3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Merlin
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
2WX0A 4HXDA 1CMXB 3KUDB 3PLUA 2FAZA 3EPYA 3GYOA 1WMHA 2XBBC 4FA6A 4XWXA 4PYZA 4DDID 2KJRA 4WJQA 3RZWC 4WQOB 3VIAA 3KUCB 3DCGA 4DHJD 4W9GA 3TL5A 3PRZA 3D8DA 4TKNA 4WSFA 2EMTA 5JP4A 2KK8A 2LXCA 3AULA 3APDA 3DVGY 3RZFA 5C1ZA 1P3RA 2E2XA 2J0MA 1U5DA 2KFKA 4D0NB 1KM7A 3N30A 4I6NB 1J0WA 2JT4B 2GBJA 4WVFB 2R09A 5LOPB 2KDBA 2OJRA 2DHKA 2RSUA 5L95C 3VTUA 3I3TB 2DYQA 1U5GA 5HE2A 1WJUA 2D10A 2CRFA 2QHOA 1DBHA 2EJ8A 3L0WB 4IC7B 2I1JA 4TQ1A 4BOSC 3U8ZA 2UYZB 3A8PA 2LRUA 3C0RB 1U27A 3R3MA 1W1HA 1IP9A 3P7ZA 4C0AA 3PTFC 2YT1A 5LXHA 2EMSA 2PE9A 1WGHA 2P0HA 4HK2A 4OVVA 2ZPNA 3DBRI 3KYDD 1FB8A 4NQLB 3O96A 2V76A 1H10A 2VKIA 2K8BA 2FCSA 3CF6E 4FN2A 1ZC3B 2YT0A 3DVNU 4KV2A 1WE6A 4W9LA 4Z2MB 3PHXB 4AWJA 1L2NA 4Z2NA 2IYBA 2RGNB 1ZM0A 1NU2A 2MKRA 2JWZA 4YONA 3UINB 3TFMA 2K6QA 3UGBB 4IFSA 1E90A 4EMOA 3PREA 2X18A 2O6VA 2KX3A 4LJPB 1HE8A 4AOFA 1WG7A 2KD0A 3AU5A 1X11A 1EO6A 2L05A 4BBNF 1I42A 4M0WB 2DX5A 4FBJB 3PG7A 4FJVB 1MK7B 2COAA 5LONB 5C5BA 1XCGA 3ECIA 4DDGD 4HLEA 1QQGA 3CSTA 1Y5OA 4ZRJA 3R7RA 3R7QA 5J3QA 2N23A 3KRWA 3R66C 2RQ1A 4HAVB 5C5BB 2CY4A 1YJ1A 2FCNA 3ML8A 5DPTA 4EZJA 3EFUA 2CODA 3IHPC 2ZEQA 2W2XC 3VHTC 3ZW3A 3DOWA 1ST7A 3GYPA 3Q3FA 3CSFA 4CO7A 3PPAA 4EEWA 2P0FA 4HJKA 3PS6A 4CHKA 3D32A 2C7NB 2DTCA 2D9VA 2CAYA 3B1LX 4BBKA 4DK5A 4HAWB 1Y8RC 3CMMB 4PYUA 4MY6A 1NTVA 2ZNVB 3QIJA 1WGUA 3M95A 1V2YA 4GPTB 3ZNID 2L0TA 5CTRC 4BKGA 1TZ1A 2R2QA 3P2BA 3SUZA 1WGRA 1XKEA 3IVFA 3KRXA 4HB3B 2FIDA 2MBHA 2JY6A 2M0XA 2YRYA 3FEHA 3MPXA 4HB4B 2MW5A 1T0YA 3SV1A 1BAKA 2LUEA 2RD0A 3VTWA 4HPLB 2RLOA 2UZRA 4NQKE 2N9EB 1B55A 3ZKJC 4BKSA 2I1KA 2JF5A 2KX0A 2D9XA 1Q1OA 1GNUA 5JHHA 2AL3A 3L13A 4IM3A 2MA9B 3WAPA 1M7RA 1S1QB 1OQYA 3ZVRA 2B3AA 2DAFA 1E8YA 1WI0A 2COFA 2G4DB 2N9XA 2NMBA 5D3WA 1WZ0A 2KLCA 2PZ1A 3A33B 2V3SA 4IWOA 4W9JA 5AZGA 3VDZA 4JL9A 3ZDMC 2J7QB 2KLGA 3D8FA 3O65B 1XD4A 2KO3A 3RCZA 1ZGUB 4IW0A 3ZVVA 3MDBC 4PS8A 5EDSA 2MLBA 4LJOB 3VUYA 4BFRA 4F7ZA 2O2VB 3QJZA 2GCJA 5FI0A 1SIFA 4GXBA 2DZMA 2W9NA 4DWFA 5DHAB 2KFKB 3SO6A 1WH3A 1RRBA 1WVHA 1HBKA 2KMAA 4G11A 4B6HA 3PZDA 3LDZE 1EVHA 2D9WA 3D8EA 3PP2A 2HTHA 2KHWB 4GMVA 5D3VA 3UF8A 5DHFB 3TO1A 3PGEA 1KOTA 4WJPA 5CLLB 1GJZA 1PMSA 2KWUB 4URKA 2KTRA 1MIXA 3ZNZB 2YLMA 4ANXA 3V60A 3QHTA 1TQZA 2G45B 1V5UA 4A5KA 1OEYJ 3M63B 2LULA 2DYBA 1H8CA 3SHQA 2GBNA 2KTRB 2P0DA 2K2UA 1XODA 5JZEB 1Z2MA 3V62A 2MWNB 1WE7A 2BKFA 3OJ4B 2JRHA 3MJWA 1V89A 5FR6A 2RPQA 1M7EA 3TW1A 4DX8A 3ZTCA 1LM8B 1RJ2A 4H8SA 5C79A 1WGYA 2NVUI 3KVFB 3WANA 1HB6A 2DZJA 3ZIMA 1X1GA 1OMWA 1OGWA 4W9HA 1LW3A 1WXAA 1C1YB 2MBOA 2PPHA 3ZNGC 2DHJA 5E6OA 1NI2A 3PSCA 5E6PA 4HDOA 3PRPB 4A6HA 2ZCBA 2BPSA 3RYTA 1MK9B 1PLSA 4I6LB 5AEKB 4HAZB 4AJWA 4AJYB 3QAQA 2LBBA 5JHBA 2HTHB 1WFYA 1PFJA 2QKMA 1UH6A 1V5TA 3H1UA 3OAWA 2DYMA 1UPRA 3NZUA 4KIKA 3IFWB 2MBEA 5LXIB 2LRWA 1SHCA 2V1YA 3FSSA 3VTVA 3EECA 1R4NI 3PSEB 3APFA 1WF9A 3H7PA 1P1AA 4MEMA 3W1SA 3FLVA 1SE9A 2N9PC 2ZZPB 2Z0OA 3DQVA 3HM6X 3PRMB 4GDLB 3ODOA 5DCNA 5AZHA 2DYOA 4RM9A 2KUPA 3H7PB 3KZ1A 4A6KA 4DHJB 4E3CA 1FHOA 2ROZB 3ALBA 4BKTA 2J0KA 1E8WA 1NVLA 2OOBB 2Z0DB 3ONSA 3TBLD 3X0WA 2YF0A 2Z59B 4MGKE 4E74A 4HAYB 3U7DA 2M38A 3OLMD 4OVUA 2DFKA 2MFQA 5L81A 2LGXA 1P0RA 1E7UA 1WI1A 3WIMA 2K00A 2YSZA 4GU2A 4KDIC 5JHGA 2P8VA 2O6VD 2D07B 1OEYA 5GMVA 1WYWB 2KDFB 3DVGX 2Q13A 1DDWA 2LG1A 2FUHB 3M62B 4IM0A 5D94A 3HIZA 3W1YA 2N7EA 4DHZE 4F1SA 4ZRIA 3NZSA 4MSQB 2PEAA 3A1QB 2EC1A 3GZNI 5CX3A 2LKOA 3DDCB 2ABDA 1Q5WB 2KC1A 3N3KB 4W9FA 1WGDA 2LVPA 4KVGB 2JRIB 1RAXA 2KWCA 2Z0QA 1DYNA 1LB1A 3A98B 2LD9A 1OTRB 2D11A 3JSVA 2DZKA 2LVOA 4ICVA 2ADZA 5CHVC 4PNKA 4IWQA 4KIKB 2COPA 4Y94A 1QC6A 4GOCA 2LZ6A 4RMAA 3PVWA 2N0YA 4MK0A 2RGFA 5C23A 2BYEA 1J8CA 4IUMB 2JZZA 2ZJDA 2RR9A 3PVLA 5TR5A 1XR0B 5GOWB 2K1FA 3SNHA 5J18A 4GSWA 4NSWA 4ASWC 1LFDA 3M3JA 4F7GA 1MKEA 3ZRFA 4L6EA 3RCPA 4NY0A 4K7WA 1E7VA 5J3YA 3N32A 4XC2A 2LOZA 3VVWB 4HDQA 2PJHA 2KC2A 4GGQA 3T8MA 1G6JA 2KGXB 2ZVNA 3VH4B 4ZDVA 2FJ9A 4LCDE 4ZYNA 3ULCA 2DKQA 2LYDA 2IBIB 2KFJA 4FADA 3B0AA 2CR5A 3DBLI 3SD5A 3WAMA 3KSYA 2NBVB 2OTXA 2YS1A 1S3SG 3L54A 1IYFA 5D6JB 1D3ZA 2A5UA 3ZRCA 5D3YA 5KHQA 1W1GA 4LDTB 2CHXA 4IM2A 4JLCA 2CU1A 4BKSD 2LJ5A 3ZLZA 2BCJA 4RM8A 5DPSA 3PT2B 4DXAB 1WR6E 3QX1A 3ODWA 1EF1A 1XT9B 5D7GA 2GBKA 1UBQA 3OANA 1V49A 5IAAC 3QBVB 2FCMA 3NHEB 1Q67A 1KI1B 2IO3B 2K8HA 3DBHI 4GIVA 4HCNB 4WWNA 3ZO5B 4BVUC 1P3QU 1UNRA 2C9WB 2KWVB 1X1MA 3H6NA 2FNJB 3VAWA 4DHZB 5CHFA 5BO4B 1UEFA 2IY0B 2NR2A 4W9IA 2YS5A 3KW5B 5DI9B 2I5FA 4MSMB 3DXCA 1HB8A 4HPMB 1SGHA 2KQSA 4JIOU 4P7IA 4K7UA 2L1CA 4KZ0A 4MGIE 2K39A 5IA7A 3BJIA 3DPDA 1FGZA 3IBEA 1C3TA 2L2IA 4A6FB 4ANWA 2RUKB 3VH3B 1PQSA 2KXJA 4IAPA 1ZVRA 1Q0WB 2GBMA 2ZNVC 2CY5A 2R0DA 1I2HA 2QKLA 2EKEC 1WM3A 2ZCCA 3H7SA 4EZKA 1FGYA 1NDDA 2K25A 5DPWA 2H7DA 4HB0B 4GDKB 3TVVA 1TBEA 2DHZA 1GG3A 2L7RA 3X23A 5J2RA 3SDLC 1V80A 2G4SA 2JP2A 5HKHA 2LASA 1UBIA 4CHMA 2NBWB 2JXXA 2O6VB 5KHOA 2G35A 2YVCA 4ANVA 3V5WA 1OQNA 1E5WA 1WR1A 1LXDA 1OY2A 5JLJB 2ZPYA 3SU8X 2GJYA 4FHJA 1ZSQA 1UPQA 5DPRA 1DDMA 1V9JA 3DVNV 3RT3B 2KCJA 4MH0E 1WJ4A 1MAIA 4AUQC 2CHWA 1I7AA 3BY4B 4ICUA 4TV3A 3V61A 5J17A 4CYEA 1V5PA 1GC7A 1MIZB 4KHBB 2AYOB 2MDXA 3M1IB 1EF5A 1XD3B 2NPTA 4X57B 3P6AA 1RLFA 3A4RA 1WX8A 1EUVB 2KDEB 1U2BA 4N9F4 1XX0A 4K17A 2JPHA 4TQ0A 4HAXB 1WM2A 2C7HA 3GOEA 4WWOA 3AJ4A 2LOXA 1WJ6A 1FOEA 3WYFB 1E8XA 4JGHB 4HATB 4A6FA 2CB8A 3LJUX 3MHSD 3DXDA 4M8MA 3HHMA 2AL6A 4MT7A 1YX5B 3KUZA 5IJMA 2NZ8B 3V6EB 3ZUNA 4GB9A 4F8CB 2WDTB 3EHVA 1GUAB 5KQ4A 1WJ1A 3CIKA 1Z87A 4IOYX 2CHZA 4K7SA 3S2AA 2RSGA 4G3XB 2M4NA 3VQIA 4DBBA 2BWFA 3EC8A 4MGYE 4K81A 3F5RA 2GBRA 4PS3A 3RUIB 2IO1B 3PEGA 4MDKE 3B08A 2KMCA 2Y8GA 1VCBA 4KZCA 2G3QB 3FP5A 4BOZB 1BTKA 1MPHA 2UVMA 1WGQA 4CHJA 1K8RB 1UELA 1UGMA 2MP2A 1WY8A 3RULA 5DH9B 1H4RA 4NNJB 1WRDB 3UIPB 4EOYA 5KQ1A 1M94A 3DXEA 2J59M 1XQQA 2N4FA 2XK5B 2BF8B 1UZXB 5HE3A 1RRPB 3HQCA 1K5DB 1X1FA 5C16A 1ZKHA 4JQWC 4XZ4A 1V86A 4K2OA 1I35A 2WH5A 2I5CA 2MBQA 1U4AA 5D27A 5KCVA 2DYNA 2MCNB 4A3OA 3QARA 1V5OA 2PE6B 3TCAA 2D3GA 4FLHA 5L83A 2GCLA 1Z5SB 3BINA 2KVRA 5CHWA 3AI5A 5G2NA 2CQUA 2MRPA 3PHWB 2NCNA 3QWZB 4HCPB 4ANUA 1W1DA 1KJTA 3L10B 4WJOA 2NPTB 2JUOA 3F0WA 3QC8B 3PVUA 2KOXA 3CXBB 3DBSA 1WZ3A 3QWMA 2N1VA 4HWIB 1EAZA 1IPGA 2AWTA 2KJHB 2RVBB 1JRUA 3L08A 1NTIA 2L00B 4BBNC 1L7YA 2UZSA 2IO0B 4FJYA 2VSZA 2D2QA 1J19A 2HJ8A 4FHKA 2MBBB 1U5EA 4KDLB 3WAOA 3K9PB 1FXTB 2FCQA 1AQCA 2DKPA 2DHIA 4A3PA 3ULBA 5EFXA 3PV1A 3WALA 4GDLA 3APCA 1NTYA 2ELAA 3SYXA 5CLQB 1NBFC 2WX1A 2ROVA 2Y5BB 1P6SA 3T06A 4NPNA 4EFOA 4G50A 3G9WA 2ASQA 2J0JA 4HB2B 2H7EA 1V61A 4M8NA 2LI5A 1V81A 3L16A 2IFSA 4IWPA 2IY1B 3A4SC 3KH0A 4I6PA 4HHVA 5D3XA 1WXSA 1ACAA 2D9ZA 2IO2B 2KTFA 2KDIA 2ZVOA 3L17A 1J0GA 1QZEA 2N7DA 3MTNB 2KJ6A 3TJPA 2DLWA 4E71A 3H9DA 4J6IA 2IYDB 4MJSA 1E8ZA 1KZGA 2DAJA 1WXVA 4K2PA 4GZUA 3A1QA 5HE1A 3UZTA 4II2B 2OQBA 3A9KB 2WYQA 1YQBA 4NJ6A 3KYCD 3ZNHB 2FJLA 3AXCA 1X86A 3JVZX 4KSLC 3LJ3A 1FAOA 2DA0A 4LDTD 4W9KA 1ZW7A 2LXAA 2KNBA 3PLVA 4FULA 2YS3A 2Z0PA 2Y8FA 3NOBA 3QQ8B 3A8QA 2CS4A 1DROA 2LVQA 4NJ7A 2W2XD 1BTNA 4HAUB 2L76A 3UIOB 3IG3A 3JW0X 4MELA 3AU4A 2V4LA 1ISNA 2BGFA 4W9EA 3ODXA 2BYFA 2GS0A 3TIXA 2O2VA 4YL8A 1BWNA 1U29A 5HE0A 4KSKC 1AWEA 3HM3A 2MP2B 3Q3JA 4WJ7A 1WX7A 1UNQA 4WAAA 4EZLA 5JH5C 3UQBA 2KANA 5D2MB 2COCA 1YIWA 5JHAA 4EKUA 2LWPA 2VRRB 2Y7BA 1A5RA 2C7MB 2KN5A 2C60A 5FI1A 2JZ3B 3JYUA 1KLVA 5LLIA 5E6NA 1LQBA 1MG8A 4A20A 4TYZA 2DENB 3WA0A 2RNRB 3QA8A 3T9LA 1V88A 1TXDA 4F7UP 2AEHA 1K5GB 4KHAA 4K1RB 2K8CA 2MQJA 2D9YA 5J3TA 2HD5B 4KAXB 1DDVA 3N7CA 4G0NB 1TJ6A 2K6DB 4NAWB 4EUTA 2HE7A 2Z0EB 4WWPA 4B9KA 4XX5A 3JSVB 3OJ3A 5C6RA 1VD2A 4ZRKA 1WMHB 1X05A 2KZRA 2N1WA 4MGZE 4W9DA 1EGXA 3NY5A 3FM8C 2DX1A 3NSUA 2DZIA 4GN1A 2DX5B 1U5FA 2XQNM 2KQ7A 3QCAA 4PS7A 1FHXA 2NBUA 1Y19B 1V5MA 2HRJA 1BT0A 2BKRB 1RFAA 2LGYA 1P98A 4HVBA 4AP4C 2IZVB 2WWZA 1ZC4B 1IRSA 2FIFA 1WGGA 3ZDTA 2M1MA 2BWES 2KKCA 2DN6A 2VRWB 4IG7B 3RD2A 2FDQA 1WJMA 4W9CA 2LGDA 2K2JA 1YX6B 4MM3A 4GMXB 1P9DU 2L3ZA 3V6CB 4WJNA 3VUXA 4EJNA 3A9JA 4II3B 1KZ7A 5G55A 2JVCA 2R2OA 4KHOA 1FHWA 1N3HA 4F7HA 2XEWA 3VUWA 2CKHB 2L8JA 1YD8U 2M17A 3NS8A 3K9OB 2UWQA 2MX2A 2L0FA 3A9JB 3ENEA 4GDKA 3VXWA 1P5TA 3HW2B 1WX9A 3QK0A 1AARA 4MJSB 3UQAA 2ELBA 3ML4A 1V6EA 2GMIC 1WXMA 4FJZA 1GC6A 3VOQA 3TMPB 5AZFA 5DIFB 4NAWA 2GOWA 4DX90 2XK5A 3A9KA 1WIAA 2C5LC 3ML9A 4B95A 1F9JA 3W1SC 2NS5A 4TUUA 4PQ0A 3VFKA 2MSED 2BYVE 2W2WA 3U30A 4DBGA 3ZTDA 4B6WA 3KY9A 2M8SA 1UNPA 2D4QA 1R4MI 1TGZB 1TTNA 3HK0A 2M14A 1WJNA 1UD7A 2A4ZA 2REXA 2MWSB
chains in the Genus database with same CATH superfamily
3PLUA 2FAZA 1WMHA 4RFBA 4FA6A 2KYWA 4OZBA 4OSNA 1OQRA 2QMTA 3RZFA 2XN9C 2E2XA 2J0MA 1U5DA 3UQAA 5L95C 2RSUA 5D3IB 3I3TB 4A6QA 2D10A 5H92C 4L23A 3GE8C 1XLPA 2UYZB 3AECB 3P7ZA 1GOZA 3AE3B 4HK2A 3ZXRA 3DBRI 2IGHA 5EE3A 4JX1C 1ZC3B 3B9JA 2OHFA 2RGNB 1XLNA 4YWGG 4IFSA 3PREA 2X18A 1WG7A 2KD0A 4XGAB 2DX5A 3PG7A 4FJVB 1MK7B 1OQQA 1WXQA 1Y5OA 1MG4A 2N23A 1QOBA 3R66C 4HAVB 2FCNA 4KKJA 2CODA 2ZEQA 2KQ4X 3GYPA 4DIXA 3URYA 1R7SA 3PS6A 5E6JA 2CAYA 4DK5A 1MI0A 4HAWB 1Y8RC 3CMMB 4PYUA 1NTVA 4GPTB 1GAQB 4HB3B 2FIDA 2M0XA 2YRYA 3FEHA 2MW5A 3NZ3A 1T0YA 1BAKA 2RD0A 3VTWA 3KWVA 2N9EB 3R2IA 2NBVA 4YSYB 2JF5A 3ZKJC 4JKHA 1GNUA 5JHHA 2BW2A 3AULA 1WI0A 1V97A 2LMCA 4XWWA 1CK1A 4OZCA 1XD4A 4IW0A 1FXIA 2RDGA 5EDSA 3VUYA 2DZMA 2W9NA 1WH3A 2NMQA 1WVHA 5M4YB 2WGSA 1EVHA 3D8EA 3PP2A 4GMVA 2FE8A 3RNGC 3UF8A 3DCXA 5BMGA 1KOTA 4HKZE 2E6XA 3V60A 2YT2A 1V5UA 4A5KA 1Z2MA 2BKFA 1JWSD 3GZNB 3MJWA 1VBHA 1RJ2A 4YSZB 1X1GA 1OMWA 3CIRB 1LW3A 1C1YB 2MBOA 5E6OA 2KACA 4HDOA 3OWEB 4A6HA 2ZCBA 1MK9B 5AEKB 5JHBA 2HTHB 1PFJA 2QKMA 2W55A 3OAWA 4KIKA 3IFWB 2BS3B 3EECA 4YTPB 4QJ5B 4MEMA 2ONQA 3DQVA 1KBLA 2Z0OA 2KIEA 3PRMB 3O13A 5AZHA 3ETRA 4E3CA 1JWUD 2ROZB 4NJCA 4BKTA 2J0KA 3X0WA 1FIQA 4MGKE 5L81A 2LGXA 2K00A 4KDIC 5JHGA 5IRSA 1NEKB 2INPE 1WYWB 3DVGX 2LG1A 3ZJVA 4DHZE 4F1SA 2I2YA 3DDCB 2ABDA 1Q5WB 4KVGB 2Z0QA 3A98B 1OTRB 1L0VB 2N0SB 1FEHA 4PNKA 4GOCA 1QC6A 4RMAA 1V1OA 4OHJA 4LNIA 1JALA 3FILB 3B2FA 2Z4DA 1SB3C 5GOWB 2LGSA 3SNHA 2MEKA 3M3JA 3ZRFA 4NY0A 2VZKD 2HDEA 4LLGM 4DQOC 1XLQA 1G6JA 2ZVNA 3P4QB 4LCDE 1KRHA 1WSPA 3WAMA 1VLBA 5KHQA 2CHXA 3OHMB 4IM2A 5BMIA 1XT9B 2JU6X 5IAAC 3QBVB 2FCMA 2KIGA 1Q67A 4HCNB 3DBLB 4BVUC 4YSXB 4K3BA 2NR2A 3TEZA 5DI9B 4MSMB 4K7UA 5BMHA 2KQSA 1FFVA 1JMLA 5IA7A 3VH3B 5LNK1 4IAPA 1Q0WB 2GBMA 2V3NA 1WM3A 4EZKA 4RGMA 1ZPSA 4GDKB 2WXRA 1V80A 2LASA 2G35A 1WR1A 3V05A 5JLJB 2ZPYA 3SBTA 1ZSQA 2INCC 3RT3B 5IP4D 4AUQC 2CHWA 2JXTA 1GC7A 4KHBB 2MDXA 2NPTA 4RNAA 1WX8A 4QJ3B 2K22A 3N9YC 4KHBA 4TQ0A 1WM2A 3DBRB 3GOEA 1WJ6A 3WYFB 1E8XA 4JGHB 4HATB 4A6FA 3MHSD 3Q2AC 3HHMA 2AL6A 3KUZA 3V6EB 5IJMA 3Q3MC 3ZUNA 4GB9A 4F8CB 3E66A 2WDTB 4K7SA 2CHZA 1R4MB 1FD6A 2RSGA 4G3XB 1SJED 4MGYE 2GBRA 1N5WA 2IO1B 4MDKE 1FRDA 1YN5A 3FP5A 5IKCM 1MPHA 4CHJA 1WGQA 2WQYB 4EOYA 5KQ1A 1M94A 2J59M 1UZXB 1RRPB 1ZKHA 4JQWC 2NTSA 3SFDB 2I5CA 2MBQA 2DYNA 4Q2JA 3QARA 5L83A 3C8YA 3BINA 5G2NA 3AI5A 3PHWB 4HCPB 2NCNA 1KJTA 1V8CA 3L10B 4JK9A 2IJ0A 2NPTB 2AX5A 3QC8B 2KOXA 4HWIB 2AWTA 2KJHB 1JRUA 3L08A 3B77A 2D2QA 2HJ8A 1F2RI 2AQ2B 3K9PB 4A3PA 1FFUA 5EFXA 3PV1A 1E6EB 2L52A 4HKQA 3P4PB 5CLQB 1CZPA 2Y5BB 1P6SA 1VR9A 2ASQA 4C7YA 2LI5A 3L16A 4I6PA 4HHVA 1WXSA 1T0QC 4GNKB 2KTFA 2ZVOA 4RF0A 2KJ6A 3H9DA 5TSSA 1KZGA 2DAJA 3A9KB 2WYQA 3HSAA 4KSLC 4LDTD 1FAOA 4FULA 2YS3A 3NOBA 1QILA 5AUKA 3A8QA 3UIOB 2SAKA 2WU5B 3VR8B 4WWMA 3HRDD 2BGFA 4IDIA 2JYTA 1UWXA 1K53A 1ZDXA 3HM3A 5JH5C 3C19A 2J42A 3UQBA 1MI1A 4EKUA 1WWTA 2VRRB 2E3TA 2KN5A 4HPPA 3JYUA 3PZ8A 2PW9A 1V88A 1TXDA 4F7UP 2JX5A 4G0NB 4KAXB 1DDVA 4K3CA 1TJ6A 2Z0EB 1WMHB 5HFYA 4ZRKA 4ILJA 1X05A 2KZRA 1SF0A 1VZ8A 4ZHOA 2WDQB 2DX1A 3NSUA 1N60A 1QKZA 2DX5B 3QCAA 4LNKA 1V5MA 4AP4C 4N59A 2WWZA 4MM3B 4JKGA 2FIFA 1WGGA 3ZDTA 2Y5PA 1LO5D 1C4AA 1D5MC 1ZYIA 2HTME 4TSSA 4II3B 1FHWA 2CKHB 2M17A 3NS8A 1KLGD 1J7CA 2G9HD 2MX2A 2L0FA 3A9JB 3MHZA 5LXHA 3ZJTA 4MJSB 4FJZA 3MC9A 2NS5A 3VFKA 4HRSA 4YTMB 4RF1A 1UNPA 1R4MI 2EELA 2K8CA 1UD7A 1T0RC 2WXQA 3KUDB 2XBBC 1YNTE 1HA5A 2NTTA 1PUTA 3DWMA 2DLBA 1TKEA 3PRZA 1AN8A 3D8DA 1J0WA 2GBJA 4WVFB 5LOPB 2DHKA 4GLSC 3VTUA 1FNVA 1U5GA 5HE2A 1WJUA 4IC7B 2LFIA 2LHDA 1DBHA 4KZCA 4TQ1A 4BOSC 1MFWA 1K51A 2QDFA 1IP9A 3PTFC 3U52E 2PE9A 1JRPA 2PVOD 4OVVA 2ZPNA 4NQLB 3O96A 1P7FA 2YT0A 3E9PA 2IYBA 3TFMA 4D6WA 4HEA1 2L05A 1J7BA 1EO6A 3PZ7A 1XF5L 3DWGC 4M0WB 4OZAA 2COAA 4GOUA 5LONB 5C5BA 1XCGA 1E7PB 2RRFA 2W82A 2RQ1A 5C5BB 1JW9D 1ZXIA 3EFUA 2WXGA 3ZW3A 3DOWA 3Q3FA 4HJKA 3D32A 1E10A 4MH8A 2DTCA 3BK1A 4BBKA 5FKAC 4AS1A 1N61A 4BKGA 1TZ1A 1MJDA 2H88B 2MBHA 2WXFA 1IUEA 4HPLB 2RLOA 2UZRA 4NQKE 5HI1A 1B55A 3AEDB 3AEGB 4ARCA 3L13A 2MA9B 2G4DB 1UF0A 2QC8A 2N9XA 2COFA 5D3WA 4W9JA 2PZ1A 4IWOA 1IBXB 4JL9A 3IT6B 3D8FA 1ZGUB 1Q10A 2BTEA 1AW7A 2MLBA 4D2KA 3DHGC 4F7ZA 3Q14C 1TKYA 2GCJA 5FI0A 1SIFA 4DWFA 2KFKB 2WLBA 3SO6A 1HBKA 4HJGE 2L83A 3IAM1 2WDRB 1TYGB 3LDZE 2HTHA 5D3VA 3NWAA 3TO1A 3PGEA 1GJZA 3U12A 1PMSA 2WP9B 5EE9A 1SIJA 2KTRA 1MIXA 2YLMA 1SBBB 2G45B 1H8CA 3GP7A 3M63B 2LULA 2KTRB 2IGDA 2P0DA 2K2UA 5JZEB 3V62A 2QCZA 3OJ4B 2KWDA 3RN9C 3KVFB 4C80A 3HUIA 2G1EA 3PSCA 3VR9B 1TS4A 3QAQA 5LG4B 1GGOA 2KVZA 1V5TA 1UPRA 5LXIB 2LRWA 4QXAB 1SHCA 3FSSA 3VTVA 1EU4A 3PSEB 3LYYA 3H7PA 3W1SA 1P1AA 3FILA 1EWYC 3ODOA 2N7JA 1VZ7A 3KZ1A 1BMLC 1NVLA 2YF0A 3U7DA 1WI1A 4GU2A 2YSZA 2BQQA 2D3AA 3ZJUA 2GRIA 2Q13A 2WXJA 2ZKMX 2FUHB 5D94A 4A8XC 4ZYSA 1L4DB 3A1QB 1NVID 2LKOA 3N3KB 4W9FA 2LVPA 2KWCA 4OT1A 3I5JC 2LD9A 2DZKA 4US8A 4OVZA 3RNEC 4Y94A 1B9RA 2LZ6A 2N0YA 2RGFA 5C23A 3AE1B 2BYEA 5TR5A 4OW0A 1XR0B 5D3DA 3P4SB 4L6EA 3P63A 4K7WA 1B1ZA 5J3YA 3N32A 3VVWB 2YEPF 3T8MA 3GB1A 4ZYNA 1T77A 3ULCA 2KFJA 2LYDA 3TEYA 3TUOA 3KSYA 2OTXA 1VZ6A 3EUB2 1IYFA 2Z8LA 1C79A 1TKGA 2CU1A 4JLCA 2LJ5A 3ZLZA 4B0MA 1EF1A 2GBKA 1UBQA 3OANA 3NHEB 4GIVA 3ABVB 2KWVB 4O1NA 2FNJB 4S17A 1UEFA 1JROA 1HB8A 4MGIE 2QIEB 4KZ0A 2L1CA 3BJIA 3DPDA 1FGZA 3SFEB 4A6FB 2RUKB 4US9A 2ZNVC 1I2HA 3Q69A 1FGYA 4LNNA 2H7DA 2DHZA 5C2TB 3SDLC 4JKAA 5HKHA 2JP2A 1MVKA 1WGKA 2JXXA 5KHOA 2YVCA 2D3BA 2GJYA 1UPQA 2KCJA 3N20C 5J17A 3BY4B 5EE0A 1IBXA 1HTOA 3M1IB 1HEZE 1EF5A 1XD3B 3GS2A 4X57B 3A4RA 1RLFA 1U2BA 4HAXB 1SE4A 2C7HA 1OFFA 2LOXA 1T3QA 4M8MA 1KF6B 3DXDA 3R8BA 2NZ8B 3W2DA 3AEBB 3EHVA 5T8IA 4IOYX 3E9SA 2M19A 3AM9A 3KLSX 2M4NA 1C9FA 3EC8A 3AE7B 1FRRA 1CQVA 3OG5A 1QLBB 1VCBA 2G3QB 2K8EA 3ZXVA 1UGMA 1H4RA 1WRDB 1XQQA 2XK5B 5C16A 4XZ4A 1HTQA 1V86A 1U4AA 4XDDA 5D27A 5KCVA 2MCNB 5CHWA 4XE0A 2JUOA 3AE6B 3QWMA 4RCOA 1EAZA 1IPGA 2RVBB 1NTIA 4BBNC 2V9HA 4FJYA 1UUPA 1J19A 4KDLB 4JK8A 2DKPA 2MJDA 2N9LA 1V1PA 4N6EB 1NTYA 4EFOA 3G9WA 2J0JA 1V61A 4IWPA 2IFSA 1LGRA 2IO2B 1ACAA 2D9ZA 2N7DA 3MTNB 2DLWA 2GLSA 1WXVA 4GZUA 2JWUA 5HE1A 1JWMD 1QOAA 3KYCD 3AXCA 3Q8AA 4WIPA 2LXAA 4HAUB 2L76A 2RPVA 3JW0X 2GI9A 2M0AA 3BZDB 1ISNA 3ODXA 1YQ4B 1I4HA 4JWSC 2BYFA 2O2VA 1TY2A 1U29A 4KSKC 1AWEA 2MP2B 3Q3JA 4EZLA 3T3NA 5D2MB 2COCA 1MPEA 2LWPA 2X38A 2C7MB 4XWTA 2C60A 3EA6A 5LLIA 2ZW1A 1LQBA 4A20A 3WA0A 2RNRB 2AEHA 1K5GB 3FAHA 1IGDA 2HE7A 2ICIA 4XX5A 3JSVB 3OJ3A 5C6RA 4IKGA 3BIID 2PLPA 4W9DA 2WU2B 1EGXA 4M00A 3AE8B 3FM8C 5DCNA 2XQNM 1FHXA 3N1ZC 1ZC4B 1IRSA 2VRWB 3NG0A 2MHJA 1DGJA 4MM3A 2L32A 2BYTA 4WJNA 1KZ7A 4KHOA 4RGNA 5BYQA 1N3HA 2XEWA 1C78A 3VUWA 2L8JA 4GDKA 1P5TA 3HW2B 1WX9A 1AARA 2GMIC 3ML4A 3AN1A 1WXMA 1GC6A 2FJUB 1EU3A 1F9JA 2ON8A 5G5HA 3U30A 4DBGA 2Y5CA 3KY9A 2M8SA 3VQIA 2D4QA 1TGZB 1WJNA 5HG2A 2MWSB 1QOGA 2WX0A 4HXDA 1CMXB 1MHXA 3EPYA 3GYOA 2IGGA 3NVYA 4XWXA 4PYZA 1TS3A 3NW8A 3W9CB 3E9LA 1FCCC 3VIAA 3DCGA 4ACFA 4W9GA 4TKNA 2KK8A 5JP4A 3APDA 2LXCA 3DVGY 1YN4A 2IDYA 2V0GA 3N30A 4I6NB 3A58A 1KM7A 1ZE3D 2OJRA 3CWIA 1SEBD 1PFDA 4JPSA 3E9OA 2QHOA 3L0WB 4LTUA 1FO4A 4B0EA 2I1JA 4WH4A 5IN7A 1N6ZA 1U27A 3R3MA 4C0AA 2P0HA 4LK0M 4C4VA 3NJTA 2LGIA 3KYDD 4WAFA 4FN2A 1I4GA 2FCSA 1L2NA 4AWJA 4Z2MB 4Z2NA 3UGBB 1NU2A 1RFKA 1E90A 3VRBB 4LJPB 1HE8A 4AOFA 4PT5A 1XCQL 4ZRQA 3V3XA 3ECIA 4DDGD 3DBHB 3R7RA 4ZRJA 5J3QA 3KRWA 4WQMA 1YJ1A 3ML8A 4EZJA 3L4PA 3VHTC 5IOIA 2W2XC 1PGAA 1YN3A 4CO7A 1XO3A 3HVDA 3B1LX 5JVLA 1I4XA 2ZNVB 1TZOA 1WGUA 3M95A 3U2SC 2DWQA 2L0TA 3AV8A 5CTRC 3ZNID 3P2BA 3SUZA 1WGRA 1XKEA 3IVFA 3KRXA 1N5XA 3MPXA 2LUEA 3SV1A 2JZPA 1FM0D 2YEPB 4BKSA 2I1KA 1Q1OA 2WXOA 4DDID 1S1QB 2B3AA 1OQYA 3ZVRA 2ACZB 2QILA 1C77A 2DAFA 4P6VF 2BT6A 3ZRCA 5AZGA 2V3SA 2J7QB 3O65B 1UGJA 3ZVVA 3RNFC 2K0PA 3MDBC 4PS8A 2R61A 4L1RA 4LJOB 4BFRA 2O2VB 1ESFA 3BWUD 1RRBA 2KMAA 2WXHA 3PZDA 1TT5B 2KHWB 2M56B 1BXTA 5DHFB 1UWMA 3P1MA 4WJPA 4URKA 2FUG1 1OEYJ 3MC8A 1IGCA 1T6BX 2GBNA 2OJWA 1WE7A 2JRHA 3FKYA 3T3OA 4DX8A 4ZOHC 1D6EC 2NVUI 3WANA 1HB6A 2DZJA 1F2RC 1WXAA 1D4BA 1NI2A 3PRPB 3RYTA 1PLSA 4HAZB 1WYGA 3H1UA 2JQRB 3MJ5A 2MBEA 2WXKA 2V1YA 1JCKB 4TMAB 3APFA 1WF9A 2DNFA 3FLVA 1TJEA 3HM6X 1SXTA 3DHIC 4GDLB 4JKBA 2DYOA 2KUPA 3H7PB 4RM9A 4A6KA 4A90A 1FHOA 3ALBA 1E8WA 2OOBB 2Z59B 4E74A 2M38A 4OVUA 4FBJB 2DFKA 2Z14A 1P0RA 1E7UA 2BB5A 2D07B 1OEYA 5GMVA 3SEBA 3MP9A 1DDWA 3M62B 3TEXA 2N7EA 3TSSA 2BS2B 4MSQB 4M0WA 2PEAA 1RAXA 1DYNA 1LB1A 1YQ3B 3JSVA 2LVOA 2ADZA 5CHVC 1RYJA 4IWQA 3PO0A 2COPA 4JKEA 3UINB 3PVWA 4MK0A 4EE2A 4IOIE 1J8CA 4IUMB 2JZZA 1GPXA 3P42A 2ZJDA 2RR9A 3N1YC 2K1FA 5J18A 4XYCA 4NSWA 4ASWC 4F7GA 4QJ4B 2WHIA 2IPKD 1E7VA 1VDVA 2LOZA 4LNOA 4JKCA 2PJHA 4GGQA 2XNAC 4ZDVA 2IBIB 2DKQA 4FADA 3DBLI 2NBVB 1S3SG 1ET6A 5D6JB 2A5UA 1DOYA 5D3YA 2J53A 1W1GA 4NAMA 2BCJA 5DPSA 5MPOA 2CJNA 3QX1A 5D7GA 1V49A 1YJIA 2IO3B 2K8HA 2WS3B 3NRZA 1UNRA 3VAWA 1X1MA 1K50A 4DXFA 4DHZB 2IY0B 4W9IA 2YS5A 3KW5B 4L1BA 2I5FA 1TY0A 1SGHA 4P7IA 3IBEA 4ANWA 1PQSA 4LNFA 4WURA 1ZVRA 2EKEC 3I9V1 4P1CC 3H7SA 5DPWA 3Q6BA 3TVVA 1GG3A 2G4SA 1UBIA 2NBWB 4ANVA 1OQNA 1E5WA 1OY2A 4CSQA 2ZW0A 5DPRA 1DDMA 1MAIA 3RMKC 1I7AA 4ICUA 1V5PA 4QAYA 2AYOB 2RMMA 3I63C 3P6AA 2KDEB 1XX0A 4K17A 2CJOA 4WWOA 2AQ1B 2K49A 1J7AA 2CB8A 4ILGB 4MT7A 4DXGA 2K5PA 1I4QA 3CIKA 1Z87A 4KGSA 1ET9A 3E56A 4K81A 3RUIB 3PEGA 3B08A 2KMCA 3HIEA 3MFGA 2WXNA 1BTKA 2UVMA 1K8RB 1UELA 1WY8A 5DH9B 4NNJB 3UIPB 2N4FA 3DXEA 2OEDA 1K5DB 3Q8EA 1I35A 2JYEA 2WH5A 2X0SA 4JKFA 4ITKA 5FK9C 2PE6B 3TCAA 2D3GA 4C7ZA 2GCLA 3QWZB 1W1DA 1FNUA 3RNBC 3BVGA 3F0WA 2KDMA 3PVUA 1C4CA 3DBSA 4ARIA 2L00B 1ZDVA 2UZSA 2MBBB 1U5EA 3WAOA 3MC0B 1FXTB 2FCQA 2DHIA 4ZRPA 2PKOA 3WALA 1JQ4A 1P7EA 2ELAA 3SYXA 2WX1A 1NBFC 1PDXA 3T06A 1L6UA 4G50A 1L0XB 4M8NA 1V81A 2IY1B 3KH0A 3L17A 5D3XA 2V3PA 4BZAA 2KDIA 1QZEA 2INDC 2LUMA 3TJPA 4MJSA 3ZGZA 4K2PA 3SR6A 3A1QA 1ZUD2 4II2B 2OQBA 1YQBA 4NJ6A 1X86A 1BUIC 3LJ3A 4W9KA 1ZW7A 2KNBA 3PLVA 3P4RB 2Z0PA 2Y8FA 3QQ8B 3ZNHB 4NJ7A 2CS4A 1DROA 2LVQA 1BTNA 3ENBA 3IG3A 1SSNA 4MELA 3AU4A 2V4LA 3W5VB 4PK1A 2GS0A 2PIAA 4JK7A 1NYQA 4WJ7A 1WX7A 1UNQA 3AE2B 1Y56A 1YIWA 2Y7BA 1T0SC 2RDBC 2JZ3B 3RFZB 5E6NA 4MT5A 1TIFA 3NS1A 4TYZA 3QA8A 4K1RB 4FXCA 2MQJA 2D9YA 5J3TA 2HD5B 2K6DB 1MHHE 4WWPA 4B9KA 4MGZE 1EWCA 2KAJA 1FMAD 3AEFB 3NY5A 2K9XA 3SHQA 1Y19B 1BT0A 1RFAA 4HVBA 2IZVB 1KH0A 1N63A 4NZLB 2BWES 2DN6A 3RD2A 4IG7B 4A9AA 2LGDA 2K2JA 4GMXB 1DOIA 1P9DU 3FC4A 2X8XX 4M01A 5G55A 2JVCA 2R2OA 4L2YA 1ROEA 3ENEA 3QK0A 2ELBA 1V6EA 3VOQA 3TMPB 5AZFA 2L1AA 4NAWA 2LHEA 1L4ZB 2XK5A 3A9KA 4YXDB 1WIAA 3NVZA 3ML9A 1KTKA 3W1SC 4TUUA 4PQ0A 2MSED 2WXMA 2REXA 3HK0A 4HSIA 5BYRA 2UU7A 1SE2A 1AWDA 4JKGB 1KFYB 2KJRA 4WJQA 3RZWC 3U4EG 4WQOB 3KUCB 4DHJD 1YMHE 3BVZA 1JWAD 4C00A 3TL5A 4WSFA 2EMTA 5C1ZA 1P3RA 2KFKA 1DIKA 4D0NB 4ICVA 2JT4B 2KDBA 1V1PB 2R09A 3RI7C 5JXVA 2DYQA 2CRFA 2KMMA 2EJ8A 3U8ZA 3SBGA 5H8YE 3A8PA 2LRUA 3C0RB 2KR0A 2TSSA 1W1HA 3KWLA 2YT1A 1F52A 2EMSA 1WGHA 3LXFA 1FB8A 2K8BA 2VKIA 2V76A 1H10A 3CF6E 4KV2A 3DVNU 4C4VB 3BYTB 1WE6A 3AEAB 3PHXB 4W9LA 2MKRA 1ZM0A 2JWZA 2KT7A 4YONA 1ZOYB 3J9CA 2K6QA 4J3OD 4EMOA 2O6VA 2KX3A 4S0RA 3AU5A 1X11A 1D5ZC 1M4VA 1JDEA 1QQRA 4H2AA 4BBNF 1I42A 1HZ6A 4KKIA 2VH2A 2BB6A 4HLEA 1QQGA 3CSTA 4N58A 3R7QA 2VH1A 2CY4A 5DPTA 3IHPC 4YTNB 3B2GA 1ST7A 1K52A 3CSFA 3PPAA 4EEWA 2P0FA 4CHKA 2C7NB 2D9VA 2D5GA 3BK2A 5I2MA 1NI3A 1RWSA 3IXSA 4MY6A 3QIJA 1V2YA 4USAA 3NWFA 2R2QA 3NVWA 1CJEA 2JY6A 4HB4B 2KX0A 2WXIA 4IM3A 2D9XA 2AL3A 2PVGC 4MACA 3AE4B 3WAPA 1M7RA 4DHJB 1E8YA 2GUMA 1VRAB 1ACCA 2NMBA 4ANXA 1WZ0A 2KLCA 3A33B 3VDZA 1F1HA 2KLGA 3WCQA 2KO3A 3RCZA 3FVCA 2HJ1A 3KQ4A 3QJZA 4GXBA 5DHAB 3LB8C 4G11A 4B6HA 1C76A 2D9WA 3AEEB 5I4DA 2LEKA 2J52A 5CLLB 2PTLA 2PMVA 2KWUB 3ZNZB 3QHTA 1TQZA 2DYBA 1XODA 4RGOS 1JWBD 2MWNB 1V89A 5FR6A 2RPQA 1M7EA 3TW1A 3ZTCA 2Q5WD 1LM8B 4H8SA 2Z59A 5C79A 1WGYA 4HROA 4M02A 1OGWA 4W9HA 2PPHA 3AB5A 2QJLA 3ZNGC 2DHJA 2AQ3B 2BPSA 4I6LB 4AJWA 4A55A 4AJYB 2LBBA 4R3DA 1WFYA 1VJKA 1UH6A 2DYMA 3NZUA 4RH6A 1GB1A 3RNAC 4ILHA 1R4NI 1SE9A 2N9PC 2ZZPB 3VRAB 4AQ7A 3ONSA 3TBLD 2Z0DB 1T5XD 4HAYB 5E6PA 3NWDA 2CU3A 2MFQA 1E0ZA 3AH7A 3WIMA 3DHHC 2KN4A 2O6VD 2P8VA 3Q8FA 2KDFB 2BVCA 4IM0A 3W1YA 3HIZA 4ZRIA 3NZSA 2EC1A 3GZNI 5CX3A 2KC1A 2EKIA 1WGDA 2JRIB 1L0YB 1ZXHA 2D11A 5I2SA 2GB1A 4KIKB 3Q8BA 3IAS1 4JE3B 1VBGA 3PVLA 1AYFA 3BYYB 1YOVB 2BBCA 4GSWA 1TS2A 1LFDA 1MKEA 2DBYA 1KC7A 3RCPA 5G5GA 1HQRD 4XC2A 4HDQA 3AE9B 2KC2A 2KGXB 4ZHPA 3VH4B 2FJ9A 3B0AA 2CR5A 3N1XC 3SD5A 2MJEA 2YS1A 3L54A 2I38A 1D5XC 1A70A 1D3ZA 3ZYYX 2FBWB 4LDTB 4BKSD 1I4PA 4RM8A 2WXPA 3PT2B 4DXAB 1PGXA 1WR6E 3ODWA 2Y3AA 1KLUD 1PYWD 4WWNA 1KI1B 3DBHI 1DYQA 4XDCA 3ZO5B 1P3QU 2C9WB 3H6NA 1FNWA 4JWUC 5CHFA 5BO4B 5EE1A 3DXCA 4HPMB 1I4RA 4JIOU 2QEJC 2K39A 3NUHB 1N62A 3AE5B 1C3TA 2L2IA 2R82A 2KXJA 1L6VA 3OLMD 2CY5A 2R0DA 2QKLA 2ZCCA 1NDDA 2K25A 1SJHD 1FPYA 4HB0B 2KUQA 1TBEA 5J2RA 2L7RA 3X23A 4CHMA 1ENFA 2O6VB 4UDUC 1XLOA 3V5WA 1DOXA 1LXDA 3ZIMA 3SU8X 4FHJA 1QOFA 1V9JA 1R4NB 3DVNV 4MH0E 1WJ4A 2B76B 1XEEA 4TV3A 3V61A 4CYEA 1MIZB 1I7HA 1EUVB 1XCTL 4N9F4 2JPHA 3AJ4A 2MH7A 4C56C 1GB4A 1EM7A 1FOEA 2QSDA 1FCLA 3LJUX 1YX5B 2W3RA 1GUAB 5KQ4A 1WJ1A 2JSVX 3S2AA 4DBBA 2BWFA 1TS5A 3F5RA 4PS3A 4JKDA 2Y8GA 4BOZB 4KGRA 2MP2A 3RULA 3TEWA 2BF8B 5HE3A 1YJJA 3HQCA 1X1FA 2WNMA 4K2OA 5FR3A 4A3OA 3GE3C 1V5OA 2LJIA 1L5PA 4FLHA 2R2YA 1Z5SB 2KVRA 4ANUA 2CQUA 2MRPA 2BS4B 1HZ5A 4WJOA 3UI3A 4P1BC 3CXBB 1WZ3A 2N1VA 1F77A 1L7YA 2IO0B 2VSZA 2H89B 4FHKA 4RGTA 5C3JB 1AQCA 3ULBA 1F0ZA 4YT0B 4GDLA 3APCA 3RPFC 2ROVA 4NPNA 4HB2B 2H7EA 1SE3A 3A4SC 4KX6B 1J0GA 1QF6A 3EFCA 4E71A 4J6IA 2IYDB 3U7ZA 1E8ZA 2Z13A 2WXLA 3UZTA 2FJLA 3JVZX 2WDVB 2DA0A 5HHDG 2D3CA 2W2XD 2DIKA 3RNCC 2W54A 4W9EA 1WRIA 3HVZA 3ZQ4A 3TIXA 4YL8A 1BWNA 5HE0A 1HXYD 2N9KA 4WAAA 1STEA 3NVVA 2KANA 3I57A 3W5UB 5JHAA 1A5RA 1XXGA 5FI1A 1KLVA 3R2TA 1MG8A 2DENB 3T9LA 1FXAA 4P16A 4KHAA 3Q3OC 5AUIA 3EGRA 3N7CA 4NAWB 2K3UA 4EUTA 1PGBA 3BVMA 1VD2A 1ZP0B 2N1WA 4REZA 2INNE 3IT4B 2DZIA 2KQ7A 4GN1A 5BYSA 1U5FA 4PS7A 3V6CB 2NBUA 2BKRB 2HRJA 2LGYA 1E9MA 1P98A 1QT9A 1NYRA 2M1MA 2KKCA 2FDQA 2J4XA 5GXGB 1WJMA 3Q8CA 4W9CA 1YX6B 3AMZA 2L3ZA 2SEBD 3VUXA 4EJNA 3A9JA 4KGTA 1C4PA 4F7HA 1YD8U 3VXWA 3K9OB 2UWQA 2RDHA 2VZKB 1UNSA 1RM6C 5DIFB 2GOWA 4DX90 5IO9A 2MJ3A 4BAXA 2C5LC 2V4IB 4B95A 4CQNA 2BYVE 2W2WA 3ZTDA 4B6WA 3ZDMC 1TTNA 2A4ZA 2M14A 2W3SA 3H8HA 3Q3NC 1NENB
chains in the Genus database with same CATH topology
3PLUA 2FAZA 1WMHA 4FA6A 3RZFA 2E2XA 2J0MA 1U5DA 3UQAA 5L95C 2RSUA 3I3TB 2D10A 2UYZB 3P7ZA 4HK2A 3DBRI 1ZC3B 2RGNB 4IFSA 3PREA 2X18A 1WG7A 2KD0A 2DX5A 3PG7A 4FJVB 1MK7B 1Y5OA 2N23A 3R66C 4HAVB 2FCNA 2CODA 2ZEQA 3GYPA 3PS6A 2CAYA 4DK5A 4HAWB 1Y8RC 3CMMB 4PYUA 1NTVA 4GPTB 4HB3B 2FIDA 2M0XA 2YRYA 3FEHA 2MW5A 3VTWA 1T0YA 1BAKA 2RD0A 2N9EB 3ZKJC 2JF5A 4JKHA 1GNUA 5JHHA 3AULA 1WI0A 1XD4A 4IW0A 5EDSA 3VUYA 2DZMA 2W9NA 1WH3A 1WVHA 1EVHA 3D8EA 3PP2A 4GMVA 3UF8A 1KOTA 3V60A 1V5UA 4A5KA 1Z2MA 2BKFA 3MJWA 1VBHA 1RJ2A 1X1GA 1OMWA 1LW3A 1C1YB 2MBOA 5E6OA 4HDOA 4A6HA 2ZCBA 1MK9B 5AEKB 5JHBA 2HTHB 1PFJA 2QKMA 3OAWA 4KIKA 3IFWB 3EECA 4MEMA 3DQVA 1KBLA 2Z0OA 3PRMB 5AZHA 4E3CA 2ROZB 4BKTA 2J0KA 3X0WA 4MGKE 5L81A 2LGXA 2K00A 4KDIC 5JHGA 1WYWB 3DVGX 2LG1A 4DHZE 4F1SA 3DDCB 2ABDA 1Q5WB 4KVGB 2Z0QA 3A98B 1OTRB 4PNKA 4GOCA 1QC6A 4RMAA 5GOWB 3SNHA 3M3JA 3ZRFA 4NY0A 1G6JA 2ZVNA 4LCDE 3WAMA 5KHQA 2CHXA 4IM2A 1XT9B 5IAAC 3QBVB 2FCMA 1Q67A 4HCNB 4BVUC 2NR2A 5DI9B 4MSMB 4K7UA 2KQSA 5IA7A 3VH3B 4IAPA 1Q0WB 2GBMA 1WM3A 4EZKA 4GDKB 1V80A 2LASA 2G35A 1WR1A 5JLJB 2ZPYA 3SBTA 1ZSQA 3RT3B 4AUQC 2CHWA 1GC7A 4KHBB 2MDXA 2NPTA 1WX8A 4TQ0A 1WM2A 3GOEA 1WJ6A 3WYFB 1E8XA 4JGHB 4HATB 4A6FA 3MHSD 3HHMA 2AL6A 3KUZA 3V6EB 5IJMA 3ZUNA 4GB9A 4F8CB 3E66A 2WDTB 4K7SA 2CHZA 2RSGA 4G3XB 4MGYE 2GBRA 2IO1B 4MDKE 3FP5A 1MPHA 4CHJA 1WGQA 4EOYA 5KQ1A 1M94A 2J59M 1UZXB 1RRPB 1ZKHA 4JQWC 2I5CA 2MBQA 2DYNA 3QARA 5L83A 3BINA 5G2NA 3AI5A 3PHWB 4HCPB 2NCNA 1KJTA 3L10B 4JK9A 2NPTB 3QC8B 2KOXA 4HWIB 2AWTA 2KJHB 1JRUA 3L08A 2D2QA 2HJ8A 3K9PB 4A3PA 5EFXA 3PV1A 5CLQB 2Y5BB 1P6SA 2ASQA 2LI5A 3L16A 4I6PA 4HHVA 1WXSA 2KTFA 2ZVOA 2KJ6A 3H9DA 1KZGA 2DAJA 3A9KB 2WYQA 4KSLC 4LDTD 1FAOA 4FULA 2YS3A 3NOBA 3A8QA 3UIOB 2BGFA 3HM3A 5JH5C 3UQBA 4EKUA 2VRRB 2KN5A 3JYUA 1V88A 1TXDA 4F7UP 4G0NB 4KAXB 1DDVA 1TJ6A 2Z0EB 1WMHB 4ZRKA 4ILJA 1X05A 2KZRA 2DX1A 3NSUA 3QCAA 2DX5B 1V5MA 4AP4C 2WWZA 4JKGA 2FIFA 1WGGA 3ZDTA 4II3B 1FHWA 2CKHB 2M17A 3NS8A 2MX2A 5LXHA 2L0FA 3A9JB 4MJSB 4FJZA 2NS5A 3VFKA 1UNPA 1R4MI 2K8CA 1UD7A 3KUDB 2XBBC 3PRZA 3D8DA 1J0WA 2GBJA 4WVFB 5LOPB 2DHKA 3VTUA 1U5GA 5HE2A 1WJUA 4IC7B 4KZCA 4BOSC 1DBHA 4TQ1A 1IP9A 3PTFC 2PE9A 4OVVA 2ZPNA 4NQLB 3O96A 2YT0A 3E9PA 2IYBA 3TFMA 2L05A 1EO6A 4M0WB 2COAA 5LONB 5C5BA 1XCGA 2RQ1A 5C5BB 3EFUA 3ZW3A 3DOWA 3Q3FA 4HJKA 3D32A 2DTCA 4BBKA 4BKGA 1TZ1A 2MBHA 4HPLB 2RLOA 2UZRA 4NQKE 1B55A 3L13A 2MA9B 2G4DB 2COFA 2N9XA 5D3WA 4W9JA 2PZ1A 4IWOA 4JL9A 3D8FA 1ZGUB 2MLBA 4F7ZA 2GCJA 5FI0A 1SIFA 4DWFA 2KFKB 3SO6A 1HBKA 3LDZE 2HTHA 5D3VA 3TO1A 3PGEA 1GJZA 1PMSA 2KTRA 1MIXA 2YLMA 2G45B 1H8CA 3M63B 2LULA 2KTRB 2P0DA 2K2UA 5JZEB 3V62A 3OJ4B 3KVFB 3PSCA 3QAQA 1GGOA 1V5TA 1UPRA 5LXIB 2LRWA 1SHCA 3FSSA 3VTVA 3PSEB 3H7PA 3W1SA 1P1AA 3ODOA 3KZ1A 1NVLA 2YF0A 3U7DA 1WI1A 4GU2A 2YSZA 2Q13A 5D94A 2FUHB 3A1QB 2LKOA 3N3KB 4W9FA 2LVPA 2KWCA 2LD9A 2DZKA 4Y94A 2LZ6A 2N0YA 2RGFA 5C23A 2BYEA 5TR5A 1XR0B 4L6EA 4K7WA 5J3YA 3N32A 3VVWB 3T8MA 4ZYNA 3ULCA 2KFJA 2LYDA 3KSYA 2OTXA 1IYFA 4JLCA 2CU1A 2LJ5A 3ZLZA 1EF1A 2GBKA 1UBQA 3OANA 3NHEB 4GIVA 2KWVB 2FNJB 1UEFA 1HB8A 4MGIE 4KZ0A 2L1CA 3BJIA 3DPDA 1FGZA 4A6FB 2RUKB 2ZNVC 1I2HA 1FGYA 2H7DA 2DHZA 3SDLC 4JKAA 5HKHA 2JP2A 2JXXA 5KHOA 2YVCA 2GJYA 1UPQA 2KCJA 5J17A 3BY4B 3M1IB 1EF5A 1XD3B 4X57B 3A4RA 1RLFA 1U2BA 4HAXB 2C7HA 2LOXA 4M8MA 3DXDA 2NZ8B 3EHVA 4IOYX 2M4NA 3EC8A 1VCBA 2G3QB 1UGMA 1H4RA 1WRDB 1XQQA 2XK5B 5C16A 4XZ4A 1V86A 1U4AA 5D27A 5KCVA 2MCNB 5CHWA 2JUOA 3QWMA 1EAZA 1IPGA 2RVBB 1NTIA 4BBNC 4FJYA 1J19A 4KDLB 4JK8A 2DKPA 1NTYA 4EFOA 3G9WA 2J0JA 1V61A 4IWPA 2IFSA 2IO2B 1ACAA 2D9ZA 2N7DA 3MTNB 2DLWA 1WXVA 4GZUA 5HE1A 3KYCD 3AXCA 2LXAA 4HAUB 2L76A 3JW0X 1ISNA 3ODXA 2BYFA 2O2VA 1U29A 4KSKC 1AWEA 2MP2B 3Q3JA 4EZLA 5D2MB 2COCA 2LWPA 2C7MB 2C60A 5LLIA 1LQBA 4A20A 3WA0A 2RNRB 2AEHA 1K5GB 2HE7A 4XX5A 3JSVB 3OJ3A 5C6RA 4W9DA 1EGXA 3FM8C 5DCNA 2XQNM 1FHXA 1ZC4B 1IRSA 2VRWB 4MM3A 4WJNA 1KZ7A 4KHOA 1N3HA 2XEWA 3VUWA 2L8JA 4GDKA 1P5TA 3HW2B 1WX9A 1AARA 2GMIC 3ML4A 1WXMA 1GC6A 1F9JA 3U30A 4DBGA 3KY9A 3VQIA 2M8SA 2D4QA 1TGZB 1WJNA 2MWSB 2WX0A 4HXDA 1CMXB 3EPYA 3GYOA 4XWXA 4PYZA 3E9LA 3VIAA 3DCGA 4W9GA 4TKNA 2KK8A 5JP4A 3APDA 2LXCA 3DVGY 3N30A 4I6NB 1KM7A 2OJRA 3E9OA 2QHOA 3L0WB 2I1JA 1U27A 3R3MA 4C0AA 2P0HA 3KYDD 4FN2A 2FCSA 1L2NA 4AWJA 4Z2MB 4Z2NA 3UGBB 1NU2A 1E90A 4LJPB 1HE8A 4AOFA 3ECIA 4DDGD 3R7RA 4ZRJA 5J3QA 3KRWA 1YJ1A 3ML8A 4EZJA 3VHTC 2W2XC 4CO7A 3B1LX 5JVLA 2ZNVB 1WGUA 3M95A 3ZNID 2L0TA 5CTRC 3P2BA 3SUZA 1WGRA 1XKEA 3IVFA 3KRXA 3MPXA 2LUEA 3SV1A 4BKSA 2I1KA 1Q1OA 4DDID 1S1QB 2B3AA 1OQYA 3ZVRA 2DAFA 3ZRCA 5AZGA 2V3SA 2J7QB 3O65B 3ZVVA 3MDBC 4PS8A 4LJOB 4BFRA 2O2VB 1RRBA 2KMAA 3PZDA 2KHWB 5DHFB 4WJPA 4URKA 1OEYJ 2GBNA 1WE7A 2JRHA 4DX8A 2NVUI 3WANA 1HB6A 2DZJA 1WXAA 1NI2A 3PRPB 3RYTA 1PLSA 4HAZB 3H1UA 2MBEA 2V1YA 3APFA 1WF9A 3FLVA 3HM6X 4GDLB 4JKBA 2DYOA 2KUPA 3H7PB 4RM9A 4A6KA 1FHOA 3ALBA 1E8WA 2OOBB 2Z59B 4E74A 4FBJB 2M38A 4OVUA 2DFKA 1P0RA 1E7UA 2D07B 1OEYA 5GMVA 1DDWA 3M62B 2N7EA 4MSQB 2PEAA 1RAXA 1DYNA 1LB1A 3JSVA 2LVOA 2ADZA 5CHVC 4IWQA 3UINB 2COPA 4JKEA 3PVWA 4MK0A 1J8CA 4IUMB 2JZZA 2ZJDA 2RR9A 2K1FA 5J18A 4NSWA 4ASWC 4F7GA 1E7VA 2LOZA 4JKCA 2PJHA 4GGQA 4ZDVA 2IBIB 2DKQA 4FADA 3DBLI 2NBVB 1S3SG 5D6JB 2A5UA 5D3YA 1W1GA 2BCJA 5DPSA 3QX1A 5D7GA 1V49A 2IO3B 2K8HA 1UNRA 3VAWA 1X1MA 4DHZB 2IY0B 4W9IA 2YS5A 3KW5B 2I5FA 1SGHA 4P7IA 3IBEA 4ANWA 1PQSA 1ZVRA 2EKEC 3H7SA 5DPWA 3TVVA 1GG3A 2G4SA 1UBIA 2NBWB 4ANVA 1OQNA 1E5WA 1OY2A 5DPRA 1DDMA 1MAIA 1I7AA 4ICUA 1V5PA 2AYOB 3P6AA 2KDEB 1XX0A 4K17A 4WWOA 2CB8A 4ILGB 4MT7A 3CIKA 1Z87A 4K81A 3RUIB 3PEGA 3B08A 2KMCA 1BTKA 2UVMA 1K8RB 1UELA 1WY8A 5DH9B 4NNJB 3UIPB 2N4FA 3DXEA 1K5DB 1I35A 2WH5A 2X0SA 4JKFA 2PE6B 3TCAA 2D3GA 2GCLA 3QWZB 1W1DA 3F0WA 3PVUA 3DBSA 2L00B 2UZSA 2MBBB 1U5EA 3WAOA 1FXTB 2FCQA 2DHIA 3WALA 2ELAA 3SYXA 2WX1A 1NBFC 3T06A 4G50A 4M8NA 1V81A 2IY1B 3KH0A 3L17A 5D3XA 2KDIA 1QZEA 3TJPA 4MJSA 4K2PA 3A1QA 4II2B 2OQBA 1YQBA 4NJ6A 1X86A 3LJ3A 4W9KA 1ZW7A 2KNBA 3PLVA 3ZNHB 2Z0PA 2Y8FA 3QQ8B 4NJ7A 2CS4A 1DROA 2LVQA 1BTNA 3ENBA 3IG3A 4MELA 3AU4A 2V4LA 2GS0A 4JK7A 4WJ7A 1WX7A 1UNQA 1YIWA 2Y7BA 2JZ3B 5E6NA 4TYZA 3QA8A 4K1RB 2MQJA 2D9YA 5J3TA 2HD5B 2K6DB 4WWPA 4B9KA 4MGZE 3NY5A 3SHQA 1Y19B 1BT0A 1RFAA 4HVBA 2IZVB 2BWES 2DN6A 3RD2A 4IG7B 2LGDA 2K2JA 4GMXB 1P9DU 5G55A 2JVCA 2R2OA 3ENEA 3QK0A 2ELBA 1V6EA 3VOQA 3TMPB 5AZFA 4NAWA 2XK5A 3A9KA 1WIAA 3ML9A 3W1SC 4TUUA 4PQ0A 2MSED 2REXA 3HK0A 4JKGB 2KJRA 4WJQA 3RZWC 4WQOB 3KUCB 4DHJD 3TL5A 4WSFA 2EMTA 5C1ZA 1P3RA 1DIKA 2KFKA 4D0NB 4ICVA 2JT4B 2KDBA 2R09A 2DYQA 2CRFA 2EJ8A 3U8ZA 3SBGA 3A8PA 2LRUA 3C0RB 1W1HA 2YT1A 2EMSA 1WGHA 1FB8A 2K8BA 2VKIA 2V76A 1H10A 3CF6E 4KV2A 3DVNU 4W9LA 1WE6A 3PHXB 2MKRA 1ZM0A 2JWZA 4YONA 2K6QA 4EMOA 2O6VA 2KX3A 3AU5A 1X11A 1I42A 4BBNF 1JDEA 4HLEA 1QQGA 3CSTA 3R7QA 2CY4A 5DPTA 3IHPC 1ST7A 3CSFA 3PPAA 4EEWA 2P0FA 4CHKA 2C7NB 2D9VA 4MY6A 3QIJA 1V2YA 2R2QA 2JY6A 4HB4B 2KX0A 4IM3A 2D9XA 2AL3A 3WAPA 1M7RA 4DHJB 1E8YA 2NMBA 4ANXA 1WZ0A 2KLCA 3A33B 3VDZA 2KLGA 2KO3A 3RCZA 3QJZA 4GXBA 5DHAB 4G11A 4B6HA 2D9WA 5CLLB 2KWUB 3ZNZB 3QHTA 1TQZA 2DYBA 1XODA 2MWNB 1V89A 5FR6A 2RPQA 1M7EA 3TW1A 3ZTCA 1LM8B 4H8SA 5C79A 1WGYA 1OGWA 4W9HA 2PPHA 3ZNGC 2DHJA 2BPSA 4I6LB 4AJWA 4AJYB 2LBBA 1WFYA 1UH6A 2DYMA 3NZUA 4ILHA 1R4NI 1SE9A 2N9PC 2ZZPB 3ONSA 3TBLD 2Z0DB 4HAYB 5E6PA 2MFQA 3WIMA 2O6VD 2P8VA 2KDFB 4IM0A 3W1YA 3HIZA 4ZRIA 3NZSA 2EC1A 3GZNI 5CX3A 2KC1A 1WGDA 2JRIB 2D11A 4KIKB 1VBGA 3PVLA 4GSWA 1LFDA 1MKEA 1KC7A 3RCPA 4XC2A 4HDQA 2KC2A 2KGXB 3VH4B 2FJ9A 3B0AA 2CR5A 3SD5A 2YS1A 3L54A 1D3ZA 4LDTB 4BKSD 4RM8A 3PT2B 4DXAB 1WR6E 3ODWA 4WWNA 1KI1B 3DBHI 3ZO5B 1P3QU 2C9WB 3H6NA 5CHFA 5BO4B 3DXCA 4HPMB 4JIOU 2K39A 1C3TA 2L2IA 2R82A 2KXJA 3OLMD 2CY5A 2R0DA 2QKLA 2ZCCA 1NDDA 2K25A 4HB0B 1TBEA 5J2RA 2L7RA 3X23A 4CHMA 2O6VB 3V5WA 1LXDA 3ZIMA 3SU8X 4FHJA 1V9JA 3DVNV 4MH0E 1WJ4A 4TV3A 3V61A 4CYEA 1MIZB 1EUVB 4N9F4 2JPHA 3AJ4A 1FOEA 3LJUX 1YX5B 1GUAB 5KQ4A 1WJ1A 3S2AA 4DBBA 2BWFA 3F5RA 4PS3A 4JKDA 2Y8GA 4BOZB 2MP2A 3RULA 2BF8B 5HE3A 3HQCA 1X1FA 4K2OA 4A3OA 1V5OA 4FLHA 1Z5SB 2KVRA 4ANUA 2CQUA 2MRPA 4WJOA 3CXBB 1WZ3A 2N1VA 1L7YA 2IO0B 2VSZA 4FHKA 1AQCA 3ULBA 4GDLA 3APCA 2ROVA 4NPNA 4HB2B 2H7EA 3A4SC 1J0GA 4E71A 4J6IA 2IYDB 1E8ZA 3UZTA 2FJLA 3JVZX 2DA0A 2W2XD 2DIKA 4W9EA 3TIXA 4YL8A 1BWNA 5HE0A 4WAAA 2KANA 5JHAA 1A5RA 5FI1A 1KLVA 1MG8A 2DENB 3T9LA 4KHAA 3N7CA 4NAWB 4EUTA 1VD2A 2N1WA 2DZIA 2KQ7A 4GN1A 1U5FA 4PS7A 3V6CB 2NBUA 2BKRB 2HRJA 2LGYA 1P98A 2M1MA 2KKCA 2FDQA 1WJMA 4W9CA 1YX6B 2L3ZA 3VUXA 4EJNA 3A9JA 4F7HA 1YD8U 3VXWA 3K9OB 2UWQA 5DIFB 2GOWA 4DX90 2C5LC 4B95A 2BYVE 2W2WA 3ZTDA 4B6WA 3ZDMC 1TTNA 2A4ZA 2M14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX0 A;  4HXD A;  1CMX B;  3KUD B;  3PLU A;  2FAZ A;  3EPY A;  3GYO A;  1WMH A;  2XBB C;  4FA6 A;  4XWX A;  4PYZ A;  4DDI D;  2KJR A;  4WJQ A;  3RZW C;  4WQO B;  3VIA A;  3KUC B;  3DCG A;  4DHJ D;  4W9G A;  3TL5 A;  3PRZ A;  3D8D A;  4TKN A;  4WSF A;  2EMT A;  5JP4 A;  2KK8 A;  2LXC A;  3AUL A;  3APD A;  3DVG Y;  3RZF A;  5C1Z A;  1P3R A;  2E2X A;  2J0M A;  1U5D A;  2KFK A;  4D0N B;  1KM7 A;  3N30 A;  4I6N B;  1J0W A;  2JT4 B;  2GBJ A;  4WVF B;  2R09 A;  5LOP B;  2KDB A;  2OJR A;  2DHK A;  2RSU A;  5L95 C;  3VTU A;  3I3T B;  2DYQ A;  1U5G A;  5HE2 A;  1WJU A;  2D10 A;  2CRF A;  2QHO A;  1DBH A;  2EJ8 A;  3L0W B;  4IC7 B;  2I1J A;  4TQ1 A;  4BOS C;  3U8Z A;  2UYZ B;  3A8P A;  2LRU A;  3C0R B;  1U27 A;  3R3M A;  1W1H A;  1IP9 A;  3P7Z A;  4C0A A;  3PTF C;  2YT1 A;  5LXH A;  2EMS A;  2PE9 A;  1WGH A;  2P0H A;  4HK2 A;  4OVV A;  2ZPN A;  3DBR I;  3KYD D;  1FB8 A;  4NQL B;  3O96 A;  2V76 A;  1H10 A;  2VKI A;  2K8B A;  2FCS A;  3CF6 E;  4FN2 A;  1ZC3 B;  2YT0 A;  3DVN U;  4KV2 A;  1WE6 A;  4W9L A;  4Z2M B;  3PHX B;  4AWJ A;  1L2N A;  4Z2N A;  2IYB A;  2RGN B;  1ZM0 A;  1NU2 A;  2MKR A;  2JWZ A;  4YON A;  3UIN B;  3TFM A;  2K6Q A;  3UGB B;  4IFS A;  1E90 A;  4EMO A;  3PRE A;  2X18 A;  2O6V A;  2KX3 A;  4LJP B;  1HE8 A;  4AOF A;  1WG7 A;  2KD0 A;  3AU5 A;  1X11 A;  1EO6 A;  2L05 A;  4BBN F;  1I42 A;  4M0W B;  2DX5 A;  4FBJ B;  3PG7 A;  4FJV B;  1MK7 B;  2COA A;  5LON B;  5C5B A;  1XCG A;  3ECI A;  4DDG D;  4HLE A;  1QQG A;  3CST A;  1Y5O A;  4ZRJ A;  3R7R A;  3R7Q A;  5J3Q A;  2N23 A;  3KRW A;  3R66 C;  2RQ1 A;  4HAV B;  5C5B B;  2CY4 A;  1YJ1 A;  2FCN A;  3ML8 A;  5DPT A;  4EZJ A;  3EFU A;  2COD A;  3IHP C;  2ZEQ A;  2W2X C;  3VHT C;  3ZW3 A;  3DOW A;  1ST7 A;  3GYP A;  3Q3F A;  3CSF A;  4CO7 A;  3PPA A;  4EEW A;  2P0F A;  4HJK A;  3PS6 A;  4CHK A;  3D32 A;  2C7N B;  2DTC A;  2D9V A;  2CAY A;  3B1L X;  4BBK A;  4DK5 A;  4HAW B;  1Y8R C;  3CMM B;  4PYU A;  4MY6 A;  1NTV A;  2ZNV B;  3QIJ A;  1WGU A;  3M95 A;  1V2Y A;  4GPT B;  3ZNI D;  2L0T A;  5CTR C;  4BKG A;  1TZ1 A;  2R2Q A;  3P2B A;  3SUZ A;  1WGR A;  1XKE A;  3IVF A;  3KRX A;  4HB3 B;  2FID A;  2MBH A;  2JY6 A;  2M0X A;  2YRY A;  3FEH A;  3MPX A;  4HB4 B;  2MW5 A;  1T0Y A;  3SV1 A;  1BAK A;  2LUE A;  2RD0 A;  3VTW A;  4HPL B;  2RLO A;  2UZR A;  4NQK E;  2N9E B;  1B55 A;  3ZKJ C;  4BKS A;  2I1K A;  2JF5 A;  2KX0 A;  2D9X A;  1Q1O A;  1GNU A;  5JHH A;  2AL3 A;  3L13 A;  4IM3 A;  2MA9 B;  3WAP A;  1M7R A;  1S1Q B;  1OQY A;  3ZVR A;  2B3A A;  2DAF A;  1E8Y A;  1WI0 A;  2COF A;  2G4D B;  2N9X A;  2NMB A;  5D3W A;  1WZ0 A;  2KLC A;  2PZ1 A;  3A33 B;  2V3S A;  4IWO A;  4W9J A;  5AZG A;  3VDZ A;  4JL9 A;  3ZDM C;  2J7Q B;  2KLG A;  3D8F A;  3O65 B;  1XD4 A;  2KO3 A;  3RCZ A;  1ZGU B;  4IW0 A;  3ZVV A;  3MDB C;  4PS8 A;  5EDS A;  2MLB A;  4LJO B;  3VUY A;  4BFR A;  4F7Z A;  2O2V B;  3QJZ A;  2GCJ A;  5FI0 A;  1SIF A;  4GXB A;  2DZM A;  2W9N A;  4DWF A;  5DHA B;  2KFK B;  3SO6 A;  1WH3 A;  1RRB A;  1WVH A;  1HBK A;  2KMA A;  4G11 A;  4B6H A;  3PZD A;  3LDZ E;  1EVH A;  2D9W A;  3D8E A;  3PP2 A;  2HTH A;  2KHW B;  4GMV A;  5D3V A;  3UF8 A;  5DHF B;  3TO1 A;  3PGE A;  1KOT A;  4WJP A;  5CLL B;  1GJZ A;  1PMS A;  2KWU B;  4URK A;  2KTR A;  1MIX A;  3ZNZ B;  2YLM A;  4ANX A;  3V60 A;  3QHT A;  1TQZ A;  2G45 B;  1V5U A;  4A5K A;  1OEY J;  3M63 B;  2LUL A;  2DYB A;  1H8C A;  3SHQ A;  2GBN A;  2KTR B;  2P0D A;  2K2U A;  1XOD A;  5JZE B;  1Z2M A;  3V62 A;  2MWN B;  1WE7 A;  2BKF A;  3OJ4 B;  2JRH A;  3MJW A;  1V89 A;  5FR6 A;  2RPQ A;  1M7E A;  3TW1 A;  4DX8 A;  3ZTC A;  1LM8 B;  1RJ2 A;  4H8S A;  5C79 A;  1WGY A;  2NVU I;  3KVF B;  3WAN A;  1HB6 A;  2DZJ A;  3ZIM A;  1X1G A;  1OMW A;  1OGW A;  4W9H A;  1LW3 A;  1WXA A;  1C1Y B;  2MBO A;  2PPH A;  3ZNG C;  2DHJ A;  5E6O A;  1NI2 A;  3PSC A;  5E6P A;  4HDO A;  3PRP B;  4A6H A;  2ZCB A;  2BPS A;  3RYT A;  1MK9 B;  1PLS A;  4I6L B;  5AEK B;  4HAZ B;  4AJW A;  4AJY B;  3QAQ A;  2LBB A;  5JHB A;  2HTH B;  1WFY A;  1PFJ A;  2QKM A;  1UH6 A;  1V5T A;  3H1U A;  3OAW A;  2DYM A;  1UPR A;  3NZU A;  4KIK A;  3IFW B;  2MBE A;  5LXI B;  2LRW A;  1SHC A;  2V1Y A;  3FSS A;  3VTV A;  3EEC A;  1R4N I;  3PSE B;  3APF A;  1WF9 A;  3H7P A;  1P1A A;  4MEM A;  3W1S A;  3FLV A;  1SE9 A;  2N9P C;  2ZZP B;  2Z0O A;  3DQV A;  3HM6 X;  3PRM B;  4GDL B;  3ODO A;  5DCN A;  5AZH A;  2DYO A;  4RM9 A;  2KUP A;  3H7P B;  3KZ1 A;  4A6K A;  4DHJ B;  4E3C A;  1FHO A;  2ROZ B;  3ALB A;  4BKT A;  2J0K A;  1E8W A;  1NVL A;  2OOB B;  2Z0D B;  3ONS A;  3TBL D;  3X0W A;  2YF0 A;  2Z59 B;  4MGK E;  4E74 A;  4HAY B;  3U7D A;  2M38 A;  3OLM D;  4OVU A;  2DFK A;  2MFQ A;  5L81 A;  2LGX A;  1P0R A;  1E7U A;  1WI1 A;  3WIM A;  2K00 A;  2YSZ A;  4GU2 A;  4KDI C;  5JHG A;  2P8V A;  2O6V D;  2D07 B;  1OEY A;  5GMV A;  1WYW B;  2KDF B;  3DVG X;  2Q13 A;  1DDW A;  2LG1 A;  2FUH B;  3M62 B;  4IM0 A;  5D94 A;  3HIZ A;  3W1Y A;  2N7E A;  4DHZ E;  4F1S A;  4ZRI A;  3NZS A;  4MSQ B;  2PEA A;  3A1Q B;  2EC1 A;  3GZN I;  5CX3 A;  2LKO A;  3DDC B;  2ABD A;  1Q5W B;  2KC1 A;  3N3K B;  4W9F A;  1WGD A;  2LVP A;  4KVG B;  2JRI B;  1RAX A;  2KWC A;  2Z0Q A;  1DYN A;  1LB1 A;  3A98 B;  2LD9 A;  1OTR B;  2D11 A;  3JSV A;  2DZK A;  2LVO A;  4ICV A;  2ADZ A;  5CHV C;  4PNK A;  4IWQ A;  4KIK B;  2COP A;  4Y94 A;  1QC6 A;  4GOC A;  2LZ6 A;  4RMA A;  3PVW A;  2N0Y A;  4MK0 A;  2RGF A;  5C23 A;  2BYE A;  1J8C A;  4IUM B;  2JZZ A;  2ZJD A;  2RR9 A;  3PVL A;  5TR5 A;  1XR0 B;  5GOW B;  2K1F A;  3SNH A;  5J18 A;  4GSW A;  4NSW A;  4ASW C;  1LFD A;  3M3J A;  4F7G A;  1MKE A;  3ZRF A;  4L6E A;  3RCP A;  4NY0 A;  4K7W A;  1E7V A;  5J3Y A;  3N32 A;  4XC2 A;  2LOZ A;  3VVW B;  4HDQ A;  2PJH A;  2KC2 A;  4GGQ A;  3T8M A;  1G6J A;  2KGX B;  2ZVN A;  3VH4 B;  4ZDV A;  2FJ9 A;  4LCD E;  4ZYN A;  3ULC A;  2DKQ A;  2LYD A;  2IBI B;  2KFJ A;  4FAD A;  3B0A A;  2CR5 A;  3DBL I;  3SD5 A;  3WAM A;  3KSY A;  2NBV B;  2OTX A;  2YS1 A;  1S3S G;  3L54 A;  1IYF A;  5D6J B;  1D3Z A;  2A5U A;  3ZRC A;  5D3Y A;  5KHQ A;  1W1G A;  4LDT B;  2CHX A;  4IM2 A;  4JLC A;  2CU1 A;  4BKS D;  2LJ5 A;  3ZLZ A;  2BCJ A;  4RM8 A;  5DPS A;  3PT2 B;  4DXA B;  1WR6 E;  3QX1 A;  3ODW A;  1EF1 A;  1XT9 B;  5D7G A;  2GBK A;  1UBQ A;  3OAN A;  1V49 A;  5IAA C;  3QBV B;  2FCM A;  3NHE B;  1Q67 A;  1KI1 B;  2IO3 B;  2K8H A;  3DBH I;  4GIV A;  4HCN B;  4WWN A;  3ZO5 B;  4BVU C;  1P3Q U;  1UNR A;  2C9W B;  2KWV B;  1X1M A;  3H6N A;  2FNJ B;  3VAW A;  4DHZ B;  5CHF A;  5BO4 B;  1UEF A;  2IY0 B;  2NR2 A;  4W9I A;  2YS5 A;  3KW5 B;  5DI9 B;  2I5F A;  4MSM B;  3DXC A;  1HB8 A;  4HPM B;  1SGH A;  2KQS A;  4JIO U;  4P7I A;  4K7U A;  2L1C A;  4KZ0 A;  4MGI E;  2K39 A;  5IA7 A;  3BJI A;  3DPD A;  1FGZ A;  3IBE A;  1C3T A;  2L2I A;  4A6F B;  4ANW A;  2RUK B;  3VH3 B;  1PQS A;  2KXJ A;  4IAP A;  1ZVR A;  1Q0W B;  2GBM A;  2ZNV C;  2CY5 A;  2R0D A;  1I2H A;  2QKL A;  2EKE C;  1WM3 A;  2ZCC A;  3H7S A;  4EZK A;  1FGY A;  1NDD A;  2K25 A;  5DPW A;  2H7D A;  4HB0 B;  4GDK B;  3TVV A;  1TBE A;  2DHZ A;  1GG3 A;  2L7R A;  3X23 A;  5J2R A;  3SDL C;  1V80 A;  2G4S A;  2JP2 A;  5HKH A;  2LAS A;  1UBI A;  4CHM A;  2NBW B;  2JXX A;  2O6V B;  5KHO A;  2G35 A;  2YVC A;  4ANV A;  3V5W A;  1OQN A;  1E5W A;  1WR1 A;  1LXD A;  1OY2 A;  5JLJ B;  2ZPY A;  3SU8 X;  2GJY A;  4FHJ A;  1ZSQ A;  1UPQ A;  5DPR A;  1DDM A;  1V9J A;  3DVN V;  3RT3 B;  2KCJ A;  4MH0 E;  1WJ4 A;  1MAI A;  4AUQ C;  2CHW A;  1I7A A;  3BY4 B;  4ICU A;  4TV3 A;  3V61 A;  5J17 A;  4CYE A;  1V5P A;  1GC7 A;  1MIZ B;  4KHB B;  2AYO B;  2MDX A;  3M1I B;  1EF5 A;  1XD3 B;  2NPT A;  4X57 B;  3P6A A;  1RLF A;  3A4R A;  1WX8 A;  1EUV B;  2KDE B;  1U2B A;  4N9F 4;  1XX0 A;  4K17 A;  2JPH A;  4TQ0 A;  4HAX B;  1WM2 A;  2C7H A;  3GOE A;  4WWO A;  3AJ4 A;  2LOX A;  1WJ6 A;  1FOE A;  3WYF B;  1E8X A;  4JGH B;  4HAT B;  4A6F A;  2CB8 A;  3LJU X;  3MHS D;  3DXD A;  4M8M A;  3HHM A;  2AL6 A;  4MT7 A;  1YX5 B;  3KUZ A;  5IJM A;  2NZ8 B;  3V6E B;  3ZUN A;  4GB9 A;  4F8C B;  2WDT B;  3EHV A;  1GUA B;  5KQ4 A;  1WJ1 A;  3CIK A;  1Z87 A;  4IOY X;  2CHZ A;  4K7S A;  3S2A A;  2RSG A;  4G3X B;  2M4N A;  3VQI A;  4DBB A;  2BWF A;  3EC8 A;  4MGY E;  4K81 A;  3F5R A;  2GBR A;  4PS3 A;  3RUI B;  2IO1 B;  3PEG A;  4MDK E;  3B08 A;  2KMC A;  2Y8G A;  1VCB A;  4KZC A;  2G3Q B;  3FP5 A;  4BOZ B;  1BTK A;  1MPH A;  2UVM A;  1WGQ A;  4CHJ A;  1K8R B;  1UEL A;  1UGM A;  2MP2 A;  1WY8 A;  3RUL A;  5DH9 B;  1H4R A;  4NNJ B;  1WRD B;  3UIP B;  4EOY A;  5KQ1 A;  1M94 A;  3DXE A;  2J59 M;  1XQQ A;  2N4F A;  2XK5 B;  2BF8 B;  1UZX B;  5HE3 A;  1RRP B;  3HQC A;  1K5D B;  1X1F A;  5C16 A;  1ZKH A;  4JQW C;  4XZ4 A;  1V86 A;  4K2O A;  1I35 A;  2WH5 A;  2I5C A;  2MBQ A;  1U4A A;  5D27 A;  5KCV A;  2DYN A;  2MCN B;  4A3O A;  3QAR A;  1V5O A;  2PE6 B;  3TCA A;  2D3G A;  4FLH A;  5L83 A;  2GCL A;  1Z5S B;  3BIN A;  2KVR A;  5CHW A;  3AI5 A;  5G2N A;  2CQU A;  2MRP A;  3PHW B;  2NCN A;  3QWZ B;  4HCP B;  4ANU A;  1W1D A;  1KJT A;  3L10 B;  4WJO A;  2NPT B;  2JUO A;  3F0W A;  3QC8 B;  3PVU A;  2KOX A;  3CXB B;  3DBS A;  1WZ3 A;  3QWM A;  2N1V A;  4HWI B;  1EAZ A;  1IPG A;  2AWT A;  2KJH B;  2RVB B;  1JRU A;  3L08 A;  1NTI A;  2L00 B;  4BBN C;  1L7Y A;  2UZS A;  2IO0 B;  4FJY A;  2VSZ A;  2D2Q A;  1J19 A;  2HJ8 A;  4FHK A;  2MBB B;  1U5E A;  4KDL B;  3WAO A;  3K9P B;  1FXT B;  2FCQ A;  1AQC A;  2DKP A;  2DHI A;  4A3P A;  3ULB A;  5EFX A;  3PV1 A;  3WAL A;  4GDL A;  3APC A;  1NTY A;  2ELA A;  3SYX A;  5CLQ B;  1NBF C;  2WX1 A;  2ROV A;  2Y5B B;  1P6S A;  3T06 A;  4NPN A;  4EFO A;  4G50 A;  3G9W A;  2ASQ A;  2J0J A;  4HB2 B;  2H7E A;  1V61 A;  4M8N A;  2LI5 A;  1V81 A;  3L16 A;  2IFS A;  4IWP A;  2IY1 B;  3A4S C;  3KH0 A;  4I6P A;  4HHV A;  5D3X A;  1WXS A;  1ACA A;  2D9Z A;  2IO2 B;  2KTF A;  2KDI A;  2ZVO A;  3L17 A;  1J0G A;  1QZE A;  2N7D A;  3MTN B;  2KJ6 A;  3TJP A;  2DLW A;  4E71 A;  3H9D A;  4J6I A;  2IYD B;  4MJS A;  1E8Z A;  1KZG A;  2DAJ A;  1WXV A;  4K2P A;  4GZU A;  3A1Q A;  5HE1 A;  3UZT A;  4II2 B;  2OQB A;  3A9K B;  2WYQ A;  1YQB A;  4NJ6 A;  3KYC D;  3ZNH B;  2FJL A;  3AXC A;  1X86 A;  3JVZ X;  4KSL C;  3LJ3 A;  1FAO A;  2DA0 A;  4LDT D;  4W9K A;  1ZW7 A;  2LXA A;  2KNB A;  3PLV A;  4FUL A;  2YS3 A;  2Z0P A;  2Y8F A;  3NOB A;  3QQ8 B;  3A8Q A;  2CS4 A;  1DRO A;  2LVQ A;  4NJ7 A;  2W2X D;  1BTN A;  4HAU B;  2L76 A;  3UIO B;  3IG3 A;  3JW0 X;  4MEL A;  3AU4 A;  2V4L A;  1ISN A;  2BGF A;  4W9E A;  3ODX A;  2BYF A;  2GS0 A;  3TIX A;  2O2V A;  4YL8 A;  1BWN A;  1U29 A;  5HE0 A;  4KSK C;  1AWE A;  3HM3 A;  2MP2 B;  3Q3J A;  4WJ7 A;  1WX7 A;  1UNQ A;  4WAA A;  4EZL A;  5JH5 C;  3UQB A;  2KAN A;  5D2M B;  2COC A;  1YIW A;  5JHA A;  4EKU A;  2LWP A;  2VRR B;  2Y7B A;  1A5R A;  2C7M B;  2KN5 A;  2C60 A;  5FI1 A;  2JZ3 B;  3JYU A;  1KLV A;  5LLI A;  5E6N A;  1LQB A;  1MG8 A;  4A20 A;  4TYZ A;  2DEN B;  3WA0 A;  2RNR B;  3QA8 A;  3T9L A;  1V88 A;  1TXD A;  4F7U P;  2AEH A;  1K5G B;  4KHA A;  4K1R B;  2K8C A;  2MQJ A;  2D9Y A;  5J3T A;  2HD5 B;  4KAX B;  1DDV A;  3N7C A;  4G0N B;  1TJ6 A;  2K6D B;  4NAW B;  4EUT A;  2HE7 A;  2Z0E B;  4WWP A;  4B9K A;  4XX5 A;  3JSV B;  3OJ3 A;  5C6R A;  1VD2 A;  4ZRK A;  1WMH B;  1X05 A;  2KZR A;  2N1W A;  4MGZ E;  4W9D A;  1EGX A;  3NY5 A;  3FM8 C;  2DX1 A;  3NSU A;  2DZI A;  4GN1 A;  2DX5 B;  1U5F A;  2XQN M;  2KQ7 A;  3QCA A;  4PS7 A;  1FHX A;  2NBU A;  1Y19 B;  1V5M A;  2HRJ A;  1BT0 A;  2BKR B;  1RFA A;  2LGY A;  1P98 A;  4HVB A;  4AP4 C;  2IZV B;  2WWZ A;  1ZC4 B;  1IRS A;  2FIF A;  1WGG A;  3ZDT A;  2M1M A;  2BWE S;  2KKC A;  2DN6 A;  2VRW B;  4IG7 B;  3RD2 A;  2FDQ A;  1WJM A;  4W9C A;  2LGD A;  2K2J A;  1YX6 B;  4MM3 A;  4GMX B;  1P9D U;  2L3Z A;  3V6C B;  4WJN A;  3VUX A;  4EJN A;  3A9J A;  4II3 B;  1KZ7 A;  5G55 A;  2JVC A;  2R2O A;  4KHO A;  1FHW A;  1N3H A;  4F7H A;  2XEW A;  3VUW A;  2CKH B;  2L8J A;  1YD8 U;  2M17 A;  3NS8 A;  3K9O B;  2UWQ A;  2MX2 A;  2L0F A;  3A9J B;  3ENE A;  4GDK A;  3VXW A;  1P5T A;  3HW2 B;  1WX9 A;  3QK0 A;  1AAR A;  4MJS B;  3UQA A;  2ELB A;  3ML4 A;  1V6E A;  2GMI C;  1WXM A;  4FJZ A;  1GC6 A;  3VOQ A;  3TMP B;  5AZF A;  5DIF B;  4NAW A;  2GOW A;  4DX9 0;  2XK5 A;  3A9K A;  1WIA A;  2C5L C;  3ML9 A;  4B95 A;  1F9J A;  3W1S C;  2NS5 A;  4TUU A;  4PQ0 A;  3VFK A;  2MSE D;  2BYV E;  2W2W A;  3U30 A;  4DBG A;  3ZTD A;  4B6W A;  3KY9 A;  2M8S A;  1UNP A;  2D4Q A;  1R4M I;  1TGZ B;  1TTN A;  3HK0 A;  2M14 A;  1WJN A;  1UD7 A;  2A4Z A;  2REX A;  2MWS B; 
#chains in the Genus database with same CATH topology
 3PLU A;  2FAZ A;  1WMH A;  4RFB A;  4FA6 A;  2KYW A;  4OZB A;  4OSN A;  1OQR A;  2QMT A;  3RZF A;  2XN9 C;  2E2X A;  2J0M A;  1U5D A;  3UQA A;  5L95 C;  2RSU A;  5D3I B;  3I3T B;  4A6Q A;  2D10 A;  5H92 C;  4L23 A;  3GE8 C;  1XLP A;  2UYZ B;  3AEC B;  3P7Z A;  1GOZ A;  3AE3 B;  4HK2 A;  3ZXR A;  3DBR I;  2IGH A;  5EE3 A;  4JX1 C;  1ZC3 B;  3B9J A;  2OHF A;  2RGN B;  1XLN A;  4YWG G;  4IFS A;  3PRE A;  2X18 A;  1WG7 A;  2KD0 A;  4XGA B;  2DX5 A;  3PG7 A;  4FJV B;  1MK7 B;  1OQQ A;  1WXQ A;  1Y5O A;  1MG4 A;  2N23 A;  1QOB A;  3R66 C;  4HAV B;  2FCN A;  4KKJ A;  2COD A;  2ZEQ A;  2KQ4 X;  3GYP A;  4DIX A;  3URY A;  1R7S A;  3PS6 A;  5E6J A;  2CAY A;  4DK5 A;  1MI0 A;  4HAW B;  1Y8R C;  3CMM B;  4PYU A;  1NTV A;  4GPT B;  1GAQ B;  4HB3 B;  2FID A;  2M0X A;  2YRY A;  3FEH A;  2MW5 A;  3NZ3 A;  1T0Y A;  1BAK A;  2RD0 A;  3VTW A;  3KWV A;  2N9E B;  3R2I A;  2NBV A;  4YSY B;  2JF5 A;  3ZKJ C;  4JKH A;  1GNU A;  5JHH A;  2BW2 A;  3AUL A;  1WI0 A;  1V97 A;  2LMC A;  4XWW A;  1CK1 A;  4OZC A;  1XD4 A;  4IW0 A;  1FXI A;  2RDG A;  5EDS A;  3VUY A;  2DZM A;  2W9N A;  1WH3 A;  2NMQ A;  1WVH A;  5M4Y B;  2WGS A;  1EVH A;  3D8E A;  3PP2 A;  4GMV A;  2FE8 A;  3RNG C;  3UF8 A;  3DCX A;  5BMG A;  1KOT A;  4HKZ E;  2E6X A;  3V60 A;  2YT2 A;  1V5U A;  4A5K A;  1Z2M A;  2BKF A;  1JWS D;  3GZN B;  3MJW A;  1VBH A;  1RJ2 A;  4YSZ B;  1X1G A;  1OMW A;  3CIR B;  1LW3 A;  1C1Y B;  2MBO A;  5E6O A;  2KAC A;  4HDO A;  3OWE B;  4A6H A;  2ZCB A;  1MK9 B;  5AEK B;  5JHB A;  2HTH B;  1PFJ A;  2QKM A;  2W55 A;  3OAW A;  4KIK A;  3IFW B;  2BS3 B;  3EEC A;  4YTP B;  4QJ5 B;  4MEM A;  2ONQ A;  3DQV A;  1KBL A;  2Z0O A;  2KIE A;  3PRM B;  3O13 A;  5AZH A;  3ETR A;  4E3C A;  1JWU D;  2ROZ B;  4NJC A;  4BKT A;  2J0K A;  3X0W A;  1FIQ A;  4MGK E;  5L81 A;  2LGX A;  2K00 A;  4KDI C;  5JHG A;  5IRS A;  1NEK B;  2INP E;  1WYW B;  3DVG X;  2LG1 A;  3ZJV A;  4DHZ E;  4F1S A;  2I2Y A;  3DDC B;  2ABD A;  1Q5W B;  4KVG B;  2Z0Q A;  3A98 B;  1OTR B;  1L0V B;  2N0S B;  1FEH A;  4PNK A;  4GOC A;  1QC6 A;  4RMA A;  1V1O A;  4OHJ A;  4LNI A;  1JAL A;  3FIL B;  3B2F A;  2Z4D A;  1SB3 C;  5GOW B;  2LGS A;  3SNH A;  2MEK A;  3M3J A;  3ZRF A;  4NY0 A;  2VZK D;  2HDE A;  4LLG M;  4DQO C;  1XLQ A;  1G6J A;  2ZVN A;  3P4Q B;  4LCD E;  1KRH A;  1WSP A;  3WAM A;  1VLB A;  5KHQ A;  2CHX A;  3OHM B;  4IM2 A;  5BMI A;  1XT9 B;  2JU6 X;  5IAA C;  3QBV B;  2FCM A;  2KIG A;  1Q67 A;  4HCN B;  3DBL B;  4BVU C;  4YSX B;  4K3B A;  2NR2 A;  3TEZ A;  5DI9 B;  4MSM B;  4K7U A;  5BMH A;  2KQS A;  1FFV A;  1JML A;  5IA7 A;  3VH3 B;  5LNK 1;  4IAP A;  1Q0W B;  2GBM A;  2V3N A;  1WM3 A;  4EZK A;  4RGM A;  1ZPS A;  4GDK B;  2WXR A;  1V80 A;  2LAS A;  2G35 A;  1WR1 A;  3V05 A;  5JLJ B;  2ZPY A;  3SBT A;  1ZSQ A;  2INC C;  3RT3 B;  5IP4 D;  4AUQ C;  2CHW A;  2JXT A;  1GC7 A;  4KHB B;  2MDX A;  2NPT A;  4RNA A;  1WX8 A;  4QJ3 B;  2K22 A;  3N9Y C;  4KHB A;  4TQ0 A;  1WM2 A;  3DBR B;  3GOE A;  1WJ6 A;  3WYF B;  1E8X A;  4JGH B;  4HAT B;  4A6F A;  3MHS D;  3Q2A C;  3HHM A;  2AL6 A;  3KUZ A;  3V6E B;  5IJM A;  3Q3M C;  3ZUN A;  4GB9 A;  4F8C B;  3E66 A;  2WDT B;  4K7S A;  2CHZ A;  1R4M B;  1FD6 A;  2RSG A;  4G3X B;  1SJE D;  4MGY E;  2GBR A;  1N5W A;  2IO1 B;  4MDK E;  1FRD A;  1YN5 A;  3FP5 A;  5IKC M;  1MPH A;  4CHJ A;  1WGQ A;  2WQY B;  4EOY A;  5KQ1 A;  1M94 A;  2J59 M;  1UZX B;  1RRP B;  1ZKH A;  4JQW C;  2NTS A;  3SFD B;  2I5C A;  2MBQ A;  2DYN A;  4Q2J A;  3QAR A;  5L83 A;  3C8Y A;  3BIN A;  5G2N A;  3AI5 A;  3PHW B;  4HCP B;  2NCN A;  1KJT A;  1V8C A;  3L10 B;  4JK9 A;  2IJ0 A;  2NPT B;  2AX5 A;  3QC8 B;  2KOX A;  4HWI B;  2AWT A;  2KJH B;  1JRU A;  3L08 A;  3B77 A;  2D2Q A;  2HJ8 A;  1F2R I;  2AQ2 B;  3K9P B;  4A3P A;  1FFU A;  5EFX A;  3PV1 A;  1E6E B;  2L52 A;  4HKQ A;  3P4P B;  5CLQ B;  1CZP A;  2Y5B B;  1P6S A;  1VR9 A;  2ASQ A;  4C7Y A;  2LI5 A;  3L16 A;  4I6P A;  4HHV A;  1WXS A;  1T0Q C;  4GNK B;  2KTF A;  2ZVO A;  4RF0 A;  2KJ6 A;  3H9D A;  5TSS A;  1KZG A;  2DAJ A;  3A9K B;  2WYQ A;  3HSA A;  4KSL C;  4LDT D;  1FAO A;  4FUL A;  2YS3 A;  3NOB A;  1QIL A;  5AUK A;  3A8Q A;  3UIO B;  2SAK A;  2WU5 B;  3VR8 B;  4WWM A;  3HRD D;  2BGF A;  4IDI A;  2JYT A;  1UWX A;  1K53 A;  1ZDX A;  3HM3 A;  5JH5 C;  3C19 A;  2J42 A;  3UQB A;  1MI1 A;  4EKU A;  1WWT A;  2VRR B;  2E3T A;  2KN5 A;  4HPP A;  3JYU A;  3PZ8 A;  2PW9 A;  1V88 A;  1TXD A;  4F7U P;  2JX5 A;  4G0N B;  4KAX B;  1DDV A;  4K3C A;  1TJ6 A;  2Z0E B;  1WMH B;  5HFY A;  4ZRK A;  4ILJ A;  1X05 A;  2KZR A;  1SF0 A;  1VZ8 A;  4ZHO A;  2WDQ B;  2DX1 A;  3NSU A;  1N60 A;  1QKZ A;  2DX5 B;  3QCA A;  4LNK A;  1V5M A;  4AP4 C;  4N59 A;  2WWZ A;  4MM3 B;  4JKG A;  2FIF A;  1WGG A;  3ZDT A;  2Y5P A;  1LO5 D;  1C4A A;  1D5M C;  1ZYI A;  2HTM E;  4TSS A;  4II3 B;  1FHW A;  2CKH B;  2M17 A;  3NS8 A;  1KLG D;  1J7C A;  2G9H D;  2MX2 A;  2L0F A;  3A9J B;  3MHZ A;  5LXH A;  3ZJT A;  4MJS B;  4FJZ A;  3MC9 A;  2NS5 A;  3VFK A;  4HRS A;  4YTM B;  4RF1 A;  1UNP A;  1R4M I;  2EEL A;  2K8C A;  1UD7 A;  1T0R C;  2WXQ A;  3KUD B;  2XBB C;  1YNT E;  1HA5 A;  2NTT A;  1PUT A;  3DWM A;  2DLB A;  1TKE A;  3PRZ A;  1AN8 A;  3D8D A;  1J0W A;  2GBJ A;  4WVF B;  5LOP B;  2DHK A;  4GLS C;  3VTU A;  1FNV A;  1U5G A;  5HE2 A;  1WJU A;  4IC7 B;  2LFI A;  2LHD A;  1DBH A;  4KZC A;  4TQ1 A;  4BOS C;  1MFW A;  1K51 A;  2QDF A;  1IP9 A;  3PTF C;  3U52 E;  2PE9 A;  1JRP A;  2PVO D;  4OVV A;  2ZPN A;  4NQL B;  3O96 A;  1P7F A;  2YT0 A;  3E9P A;  2IYB A;  3TFM A;  4D6W A;  4HEA 1;  2L05 A;  1J7B A;  1EO6 A;  3PZ7 A;  1XF5 L;  3DWG C;  4M0W B;  4OZA A;  2COA A;  4GOU A;  5LON B;  5C5B A;  1XCG A;  1E7P B;  2RRF A;  2W82 A;  2RQ1 A;  5C5B B;  1JW9 D;  1ZXI A;  3EFU A;  2WXG A;  3ZW3 A;  3DOW A;  3Q3F A;  4HJK A;  3D32 A;  1E10 A;  4MH8 A;  2DTC A;  3BK1 A;  4BBK A;  5FKA C;  4AS1 A;  1N61 A;  4BKG A;  1TZ1 A;  1MJD A;  2H88 B;  2MBH A;  2WXF A;  1IUE A;  4HPL B;  2RLO A;  2UZR A;  4NQK E;  5HI1 A;  1B55 A;  3AED B;  3AEG B;  4ARC A;  3L13 A;  2MA9 B;  2G4D B;  1UF0 A;  2QC8 A;  2N9X A;  2COF A;  5D3W A;  4W9J A;  2PZ1 A;  4IWO A;  1IBX B;  4JL9 A;  3IT6 B;  3D8F A;  1ZGU B;  1Q10 A;  2BTE A;  1AW7 A;  2MLB A;  4D2K A;  3DHG C;  4F7Z A;  3Q14 C;  1TKY A;  2GCJ A;  5FI0 A;  1SIF A;  4DWF A;  2KFK B;  2WLB A;  3SO6 A;  1HBK A;  4HJG E;  2L83 A;  3IAM 1;  2WDR B;  1TYG B;  3LDZ E;  2HTH A;  5D3V A;  3NWA A;  3TO1 A;  3PGE A;  1GJZ A;  3U12 A;  1PMS A;  2WP9 B;  5EE9 A;  1SIJ A;  2KTR A;  1MIX A;  2YLM A;  1SBB B;  2G45 B;  1H8C A;  3GP7 A;  3M63 B;  2LUL A;  2KTR B;  2IGD A;  2P0D A;  2K2U A;  5JZE B;  3V62 A;  2QCZ A;  3OJ4 B;  2KWD A;  3RN9 C;  3KVF B;  4C80 A;  3HUI A;  2G1E A;  3PSC A;  3VR9 B;  1TS4 A;  3QAQ A;  5LG4 B;  1GGO A;  2KVZ A;  1V5T A;  1UPR A;  5LXI B;  2LRW A;  4QXA B;  1SHC A;  3FSS A;  3VTV A;  1EU4 A;  3PSE B;  3LYY A;  3H7P A;  3W1S A;  1P1A A;  3FIL A;  1EWY C;  3ODO A;  2N7J A;  1VZ7 A;  3KZ1 A;  1BML C;  1NVL A;  2YF0 A;  3U7D A;  1WI1 A;  4GU2 A;  2YSZ A;  2BQQ A;  2D3A A;  3ZJU A;  2GRI A;  2Q13 A;  2WXJ A;  2ZKM X;  2FUH B;  5D94 A;  4A8X C;  4ZYS A;  1L4D B;  3A1Q B;  1NVI D;  2LKO A;  3N3K B;  4W9F A;  2LVP A;  2KWC A;  4OT1 A;  3I5J C;  2LD9 A;  2DZK A;  4US8 A;  4OVZ A;  3RNE C;  4Y94 A;  1B9R A;  2LZ6 A;  2N0Y A;  2RGF A;  5C23 A;  3AE1 B;  2BYE A;  5TR5 A;  4OW0 A;  1XR0 B;  5D3D A;  3P4S B;  4L6E A;  3P63 A;  4K7W A;  1B1Z A;  5J3Y A;  3N32 A;  3VVW B;  2YEP F;  3T8M A;  3GB1 A;  4ZYN A;  1T77 A;  3ULC A;  2KFJ A;  2LYD A;  3TEY A;  3TUO A;  3KSY A;  2OTX A;  1VZ6 A;  3EUB 2;  1IYF A;  2Z8L A;  1C79 A;  1TKG A;  2CU1 A;  4JLC A;  2LJ5 A;  3ZLZ A;  4B0M A;  1EF1 A;  2GBK A;  1UBQ A;  3OAN A;  3NHE B;  4GIV A;  3ABV B;  2KWV B;  4O1N A;  2FNJ B;  4S17 A;  1UEF A;  1JRO A;  1HB8 A;  4MGI E;  2QIE B;  4KZ0 A;  2L1C A;  3BJI A;  3DPD A;  1FGZ A;  3SFE B;  4A6F B;  2RUK B;  4US9 A;  2ZNV C;  1I2H A;  3Q69 A;  1FGY A;  4LNN A;  2H7D A;  2DHZ A;  5C2T B;  3SDL C;  4JKA A;  5HKH A;  2JP2 A;  1MVK A;  1WGK A;  2JXX A;  5KHO A;  2YVC A;  2D3B A;  2GJY A;  1UPQ A;  2KCJ A;  3N20 C;  5J17 A;  3BY4 B;  5EE0 A;  1IBX A;  1HTO A;  3M1I B;  1HEZ E;  1EF5 A;  1XD3 B;  3GS2 A;  4X57 B;  3A4R A;  1RLF A;  1U2B A;  4HAX B;  1SE4 A;  2C7H A;  1OFF A;  2LOX A;  1T3Q A;  4M8M A;  1KF6 B;  3DXD A;  3R8B A;  2NZ8 B;  3W2D A;  3AEB B;  3EHV A;  5T8I A;  4IOY X;  3E9S A;  2M19 A;  3AM9 A;  3KLS X;  2M4N A;  1C9F A;  3EC8 A;  3AE7 B;  1FRR A;  1CQV A;  3OG5 A;  1QLB B;  1VCB A;  2G3Q B;  2K8E A;  3ZXV A;  1UGM A;  1H4R A;  1WRD B;  1XQQ A;  2XK5 B;  5C16 A;  4XZ4 A;  1HTQ A;  1V86 A;  1U4A A;  4XDD A;  5D27 A;  5KCV A;  2MCN B;  5CHW A;  4XE0 A;  2JUO A;  3AE6 B;  3QWM A;  4RCO A;  1EAZ A;  1IPG A;  2RVB B;  1NTI A;  4BBN C;  2V9H A;  4FJY A;  1UUP A;  1J19 A;  4KDL B;  4JK8 A;  2DKP A;  2MJD A;  2N9L A;  1V1P A;  4N6E B;  1NTY A;  4EFO A;  3G9W A;  2J0J A;  1V61 A;  4IWP A;  2IFS A;  1LGR A;  2IO2 B;  1ACA A;  2D9Z A;  2N7D A;  3MTN B;  2DLW A;  2GLS A;  1WXV A;  4GZU A;  2JWU A;  5HE1 A;  1JWM D;  1QOA A;  3KYC D;  3AXC A;  3Q8A A;  4WIP A;  2LXA A;  4HAU B;  2L76 A;  2RPV A;  3JW0 X;  2GI9 A;  2M0A A;  3BZD B;  1ISN A;  3ODX A;  1YQ4 B;  1I4H A;  4JWS C;  2BYF A;  2O2V A;  1TY2 A;  1U29 A;  4KSK C;  1AWE A;  2MP2 B;  3Q3J A;  4EZL A;  3T3N A;  5D2M B;  2COC A;  1MPE A;  2LWP A;  2X38 A;  2C7M B;  4XWT A;  2C60 A;  3EA6 A;  5LLI A;  2ZW1 A;  1LQB A;  4A20 A;  3WA0 A;  2RNR B;  2AEH A;  1K5G B;  3FAH A;  1IGD A;  2HE7 A;  2ICI A;  4XX5 A;  3JSV B;  3OJ3 A;  5C6R A;  4IKG A;  3BII D;  2PLP A;  4W9D A;  2WU2 B;  1EGX A;  4M00 A;  3AE8 B;  3FM8 C;  5DCN A;  2XQN M;  1FHX A;  3N1Z C;  1ZC4 B;  1IRS A;  2VRW B;  3NG0 A;  2MHJ A;  1DGJ A;  4MM3 A;  2L32 A;  2BYT A;  4WJN A;  1KZ7 A;  4KHO A;  4RGN A;  5BYQ A;  1N3H A;  2XEW A;  1C78 A;  3VUW A;  2L8J A;  4GDK A;  1P5T A;  3HW2 B;  1WX9 A;  1AAR A;  2GMI C;  3ML4 A;  3AN1 A;  1WXM A;  1GC6 A;  2FJU B;  1EU3 A;  1F9J A;  2ON8 A;  5G5H A;  3U30 A;  4DBG A;  2Y5C A;  3KY9 A;  2M8S A;  3VQI A;  2D4Q A;  1TGZ B;  1WJN A;  5HG2 A;  2MWS B;  1QOG A;  2WX0 A;  4HXD A;  1CMX B;  1MHX A;  3EPY A;  3GYO A;  2IGG A;  3NVY A;  4XWX A;  4PYZ A;  1TS3 A;  3NW8 A;  3W9C B;  3E9L A;  1FCC C;  3VIA A;  3DCG A;  4ACF A;  4W9G A;  4TKN A;  2KK8 A;  5JP4 A;  3APD A;  2LXC A;  3DVG Y;  1YN4 A;  2IDY A;  2V0G A;  3N30 A;  4I6N B;  3A58 A;  1KM7 A;  1ZE3 D;  2OJR A;  3CWI A;  1SEB D;  1PFD A;  4JPS A;  3E9O A;  2QHO A;  3L0W B;  4LTU A;  1FO4 A;  4B0E A;  2I1J A;  4WH4 A;  5IN7 A;  1N6Z A;  1U27 A;  3R3M A;  4C0A A;  2P0H A;  4LK0 M;  4C4V A;  3NJT A;  2LGI A;  3KYD D;  4WAF A;  4FN2 A;  1I4G A;  2FCS A;  1L2N A;  4AWJ A;  4Z2M B;  4Z2N A;  3UGB B;  1NU2 A;  1RFK A;  1E90 A;  3VRB B;  4LJP B;  1HE8 A;  4AOF A;  4PT5 A;  1XCQ L;  4ZRQ A;  3V3X A;  3ECI A;  4DDG D;  3DBH B;  3R7R A;  4ZRJ A;  5J3Q A;  3KRW A;  4WQM A;  1YJ1 A;  3ML8 A;  4EZJ A;  3L4P A;  3VHT C;  5IOI A;  2W2X C;  1PGA A;  1YN3 A;  4CO7 A;  1XO3 A;  3HVD A;  3B1L X;  5JVL A;  1I4X A;  2ZNV B;  1TZO A;  1WGU A;  3M95 A;  3U2S C;  2DWQ A;  2L0T A;  3AV8 A;  5CTR C;  3ZNI D;  3P2B A;  3SUZ A;  1WGR A;  1XKE A;  3IVF A;  3KRX A;  1N5X A;  3MPX A;  2LUE A;  3SV1 A;  2JZP A;  1FM0 D;  2YEP B;  4BKS A;  2I1K A;  1Q1O A;  2WXO A;  4DDI D;  1S1Q B;  2B3A A;  1OQY A;  3ZVR A;  2ACZ B;  2QIL A;  1C77 A;  2DAF A;  4P6V F;  2BT6 A;  3ZRC A;  5AZG A;  2V3S A;  2J7Q B;  3O65 B;  1UGJ A;  3ZVV A;  3RNF C;  2K0P A;  3MDB C;  4PS8 A;  2R61 A;  4L1R A;  4LJO B;  4BFR A;  2O2V B;  1ESF A;  3BWU D;  1RRB A;  2KMA A;  2WXH A;  3PZD A;  1TT5 B;  2KHW B;  2M56 B;  1BXT A;  5DHF B;  1UWM A;  3P1M A;  4WJP A;  4URK A;  2FUG 1;  1OEY J;  3MC8 A;  1IGC A;  1T6B X;  2GBN A;  2OJW A;  1WE7 A;  2JRH A;  3FKY A;  3T3O A;  4DX8 A;  4ZOH C;  1D6E C;  2NVU I;  3WAN A;  1HB6 A;  2DZJ A;  1F2R C;  1WXA A;  1D4B A;  1NI2 A;  3PRP B;  3RYT A;  1PLS A;  4HAZ B;  1WYG A;  3H1U A;  2JQR B;  3MJ5 A;  2MBE A;  2WXK A;  2V1Y A;  1JCK B;  4TMA B;  3APF A;  1WF9 A;  2DNF A;  3FLV A;  1TJE A;  3HM6 X;  1SXT A;  3DHI C;  4GDL B;  4JKB A;  2DYO A;  2KUP A;  3H7P B;  4RM9 A;  4A6K A;  4A90 A;  1FHO A;  3ALB A;  1E8W A;  2OOB B;  2Z59 B;  4E74 A;  2M38 A;  4OVU A;  4FBJ B;  2DFK A;  2Z14 A;  1P0R A;  1E7U A;  2BB5 A;  2D07 B;  1OEY A;  5GMV A;  3SEB A;  3MP9 A;  1DDW A;  3M62 B;  3TEX A;  2N7E A;  3TSS A;  2BS2 B;  4MSQ B;  4M0W A;  2PEA A;  1RAX A;  1DYN A;  1LB1 A;  1YQ3 B;  3JSV A;  2LVO A;  2ADZ A;  5CHV C;  1RYJ A;  4IWQ A;  3PO0 A;  2COP A;  4JKE A;  3UIN B;  3PVW A;  4MK0 A;  4EE2 A;  4IOI E;  1J8C A;  4IUM B;  2JZZ A;  1GPX A;  3P42 A;  2ZJD A;  2RR9 A;  3N1Y C;  2K1F A;  5J18 A;  4XYC A;  4NSW A;  4ASW C;  4F7G A;  4QJ4 B;  2WHI A;  2IPK D;  1E7V A;  1VDV A;  2LOZ A;  4LNO A;  4JKC A;  2PJH A;  4GGQ A;  2XNA C;  4ZDV A;  2IBI B;  2DKQ A;  4FAD A;  3DBL I;  2NBV B;  1S3S G;  1ET6 A;  5D6J B;  2A5U A;  1DOY A;  5D3Y A;  2J53 A;  1W1G A;  4NAM A;  2BCJ A;  5DPS A;  5MPO A;  2CJN A;  3QX1 A;  5D7G A;  1V49 A;  1YJI A;  2IO3 B;  2K8H A;  2WS3 B;  3NRZ A;  1UNR A;  3VAW A;  1X1M A;  1K50 A;  4DXF A;  4DHZ B;  2IY0 B;  4W9I A;  2YS5 A;  3KW5 B;  4L1B A;  2I5F A;  1TY0 A;  1SGH A;  4P7I A;  3IBE A;  4ANW A;  1PQS A;  4LNF A;  4WUR A;  1ZVR A;  2EKE C;  3I9V 1;  4P1C C;  3H7S A;  5DPW A;  3Q6B A;  3TVV A;  1GG3 A;  2G4S A;  1UBI A;  2NBW B;  4ANV A;  1OQN A;  1E5W A;  1OY2 A;  4CSQ A;  2ZW0 A;  5DPR A;  1DDM A;  1MAI A;  3RMK C;  1I7A A;  4ICU A;  1V5P A;  4QAY A;  2AYO B;  2RMM A;  3I63 C;  3P6A A;  2KDE B;  1XX0 A;  4K17 A;  2CJO A;  4WWO A;  2AQ1 B;  2K49 A;  1J7A A;  2CB8 A;  4ILG B;  4MT7 A;  4DXG A;  2K5P A;  1I4Q A;  3CIK A;  1Z87 A;  4KGS A;  1ET9 A;  3E56 A;  4K81 A;  3RUI B;  3PEG A;  3B08 A;  2KMC A;  3HIE A;  3MFG A;  2WXN A;  1BTK A;  2UVM A;  1K8R B;  1UEL A;  1WY8 A;  5DH9 B;  4NNJ B;  3UIP B;  2N4F A;  3DXE A;  2OED A;  1K5D B;  3Q8E A;  1I35 A;  2JYE A;  2WH5 A;  2X0S A;  4JKF A;  4ITK A;  5FK9 C;  2PE6 B;  3TCA A;  2D3G A;  4C7Z A;  2GCL A;  3QWZ B;  1W1D A;  1FNU A;  3RNB C;  3BVG A;  3F0W A;  2KDM A;  3PVU A;  1C4C A;  3DBS A;  4ARI A;  2L00 B;  1ZDV A;  2UZS A;  2MBB B;  1U5E A;  3WAO A;  3MC0 B;  1FXT B;  2FCQ A;  2DHI A;  4ZRP A;  2PKO A;  3WAL A;  1JQ4 A;  1P7E A;  2ELA A;  3SYX A;  2WX1 A;  1NBF C;  1PDX A;  3T06 A;  1L6U A;  4G50 A;  1L0X B;  4M8N A;  1V81 A;  2IY1 B;  3KH0 A;  3L17 A;  5D3X A;  2V3P A;  4BZA A;  2KDI A;  1QZE A;  2IND C;  2LUM A;  3TJP A;  4MJS A;  3ZGZ A;  4K2P A;  3SR6 A;  3A1Q A;  1ZUD 2;  4II2 B;  2OQB A;  1YQB A;  4NJ6 A;  1X86 A;  1BUI C;  3LJ3 A;  4W9K A;  1ZW7 A;  2KNB A;  3PLV A;  3P4R B;  2Z0P A;  2Y8F A;  3QQ8 B;  3ZNH B;  4NJ7 A;  2CS4 A;  1DRO A;  2LVQ A;  1BTN A;  3ENB A;  3IG3 A;  1SSN A;  4MEL A;  3AU4 A;  2V4L A;  3W5V B;  4PK1 A;  2GS0 A;  2PIA A;  4JK7 A;  1NYQ A;  4WJ7 A;  1WX7 A;  1UNQ A;  3AE2 B;  1Y56 A;  1YIW A;  2Y7B A;  1T0S C;  2RDB C;  2JZ3 B;  3RFZ B;  5E6N A;  4MT5 A;  1TIF A;  3NS1 A;  4TYZ A;  3QA8 A;  4K1R B;  4FXC A;  2MQJ A;  2D9Y A;  5J3T A;  2HD5 B;  2K6D B;  1MHH E;  4WWP A;  4B9K A;  4MGZ E;  1EWC A;  2KAJ A;  1FMA D;  3AEF B;  3NY5 A;  2K9X A;  3SHQ A;  1Y19 B;  1BT0 A;  1RFA A;  4HVB A;  2IZV B;  1KH0 A;  1N63 A;  4NZL B;  2BWE S;  2DN6 A;  3RD2 A;  4IG7 B;  4A9A A;  2LGD A;  2K2J A;  4GMX B;  1DOI A;  1P9D U;  3FC4 A;  2X8X X;  4M01 A;  5G55 A;  2JVC A;  2R2O A;  4L2Y A;  1ROE A;  3ENE A;  3QK0 A;  2ELB A;  1V6E A;  3VOQ A;  3TMP B;  5AZF A;  2L1A A;  4NAW A;  2LHE A;  1L4Z B;  2XK5 A;  3A9K A;  4YXD B;  1WIA A;  3NVZ A;  3ML9 A;  1KTK A;  3W1S C;  4TUU A;  4PQ0 A;  2MSE D;  2WXM A;  2REX A;  3HK0 A;  4HSI A;  5BYR A;  2UU7 A;  1SE2 A;  1AWD A;  4JKG B;  1KFY B;  2KJR A;  4WJQ A;  3RZW C;  3U4E G;  4WQO B;  3KUC B;  4DHJ D;  1YMH E;  3BVZ A;  1JWA D;  4C00 A;  3TL5 A;  4WSF A;  2EMT A;  5C1Z A;  1P3R A;  2KFK A;  1DIK A;  4D0N B;  4ICV A;  2JT4 B;  2KDB A;  1V1P B;  2R09 A;  3RI7 C;  5JXV A;  2DYQ A;  2CRF A;  2KMM A;  2EJ8 A;  3U8Z A;  3SBG A;  5H8Y E;  3A8P A;  2LRU A;  3C0R B;  2KR0 A;  2TSS A;  1W1H A;  3KWL A;  2YT1 A;  1F52 A;  2EMS A;  1WGH A;  3LXF A;  1FB8 A;  2K8B A;  2VKI A;  2V76 A;  1H10 A;  3CF6 E;  4KV2 A;  3DVN U;  4C4V B;  3BYT B;  1WE6 A;  3AEA B;  3PHX B;  4W9L A;  2MKR A;  1ZM0 A;  2JWZ A;  2KT7 A;  4YON A;  1ZOY B;  3J9C A;  2K6Q A;  4J3O D;  4EMO A;  2O6V A;  2KX3 A;  4S0R A;  3AU5 A;  1X11 A;  1D5Z C;  1M4V A;  1JDE A;  1QQR A;  4H2A A;  4BBN F;  1I42 A;  1HZ6 A;  4KKI A;  2VH2 A;  2BB6 A;  4HLE A;  1QQG A;  3CST A;  4N58 A;  3R7Q A;  2VH1 A;  2CY4 A;  5DPT A;  3IHP C;  4YTN B;  3B2G A;  1ST7 A;  1K52 A;  3CSF A;  3PPA A;  4EEW A;  2P0F A;  4CHK A;  2C7N B;  2D9V A;  2D5G A;  3BK2 A;  5I2M A;  1NI3 A;  1RWS A;  3IXS A;  4MY6 A;  3QIJ A;  1V2Y A;  4USA A;  3NWF A;  2R2Q A;  3NVW A;  1CJE A;  2JY6 A;  4HB4 B;  2KX0 A;  2WXI A;  4IM3 A;  2D9X A;  2AL3 A;  2PVG C;  4MAC A;  3AE4 B;  3WAP A;  1M7R A;  4DHJ B;  1E8Y A;  2GUM A;  1VRA B;  1ACC A;  2NMB A;  4ANX A;  1WZ0 A;  2KLC A;  3A33 B;  3VDZ A;  1F1H A;  2KLG A;  3WCQ A;  2KO3 A;  3RCZ A;  3FVC A;  2HJ1 A;  3KQ4 A;  3QJZ A;  4GXB A;  5DHA B;  3LB8 C;  4G11 A;  4B6H A;  1C76 A;  2D9W A;  3AEE B;  5I4D A;  2LEK A;  2J52 A;  5CLL B;  2PTL A;  2PMV A;  2KWU B;  3ZNZ B;  3QHT A;  1TQZ A;  2DYB A;  1XOD A;  4RGO S;  1JWB D;  2MWN B;  1V89 A;  5FR6 A;  2RPQ A;  1M7E A;  3TW1 A;  3ZTC A;  2Q5W D;  1LM8 B;  4H8S A;  2Z59 A;  5C79 A;  1WGY A;  4HRO A;  4M02 A;  1OGW A;  4W9H A;  2PPH A;  3AB5 A;  2QJL A;  3ZNG C;  2DHJ A;  2AQ3 B;  2BPS A;  4I6L B;  4AJW A;  4A55 A;  4AJY B;  2LBB A;  4R3D A;  1WFY A;  1VJK A;  1UH6 A;  2DYM A;  3NZU A;  4RH6 A;  1GB1 A;  3RNA C;  4ILH A;  1R4N I;  1SE9 A;  2N9P C;  2ZZP B;  3VRA B;  4AQ7 A;  3ONS A;  3TBL D;  2Z0D B;  1T5X D;  4HAY B;  5E6P A;  3NWD A;  2CU3 A;  2MFQ A;  1E0Z A;  3AH7 A;  3WIM A;  3DHH C;  2KN4 A;  2O6V D;  2P8V A;  3Q8F A;  2KDF B;  2BVC A;  4IM0 A;  3W1Y A;  3HIZ A;  4ZRI A;  3NZS A;  2EC1 A;  3GZN I;  5CX3 A;  2KC1 A;  2EKI A;  1WGD A;  2JRI B;  1L0Y B;  1ZXH A;  2D11 A;  5I2S A;  2GB1 A;  4KIK B;  3Q8B A;  3IAS 1;  4JE3 B;  1VBG A;  3PVL A;  1AYF A;  3BYY B;  1YOV B;  2BBC A;  4GSW A;  1TS2 A;  1LFD A;  1MKE A;  2DBY A;  1KC7 A;  3RCP A;  5G5G A;  1HQR D;  4XC2 A;  4HDQ A;  3AE9 B;  2KC2 A;  2KGX B;  4ZHP A;  3VH4 B;  2FJ9 A;  3B0A A;  2CR5 A;  3N1X C;  3SD5 A;  2MJE A;  2YS1 A;  3L54 A;  2I38 A;  1D5X C;  1A70 A;  1D3Z A;  3ZYY X;  2FBW B;  4LDT B;  4BKS D;  1I4P A;  4RM8 A;  2WXP A;  3PT2 B;  4DXA B;  1PGX A;  1WR6 E;  3ODW A;  2Y3A A;  1KLU D;  1PYW D;  4WWN A;  1KI1 B;  3DBH I;  1DYQ A;  4XDC A;  3ZO5 B;  1P3Q U;  2C9W B;  3H6N A;  1FNW A;  4JWU C;  5CHF A;  5BO4 B;  5EE1 A;  3DXC A;  4HPM B;  1I4R A;  4JIO U;  2QEJ C;  2K39 A;  3NUH B;  1N62 A;  3AE5 B;  1C3T A;  2L2I A;  2R82 A;  2KXJ A;  1L6V A;  3OLM D;  2CY5 A;  2R0D A;  2QKL A;  2ZCC A;  1NDD A;  2K25 A;  1SJH D;  1FPY A;  4HB0 B;  2KUQ A;  1TBE A;  5J2R A;  2L7R A;  3X23 A;  4CHM A;  1ENF A;  2O6V B;  4UDU C;  1XLO A;  3V5W A;  1DOX A;  1LXD A;  3ZIM A;  3SU8 X;  4FHJ A;  1QOF A;  1V9J A;  1R4N B;  3DVN V;  4MH0 E;  1WJ4 A;  2B76 B;  1XEE A;  4TV3 A;  3V61 A;  4CYE A;  1MIZ B;  1I7H A;  1EUV B;  1XCT L;  4N9F 4;  2JPH A;  3AJ4 A;  2MH7 A;  4C56 C;  1GB4 A;  1EM7 A;  1FOE A;  2QSD A;  1FCL A;  3LJU X;  1YX5 B;  2W3R A;  1GUA B;  5KQ4 A;  1WJ1 A;  2JSV X;  3S2A A;  4DBB A;  2BWF A;  1TS5 A;  3F5R A;  4PS3 A;  4JKD A;  2Y8G A;  4BOZ B;  4KGR A;  2MP2 A;  3RUL A;  3TEW A;  2BF8 B;  5HE3 A;  1YJJ A;  3HQC A;  1X1F A;  2WNM A;  4K2O A;  5FR3 A;  4A3O A;  3GE3 C;  1V5O A;  2LJI A;  1L5P A;  4FLH A;  2R2Y A;  1Z5S B;  2KVR A;  4ANU A;  2CQU A;  2MRP A;  2BS4 B;  1HZ5 A;  4WJO A;  3UI3 A;  4P1B C;  3CXB B;  1WZ3 A;  2N1V A;  1F77 A;  1L7Y A;  2IO0 B;  2VSZ A;  2H89 B;  4FHK A;  4RGT A;  5C3J B;  1AQC A;  3ULB A;  1F0Z A;  4YT0 B;  4GDL A;  3APC A;  3RPF C;  2ROV A;  4NPN A;  4HB2 B;  2H7E A;  1SE3 A;  3A4S C;  4KX6 B;  1J0G A;  1QF6 A;  3EFC A;  4E71 A;  4J6I A;  2IYD B;  3U7Z A;  1E8Z A;  2Z13 A;  2WXL A;  3UZT A;  2FJL A;  3JVZ X;  2WDV B;  2DA0 A;  5HHD G;  2D3C A;  2W2X D;  2DIK A;  3RNC C;  2W54 A;  4W9E A;  1WRI A;  3HVZ A;  3ZQ4 A;  3TIX A;  4YL8 A;  1BWN A;  5HE0 A;  1HXY D;  2N9K A;  4WAA A;  1STE A;  3NVV A;  2KAN A;  3I57 A;  3W5U B;  5JHA A;  1A5R A;  1XXG A;  5FI1 A;  1KLV A;  3R2T A;  1MG8 A;  2DEN B;  3T9L A;  1FXA A;  4P16 A;  4KHA A;  3Q3O C;  5AUI A;  3EGR A;  3N7C A;  4NAW B;  2K3U A;  4EUT A;  1PGB A;  3BVM A;  1VD2 A;  1ZP0 B;  2N1W A;  4REZ A;  2INN E;  3IT4 B;  2DZI A;  2KQ7 A;  4GN1 A;  5BYS A;  1U5F A;  4PS7 A;  3V6C B;  2NBU A;  2BKR B;  2HRJ A;  2LGY A;  1E9M A;  1P98 A;  1QT9 A;  1NYR A;  2M1M A;  2KKC A;  2FDQ A;  2J4X A;  5GXG B;  1WJM A;  3Q8C A;  4W9C A;  1YX6 B;  3AMZ A;  2L3Z A;  2SEB D;  3VUX A;  4EJN A;  3A9J A;  4KGT A;  1C4P A;  4F7H A;  1YD8 U;  3VXW A;  3K9O B;  2UWQ A;  2RDH A;  2VZK B;  1UNS A;  1RM6 C;  5DIF B;  2GOW A;  4DX9 0;  5IO9 A;  2MJ3 A;  4BAX A;  2C5L C;  2V4I B;  4B95 A;  4CQN A;  2BYV E;  2W2W A;  3ZTD A;  4B6W A;  3ZDM C;  1TTN A;  2A4Z A;  2M14 A;  2W3S A;  3H8H A;  3Q3N C;  1NEN B; 
#chains in the Genus database with same CATH homology
 3PLU A;  2FAZ A;  1WMH A;  4FA6 A;  3RZF A;  2E2X A;  2J0M A;  1U5D A;  3UQA A;  5L95 C;  2RSU A;  3I3T B;  2D10 A;  2UYZ B;  3P7Z A;  4HK2 A;  3DBR I;  1ZC3 B;  2RGN B;  4IFS A;  3PRE A;  2X18 A;  1WG7 A;  2KD0 A;  2DX5 A;  3PG7 A;  4FJV B;  1MK7 B;  1Y5O A;  2N23 A;  3R66 C;  4HAV B;  2FCN A;  2COD A;  2ZEQ A;  3GYP A;  3PS6 A;  2CAY A;  4DK5 A;  4HAW B;  1Y8R C;  3CMM B;  4PYU A;  1NTV A;  4GPT B;  4HB3 B;  2FID A;  2M0X A;  2YRY A;  3FEH A;  2MW5 A;  3VTW A;  1T0Y A;  1BAK A;  2RD0 A;  2N9E B;  3ZKJ C;  2JF5 A;  4JKH A;  1GNU A;  5JHH A;  3AUL A;  1WI0 A;  1XD4 A;  4IW0 A;  5EDS A;  3VUY A;  2DZM A;  2W9N A;  1WH3 A;  1WVH A;  1EVH A;  3D8E A;  3PP2 A;  4GMV A;  3UF8 A;  1KOT A;  3V60 A;  1V5U A;  4A5K A;  1Z2M A;  2BKF A;  3MJW A;  1VBH A;  1RJ2 A;  1X1G A;  1OMW A;  1LW3 A;  1C1Y B;  2MBO A;  5E6O A;  4HDO A;  4A6H A;  2ZCB A;  1MK9 B;  5AEK B;  5JHB A;  2HTH B;  1PFJ A;  2QKM A;  3OAW A;  4KIK A;  3IFW B;  3EEC A;  4MEM A;  3DQV A;  1KBL A;  2Z0O A;  3PRM B;  5AZH A;  4E3C A;  2ROZ B;  4BKT A;  2J0K A;  3X0W A;  4MGK E;  5L81 A;  2LGX A;  2K00 A;  4KDI C;  5JHG A;  1WYW B;  3DVG X;  2LG1 A;  4DHZ E;  4F1S A;  3DDC B;  2ABD A;  1Q5W B;  4KVG B;  2Z0Q A;  3A98 B;  1OTR B;  4PNK A;  4GOC A;  1QC6 A;  4RMA A;  5GOW B;  3SNH A;  3M3J A;  3ZRF A;  4NY0 A;  1G6J A;  2ZVN A;  4LCD E;  3WAM A;  5KHQ A;  2CHX A;  4IM2 A;  1XT9 B;  5IAA C;  3QBV B;  2FCM A;  1Q67 A;  4HCN B;  4BVU C;  2NR2 A;  5DI9 B;  4MSM B;  4K7U A;  2KQS A;  5IA7 A;  3VH3 B;  4IAP A;  1Q0W B;  2GBM A;  1WM3 A;  4EZK A;  4GDK B;  1V80 A;  2LAS A;  2G35 A;  1WR1 A;  5JLJ B;  2ZPY A;  3SBT A;  1ZSQ A;  3RT3 B;  4AUQ C;  2CHW A;  1GC7 A;  4KHB B;  2MDX A;  2NPT A;  1WX8 A;  4TQ0 A;  1WM2 A;  3GOE A;  1WJ6 A;  3WYF B;  1E8X A;  4JGH B;  4HAT B;  4A6F A;  3MHS D;  3HHM A;  2AL6 A;  3KUZ A;  3V6E B;  5IJM A;  3ZUN A;  4GB9 A;  4F8C B;  3E66 A;  2WDT B;  4K7S A;  2CHZ A;  2RSG A;  4G3X B;  4MGY E;  2GBR A;  2IO1 B;  4MDK E;  3FP5 A;  1MPH A;  4CHJ A;  1WGQ A;  4EOY A;  5KQ1 A;  1M94 A;  2J59 M;  1UZX B;  1RRP B;  1ZKH A;  4JQW C;  2I5C A;  2MBQ A;  2DYN A;  3QAR A;  5L83 A;  3BIN A;  5G2N A;  3AI5 A;  3PHW B;  4HCP B;  2NCN A;  1KJT A;  3L10 B;  4JK9 A;  2NPT B;  3QC8 B;  2KOX A;  4HWI B;  2AWT A;  2KJH B;  1JRU A;  3L08 A;  2D2Q A;  2HJ8 A;  3K9P B;  4A3P A;  5EFX A;  3PV1 A;  5CLQ B;  2Y5B B;  1P6S A;  2ASQ A;  2LI5 A;  3L16 A;  4I6P A;  4HHV A;  1WXS A;  2KTF A;  2ZVO A;  2KJ6 A;  3H9D A;  1KZG A;  2DAJ A;  3A9K B;  2WYQ A;  4KSL C;  4LDT D;  1FAO A;  4FUL A;  2YS3 A;  3NOB A;  3A8Q A;  3UIO B;  2BGF A;  3HM3 A;  5JH5 C;  3UQB A;  4EKU A;  2VRR B;  2KN5 A;  3JYU A;  1V88 A;  1TXD A;  4F7U P;  4G0N B;  4KAX B;  1DDV A;  1TJ6 A;  2Z0E B;  1WMH B;  4ZRK A;  4ILJ A;  1X05 A;  2KZR A;  2DX1 A;  3NSU A;  3QCA A;  2DX5 B;  1V5M A;  4AP4 C;  2WWZ A;  4JKG A;  2FIF A;  1WGG A;  3ZDT A;  4II3 B;  1FHW A;  2CKH B;  2M17 A;  3NS8 A;  2MX2 A;  5LXH A;  2L0F A;  3A9J B;  4MJS B;  4FJZ A;  2NS5 A;  3VFK A;  1UNP A;  1R4M I;  2K8C A;  1UD7 A;  3KUD B;  2XBB C;  3PRZ A;  3D8D A;  1J0W A;  2GBJ A;  4WVF B;  5LOP B;  2DHK A;  3VTU A;  1U5G A;  5HE2 A;  1WJU A;  4IC7 B;  4KZC A;  4BOS C;  1DBH A;  4TQ1 A;  1IP9 A;  3PTF C;  2PE9 A;  4OVV A;  2ZPN A;  4NQL B;  3O96 A;  2YT0 A;  3E9P A;  2IYB A;  3TFM A;  2L05 A;  1EO6 A;  4M0W B;  2COA A;  5LON B;  5C5B A;  1XCG A;  2RQ1 A;  5C5B B;  3EFU A;  3ZW3 A;  3DOW A;  3Q3F A;  4HJK A;  3D32 A;  2DTC A;  4BBK A;  4BKG A;  1TZ1 A;  2MBH A;  4HPL B;  2RLO A;  2UZR A;  4NQK E;  1B55 A;  3L13 A;  2MA9 B;  2G4D B;  2COF A;  2N9X A;  5D3W A;  4W9J A;  2PZ1 A;  4IWO A;  4JL9 A;  3D8F A;  1ZGU B;  2MLB A;  4F7Z A;  2GCJ A;  5FI0 A;  1SIF A;  4DWF A;  2KFK B;  3SO6 A;  1HBK A;  3LDZ E;  2HTH A;  5D3V A;  3TO1 A;  3PGE A;  1GJZ A;  1PMS A;  2KTR A;  1MIX A;  2YLM A;  2G45 B;  1H8C A;  3M63 B;  2LUL A;  2KTR B;  2P0D A;  2K2U A;  5JZE B;  3V62 A;  3OJ4 B;  3KVF B;  3PSC A;  3QAQ A;  1GGO A;  1V5T A;  1UPR A;  5LXI B;  2LRW A;  1SHC A;  3FSS A;  3VTV A;  3PSE B;  3H7P A;  3W1S A;  1P1A A;  3ODO A;  3KZ1 A;  1NVL A;  2YF0 A;  3U7D A;  1WI1 A;  4GU2 A;  2YSZ A;  2Q13 A;  5D94 A;  2FUH B;  3A1Q B;  2LKO A;  3N3K B;  4W9F A;  2LVP A;  2KWC A;  2LD9 A;  2DZK A;  4Y94 A;  2LZ6 A;  2N0Y A;  2RGF A;  5C23 A;  2BYE A;  5TR5 A;  1XR0 B;  4L6E A;  4K7W A;  5J3Y A;  3N32 A;  3VVW B;  3T8M A;  4ZYN A;  3ULC A;  2KFJ A;  2LYD A;  3KSY A;  2OTX A;  1IYF A;  4JLC A;  2CU1 A;  2LJ5 A;  3ZLZ A;  1EF1 A;  2GBK A;  1UBQ A;  3OAN A;  3NHE B;  4GIV A;  2KWV B;  2FNJ B;  1UEF A;  1HB8 A;  4MGI E;  4KZ0 A;  2L1C A;  3BJI A;  3DPD A;  1FGZ A;  4A6F B;  2RUK B;  2ZNV C;  1I2H A;  1FGY A;  2H7D A;  2DHZ A;  3SDL C;  4JKA A;  5HKH A;  2JP2 A;  2JXX A;  5KHO A;  2YVC A;  2GJY A;  1UPQ A;  2KCJ A;  5J17 A;  3BY4 B;  3M1I B;  1EF5 A;  1XD3 B;  4X57 B;  3A4R A;  1RLF A;  1U2B A;  4HAX B;  2C7H A;  2LOX A;  4M8M A;  3DXD A;  2NZ8 B;  3EHV A;  4IOY X;  2M4N A;  3EC8 A;  1VCB A;  2G3Q B;  1UGM A;  1H4R A;  1WRD B;  1XQQ A;  2XK5 B;  5C16 A;  4XZ4 A;  1V86 A;  1U4A A;  5D27 A;  5KCV A;  2MCN B;  5CHW A;  2JUO A;  3QWM A;  1EAZ A;  1IPG A;  2RVB B;  1NTI A;  4BBN C;  4FJY A;  1J19 A;  4KDL B;  4JK8 A;  2DKP A;  1NTY A;  4EFO A;  3G9W A;  2J0J A;  1V61 A;  4IWP A;  2IFS A;  2IO2 B;  1ACA A;  2D9Z A;  2N7D A;  3MTN B;  2DLW A;  1WXV A;  4GZU A;  5HE1 A;  3KYC D;  3AXC A;  2LXA A;  4HAU B;  2L76 A;  3JW0 X;  1ISN A;  3ODX A;  2BYF A;  2O2V A;  1U29 A;  4KSK C;  1AWE A;  2MP2 B;  3Q3J A;  4EZL A;  5D2M B;  2COC A;  2LWP A;  2C7M B;  2C60 A;  5LLI A;  1LQB A;  4A20 A;  3WA0 A;  2RNR B;  2AEH A;  1K5G B;  2HE7 A;  4XX5 A;  3JSV B;  3OJ3 A;  5C6R A;  4W9D A;  1EGX A;  3FM8 C;  5DCN A;  2XQN M;  1FHX A;  1ZC4 B;  1IRS A;  2VRW B;  4MM3 A;  4WJN A;  1KZ7 A;  4KHO A;  1N3H A;  2XEW A;  3VUW A;  2L8J A;  4GDK A;  1P5T A;  3HW2 B;  1WX9 A;  1AAR A;  2GMI C;  3ML4 A;  1WXM A;  1GC6 A;  1F9J A;  3U30 A;  4DBG A;  3KY9 A;  3VQI A;  2M8S A;  2D4Q A;  1TGZ B;  1WJN A;  2MWS B;  2WX0 A;  4HXD A;  1CMX B;  3EPY A;  3GYO A;  4XWX A;  4PYZ A;  3E9L A;  3VIA A;  3DCG A;  4W9G A;  4TKN A;  2KK8 A;  5JP4 A;  3APD A;  2LXC A;  3DVG Y;  3N30 A;  4I6N B;  1KM7 A;  2OJR A;  3E9O A;  2QHO A;  3L0W B;  2I1J A;  1U27 A;  3R3M A;  4C0A A;  2P0H A;  3KYD D;  4FN2 A;  2FCS A;  1L2N A;  4AWJ A;  4Z2M B;  4Z2N A;  3UGB B;  1NU2 A;  1E90 A;  4LJP B;  1HE8 A;  4AOF A;  3ECI A;  4DDG D;  3R7R A;  4ZRJ A;  5J3Q A;  3KRW A;  1YJ1 A;  3ML8 A;  4EZJ A;  3VHT C;  2W2X C;  4CO7 A;  3B1L X;  5JVL A;  2ZNV B;  1WGU A;  3M95 A;  3ZNI D;  2L0T A;  5CTR C;  3P2B A;  3SUZ A;  1WGR A;  1XKE A;  3IVF A;  3KRX A;  3MPX A;  2LUE A;  3SV1 A;  4BKS A;  2I1K A;  1Q1O A;  4DDI D;  1S1Q B;  2B3A A;  1OQY A;  3ZVR A;  2DAF A;  3ZRC A;  5AZG A;  2V3S A;  2J7Q B;  3O65 B;  3ZVV A;  3MDB C;  4PS8 A;  4LJO B;  4BFR A;  2O2V B;  1RRB A;  2KMA A;  3PZD A;  2KHW B;  5DHF B;  4WJP A;  4URK A;  1OEY J;  2GBN A;  1WE7 A;  2JRH A;  4DX8 A;  2NVU I;  3WAN A;  1HB6 A;  2DZJ A;  1WXA A;  1NI2 A;  3PRP B;  3RYT A;  1PLS A;  4HAZ B;  3H1U A;  2MBE A;  2V1Y A;  3APF A;  1WF9 A;  3FLV A;  3HM6 X;  4GDL B;  4JKB A;  2DYO A;  2KUP A;  3H7P B;  4RM9 A;  4A6K A;  1FHO A;  3ALB A;  1E8W A;  2OOB B;  2Z59 B;  4E74 A;  4FBJ B;  2M38 A;  4OVU A;  2DFK A;  1P0R A;  1E7U A;  2D07 B;  1OEY A;  5GMV A;  1DDW A;  3M62 B;  2N7E A;  4MSQ B;  2PEA A;  1RAX A;  1DYN A;  1LB1 A;  3JSV A;  2LVO A;  2ADZ A;  5CHV C;  4IWQ A;  3UIN B;  2COP A;  4JKE A;  3PVW A;  4MK0 A;  1J8C A;  4IUM B;  2JZZ A;  2ZJD A;  2RR9 A;  2K1F A;  5J18 A;  4NSW A;  4ASW C;  4F7G A;  1E7V A;  2LOZ A;  4JKC A;  2PJH A;  4GGQ A;  4ZDV A;  2IBI B;  2DKQ A;  4FAD A;  3DBL I;  2NBV B;  1S3S G;  5D6J B;  2A5U A;  5D3Y A;  1W1G A;  2BCJ A;  5DPS A;  3QX1 A;  5D7G A;  1V49 A;  2IO3 B;  2K8H A;  1UNR A;  3VAW A;  1X1M A;  4DHZ B;  2IY0 B;  4W9I A;  2YS5 A;  3KW5 B;  2I5F A;  1SGH A;  4P7I A;  3IBE A;  4ANW A;  1PQS A;  1ZVR A;  2EKE C;  3H7S A;  5DPW A;  3TVV A;  1GG3 A;  2G4S A;  1UBI A;  2NBW B;  4ANV A;  1OQN A;  1E5W A;  1OY2 A;  5DPR A;  1DDM A;  1MAI A;  1I7A A;  4ICU A;  1V5P A;  2AYO B;  3P6A A;  2KDE B;  1XX0 A;  4K17 A;  4WWO A;  2CB8 A;  4ILG B;  4MT7 A;  3CIK A;  1Z87 A;  4K81 A;  3RUI B;  3PEG A;  3B08 A;  2KMC A;  1BTK A;  2UVM A;  1K8R B;  1UEL A;  1WY8 A;  5DH9 B;  4NNJ B;  3UIP B;  2N4F A;  3DXE A;  1K5D B;  1I35 A;  2WH5 A;  2X0S A;  4JKF A;  2PE6 B;  3TCA A;  2D3G A;  2GCL A;  3QWZ B;  1W1D A;  3F0W A;  3PVU A;  3DBS A;  2L00 B;  2UZS A;  2MBB B;  1U5E A;  3WAO A;  1FXT B;  2FCQ A;  2DHI A;  3WAL A;  2ELA A;  3SYX A;  2WX1 A;  1NBF C;  3T06 A;  4G50 A;  4M8N A;  1V81 A;  2IY1 B;  3KH0 A;  3L17 A;  5D3X A;  2KDI A;  1QZE A;  3TJP A;  4MJS A;  4K2P A;  3A1Q A;  4II2 B;  2OQB A;  1YQB A;  4NJ6 A;  1X86 A;  3LJ3 A;  4W9K A;  1ZW7 A;  2KNB A;  3PLV A;  3ZNH B;  2Z0P A;  2Y8F A;  3QQ8 B;  4NJ7 A;  2CS4 A;  1DRO A;  2LVQ A;  1BTN A;  3ENB A;  3IG3 A;  4MEL A;  3AU4 A;  2V4L A;  2GS0 A;  4JK7 A;  4WJ7 A;  1WX7 A;  1UNQ A;  1YIW A;  2Y7B A;  2JZ3 B;  5E6N A;  4TYZ A;  3QA8 A;  4K1R B;  2MQJ A;  2D9Y A;  5J3T A;  2HD5 B;  2K6D B;  4WWP A;  4B9K A;  4MGZ E;  3NY5 A;  3SHQ A;  1Y19 B;  1BT0 A;  1RFA A;  4HVB A;  2IZV B;  2BWE S;  2DN6 A;  3RD2 A;  4IG7 B;  2LGD A;  2K2J A;  4GMX B;  1P9D U;  5G55 A;  2JVC A;  2R2O A;  3ENE A;  3QK0 A;  2ELB A;  1V6E A;  3VOQ A;  3TMP B;  5AZF A;  4NAW A;  2XK5 A;  3A9K A;  1WIA A;  3ML9 A;  3W1S C;  4TUU A;  4PQ0 A;  2MSE D;  2REX A;  3HK0 A;  4JKG B;  2KJR A;  4WJQ A;  3RZW C;  4WQO B;  3KUC B;  4DHJ D;  3TL5 A;  4WSF A;  2EMT A;  5C1Z A;  1P3R A;  1DIK A;  2KFK A;  4D0N B;  4ICV A;  2JT4 B;  2KDB A;  2R09 A;  2DYQ A;  2CRF A;  2EJ8 A;  3U8Z A;  3SBG A;  3A8P A;  2LRU A;  3C0R B;  1W1H A;  2YT1 A;  2EMS A;  1WGH A;  1FB8 A;  2K8B A;  2VKI A;  2V76 A;  1H10 A;  3CF6 E;  4KV2 A;  3DVN U;  4W9L A;  1WE6 A;  3PHX B;  2MKR A;  1ZM0 A;  2JWZ A;  4YON A;  2K6Q A;  4EMO A;  2O6V A;  2KX3 A;  3AU5 A;  1X11 A;  1I42 A;  4BBN F;  1JDE A;  4HLE A;  1QQG A;  3CST A;  3R7Q A;  2CY4 A;  5DPT A;  3IHP C;  1ST7 A;  3CSF A;  3PPA A;  4EEW A;  2P0F A;  4CHK A;  2C7N B;  2D9V A;  4MY6 A;  3QIJ A;  1V2Y A;  2R2Q A;  2JY6 A;  4HB4 B;  2KX0 A;  4IM3 A;  2D9X A;  2AL3 A;  3WAP A;  1M7R A;  4DHJ B;  1E8Y A;  2NMB A;  4ANX A;  1WZ0 A;  2KLC A;  3A33 B;  3VDZ A;  2KLG A;  2KO3 A;  3RCZ A;  3QJZ A;  4GXB A;  5DHA B;  4G11 A;  4B6H A;  2D9W A;  5CLL B;  2KWU B;  3ZNZ B;  3QHT A;  1TQZ A;  2DYB A;  1XOD A;  2MWN B;  1V89 A;  5FR6 A;  2RPQ A;  1M7E A;  3TW1 A;  3ZTC A;  1LM8 B;  4H8S A;  5C79 A;  1WGY A;  1OGW A;  4W9H A;  2PPH A;  3ZNG C;  2DHJ A;  2BPS A;  4I6L B;  4AJW A;  4AJY B;  2LBB A;  1WFY A;  1UH6 A;  2DYM A;  3NZU A;  4ILH A;  1R4N I;  1SE9 A;  2N9P C;  2ZZP B;  3ONS A;  3TBL D;  2Z0D B;  4HAY B;  5E6P A;  2MFQ A;  3WIM A;  2O6V D;  2P8V A;  2KDF B;  4IM0 A;  3W1Y A;  3HIZ A;  4ZRI A;  3NZS A;  2EC1 A;  3GZN I;  5CX3 A;  2KC1 A;  1WGD A;  2JRI B;  2D11 A;  4KIK B;  1VBG A;  3PVL A;  4GSW A;  1LFD A;  1MKE A;  1KC7 A;  3RCP A;  4XC2 A;  4HDQ A;  2KC2 A;  2KGX B;  3VH4 B;  2FJ9 A;  3B0A A;  2CR5 A;  3SD5 A;  2YS1 A;  3L54 A;  1D3Z A;  4LDT B;  4BKS D;  4RM8 A;  3PT2 B;  4DXA B;  1WR6 E;  3ODW A;  4WWN A;  1KI1 B;  3DBH I;  3ZO5 B;  1P3Q U;  2C9W B;  3H6N A;  5CHF A;  5BO4 B;  3DXC A;  4HPM B;  4JIO U;  2K39 A;  1C3T A;  2L2I A;  2R82 A;  2KXJ A;  3OLM D;  2CY5 A;  2R0D A;  2QKL A;  2ZCC A;  1NDD A;  2K25 A;  4HB0 B;  1TBE A;  5J2R A;  2L7R A;  3X23 A;  4CHM A;  2O6V B;  3V5W A;  1LXD A;  3ZIM A;  3SU8 X;  4FHJ A;  1V9J A;  3DVN V;  4MH0 E;  1WJ4 A;  4TV3 A;  3V61 A;  4CYE A;  1MIZ B;  1EUV B;  4N9F 4;  2JPH A;  3AJ4 A;  1FOE A;  3LJU X;  1YX5 B;  1GUA B;  5KQ4 A;  1WJ1 A;  3S2A A;  4DBB A;  2BWF A;  3F5R A;  4PS3 A;  4JKD A;  2Y8G A;  4BOZ B;  2MP2 A;  3RUL A;  2BF8 B;  5HE3 A;  3HQC A;  1X1F A;  4K2O A;  4A3O A;  1V5O A;  4FLH A;  1Z5S B;  2KVR A;  4ANU A;  2CQU A;  2MRP A;  4WJO A;  3CXB B;  1WZ3 A;  2N1V A;  1L7Y A;  2IO0 B;  2VSZ A;  4FHK A;  1AQC A;  3ULB A;  4GDL A;  3APC A;  2ROV A;  4NPN A;  4HB2 B;  2H7E A;  3A4S C;  1J0G A;  4E71 A;  4J6I A;  2IYD B;  1E8Z A;  3UZT A;  2FJL A;  3JVZ X;  2DA0 A;  2W2X D;  2DIK A;  4W9E A;  3TIX A;  4YL8 A;  1BWN A;  5HE0 A;  4WAA A;  2KAN A;  5JHA A;  1A5R A;  5FI1 A;  1KLV A;  1MG8 A;  2DEN B;  3T9L A;  4KHA A;  3N7C A;  4NAW B;  4EUT A;  1VD2 A;  2N1W A;  2DZI A;  2KQ7 A;  4GN1 A;  1U5F A;  4PS7 A;  3V6C B;  2NBU A;  2BKR B;  2HRJ A;  2LGY A;  1P98 A;  2M1M A;  2KKC A;  2FDQ A;  1WJM A;  4W9C A;  1YX6 B;  2L3Z A;  3VUX A;  4EJN A;  3A9J A;  4F7H A;  1YD8 U;  3VXW A;  3K9O B;  2UWQ A;  5DIF B;  2GOW A;  4DX9 0;  2C5L C;  4B95 A;  2BYV E;  2W2W A;  3ZTD A;  4B6W A;  3ZDM C;  1TTN A;  2A4Z A;  2M14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...