHH A;  3VFK A;  2FJL A;  3SU8 X;  3A4S C;  1WJU A;  4K2P A;  4MH0 E;  5G55 A;  4DWF A;  5JLJ B;  1Q1O A;  4IOY X;  4NNJ B;  2AEH A;  3CST A;  1YQB A;  4GDL B;  4WWP A;  4MEM A;  3RZW C;  3VDZ A;  3N3K B;  1X86 A;  1BTN A;  1K8R B;  4MM3 A;  3LJU X;  1WJ1 A;  5C5B B;  2D3G A;  2RUK B;  4AJY B;  3PEG A;  1Z5S B;  1U4A A;  2I5F A;  3GZN I;  1UBQ A;  3U30 A;  4HDQ A;  4AP4 C;  2EC1 A;  4IM2 A;  2V3S A;  2B3A A;  1NTV A;  3PS6 A;  4ZDV A;  1E8Y A;  2YS3 A;  3OAW A;  2MWN B;  3FEH A;  1LXD A;  4TV3 A;  4W9D A;  2M14 A;  1I2H A;  2R0D A;  1AQC A;  2L3Z A;  1P9D U;  1EAZ A;  4G11 A;  5AEK B;  1WXA A;  4W9L A;  3FSS A;  2MA9 B;  4KAX B;  1L7Y A;  4HPL B;  2N9X A;  2KC2 A;  4HVB A;  1X1M A;  2FCN A;  5DIF B;  3RCZ A;  3L13 A;  4BOZ B;  3T06 A;  4GDL A;  5AZH A;  3OJ3 A;  4A6K A;  1XX0 A;  1W1D A;  3A9J A;  4TKN A;  1TTN A;  3W1Y A;  2L8J A;  1LB1 A;  3JYU A;  1C1Y B;  4HAU B;  5KQ1 A;  3DVG Y;  4K81 A;  4OVV A;  1U27 A;  4IUM B;  3PP2 A;  5C5B A;  1AWE A;  2YSZ A;  3C0R B;  2C9W B;  5J2R A;  2E2X A;  1A5R A;  2G4S A;  1P3Q U;  1VD2 A;  1WRD B;  1ZC3 B;  4EJN A;  2RGN B;  4EKU A;  2KVR A;  3DDC B;  2MWS B;  2I1J A;  2JUO A;  3NSU A;  4H8S A;  3L08 A;  3VTW A;  2KK8 A;  2I1K A;  2NMB A;  3ZNG C;  2Z0Q A;  4NJ6 A;  2K2J A;  3PRZ A;  3NY5 A;  3PT2 B;  3LJ3 A;  3UIN B;  3IVF A;  2MBE A;  2XEW A;  1CMX B;  1X05 A;  2JT4 B;  5IJM A;  4N9F 4;  4GB9 A;  4CYE A;  2MRP A;  2JF5 A;  3TW1 A;  3KYD D;  1ST7 A;  3ENE A;  2KTR B;  1UEL A;  4NQK E;  3N30 A;  3KRX A;  1UNP A;  2KC1 A;  3OLM D;  3DBL I;  4G0N B;  2DYN A;  3A4R A;  3QCA A;  4J6I A;  2N1V A;  1PQS A;  2VSZ A;  4WJ7 A;  3EPY A;  4K17 A;  1WR6 E;  3NS8 A;  1XT9 B;  4CHK A;  1ISN A;  3K9P B;  4XZ4 A;  3CXB B;  2KDI A;  5CLQ B;  4M8N A;  2KJR A;  2RGF A;  3ZDM C;  3QA8 A;  4DBB A;  4Z2N A;  2XBB C;  2MCN B;  2MX2 A;  5CHF A;  1XOD A;  2KUP A;  3KZ1 A;  3WIM A;  4F1S A;  1Y5O A;  3B08 A;  2KOX A;  3QHT A;  5CHV C;  4LDT D;  4LJO B;  2GBK A;  2LOX A;  2GOW A;  2O2V B;  3MHS D;  3R7Q A;  4TQ0 A;  2EMS A;  5DHA B;  2DYQ A;  2KNB A;  4MY6 A;  1GC7 A;  5C16 A;  3Q3J A;  5FI0 A;  2O6V B;  4KDL B;  3IHP C;  1WGG A;  1XD4 A;  2Y8F A;  1P3R A;  1RAX A;  1H8C A;  5D3Y A;  2LI5 A;  1U5F A;  2MKR A;  4HB2 B;  5D3V A;  3QWM A;  3ECI A;  3FP5 A;  2KTR A;  2QKL A;  3NHE B;  4BOS C;  1ZC4 B;  3SV1 A;  2KHW B;  3ALB A;  2MQJ A;  1WY8 A;  5G2N A;  4M8M A;  4XWX A;  1IYF A;  2WDT B;  5LON B;  2L76 A;  1DRO A;  2AL3 A;  3WYF B;  2W2X D;  3QAQ A;  2UVM A;  2KJH B;  2L2I A;  2N23 A;  1J19 A;  3AJ4 A;  1KZ7 A;  1HB8 A;  3DXD A;  2GBN A;  4JGH B;  1VCB A;  2GCJ A;  5FR6 A;  1WGD A;  3CMM B;  1QC6 A;  1YJ1 A;  4GIV A;  4PQ0 A;  2FJ9 A;  3JVZ X;  3EHV A;  3IFW B;  4W9H A;  1DDW A;  3H6N A;  3ONS A;  2IO1 B;  1KM7 A;  5JHG A;  2NZ8 B;  1U2B A;  1P1A A;  4CHJ A;  4MDK E;  3R3M A;  2ASQ A;  1EO6 A;  2O2V A;  3T8M A;  2DEN B;  2R2Q A;  3TL5 A;  5DPR A;  2AWT A;  2O6V A;  3M95 A;  5D3W A;  2PEA A;  4NQL B;  5D27 A;  1QQG A;  2DA0 A;  3L16 A;  3RD2 A;  1YIW A;  4FHJ A;  2CKH B;  2IO3 B;  4IM0 A;  2YS1 A;  4B6W A;  2D11 A;  1OGW A;  2C7M B;  4IC7 B;  3AXC A;  1R4N I;  4G50 A;  2J0M A;  2P0F A;  2A5U A;  2A4Z A;  4RM8 A;  2G3Q B;  2J0J A;  2CAY A;  4WVF B;  1PMS A;  2MDX A;  1WX7 A;  1OQN A;  4E71 A;  2JWZ A;  5D94 A;  1E5W A;  2NBU A;  3ZUN A;  4IW0 A;  2M38 A;  5D3X A;  2RPQ A;  4A6F B;  2DZJ A;  3VUY A;  3KUC B;  2KN5 A;  2M4N A;  4EUT A;  2V1Y A;  1WX9 A;  2MW5 A;  3IG3 A;  3FLV A;  2MBB B;  2GBM A;  4B6H A;  3A8Q A;  2C7N B;  3H7P B;  1G6J A;  2VRR B;  1PLS A;  1P5T A;  3V60 A;  3SNH A;  3T9L A;  1OMW A;  1WXV A;  3W1S C;  2HE7 A;  2DHJ A;  2RSU A;  4W9C A;  2CQU A;  2RSG A;  1V81 A;  3PLU A;  3ZDT A;  2N0Y A;  3ZNI D;  1K5D B;  2BKF A;  2GS0 A;  2LKO A;  1KZG A;  4BKG A; 
#chains in the Genus database with same CATH topology
 2WDV B;  2GMI C;  4OVU A;  1U5E A;  5G5H A;  4C4V B;  2KAN A;  4D0N B;  3U7Z A;  4CHM A;  2Y5B B;  1ACA A;  2BYV E;  1RJ2 A;  1XCG A;  3ZW3 A;  3QBV B;  2QHO A;  4USA A;  4HAV B;  2OJW A;  3APF A;  2WXF A;  2QKM A;  4HHV A;  1Q67 A;  5D3I B;  2MP2 B;  5EE1 A;  3APC A;  1SEB D;  3MJ5 A;  5KCV A;  1VZ8 A;  2KLG A;  3MC8 A;  4LJP B;  4P16 A;  1WJM A;  4K7U A;  4NJ7 A;  2N9K A;  1FRR A;  1V6E A;  1JDE A;  3QIJ A;  3DWM A;  1T0R C;  2J59 M;  4N59 A;  3NZS A;  1FOE A;  1L4D B;  1BAK A;  1Q5W B;  2LGS A;  5LXH A;  5HE0 A;  2JYT A;  4WAF A;  1T5X D;  3HVD A;  2NCN A;  2DYB A;  3Q3M C;  2V4L A;  3QQ8 B;  4IKG A;  4BBN C;  3DCG A;  4HLE A;  2RMM A;  4KZC A;  2ELA A;  1D3Z A;  4A6F A;  2KO3 A;  1JAL A;  2M1M A;  4AOF A;  3Q6B A;  2N7E A;  2NVU I;  3DCX A;  2NTS A;  4LDT B;  2LFI A;  3MPX A;  3C8Y A;  2VKI A;  1QIL A;  4W9F A;  1UGJ A;  2L32 A;  1QLB B;  3H9D A;  4KHB B;  3H7P A;  2OED A;  2LUM A;  4RGO S;  1L2N A;  2ZJD A;  3RN9 C;  1TZ1 A;  2CJO A;  1V97 A;  3IAS 1;  3PTF C;  5TR5 A;  5FI1 A;  1ENF A;  1NVI D;  2K6Q A;  2BT6 A;  4WWN A;  2KGX B;  2LG1 A;  2DX5 B;  1Y8R C;  2JY6 A;  3W1S A;  4XDD A;  3PG7 A;  1XCQ L;  1NVL A;  2DNF A;  2LBB A;  3HW2 B;  2WXL A;  1UH6 A;  1MPH A;  3JSV B;  4JLC A;  4KSL C;  2KDM A;  2YEP F;  1VLB A;  3BVG A;  2Z0P A;  2QC8 A;  5BYR A;  2LRW A;  2W2X C;  4C4V A;  3ZNH B;  1FHX A;  1V1P B;  4PT5 A;  1TY0 A;  3ZNZ B;  2ACZ B;  2FCS A;  4P1C C;  3VIA A;  2D9X A;  3MJW A;  3O96 A;  3NW8 A;  4TYZ A;  2EMT A;  1QZE A;  1FCC C;  4B9K A;  2FNJ B;  3OG5 A;  4DHJ D;  2WXP A;  3DBR I;  2MP2 A;  1M94 A;  1B9R A;  4TQ1 A;  2R09 A;  2K8H A;  3VVW B;  1NTI A;  2LXA A;  4E3C A;  1I7A A;  2VH2 A;  4A55 A;  5C1Z A;  1WMH B;  1YX5 B;  1MJD A;  1X1F A;  3AM9 A;  3DVN V;  4DX8 A;  1EM7 A;  1UZX B;  5KHO A;  1WVH A;  4HAT B;  4ANX A;  1TQZ A;  3P4Q B;  2K25 A;  1ZDV A;  1J0W A;  1T0Y A;  3AUL A;  1N5X A;  3DWG C;  4M0W B;  5E6O A;  2ON8 A;  3F0W A;  4JL9 A;  3MTN B;  4HPM B;  5JH5 C;  3NOB A;  4BKS D;  1TKY A;  1UNQ A;  1WSP A;  2KMM A;  1IP9 A;  2DYO A;  2N7D A;  4EZJ A;  5KQ4 A;  3ODO A;  4HCN B;  4KHB A;  2RDG A;  4F7H A;  4OVZ A;  3SFD B;  1KI1 B;  3I3T B;  4DHZ E;  3C19 A;  1KBL A;  4KZ0 A;  2CRF A;  4HRS A;  1H4R A;  2LMC A;  2D9Y A;  2K8B A;  1WIA A;  4DDI D;  2DHI A;  2DX5 A;  3NRZ A;  2IGH A;  2N9E B;  3DXE A;  2JWU A;  1XKE A;  2FAZ A;  1QF6 A;  1LQB A;  2ZEQ A;  3WAO A;  2PTL A;  3Q8E A;  3EA6 A;  2UZR A;  1D5Z C;  1U5G A;  1XR0 B;  4XDC A;  3JSV A;  1Q10 A;  4EOY A;  3P4P B;  4HPP A;  3OJ4 B;  4MK0 A;  4YL8 A;  2R2O A;  3VHT C;  2KWC A;  4REZ A;  2WX1 A;  2AQ3 B;  1RFA A;  4BVU C;  2INN E;  1V1P A;  3ZJU A;  1FHW A;  1JW9 D;  3HSA A;  1RFK A;  1PYW D;  1DDV A;  4F7G A;  3X0W A;  3DVG X;  1UNR A;  2Z59 B;  1L4Z B;  2COC A;  2KTF A;  3PZD A;  2WLB A;  2YT0 A;  4YSZ B;  1STE A;  2WXI A;  3PHW B;  4BFR A;  2G45 B;  3KH0 A;  1GC6 A;  5IA7 A;  4K1R B;  1HTO A;  3PPA A;  2KDE B;  1SHC A;  2COD A;  2P0D A;  2TSS A;  2CHW A;  2UYZ B;  1L0X B;  3V6E B;  2ELB A;  1WMH A;  2YEP B;  1JWB D;  4IWP A;  3L10 B;  1P6S A;  1BWN A;  2RDH A;  3H1U A;  5IO9 A;  5D6J B;  4DXF A;  4EZL A;  2HJ1 A;  2WXQ A;  5DH9 B;  4M00 A;  3N7C A;  1TS3 A;  2CU3 A;  2KD0 A;  3TEX A;  3L54 A;  4L2Y A;  2L0T A;  3U7D A;  3T3O A;  1JQ4 A;  2IZV B;  4M0W A;  4W9G A;  3FM8 C;  1MAI A;  1JWM D;  1GAQ B;  2N0S B;  1S1Q B;  4JK8 A;  2LAS A;  3DBH B;  3TJP A;  2Y7B A;  4FHK A;  5DPS A;  2BYE A;  5DPW A;  4MGI E;  4S17 A;  3NVY A;  2EEL A;  1JWU D;  3AE7 B;  4WQO B;  4DBG A;  1IUE A;  2WWZ A;  2K2U A;  5L81 A;  2X38 A;  1RYJ A;  1V86 A;  1IBX B;  1HXY D;  3D8E A;  3KSY A;  1BUI C;  3SD5 A;  5BYQ A;  3QJZ A;  3SDL C;  3U2S C;  2YLM A;  2RDB C;  3MC9 A;  2J0K A;  3R66 C;  2M0A A;  2NPT B;  2LXC A;  2P0H A;  3ABV B;  2UZS A;  4JIO U;  4KDI C;  3DOW A;  3ZLZ A;  1SF0 A;  4EE2 A;  2JXT A;  2WXK A;  2K6D B;  4ANV A;  2KFJ A;  2BW2 A;  3IBE A;  4R3D A;  3MFG A;  4GDK B;  3ODX A;  2L0F A;  1P7E A;  3AH7 A;  4P7I A;  1RLF A;  1NI2 A;  3TEZ A;  1GUA B;  3WAL A;  3R7R A;  2C60 A;  1WGR A;  3NVZ A;  3ZIM A;  1WR1 A;  2VZK D;  3WAM A;  1CJE A;  4ICU A;  2DX1 A;  2Z59 A;  4F8C B;  1NI3 A;  3GP7 A;  1V5P A;  4YTM B;  4MT7 A;  1HQR D;  4JQW C;  2X18 A;  2UWQ A;  1TKG A;  1RRB A;  2COF A;  2K49 A;  1C77 A;  1H10 A;  3TFM A;  5AZG A;  4ILH A;  2LUL A;  3ULB A;  1XLO A;  2NBW B;  4ITK A;  3SUZ A;  3AI5 A;  1YN4 A;  3B9J A;  2DLW A;  2JPH A;  3VTU A;  2GBJ A;  3RUI B;  3VUX A;  2BCJ A;  3UGB B;  1N5W A;  2C7H A;  3KWV A;  4NZL B;  3KLS X;  2LZ6 A;  2QIL A;  2FUH B;  4NY0 A;  5LOP B;  2K1F A;  2SEB D;  2LGD A;  1KOT A;  2REX A;  1MKE A;  4II3 B;  3M1I B;  1T0S C;  3AN1 A;  4WJQ A;  4MT5 A;  3BVZ A;  4C00 A;  1WYW B;  2WYQ A;  2PZ1 A;  1WGK A;  1TYG B;  3L4P A;  3X23 A;  4A20 A;  3N9Y C;  5JP4 A;  2COA A;  2KZR A;  2CJN A;  1IBX A;  1UD7 A;  3PV1 A;  3LDZ E;  2LHE A;  4KGT A;  2K3U A;  4PYZ A;  3PVW A;  1TZO A;  4HB3 B;  2NPT A;  2W9N A;  4LK0 M;  3BZD B;  1AAR A;  2YS5 A;  4YXD B;  3A9K B;  2FDQ A;  2WDQ B;  3BWU D;  5DPT A;  2LVQ A;  3H8H A;  3QWZ B;  1UWX A;  4L1R A;  3H7S A;  3FVC A;  4AJW A;  3PRP B;  1V88 A;  3RT3 B;  3RPF C;  2Y8G A;  4GDK A;  3MHZ A;  2QDF A;  1YJJ A;  3DVN U;  2GUM A;  3RCP A;  4HXD A;  4ZHP A;  2KQ7 A;  1U29 A;  2MBO A;  2ONQ A;  2QEJ C;  4JKF A;  4HJG E;  3AE4 B;  3BJI A;  1ZPS A;  3A58 A;  2DIK A;  2V76 A;  2GRI A;  2MJ3 A;  2Y5C A;  1K5G B;  5BO4 B;  3DHI C;  4G3X B;  2D3B A;  2RVB B;  1VBH A;  4IAP A;  1WX8 A;  4FJV B;  3PRE A;  2UU7 A;  1YN5 A;  3DXC A;  4FAD A;  4BKT A;  2KX3 A;  3VH3 B;  1ET9 A;  2FIF A;  2V9H A;  2ZCB A;  3EUB 2;  2DZK A;  4YTN B;  3RNE C;  3CIK A;  3HRD D;  2P8V A;  1F9J A;  2OTX A;  3D8F A;  2BVC A;  1DYN A;  2DZI A;  4HK2 A;  2DZM A;  3Q8C A;  3ZVR A;  4DHZ B;  4QJ4 B;  3RYT A;  4XC2 A;  2Q13 A;  4JK7 A;  1WZ0 A;  4AS1 A;  3DHG C;  2MSE D;  4PNK A;  3ODW A;  3DQV A;  2D4Q A;  1PFJ A;  2WU5 B;  1NYR A;  4BBN F;  1M7R A;  2ZKM X;  3BYY B;  1HBK A;  1ZSQ A;  3DBH I;  3TEY A;  4HJK A;  1WM3 A;  4CQN A;  1Y56 A;  3CWI A;  2BB5 A;  3B77 A;  3ZTC A;  5C79 A;  5H8Y E;  1TS5 A;  3UQB A;  1GB4 A;  5C23 A;  5J3Y A;  4FJY A;  3S2A A;  5KHQ A;  1GG3 A;  1CK1 A;  4FA6 A;  3RMK C;  1VJK A;  3U52 E;  4II2 B;  2BGF A;  1ZYI A;  4L6E A;  4K7S A;  2W82 A;  5IAA C;  5GMV A;  4EEW A;  2BF8 B;  1Q0W B;  4CSQ A;  5HKH A;  3A9K A;  1JWA D;  4QXA B;  3L0W B;  1SSN A;  4XX5 A;  5DHF B;  4W9K A;  1FXT B;  1UPQ A;  4OSN A;  4GOC A;  4X57 B;  4LCD E;  1ZW7 A;  5J3Q A;  1XQQ A;  3QAR A;  2N9P C;  3B2G A;  4ZHO A;  5JXV A;  3VTV A;  5I2S A;  3SBG A;  1FGZ A;  2MBH A;  3ML9 A;  1S3S G;  1AW7 A;  1UNS A;  1XCT L;  3VAW A;  2LOZ A;  1WGY A;  4E74 A;  1WM2 A;  2PVO D;  3ZXV A;  3OAN A;  5BYS A;  1N62 A;  2MBQ A;  1WRI A;  1D6E C;  4FLH A;  2DKQ A;  2KXJ A;  1MI1 A;  4YTP B;  2ZVO A;  2KN4 A;  1A70 A;  3VUW A;  1EVH A;  4RCO A;  4RGN A;  2IY1 B;  1IRS A;  4ICV A;  1MK7 B;  1PGA A;  5BMI A;  3OHM B;  1FFU A;  4LLG M;  4WSF A;  4M01 A;  4DK5 A;  1JML A;  3AU4 A;  3EFU A;  1V49 A;  2ZNV C;  2HD5 B;  2IYD B;  1WJ6 A;  2RR9 A;  4DDG D;  2V3N A;  2KFK B;  1J8C A;  1FD6 A;  2SAK A;  1F2R I;  3A8P A;  2ZNV B;  3NVW A;  5HE1 A;  3SEB A;  1X11 A;  3GOE A;  1UGM A;  2G1E A;  3GE8 C;  4C56 C;  3KRW A;  2N7J A;  2JXX A;  4US9 A;  3FIL B;  4ZRK A;  2BYF A;  3WAP A;  2IJ0 A;  1WGU A;  4BZA A;  2IGD A;  1HZ5 A;  3P4R B;  1MK9 B;  3CIR B;  4CO7 A;  3Q14 C;  1Z87 A;  1EWY C;  4GLS C;  4M02 A;  4OW0 A;  2G4D B;  3O65 B;  3UIO B;  1FCL A;  1SE9 A;  1ZM0 A;  2KQ4 X;  2D07 B;  3LXF A;  3VOQ A;  3VR8 B;  4C7Z A;  3F5R A;  2IO0 B;  4EFO A;  2IY0 B;  3MDB C;  4IM3 A;  1P98 A;  4HAW B;  4Z2M B;  1VR9 A;  2HTH B;  2VZK B;  1V61 A;  2LGY A;  1IPG A;  4HDO A;  2KMC A;  1LW3 A;  1YNT E;  3JW0 X;  3BII D;  1U5D A;  2OJR A;  3B2F A;  2DHK A;  4HAZ B;  3AE5 B;  2ZPN A;  4FJZ A;  1C4P A;  1ZVR A;  4LNN A;  1WXM A;  5LXI B;  2IDY A;  1WH3 A;  3A98 B;  3RUL A;  2VRW B;  4GGQ A;  2IO2 B;  2DAF A;  1D5X C;  4KGR A;  1EGX A;  2FJU B;  1UPR A;  3HK0 A;  4DQO C;  4KIK B;  3VQI A;  2LUE A;  3G9W A;  1N3H A;  2K5P A;  2H7E A;  5LNK 1;  4HWI B;  2MLB A;  3D8D A;  4B0E A;  1P0R A;  5HI1 A;  1SE3 A;  2DBY A;  4HKZ E;  4D2K A;  1MG8 A;  3RNB C;  2H89 B;  2WXN A;  5LLI A;  1XO3 A;  1V5M A;  1SJH D;  2KR0 A;  3A9J B;  3ZXR A;  1I42 A;  2O6V D;  4LTU A;  2KFK A;  3VR9 B;  3TVV A;  1B55 A;  1ZOY B;  2JU6 X;  3KY9 A;  1MHH E;  3P63 A;  4HCP B;  4WAA A;  2I5C A;  1ZE3 D;  1C3T A;  1HE8 A;  2KKC A;  4GZU A;  5G5G A;  3P1M A;  3TCA A;  4RFB A;  3NZU A;  3HM3 A;  2PJH A;  1BT0 A;  3TMP B;  1FGY A;  3M63 B;  1Z2M A;  3R8B A;  1KJT A;  4WIP A;  1ZKH A;  1WF9 A;  2WXO A;  2LD9 A;  1T3Q A;  3PSC A;  4IWO A;  4FN2 A;  1C4C A;  3E56 A;  2WGS A;  4C7Y A;  2HTH A;  2CB8 A;  2GLS A;  4MJS B;  2K22 A;  4QJ5 B;  2CY4 A;  2CS4 A;  2NBV B;  3N32 A;  5EE9 A;  5DI9 B;  1ZUD 2;  3WAN A;  3PLV A;  1FRD A;  3KVF B;  3BVM A;  2JP2 A;  2OQB A;  1DOX A;  2R2Y A;  3Q8A A;  2CHX A;  1SGH A;  2WXJ A;  5IKC M;  2WXR A;  1I4G A;  2KAC A;  3Q3F A;  3SR6 A;  2Z8L A;  3ZGZ A;  4NAW B;  2NMQ A;  2PPH A;  2K8C A;  4ACF A;  2YT2 A;  4S0R A;  3RNC C;  4IWQ A;  3P7Z A;  4KIK A;  4RF0 A;  2FID A;  3UI3 A;  3PVU A;  4OZA A;  1V2Y A;  3WCQ A;  3PSE B;  3AE6 B;  1I4X A;  1WXQ A;  4GMX B;  5J18 A;  3UZT A;  1PUT A;  2BQQ A;  1WE7 A;  3NUH B;  2YT1 A;  3CF6 E;  5FKA C;  2LVO A;  2LWP A;  2HDE A;  1DYQ A;  3P6A A;  4WJP A;  2L83 A;  4ARI A;  2V3P A;  4GPT B;  1LO5 D;  4GN1 A;  3VRB B;  1C78 A;  4WWO A;  2AL6 A;  2EJ8 A;  3BK1 A;  3HM6 X;  4A3O A;  2PLP A;  4K3C A;  1YX6 B;  4I6N B;  1V8C A;  1RRP B;  5EDS A;  2PE6 B;  1KLV A;  3ZRC A;  1I4R A;  3V5W A;  1OQY A;  4A6H A;  1FNU A;  1SJE D;  3P2B A;  1T77 A;  3HVZ A;  1ZGU B;  1V5O A;  4UDU C;  1BTK A;  4K7W A;  4IG7 B;  3NZ3 A;  3M3J A;  2KX0 A;  4NPN A;  4OZC A;  3AE1 B;  4JE3 B;  2WXG A;  3HQC A;  3I5J C;  4MJS A;  1FNV A;  2WP9 B;  2LRU A;  2NBV A;  5DCN A;  4B95 A;  4URK A;  1IGC A;  5JHA A;  2ZW0 A;  2W54 A;  3L17 A;  4JKE A;  4C0A A;  3QX1 A;  1E8W A;  2WQY B;  3AU5 A;  1AN8 A;  1WWT A;  4MGZ E;  2CU1 A;  2OOB B;  2DAJ A;  4W9E A;  1QQR A;  5CX3 A;  1E7U A;  1V80 A;  3UF8 A;  1W1G A;  2ZPY A;  4NAW A;  2L52 A;  2L00 B;  2ZVN A;  4KVG B;  2W2W A;  3LB8 C;  2Z13 A;  2EKI A;  2WX0 A;  4PS8 A;  1LM8 B;  4MGK E;  2DTC A;  1E0Z A;  3KUZ A;  2M8S A;  2KDF B;  1KTK A;  1WXS A;  2CR5 A;  1GOZ A;  3Q8F A;  3AMZ A;  2RQ1 A;  2IBI B;  2BTE A;  2IND C;  4HB0 B;  2GBR A;  1DBH A;  5EFX A;  4JKA A;  1QOF A;  4A8X C;  1WGQ A;  4KX6 B;  5CHW A;  4KV2 A;  1I7H A;  2Z0O A;  1WI1 A;  2LYD A;  2HTM E;  2GCL A;  4TUU A;  1MHX A;  2JRI B;  1V5U A;  1GJZ A;  1WJN A;  4QAY A;  1OTR B;  4Y94 A;  4N6E B;  2ADZ A;  1L0V B;  4HAY B;  4K3B A;  3U8Z A;  3KWL A;  2LGX A;  2IYB A;  5HE3 A;  2EKE C;  4O1N A;  2BB6 A;  1MPE A;  1FB8 A;  1Y19 B;  3TO1 A;  1KLU D;  2R82 A;  1NBF C;  2H7D A;  1F52 A;  2D10 A;  2CY5 A;  2XK5 B;  3HUI A;  4AQ7 A;  4W9I A;  1E90 A;  4HAX B;  1DDM A;  3A1Q B;  3RNF C;  1HTQ A;  1J7C A;  2JVC A;  3KUD B;  1V89 A;  2YRY A;  3SYX A;  2WXM A;  4NSW A;  1F2R C;  2RNR B;  4K2O A;  1OQQ A;  1L6U A;  3WA0 A;  4RNA A;  4US8 A;  4DXA B;  2D9Z A;  4RMA A;  3V62 A;  1WI0 A;  5HFY A;  2KDB A;  4GU2 A;  4LNK A;  4MSM B;  1SBB B;  5CLL B;  4D6W A;  2NR2 A;  1XXG A;  2IFS A;  1ZP0 B;  2ICI A;  4PS3 A;  4FBJ B;  4F7Z A;  1J0G A;  3N1Y C;  3DBS A;  2J7Q B;  4EMO A;  3ZJT A;  4N58 A;  3E9P A;  3IT4 B;  3ZYY X;  1D4B A;  4L1B A;  4W9J A;  5IP4 D;  1AYF A;  1E7P B;  1NEK B;  2KQS A;  4ANW A;  2KWD A;  3T3N A;  3PZ7 A;  2B76 B;  2MHJ A;  3BY4 B;  3AED B;  5L83 A;  1FHO A;  1MIZ B;  4GXB A;  2JZ3 B;  5L95 C;  4DHJ B;  1E8Z A;  3ZTD A;  2LJ5 A;  1KC7 A;  3Q2A C;  1HB6 A;  1I4H A;  5AZF A;  3U4E G;  3B0A A;  3A33 B;  4NAM A;  2YVC A;  2QCZ A;  3TBL D;  2E6X A;  2WDR B;  1OEY J;  2AX5 A;  2D9V A;  2QMT A;  2M17 A;  2BS2 B;  5C6R A;  3O13 A;  3RNA C;  5E6J A;  2BBC A;  3EC8 A;  1FMA D;  3APD A;  1SE4 A;  1V9J A;  2D9W A;  4GSW A;  2NTT A;  2COP A;  2JSV X;  3AE3 B;  4MEL A;  5CTR C;  3AEF B;  2XK5 A;  2YF0 A;  2G35 A;  3KW5 B;  3UIP B;  2RD0 A;  4EZK A;  1KLG D;  3A1Q A;  4HRO A;  1UBI A;  4ZYN A;  4ZRI A;  3ULC A;  4DX9 0;  3EEC A;  3FC4 A;  2K9X A;  4LNF A;  5D2M B;  3E9O A;  2K0P A;  4XWW A;  2KWU B;  3RZF A;  5E6N A;  2DYM A;  3GYP A;  1WJ4 A;  2BKR B;  1FAO A;  5FK9 C;  2ROZ B;  4LNI A;  2GJY A;  2KLC A;  1VDV A;  1TJ6 A;  2C5L C;  2BWE S;  3V61 A;  3ENB A;  2BPS A;  1I35 A;  2HRJ A;  4I6L B;  2ABD A;  4P1B C;  5J17 A;  2Z0E B;  5BMH A;  2KJ6 A;  2JZZ A;  3KYC D;  3D32 A;  1WG7 A;  3M62 B;  1V5T A;  4KHA A;  1EUV B;  1P7F A;  3HHM A;  3TIX A;  1PGX A;  1MIX A;  1NTY A;  2DLB A;  5D7G A;  3B1L X;  3R2I A;  4PYU A;  2BYT A;  2FE8 A;  4A5K A;  3PHX B;  4RM9 A;  1E7V A;  5JHB A;  3UQA A;  1UEF A;  5HG2 A;  2X8X X;  2NS5 A;  2Q5W D;  2KWV B;  4JWS C;  2HJ8 A;  3BYT B;  1FXI A;  1GB1 A;  2LVP A;  4WJN A;  1WZ3 A;  3PGE A;  4XYC A;  2DKP A;  3SO6 A;  1JRU A;  1OY2 A;  2JYE A;  1UWM A;  1XD3 B;  2IPK D;  1HEZ E;  2Z0D B;  2INC C;  2KCJ A;  2WU2 B;  1TBE A;  5GOW B;  2DHZ A;  2R61 A;  1M7E A;  1E9M A;  1TXD A;  3MP9 A;  3ML8 A;  1YJI A;  2KAJ A;  4AWJ A;  5EE3 A;  2BWF A;  5IOI A;  4MSQ B;  1UF0 A;  4HSI A;  2KMA A;  4YON A;  3DPD A;  1W1H A;  2D2Q A;  3V6C B;  4JKG B;  2K39 A;  4I6P A;  3N1X C;  3E9S A;  1R4M I;  4ANU A;  4MH8 A;  3ML4 A;  2RLO A;  4BKS A;  4GMV A;  3ZKJ C;  4ZRP A;  3GYO A;  2ZZP B;  4LNO A;  2CHZ A;  2JRH A;  3Q8B A;  4HB4 B;  3SHQ A;  4A3P A;  3PVL A;  4TSS A;  1VBG A;  1OEY A;  2M0X A;  4KGS A;  4KSK C;  1QKZ A;  5JVL A;  1WGH A;  1GNU A;  4MM3 B;  2PKO A;  4NJC A;  3HIZ A;  2W55 A;  1EU4 A;  2ROV A;  4F7U P;  4ZRJ A;  4ILG B;  1OFF A;  2W3R A;  4BAX A;  4FUL A;  3BIN A;  3GE3 C;  1EF5 A;  2W3S A;  3AE2 B;  1YN3 A;  2FCM A;  2DN6 A;  4FXC A;  2PE9 A;  2V4I B;  2AYO B;  1WE6 A;  3AB5 A;  2XQN M;  3ZVV A;  1YD8 U;  1WFY A;  5I2M A;  3SBT A;  2ZCC A;  3CSF A;  5BMG A;  4AUQ C;  5I4D A;  2L7R A;  5HE2 A;  2L05 A;  2K00 A;  1EU3 A;  3KQ4 A;  1X1G A;  4PS7 A;  3QC8 B;  4MGY E;  2L1C A;  4ASW C;  1FM0 D;  5JZE B;  1EF1 A;  1SIF A;  1NU2 A;  3J9C A;  3ZO5 B;  4JKD A;  1GPX A;  1E8X A;  1TGZ B;  2WH5 A;  2V0G A;  5E6P A;  1DOI A;  2DFK A;  2OHF A;  2PMV A;  4BBK A;  3VXW A;  1RM6 C;  3PRM B;  3QK0 A;  1FEH A;  1LFD A;  3TUO A;  1JWS D;  2N4F A;  3AEA B;  4WQM A;  5J3T A;  3VH4 B;  5LG4 B;  2MFQ A;  4WJO A;  1NDD A;  4KHO A;  1SB3 C;  3ZRF A;  3K9O B;  1TY2 A;  2FCQ A;  4XGA B;  1JCK B;  3NWD A;  1PGB A;  2N1W A;  4IFS A;  2KVZ A;  3NG0 A;  5JHH A;  3VFK A;  2FJL A;  3SU8 X;  2J53 A;  3A4S C;  1XLP A;  1WJU A;  4K2P A;  4MH0 E;  5G55 A;  4DWF A;  1F77 A;  4JKG A;  5JLJ B;  1MG4 A;  1Q1O A;  5GXG B;  1K51 A;  4IOY X;  4NNJ B;  2AEH A;  3CST A;  1YQB A;  3Q3O C;  4GDL B;  4WWP A;  1VZ6 A;  4MEM A;  3RZW C;  4JK9 A;  3VDZ A;  5H92 C;  3OWE B;  4KKJ A;  3N3K B;  1X86 A;  4QJ3 B;  1RWS A;  1C79 A;  2J52 A;  3DBL B;  3VRA B;  3V3X A;  1BTN A;  1K8R B;  2MEK A;  4MM3 A;  3LJU X;  1WJ1 A;  5C3J B;  5C5B B;  4IDI A;  2D3G A;  1BXT A;  2JQR B;  3I9V 1;  2RUK B;  4AJY B;  3PEG A;  5FR3 A;  1Z5S B;  1U4A A;  3FIL A;  2Y5P A;  4B0M A;  2I5F A;  3GZN I;  1UBQ A;  1I4Q A;  2XNA C;  1E6E B;  1FNW A;  3W9C B;  3U30 A;  1ZXI A;  4HDQ A;  2AQ2 B;  2JZP A;  4AP4 C;  2EC1 A;  4IM2 A;  3PZ8 A;  2V3S A;  4TMA B;  2FBW B;  2IGG A;  1UUP A;  4OHJ A;  2B3A A;  1NTV A;  1FPY A;  2QSD A;  3PS6 A;  1L6V A;  1QOA A;  1YQ3 B;  4ZDV A;  1E8Y A;  1SIJ A;  4DIX A;  2YS3 A;  1VZ7 A;  3W2D A;  3OAW A;  2MWN B;  3FEH A;  1LXD A;  4TV3 A;  4W9D A;  1YOV B;  2M14 A;  1T0Q C;  1PDX A;  5EE0 A;  2J42 A;  2M19 A;  3IAM 1;  3AEC B;  1I2H A;  2R0D A;  3FAH A;  1AQC A;  2L3Z A;  1P9D U;  4RF1 A;  5TSS A;  2LGI A;  1EAZ A;  1ESF A;  4G11 A;  1TJE A;  5AEK B;  1YQ4 B;  1WXA A;  3PO0 A;  4W9L A;  1C76 A;  2QIE B;  3FSS A;  1DIK A;  2MA9 B;  4KAX B;  1L7Y A;  1BML C;  4HPL B;  4ZYS A;  4J3O D;  2N9X A;  1NYQ A;  1IGD A;  2KC2 A;  4A9A A;  1TS4 A;  4HVB A;  1X1M A;  2FCN A;  5DIF B;  3RCZ A;  3L13 A;  4KKI A;  4BOZ B;  3T06 A;  4OT1 A;  4GDL A;  5AUK A;  4HEA 1;  2LEK A;  5AZH A;  4C80 A;  3OJ3 A;  4A6K A;  1XX0 A;  2M56 B;  1W1D A;  3A9J A;  4TKN A;  1TTN A;  2H88 B;  2L8J A;  3W1Y A;  1LB1 A;  1JRP A;  2J4X A;  1C1Y B;  3JYU A;  4HAU B;  1ZXH A;  1C9F A;  1K50 A;  3RFZ B;  4ARC A;  5KQ1 A;  3DVG Y;  4K81 A;  4Q2J A;  4OVV A;  1U27 A;  4IUM B;  3PP2 A;  4IOI E;  5C5B A;  1J7B A;  1AWE A;  2YSZ A;  1NEN B;  2INP E;  3C0R B;  3ZQ4 A;  2C9W B;  5J2R A;  2RRF A;  4OZB A;  1XLQ A;  4WWM A;  2E2X A;  1A5R A;  2G4S A;  1P3Q U;  1VD2 A;  4JWU C;  3RNG C;  1WRD B;  1ZC3 B;  1KH0 A;  4EJN A;  2RGN B;  3N20 C;  4EKU A;  2KVR A;  3AEE B;  3DDC B;  1FXA A;  2MWS B;  3TEW A;  1MI0 A;  2WHI A;  2I1J A;  2KIE A;  1M4V A;  3W5U B;  1DGJ A;  4ZRQ A;  3Q69 A;  2JUO A;  3NSU A;  4H8S A;  3L08 A;  3DHH C;  1KFY B;  4WH4 A;  3VTW A;  2KK8 A;  2I1K A;  1QT9 A;  2NMB A;  1I4P A;  3ZNG C;  2Z0Q A;  4NJ6 A;  2GI9 A;  2K2J A;  3PRZ A;  2FUG 1;  3NY5 A;  3PT2 B;  1FFV A;  3LJ3 A;  1WYG A;  2WNM A;  3IVF A;  3UIN B;  3ZJV A;  2MBE A;  3E9L A;  2XEW A;  2ZW1 A;  1N60 A;  1CMX B;  3Q3N C;  1TT5 B;  1X05 A;  1TKE A;  4XWT A;  2JT4 B;  5IJM A;  4N9F 4;  4GB9 A;  4CYE A;  2MRP A;  3AEB B;  4DXG A;  2JF5 A;  3TW1 A;  3KYD D;  4ZOH C;  1ST7 A;  1F0Z A;  2PVG C;  5T8I A;  5M4Y B;  3ENE A;  4XE0 A;  4H2A A;  2KTR B;  1UEL A;  1FIQ A;  1L5P A;  4NQK E;  5IN7 A;  1R4N B;  4GNK B;  3N30 A;  4JKB A;  3KRX A;  1UNP A;  2KC1 A;  2KUQ A;  1K53 A;  2L1A A;  2GB1 A;  3EFC A;  4A90 A;  5C2T B;  3OLM D;  1XF5 L;  3DBL I;  4G0N B;  2KYW A;  2DYN A;  3A4R A;  3TSS A;  3QCA A;  4J6I A;  3BK2 A;  2N1V A;  1PQS A;  2VSZ A;  1LGR A;  2Z4D A;  3NWA A;  2N9L A;  2D3C A;  4WJ7 A;  1QOG A;  3EPY A;  2DWQ A;  4K17 A;  1WR6 E;  3NS8 A;  1R4M B;  1XT9 B;  1V1O A;  4CHK A;  1ISN A;  3K9P B;  4XZ4 A;  2LHD A;  3CXB B;  2KDI A;  5CLQ B;  4M8N A;  1MFW A;  2KJR A;  2VH1 A;  1FO4 A;  2JX5 A;  2RPV A;  2RGF A;  2G9H D;  3ZDM C;  1EWC A;  3QA8 A;  1KF6 B;  4DBB A;  4Z2N A;  2XBB C;  2MCN B;  2MX2 A;  2Y3A A;  5CHF A;  1XOD A;  2KUP A;  3E66 A;  3KZ1 A;  3WIM A;  4F1S A;  3AE8 B;  1Y5O A;  3B08 A;  2KOX A;  3QHT A;  2MJD A;  4LDT D;  5CHV C;  4LJO B;  3AE9 B;  2GBK A;  3P4S B;  2LOX A;  2GOW A;  2O2V B;  3MHS D;  3R7Q A;  2BS4 B;  4JX1 C;  3SFE B;  4TQ0 A;  2EMS A;  5DHA B;  2DYQ A;  2KNB A;  4MY6 A;  1K52 A;  2KIG A;  4RGT A;  1KRH A;  1GC7 A;  5C16 A;  1D5M C;  5FI0 A;  3Q3J A;  2D5G A;  2O6V B;  4KDL B;  3N1Z C;  3IHP C;  1WGG A;  3URY A;  1XD4 A;  2Y8F A;  1P3R A;  1RAX A;  1H8C A;  5D3Y A;  2LI5 A;  2MJE A;  1U5F A;  2MKR A;  4HB2 B;  1PFD A;  5D3V A;  1SXT A;  1HA5 A;  3QWM A;  3ECI A;  3NJT A;  1N63 A;  5MPO A;  1DOY A;  3FP5 A;  5IRS A;  2KTR A;  2QKL A;  3EGR A;  3NHE B;  4BOS C;  1ZDX A;  2X0S A;  4MAC A;  1ZC4 B;  1SE2 A;  3SV1 A;  4JPS A;  2KHW B;  3ALB A;  2MQJ A;  1WY8 A;  5G2N A;  4M8M A;  4YT0 B;  4XWX A;  3FKY A;  5HHD G;  2WDT B;  1IYF A;  5LON B;  2L76 A;  1DRO A;  2AL3 A;  1YMH E;  3WYF B;  5AUI A;  4L23 A;  2W2X D;  3QAQ A;  2UVM A;  2KJH B;  1GGO A;  2L2I A;  2N23 A;  3R2T A;  2LJI A;  1J19 A;  1AWD A;  3AJ4 A;  1KZ7 A;  1HB8 A;  1T6B X;  3DXD A;  1N6Z A;  2GBN A;  4JGH B;  1VCB A;  3IXS A;  2I38 A;  1OQR A;  2GCJ A;  2KT7 A;  3P42 A;  5FR6 A;  1WGD A;  3NWF A;  3CMM B;  1E10 A;  1ROE A;  4RH6 A;  1TS2 A;  1QC6 A;  3W5V B;  1YJ1 A;  1CQV A;  4JKC A;  4GIV A;  4PQ0 A;  2FJ9 A;  3JVZ X;  3EHV A;  3IFW B;  4W9H A;  1DDW A;  1QOB A;  3H6N A;  3ONS A;  2IO1 B;  1KM7 A;  4JKH A;  5JHG A;  2NZ8 B;  1U2B A;  1P1A A;  4CHJ A;  3IT6 B;  4MDK E;  3R3M A;  2ASQ A;  1EO6 A;  2O2V A;  3I57 A;  3T8M A;  3GZN B;  5D3D A;  1HZ6 A;  2DEN B;  3I63 C;  2R2Q A;  2PW9 A;  1MVK A;  3TL5 A;  2K8E A;  2QJL A;  5DPR A;  2AWT A;  1TIF A;  2O6V A;  2XN9 C;  3M95 A;  1ET6 A;  5D3W A;  2PEA A;  4NQL B;  2PIA A;  5D27 A;  1QQG A;  2DA0 A;  3L16 A;  1B1Z A;  3RD2 A;  1YIW A;  3GS2 A;  4FHJ A;  2CKH B;  4P6V F;  2IO3 B;  4IM0 A;  2YS1 A;  3V05 A;  4B6W A;  3DBR B;  2D11 A;  1OGW A;  2C7M B;  1L0Y B;  4IC7 B;  2D3A A;  3AXC A;  1C4A A;  1R4N I;  2WS3 B;  4G50 A;  2J0M A;  2P0F A;  2A5U A;  2A4Z A;  3GB1 A;  4RM8 A;  3ETR A;  2G3Q B;  2J0J A;  4YSY B;  2CAY A;  4WVF B;  1PMS A;  2AQ1 B;  2MDX A;  1WX7 A;  1OQN A;  4RGM A;  2JWZ A;  4E71 A;  1J7A A;  4YWG G;  3NVV A;  1N61 A;  5D94 A;  2WXH A;  1E5W A;  2NBU A;  3ZUN A;  3LYY A;  4IW0 A;  4YSX B;  2M38 A;  5D3X A;  2Z14 A;  2RPQ A;  4ILJ A;  4A6F B;  2DZJ A;  4WUR A;  3MC0 B;  1CZP A;  4GOU A;  3VUY A;  4PK1 A;  3HIE A;  3KUC B;  2KN5 A;  1XLN A;  2M4N A;  4EUT A;  3NS1 A;  2I2Y A;  1XEE A;  2V1Y A;  1WX9 A;  2MW5 A;  3IG3 A;  3FLV A;  2MBB B;  2GBM A;  4B6H A;  4A6Q A;  3A8Q A;  2C7N B;  3H7P B;  1G6J A;  1VRA B;  1F1H A;  2VRR B;  1PLS A;  1P5T A;  3V60 A;  3U12 A;  2MH7 A;  3SNH A;  3T9L A;  1OMW A;  1WXV A;  3W1S C;  2HE7 A;  2E3T A;  1R7S A;  2DHJ A;  2RSU A;  4W9C A;  2CQU A;  2RSG A;  1V81 A;  3PLU A;  3ZDT A;  1JRO A;  2N0Y A;  3ZNI D;  3AEG B;  1K5D B;  2BKF A;  2BS3 B;  2GS0 A;  3RI7 C;  2LKO A;  4HKQ A;  3AV8 A;  1KZG A;  1ACC A;  4BKG A; 
#chains in the Genus database with same CATH homology
 2GMI C;  4OVU A;  1U5E A;  2KAN A;  4D0N B;  4CHM A;  2Y5B B;  1ACA A;  2BYV E;  1RJ2 A;  1XCG A;  3ZW3 A;  3QBV B;  2QHO A;  4HAV B;  3APF A;  2QKM A;  4HHV A;  1Q67 A;  2MP2 B;  3APC A;  5KCV A;  2KLG A;  4LJP B;  1WJM A;  4K7U A;  4NJ7 A;  1V6E A;  1JDE A;  3QIJ A;  2J59 M;  3NZS A;  1FOE A;  1BAK A;  1Q5W B;  5LXH A;  5HE0 A;  2NCN A;  2DYB A;  4BBN C;  2V4L A;  3QQ8 B;  3DCG A;  4HLE A;  4KZC A;  2ELA A;  1D3Z A;  4A6F A;  2KO3 A;  2M1M A;  4AOF A;  2N7E A;  2NVU I;  4LDT B;  3MPX A;  2VKI A;  4W9F A;  3H9D A;  4KHB B;  3H7P A;  1L2N A;  2ZJD A;  1TZ1 A;  3PTF C;  5TR5 A;  5FI1 A;  2K6Q A;  4WWN A;  2KGX B;  2LG1 A;  2DX5 B;  1Y8R C;  2JY6 A;  3W1S A;  3PG7 A;  1NVL A;  2LBB A;  3HW2 B;  1UH6 A;  1MPH A;  3JSV B;  4JLC A;  4KSL C;  2Z0P A;  2LRW A;  2W2X C;  3ZNH B;  1FHX A;  3ZNZ B;  2FCS A;  3VIA A;  2D9X A;  3MJW A;  3O96 A;  4TYZ A;  2EMT A;  1QZE A;  4B9K A;  2FNJ B;  4DHJ D;  3DBR I;  2MP2 A;  1M94 A;  4TQ1 A;  2R09 A;  2K8H A;  3VVW B;  1NTI A;  2LXA A;  4E3C A;  1I7A A;  5C1Z A;  1WMH B;  1YX5 B;  1X1F A;  3DVN V;  4DX8 A;  1UZX B;  5KHO A;  1WVH A;  4HAT B;  4ANX A;  1TQZ A;  2K25 A;  1J0W A;  1T0Y A;  3AUL A;  4M0W B;  5E6O A;  3F0W A;  4JL9 A;  3MTN B;  4HPM B;  5JH5 C;  3NOB A;  4BKS D;  1UNQ A;  1IP9 A;  2DYO A;  2N7D A;  4EZJ A;  5KQ4 A;  3ODO A;  4HCN B;  4F7H A;  1KI1 B;  3I3T B;  4DHZ E;  1KBL A;  4KZ0 A;  2CRF A;  1H4R A;  2D9Y A;  2K8B A;  1WIA A;  4DDI D;  2DHI A;  2DX5 A;  2N9E B;  3DXE A;  1XKE A;  2FAZ A;  1LQB A;  2ZEQ A;  3WAO A;  2UZR A;  1U5G A;  1XR0 B;  3JSV A;  4EOY A;  3OJ4 B;  4MK0 A;  4YL8 A;  2R2O A;  3VHT C;  2KWC A;  2WX1 A;  1RFA A;  4BVU C;  1FHW A;  1DDV A;  4F7G A;  3X0W A;  3DVG X;  1UNR A;  2Z59 B;  2KTF A;  2COC A;  3PZD A;  2YT0 A;  3PHW B;  4BFR A;  2G45 B;  3KH0 A;  1GC6 A;  5IA7 A;  4K1R B;  3PPA A;  2KDE B;  1SHC A;  2COD A;  2P0D A;  2CHW A;  2UYZ B;  3V6E B;  2ELB A;  1WMH A;  4IWP A;  3L10 B;  1P6S A;  1BWN A;  3H1U A;  5D6J B;  4EZL A;  5DH9 B;  3N7C A;  2KD0 A;  3L54 A;  2L0T A;  3U7D A;  2IZV B;  4W9G A;  3FM8 C;  1MAI A;  1S1Q B;  4JK8 A;  2LAS A;  3TJP A;  2Y7B A;  4FHK A;  5DPS A;  2BYE A;  5DPW A;  4MGI E;  4WQO B;  4DBG A;  2WWZ A;  2K2U A;  5L81 A;  1V86 A;  3D8E A;  3KSY A;  3SD5 A;  3QJZ A;  3SDL C;  2YLM A;  2J0K A;  3R66 C;  2NPT B;  2LXC A;  2P0H A;  2UZS A;  4JIO U;  4KDI C;  3DOW A;  3ZLZ A;  2K6D B;  4ANV A;  2KFJ A;  3IBE A;  4GDK B;  3ODX A;  2L0F A;  4P7I A;  1RLF A;  1NI2 A;  1GUA B;  3WAL A;  3R7R A;  2C60 A;  1WGR A;  3ZIM A;  1WR1 A;  3WAM A;  4ICU A;  2DX1 A;  4F8C B;  1V5P A;  4MT7 A;  4JQW C;  2X18 A;  2UWQ A;  1RRB A;  2COF A;  1H10 A;  3TFM A;  5AZG A;  4ILH A;  2LUL A;  3ULB A;  2NBW B;  3SUZ A;  3AI5 A;  2DLW A;  2JPH A;  3VTU A;  2GBJ A;  3RUI B;  3VUX A;  2BCJ A;  3UGB B;  2C7H A;  2LZ6 A;  2FUH B;  4NY0 A;  5LOP B;  2K1F A;  1KOT A;  2LGD A;  2REX A;  1MKE A;  4II3 B;  3M1I B;  4WJQ A;  1WYW B;  2WYQ A;  2PZ1 A;  3X23 A;  4A20 A;  5JP4 A;  2COA A;  2KZR A;  1UD7 A;  3PV1 A;  3LDZ E;  4PYZ A;  3PVW A;  4HB3 B;  2NPT A;  2W9N A;  1AAR A;  2YS5 A;  3A9K B;  2FDQ A;  5DPT A;  2LVQ A;  3QWZ B;  3H7S A;  4AJW A;  3PRP B;  1V88 A;  3RT3 B;  2Y8G A;  4GDK A;  3DVN U;  3RCP A;  4HXD A;  2KQ7 A;  1U29 A;  2MBO A;  4JKF A;  3BJI A;  2DIK A;  2V76 A;  1K5G B;  5BO4 B;  4G3X B;  2RVB B;  1VBH A;  4IAP A;  1WX8 A;  4FJV B;  3PRE A;  4FAD A;  3DXC A;  4BKT A;  2KX3 A;  3VH3 B;  2FIF A;  2ZCB A;  2DZK A;  3CIK A;  2P8V A;  1F9J A;  2OTX A;  3D8F A;  1DYN A;  2DZI A;  4HK2 A;  2DZM A;  3ZVR A;  4DHZ B;  3RYT A;  4XC2 A;  2Q13 A;  4JK7 A;  1WZ0 A;  2MSE D;  4PNK A;  3ODW A;  3DQV A;  2D4Q A;  1PFJ A;  4BBN F;  1M7R A;  1HBK A;  1ZSQ A;  3DBH I;  4HJK A;  1WM3 A;  3ZTC A;  5C79 A;  3UQB A;  5C23 A;  5J3Y A;  4FJY A;  3S2A A;  5KHQ A;  1GG3 A;  4FA6 A;  4II2 B;  2BGF A;  4L6E A;  4K7S A;  5IAA C;  5GMV A;  4EEW A;  2BF8 B;  1Q0W B;  5HKH A;  3A9K A;  3L0W B;  4XX5 A;  5DHF B;  4W9K A;  1FXT B;  1UPQ A;  4GOC A;  4X57 B;  4LCD E;  1ZW7 A;  5J3Q A;  1XQQ A;  3QAR A;  2N9P C;  3VTV A;  3SBG A;  1FGZ A;  2MBH A;  3ML9 A;  1S3S G;  3VAW A;  2LOZ A;  1WGY A;  4E74 A;  1WM2 A;  3OAN A;  2MBQ A;  4FLH A;  2DKQ A;  2KXJ A;  2ZVO A;  3VUW A;  1EVH A;  2IY1 B;  1IRS A;  4ICV A;  1MK7 B;  4WSF A;  4DK5 A;  3AU4 A;  3EFU A;  1V49 A;  2ZNV C;  2HD5 B;  2IYD B;  1WJ6 A;  2RR9 A;  4DDG D;  2KFK B;  1J8C A;  3A8P A;  2ZNV B;  5HE1 A;  1X11 A;  3GOE A;  1UGM A;  3KRW A;  2JXX A;  4ZRK A;  2BYF A;  3WAP A;  1WGU A;  1MK9 B;  4CO7 A;  1Z87 A;  2G4D B;  3O65 B;  3UIO B;  1SE9 A;  1ZM0 A;  2D07 B;  3VOQ A;  3F5R A;  2IO0 B;  4EFO A;  2IY0 B;  3MDB C;  4IM3 A;  1P98 A;  4HAW B;  4Z2M B;  2HTH B;  1V61 A;  2LGY A;  1IPG A;  4HDO A;  2KMC A;  1LW3 A;  3JW0 X;  1U5D A;  2OJR A;  2DHK A;  4HAZ B;  2ZPN A;  4FJZ A;  1ZVR A;  1WXM A;  5LXI B;  1WH3 A;  3A98 B;  3RUL A;  2VRW B;  4GGQ A;  2IO2 B;  2DAF A;  1EGX A;  3HK0 A;  1UPR A;  4KIK B;  3VQI A;  2LUE A;  3G9W A;  1N3H A;  2H7E A;  4HWI B;  2MLB A;  3D8D A;  1P0R A;  1MG8 A;  5LLI A;  1V5M A;  3A9J B;  1I42 A;  2O6V D;  2KFK A;  3TVV A;  1B55 A;  3KY9 A;  4HCP B;  4WAA A;  2I5C A;  1C3T A;  1HE8 A;  2KKC A;  4GZU A;  3TCA A;  3NZU A;  3HM3 A;  2PJH A;  1BT0 A;  3TMP B;  1FGY A;  3M63 B;  1Z2M A;  1KJT A;  1ZKH A;  1WF9 A;  2LD9 A;  3PSC A;  4IWO A;  4FN2 A;  2HTH A;  2CB8 A;  4MJS B;  2CY4 A;  2CS4 A;  2NBV B;  3N32 A;  5DI9 B;  3WAN A;  3PLV A;  3KVF B;  2JP2 A;  2OQB A;  2CHX A;  1SGH A;  3Q3F A;  4NAW B;  2PPH A;  2K8C A;  4IWQ A;  3P7Z A;  4KIK A;  2FID A;  3PVU A;  1V2Y A;  3PSE B;  4GMX B;  5J18 A;  3UZT A;  1WE7 A;  2YT1 A;  3CF6 E;  2LVO A;  2LWP A;  3P6A A;  4WJP A;  4GPT B;  4GN1 A;  4WWO A;  2AL6 A;  2EJ8 A;  3HM6 X;  4A3O A;  1YX6 B;  4I6N B;  1RRP B;  5EDS A;  2PE6 B;  1KLV A;  3ZRC A;  3V5W A;  1OQY A;  4A6H A;  3P2B A;  1ZGU B;  1V5O A;  1BTK A;  4K7W A;  4IG7 B;  4NPN A;  3M3J A;  2KX0 A;  4MJS A;  3HQC A;  2LRU A;  5DCN A;  4B95 A;  4URK A;  5JHA A;  3L17 A;  4JKE A;  4C0A A;  3QX1 A;  1E8W A;  3AU5 A;  4MGZ E;  2CU1 A;  2OOB B;  2DAJ A;  4W9E A;  5CX3 A;  1E7U A;  1V80 A;  3UF8 A;  1W1G A;  2ZPY A;  4NAW A;  2L00 B;  2ZVN A;  4KVG B;  2W2W A;  2WX0 A;  4PS8 A;  1LM8 B;  4MGK E;  2DTC A;  3KUZ A;  2M8S A;  2KDF B;  1WXS A;  2CR5 A;  2RQ1 A;  2IBI B;  4HB0 B;  2GBR A;  1DBH A;  5EFX A;  4JKA A;  1WGQ A;  5CHW A;  4KV2 A;  2Z0O A;  1WI1 A;  2LYD A;  2GCL A;  4TUU A;  2JRI B;  1V5U A;  1GJZ A;  1WJN A;  1OTR B;  4Y94 A;  2ADZ A;  4HAY B;  3U8Z A;  2LGX A;  2IYB A;  5HE3 A;  2EKE C;  1FB8 A;  1Y19 B;  3TO1 A;  2R82 A;  1NBF C;  2H7D A;  2D10 A;  2CY5 A;  2XK5 B;  4W9I A;  1E90 A;  4HAX B;  1DDM A;  3A1Q B;  2JVC A;  3KUD B;  1V89 A;  2YRY A;  3SYX A;  4NSW A;  2RNR B;  4K2O A;  3WA0 A;  4DXA B;  2D9Z A;  4RMA A;  3V62 A;  1WI0 A;  2KDB A;  4GU2 A;  4MSM B;  5CLL B;  2NR2 A;  2IFS A;  4PS3 A;  4FBJ B;  4F7Z A;  1J0G A;  3DBS A;  2J7Q B;  4EMO A;  3E9P A;  4W9J A;  2KQS A;  4ANW A;  3BY4 B;  5L83 A;  1FHO A;  1MIZ B;  4GXB A;  2JZ3 B;  5L95 C;  4DHJ B;  1E8Z A;  3ZTD A;  2LJ5 A;  1KC7 A;  5AZF A;  1HB6 A;  3B0A A;  3A33 B;  2YVC A;  3TBL D;  1OEY J;  2D9V A;  2M17 A;  5C6R A;  3EC8 A;  3APD A;  1V9J A;  2D9W A;  4GSW A;  2COP A;  4MEL A;  5CTR C;  2XK5 A;  2YF0 A;  2G35 A;  3KW5 B;  3UIP B;  2RD0 A;  4EZK A;  3A1Q A;  1UBI A;  4ZYN A;  4ZRI A;  3ULC A;  4DX9 0;  3EEC A;  5D2M B;  3E9O A;  2KWU B;  3RZF A;  5E6N A;  2DYM A;  3GYP A;  1WJ4 A;  2BKR B;  1FAO A;  2ROZ B;  2GJY A;  2KLC A;  1TJ6 A;  2C5L C;  2BWE S;  3V61 A;  3ENB A;  2BPS A;  1I35 A;  2HRJ A;  4I6L B;  2ABD A;  5J17 A;  2Z0E B;  2KJ6 A;  2JZZ A;  3KYC D;  3D32 A;  1WG7 A;  3M62 B;  1V5T A;  4KHA A;  1EUV B;  3HHM A;  3TIX A;  1MIX A;  1NTY A;  5D7G A;  3B1L X;  4PYU A;  4A5K A;  3PHX B;  4RM9 A;  1E7V A;  5JHB A;  3UQA A;  1UEF A;  2NS5 A;  2KWV B;  2HJ8 A;  2LVP A;  4WJN A;  1WZ3 A;  3PGE A;  2DKP A;  3SO6 A;  1JRU A;  1OY2 A;  1XD3 B;  2Z0D B;  2KCJ A;  1TBE A;  5GOW B;  2DHZ A;  1M7E A;  1TXD A;  3ML8 A;  4AWJ A;  2BWF A;  4MSQ B;  2KMA A;  4YON A;  3DPD A;  1W1H A;  2D2Q A;  3V6C B;  4JKG B;  2K39 A;  4I6P A;  1R4M I;  4ANU A;  3ML4 A;  2RLO A;  4BKS A;  4GMV A;  3ZKJ C;  3GYO A;  2ZZP B;  2CHZ A;  2JRH A;  4HB4 B;  3SHQ A;  4A3P A;  3PVL A;  1VBG A;  1OEY A;  2M0X A;  4KSK C;  5JVL A;  1WGH A;  1GNU A;  3HIZ A;  2ROV A;  4F7U P;  4ZRJ A;  4ILG B;  4FUL A;  3BIN A;  1EF5 A;  2FCM A;  2DN6 A;  2PE9 A;  2AYO B;  1WE6 A;  2XQN M;  3ZVV A;  1YD8 U;  1WFY A;  3SBT A;  2ZCC A;  3CSF A;  4AUQ C;  2L7R A;  5HE2 A;  2L05 A;  2K00 A;  1X1G A;  4PS7 A;  3QC8 B;  4MGY E;  2L1C A;  4ASW C;  5JZE B;  1EF1 A;  1SIF A;  1NU2 A;  3ZO5 B;  4JKD A;  1E8X A;  1TGZ B;  2WH5 A;  5E6P A;  2DFK A;  4BBK A;  3VXW A;  3PRM B;  3QK0 A;  1LFD A;  2N4F A;  5J3T A;  3VH4 B;  2MFQ A;  4WJO A;  1NDD A;  4KHO A;  3ZRF A;  3K9O B;  2FCQ A;  2N1W A;  4IFS A;  5JHH A;  3VFK A;  2FJL A;  3SU8 X;  3A4S C;  1WJU A;  4K2P A;  4MH0 E;  5G55 A;  4DWF A;  4JKG A;  5JLJ B;  1Q1O A;  4IOY X;  4NNJ B;  2AEH A;  3CST A;  1YQB A;  4GDL B;  4WWP A;  4MEM A;  3RZW C;  4JK9 A;  3VDZ A;  3N3K B;  1X86 A;  1BTN A;  1K8R B;  4MM3 A;  3LJU X;  1WJ1 A;  5C5B B;  2D3G A;  2RUK B;  4AJY B;  3PEG A;  1Z5S B;  1U4A A;  2I5F A;  3GZN I;  1UBQ A;  3U30 A;  4HDQ A;  4AP4 C;  2EC1 A;  4IM2 A;  2V3S A;  2B3A A;  1NTV A;  3PS6 A;  4ZDV A;  1E8Y A;  2YS3 A;  3OAW A;  2MWN B;  3FEH A;  1LXD A;  4TV3 A;  4W9D A;  2M14 A;  1I2H A;  2R0D A;  1AQC A;  2L3Z A;  1P9D U;  1EAZ A;  4G11 A;  5AEK B;  1WXA A;  4W9L A;  3FSS A;  1DIK A;  2MA9 B;  4KAX B;  1L7Y A;  4HPL B;  2N9X A;  2KC2 A;  4HVB A;  1X1M A;  2FCN A;  5DIF B;  3RCZ A;  3L13 A;  4BOZ B;  3T06 A;  4GDL A;  5AZH A;  3OJ3 A;  4A6K A;  1XX0 A;  1W1D A;  3A9J A;  4TKN A;  1TTN A;  3W1Y A;  2L8J A;  1LB1 A;  3JYU A;  1C1Y B;  4HAU B;  5KQ1 A;  3DVG Y;  4K81 A;  4OVV A;  1U27 A;  4IUM B;  3PP2 A;  5C5B A;  1AWE A;  2YSZ A;  3C0R B;  2C9W B;  5J2R A;  2E2X A;  1A5R A;  2G4S A;  1P3Q U;  1VD2 A;  1WRD B;  1ZC3 B;  4EJN A;  2RGN B;  4EKU A;  2KVR A;  3DDC B;  2MWS B;  2I1J A;  2JUO A;  3NSU A;  4H8S A;  3L08 A;  3VTW A;  2KK8 A;  2I1K A;  2NMB A;  3ZNG C;  2Z0Q A;  4NJ6 A;  2K2J A;  3PRZ A;  3NY5 A;  3PT2 B;  3LJ3 A;  3UIN B;  3IVF A;  2MBE A;  3E9L A;  2XEW A;  1CMX B;  1X05 A;  2JT4 B;  5IJM A;  4N9F 4;  4GB9 A;  4CYE A;  2MRP A;  2JF5 A;  3TW1 A;  3KYD D;  1ST7 A;  3ENE A;  2KTR B;  1UEL A;  4NQK E;  3N30 A;  4JKB A;  3KRX A;  1UNP A;  2KC1 A;  3OLM D;  3DBL I;  4G0N B;  2DYN A;  3A4R A;  3QCA A;  4J6I A;  2N1V A;  1PQS A;  2VSZ A;  4WJ7 A;  3EPY A;  4K17 A;  1WR6 E;  3NS8 A;  1XT9 B;  4CHK A;  1ISN A;  3K9P B;  4XZ4 A;  3CXB B;  2KDI A;  5CLQ B;  4M8N A;  2KJR A;  2RGF A;  3ZDM C;  3QA8 A;  4DBB A;  4Z2N A;  2XBB C;  2MCN B;  2MX2 A;  5CHF A;  1XOD A;  2KUP A;  3E66 A;  3KZ1 A;  3WIM A;  4F1S A;  1Y5O A;  3B08 A;  2KOX A;  3QHT A;  5CHV C;  4LDT D;  4LJO B;  2GBK A;  2LOX A;  2GOW A;  2O2V B;  3MHS D;  3R7Q A;  4TQ0 A;  2EMS A;  5DHA B;  2DYQ A;  2KNB A;  4MY6 A;  1GC7 A;  5C16 A;  3Q3J A;  5FI0 A;  2O6V B;  4KDL B;  3IHP C;  1WGG A;  1XD4 A;  2Y8F A;  1P3R A;  1RAX A;  1H8C A;  5D3Y A;  2LI5 A;  1U5F A;  2MKR A;  4HB2 B;  5D3V A;  3QWM A;  3ECI A;  3FP5 A;  2KTR A;  2QKL A;  3NHE B;  4BOS C;  2X0S A;  1ZC4 B;  3SV1 A;  2KHW B;  3ALB A;  2MQJ A;  1WY8 A;  5G2N A;  4M8M A;  4XWX A;  1IYF A;  2WDT B;  5LON B;  2L76 A;  1DRO A;  2AL3 A;  3WYF B;  2W2X D;  3QAQ A;  2UVM A;  2KJH B;  1GGO A;  2L2I A;  2N23 A;  1J19 A;  3AJ4 A;  1KZ7 A;  1HB8 A;  3DXD A;  2GBN A;  4JGH B;  1VCB A;  2GCJ A;  5FR6 A;  1WGD A;  3CMM B;  1QC6 A;  1YJ1 A;  4JKC A;  4GIV A;  4PQ0 A;  2FJ9 A;  3JVZ X;  3EHV A;  3IFW B;  4W9H A;  1DDW A;  3H6N A;  3ONS A;  2IO1 B;  1KM7 A;  4JKH A;  5JHG A;  2NZ8 B;  1U2B A;  1P1A A;  4CHJ A;  4MDK E;  3R3M A;  2ASQ A;  1EO6 A;  2O2V A;  3T8M A;  2DEN B;  2R2Q A;  3TL5 A;  5DPR A;  2AWT A;  2O6V A;  3M95 A;  5D3W A;  2PEA A;  4NQL B;  5D27 A;  1QQG A;  2DA0 A;  3L16 A;  3RD2 A;  1YIW A;  4FHJ A;  2CKH B;  2IO3 B;  4IM0 A;  2YS1 A;  4B6W A;  2D11 A;  1OGW A;  2C7M B;  4IC7 B;  3AXC A;  1R4N I;  4G50 A;  2J0M A;  2P0F A;  2A5U A;  2A4Z A;  4RM8 A;  2G3Q B;  2J0J A;  2CAY A;  4WVF B;  1PMS A;  2MDX A;  1WX7 A;  1OQN A;  4E71 A;  2JWZ A;  5D94 A;  1E5W A;  2NBU A;  3ZUN A;  4IW0 A;  2M38 A;  5D3X A;  2RPQ A;  4ILJ A;  4A6F B;  2DZJ A;  3VUY A;  3KUC B;  2KN5 A;  2M4N A;  4EUT A;  2V1Y A;  1WX9 A;  2MW5 A;  3IG3 A;  3FLV A;  2MBB B;  2GBM A;  4B6H A;  3A8Q A;  2C7N B;  3H7P B;  1G6J A;  2VRR B;  1PLS A;  1P5T A;  3V60 A;  3SNH A;  3T9L A;  1OMW A;  1WXV A;  3W1S C;  2HE7 A;  2DHJ A;  2RSU A;  4W9C A;  2CQU A;  2RSG A;  1V81 A;  3PLU A;  3ZDT A;  2N0Y A;  3ZNI D;  1K5D B;  2BKF A;  2GS0 A;  2LKO A;  1KZG A;  4BKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...