4CYEA

Crystal structure of avian fak ferm domain fak31-405 at 3.2a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
330
structure length
330
Chain Sequence
b'MERVLKVFHYFENSSEPTTWASIIRHGDATDVRGIIQKIVDCHKVKNVACYGLRLSHLQSEEVHWLHLDMGVSNVREKFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGANPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FOCAL ADHESION KINASE 1
molecule tags Transferase
source organism Gallus gallus
publication title Phosphatidylinositol 4,5-Bisphosphate Triggers Activation of Focal Adhesion Kinase by Inducing Clustering and Conformational Changes.
pubmed doi rcsb
total genus 95
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4cyeA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4cyeA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4cyeA01
3A33B 3F5RA 3PRPB 1LQBA 4NJ7A 1V6EA 4FHKA 4G3XB 2GJYA 4ZDVA 1XQQA 1M7RA 3X23A 1WGQA 1OQNA 3ZIMA 3F0WA 3FLVA 2COFA 1SE9A 3WAOA 4DXAB 1XODA 1Z87A 5JLJB 4ANUA 2LVOA 4BBNC 1MIXA 1S3SG 2KLCA 1FAOA 2HJ8A 1ISNA 2KQSA 1UNPA 3ULBA 2KLGA 4KHBB 4M0WB 3W1YA 5EDSA 1F9JA 2LULA 4PQ0A 4AWJA 1PMSA 3D8FA 2DYMA 1RRBA 5G2NA 2N9PC 3ML8A 4TV3A 3PSEB 2K8CA 2M0XA 4F8CB 4NAWB 2CQUA 4DDGD 2D9WA 2DYOA 2FJ9A 1H4RA 3DXDA 4CHJA 1X1GA 2L2IA 1BTKA 1E7VA 4MSQB 1RRPB 3G9WA 1WGDA 1WE7A 3BY4B 1U5DA 4K81A 1GG3A 2KX3A 2I5CA 4FN2A 3WA0A 2BPSA 2KDBA 1V86A 2G45B 2IO0B 2XEWA 2R0DA 3B0AA 4HAVB 3KUDB 3QQ8B 4W9CA 2K2JA 3B08A 5BO4B 3W1SC 5CHWA 2IYBA 3MPXA 1HBKA 4KHOA 2WX0A 1U5FA 4FHJA 4AOFA 4WWPA 1PLSA 2BYVE 2FJLA 3VIAA 4IUMB 2CB8A 4EZJA 3QK0A 1GJZA 4B6HA 3A8PA 3JSVB 3P7ZA 2KANA 1FGZA 3ZKJC 4EZLA 1TGZB 5AEKB 4BKSD 3KSYA 3VXWA 4AJYB 2RGNB 2CAYA 4WJ7A 2W2WA 5HE1A 2JRIB 2ZCCA 2KKCA 2P0HA 3MDBC 3KUZA 3PVLA 2PEAA 4A6HA 2LGDA 2HE7A 4GIVA 4P7IA 2DLWA 1B55A 3CIKA 3HHMA 1PFJA 2NBUA 4LJPB 2KMCA 1V5PA 1WE6A 2DHJA 3SDLC 3TL5A 5J17A 2M8SA 1D3ZA 1WM3A 2KDEB 3R3MA 3AU5A 3MHSD 2JY6A 1ZKHA 4FJVB 2L0FA 1SGHA 4KAXB 4MGZE 2JPHA 3SU8X 1C3TA 2O6VD 2EJ8A 3JVZX 4ICVA 3ML9A 3QWZB 1P5TA 2ZNVB 2KDFB 3R7QA 2M4NA 1LM8B 2BKFA 1MK9B 2YF0A 4JLCA 4MK0A 3AXCA 3U8ZA 2D4QA 1U4AA 2J0JA 4TYZA 1V49A 3KH0A 4CYEA 3N3KB 3L08A 1ZC4B 2CHWA 1UPRA 3PVWA 3RZWC 3ECIA 4DHJD 1HB6A 2C7NB 3VVWB 4TQ0A 3DVGX 2K2UA 2DHIA 3FM8C 3HK0A 1EF5A 3PPAA 4NAWA 5C16A 1AWEA 4BOSC 4DBGA 4HXDA 3FEHA 3H7PA 4K1RB 1K5GB 2H7EA 5LONB 3NZUA 4HATB 2KDIA 2DX1A 2YT0A 2N9XA 4DHZB 2Q13A 2WWZA 3A4SC 3TJPA 3ZUNA 3SHQA 4F1SA 1LW3A 5FI1A 4NQLB 2NPTA 3ENEA 2YS3A 2D2QA 3DXCA 2P0DA 1FXTB 1VD2A 3PRZA 5EFXA 4WAAA 3DVNU 3OANA 2X18A 1E7UA 3A9JA 3UQAA 1J0WA 1E8WA 3L17A 3ZVVA 3PLVA 2OTXA 1J0GA 1IRSA 3MJWA 4IOYX 2DZKA 1Y19B 1V5OA 2J7QB 2N7EA 2ZNVC 2GBJA 1A5RA 5DPSA 1WX7A 1V61A 2DHZA 4PS3A 4KDLB 2GBRA 2MDXA 2KGXB 4GDKB 3C0RB 3V62A 4BBKA 2O6VA 3OJ4B 1WGRA 4WVFB 5IJMA 1Z2MA 5JHBA 4EEWA 3P2BA 1NBFC 3A9JB 1V88A 2IFSA 2UWQA 1IP9A 5HE2A 1WIAA 4EOYA 3GOEA 4HHVA 1X05A 5C6RA 2GBNA 2ZPNA 3QJZA 3TIXA 2P8VA 4RM8A 4NSWA 4LJOB 5CHVC 3H9DA 5CLQB 2EMSA 3EHVA 2KC1A 3ZNGC 3DCGA 3R7RA 3ALBA 1WRDB 4MY6A 4MJSA 4HDQA 1QZEA 1X11A 2K6DB 4WWNA 2KFKB 1UGMA 5DCNA 3VUWA 4MSMB 2Y5BB 3H6NA 2AWTA 1FGYA 3PTFC 3SD5A 3X0WA 3D32A 4ASWC 1Q1OA 2FCMA 3ONSA 3DVGY 1KZ7A 2DHKA 3OLMD 4HB0B 2LVPA 2DYQA 1TTNA 2WYQA 1KM7A 3RCPA 1P0RA 2MA9B 3HM6X 4BBNF 3AJ4A 3TO1A 5JHHA 4CHMA 1DBHA 2NS5A 5J3YA 4RMAA 2L7RA 2LI5A 2NCNA 3ZDMC 2LVQA 2PE9A 4IM3A 2BGFA 2KXJA 1WXMA 2N23A 3HW2B 2KFKA 5J2RA 2Y8GA 3NSUA 4K17A 1E90A 1LFDA 1MAIA 5D3XA 2NZ8B 3L0WB 4W9IA 2RSUA 3VH4B 3ZTCA 2LOXA 2L76A 1UNQA 2J0MA 2D9XA 2ROVA 3A8QA 2Z0PA 2XBBC 3PLUA 2GOWA 2FNJB 4URKA 5D6JB 3M62B 3ZNZB 2YS1A 2NPTB 2R2OA 4IWQA 1NDDA 4DK5A 2FCQA 2KN5A 1TZ1A 4KSKC 1W1GA 4B6WA 5LXHA 1LXDA 2JT4B 1FHXA 1GUAB 4FULA 1X1FA 3KVFB 3SUZA 4KVGB 2K25A 3MTNB 2R2QA 5KQ4A 3L10B 1X86A 1WXSA 2E2XA 3EPYA 3I3TB 2BCJA 5AZFA 1V9JA 5L81A 2DENB 3QCAA 3UQBA 1S1QB 5IA7A 4JGHB 1P3QU 2WX1A 3M3JA 3V61A 3P6AA 5L95C 2DTCA 1M7EA 2P0FA 2GCLA 2CY4A 2JF5A 3RCZA 5C1ZA 5KCVA 2ABDA 3KZ1A 2MP2A 3VTUA 3UZTA 3PT2B 4Z2NA 2A4ZA 1NU2A 1BTNA 2CKHB 1DDMA 3IFWB 3KYDD 3LJUX 3QX1A 4CHKA 5GMVA 2JRHA 4DX90 2L05A 1WGYA 3CF6E 3VUYA 1IPGA 3PHXB 3V6CB 4YONA 4D0NB 1NVLA 3VH3B 4K2OA 5D3VA 2A5UA 1I2HA 1WG7A 3ULCA 4LDTB 4JIOU 3RUIB 2ADZA 3VAWA 3W1SA 1SHCA 1EGXA 4HDOA 1GC6A 1RLFA 4GN1A 4A3OA 2ASQA 1YX5B 2YRYA 5C5BA 2OOBB 4IM2A 3RULA 2MKRA 2VKIA 1HE8A 4M8MA 4E3CA 4K2PA 1WY8A 3M1IB 4K7WA 1V5UA 4HB2B 4DBBA 4E74A 2ZJDA 3DVNV 2KX0A 4NY0A 4YL8A 5KQ1A 1HB8A 3APFA 1ZM0A 4A20A 3GZNI 1W1DA 2D9YA 3FSSA 4MT7A 3NY5A 3QBVB 1WI0A 2YLMA 3DBRI 1W1HA 5LXIB 4KZ0A 2V76A 2G3QB 2GCJA 3UGBB 3IG3A 3PSCA 1UNRA 3FP5A 4NNJB 2KQ7A 4FJYA 2MQJA 1NI2A 1RAXA 2GS0A 1KJTA 2MW5A 3HQCA 1OY2A 4HPMB 2LD9A 1H10A 4A6FB 1KI1B 1U5GA 4IWOA 2JWZA 2D11A 4HVBA 2YS5A 4G0NB 4C0AA 3A4RA 1VCBA 4NJ6A 1NTIA 1SIFA 1YJ1A 4RM9A 1WXVA 3SNHA 1V81A 3ZNHB 2MBHA 3CMMB 5G55A 4WJNA 2KTFA 3ODXA 1P9DU 3DOWA 3TMPB 1MIZB 3V6EB 2RQ1A 3RYTA 4ANWA 4HAXB 4IAPA 3GYPA 2ZPYA 2DAJA 2LGYA 1ZVRA 3PV1A 4HCPB 2K00A 5DPRA 3LDZE 2ZCBA 3DQVA 4FBJB 3ZDTA 3DBSA 4I6PA 5DH9B 2BWFA 4IC7B 3WIMA 3Q3JA 4W9FA 2MCNB 2IZVB 3U7DA 1E8YA 3PRMB 1WJNA 4JQWC 3A1QA 3EC8A 4F7ZA 1DDVA 1E8XA 2K1FA 4HJKA 3ZLZA 2KMAA 3O96A 2JUOA 1WF9A 2LBBA 2KNBA 4WQOB 1Y5OA 2UZRA 3H7SA 2N7DA 1OGWA 4HK2A 1QC6A 1K8RB 1R4NI 4I6LB 3DBHI 1XR0B 3AU4A 3A98B 1WGHA 3S2AA 4FA6A 2KHWB 2ROZB 4F7HA 5J3TA 2YSZA 4GMVA 2LUEA 3N30A 4MDKE 4W9DA 2FDQA 3ODWA 1WH3A 2N9EB 3TVVA 1KOTA 5E6OA 5IAAC 2Z0OA 3IVFA 2LYDA 4F7UP 4DHJB 3VTWA 1V2YA 3ZW3A 4HB3B 2EC1A 2L1CA 3TW1A 1DROA 3WAMA 2VRWB 3ZO5B 1BT0A 1DDWA 2Z0QA 2K39A 3SO6A 2IO2B 5JH5C 3APCA 5HKHA 1C1YB 3O65B 5GOWB 2KJ6A 4W9GA 1J19A 3PEGA 4DWFA 2FIDA 2NBVB 2NMBA 5KHOA 3DPDA 4L6EA 1T0YA 4A6FA 2QKMA 2KUPA 1ST7A 1MKEA 4Z2MB 1WJ4A 2GBMA 5D2MB 2IO1B 4AJWA 1P3RA 1AARA 4PNKA 3QC8B 3V60A 4BKTA 3DDCB 4LDTD 2C7HA 4G11A 2RLOA 2MSED 3VQIA 2KC2A 4DDID 2N1WA 4XC2A 5CX3A 1P6SA 3VTVA 1WGUA 2COCA 2ZEQA 2DYBA 1AQCA 1IYFA 1I42A 4KHAA 1DYNA 3D8EA 4DX8A 3NZSA 2KWVB 4BVUC 1J8CA 4FADA 3L16A 4EKUA 5AZHA 2QHOA 3IBEA 3PG7A 2D9ZA 2Y7BA 4XWXA 2KD0A 2MBQA 4W9KA 5AZGA 3WALA 1H8CA 2NBWB 2QKLA 3D8DA 3NHEB 1UD7A 2KK8A 3A1QB 2OQBA 5J18A 5JP4A 3JW0X 4GU2A 4GMXB 5LOPB 4HPLB 4MEMA 5DHFB 1RJ2A 3RT3B 3IHPC 5KHQA 5D7GA 3T9LA 3B1LX 1MK7B 2AL3A 4OVVA 3R66C 3CSFA 1OQYA 1UBQA 3QAQA 4BKSA 2JP2A 2KOXA 2KZRA 3KYCD 4GGQA 4MGIE 4JL9A 2Z0EB 2CY5A 2I1JA 2DFKA 2AYOB 4N9F4 5D94A 4ZYNA 2DX5A 1WR6E 2G4DB 1LB1A 1WVHA 2ELAA 1UBIA 2IY1B 2D9VA 1V5MA 3CSTA 3PS6A 1WMHB 3N7CA 1TQZA 2KWCA 2CRFA 3M63B 2RNRB 4WJOA 2C7MB 3KRWA 1ACAA 3VOQA 2KTRA 4ZRJA 1XD4A 1Y8RC 2L8JA 4GDLB 5DI9B 2RSGA 4WJQA 3ZVRA 2Z0DB 2C9WB 4XX5A 1Q0WB 4Y94A 5E6PA 4G50A 3V5WA 1FB8A 1KZGA 4FJZA 4GB9A 4A5KA 2W2XD 2B3AA 2N4FA 4M8NA 1UH6A 3QARA 4IG7B 2V1YA 4GDKA 2MWSB 3TBLD 5FI0A 3OAWA 1U29A 4X57B 1YX6B 1XD3B 3QWMA 2PZ1A 5TR5A 4GXBA 2HTHA 3AULA 3DBLI 2NR2A 4GOCA 3L13A 1UZXB 1ZW7A 1X1MA 3HM3A 4BOZB 5DPWA 3ODOA 1V5TA 2OJRA 5D3YA 4HCNB 4KSLC 2KJHB 2W2XC 2K8HA 4TKNA 5C5BB 3T8MA 4CO7A 3ZNID 2BWES 1GNUA 4H8SA 4HWIB 1G6JA 2JZZA 3SV1A 5E6NA 4EJNA 2CU1A 3PP2A 1OEYJ 1NTVA 1TBEA 5JHAA 1WYWB 3UINB 2DKQA 2W9NA 5D3WA 3HIZA 1BWNA 3JSVA 2WH5A 1KLVA 1EVHA 1XT9B 4FLHA 2COAA 1EO6A 2DX5B 2JVCA 2L0TA 4MJSB 2G4SA 3U30A 1NTYA 3NOBA 1L2NA 3QA8A 1ZSQA 4NQKE 1JRUA 2MP2B 4HAUB 2FCNA 4HAZB 3KW5B 1TXDA 3ZRCA 2KTRB 1ZGUB 3VUXA 3WYFB 1WMHA 4TQ1A 4W9LA 2J0KA 2BF8B 3KY9A 4NPNA 3EFUA 4K7UA 4KZCA 4XZ4A 2MLBA 5LLIA 4E71A 5D27A 1V89A 4TUUA 2XK5A 2H7DA 1P1AA 2DZMA 2O2VA 4A3PA 2LWPA 4GSWA 4PS8A 2AL6A 2RD0A 1WM2A 2RR9A 1WI1A 2PE6B 2R09A 3PVUA 3A9KA 4II3B 5JZEB 2I5FA 2LOZA 1R4MI 2KVRA 4IW0A 2GMIC 4EZKA 4ZRKA 2N0YA 4GPTB 1WJMA 2M38A 2VSZA 5JHGA 1U5EA 2D07B 2Z59B 2ZVOA 2AEHA 2HTHB 3KUCB 2VRRB 3H7PB 3ML4A 2BKRB 4MGKE 2DZJA 1XX0A 2XK5B 3SYXA 1U27A 2FCSA 1EAZA 1WJ1A 3BJIA 3CXBB 4GZUA 1WZ3A 2IO3B 1OTRB 2MBBB 2LXCA 2RPQA 4IWPA 4W9EA 2MFQA 4KV2A 1Q67A 2JZ3B 1GC7A 3JYUA 4F7GA 3PREA 2WDTB 4K7SA 1RFAA 2MBEA 4WJPA 4I6NB 5C79A 2FAZA 2NVUI 5HE0A 2ZVNA 4MM3A 3VHTC 3WANA 4KIKB 2IYDB 4II2B 4DHZE 3H1UA 2L3ZA 2LZ6A 1YD8U 4OVUA 3UF8A 3PGEA 3VDZA 2COPA 2C5LC 4HAYB 2ELBA 4EMOA 3N32A 4PYUA 3ZTDA 1MG8A 2RUKB 2HD5B 4ANXA 1UELA 2LJ5A 4B95A 1WJ6A 5J3QA 2V3SA 1QQGA 3TCAA 1WFYA 5DHAB 1WXAA 1V80A 3EECA 1MPHA 2PJHA 1U2BA 4HB4B 2YT1A 2DYNA 4HAWB 2YVCA 2BYEA 1I7AA 1Q5WB 2LRWA 2MWNB 4WWOA 2D3GA 2CS4A 2XQNM 2REXA 5FR6A 3RD2A 4EUTA 1TJ6A 4ZRIA 1WX9A 1EF1A 5CTRC 1OMWA 3T06A 4BKGA 5CLLB 3M95A 3PHWB 2C60A 3QIJA 1YIWA 2LRUA 2M1MA 2MX2A 2DKPA 3NS8A 1WX8A 4KDIC 4AUQC 1N3HA 3KRXA 4PYZA 2V4LA 1E5WA 2LKOA 2O2VB 2FUHB 1FHOA 2D10A 4W9HA 4J6IA 2G35A 5DIFB 2EMTA 1L7YA 2BYFA 4HLEA 2IBIB 3APDA 3L54A 3A9KB 1XKEA 1Z5SB 2N1VA 3K9OB 1CMXB 2DZIA 2O6VB 2K6QA 2HRJA 2CHXA 2MRPA 3LJ3A 3OJ3A 2M17A 4ICUA 3WAPA 4EFOA 2J59M 2KCJA 2M14A 1WGGA 2DAFA 2DN6A 2KJRA 2I1KA 1ZC3B 1WZ0A 1BAKA 1I35A 5C23A 4AP4C 2UZSA 4IFSA 1WR1A 2LASA 2Y8FA 3ZRFA 1FOEA 1K5DB 2RVBB 2EKEC 4WSFA 2JXXA 3GYOA 2RGFA 4IM0A 5DPTA 1OEYA 2LGXA 5L83A 4A6KA 3UIOB 3BINA 4GDLA 4MGYE 3TFMA 2LG1A 3QHTA 5HE3A 2FIFA 1M94A 2GBKA 4W9JA 5CHFA 4B9KA 1P98A 4ANVA 1PQSA 2CODA 2CHZA 3PZDA 1UPQA 4BFRA 1E8ZA 1WJUA 4MH0E 4MELA 3AI5A 3K9PB 3DXEA 2PPHA 1FHWA 2LXAA 2ZZPB 2MBOA 2DA0A 4PS7A 3Q3FA 4KIKA 2IY0B 2UVMA 2K8BA 2KFJA 2KO3A 3UIPB 1YQBA 3VFKA 2L00B 2CR5A 2KWUB 4LCDE 3RZFA 1EUVB 2UYZB 1UEFA 1XCGA
chains in the Genus database with same CATH superfamily
4NJ7A 2J4XA 4OZAA 1V6EA 4G3XB 1WGQA 1OQNA 4ZHPA 1T0SC 3F0WA 3WAOA 4ANUA 4DXAB 1XODA 2PKOA 1S3SG 2BS4B 3BZDB 2W54A 4M0WB 3ULBA 2CU3A 4KHBB 2ON8A 4AWJA 2JZPA 3PSEB 2D9WA 4JKGB 2L2IA 1BTKA 2LUMA 2FJUB 3BY4B 1HA5A 2KX3A 2I5CA 2BPSA 4W9CA 2IO0B 3KUDB 4HAVB 3B08A 2Z8LA 3W1SC 5CHWA 1VZ6A 4FHJA 4AOFA 2X0SA 3VIAA 2CB8A 3FILA 1L6VA 1V1OA 3A8PA 4EZLA 4BKSD 3KSYA 2RGNB 2CAYA 2W2WA 3ZJVA 3PVLA 2PEAA 3J9CA 2WXGA 3CIKA 4LJPB 2KMCA 5J17A 2KDEB 4C80A 3AU5A 4FJVB 1ZKHA 2L0FA 2WDVB 4MGZE 5MPOA 3SU8X 2O6VD 2EJ8A 2KR0A 2HTME 2KDFB 2ZNVB 3R7QA 2Z13A 1AWDA 3KQ4A 3AXCA 3U8ZA 3N3KB 2WXNA 4LTUA 4DHJD 2K2UA 3AECB 3I9V1 4DBGA 4K1RB 5LONB 2KDIA 2YT0A 3DHGC 1DOIA 5G5HA 1LW3A 3ENEA 3DXCA 4WAAA 2P0DA 3DVNU 1GGOA 3L17A 3ZVVA 1L5PA 2OTXA 1J0GA 5JVLA 4IOYX 2J7QB 2ZNVC 2N7EA 5DPSA 3V62A 2KGXB 5HHDG 4BBKA 3OJ4B 1WGRA 4JKDA 1FCLA 3FILB 1NBFC 1V88A 2IFSA 3AV8A 3B2FA 4C7YA 4HHVA 1X05A 4EOYA 2ZPNA 3QJZA 2P8VA 5CLQB 2KC1A 1WRDB 4MJSA 1QZEA 4WWNA 1UGMA 2D3AA 2AWTA 3PTFC 4QJ3B 1I4RA 5IP4D 4YSZB 3DVGY 1KZ7A 1HZ5A 3OLMD 1I4QA 3RCPA 2MA9B 4KKIA 4BBNF 3TO1A 2QSDA 4CHMA 5J3YA 2LI5A 5T8IA 5EE3A 3HUIA 2N23A 4W9IA 1TIFA 2L76A 2ROVA 1EU3A 4C00A 1HZ6A 1JWSD 1FNVA 1AW7A 1NDDA 1QOFA 1W1GA 1FHXA 1SF0A 4M00A 1X1FA 2K25A 2R2QA 3EPYA 2BCJA 3E9LA 3QCAA 1N63A 1S1QB 4JGHB 4JE3B 4S0RA 3W9CB 3RI7C 4OSNA 3KZ1A 3UZTA 2A4ZA 1ZE3D 1NYRA 1QT9A 3IFWB 3C8YA 2PTLA 3CF6E 3VUYA 4A90A 3V6CB 4UDUC 1F0ZA 5D3VA 3W1SA 4JIOU 2ADZA 1TS2A 1RLFA 4KKJA 4GN1A 1ESFA 2H88B 1JQ4A 2VKIA 4K7WA 2H89B 4MT5A 2KX0A 4YL8A 4A20A 1PDXA 4MT7A 2YLMA 3IG3A 1UNRA 4K3CA 4NNJB 2MQJA 4HRSA 1RAXA 2WXIA 2MW5A 1R7SA 4A6FB 1KI1B 2D11A 2YS5A 4G0NB 4C0AA 3A4RA 1VCBA 1NTIA 1WXVA 3NVWA 3SNHA 5I2SA 5G55A 4ANWA 2DLBA 3NZ3A 3V6EB 2RQ1A 3RYTA 2CJOA 2K00A 2IDYA 2BWFA 3Q3JA 2MCNB 3U7DA 1N6ZA 1WJNA 1T3QA 3ZLZA 3O96A 3O13A 1J7CA 2UZRA 3H7SA 3I57A 1NVID 1K8RB 4ITKA 3DBHI 1B9RA 2PVGC 1WGHA 4FA6A 2ROZB 5J3TA 3MC9A 2R82A 2YSZA 3N30A 1QF6A 1UF0A 3ODWA 1VLBA 3TVVA 2LHEA 3OWEB 2LYDA 3VTWA 2L1CA 1DROA 1F2RC 3Q69A 3E66A 4W9GA 2KJ6A 2KUQA 1J19A 4JKGA 2FIDA 2NBVB 3TUOA 4A6FA 2GBMA 2K22A 5D2MB 3QC8B 1I4XA 2C7HA 2RLOA 2MSED 2INCC 1SB3C 3VQIA 4N6EB 1P6SA 2K0PA 2ZEQA 1AQCA 3D8EA 2RDGA 3L16A 4EKUA 5D3DA 3PG7A 4LNNA 2NBWB 3NHEB 2OQBA 4GMXB 5LOPB 3IHPC 3N1XC 5D7GA 2JX5A 3T9LA 4OVVA 2N9LA 2INNE 2L32A 4JL9A 2CY5A 4N9F4 5D94A 5FK9C 1WMHB 4YTPB 3M63B 4L1BA 3DWGC 1TY2A 1JDEA 4P1CC 3GS2A 3SEBA 3ZQ4A 3Q8FA 1Y8RC 2L8JA 4YWGG 4GDLB 5DI9B 2RSGA 3GB1A 2Z0DB 1FB8A 4YTNB 1ZDXA 5EE1A 1YN4A 3RNCC 2V1YA 3R8BA 2MWSB 5FI0A 3OAWA 1XD3B 3ZYYX 2PZ1A 2HTHA 1ZW7A 1M4VA 3U7ZA 2JXTA 4KSLC 4R3DA 3T8MA 4CO7A 2LFIA 1NTVA 3HIZA 3P4PB 3JSVA 1BWNA 2WH5A 1KLVA 3DWMA 1J7BA 4NQKE 2MP2B 1HEZE 4HAUB 4HAZB 2OJWA 2KTRB 1CZPA 1WYGA 3VUXA 4TQ1A 2BF8B 3KY9A 4H2AA 4XZ4A 4C4VB 4TUUA 4P16A 2XK5A 1JWUD 1L4DB 2DZMA 1P1AA 1P7EA 1R4MB 3MFGA 5JZEB 1R4MI 1JWAD 2KVRA 2VSZA 2D07B 2HTHB 5D3IB 2VRRB 4MGKE 1EAZA 1WZ3A 4IWPA 3V60A 4W9EA 2LXCA 2KACA 4Q2JA 4ILHA 4HSIA 5IRSA 2FAZA 4MM3A 3BVMA 2SAKA 2LZ6A 1YNTE 2COPA 1ET9A 2C5LC 4HAYB 4EMOA 2I2YA 2HD5B 1SXTA 4YXDB 1UELA 2LJ5A 2V3SA 1N62A 1WFYA 1TJEA 1NI3A 3EECA 1C79A 1MPHA 3EA6A 4HB4B 4HAWB 1V1PB 2MWNB 2D3GA 2XQNM 1EF1A 1FRDA 2C60A 4KDIC 5IO9A 2DKPA 1WX8A 2V4LA 1E5WA 2LKOA 3Q3OC 4W9HA 4J6IA 5DIFB 1L7YA 4YT0B 2BYFA 2W3RA 2QMTA 1QLBB 1TKYA 3L54A 5BMGA 3K9OB 1CMXB 2HRJA 2KCJA 5C23A 4IFSA 2RRFA 2RGFA 1K5DB 3IAM1 1SJHD 3ZJTA 3UIOB 4MGYE 1ZYIA 3QHTA 4W9JA 1E10A 4ANVA 2AQ1B 2CHZA 4BFRA 1DOYA 2NBVA 4B0EA 2WXKA 2J53A 1YJIA 2PPHA 1T77A 4KIKA 3SBTA 1WSPA 2IY0B 2UVMA 3UIPB 2L00B 1JW9D 2CR5A 2KWUB 2ONQA 4EUTA 1UEFA 1XCGA 3CIRB 3A33B 3Q8EA 1K50A 3X23A 1QOGA 1VZ7A 5JLJB 2NTTA 4BBNC 1FAOA 2DNFA 2OHFA 3P63A 5EDSA 1UNPA 2LULA 1P7FA 2V4IB 4WH4A 2DYMA 1RRBA 3ML8A 4TV3A 3CWIA 2FJ9A 2BVCA 1MPEA 4MSQB 1L0YB 1WGDA 1K52A 1GG3A 4FN2A 2KDBA 1V86A 2XEWA 2R0DA 3ZJUA 2PW9A 2BBCA 3TEYA 3NWAA 2IYBA 3MPXA 4RGTA 3PO0A 3I63C 4F8CB 4WURA 2BT6A 2FJLA 3DHHC 2WU5B 4HKZE 3ZKJC 1FGZA 5AEKB 1F77A 1T0RC 4AJYB 3BVGA 2MJDA 2ZCCA 2KKCA 1SBBB 2P0HA 3KUZA 2ZKMX 4RGOS 4GIVA 1B55A 2MEKA 1JALA 3HHMA 1IYFA 1OFFA 4L2YA 2DHJA 3DBHB 5AUIA 3HSAA 2N7JA 3R3MA 2JY6A 4JWSC 2Z14A 1IGDA 3VR9B 2BKFA 1MK9B 4US9A 5H8YE 4MK0A 1KF6B 4JKFA 1V49A 4TYZA 4ANXA 2CHWA 2AQ2B 3RZWC 1HB6A 3FM8C 1EF5A 4J3OD 4NAWA 1Q10A 5C16A 3FEHA 3H7PA 2ACZB 4HATB 2N9XA 4TMAB 2WWZA 3TJPA 3ZUNA 4F1SA 1XLPA 1TS5A 5FI1A 2LGIA 2NPTA 2D2QA 3U2SC 3UQAA 1WGKA 2INDC 3PLVA 2G9HD 4S17A 1YN3A 3U52E 2DZKA 4D6WA 2EKIA 1V61A 1UUPA 4PS3A 4KDLB 2MDXA 1CJEA 2O6VA 4RFBA 1NYQA 5JHBA 1UWMA 1NENB 4NJCA 5C6RA 4JPSA 1IBXA 4RM8A 4NSWA 3H9DA 3NRZA 4MY6A 3U12A 5DCNA 4A9AA 4MSMB 3ZXRA 2Y5BB 3H6NA 1FGYA 3SD5A 1Q1OA 1I4GA 2Z4DA 3ONSA 2LVPA 2DYQA 3P1MA 4XYCA 2LVQA 4IM3A 5J2RA 3HW2B 2WXQA 2Y8GA 4K17A 4LNIA 1YQ3B 1MAIA 1QKZA 3VH4B 3ZTCA 4DDGD 4JKHA 2J0MA 2XBBC 4RF0A 3ZNZB 2NPTB 2R2OA 4IWQA 3V05A 2NTSA 4KSKC 4B6WA 1GUAB 3KVFB 2GB1A 3SUZA 4XGAB 2KAJA 3L10B 1X86A 1MG4A 4AQ7A 2DENB 5IA7A 1D5ZC 2K5PA 2JSVX 2KMMA 4RH6A 5KCVA 3VTUA 1BMLC 3PT2B 4Z2NA 1MI0A 5GMVA 2K49A 5HI1A 1NVLA 4K2OA 3VAWA 4ARCA 1EGXA 4A3OA 4OVZA 2WHIA 3ZGZA 2QEJC 3Q14C 2OOBB 3LYYA 2PMVA 1SE4A 4P1BC 4K2PA 1WY8A 3M1IB 4E74A 3DVNV 1GPXA 1ZM0A 3GZNI 2D9YA 1WI0A 4RF1A 2JQRB 3BYTB 2G3QB 5HFYA 2HDEA 3PSCA 3FP5A 1ZXIA 2KQ7A 4FJYA 1OY2A 4IWOA 2ZW1A 4A8XC 2JWZA 5LNK1 2DAJA 4IAPA 2LGYA 1TKEA 4FBJB 2BYTA 3ZDTA 5DH9B 3OHMB 4HEA1 4OHJA 4JQWC 3A1QA 3EC8A 1EM7A 2WXOA 1XCTL 2KMAA 2KNBA 2JUOA 1WF9A 5BYQA 1Y5OA 3R2IA 1QC6A 3Q8BA 3S2AA 3A98B 2KHWB 4USAA 4GMVA 4W9DA 2FDQA 1K51A 2QDFA 5IAAC 2Z0OA 4KGSA 4DHJB 4XDDA 3TW1A 3VRBB 3WAMA 3ZO5B 2Z0QA 1ZOYB 2N0SB 4GNKB 1C1YB 5GOWB 1N5WA 3DPDA 2QJLA 3ABVB 1T0YA 2KUPA 1XXGA 4Z2MB 1MKEA 1WJ4A 1VJKA 4AJWA 1AARA 4BKTA 2WXMA 3DDCB 4LDTD 1JMLA 4K3BA 4N58A 2KC2A 5CX3A 4MM3B 2COCA 1I42A 2J42A 3BWUD 3RN9C 1DYNA 3NZSA 2KWVB 1J8CA 3A58A 2QHOA 2MBQA 2KIGA 1H8CA 1EWYC 4OT1A 1E9MA 4QXAB 5J18A 3JW0X 1MJDA 4HPLB 1RJ2A 3RT3B 1MK7B 3W5VB 2AL3A 1FO4A 4CQNA 2KIEA 1C76A 4L23A 2JP2A 4MGIE 3KYCD 3MP9A 3KWLA 2Z0EB 1FNUA 1WR6E 2ELAA 1WVHA 2IY1B 2D9VA 3CSTA 3EGRA 1TQZA 1PYWD 2KWCA 2RNRB 3KRWA 3VOQA 3H8HA 2KTRA 1FXAA 3LXFA 2BS2B 2C9WB 5E6PA 4GB9A 3B77A 2W2XD 2B3AA 1D6EC 4M8NA 2VH2A 5I4DA 3TBLD 1GB4A 1PUTA 5TR5A 5BMIA 2NR2A 2KWDA 1UZXB 3AEBB 1HQRD 3HM3A 1KFYB 2OJRA 5D3YA 2KJHB 1R4NB 2X38A 1ROEA 3AE4B 1MHHE 2AX5A 3SV1A 4EJNA 2CU1A 3TEXA 1TBEA 2W9NA 2LEKA 5D3WA 1ZXHA 2QILA 1EVHA 4FLHA 2G4SA 3U30A 1NTYA 1KH0A 1E6EB 1TXDA 3E9OA 4NPNA 3KWVA 3EFUA 4K7UA 4E71A 2MLBA 5D27A 1V89A 2H7DA 1KRHA 4JK7A 1GOZA 2WP9B 3BYYB 1WI1A 4II3B 2YEPF 1HXYD 4IW0A 2N0YA 4GPTB 1HTOA 1WJMA 2Z59B 3GZNB 5C2TB 3ML4A 2DZJA 1U27A 2IO3B 3N20C 3UI3A 1KBLA 1RFAA 5BYRA 5BYSA 3BIID 2IYDB 4II2B 1YD8U 3VR8B 3FVCA 3L4PA 3VDZA 2ELBA 2Q5WD 1VBHA 5J3QA 4JX1C 1XLNA 3IAS1 1WWTA 2YT1A 3UQBA 2YVCA 1Q5WB 4WWOA 2CS4A 4DXGA 2REXA 1TJ6A 1TY0A 1T6BX 5G5GA 3M95A 2MX2A 4AUQC 3FKYA 1FHOA 2EMTA 3A9KB 4D2KA 2DZIA 4GLSC 2CHXA 3LJ3A 3WAPA 3EFCA 1WGGA 2M14A 2KJRA 1ZC3B 1E0ZA 1BAKA 1FXIA 4AP4C 2R2YA 2DWQA 4XDCA 2Y8FA 1FOEA 2RVBB 4RGNA 4WSFA 3I5JC 1OEYA 3BINA 2LG1A 1M94A 1P98A 2CODA 4ARIA 3PZDA 1UPQA 1TS4A 1UWXA 3AI5A 4M01A 4DQOC 3R2TA 2LXAA 3Q3FA 3MC0B 4CSQA 2K8BA 2WNMA 2KO3A 2WXPA 1FIQA 4LCDE 3RZFA 1PFDA 4QJ5B 3F5RA 1LQBA 4FHKA 5IKCM 4ZDVA 1M7RA 1Z87A 4LLGM 2LGSA 2B76B 4AS1A 2TSSA 2MJEA 3D8FA 5G2NA 4NAWB 2WXFA 3AM9A 4CHJA 1D4BA 1RRPB 3G9WA 1WE7A 1U5DA 5FR3A 2Y3AA 3QQ8B 2G45B 3B0AA 3AEAB 2SEBD 5BO4B 2RPVA 1HBKA 1U5FA 1PLSA 4BZAA 3QK0A 4B6HA 1LO5D 3P7ZA 2KANA 2KN4A 4HPPA 1TGZB 5HE1A 2JRIB 3MDBC 2LGDA 1ENFA 2HE7A 4P7IA 1AYFA 3SDLC 1PFJA 2NBUA 1V5PA 1WE6A 1D3ZA 1WM3A 3MHSD 4KAXB 4ICVA 3QWZB 3TSSA 2M4NA 2YF0A 4JLCA 1TS3A 3LB8C 3NWDA 4CYEA 1V97A 1TKGA 1C4CA 2IGGA 3VVWB 3DVGX 3BK2A 4BOSC 2DHIA 1AWEA 4DIXA 1EWCA 4HXDA 1K5GB 2H7EA 2WDRB 3P4RB 3E9SA 5IN7A 4NQLB 2YS3A 1F2RI 1FXTB 1VD2A 3PRZA 3MHZA 5EFXA 3OANA 3A9JA 1E8WA 4ZYSA 3MJWA 1J7AA 2GI9A 1A5RA 2GBJA 1WX7A 1DOXA 2GBRA 2R61A 3C0RB 3ETRA 4WVFB 5IJMA 3P2BA 2UWQA 5HE2A 1WIAA 4WIPA 2GBNA 4NZLB 1XO3A 4WAFA 3EHVA 3DCGA 3R7RA 4HDQA 1X11A 2K6DB 2KFKB 2BQQA 2J52A 2JWUA 4ASWC 3X0WA 4HB0B 2WYQA 1TTNA 3SBGA 2JYTA 1V8CA 1DBHA 4RMAA 1ET6A 2NCNA 2PE9A 2KXJA 2KFKA 1XLOA 1LFDA 3L0WB 2WXRA 2LOXA 2D9XA 2Z59A 3M62B 3VRAB 1C4PA 4DK5A 2FCQA 2KN5A 1TZ1A 2VZKD 5LXHA 2JT4B 4FULA 2IPKD 3NVYA 3MTNB 4PK1A 3I3TB 4JKCA 1V9JA 5L81A 3SFDB 1P3QU 3M3JA 3P6AA 5L95C 2DTCA 4PT5A 1M7EA 4KGTA 3Q6BA 2P0FA 2CY4A 2ABDA 1SE2A 1BTNA 2CKHB 1DDMA 3KYDD 3LJUX 3QX1A 1RWSA 2JRHA 1FPYA 2L05A 1VBGA 1IPGA 2IGDA 4LDTB 3RUIB 3ULCA 1QQRA 1VZ8A 1GC6A 1YX5B 2YRYA 5C5BA 4US8A 3RULA 4E3CA 3HVZA 3AE8B 2IJ0A 2W3SA 4DBBA 2ZJDA 4NY0A 5KQ1A 3APFA 2MH7A 3N1YC 1W1HA 4KZ0A 3UGBB 2VZKB 2L83A 1KJTA 3HQCA 4HVBA 1U5GA 4MACA 3RFZB 1C77A 1SIFA 1RYJA 1YJ1A 2N9KA 4RM9A 2I38A 2FUG1 3ZNHB 2MBHA 3CMMB 1I7HA 2KTFA 1P9DU 4WJNA 3DOWA 3TMPB 1MIZB 4HAXB 2ZPYA 1ZVRA 3LDZE 2ZCBA 4XWWA 3PRMB 2BS3B 2V9HA 1E8XA 2VH1A 3T3OA 2LBBA 3Q8AA 5AUKA 3NS1A 2N7DA 1OGWA 1KLUD 4HK2A 1XR0B 4ILJA 4MDKE 4REZA 4F7UP 5M4YB 2WU2B 3ZW3A 4HB3B 1ZUD2 2VRWB 3SO6A 1L0XB 2XN9C 3PEGA 4DWFA 2NMBA 4L6EA 2RMMA 2QKMA 1ST7A 4QJ4B 1P3RA 3DBLB 1DYQA 4DDID 1KLGD 4XC2A 3VTVA 1TYGB 1WGUA 4KHAA 1XEEA 4FADA 1QILA 1L4ZB 4W9KA 4XWXA 3WALA 3A1QB 5JP4A 4MEMA 2V3NA 5KHQA 5E6JA 1T0QC 3CSFA 1OQYA 1UBQA 1I4HA 3QAQA 4BKSA 2KOXA 1STEA 2KZRA 2MJ3A 2DFKA 2I1JA 2AYOB 4ZYNA 1LB1A 3PS6A 4O1NA 3NVZA 1V5MA 2M56B 2Y5PA 4ZRJA 1XD4A 1EU4A 3E56A 4WJQA 3ZVRA 4XX5A 3W2DA 4Y94A 1CK1A 4A5KA 1UH6A 3QARA 4IG7B 3QWMA 1FNWA 4GXBA 3DCXA 3DBLI 5DPWA 1C9FA 3ODOA 1V5TA 4HCNB 2G1EA 1E7PB 2BWES 2Y5CA 4LNKA 1GNUA 3AE3B 4HWIB 5E6NA 3AMZA 3PP2A 1OEYJ 2PVOD 4RGMA 3GP7A 1WYWB 2DKQA 1VRAB 1XCQL 4C4VA 2COAA 2GUMA 2JVCA 5IOIA 1L2NA 2RDBC 2INPE 5C3JB 1K53A 2FCNA 3NWFA 1ZGUB 1N60A 1SSNA 3WYFB 3PZ7A 4KZCA 5LLIA 1KOTA 2O2VA 1JWBD 1DIKA 4PS8A 2AL6A 1WM2A 2RR9A 3A9KA 2LMCA 2R09A 4LNOA 1JRPA 2M19A 2WQYB 1WRIA 2LOZA 4EZKA 4ZRKA 3HVDA 2M38A 5JHGA 2DIKA 4DXFA 1U5EA 3HRDD 2AEHA 2QCZA 3H7PB 1SEBD 1XX0A 2FCSA 2MBBB 1WJ1A 4GZUA 3CXBB 2NMQA 2RPQA 4KV2A 2JZ3B 1Q67A 3JYUA 3PREA 1D5XC 4K7SA 1HTQA 2MBEA 2FE8A 4WJPA 4I6NB 2ZVNA 5HE0A 3VHTC 3WANA 4KIKB 2BW2A 3UF8A 2RDHA 3ZTDA 1VDVA 3N32A 3N9YC 4PYUA 1MG8A 2RUKB 3NW8A 4B95A 1QQGA 4JKAA 2ICIA 5DHAB 1WXAA 4RCOA 1U2BA 1MI1A 2BYEA 2LRWA 3RD2A 4ILGB 4ZRIA 1WX9A 4LK0M 5EE0A 3T06A 1YIWA 3NS8A 2LRUA 1A70A 2O2VB 2FUHB 4HLEA 3APDA 1XKEA 3IT4B 2L1AA 2O6VB 3URYA 2MRPA 1B1ZA 4EFOA 4ICUA 2KVZA 2M17A 5LG4B 2DAFA 2DN6A 1I35A 3AE1B 2QC8A 2LASA 2UZSA 2IGHA 3ZRFA 2EKEC 5JXVA 3GYOA 1QOBA 1UGJA 3AE6B 4IM0A 2LGXA 5L83A 3TFMA 4B9KA 5HE3A 1JWMD 1I4PA 4MELA 3K9PB 3DXEA 2ZZPB 3P4QB 2WXHA 1YQBA 3TEWA 4HJGE 1EUVB 2BB5A 3PRPB 1OQRA 3B2GA 2GJYA 4MH8A 1FFVA 1XQQA 3ZIMA 4YSYB 3FLVA 2COFA 1SE9A 4B0MA 2K8EA 2LVOA 1MIXA 2KLCA 2V3PA 2HJ8A 1ISNA 2KQSA 2KLGA 3W1YA 1F9JA 4PQ0A 2XNAC 1PMSA 4RNAA 4C7ZA 2N9PC 2K8CA 2M0XA 4M02A 2CQUA 2DYOA 1H4RA 4YTMB 3DXDA 2W82A 1X1GA 1E7VA 3BVZA 4K81A 2BB6A 3WA0A 2K2JA 3AEDB 2KYWA 4L1RA 5HG2A 4KHOA 2WX0A 4EZJA 2BYVE 4IUMB 1GJZA 5I2MA 3JSVB 3AEEB 1SJED 1GB1A 1RFKA 3VXWA 4WJ7A 4A6HA 1VR9A 2GLSA 2BTEA 2DLWA 4HKQA 3RNAC 3TL5A 1JCKB 2M8SA 1SGHA 2JPHA 1C3TA 3JVZX 3ML9A 1P5TA 3KLSX 3AN1A 1LM8B 3ENBA 1U4AA 2D4QA 2WGSA 2J0JA 3AE7B 4ZHOA 3KH0A 3L08A 1ZC4B 1FD6A 1UPRA 3PVWA 3ECIA 1KC7A 2K9XA 2C7NB 4TQ0A 4N59A 3HK0A 2HJ1A 3PPAA 2GRIA 3NZUA 2DX1A 4DHZB 1UNSA 4KGRA 3TEZA 2Q13A 3A4SC 3B9JA 1SE3A 3SHQA 3AE9B 5AZGA 4DHZE 2AQ3B 2X18A 1ZDVA 1E7UA 1J0WA 3E9PA 5H92C 1IBXB 1IRSA 2PIAA 1Y19B 1V5OA 4ZRQA 2DHZA 4GDKB 3FC4A 3RMKC 1Z2MA 4EEWA 1F52A 4EE2A 1V1PA 3A9JB 1IP9A 4JKBA 3GOEA 3TIXA 4LJOB 5CHVC 1WXQA 3MC8A 4ZOHC 2K3UA 2JU6X 2EMSA 3ZNGC 1D5MC 3ALBA 1IUEA 1SIJA 5GXGB 3VUWA 3D32A 2FCMA 3Q3NC 2DHKA 4OZCA 1KM7A 1P0RA 3HM6X 1PGBA 3AJ4A 5JHHA 2NS5A 2L7RA 3ZDMC 2BGFA 1WXMA 1YN5A 3NSUA 1E90A 4WQMA 1F1HA 5D3XA 2NZ8B 2RSUA 1UNQA 2Z0PA 3A8QA 4URKA 3PLUA 2GOWA 2FNJB 4JK8A 5D6JB 2MHJA 2YS1A 4OZBA 3NVVA 1LXDA 4KVGB 4P6VF 3AB5A 2JYEA 3AH7A 5KQ4A 1WXSA 2E2XA 5AZFA 2D3CA 1TZOA 1L0VB 2WX1A 4YSXB 3V61A 2JF5A 2GCLA 3RCZA 5C1ZA 2MP2A 1NU2A 1GAQB 4KHBA 3HIEA 4CHKA 1N5XA 4DX90 1WGYA 3P42A 3PHXB 3AEFB 4YONA 4D0NB 2D5GA 3VH3B 2A5UA 1I2HA 1WG7A 1SHCA 4HDOA 2ASQA 4OW0A 4IM2A 3RNEC 2MKRA 1HE8A 4M8MA 1V5UA 4HB2B 1KTKA 1HB8A 3RNBC 1W1DA 3NY5A 3FSSA 1ZP0B 3QBVB 3Q8CA 3DBRI 5LXIB 2V76A 4ZRPA 2GCJA 2QIEB 2PLPA 2FBWB 3EUB2 3PZ8A 1NI2A 2GS0A 4HPMB 2LD9A 1H10A 4NJ6A 1V81A 3ZXVA 1MFWA 3ODXA 2WXLA 1ZPSA 2YEPB 3AE2B 4HCPB 3GYPA 3PV1A 1N61A 5DPRA 3DQVA 3DBSA 1YOVB 4I6PA 4IC7B 1NEKB 3RNGC 3WIMA 4W9FA 2IZVB 1E8YA 1PGXA 2E6XA 4F7ZA 5FKAC 1DDVA 4HJKA 2K1FA 4GOUA 1T5XD 4WQOB 3FAHA 1R4NI 4I6LB 2W55A 3AU4A 4F7HA 2LUEA 1LGRA 1WH3A 2N9EB 5E6OA 3IVFA 1V2YA 2EC1A 2DBYA 1BT0A 1DDWA 2K39A 2L52A 2IO2B 5JH5C 3APCA 5HKHA 3O65B 2LJIA 5KHOA 3AEGB 3RPFC 2IO1B 3Q2AC 4A6QA 2ZW0A 4PNKA 4G11A 2N1WA 3NJTA 1JROA 2DYBA 4DX8A 3RNFC 4BVUC 2KQ4X 5AZHA 3IBEA 3Q3MC 2D9ZA 2Y7BA 2KD0A 2QKLA 3D8DA 1PGAA 1UD7A 2KK8A 4HROA 4IOIE 4M0WA 4GU2A 2V0GA 3SFEB 5DHFB 3N1ZC 3B1LX 1FRRA 3R66C 4JK9A 4GGQA 4TSSA 4XWTA 2DX5A 1FFUA 2G4DB 3U4EG 1UBIA 3N7CA 3DHIC 2CRFA 2WS3B 4WJOA 1AN8A 1OQQA 1QOAA 2C7MB 1ACAA 4FXCA 1MVKA 4LNFA 2WLBA 1Q0WB 2EELA 4G50A 3V5WA 1TT5B 1KZGA 4FJZA 2N4FA 1FEHA 4XE0A 4GDKA 1XF5L 4JWUC 1U29A 4X57B 1YX6B 3GE8C 3OG5A 4IDIA 3AULA 5TSSA 3IT6B 4QAYA 4GOCA 3L13A 1X1MA 4BOZB 4WWMA 3T3NA 2W2XC 2K8HA 4TKNA 5C5BB 4KX6B 3ZNID 4H8SA 1G6JA 2JZZA 5JHAA 5BMHA 3UINB 1YJJA 1XT9B 1BXTA 1EO6A 2DX5B 4A55A 2L0TA 3IXSA 4MJSB 2CJNA 3NOBA 3SR6A 4IKGA 3QA8A 1ZSQA 1JRUA 3KW5B 3ZRCA 4W9LA 1WMHA 2J0KA 3BK1A 4A3PA 1Y56A 1FMAD 2LWPA 4GSWA 1FCCC 2RD0A 2PE6B 4BAXA 3PVUA 1FM0D 2I5FA 2YT2A 1C78A 2GMIC 3AE5B 1XLQA 1IGCA 2ZVOA 3GE3C 2OEDA 3KUCB 2BKRB 2XK5B 3SYXA 3NUHB 3BJIA 1OTRB 3P4SB 2MFQA 1GC7A 4F7GA 2WDTB 4WWPA 4JKEA 5C79A 2NVUI 3H1UA 2L3ZA 4OVUA 3MJ5A 1WJ6A 3TCAA 1BUIC 1V80A 2PJHA 3C19A 1RM6C 3WCQA 2DYNA 1I7AA 5FR6A 5CTRC 1OMWA 4BKGA 5CLLB 3PHWB 3QIJA 2M1MA 2X8XX 1N3HA 3KRXA 4PYZA 3DBRB 2E3TA 4ACFA 2D10A 2G35A 2LHDA 2IBIB 4NAMA 1Z5SB 2N1VA 2K6QA 2KDMA 2UU7A 3OJ3A 3NG0A 2J59M 1MHXA 2D3BA 2I1KA 1WZ0A 1WR1A 1YMHE 5DPTA 2JXXA 2M0AA 1L6UA 2WDQB 4A6KA 2WXJA 4GDLA 2FIFA 2GBKA 5CHFA 3V3XA 2KT7A 1PQSA 1C4AA 1E8ZA 1WJUA 5EE9A 4MH0E 1DGJA 1ACCA 1FHWA 2MBOA 2DA0A 4PS7A 1YQ4B 4C56C 1CQVA 2KFJA 3VFKA 3W5UB 3PGEA 2UYZB
chains in the Genus database with same CATH topology
4NJ7A 1V6EA 4G3XB 1WGQA 1OQNA 3F0WA 3WAOA 4ANUA 4DXAB 1XODA 1S3SG 4M0WB 3ULBA 4KHBB 4AWJA 3PSEB 2D9WA 4JKGB 2L2IA 1BTKA 3BY4B 2KX3A 2I5CA 2BPSA 4W9CA 2IO0B 3KUDB 4HAVB 3B08A 3W1SC 5CHWA 4FHJA 4AOFA 2X0SA 3VIAA 2CB8A 3A8PA 4EZLA 4BKSD 3KSYA 2RGNB 2CAYA 2W2WA 3PVLA 2PEAA 3CIKA 4LJPB 2KMCA 5J17A 2KDEB 3AU5A 4FJVB 1ZKHA 2L0FA 4MGZE 3SU8X 2O6VD 2EJ8A 2ZNVB 2KDFB 3R7QA 3AXCA 3U8ZA 3N3KB 4DHJD 2K2UA 4DBGA 4K1RB 5LONB 2KDIA 2YT0A 1LW3A 3ENEA 3DXCA 4WAAA 2P0DA 3DVNU 1GGOA 3L17A 3ZVVA 2OTXA 1J0GA 5JVLA 4IOYX 2J7QB 2ZNVC 2N7EA 5DPSA 3V62A 2KGXB 4BBKA 3OJ4B 1WGRA 4JKDA 1NBFC 1V88A 2IFSA 4EOYA 4HHVA 1X05A 2ZPNA 3QJZA 2P8VA 5CLQB 2KC1A 1WRDB 4MJSA 1QZEA 4WWNA 1UGMA 2AWTA 3PTFC 3DVGY 1KZ7A 3OLMD 3RCPA 2MA9B 4BBNF 3TO1A 4CHMA 5J3YA 2LI5A 2N23A 4W9IA 2L76A 2ROVA 1NDDA 1W1GA 1FHXA 1X1FA 2K25A 2R2QA 3EPYA 2BCJA 3E9LA 3QCAA 1S1QB 4JGHB 3KZ1A 3UZTA 2A4ZA 3IFWB 3CF6E 3VUYA 3V6CB 5D3VA 3W1SA 4JIOU 2ADZA 1RLFA 4GN1A 2VKIA 4K7WA 2KX0A 4YL8A 4A20A 4MT7A 2YLMA 3IG3A 1UNRA 4NNJB 2MQJA 1RAXA 2MW5A 4A6FB 1KI1B 2D11A 2YS5A 4G0NB 4C0AA 3A4RA 1VCBA 1NTIA 1WXVA 3SNHA 5G55A 4ANWA 3V6EB 2RQ1A 3RYTA 2K00A 2BWFA 3Q3JA 2MCNB 3U7DA 1WJNA 3ZLZA 3O96A 2UZRA 3H7SA 1K8RB 3DBHI 1WGHA 4FA6A 2ROZB 5J3TA 3N30A 2R82A 2YSZA 3ODWA 3TVVA 2LYDA 3VTWA 2L1CA 1DROA 3E66A 4W9GA 2KJ6A 1J19A 4JKGA 2FIDA 2NBVB 4A6FA 2GBMA 5D2MB 3QC8B 2C7HA 2RLOA 2MSED 3VQIA 1P6SA 2ZEQA 1AQCA 3D8EA 3L16A 4EKUA 3PG7A 2NBWB 3NHEB 2OQBA 4GMXB 5LOPB 3IHPC 5D7GA 3T9LA 4OVVA 4JL9A 2CY5A 4N9F4 5D94A 1WMHB 3M63B 1JDEA 1Y8RC 2L8JA 4GDLB 5DI9B 2RSGA 2Z0DB 1FB8A 2V1YA 2MWSB 5FI0A 3OAWA 1XD3B 2PZ1A 2HTHA 1ZW7A 4KSLC 3T8MA 4CO7A 1NTVA 3HIZA 3JSVA 1BWNA 2WH5A 1KLVA 4NQKE 2MP2B 4HAUB 4HAZB 2KTRB 3VUXA 4TQ1A 2BF8B 3KY9A 4XZ4A 4TUUA 2XK5A 1P1AA 2DZMA 5JZEB 1R4MI 2KVRA 2VSZA 2D07B 2HTHB 2VRRB 4MGKE 1EAZA 1WZ3A 4IWPA 3V60A 4W9EA 2LXCA 4ILHA 2FAZA 4MM3A 2LZ6A 2COPA 2C5LC 4HAYB 4EMOA 2HD5B 1UELA 2LJ5A 2V3SA 1WFYA 3EECA 1MPHA 4HB4B 4HAWB 2MWNB 2D3GA 2XQNM 1EF1A 2C60A 4KDIC 2DKPA 1WX8A 2V4LA 1E5WA 2LKOA 4W9HA 4J6IA 5DIFB 1L7YA 2BYFA 3L54A 3K9OB 1CMXB 2HRJA 2KCJA 5C23A 4IFSA 1K5DB 2RGFA 3UIOB 4MGYE 3QHTA 4W9JA 4ANVA 2CHZA 4BFRA 2PPHA 4KIKA 3SBTA 2IY0B 2UVMA 3UIPB 2L00B 2CR5A 2KWUB 4EUTA 1UEFA 1XCGA 3A33B 3X23A 5JLJB 4BBNC 1FAOA 5EDSA 1UNPA 2LULA 2DYMA 1RRBA 3ML8A 4TV3A 2FJ9A 4MSQB 1WGDA 1GG3A 4FN2A 2KDBA 1V86A 2XEWA 2R0DA 2IYBA 3MPXA 4F8CB 2FJLA 3ZKJC 1FGZA 5AEKB 4AJYB 2ZCCA 2KKCA 2P0HA 3KUZA 4GIVA 1B55A 3HHMA 1IYFA 2DHJA 3R3MA 2JY6A 2BKFA 1MK9B 4MK0A 4JKFA 1V49A 4TYZA 4ANXA 2CHWA 3RZWC 1HB6A 3FM8C 1EF5A 4NAWA 5C16A 3FEHA 3H7PA 4HATB 2N9XA 2WWZA 3TJPA 3ZUNA 4F1SA 5FI1A 2NPTA 2D2QA 3UQAA 3PLVA 2DZKA 1V61A 4PS3A 4KDLB 2MDXA 2O6VA 5JHBA 5C6RA 4RM8A 4NSWA 3H9DA 4MY6A 5DCNA 4MSMB 2Y5BB 3H6NA 1FGYA 3SD5A 1Q1OA 3ONSA 2LVPA 2DYQA 2LVQA 4IM3A 5J2RA 3HW2B 2Y8GA 4K17A 1MAIA 3ZTCA 3VH4B 4DDGD 4JKHA 2J0MA 2XBBC 3ZNZB 2NPTB 2R2OA 4IWQA 4KSKC 4B6WA 1GUAB 3KVFB 3SUZA 3L10B 1X86A 2DENB 5IA7A 5KCVA 3VTUA 3PT2B 4Z2NA 5GMVA 1NVLA 4K2OA 3VAWA 1EGXA 4A3OA 2OOBB 4K2PA 1WY8A 3M1IB 4E74A 3DVNV 1ZM0A 3GZNI 2D9YA 1WI0A 2G3QB 3PSCA 3FP5A 2KQ7A 4FJYA 1OY2A 4IWOA 2JWZA 2DAJA 4IAPA 2LGYA 4FBJB 3ZDTA 5DH9B 4JQWC 3A1QA 3EC8A 2KMAA 2KNBA 2JUOA 1WF9A 1Y5OA 1QC6A 3S2AA 3A98B 2KHWB 4GMVA 4W9DA 2FDQA 5IAAC 2Z0OA 4DHJB 3TW1A 3WAMA 3ZO5B 2Z0QA 1C1YB 5GOWB 3DPDA 1T0YA 2KUPA 4Z2MB 1MKEA 1WJ4A 4AJWA 1AARA 4BKTA 3DDCB 4LDTD 2KC2A 5CX3A 2COCA 1I42A 1DYNA 3NZSA 2KWVB 1J8CA 2QHOA 2MBQA 1H8CA 5J18A 3JW0X 4HPLB 1RJ2A 3RT3B 1MK7B 2AL3A 2JP2A 4MGIE 3KYCD 2Z0EB 1WR6E 2ELAA 1WVHA 2IY1B 2D9VA 3CSTA 1TQZA 2KWCA 2RNRB 3KRWA 3VOQA 2KTRA 2C9WB 5E6PA 4GB9A 2W2XD 2B3AA 4M8NA 3TBLD 5TR5A 2NR2A 1UZXB 3HM3A 2OJRA 5D3YA 2KJHB 3SV1A 4EJNA 2CU1A 1TBEA 2W9NA 5D3WA 1EVHA 4FLHA 2G4SA 3U30A 1NTYA 1TXDA 3E9OA 4NPNA 3EFUA 4K7UA 4E71A 2MLBA 5D27A 1V89A 2H7DA 4JK7A 1WI1A 4II3B 4IW0A 2N0YA 4GPTB 1WJMA 2Z59B 3ML4A 2DZJA 1U27A 2IO3B 1KBLA 1RFAA 2IYDB 4II2B 1YD8U 3VDZA 2ELBA 1VBHA 5J3QA 2YT1A 3UQBA 2YVCA 1Q5WB 4WWOA 2CS4A 2REXA 1TJ6A 3M95A 2MX2A 4AUQC 1FHOA 2EMTA 3A9KB 2DZIA 2CHXA 3LJ3A 3WAPA 1WGGA 2M14A 2KJRA 1ZC3B 1BAKA 4AP4C 2Y8FA 1FOEA 2RVBB 4WSFA 1OEYA 3BINA 2LG1A 1M94A 1P98A 2CODA 3PZDA 1UPQA 3AI5A 2LXAA 3Q3FA 2K8BA 2KO3A 4LCDE 3RZFA 3F5RA 1LQBA 4FHKA 4ZDVA 1M7RA 1Z87A 3D8FA 5G2NA 4NAWB 4CHJA 1RRPB 3G9WA 1WE7A 1U5DA 3QQ8B 2G45B 3B0AA 5BO4B 1HBKA 1U5FA 1PLSA 3QK0A 4B6HA 3P7ZA 2KANA 1TGZB 5HE1A 2JRIB 3MDBC 2LGDA 2HE7A 4P7IA 3SDLC 1PFJA 2NBUA 1V5PA 1WE6A 1D3ZA 1WM3A 3MHSD 4KAXB 4ICVA 3QWZB 2M4NA 2YF0A 4JLCA 4CYEA 3VVWB 3DVGX 4BOSC 2DHIA 1AWEA 4HXDA 1K5GB 2H7EA 4NQLB 2YS3A 1FXTB 1VD2A 3PRZA 5EFXA 3OANA 3A9JA 1E8WA 3MJWA 1A5RA 2GBJA 1WX7A 2GBRA 3C0RB 4WVFB 5IJMA 3P2BA 2UWQA 5HE2A 1WIAA 2GBNA 3EHVA 3DCGA 3R7RA 4HDQA 1X11A 2K6DB 2KFKB 4ASWC 3X0WA 4HB0B 2WYQA 1TTNA 3SBGA 1DBHA 4RMAA 2NCNA 2PE9A 2KXJA 2KFKA 1LFDA 3L0WB 2LOXA 2D9XA 3M62B 4DK5A 2FCQA 2KN5A 1TZ1A 5LXHA 2JT4B 4FULA 3MTNB 3I3TB 4JKCA 1V9JA 5L81A 1P3QU 3M3JA 3P6AA 5L95C 2DTCA 1M7EA 2P0FA 2CY4A 2ABDA 1BTNA 2CKHB 1DDMA 3KYDD 3LJUX 3QX1A 2JRHA 2L05A 1VBGA 1IPGA 4LDTB 3RUIB 3ULCA 1GC6A 1YX5B 2YRYA 5C5BA 3RULA 4E3CA 4DBBA 2ZJDA 4NY0A 5KQ1A 3APFA 1W1HA 4KZ0A 3UGBB 1KJTA 3HQCA 4HVBA 1U5GA 1SIFA 1YJ1A 4RM9A 3ZNHB 2MBHA 3CMMB 4WJNA 2KTFA 1P9DU 3TMPB 3DOWA 1MIZB 4HAXB 2ZPYA 1ZVRA 3LDZE 2ZCBA 3PRMB 1E8XA 2LBBA 2N7DA 1OGWA 4HK2A 1XR0B 4ILJA 4MDKE 4F7UP 3ZW3A 4HB3B 2VRWB 3SO6A 3PEGA 4DWFA 2NMBA 4L6EA 2QKMA 1ST7A 1P3RA 4DDID 4XC2A 3VTVA 1WGUA 4KHAA 4FADA 4W9KA 4XWXA 3WALA 3A1QB 5JP4A 4MEMA 5KHQA 3CSFA 1OQYA 1UBQA 3QAQA 4BKSA 2KOXA 2KZRA 2DFKA 2I1JA 2AYOB 4ZYNA 1LB1A 3PS6A 1V5MA 4ZRJA 1XD4A 4WJQA 3ZVRA 4XX5A 4Y94A 4A5KA 1UH6A 3QARA 4IG7B 3QWMA 4GXBA 3DBLI 5DPWA 3ODOA 1V5TA 4HCNB 2BWES 1GNUA 4HWIB 5E6NA 3PP2A 1OEYJ 1WYWB 2DKQA 2COAA 2JVCA 1L2NA 2FCNA 1ZGUB 3WYFB 4KZCA 5LLIA 1KOTA 2O2VA 1DIKA 4PS8A 2AL6A 1WM2A 2RR9A 3A9KA 2R09A 2LOZA 4EZKA 4ZRKA 2M38A 5JHGA 2DIKA 1U5EA 2AEHA 3H7PB 1XX0A 2FCSA 2MBBB 1WJ1A 4GZUA 3CXBB 2RPQA 4KV2A 1Q67A 3PREA 4K7SA 2JZ3B 3JYUA 2MBEA 4WJPA 4I6NB 2ZVNA 5HE0A 3VHTC 3WANA 4KIKB 3UF8A 3ZTDA 3N32A 4PYUA 1MG8A 2RUKB 4B95A 1QQGA 4JKAA 5DHAB 1WXAA 1U2BA 2BYEA 2LRWA 3RD2A 4ILGB 4ZRIA 1WX9A 3T06A 1YIWA 3NS8A 2LRUA 2O2VB 2FUHB 4HLEA 3APDA 1XKEA 2O6VB 2MRPA 4EFOA 4ICUA 2M17A 2DAFA 2DN6A 1I35A 2UZSA 2LASA 3ZRFA 2EKEC 3GYOA 4IM0A 2LGXA 5L83A 3TFMA 4B9KA 5HE3A 4MELA 3K9PB 3DXEA 2ZZPB 1YQBA 1EUVB 3PRPB 2GJYA 1XQQA 3ZIMA 3FLVA 2COFA 1SE9A 2LVOA 1MIXA 2KLCA 2HJ8A 1ISNA 2KQSA 2KLGA 3W1YA 1F9JA 4PQ0A 1PMSA 2N9PC 2K8CA 2M0XA 2CQUA 2DYOA 1H4RA 3DXDA 1X1GA 1E7VA 4K81A 3WA0A 2K2JA 4KHOA 2WX0A 4EZJA 2BYVE 4IUMB 1GJZA 3JSVB 3VXWA 4WJ7A 4A6HA 2DLWA 3TL5A 2M8SA 1SGHA 2JPHA 1C3TA 3JVZX 3ML9A 1P5TA 1LM8B 3ENBA 1U4AA 2D4QA 2J0JA 3KH0A 3L08A 1ZC4B 1UPRA 3PVWA 3ECIA 1KC7A 2C7NB 4TQ0A 3HK0A 3PPAA 3NZUA 2DX1A 4DHZB 2Q13A 3A4SC 3SHQA 5AZGA 4DHZE 2X18A 1E7UA 1J0WA 3E9PA 1IRSA 1Y19B 1V5OA 2DHZA 4GDKB 1Z2MA 4EEWA 3A9JB 1IP9A 4JKBA 3GOEA 3TIXA 4LJOB 5CHVC 2EMSA 3ZNGC 3ALBA 3VUWA 3D32A 2FCMA 2DHKA 1KM7A 1P0RA 3HM6X 3AJ4A 5JHHA 2NS5A 2L7RA 3ZDMC 2BGFA 1WXMA 3NSUA 1E90A 5D3XA 2NZ8B 2RSUA 1UNQA 2Z0PA 3A8QA 4URKA 3PLUA 2GOWA 2FNJB 4JK8A 5D6JB 2YS1A 1LXDA 4KVGB 5KQ4A 1WXSA 2E2XA 5AZFA 2WX1A 3V61A 2JF5A 2GCLA 3RCZA 5C1ZA 2MP2A 1NU2A 4CHKA 4DX90 1WGYA 3PHXB 4YONA 4D0NB 3VH3B 2A5UA 1I2HA 1WG7A 1SHCA 4HDOA 2ASQA 4IM2A 2MKRA 1HE8A 4M8MA 1V5UA 4HB2B 1HB8A 1W1DA 3NY5A 3FSSA 3QBVB 3DBRI 5LXIB 2V76A 2GCJA 1NI2A 2GS0A 4HPMB 2LD9A 1H10A 4NJ6A 1V81A 3ODXA 4HCPB 3GYPA 3PV1A 5DPRA 3DQVA 3DBSA 4I6PA 4IC7B 3WIMA 4W9FA 2IZVB 1E8YA 4F7ZA 1DDVA 4HJKA 2K1FA 4WQOB 1R4NI 4I6LB 3AU4A 4F7HA 2LUEA 1WH3A 2N9EB 5E6OA 3IVFA 1V2YA 2EC1A 1BT0A 1DDWA 2K39A 2IO2B 5JH5C 3APCA 5HKHA 3O65B 5KHOA 2IO1B 4PNKA 4G11A 2N1WA 2DYBA 4DX8A 4BVUC 5AZHA 3IBEA 2D9ZA 2Y7BA 2KD0A 2QKLA 3D8DA 1UD7A 2KK8A 4GU2A 5DHFB 3B1LX 3R66C 4JK9A 4GGQA 2DX5A 2G4DB 1UBIA 3N7CA 2CRFA 4WJOA 2C7MB 1ACAA 1Q0WB 4G50A 3V5WA 1KZGA 4FJZA 2N4FA 4GDKA 1U29A 4X57B 1YX6B 3AULA 4GOCA 3L13A 1X1MA 4BOZB 2W2XC 2K8HA 4TKNA 5C5BB 3ZNID 4H8SA 1G6JA 2JZZA 5JHAA 3UINB 1XT9B 1EO6A 2DX5B 2L0TA 4MJSB 3NOBA 3QA8A 1ZSQA 1JRUA 3KW5B 3ZRCA 4W9LA 1WMHA 2J0KA 4A3PA 2LWPA 4GSWA 2RD0A 2PE6B 3PVUA 2I5FA 2GMIC 2ZVOA 3KUCB 2BKRB 2XK5B 3SYXA 3BJIA 1OTRB 2MFQA 1GC7A 4F7GA 4WWPA 2WDTB 4JKEA 5C79A 2NVUI 3H1UA 2L3ZA 4OVUA 1WJ6A 3TCAA 1V80A 2PJHA 2DYNA 1I7AA 5FR6A 5CTRC 1OMWA 4BKGA 5CLLB 3PHWB 3QIJA 2M1MA 1N3HA 3KRXA 4PYZA 2D10A 2G35A 2IBIB 1Z5SB 2N1VA 2K6QA 3OJ3A 2J59M 2I1KA 1WZ0A 1WR1A 5DPTA 2JXXA 4A6KA 4GDLA 2FIFA 2GBKA 5CHFA 1PQSA 1E8ZA 1WJUA 4MH0E 1FHWA 2MBOA 2DA0A 4PS7A 2KFJA 3VFKA 3PGEA 2UYZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A33 B;  3F5R A;  3PRP B;  1LQB A;  4NJ7 A;  1V6E A;  4FHK A;  4G3X B;  2GJY A;  4ZDV A;  1XQQ A;  1M7R A;  3X23 A;  1WGQ A;  1OQN A;  3ZIM A;  3F0W A;  3FLV A;  2COF A;  1SE9 A;  3WAO A;  4DXA B;  1XOD A;  1Z87 A;  5JLJ B;  4ANU A;  2LVO A;  4BBN C;  1MIX A;  1S3S G;  2KLC A;  1FAO A;  2HJ8 A;  1ISN A;  2KQS A;  1UNP A;  3ULB A;  2KLG A;  4KHB B;  4M0W B;  3W1Y A;  5EDS A;  1F9J A;  2LUL A;  4PQ0 A;  4AWJ A;  1PMS A;  3D8F A;  2DYM A;  1RRB A;  5G2N A;  2N9P C;  3ML8 A;  4TV3 A;  3PSE B;  2K8C A;  2M0X A;  4F8C B;  4NAW B;  2CQU A;  4DDG D;  2D9W A;  2DYO A;  2FJ9 A;  1H4R A;  3DXD A;  4CHJ A;  1X1G A;  2L2I A;  1BTK A;  1E7V A;  4MSQ B;  1RRP B;  3G9W A;  1WGD A;  1WE7 A;  3BY4 B;  1U5D A;  4K81 A;  1GG3 A;  2KX3 A;  2I5C A;  4FN2 A;  3WA0 A;  2BPS A;  2KDB A;  1V86 A;  2G45 B;  2IO0 B;  2XEW A;  2R0D A;  3B0A A;  4HAV B;  3KUD B;  3QQ8 B;  4W9C A;  2K2J A;  3B08 A;  5BO4 B;  3W1S C;  5CHW A;  2IYB A;  3MPX A;  1HBK A;  4KHO A;  2WX0 A;  1U5F A;  4FHJ A;  4AOF A;  4WWP A;  1PLS A;  2BYV E;  2FJL A;  3VIA A;  4IUM B;  2CB8 A;  4EZJ A;  3QK0 A;  1GJZ A;  4B6H A;  3A8P A;  3JSV B;  3P7Z A;  2KAN A;  1FGZ A;  3ZKJ C;  4EZL A;  1TGZ B;  5AEK B;  4BKS D;  3KSY A;  3VXW A;  4AJY B;  2RGN B;  2CAY A;  4WJ7 A;  2W2W A;  5HE1 A;  2JRI B;  2ZCC A;  2KKC A;  2P0H A;  3MDB C;  3KUZ A;  3PVL A;  2PEA A;  4A6H A;  2LGD A;  2HE7 A;  4GIV A;  4P7I A;  2DLW A;  1B55 A;  3CIK A;  3HHM A;  1PFJ A;  2NBU A;  4LJP B;  2KMC A;  1V5P A;  1WE6 A;  2DHJ A;  3SDL C;  3TL5 A;  5J17 A;  2M8S A;  1D3Z A;  1WM3 A;  2KDE B;  3R3M A;  3AU5 A;  3MHS D;  2JY6 A;  1ZKH A;  4FJV B;  2L0F A;  1SGH A;  4KAX B;  4MGZ E;  2JPH A;  3SU8 X;  1C3T A;  2O6V D;  2EJ8 A;  3JVZ X;  4ICV A;  3ML9 A;  3QWZ B;  1P5T A;  2ZNV B;  2KDF B;  3R7Q A;  2M4N A;  1LM8 B;  2BKF A;  1MK9 B;  2YF0 A;  4JLC A;  4MK0 A;  3AXC A;  3U8Z A;  2D4Q A;  1U4A A;  2J0J A;  4TYZ A;  1V49 A;  3KH0 A;  4CYE A;  3N3K B;  3L08 A;  1ZC4 B;  2CHW A;  1UPR A;  3PVW A;  3RZW C;  3ECI A;  4DHJ D;  1HB6 A;  2C7N B;  3VVW B;  4TQ0 A;  3DVG X;  2K2U A;  2DHI A;  3FM8 C;  3HK0 A;  1EF5 A;  3PPA A;  4NAW A;  5C16 A;  1AWE A;  4BOS C;  4DBG A;  4HXD A;  3FEH A;  3H7P A;  4K1R B;  1K5G B;  2H7E A;  5LON B;  3NZU A;  4HAT B;  2KDI A;  2DX1 A;  2YT0 A;  2N9X A;  4DHZ B;  2Q13 A;  2WWZ A;  3A4S C;  3TJP A;  3ZUN A;  3SHQ A;  4F1S A;  1LW3 A;  5FI1 A;  4NQL B;  2NPT A;  3ENE A;  2YS3 A;  2D2Q A;  3DXC A;  2P0D A;  1FXT B;  1VD2 A;  3PRZ A;  5EFX A;  4WAA A;  3DVN U;  3OAN A;  2X18 A;  1E7U A;  3A9J A;  3UQA A;  1J0W A;  1E8W A;  3L17 A;  3ZVV A;  3PLV A;  2OTX A;  1J0G A;  1IRS A;  3MJW A;  4IOY X;  2DZK A;  1Y19 B;  1V5O A;  2J7Q B;  2N7E A;  2ZNV C;  2GBJ A;  1A5R A;  5DPS A;  1WX7 A;  1V61 A;  2DHZ A;  4PS3 A;  4KDL B;  2GBR A;  2MDX A;  2KGX B;  4GDK B;  3C0R B;  3V62 A;  4BBK A;  2O6V A;  3OJ4 B;  1WGR A;  4WVF B;  5IJM A;  1Z2M A;  5JHB A;  4EEW A;  3P2B A;  1NBF C;  3A9J B;  1V88 A;  2IFS A;  2UWQ A;  1IP9 A;  5HE2 A;  1WIA A;  4EOY A;  3GOE A;  4HHV A;  1X05 A;  5C6R A;  2GBN A;  2ZPN A;  3QJZ A;  3TIX A;  2P8V A;  4RM8 A;  4NSW A;  4LJO B;  5CHV C;  3H9D A;  5CLQ B;  2EMS A;  3EHV A;  2KC1 A;  3ZNG C;  3DCG A;  3R7R A;  3ALB A;  1WRD B;  4MY6 A;  4MJS A;  4HDQ A;  1QZE A;  1X11 A;  2K6D B;  4WWN A;  2KFK B;  1UGM A;  5DCN A;  3VUW A;  4MSM B;  2Y5B B;  3H6N A;  2AWT A;  1FGY A;  3PTF C;  3SD5 A;  3X0W A;  3D32 A;  4ASW C;  1Q1O A;  2FCM A;  3ONS A;  3DVG Y;  1KZ7 A;  2DHK A;  3OLM D;  4HB0 B;  2LVP A;  2DYQ A;  1TTN A;  2WYQ A;  1KM7 A;  3RCP A;  1P0R A;  2MA9 B;  3HM6 X;  4BBN F;  3AJ4 A;  3TO1 A;  5JHH A;  4CHM A;  1DBH A;  2NS5 A;  5J3Y A;  4RMA A;  2L7R A;  2LI5 A;  2NCN A;  3ZDM C;  2LVQ A;  2PE9 A;  4IM3 A;  2BGF A;  2KXJ A;  1WXM A;  2N23 A;  3HW2 B;  2KFK A;  5J2R A;  2Y8G A;  3NSU A;  4K17 A;  1E90 A;  1LFD A;  1MAI A;  5D3X A;  2NZ8 B;  3L0W B;  4W9I A;  2RSU A;  3VH4 B;  3ZTC A;  2LOX A;  2L76 A;  1UNQ A;  2J0M A;  2D9X A;  2ROV A;  3A8Q A;  2Z0P A;  2XBB C;  3PLU A;  2GOW A;  2FNJ B;  4URK A;  5D6J B;  3M62 B;  3ZNZ B;  2YS1 A;  2NPT B;  2R2O A;  4IWQ A;  1NDD A;  4DK5 A;  2FCQ A;  2KN5 A;  1TZ1 A;  4KSK C;  1W1G A;  4B6W A;  5LXH A;  1LXD A;  2JT4 B;  1FHX A;  1GUA B;  4FUL A;  1X1F A;  3KVF B;  3SUZ A;  4KVG B;  2K25 A;  3MTN B;  2R2Q A;  5KQ4 A;  3L10 B;  1X86 A;  1WXS A;  2E2X A;  3EPY A;  3I3T B;  2BCJ A;  5AZF A;  1V9J A;  5L81 A;  2DEN B;  3QCA A;  3UQB A;  1S1Q B;  5IA7 A;  4JGH B;  1P3Q U;  2WX1 A;  3M3J A;  3V61 A;  3P6A A;  5L95 C;  2DTC A;  1M7E A;  2P0F A;  2GCL A;  2CY4 A;  2JF5 A;  3RCZ A;  5C1Z A;  5KCV A;  2ABD A;  3KZ1 A;  2MP2 A;  3VTU A;  3UZT A;  3PT2 B;  4Z2N A;  2A4Z A;  1NU2 A;  1BTN A;  2CKH B;  1DDM A;  3IFW B;  3KYD D;  3LJU X;  3QX1 A;  4CHK A;  5GMV A;  2JRH A;  4DX9 0;  2L05 A;  1WGY A;  3CF6 E;  3VUY A;  1IPG A;  3PHX B;  3V6C B;  4YON A;  4D0N B;  1NVL A;  3VH3 B;  4K2O A;  5D3V A;  2A5U A;  1I2H A;  1WG7 A;  3ULC A;  4LDT B;  4JIO U;  3RUI B;  2ADZ A;  3VAW A;  3W1S A;  1SHC A;  1EGX A;  4HDO A;  1GC6 A;  1RLF A;  4GN1 A;  4A3O A;  2ASQ A;  1YX5 B;  2YRY A;  5C5B A;  2OOB B;  4IM2 A;  3RUL A;  2MKR A;  2VKI A;  1HE8 A;  4M8M A;  4E3C A;  4K2P A;  1WY8 A;  3M1I B;  4K7W A;  1V5U A;  4HB2 B;  4DBB A;  4E74 A;  2ZJD A;  3DVN V;  2KX0 A;  4NY0 A;  4YL8 A;  5KQ1 A;  1HB8 A;  3APF A;  1ZM0 A;  4A20 A;  3GZN I;  1W1D A;  2D9Y A;  3FSS A;  4MT7 A;  3NY5 A;  3QBV B;  1WI0 A;  2YLM A;  3DBR I;  1W1H A;  5LXI B;  4KZ0 A;  2V76 A;  2G3Q B;  2GCJ A;  3UGB B;  3IG3 A;  3PSC A;  1UNR A;  3FP5 A;  4NNJ B;  2KQ7 A;  4FJY A;  2MQJ A;  1NI2 A;  1RAX A;  2GS0 A;  1KJT A;  2MW5 A;  3HQC A;  1OY2 A;  4HPM B;  2LD9 A;  1H10 A;  4A6F B;  1KI1 B;  1U5G A;  4IWO A;  2JWZ A;  2D11 A;  4HVB A;  2YS5 A;  4G0N B;  4C0A A;  3A4R A;  1VCB A;  4NJ6 A;  1NTI A;  1SIF A;  1YJ1 A;  4RM9 A;  1WXV A;  3SNH A;  1V81 A;  3ZNH B;  2MBH A;  3CMM B;  5G55 A;  4WJN A;  2KTF A;  3ODX A;  1P9D U;  3DOW A;  3TMP B;  1MIZ B;  3V6E B;  2RQ1 A;  3RYT A;  4ANW A;  4HAX B;  4IAP A;  3GYP A;  2ZPY A;  2DAJ A;  2LGY A;  1ZVR A;  3PV1 A;  4HCP B;  2K00 A;  5DPR A;  3LDZ E;  2ZCB A;  3DQV A;  4FBJ B;  3ZDT A;  3DBS A;  4I6P A;  5DH9 B;  2BWF A;  4IC7 B;  3WIM A;  3Q3J A;  4W9F A;  2MCN B;  2IZV B;  3U7D A;  1E8Y A;  3PRM B;  1WJN A;  4JQW C;  3A1Q A;  3EC8 A;  4F7Z A;  1DDV A;  1E8X A;  2K1F A;  4HJK A;  3ZLZ A;  2KMA A;  3O96 A;  2JUO A;  1WF9 A;  2LBB A;  2KNB A;  4WQO B;  1Y5O A;  2UZR A;  3H7S A;  2N7D A;  1OGW A;  4HK2 A;  1QC6 A;  1K8R B;  1R4N I;  4I6L B;  3DBH I;  1XR0 B;  3AU4 A;  3A98 B;  1WGH A;  3S2A A;  4FA6 A;  2KHW B;  2ROZ B;  4F7H A;  5J3T A;  2YSZ A;  4GMV A;  2LUE A;  3N30 A;  4MDK E;  4W9D A;  2FDQ A;  3ODW A;  1WH3 A;  2N9E B;  3TVV A;  1KOT A;  5E6O A;  5IAA C;  2Z0O A;  3IVF A;  2LYD A;  4F7U P;  4DHJ B;  3VTW A;  1V2Y A;  3ZW3 A;  4HB3 B;  2EC1 A;  2L1C A;  3TW1 A;  1DRO A;  3WAM A;  2VRW B;  3ZO5 B;  1BT0 A;  1DDW A;  2Z0Q A;  2K39 A;  3SO6 A;  2IO2 B;  5JH5 C;  3APC A;  5HKH A;  1C1Y B;  3O65 B;  5GOW B;  2KJ6 A;  4W9G A;  1J19 A;  3PEG A;  4DWF A;  2FID A;  2NBV B;  2NMB A;  5KHO A;  3DPD A;  4L6E A;  1T0Y A;  4A6F A;  2QKM A;  2KUP A;  1ST7 A;  1MKE A;  4Z2M B;  1WJ4 A;  2GBM A;  5D2M B;  2IO1 B;  4AJW A;  1P3R A;  1AAR A;  4PNK A;  3QC8 B;  3V60 A;  4BKT A;  3DDC B;  4LDT D;  2C7H A;  4G11 A;  2RLO A;  2MSE D;  3VQI A;  2KC2 A;  4DDI D;  2N1W A;  4XC2 A;  5CX3 A;  1P6S A;  3VTV A;  1WGU A;  2COC A;  2ZEQ A;  2DYB A;  1AQC A;  1IYF A;  1I42 A;  4KHA A;  1DYN A;  3D8E A;  4DX8 A;  3NZS A;  2KWV B;  4BVU C;  1J8C A;  4FAD A;  3L16 A;  4EKU A;  5AZH A;  2QHO A;  3IBE A;  3PG7 A;  2D9Z A;  2Y7B A;  4XWX A;  2KD0 A;  2MBQ A;  4W9K A;  5AZG A;  3WAL A;  1H8C A;  2NBW B;  2QKL A;  3D8D A;  3NHE B;  1UD7 A;  2KK8 A;  3A1Q B;  2OQB A;  5J18 A;  5JP4 A;  3JW0 X;  4GU2 A;  4GMX B;  5LOP B;  4HPL B;  4MEM A;  5DHF B;  1RJ2 A;  3RT3 B;  3IHP C;  5KHQ A;  5D7G A;  3T9L A;  3B1L X;  1MK7 B;  2AL3 A;  4OVV A;  3R66 C;  3CSF A;  1OQY A;  1UBQ A;  3QAQ A;  4BKS A;  2JP2 A;  2KOX A;  2KZR A;  3KYC D;  4GGQ A;  4MGI E;  4JL9 A;  2Z0E B;  2CY5 A;  2I1J A;  2DFK A;  2AYO B;  4N9F 4;  5D94 A;  4ZYN A;  2DX5 A;  1WR6 E;  2G4D B;  1LB1 A;  1WVH A;  2ELA A;  1UBI A;  2IY1 B;  2D9V A;  1V5M A;  3CST A;  3PS6 A;  1WMH B;  3N7C A;  1TQZ A;  2KWC A;  2CRF A;  3M63 B;  2RNR B;  4WJO A;  2C7M B;  3KRW A;  1ACA A;  3VOQ A;  2KTR A;  4ZRJ A;  1XD4 A;  1Y8R C;  2L8J A;  4GDL B;  5DI9 B;  2RSG A;  4WJQ A;  3ZVR A;  2Z0D B;  2C9W B;  4XX5 A;  1Q0W B;  4Y94 A;  5E6P A;  4G50 A;  3V5W A;  1FB8 A;  1KZG A;  4FJZ A;  4GB9 A;  4A5K A;  2W2X D;  2B3A A;  2N4F A;  4M8N A;  1UH6 A;  3QAR A;  4IG7 B;  2V1Y A;  4GDK A;  2MWS B;  3TBL D;  5FI0 A;  3OAW A;  1U29 A;  4X57 B;  1YX6 B;  1XD3 B;  3QWM A;  2PZ1 A;  5TR5 A;  4GXB A;  2HTH A;  3AUL A;  3DBL I;  2NR2 A;  4GOC A;  3L13 A;  1UZX B;  1ZW7 A;  1X1M A;  3HM3 A;  4BOZ B;  5DPW A;  3ODO A;  1V5T A;  2OJR A;  5D3Y A;  4HCN B;  4KSL C;  2KJH B;  2W2X C;  2K8H A;  4TKN A;  5C5B B;  3T8M A;  4CO7 A;  3ZNI D;  2BWE S;  1GNU A;  4H8S A;  4HWI B;  1G6J A;  2JZZ A;  3SV1 A;  5E6N A;  4EJN A;  2CU1 A;  3PP2 A;  1OEY J;  1NTV A;  1TBE A;  5JHA A;  1WYW B;  3UIN B;  2DKQ A;  2W9N A;  5D3W A;  3HIZ A;  1BWN A;  3JSV A;  2WH5 A;  1KLV A;  1EVH A;  1XT9 B;  4FLH A;  2COA A;  1EO6 A;  2DX5 B;  2JVC A;  2L0T A;  4MJS B;  2G4S A;  3U30 A;  1NTY A;  3NOB A;  1L2N A;  3QA8 A;  1ZSQ A;  4NQK E;  1JRU A;  2MP2 B;  4HAU B;  2FCN A;  4HAZ B;  3KW5 B;  1TXD A;  3ZRC A;  2KTR B;  1ZGU B;  3VUX A;  3WYF B;  1WMH A;  4TQ1 A;  4W9L A;  2J0K A;  2BF8 B;  3KY9 A;  4NPN A;  3EFU A;  4K7U A;  4KZC A;  4XZ4 A;  2MLB A;  5LLI A;  4E71 A;  5D27 A;  1V89 A;  4TUU A;  2XK5 A;  2H7D A;  1P1A A;  2DZM A;  2O2V A;  4A3P A;  2LWP A;  4GSW A;  4PS8 A;  2AL6 A;  2RD0 A;  1WM2 A;  2RR9 A;  1WI1 A;  2PE6 B;  2R09 A;  3PVU A;  3A9K A;  4II3 B;  5JZE B;  2I5F A;  2LOZ A;  1R4M I;  2KVR A;  4IW0 A;  2GMI C;  4EZK A;  4ZRK A;  2N0Y A;  4GPT B;  1WJM A;  2M38 A;  2VSZ A;  5JHG A;  1U5E A;  2D07 B;  2Z59 B;  2ZVO A;  2AEH A;  2HTH B;  3KUC B;  2VRR B;  3H7P B;  3ML4 A;  2BKR B;  4MGK E;  2DZJ A;  1XX0 A;  2XK5 B;  3SYX A;  1U27 A;  2FCS A;  1EAZ A;  1WJ1 A;  3BJI A;  3CXB B;  4GZU A;  1WZ3 A;  2IO3 B;  1OTR B;  2MBB B;  2LXC A;  2RPQ A;  4IWP A;  4W9E A;  2MFQ A;  4KV2 A;  1Q67 A;  2JZ3 B;  1GC7 A;  3JYU A;  4F7G A;  3PRE A;  2WDT B;  4K7S A;  1RFA A;  2MBE A;  4WJP A;  4I6N B;  5C79 A;  2FAZ A;  2NVU I;  5HE0 A;  2ZVN A;  4MM3 A;  3VHT C;  3WAN A;  4KIK B;  2IYD B;  4II2 B;  4DHZ E;  3H1U A;  2L3Z A;  2LZ6 A;  1YD8 U;  4OVU A;  3UF8 A;  3PGE A;  3VDZ A;  2COP A;  2C5L C;  4HAY B;  2ELB A;  4EMO A;  3N32 A;  4PYU A;  3ZTD A;  1MG8 A;  2RUK B;  2HD5 B;  4ANX A;  1UEL A;  2LJ5 A;  4B95 A;  1WJ6 A;  5J3Q A;  2V3S A;  1QQG A;  3TCA A;  1WFY A;  5DHA B;  1WXA A;  1V80 A;  3EEC A;  1MPH A;  2PJH A;  1U2B A;  4HB4 B;  2YT1 A;  2DYN A;  4HAW B;  2YVC A;  2BYE A;  1I7A A;  1Q5W B;  2LRW A;  2MWN B;  4WWO A;  2D3G A;  2CS4 A;  2XQN M;  2REX A;  5FR6 A;  3RD2 A;  4EUT A;  1TJ6 A;  4ZRI A;  1WX9 A;  1EF1 A;  5CTR C;  1OMW A;  3T06 A;  4BKG A;  5CLL B;  3M95 A;  3PHW B;  2C60 A;  3QIJ A;  1YIW A;  2LRU A;  2M1M A;  2MX2 A;  2DKP A;  3NS8 A;  1WX8 A;  4KDI C;  4AUQ C;  1N3H A;  3KRX A;  4PYZ A;  2V4L A;  1E5W A;  2LKO A;  2O2V B;  2FUH B;  1FHO A;  2D10 A;  4W9H A;  4J6I A;  2G35 A;  5DIF B;  2EMT A;  1L7Y A;  2BYF A;  4HLE A;  2IBI B;  3APD A;  3L54 A;  3A9K B;  1XKE A;  1Z5S B;  2N1V A;  3K9O B;  1CMX B;  2DZI A;  2O6V B;  2K6Q A;  2HRJ A;  2CHX A;  2MRP A;  3LJ3 A;  3OJ3 A;  2M17 A;  4ICU A;  3WAP A;  4EFO A;  2J59 M;  2KCJ A;  2M14 A;  1WGG A;  2DAF A;  2DN6 A;  2KJR A;  2I1K A;  1ZC3 B;  1WZ0 A;  1BAK A;  1I35 A;  5C23 A;  4AP4 C;  2UZS A;  4IFS A;  1WR1 A;  2LAS A;  2Y8F A;  3ZRF A;  1FOE A;  1K5D B;  2RVB B;  2EKE C;  4WSF A;  2JXX A;  3GYO A;  2RGF A;  4IM0 A;  5DPT A;  1OEY A;  2LGX A;  5L83 A;  4A6K A;  3UIO B;  3BIN A;  4GDL A;  4MGY E;  3TFM A;  2LG1 A;  3QHT A;  5HE3 A;  2FIF A;  1M94 A;  2GBK A;  4W9J A;  5CHF A;  4B9K A;  1P98 A;  4ANV A;  1PQS A;  2COD A;  2CHZ A;  3PZD A;  1UPQ A;  4BFR A;  1E8Z A;  1WJU A;  4MH0 E;  4MEL A;  3AI5 A;  3K9P B;  3DXE A;  2PPH A;  1FHW A;  2LXA A;  2ZZP B;  2MBO A;  2DA0 A;  4PS7 A;  3Q3F A;  4KIK A;  2IY0 B;  2UVM A;  2K8B A;  2KFJ A;  2KO3 A;  3UIP B;  1YQB A;  3VFK A;  2L00 B;  2CR5 A;  2KWU B;  4LCD E;  3RZF A;  1EUV B;  2UYZ B;  1UEF A;  1XCG A; 
#chains in the Genus database with same CATH topology
 4NJ7 A;  2J4X A;  4OZA A;  1V6E A;  4G3X B;  1WGQ A;  1OQN A;  4ZHP A;  1T0S C;  3F0W A;  3WAO A;  4ANU A;  4DXA B;  1XOD A;  2PKO A;  1S3S G;  2BS4 B;  3BZD B;  2W54 A;  4M0W B;  3ULB A;  2CU3 A;  4KHB B;  2ON8 A;  4AWJ A;  2JZP A;  3PSE B;  2D9W A;  4JKG B;  2L2I A;  1BTK A;  2LUM A;  2FJU B;  3BY4 B;  1HA5 A;  2KX3 A;  2I5C A;  2BPS A;  4W9C A;  2IO0 B;  3KUD B;  4HAV B;  3B08 A;  2Z8L A;  3W1S C;  5CHW A;  1VZ6 A;  4FHJ A;  4AOF A;  2X0S A;  3VIA A;  2CB8 A;  3FIL A;  1L6V A;  1V1O A;  3A8P A;  4EZL A;  4BKS D;  3KSY A;  2RGN B;  2CAY A;  2W2W A;  3ZJV A;  3PVL A;  2PEA A;  3J9C A;  2WXG A;  3CIK A;  4LJP B;  2KMC A;  5J17 A;  2KDE B;  4C80 A;  3AU5 A;  4FJV B;  1ZKH A;  2L0F A;  2WDV B;  4MGZ E;  5MPO A;  3SU8 X;  2O6V D;  2EJ8 A;  2KR0 A;  2HTM E;  2KDF B;  2ZNV B;  3R7Q A;  2Z13 A;  1AWD A;  3KQ4 A;  3AXC A;  3U8Z A;  3N3K B;  2WXN A;  4LTU A;  4DHJ D;  2K2U A;  3AEC B;  3I9V 1;  4DBG A;  4K1R B;  5LON B;  2KDI A;  2YT0 A;  3DHG C;  1DOI A;  5G5H A;  1LW3 A;  3ENE A;  3DXC A;  4WAA A;  2P0D A;  3DVN U;  1GGO A;  3L17 A;  3ZVV A;  1L5P A;  2OTX A;  1J0G A;  5JVL A;  4IOY X;  2J7Q B;  2ZNV C;  2N7E A;  5DPS A;  3V62 A;  2KGX B;  5HHD G;  4BBK A;  3OJ4 B;  1WGR A;  4JKD A;  1FCL A;  3FIL B;  1NBF C;  1V88 A;  2IFS A;  3AV8 A;  3B2F A;  4C7Y A;  4HHV A;  1X05 A;  4EOY A;  2ZPN A;  3QJZ A;  2P8V A;  5CLQ B;  2KC1 A;  1WRD B;  4MJS A;  1QZE A;  4WWN A;  1UGM A;  2D3A A;  2AWT A;  3PTF C;  4QJ3 B;  1I4R A;  5IP4 D;  4YSZ B;  3DVG Y;  1KZ7 A;  1HZ5 A;  3OLM D;  1I4Q A;  3RCP A;  2MA9 B;  4KKI A;  4BBN F;  3TO1 A;  2QSD A;  4CHM A;  5J3Y A;  2LI5 A;  5T8I A;  5EE3 A;  3HUI A;  2N23 A;  4W9I A;  1TIF A;  2L76 A;  2ROV A;  1EU3 A;  4C00 A;  1HZ6 A;  1JWS D;  1FNV A;  1AW7 A;  1NDD A;  1QOF A;  1W1G A;  1FHX A;  1SF0 A;  4M00 A;  1X1F A;  2K25 A;  2R2Q A;  3EPY A;  2BCJ A;  3E9L A;  3QCA A;  1N63 A;  1S1Q B;  4JGH B;  4JE3 B;  4S0R A;  3W9C B;  3RI7 C;  4OSN A;  3KZ1 A;  3UZT A;  2A4Z A;  1ZE3 D;  1NYR A;  1QT9 A;  3IFW B;  3C8Y A;  2PTL A;  3CF6 E;  3VUY A;  4A90 A;  3V6C B;  4UDU C;  1F0Z A;  5D3V A;  3W1S A;  4JIO U;  2ADZ A;  1TS2 A;  1RLF A;  4KKJ A;  4GN1 A;  1ESF A;  2H88 B;  1JQ4 A;  2VKI A;  4K7W A;  2H89 B;  4MT5 A;  2KX0 A;  4YL8 A;  4A20 A;  1PDX A;  4MT7 A;  2YLM A;  3IG3 A;  1UNR A;  4K3C A;  4NNJ B;  2MQJ A;  4HRS A;  1RAX A;  2WXI A;  2MW5 A;  1R7S A;  4A6F B;  1KI1 B;  2D11 A;  2YS5 A;  4G0N B;  4C0A A;  3A4R A;  1VCB A;  1NTI A;  1WXV A;  3NVW A;  3SNH A;  5I2S A;  5G55 A;  4ANW A;  2DLB A;  3NZ3 A;  3V6E B;  2RQ1 A;  3RYT A;  2CJO A;  2K00 A;  2IDY A;  2BWF A;  3Q3J A;  2MCN B;  3U7D A;  1N6Z A;  1WJN A;  1T3Q A;  3ZLZ A;  3O96 A;  3O13 A;  1J7C A;  2UZR A;  3H7S A;  3I57 A;  1NVI D;  1K8R B;  4ITK A;  3DBH I;  1B9R A;  2PVG C;  1WGH A;  4FA6 A;  2ROZ B;  5J3T A;  3MC9 A;  2R82 A;  2YSZ A;  3N30 A;  1QF6 A;  1UF0 A;  3ODW A;  1VLB A;  3TVV A;  2LHE A;  3OWE B;  2LYD A;  3VTW A;  2L1C A;  1DRO A;  1F2R C;  3Q69 A;  3E66 A;  4W9G A;  2KJ6 A;  2KUQ A;  1J19 A;  4JKG A;  2FID A;  2NBV B;  3TUO A;  4A6F A;  2GBM A;  2K22 A;  5D2M B;  3QC8 B;  1I4X A;  2C7H A;  2RLO A;  2MSE D;  2INC C;  1SB3 C;  3VQI A;  4N6E B;  1P6S A;  2K0P A;  2ZEQ A;  1AQC A;  3D8E A;  2RDG A;  3L16 A;  4EKU A;  5D3D A;  3PG7 A;  4LNN A;  2NBW B;  3NHE B;  2OQB A;  4GMX B;  5LOP B;  3IHP C;  3N1X C;  5D7G A;  2JX5 A;  3T9L A;  4OVV A;  2N9L A;  2INN E;  2L32 A;  4JL9 A;  2CY5 A;  4N9F 4;  5D94 A;  5FK9 C;  1WMH B;  4YTP B;  3M63 B;  4L1B A;  3DWG C;  1TY2 A;  1JDE A;  4P1C C;  3GS2 A;  3SEB A;  3ZQ4 A;  3Q8F A;  1Y8R C;  2L8J A;  4YWG G;  4GDL B;  5DI9 B;  2RSG A;  3GB1 A;  2Z0D B;  1FB8 A;  4YTN B;  1ZDX A;  5EE1 A;  1YN4 A;  3RNC C;  2V1Y A;  3R8B A;  2MWS B;  5FI0 A;  3OAW A;  1XD3 B;  3ZYY X;  2PZ1 A;  2HTH A;  1ZW7 A;  1M4V A;  3U7Z A;  2JXT A;  4KSL C;  4R3D A;  3T8M A;  4CO7 A;  2LFI A;  1NTV A;  3HIZ A;  3P4P B;  3JSV A;  1BWN A;  2WH5 A;  1KLV A;  3DWM A;  1J7B A;  4NQK E;  2MP2 B;  1HEZ E;  4HAU B;  4HAZ B;  2OJW A;  2KTR B;  1CZP A;  1WYG A;  3VUX A;  4TQ1 A;  2BF8 B;  3KY9 A;  4H2A A;  4XZ4 A;  4C4V B;  4TUU A;  4P16 A;  2XK5 A;  1JWU D;  1L4D B;  2DZM A;  1P1A A;  1P7E A;  1R4M B;  3MFG A;  5JZE B;  1R4M I;  1JWA D;  2KVR A;  2VSZ A;  2D07 B;  2HTH B;  5D3I B;  2VRR B;  4MGK E;  1EAZ A;  1WZ3 A;  4IWP A;  3V60 A;  4W9E A;  2LXC A;  2KAC A;  4Q2J A;  4ILH A;  4HSI A;  5IRS A;  2FAZ A;  4MM3 A;  3BVM A;  2SAK A;  2LZ6 A;  1YNT E;  2COP A;  1ET9 A;  2C5L C;  4HAY B;  4EMO A;  2I2Y A;  2HD5 B;  1SXT A;  4YXD B;  1UEL A;  2LJ5 A;  2V3S A;  1N62 A;  1WFY A;  1TJE A;  1NI3 A;  3EEC A;  1C79 A;  1MPH A;  3EA6 A;  4HB4 B;  4HAW B;  1V1P B;  2MWN B;  2D3G A;  2XQN M;  1EF1 A;  1FRD A;  2C60 A;  4KDI C;  5IO9 A;  2DKP A;  1WX8 A;  2V4L A;  1E5W A;  2LKO A;  3Q3O C;  4W9H A;  4J6I A;  5DIF B;  1L7Y A;  4YT0 B;  2BYF A;  2W3R A;  2QMT A;  1QLB B;  1TKY A;  3L54 A;  5BMG A;  3K9O B;  1CMX B;  2HRJ A;  2KCJ A;  5C23 A;  4IFS A;  2RRF A;  2RGF A;  1K5D B;  3IAM 1;  1SJH D;  3ZJT A;  3UIO B;  4MGY E;  1ZYI A;  3QHT A;  4W9J A;  1E10 A;  4ANV A;  2AQ1 B;  2CHZ A;  4BFR A;  1DOY A;  2NBV A;  4B0E A;  2WXK A;  2J53 A;  1YJI A;  2PPH A;  1T77 A;  4KIK A;  3SBT A;  1WSP A;  2IY0 B;  2UVM A;  3UIP B;  2L00 B;  1JW9 D;  2CR5 A;  2KWU B;  2ONQ A;  4EUT A;  1UEF A;  1XCG A;  3CIR B;  3A33 B;  3Q8E A;  1K50 A;  3X23 A;  1QOG A;  1VZ7 A;  5JLJ B;  2NTT A;  4BBN C;  1FAO A;  2DNF A;  2OHF A;  3P63 A;  5EDS A;  1UNP A;  2LUL A;  1P7F A;  2V4I B;  4WH4 A;  2DYM A;  1RRB A;  3ML8 A;  4TV3 A;  3CWI A;  2FJ9 A;  2BVC A;  1MPE A;  4MSQ B;  1L0Y B;  1WGD A;  1K52 A;  1GG3 A;  4FN2 A;  2KDB A;  1V86 A;  2XEW A;  2R0D A;  3ZJU A;  2PW9 A;  2BBC A;  3TEY A;  3NWA A;  2IYB A;  3MPX A;  4RGT A;  3PO0 A;  3I63 C;  4F8C B;  4WUR A;  2BT6 A;  2FJL A;  3DHH C;  2WU5 B;  4HKZ E;  3ZKJ C;  1FGZ A;  5AEK B;  1F77 A;  1T0R C;  4AJY B;  3BVG A;  2MJD A;  2ZCC A;  2KKC A;  1SBB B;  2P0H A;  3KUZ A;  2ZKM X;  4RGO S;  4GIV A;  1B55 A;  2MEK A;  1JAL A;  3HHM A;  1IYF A;  1OFF A;  4L2Y A;  2DHJ A;  3DBH B;  5AUI A;  3HSA A;  2N7J A;  3R3M A;  2JY6 A;  4JWS C;  2Z14 A;  1IGD A;  3VR9 B;  2BKF A;  1MK9 B;  4US9 A;  5H8Y E;  4MK0 A;  1KF6 B;  4JKF A;  1V49 A;  4TYZ A;  4ANX A;  2CHW A;  2AQ2 B;  3RZW C;  1HB6 A;  3FM8 C;  1EF5 A;  4J3O D;  4NAW A;  1Q10 A;  5C16 A;  3FEH A;  3H7P A;  2ACZ B;  4HAT B;  2N9X A;  4TMA B;  2WWZ A;  3TJP A;  3ZUN A;  4F1S A;  1XLP A;  1TS5 A;  5FI1 A;  2LGI A;  2NPT A;  2D2Q A;  3U2S C;  3UQA A;  1WGK A;  2IND C;  3PLV A;  2G9H D;  4S17 A;  1YN3 A;  3U52 E;  2DZK A;  4D6W A;  2EKI A;  1V61 A;  1UUP A;  4PS3 A;  4KDL B;  2MDX A;  1CJE A;  2O6V A;  4RFB A;  1NYQ A;  5JHB A;  1UWM A;  1NEN B;  4NJC A;  5C6R A;  4JPS A;  1IBX A;  4RM8 A;  4NSW A;  3H9D A;  3NRZ A;  4MY6 A;  3U12 A;  5DCN A;  4A9A A;  4MSM B;  3ZXR A;  2Y5B B;  3H6N A;  1FGY A;  3SD5 A;  1Q1O A;  1I4G A;  2Z4D A;  3ONS A;  2LVP A;  2DYQ A;  3P1M A;  4XYC A;  2LVQ A;  4IM3 A;  5J2R A;  3HW2 B;  2WXQ A;  2Y8G A;  4K17 A;  4LNI A;  1YQ3 B;  1MAI A;  1QKZ A;  3VH4 B;  3ZTC A;  4DDG D;  4JKH A;  2J0M A;  2XBB C;  4RF0 A;  3ZNZ B;  2NPT B;  2R2O A;  4IWQ A;  3V05 A;  2NTS A;  4KSK C;  4B6W A;  1GUA B;  3KVF B;  2GB1 A;  3SUZ A;  4XGA B;  2KAJ A;  3L10 B;  1X86 A;  1MG4 A;  4AQ7 A;  2DEN B;  5IA7 A;  1D5Z C;  2K5P A;  2JSV X;  2KMM A;  4RH6 A;  5KCV A;  3VTU A;  1BML C;  3PT2 B;  4Z2N A;  1MI0 A;  5GMV A;  2K49 A;  5HI1 A;  1NVL A;  4K2O A;  3VAW A;  4ARC A;  1EGX A;  4A3O A;  4OVZ A;  2WHI A;  3ZGZ A;  2QEJ C;  3Q14 C;  2OOB B;  3LYY A;  2PMV A;  1SE4 A;  4P1B C;  4K2P A;  1WY8 A;  3M1I B;  4E74 A;  3DVN V;  1GPX A;  1ZM0 A;  3GZN I;  2D9Y A;  1WI0 A;  4RF1 A;  2JQR B;  3BYT B;  2G3Q B;  5HFY A;  2HDE A;  3PSC A;  3FP5 A;  1ZXI A;  2KQ7 A;  4FJY A;  1OY2 A;  4IWO A;  2ZW1 A;  4A8X C;  2JWZ A;  5LNK 1;  2DAJ A;  4IAP A;  2LGY A;  1TKE A;  4FBJ B;  2BYT A;  3ZDT A;  5DH9 B;  3OHM B;  4HEA 1;  4OHJ A;  4JQW C;  3A1Q A;  3EC8 A;  1EM7 A;  2WXO A;  1XCT L;  2KMA A;  2KNB A;  2JUO A;  1WF9 A;  5BYQ A;  1Y5O A;  3R2I A;  1QC6 A;  3Q8B A;  3S2A A;  3A98 B;  2KHW B;  4USA A;  4GMV A;  4W9D A;  2FDQ A;  1K51 A;  2QDF A;  5IAA C;  2Z0O A;  4KGS A;  4DHJ B;  4XDD A;  3TW1 A;  3VRB B;  3WAM A;  3ZO5 B;  2Z0Q A;  1ZOY B;  2N0S B;  4GNK B;  1C1Y B;  5GOW B;  1N5W A;  3DPD A;  2QJL A;  3ABV B;  1T0Y A;  2KUP A;  1XXG A;  4Z2M B;  1MKE A;  1WJ4 A;  1VJK A;  4AJW A;  1AAR A;  4BKT A;  2WXM A;  3DDC B;  4LDT D;  1JML A;  4K3B A;  4N58 A;  2KC2 A;  5CX3 A;  4MM3 B;  2COC A;  1I42 A;  2J42 A;  3BWU D;  3RN9 C;  1DYN A;  3NZS A;  2KWV B;  1J8C A;  3A58 A;  2QHO A;  2MBQ A;  2KIG A;  1H8C A;  1EWY C;  4OT1 A;  1E9M A;  4QXA B;  5J18 A;  3JW0 X;  1MJD A;  4HPL B;  1RJ2 A;  3RT3 B;  1MK7 B;  3W5V B;  2AL3 A;  1FO4 A;  4CQN A;  2KIE A;  1C76 A;  4L23 A;  2JP2 A;  4MGI E;  3KYC D;  3MP9 A;  3KWL A;  2Z0E B;  1FNU A;  1WR6 E;  2ELA A;  1WVH A;  2IY1 B;  2D9V A;  3CST A;  3EGR A;  1TQZ A;  1PYW D;  2KWC A;  2RNR B;  3KRW A;  3VOQ A;  3H8H A;  2KTR A;  1FXA A;  3LXF A;  2BS2 B;  2C9W B;  5E6P A;  4GB9 A;  3B77 A;  2W2X D;  2B3A A;  1D6E C;  4M8N A;  2VH2 A;  5I4D A;  3TBL D;  1GB4 A;  1PUT A;  5TR5 A;  5BMI A;  2NR2 A;  2KWD A;  1UZX B;  3AEB B;  1HQR D;  3HM3 A;  1KFY B;  2OJR A;  5D3Y A;  2KJH B;  1R4N B;  2X38 A;  1ROE A;  3AE4 B;  1MHH E;  2AX5 A;  3SV1 A;  4EJN A;  2CU1 A;  3TEX A;  1TBE A;  2W9N A;  2LEK A;  5D3W A;  1ZXH A;  2QIL A;  1EVH A;  4FLH A;  2G4S A;  3U30 A;  1NTY A;  1KH0 A;  1E6E B;  1TXD A;  3E9O A;  4NPN A;  3KWV A;  3EFU A;  4K7U A;  4E71 A;  2MLB A;  5D27 A;  1V89 A;  2H7D A;  1KRH A;  4JK7 A;  1GOZ A;  2WP9 B;  3BYY B;  1WI1 A;  4II3 B;  2YEP F;  1HXY D;  4IW0 A;  2N0Y A;  4GPT B;  1HTO A;  1WJM A;  2Z59 B;  3GZN B;  5C2T B;  3ML4 A;  2DZJ A;  1U27 A;  2IO3 B;  3N20 C;  3UI3 A;  1KBL A;  1RFA A;  5BYR A;  5BYS A;  3BII D;  2IYD B;  4II2 B;  1YD8 U;  3VR8 B;  3FVC A;  3L4P A;  3VDZ A;  2ELB A;  2Q5W D;  1VBH A;  5J3Q A;  4JX1 C;  1XLN A;  3IAS 1;  1WWT A;  2YT1 A;  3UQB A;  2YVC A;  1Q5W B;  4WWO A;  2CS4 A;  4DXG A;  2REX A;  1TJ6 A;  1TY0 A;  1T6B X;  5G5G A;  3M95 A;  2MX2 A;  4AUQ C;  3FKY A;  1FHO A;  2EMT A;  3A9K B;  4D2K A;  2DZI A;  4GLS C;  2CHX A;  3LJ3 A;  3WAP A;  3EFC A;  1WGG A;  2M14 A;  2KJR A;  1ZC3 B;  1E0Z A;  1BAK A;  1FXI A;  4AP4 C;  2R2Y A;  2DWQ A;  4XDC A;  2Y8F A;  1FOE A;  2RVB B;  4RGN A;  4WSF A;  3I5J C;  1OEY A;  3BIN A;  2LG1 A;  1M94 A;  1P98 A;  2COD A;  4ARI A;  3PZD A;  1UPQ A;  1TS4 A;  1UWX A;  3AI5 A;  4M01 A;  4DQO C;  3R2T A;  2LXA A;  3Q3F A;  3MC0 B;  4CSQ A;  2K8B A;  2WNM A;  2KO3 A;  2WXP A;  1FIQ A;  4LCD E;  3RZF A;  1PFD A;  4QJ5 B;  3F5R A;  1LQB A;  4FHK A;  5IKC M;  4ZDV A;  1M7R A;  1Z87 A;  4LLG M;  2LGS A;  2B76 B;  4AS1 A;  2TSS A;  2MJE A;  3D8F A;  5G2N A;  4NAW B;  2WXF A;  3AM9 A;  4CHJ A;  1D4B A;  1RRP B;  3G9W A;  1WE7 A;  1U5D A;  5FR3 A;  2Y3A A;  3QQ8 B;  2G45 B;  3B0A A;  3AEA B;  2SEB D;  5BO4 B;  2RPV A;  1HBK A;  1U5F A;  1PLS A;  4BZA A;  3QK0 A;  4B6H A;  1LO5 D;  3P7Z A;  2KAN A;  2KN4 A;  4HPP A;  1TGZ B;  5HE1 A;  2JRI B;  3MDB C;  2LGD A;  1ENF A;  2HE7 A;  4P7I A;  1AYF A;  3SDL C;  1PFJ A;  2NBU A;  1V5P A;  1WE6 A;  1D3Z A;  1WM3 A;  3MHS D;  4KAX B;  4ICV A;  3QWZ B;  3TSS A;  2M4N A;  2YF0 A;  4JLC A;  1TS3 A;  3LB8 C;  3NWD A;  4CYE A;  1V97 A;  1TKG A;  1C4C A;  2IGG A;  3VVW B;  3DVG X;  3BK2 A;  4BOS C;  2DHI A;  1AWE A;  4DIX A;  1EWC A;  4HXD A;  1K5G B;  2H7E A;  2WDR B;  3P4R B;  3E9S A;  5IN7 A;  4NQL B;  2YS3 A;  1F2R I;  1FXT B;  1VD2 A;  3PRZ A;  3MHZ A;  5EFX A;  3OAN A;  3A9J A;  1E8W A;  4ZYS A;  3MJW A;  1J7A A;  2GI9 A;  1A5R A;  2GBJ A;  1WX7 A;  1DOX A;  2GBR A;  2R61 A;  3C0R B;  3ETR A;  4WVF B;  5IJM A;  3P2B A;  2UWQ A;  5HE2 A;  1WIA A;  4WIP A;  2GBN A;  4NZL B;  1XO3 A;  4WAF A;  3EHV A;  3DCG A;  3R7R A;  4HDQ A;  1X11 A;  2K6D B;  2KFK B;  2BQQ A;  2J52 A;  2JWU A;  4ASW C;  3X0W A;  4HB0 B;  2WYQ A;  1TTN A;  3SBG A;  2JYT A;  1V8C A;  1DBH A;  4RMA A;  1ET6 A;  2NCN A;  2PE9 A;  2KXJ A;  2KFK A;  1XLO A;  1LFD A;  3L0W B;  2WXR A;  2LOX A;  2D9X A;  2Z59 A;  3M62 B;  3VRA B;  1C4P A;  4DK5 A;  2FCQ A;  2KN5 A;  1TZ1 A;  2VZK D;  5LXH A;  2JT4 B;  4FUL A;  2IPK D;  3NVY A;  3MTN B;  4PK1 A;  3I3T B;  4JKC A;  1V9J A;  5L81 A;  3SFD B;  1P3Q U;  3M3J A;  3P6A A;  5L95 C;  2DTC A;  4PT5 A;  1M7E A;  4KGT A;  3Q6B A;  2P0F A;  2CY4 A;  2ABD A;  1SE2 A;  1BTN A;  2CKH B;  1DDM A;  3KYD D;  3LJU X;  3QX1 A;  1RWS A;  2JRH A;  1FPY A;  2L05 A;  1VBG A;  1IPG A;  2IGD A;  4LDT B;  3RUI B;  3ULC A;  1QQR A;  1VZ8 A;  1GC6 A;  1YX5 B;  2YRY A;  5C5B A;  4US8 A;  3RUL A;  4E3C A;  3HVZ A;  3AE8 B;  2IJ0 A;  2W3S A;  4DBB A;  2ZJD A;  4NY0 A;  5KQ1 A;  3APF A;  2MH7 A;  3N1Y C;  1W1H A;  4KZ0 A;  3UGB B;  2VZK B;  2L83 A;  1KJT A;  3HQC A;  4HVB A;  1U5G A;  4MAC A;  3RFZ B;  1C77 A;  1SIF A;  1RYJ A;  1YJ1 A;  2N9K A;  4RM9 A;  2I38 A;  2FUG 1;  3ZNH B;  2MBH A;  3CMM B;  1I7H A;  2KTF A;  1P9D U;  4WJN A;  3DOW A;  3TMP B;  1MIZ B;  4HAX B;  2ZPY A;  1ZVR A;  3LDZ E;  2ZCB A;  4XWW A;  3PRM B;  2BS3 B;  2V9H A;  1E8X A;  2VH1 A;  3T3O A;  2LBB A;  3Q8A A;  5AUK A;  3NS1 A;  2N7D A;  1OGW A;  1KLU D;  4HK2 A;  1XR0 B;  4ILJ A;  4MDK E;  4REZ A;  4F7U P;  5M4Y B;  2WU2 B;  3ZW3 A;  4HB3 B;  1ZUD 2;  2VRW B;  3SO6 A;  1L0X B;  2XN9 C;  3PEG A;  4DWF A;  2NMB A;  4L6E A;  2RMM A;  2QKM A;  1ST7 A;  4QJ4 B;  1P3R A;  3DBL B;  1DYQ A;  4DDI D;  1KLG D;  4XC2 A;  3VTV A;  1TYG B;  1WGU A;  4KHA A;  1XEE A;  4FAD A;  1QIL A;  1L4Z B;  4W9K A;  4XWX A;  3WAL A;  3A1Q B;  5JP4 A;  4MEM A;  2V3N A;  5KHQ A;  5E6J A;  1T0Q C;  3CSF A;  1OQY A;  1UBQ A;  1I4H A;  3QAQ A;  4BKS A;  2KOX A;  1STE A;  2KZR A;  2MJ3 A;  2DFK A;  2I1J A;  2AYO B;  4ZYN A;  1LB1 A;  3PS6 A;  4O1N A;  3NVZ A;  1V5M A;  2M56 B;  2Y5P A;  4ZRJ A;  1XD4 A;  1EU4 A;  3E56 A;  4WJQ A;  3ZVR A;  4XX5 A;  3W2D A;  4Y94 A;  1CK1 A;  4A5K A;  1UH6 A;  3QAR A;  4IG7 B;  3QWM A;  1FNW A;  4GXB A;  3DCX A;  3DBL I;  5DPW A;  1C9F A;  3ODO A;  1V5T A;  4HCN B;  2G1E A;  1E7P B;  2BWE S;  2Y5C A;  4LNK A;  1GNU A;  3AE3 B;  4HWI B;  5E6N A;  3AMZ A;  3PP2 A;  1OEY J;  2PVO D;  4RGM A;  3GP7 A;  1WYW B;  2DKQ A;  1VRA B;  1XCQ L;  4C4V A;  2COA A;  2GUM A;  2JVC A;  5IOI A;  1L2N A;  2RDB C;  2INP E;  5C3J B;  1K53 A;  2FCN A;  3NWF A;  1ZGU B;  1N60 A;  1SSN A;  3WYF B;  3PZ7 A;  4KZC A;  5LLI A;  1KOT A;  2O2V A;  1JWB D;  1DIK A;  4PS8 A;  2AL6 A;  1WM2 A;  2RR9 A;  3A9K A;  2LMC A;  2R09 A;  4LNO A;  1JRP A;  2M19 A;  2WQY B;  1WRI A;  2LOZ A;  4EZK A;  4ZRK A;  3HVD A;  2M38 A;  5JHG A;  2DIK A;  4DXF A;  1U5E A;  3HRD D;  2AEH A;  2QCZ A;  3H7P B;  1SEB D;  1XX0 A;  2FCS A;  2MBB B;  1WJ1 A;  4GZU A;  3CXB B;  2NMQ A;  2RPQ A;  4KV2 A;  2JZ3 B;  1Q67 A;  3JYU A;  3PRE A;  1D5X C;  4K7S A;  1HTQ A;  2MBE A;  2FE8 A;  4WJP A;  4I6N B;  2ZVN A;  5HE0 A;  3VHT C;  3WAN A;  4KIK B;  2BW2 A;  3UF8 A;  2RDH A;  3ZTD A;  1VDV A;  3N32 A;  3N9Y C;  4PYU A;  1MG8 A;  2RUK B;  3NW8 A;  4B95 A;  1QQG A;  4JKA A;  2ICI A;  5DHA B;  1WXA A;  4RCO A;  1U2B A;  1MI1 A;  2BYE A;  2LRW A;  3RD2 A;  4ILG B;  4ZRI A;  1WX9 A;  4LK0 M;  5EE0 A;  3T06 A;  1YIW A;  3NS8 A;  2LRU A;  1A70 A;  2O2V B;  2FUH B;  4HLE A;  3APD A;  1XKE A;  3IT4 B;  2L1A A;  2O6V B;  3URY A;  2MRP A;  1B1Z A;  4EFO A;  4ICU A;  2KVZ A;  2M17 A;  5LG4 B;  2DAF A;  2DN6 A;  1I35 A;  3AE1 B;  2QC8 A;  2LAS A;  2UZS A;  2IGH A;  3ZRF A;  2EKE C;  5JXV A;  3GYO A;  1QOB A;  1UGJ A;  3AE6 B;  4IM0 A;  2LGX A;  5L83 A;  3TFM A;  4B9K A;  5HE3 A;  1JWM D;  1I4P A;  4MEL A;  3K9P B;  3DXE A;  2ZZP B;  3P4Q B;  2WXH A;  1YQB A;  3TEW A;  4HJG E;  1EUV B;  2BB5 A;  3PRP B;  1OQR A;  3B2G A;  2GJY A;  4MH8 A;  1FFV A;  1XQQ A;  3ZIM A;  4YSY B;  3FLV A;  2COF A;  1SE9 A;  4B0M A;  2K8E A;  2LVO A;  1MIX A;  2KLC A;  2V3P A;  2HJ8 A;  1ISN A;  2KQS A;  2KLG A;  3W1Y A;  1F9J A;  4PQ0 A;  2XNA C;  1PMS A;  4RNA A;  4C7Z A;  2N9P C;  2K8C A;  2M0X A;  4M02 A;  2CQU A;  2DYO A;  1H4R A;  4YTM B;  3DXD A;  2W82 A;  1X1G A;  1E7V A;  3BVZ A;  4K81 A;  2BB6 A;  3WA0 A;  2K2J A;  3AED B;  2KYW A;  4L1R A;  5HG2 A;  4KHO A;  2WX0 A;  4EZJ A;  2BYV E;  4IUM B;  1GJZ A;  5I2M A;  3JSV B;  3AEE B;  1SJE D;  1GB1 A;  1RFK A;  3VXW A;  4WJ7 A;  4A6H A;  1VR9 A;  2GLS A;  2BTE A;  2DLW A;  4HKQ A;  3RNA C;  3TL5 A;  1JCK B;  2M8S A;  1SGH A;  2JPH A;  1C3T A;  3JVZ X;  3ML9 A;  1P5T A;  3KLS X;  3AN1 A;  1LM8 B;  3ENB A;  1U4A A;  2D4Q A;  2WGS A;  2J0J A;  3AE7 B;  4ZHO A;  3KH0 A;  3L08 A;  1ZC4 B;  1FD6 A;  1UPR A;  3PVW A;  3ECI A;  1KC7 A;  2K9X A;  2C7N B;  4TQ0 A;  4N59 A;  3HK0 A;  2HJ1 A;  3PPA A;  2GRI A;  3NZU A;  2DX1 A;  4DHZ B;  1UNS A;  4KGR A;  3TEZ A;  2Q13 A;  3A4S C;  3B9J A;  1SE3 A;  3SHQ A;  3AE9 B;  5AZG A;  4DHZ E;  2AQ3 B;  2X18 A;  1ZDV A;  1E7U A;  1J0W A;  3E9P A;  5H92 C;  1IBX B;  1IRS A;  2PIA A;  1Y19 B;  1V5O A;  4ZRQ A;  2DHZ A;  4GDK B;  3FC4 A;  3RMK C;  1Z2M A;  4EEW A;  1F52 A;  4EE2 A;  1V1P A;  3A9J B;  1IP9 A;  4JKB A;  3GOE A;  3TIX A;  4LJO B;  5CHV C;  1WXQ A;  3MC8 A;  4ZOH C;  2K3U A;  2JU6 X;  2EMS A;  3ZNG C;  1D5M C;  3ALB A;  1IUE A;  1SIJ A;  5GXG B;  3VUW A;  3D32 A;  2FCM A;  3Q3N C;  2DHK A;  4OZC A;  1KM7 A;  1P0R A;  3HM6 X;  1PGB A;  3AJ4 A;  5JHH A;  2NS5 A;  2L7R A;  3ZDM C;  2BGF A;  1WXM A;  1YN5 A;  3NSU A;  1E90 A;  4WQM A;  1F1H A;  5D3X A;  2NZ8 B;  2RSU A;  1UNQ A;  2Z0P A;  3A8Q A;  4URK A;  3PLU A;  2GOW A;  2FNJ B;  4JK8 A;  5D6J B;  2MHJ A;  2YS1 A;  4OZB A;  3NVV A;  1LXD A;  4KVG B;  4P6V F;  3AB5 A;  2JYE A;  3AH7 A;  5KQ4 A;  1WXS A;  2E2X A;  5AZF A;  2D3C A;  1TZO A;  1L0V B;  2WX1 A;  4YSX B;  3V61 A;  2JF5 A;  2GCL A;  3RCZ A;  5C1Z A;  2MP2 A;  1NU2 A;  1GAQ B;  4KHB A;  3HIE A;  4CHK A;  1N5X A;  4DX9 0;  1WGY A;  3P42 A;  3PHX B;  3AEF B;  4YON A;  4D0N B;  2D5G A;  3VH3 B;  2A5U A;  1I2H A;  1WG7 A;  1SHC A;  4HDO A;  2ASQ A;  4OW0 A;  4IM2 A;  3RNE C;  2MKR A;  1HE8 A;  4M8M A;  1V5U A;  4HB2 B;  1KTK A;  1HB8 A;  3RNB C;  1W1D A;  3NY5 A;  3FSS A;  1ZP0 B;  3QBV B;  3Q8C A;  3DBR I;  5LXI B;  2V76 A;  4ZRP A;  2GCJ A;  2QIE B;  2PLP A;  2FBW B;  3EUB 2;  3PZ8 A;  1NI2 A;  2GS0 A;  4HPM B;  2LD9 A;  1H10 A;  4NJ6 A;  1V81 A;  3ZXV A;  1MFW A;  3ODX A;  2WXL A;  1ZPS A;  2YEP B;  3AE2 B;  4HCP B;  3GYP A;  3PV1 A;  1N61 A;  5DPR A;  3DQV A;  3DBS A;  1YOV B;  4I6P A;  4IC7 B;  1NEK B;  3RNG C;  3WIM A;  4W9F A;  2IZV B;  1E8Y A;  1PGX A;  2E6X A;  4F7Z A;  5FKA C;  1DDV A;  4HJK A;  2K1F A;  4GOU A;  1T5X D;  4WQO B;  3FAH A;  1R4N I;  4I6L B;  2W55 A;  3AU4 A;  4F7H A;  2LUE A;  1LGR A;  1WH3 A;  2N9E B;  5E6O A;  3IVF A;  1V2Y A;  2EC1 A;  2DBY A;  1BT0 A;  1DDW A;  2K39 A;  2L52 A;  2IO2 B;  5JH5 C;  3APC A;  5HKH A;  3O65 B;  2LJI A;  5KHO A;  3AEG B;  3RPF C;  2IO1 B;  3Q2A C;  4A6Q A;  2ZW0 A;  4PNK A;  4G11 A;  2N1W A;  3NJT A;  1JRO A;  2DYB A;  4DX8 A;  3RNF C;  4BVU C;  2KQ4 X;  5AZH A;  3IBE A;  3Q3M C;  2D9Z A;  2Y7B A;  2KD0 A;  2QKL A;  3D8D A;  1PGA A;  1UD7 A;  2KK8 A;  4HRO A;  4IOI E;  4M0W A;  4GU2 A;  2V0G A;  3SFE B;  5DHF B;  3N1Z C;  3B1L X;  1FRR A;  3R66 C;  4JK9 A;  4GGQ A;  4TSS A;  4XWT A;  2DX5 A;  1FFU A;  2G4D B;  3U4E G;  1UBI A;  3N7C A;  3DHI C;  2CRF A;  2WS3 B;  4WJO A;  1AN8 A;  1OQQ A;  1QOA A;  2C7M B;  1ACA A;  4FXC A;  1MVK A;  4LNF A;  2WLB A;  1Q0W B;  2EEL A;  4G50 A;  3V5W A;  1TT5 B;  1KZG A;  4FJZ A;  2N4F A;  1FEH A;  4XE0 A;  4GDK A;  1XF5 L;  4JWU C;  1U29 A;  4X57 B;  1YX6 B;  3GE8 C;  3OG5 A;  4IDI A;  3AUL A;  5TSS A;  3IT6 B;  4QAY A;  4GOC A;  3L13 A;  1X1M A;  4BOZ B;  4WWM A;  3T3N A;  2W2X C;  2K8H A;  4TKN A;  5C5B B;  4KX6 B;  3ZNI D;  4H8S A;  1G6J A;  2JZZ A;  5JHA A;  5BMH A;  3UIN B;  1YJJ A;  1XT9 B;  1BXT A;  1EO6 A;  2DX5 B;  4A55 A;  2L0T A;  3IXS A;  4MJS B;  2CJN A;  3NOB A;  3SR6 A;  4IKG A;  3QA8 A;  1ZSQ A;  1JRU A;  3KW5 B;  3ZRC A;  4W9L A;  1WMH A;  2J0K A;  3BK1 A;  4A3P A;  1Y56 A;  1FMA D;  2LWP A;  4GSW A;  1FCC C;  2RD0 A;  2PE6 B;  4BAX A;  3PVU A;  1FM0 D;  2I5F A;  2YT2 A;  1C78 A;  2GMI C;  3AE5 B;  1XLQ A;  1IGC A;  2ZVO A;  3GE3 C;  2OED A;  3KUC B;  2BKR B;  2XK5 B;  3SYX A;  3NUH B;  3BJI A;  1OTR B;  3P4S B;  2MFQ A;  1GC7 A;  4F7G A;  2WDT B;  4WWP A;  4JKE A;  5C79 A;  2NVU I;  3H1U A;  2L3Z A;  4OVU A;  3MJ5 A;  1WJ6 A;  3TCA A;  1BUI C;  1V80 A;  2PJH A;  3C19 A;  1RM6 C;  3WCQ A;  2DYN A;  1I7A A;  5FR6 A;  5CTR C;  1OMW A;  4BKG A;  5CLL B;  3PHW B;  3QIJ A;  2M1M A;  2X8X X;  1N3H A;  3KRX A;  4PYZ A;  3DBR B;  2E3T A;  4ACF A;  2D10 A;  2G35 A;  2LHD A;  2IBI B;  4NAM A;  1Z5S B;  2N1V A;  2K6Q A;  2KDM A;  2UU7 A;  3OJ3 A;  3NG0 A;  2J59 M;  1MHX A;  2D3B A;  2I1K A;  1WZ0 A;  1WR1 A;  1YMH E;  5DPT A;  2JXX A;  2M0A A;  1L6U A;  2WDQ B;  4A6K A;  2WXJ A;  4GDL A;  2FIF A;  2GBK A;  5CHF A;  3V3X A;  2KT7 A;  1PQS A;  1C4A A;  1E8Z A;  1WJU A;  5EE9 A;  4MH0 E;  1DGJ A;  1ACC A;  1FHW A;  2MBO A;  2DA0 A;  4PS7 A;  1YQ4 B;  4C56 C;  1CQV A;  2KFJ A;  3VFK A;  3W5U B;  3PGE A;  2UYZ B; 
#chains in the Genus database with same CATH homology
 4NJ7 A;  1V6E A;  4G3X B;  1WGQ A;  1OQN A;  3F0W A;  3WAO A;  4ANU A;  4DXA B;  1XOD A;  1S3S G;  4M0W B;  3ULB A;  4KHB B;  4AWJ A;  3PSE B;  2D9W A;  4JKG B;  2L2I A;  1BTK A;  3BY4 B;  2KX3 A;  2I5C A;  2BPS A;  4W9C A;  2IO0 B;  3KUD B;  4HAV B;  3B08 A;  3W1S C;  5CHW A;  4FHJ A;  4AOF A;  2X0S A;  3VIA A;  2CB8 A;  3A8P A;  4EZL A;  4BKS D;  3KSY A;  2RGN B;  2CAY A;  2W2W A;  3PVL A;  2PEA A;  3CIK A;  4LJP B;  2KMC A;  5J17 A;  2KDE B;  3AU5 A;  4FJV B;  1ZKH A;  2L0F A;  4MGZ E;  3SU8 X;  2O6V D;  2EJ8 A;  2ZNV B;  2KDF B;  3R7Q A;  3AXC A;  3U8Z A;  3N3K B;  4DHJ D;  2K2U A;  4DBG A;  4K1R B;  5LON B;  2KDI A;  2YT0 A;  1LW3 A;  3ENE A;  3DXC A;  4WAA A;  2P0D A;  3DVN U;  1GGO A;  3L17 A;  3ZVV A;  2OTX A;  1J0G A;  5JVL A;  4IOY X;  2J7Q B;  2ZNV C;  2N7E A;  5DPS A;  3V62 A;  2KGX B;  4BBK A;  3OJ4 B;  1WGR A;  4JKD A;  1NBF C;  1V88 A;  2IFS A;  4EOY A;  4HHV A;  1X05 A;  2ZPN A;  3QJZ A;  2P8V A;  5CLQ B;  2KC1 A;  1WRD B;  4MJS A;  1QZE A;  4WWN A;  1UGM A;  2AWT A;  3PTF C;  3DVG Y;  1KZ7 A;  3OLM D;  3RCP A;  2MA9 B;  4BBN F;  3TO1 A;  4CHM A;  5J3Y A;  2LI5 A;  2N23 A;  4W9I A;  2L76 A;  2ROV A;  1NDD A;  1W1G A;  1FHX A;  1X1F A;  2K25 A;  2R2Q A;  3EPY A;  2BCJ A;  3E9L A;  3QCA A;  1S1Q B;  4JGH B;  3KZ1 A;  3UZT A;  2A4Z A;  3IFW B;  3CF6 E;  3VUY A;  3V6C B;  5D3V A;  3W1S A;  4JIO U;  2ADZ A;  1RLF A;  4GN1 A;  2VKI A;  4K7W A;  2KX0 A;  4YL8 A;  4A20 A;  4MT7 A;  2YLM A;  3IG3 A;  1UNR A;  4NNJ B;  2MQJ A;  1RAX A;  2MW5 A;  4A6F B;  1KI1 B;  2D11 A;  2YS5 A;  4G0N B;  4C0A A;  3A4R A;  1VCB A;  1NTI A;  1WXV A;  3SNH A;  5G55 A;  4ANW A;  3V6E B;  2RQ1 A;  3RYT A;  2K00 A;  2BWF A;  3Q3J A;  2MCN B;  3U7D A;  1WJN A;  3ZLZ A;  3O96 A;  2UZR A;  3H7S A;  1K8R B;  3DBH I;  1WGH A;  4FA6 A;  2ROZ B;  5J3T A;  3N30 A;  2R82 A;  2YSZ A;  3ODW A;  3TVV A;  2LYD A;  3VTW A;  2L1C A;  1DRO A;  3E66 A;  4W9G A;  2KJ6 A;  1J19 A;  4JKG A;  2FID A;  2NBV B;  4A6F A;  2GBM A;  5D2M B;  3QC8 B;  2C7H A;  2RLO A;  2MSE D;  3VQI A;  1P6S A;  2ZEQ A;  1AQC A;  3D8E A;  3L16 A;  4EKU A;  3PG7 A;  2NBW B;  3NHE B;  2OQB A;  4GMX B;  5LOP B;  3IHP C;  5D7G A;  3T9L A;  4OVV A;  4JL9 A;  2CY5 A;  4N9F 4;  5D94 A;  1WMH B;  3M63 B;  1JDE A;  1Y8R C;  2L8J A;  4GDL B;  5DI9 B;  2RSG A;  2Z0D B;  1FB8 A;  2V1Y A;  2MWS B;  5FI0 A;  3OAW A;  1XD3 B;  2PZ1 A;  2HTH A;  1ZW7 A;  4KSL C;  3T8M A;  4CO7 A;  1NTV A;  3HIZ A;  3JSV A;  1BWN A;  2WH5 A;  1KLV A;  4NQK E;  2MP2 B;  4HAU B;  4HAZ B;  2KTR B;  3VUX A;  4TQ1 A;  2BF8 B;  3KY9 A;  4XZ4 A;  4TUU A;  2XK5 A;  1P1A A;  2DZM A;  5JZE B;  1R4M I;  2KVR A;  2VSZ A;  2D07 B;  2HTH B;  2VRR B;  4MGK E;  1EAZ A;  1WZ3 A;  4IWP A;  3V60 A;  4W9E A;  2LXC A;  4ILH A;  2FAZ A;  4MM3 A;  2LZ6 A;  2COP A;  2C5L C;  4HAY B;  4EMO A;  2HD5 B;  1UEL A;  2LJ5 A;  2V3S A;  1WFY A;  3EEC A;  1MPH A;  4HB4 B;  4HAW B;  2MWN B;  2D3G A;  2XQN M;  1EF1 A;  2C60 A;  4KDI C;  2DKP A;  1WX8 A;  2V4L A;  1E5W A;  2LKO A;  4W9H A;  4J6I A;  5DIF B;  1L7Y A;  2BYF A;  3L54 A;  3K9O B;  1CMX B;  2HRJ A;  2KCJ A;  5C23 A;  4IFS A;  1K5D B;  2RGF A;  3UIO B;  4MGY E;  3QHT A;  4W9J A;  4ANV A;  2CHZ A;  4BFR A;  2PPH A;  4KIK A;  3SBT A;  2IY0 B;  2UVM A;  3UIP B;  2L00 B;  2CR5 A;  2KWU B;  4EUT A;  1UEF A;  1XCG A;  3A33 B;  3X23 A;  5JLJ B;  4BBN C;  1FAO A;  5EDS A;  1UNP A;  2LUL A;  2DYM A;  1RRB A;  3ML8 A;  4TV3 A;  2FJ9 A;  4MSQ B;  1WGD A;  1GG3 A;  4FN2 A;  2KDB A;  1V86 A;  2XEW A;  2R0D A;  2IYB A;  3MPX A;  4F8C B;  2FJL A;  3ZKJ C;  1FGZ A;  5AEK B;  4AJY B;  2ZCC A;  2KKC A;  2P0H A;  3KUZ A;  4GIV A;  1B55 A;  3HHM A;  1IYF A;  2DHJ A;  3R3M A;  2JY6 A;  2BKF A;  1MK9 B;  4MK0 A;  4JKF A;  1V49 A;  4TYZ A;  4ANX A;  2CHW A;  3RZW C;  1HB6 A;  3FM8 C;  1EF5 A;  4NAW A;  5C16 A;  3FEH A;  3H7P A;  4HAT B;  2N9X A;  2WWZ A;  3TJP A;  3ZUN A;  4F1S A;  5FI1 A;  2NPT A;  2D2Q A;  3UQA A;  3PLV A;  2DZK A;  1V61 A;  4PS3 A;  4KDL B;  2MDX A;  2O6V A;  5JHB A;  5C6R A;  4RM8 A;  4NSW A;  3H9D A;  4MY6 A;  5DCN A;  4MSM B;  2Y5B B;  3H6N A;  1FGY A;  3SD5 A;  1Q1O A;  3ONS A;  2LVP A;  2DYQ A;  2LVQ A;  4IM3 A;  5J2R A;  3HW2 B;  2Y8G A;  4K17 A;  1MAI A;  3ZTC A;  3VH4 B;  4DDG D;  4JKH A;  2J0M A;  2XBB C;  3ZNZ B;  2NPT B;  2R2O A;  4IWQ A;  4KSK C;  4B6W A;  1GUA B;  3KVF B;  3SUZ A;  3L10 B;  1X86 A;  2DEN B;  5IA7 A;  5KCV A;  3VTU A;  3PT2 B;  4Z2N A;  5GMV A;  1NVL A;  4K2O A;  3VAW A;  1EGX A;  4A3O A;  2OOB B;  4K2P A;  1WY8 A;  3M1I B;  4E74 A;  3DVN V;  1ZM0 A;  3GZN I;  2D9Y A;  1WI0 A;  2G3Q B;  3PSC A;  3FP5 A;  2KQ7 A;  4FJY A;  1OY2 A;  4IWO A;  2JWZ A;  2DAJ A;  4IAP A;  2LGY A;  4FBJ B;  3ZDT A;  5DH9 B;  4JQW C;  3A1Q A;  3EC8 A;  2KMA A;  2KNB A;  2JUO A;  1WF9 A;  1Y5O A;  1QC6 A;  3S2A A;  3A98 B;  2KHW B;  4GMV A;  4W9D A;  2FDQ A;  5IAA C;  2Z0O A;  4DHJ B;  3TW1 A;  3WAM A;  3ZO5 B;  2Z0Q A;  1C1Y B;  5GOW B;  3DPD A;  1T0Y A;  2KUP A;  4Z2M B;  1MKE A;  1WJ4 A;  4AJW A;  1AAR A;  4BKT A;  3DDC B;  4LDT D;  2KC2 A;  5CX3 A;  2COC A;  1I42 A;  1DYN A;  3NZS A;  2KWV B;  1J8C A;  2QHO A;  2MBQ A;  1H8C A;  5J18 A;  3JW0 X;  4HPL B;  1RJ2 A;  3RT3 B;  1MK7 B;  2AL3 A;  2JP2 A;  4MGI E;  3KYC D;  2Z0E B;  1WR6 E;  2ELA A;  1WVH A;  2IY1 B;  2D9V A;  3CST A;  1TQZ A;  2KWC A;  2RNR B;  3KRW A;  3VOQ A;  2KTR A;  2C9W B;  5E6P A;  4GB9 A;  2W2X D;  2B3A A;  4M8N A;  3TBL D;  5TR5 A;  2NR2 A;  1UZX B;  3HM3 A;  2OJR A;  5D3Y A;  2KJH B;  3SV1 A;  4EJN A;  2CU1 A;  1TBE A;  2W9N A;  5D3W A;  1EVH A;  4FLH A;  2G4S A;  3U30 A;  1NTY A;  1TXD A;  3E9O A;  4NPN A;  3EFU A;  4K7U A;  4E71 A;  2MLB A;  5D27 A;  1V89 A;  2H7D A;  4JK7 A;  1WI1 A;  4II3 B;  4IW0 A;  2N0Y A;  4GPT B;  1WJM A;  2Z59 B;  3ML4 A;  2DZJ A;  1U27 A;  2IO3 B;  1KBL A;  1RFA A;  2IYD B;  4II2 B;  1YD8 U;  3VDZ A;  2ELB A;  1VBH A;  5J3Q A;  2YT1 A;  3UQB A;  2YVC A;  1Q5W B;  4WWO A;  2CS4 A;  2REX A;  1TJ6 A;  3M95 A;  2MX2 A;  4AUQ C;  1FHO A;  2EMT A;  3A9K B;  2DZI A;  2CHX A;  3LJ3 A;  3WAP A;  1WGG A;  2M14 A;  2KJR A;  1ZC3 B;  1BAK A;  4AP4 C;  2Y8F A;  1FOE A;  2RVB B;  4WSF A;  1OEY A;  3BIN A;  2LG1 A;  1M94 A;  1P98 A;  2COD A;  3PZD A;  1UPQ A;  3AI5 A;  2LXA A;  3Q3F A;  2K8B A;  2KO3 A;  4LCD E;  3RZF A;  3F5R A;  1LQB A;  4FHK A;  4ZDV A;  1M7R A;  1Z87 A;  3D8F A;  5G2N A;  4NAW B;  4CHJ A;  1RRP B;  3G9W A;  1WE7 A;  1U5D A;  3QQ8 B;  2G45 B;  3B0A A;  5BO4 B;  1HBK A;  1U5F A;  1PLS A;  3QK0 A;  4B6H A;  3P7Z A;  2KAN A;  1TGZ B;  5HE1 A;  2JRI B;  3MDB C;  2LGD A;  2HE7 A;  4P7I A;  3SDL C;  1PFJ A;  2NBU A;  1V5P A;  1WE6 A;  1D3Z A;  1WM3 A;  3MHS D;  4KAX B;  4ICV A;  3QWZ B;  2M4N A;  2YF0 A;  4JLC A;  4CYE A;  3VVW B;  3DVG X;  4BOS C;  2DHI A;  1AWE A;  4HXD A;  1K5G B;  2H7E A;  4NQL B;  2YS3 A;  1FXT B;  1VD2 A;  3PRZ A;  5EFX A;  3OAN A;  3A9J A;  1E8W A;  3MJW A;  1A5R A;  2GBJ A;  1WX7 A;  2GBR A;  3C0R B;  4WVF B;  5IJM A;  3P2B A;  2UWQ A;  5HE2 A;  1WIA A;  2GBN A;  3EHV A;  3DCG A;  3R7R A;  4HDQ A;  1X11 A;  2K6D B;  2KFK B;  4ASW C;  3X0W A;  4HB0 B;  2WYQ A;  1TTN A;  3SBG A;  1DBH A;  4RMA A;  2NCN A;  2PE9 A;  2KXJ A;  2KFK A;  1LFD A;  3L0W B;  2LOX A;  2D9X A;  3M62 B;  4DK5 A;  2FCQ A;  2KN5 A;  1TZ1 A;  5LXH A;  2JT4 B;  4FUL A;  3MTN B;  3I3T B;  4JKC A;  1V9J A;  5L81 A;  1P3Q U;  3M3J A;  3P6A A;  5L95 C;  2DTC A;  1M7E A;  2P0F A;  2CY4 A;  2ABD A;  1BTN A;  2CKH B;  1DDM A;  3KYD D;  3LJU X;  3QX1 A;  2JRH A;  2L05 A;  1VBG A;  1IPG A;  4LDT B;  3RUI B;  3ULC A;  1GC6 A;  1YX5 B;  2YRY A;  5C5B A;  3RUL A;  4E3C A;  4DBB A;  2ZJD A;  4NY0 A;  5KQ1 A;  3APF A;  1W1H A;  4KZ0 A;  3UGB B;  1KJT A;  3HQC A;  4HVB A;  1U5G A;  1SIF A;  1YJ1 A;  4RM9 A;  3ZNH B;  2MBH A;  3CMM B;  4WJN A;  2KTF A;  1P9D U;  3TMP B;  3DOW A;  1MIZ B;  4HAX B;  2ZPY A;  1ZVR A;  3LDZ E;  2ZCB A;  3PRM B;  1E8X A;  2LBB A;  2N7D A;  1OGW A;  4HK2 A;  1XR0 B;  4ILJ A;  4MDK E;  4F7U P;  3ZW3 A;  4HB3 B;  2VRW B;  3SO6 A;  3PEG A;  4DWF A;  2NMB A;  4L6E A;  2QKM A;  1ST7 A;  1P3R A;  4DDI D;  4XC2 A;  3VTV A;  1WGU A;  4KHA A;  4FAD A;  4W9K A;  4XWX A;  3WAL A;  3A1Q B;  5JP4 A;  4MEM A;  5KHQ A;  3CSF A;  1OQY A;  1UBQ A;  3QAQ A;  4BKS A;  2KOX A;  2KZR A;  2DFK A;  2I1J A;  2AYO B;  4ZYN A;  1LB1 A;  3PS6 A;  1V5M A;  4ZRJ A;  1XD4 A;  4WJQ A;  3ZVR A;  4XX5 A;  4Y94 A;  4A5K A;  1UH6 A;  3QAR A;  4IG7 B;  3QWM A;  4GXB A;  3DBL I;  5DPW A;  3ODO A;  1V5T A;  4HCN B;  2BWE S;  1GNU A;  4HWI B;  5E6N A;  3PP2 A;  1OEY J;  1WYW B;  2DKQ A;  2COA A;  2JVC A;  1L2N A;  2FCN A;  1ZGU B;  3WYF B;  4KZC A;  5LLI A;  1KOT A;  2O2V A;  1DIK A;  4PS8 A;  2AL6 A;  1WM2 A;  2RR9 A;  3A9K A;  2R09 A;  2LOZ A;  4EZK A;  4ZRK A;  2M38 A;  5JHG A;  2DIK A;  1U5E A;  2AEH A;  3H7P B;  1XX0 A;  2FCS A;  2MBB B;  1WJ1 A;  4GZU A;  3CXB B;  2RPQ A;  4KV2 A;  1Q67 A;  3PRE A;  4K7S A;  2JZ3 B;  3JYU A;  2MBE A;  4WJP A;  4I6N B;  2ZVN A;  5HE0 A;  3VHT C;  3WAN A;  4KIK B;  3UF8 A;  3ZTD A;  3N32 A;  4PYU A;  1MG8 A;  2RUK B;  4B95 A;  1QQG A;  4JKA A;  5DHA B;  1WXA A;  1U2B A;  2BYE A;  2LRW A;  3RD2 A;  4ILG B;  4ZRI A;  1WX9 A;  3T06 A;  1YIW A;  3NS8 A;  2LRU A;  2O2V B;  2FUH B;  4HLE A;  3APD A;  1XKE A;  2O6V B;  2MRP A;  4EFO A;  4ICU A;  2M17 A;  2DAF A;  2DN6 A;  1I35 A;  2UZS A;  2LAS A;  3ZRF A;  2EKE C;  3GYO A;  4IM0 A;  2LGX A;  5L83 A;  3TFM A;  4B9K A;  5HE3 A;  4MEL A;  3K9P B;  3DXE A;  2ZZP B;  1YQB A;  1EUV B;  3PRP B;  2GJY A;  1XQQ A;  3ZIM A;  3FLV A;  2COF A;  1SE9 A;  2LVO A;  1MIX A;  2KLC A;  2HJ8 A;  1ISN A;  2KQS A;  2KLG A;  3W1Y A;  1F9J A;  4PQ0 A;  1PMS A;  2N9P C;  2K8C A;  2M0X A;  2CQU A;  2DYO A;  1H4R A;  3DXD A;  1X1G A;  1E7V A;  4K81 A;  3WA0 A;  2K2J A;  4KHO A;  2WX0 A;  4EZJ A;  2BYV E;  4IUM B;  1GJZ A;  3JSV B;  3VXW A;  4WJ7 A;  4A6H A;  2DLW A;  3TL5 A;  2M8S A;  1SGH A;  2JPH A;  1C3T A;  3JVZ X;  3ML9 A;  1P5T A;  1LM8 B;  3ENB A;  1U4A A;  2D4Q A;  2J0J A;  3KH0 A;  3L08 A;  1ZC4 B;  1UPR A;  3PVW A;  3ECI A;  1KC7 A;  2C7N B;  4TQ0 A;  3HK0 A;  3PPA A;  3NZU A;  2DX1 A;  4DHZ B;  2Q13 A;  3A4S C;  3SHQ A;  5AZG A;  4DHZ E;  2X18 A;  1E7U A;  1J0W A;  3E9P A;  1IRS A;  1Y19 B;  1V5O A;  2DHZ A;  4GDK B;  1Z2M A;  4EEW A;  3A9J B;  1IP9 A;  4JKB A;  3GOE A;  3TIX A;  4LJO B;  5CHV C;  2EMS A;  3ZNG C;  3ALB A;  3VUW A;  3D32 A;  2FCM A;  2DHK A;  1KM7 A;  1P0R A;  3HM6 X;  3AJ4 A;  5JHH A;  2NS5 A;  2L7R A;  3ZDM C;  2BGF A;  1WXM A;  3NSU A;  1E90 A;  5D3X A;  2NZ8 B;  2RSU A;  1UNQ A;  2Z0P A;  3A8Q A;  4URK A;  3PLU A;  2GOW A;  2FNJ B;  4JK8 A;  5D6J B;  2YS1 A;  1LXD A;  4KVG B;  5KQ4 A;  1WXS A;  2E2X A;  5AZF A;  2WX1 A;  3V61 A;  2JF5 A;  2GCL A;  3RCZ A;  5C1Z A;  2MP2 A;  1NU2 A;  4CHK A;  4DX9 0;  1WGY A;  3PHX B;  4YON A;  4D0N B;  3VH3 B;  2A5U A;  1I2H A;  1WG7 A;  1SHC A;  4HDO A;  2ASQ A;  4IM2 A;  2MKR A;  1HE8 A;  4M8M A;  1V5U A;  4HB2 B;  1HB8 A;  1W1D A;  3NY5 A;  3FSS A;  3QBV B;  3DBR I;  5LXI B;  2V76 A;  2GCJ A;  1NI2 A;  2GS0 A;  4HPM B;  2LD9 A;  1H10 A;  4NJ6 A;  1V81 A;  3ODX A;  4HCP B;  3GYP A;  3PV1 A;  5DPR A;  3DQV A;  3DBS A;  4I6P A;  4IC7 B;  3WIM A;  4W9F A;  2IZV B;  1E8Y A;  4F7Z A;  1DDV A;  4HJK A;  2K1F A;  4WQO B;  1R4N I;  4I6L B;  3AU4 A;  4F7H A;  2LUE A;  1WH3 A;  2N9E B;  5E6O A;  3IVF A;  1V2Y A;  2EC1 A;  1BT0 A;  1DDW A;  2K39 A;  2IO2 B;  5JH5 C;  3APC A;  5HKH A;  3O65 B;  5KHO A;  2IO1 B;  4PNK A;  4G11 A;  2N1W A;  2DYB A;  4DX8 A;  4BVU C;  5AZH A;  3IBE A;  2D9Z A;  2Y7B A;  2KD0 A;  2QKL A;  3D8D A;  1UD7 A;  2KK8 A;  4GU2 A;  5DHF B;  3B1L X;  3R66 C;  4JK9 A;  4GGQ A;  2DX5 A;  2G4D B;  1UBI A;  3N7C A;  2CRF A;  4WJO A;  2C7M B;  1ACA A;  1Q0W B;  4G50 A;  3V5W A;  1KZG A;  4FJZ A;  2N4F A;  4GDK A;  1U29 A;  4X57 B;  1YX6 B;  3AUL A;  4GOC A;  3L13 A;  1X1M A;  4BOZ B;  2W2X C;  2K8H A;  4TKN A;  5C5B B;  3ZNI D;  4H8S A;  1G6J A;  2JZZ A;  5JHA A;  3UIN B;  1XT9 B;  1EO6 A;  2DX5 B;  2L0T A;  4MJS B;  3NOB A;  3QA8 A;  1ZSQ A;  1JRU A;  3KW5 B;  3ZRC A;  4W9L A;  1WMH A;  2J0K A;  4A3P A;  2LWP A;  4GSW A;  2RD0 A;  2PE6 B;  3PVU A;  2I5F A;  2GMI C;  2ZVO A;  3KUC B;  2BKR B;  2XK5 B;  3SYX A;  3BJI A;  1OTR B;  2MFQ A;  1GC7 A;  4F7G A;  4WWP A;  2WDT B;  4JKE A;  5C79 A;  2NVU I;  3H1U A;  2L3Z A;  4OVU A;  1WJ6 A;  3TCA A;  1V80 A;  2PJH A;  2DYN A;  1I7A A;  5FR6 A;  5CTR C;  1OMW A;  4BKG A;  5CLL B;  3PHW B;  3QIJ A;  2M1M A;  1N3H A;  3KRX A;  4PYZ A;  2D10 A;  2G35 A;  2IBI B;  1Z5S B;  2N1V A;  2K6Q A;  3OJ3 A;  2J59 M;  2I1K A;  1WZ0 A;  1WR1 A;  5DPT A;  2JXX A;  4A6K A;  4GDL A;  2FIF A;  2GBK A;  5CHF A;  1PQS A;  1E8Z A;  1WJU A;  4MH0 E;  1FHW A;  2MBO A;  2DA0 A;  4PS7 A;  2KFJ A;  3VFK A;  3PGE A;  2UYZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...