3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
b'KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
1BT0A 1PLSA 3PT2B 3C0RB 2MDXA 1RRBA 4LCDE 4A3PA 2LVQA 3S2AA 3DBHI 2N23A 2G45B 2GBJA 3RULA 2QHOA 2KN5A 1WXVA 1B55A 4DHJB 3PZDA 5D3XA 5E6OA 4NJ6A 3PV1A 2DKQA 3QARA 1K5GB 4MELA 1UELA 4NQLB 1U5DA 2YF0A 3ZRCA 5HKHA 4IC7B 4TYZA 1WZ0A 1FHOA 2BKRB 3ALBA 5AEKB 2NBWB 4XZ4A 4GB9A 4P7IA 2OQBA 1WGHA 4FHJA 1J0WA 2MRPA 2JPHA 2NBVB 2H7EA 3NY5A 1A5RA 4FJZA 3LDZE 2FUHB 3UGBB 4GXBA 2CRFA 2A4ZA 5C5BB 2K2JA 4FN2A 2ZVOA 1BAKA 4F7ZA 2NPTB 2G4SA 2M17A 5FI0A 2DFKA 4K1RB 1WH3A 1KM7A 1H4RA 4A6HA 5J2RA 2R09A 1OY2A 1I2HA 4GMVA 2DZMA 1WZ3A 2IY0B 4BFRA 1UNRA 2MBOA 2WDTB 3SDLC 2KMAA 2YRYA 1BWNA 3ENEA 3TFMA 4WJPA 4EOYA 4BOSC 3A33B 3DPDA 5C6RA 1V5MA 2ZJDA 3D8DA 1IRSA 4F8CB 1P6SA 2DKPA 1WR6E 3NSUA 3N3KB 2L2IA 2XK5B 2O2VA 2UYZB 4DK5A 1FAOA 3VOQA 4BBNC 4HAXB 1OMWA 1X1MA 5LXIB 2DAFA 1WX7A 2CAYA 2ELAA 3H6NA 2LVOA 5L95C 2J0JA 2LRWA 2FCNA 1QQGA 1E8WA 1Q1OA 2L76A 2IO0B 2DYQA 4ZRKA 1P3QU 4IM2A 3QC8B 2LBBA 2P8VA 3VUXA 3VTWA 1WVHA 2CQUA 5LONB 2NCNA 3UF8A 3D8EA 1WM2A 2LASA 3A4RA 5DPWA 1SE9A 3VDZA 2PE9A 1R4NI 2AL3A 3AU5A 4K17A 1NTIA 3WANA 5C23A 2KWCA 2WWZA 4HCPB 2KZRA 1GC7A 3M3JA 1WJ4A 4TV3A 2JUOA 3D32A 2D11A 1V5PA 1AQCA 2KQ7A 4TQ1A 5LOPB 3DQVA 3RCZA 3PSEB 4AUQC 2PJHA 3KUCB 2LXAA 4HHVA 1E5WA 2IZVB 2DZJA 4MGYE 3VH4B 1N3HA 3PVLA 2MBQA 2DENB 2LGYA 5HE1A 2G4DB 1XKEA 4A6FA 1NTYA 2N9EB 2W9NA 4MSQB 2K6DB 4JQWC 4B95A 2NBUA 2KC1A 5JHGA 2LGDA 4TUUA 3TVVA 1EO6A 3PHWB 1GG3A 4IFSA 1Z2MA 1ZM0A 5JH5C 3ONSA 1IYFA 1RFAA 1G6JA 3KYCD 1EVHA 2MCNB 4MGKE 4FLHA 3H7SA 4EFOA 1TTNA 4GDLB 2MFQA 3PVWA 4G11A 2HRJA 2ELBA 4ZYNA 3FP5A 3V5WA 4IWOA 2BYEA 3ZNID 2O6VB 2HD5B 4KZCA 4NQKE 2CB8A 2COAA 2IFSA 1V88A 1V80A 3IHPC 2ROVA 2YS5A 1GC6A 1K5DB 2MP2A 3TMPB 3PSCA 3HW2B 4ZRIA 1WJMA 3NZSA 1SGHA 2CHZA 4KIKB 4ZRJA 3DBLI 1H10A 2YT1A 2UZSA 2LUEA 2KHWB 3ODXA 3I3TB 4WAAA 4W9HA 2Z0OA 4WJQA 3K9PB 3PTFC 2KKCA 2D10A 3T9LA 4AOFA 3LJUX 4TKNA 1U4AA 1WGYA 2JRHA 3TW1A 4K81A 4HAZB 4FJVB 4HB0B 2QKLA 5D94A 2PEAA 4BKSD 2OJRA 1TQZA 3SV1A 3L08A 3PG7A 2MLBA 2FJLA 2BCJA 5JHHA 2L8JA 1ACAA 4GU2A 3QBVB 4XWXA 3WYFB 4KZ0A 1WGQA 1WF9A 4BVUC 1I42A 1TXDA 3KUDB 1KJTA 1UNQA 4YONA 2D9YA 3GYPA 4A5KA 3TCAA 1EAZA 5HE0A 1V49A 2OTXA 1MG8A 2KDBA 1HB8A 2D4QA 2GBMA 4LJPB 4RM9A 1TJ6A 2BF8B 4OVUA 2XBBC 3KSYA 1Q0WB 1QC6A 2RGNB 2X18A 2K6QA 4HDQA 1JRUA 2DHZA 1NI2A 5C1ZA 4YL8A 3AJ4A 4I6PA 2K8BA 2WX0A 3WAMA 3VUYA 1U2BA 1VD2A 3IVFA 4EZKA 1U5GA 2NZ8B 2BPSA 3W1YA 3WAOA 3OANA 3A9JB 2IYDB 4GIVA 2L05A 5AZFA 4X57B 3ZNGC 2LOZA 3D8FA 4JLCA 2FDQA 3U7DA 3NS8A 1LQBA 3UIPB 3ZW3A 5FI1A 4K7UA 3ULBA 2Y8GA 4CYEA 1SIFA 2ADZA 1J0GA 3AI5A 3U8ZA 3EHVA 2K2UA 2C9WB 1WXAA 1WM3A 1XT9B 3PRPB 1V2YA 1WY8A 1P1AA 1L2NA 2PE6B 3VXWA 2Y5BB 3B1LX 1ZKHA 2RD0A 2GBNA 5DHAB 3QCAA 5CHWA 4Y94A 2K8HA 4BBNF 3DXDA 1WXMA 4FA6A 4DX90 1Q5WB 4MJSA 4NAWB 1YQBA 3IG3A 3QAQA 2KC2A 3V62A 2P0DA 2N4FA 4HLEA 1MKEA 4LDTB 2V4LA 4DDID 4NJ7A 2Y7BA 3DVNU 2UVMA 1UGMA 1WMHB 3RUIB 1WX8A 5JLJB 2DN6A 1Y8RC 4W9IA 5C16A 3OLMD 1XCGA 1IPGA 1WG7A 1GNUA 2WH5A 1V61A 2KTFA 4PS8A 2NS5A 3N7CA 2BKFA 4A3OA 3IFWB 5D3WA 3PPAA 1RRPB 1WIAA 2RVBB 4PYZA 1DROA 2B3AA 3QHTA 3ZKJC 3KZ1A 3M95A 3MPXA 2NPTA 3X0WA 2KFKA 4W9JA 1MAIA 4MM3A 3WAPA 3O65B 4ANWA 1E7UA 4BKSA 4WWNA 3RZFA 3HHMA 1AWEA 3Q3FA 2L1CA 1OQYA 2O6VD 1WI0A 2DLWA 2L0TA 3OJ4B 3AULA 3ZIMA 4IOYX 3N32A 1UNPA 2MBHA 2LGXA 4AWJA 4ICUA 3MHSD 2YS3A 4DHZB 4G3XB 1V5UA 2KTRB 2JY6A 3DVGX 2HTHB 2WYQA 1OEYJ 2ZPNA 2NVUI 3DXEA 1Z5SB 4ANVA 1XR0B 1WXSA 2YSZA 3R7QA 3UINB 4WWPA 3UQBA 3M63B 4HWIB 3UZTA 2E2XA 4IM3A 1E90A 4KHBB 2XK5A 2N1VA 2JZZA 2JRIB 2RNRB 2KDEB 2MKRA 2P0HA 3F0WA 4MEMA 5CX3A 2C7NB 2ZNVB 3TJPA 1ZC4B 2RPQA 4MSMB 1LB1A 2IY1B 3QA8A 3KH0A 1J19A 5CHVC 2I5CA 4HXDA 2LYDA 5GMVA 4KDLB 2O2VB 1H8CA 4GZUA 5J18A 1GUAB 3QQ8B 1MK7B 1ZW7A 4ANUA 5LXHA 2R2QA 1KZ7A 3PRZA 2XQNM 1BTKA 4H8SA 4GN1A 3SYXA 1YX5B 3KY9A 1XQQA 5D3YA 2KFJA 3R66C 4HAYB 3GZNI 2DAJA 4BBKA 2JVCA 4CHJA 4DX8A 3B08A 4NNJB 3RD2A 5G55A 4EZLA 3VAWA 2KO3A 2BWES 5GOWB 1TZ1A 3SHQA 1S1QB 4EUTA 2V76A 4IM0A 3QJZA 1FHWA 5DIFB 2FCMA 4NSWA 1DDVA 5IA7A 1Z87A 2ABDA 3HK0A 1RJ2A 2DYMA 2EC1A 2P0FA 2MA9B 5DCNA 1U27A 2CY5A 1WRDB 4BOZB 1UEFA 2KX0A 2N7DA 5KQ4A 2DHIA 1U5EA 3TBLD 5CLQB 2KLCA 3L0WB 2LRUA 2DYNA 2IYBA 3MTNB 5JHBA 3H1UA 2LVPA 1U5FA 2RSGA 2LWPA 4IW0A 2DA0A 3DBRI 1NVLA 2FCSA 3T8MA 1RAXA 4E71A 4GDLA 3EECA 4DXAB 4K2PA 4CO7A 2W2XC 3FLVA 2KGXB 1NBFC 2KUPA 3PGEA 4LDTD 1MK9B 3SD5A 2LXCA 2KNBA 2ZPYA 2VRWB 2KWVB 2O6VA 2V3SA 2K39A 3HM3A 4DHJD 4IWPA 2EMSA 2ZNVC 2J0MA 1UPRA 3JSVB 3JW0X 2I5FA 4KIKA 2DYOA 5J17A 2AL6A 2UWQA 3WALA 1AARA 3SNHA 1KOTA 3BY4B 4EKUA 4B6HA 3ZNHB 1LM8B 1OTRB 1V86A 2ZZPB 5JZEB 2C60A 1HB6A 2YS1A 2H7DA 3F5RA 3BINA 5DH9B 1RLFA 5DPSA 2M38A 2MX2A 1P5TA 3DBSA 2DZKA 2W2WA 2MP2B 2EJ8A 3H7PA 3CSTA 4FADA 5HE3A 2FCQA 1IP9A 2AEHA 2GCJA 4K7SA 3LJ3A 3T06A 3KVFB 2KXJA 1V81A 4Z2MB 2D07B 2RLOA 3ZDTA 4HATB 2KLGA 4PS7A 1CMXB 1EGXA 5AZGA 2Z0EB 5J3TA 3DVGY 4W9CA 4PS3A 2CODA 4MDKE 3ECIA 1E8YA 4ICVA 1UPQA 3TO1A 4FJYA 3PP2A 1P3RA 1WE6A 2W2XD 3KW5B 1C1YB 3ZVRA 3X23A 3ZDMC 3G9WA 3IBEA 4DDGD 5L81A 5KCVA 2DX5B 2L0FA 1W1DA 4L6EA 2PZ1A 2LJ5A 5JHAA 4HAVB 3B0AA 1FXTB 2RQ1A 4WJ7A 2FIFA 5CTRC 2RGFA 3EFUA 3A9JA 3DVNV 3OAWA 2Y8FA 4IG7B 2C5LC 2L7RA 2ASQA 2K1FA 1EF5A 3CMMB 3WA0A 5D2MB 4II2B 2REXA 1Y19B 2LULA 2G3QB 2JF5A 3SU8X 1W1HA 2IO1B 3PS6A 2I1JA 3A1QB 2L00B 1LW3A 1V5TA 5KHOA 2AWTA 4GSWA 3CIKA 4W9LA 4MY6A 2MQJA 2COPA 3FSSA 2D3GA 2LI5A 3JVZX 3V61A 3CSFA 1EUVB 1E7VA 5CLLB 5D6JB 1WX9A 3A9KB 1J8CA 1UBIA 4KDIC 2KJHB 1HBKA 4WJNA 3VUWA 3PLVA 4AJWA 2KANA 4KSKC 4PQ0A 3NHEB 1FB8A 3PHXB 5E6PA 3ZLZA 4DHZE 2MWSB 4E3CA 4AP4C 2YT0A 4NPNA 2IO2B 4TQ0A 2KWUB 1V6EA 1SHCA 2KDIA 1KZGA 4GDKB 1WMHA 2JP2A 4KHAA 1YIWA 4N9F4 1DYNA 3A8PA 2FJ9A 4K2OA 3VQIA 4HPLB 3L17A 4BKTA 1NU2A 2KDFB 4DBBA 4ZDVA 5CHFA 1ZC3B 4MJSB 3HM6X 2J7QB 1ISNA 4F1SA 2MW5A 4HB4B 5J3QA 2OOBB 5IJMA 2N0YA 2RR9A 1M94A 2N1WA 3KRWA 2JXXA 5DPRA 2BYVE 3ULCA 2GS0A 4WWOA 1UD7A 3APDA 1ZGUB 5C5BA 3PEGA 2KJ6A 2L3ZA 2G35A 1FOEA 3AU4A 4RMAA 2GCLA 1X1FA 4B9KA 3NOBA 4HK2A 2ROZB 3RYTA 2M4NA 4EMOA 4KSLC 5FR6A 2C7MB 3ML9A 1WGRA 3PRMB 5LLIA 4WVFB 2DZIA 1D3ZA 2KTRA 3W1SC 3KUZA 2BWFA 2HTHA 2KFKB 1OQNA 3UIOB 4HDOA 1DDMA 1R4MI 4HAWB 4DBGA 2BYFA 2EKEC 3MJWA 2M8SA 1PFJA 3R7RA 4C0AA 3L54A 4G0NB 3V6EB 1VCBA 4BKGA 2COCA 1T0YA 2CS4A 2QKMA 3HIZA 2JT4B 4M0WB 4WSFA 1XX0A 4XX5A 2CR5A 3WIMA 1C3TA 2VSZA 4FULA 4G50A 2K25A 4HB3B 3QX1A 2DTCA 3EC8A 3QWMA 4WQOB 2R2OA 4MGZE 2UZRA 2Z0PA 4EZJA 2D9VA 4GPTB 4GGQA 1GJZA 1KI1B 4JL9A 3HQCA 2M1MA 4FBJB 1V5OA 2HJ8A 2KD0A 2PPHA 3GYOA 1ZSQA 2J0KA 1MIXA 4W9EA 1WYWB 3ODOA 3RZWC 1WR1A 2N7EA 5G2NA 1WJUA 2K8CA 4IUMB 1FGYA 4MK0A 3ZTCA 4M8NA 4K7WA 3P2BA 2KOXA 3L13A 2K00A 1MPHA 4CHKA 2CKHB 4ANXA 1KLVA 4URKA 3KYDD 4PYUA 4GOCA 1V89A 4D0NB 2CY4A 4DWFA 2KMCA 3QK0A 4RM8A 2EMTA 4W9FA 2Z0QA 2GOWA 3UQAA 2FNJB 3L10B 2N9PC 2Q13A 2IO3B 2YLMA 4JIOU 5HE2A 1S3SG 4B6WA 1WFYA 1WGDA 4KV2A 1PQSA 1UZXB 3V6CB 1WJNA 2JZ3B 1PMSA 5BO4B 2JWZA 4ASWC 4HPMB 1I35A 3ZVVA 4HCNB 3V60A 3PVUA 4A6FB 2KK8A 3CF6E 2N9XA 2KVRA 4HJKA 2M14A 2Z59B 3VHTC 4J6IA 3R3MA 1WGUA 2AYOB 2LZ6A 2HE7A 1V9JA 1E8XA 2KCJA 5L83A 3JYUA 4MT7A 3P7ZA 4CHMA 3SUZA 3JSVA 2CHWA 4JGHB 4WJOA 2A5UA 3MDBC 3VIAA 3L16A 2GBRA 1FGZA 1E8ZA 4LJOB 1F9JA 1X1GA 1X05A 1M7EA 2KJRA 2LG1A 3QWZB 3ZTDA 2VRRB 5J3YA 2D9WA 1WJ1A 1UBQA 1MIZB 1Y5OA 3M1IB 4HB2B 3DXCA 3VVWB 3PREA 4XC2A 1LFDA 2NMBA 2LOXA 3ZRFA 4I6NB 4IAPA 1FHXA 5JP4A 3OJ3A 3DOWA 4II3B 3U30A 1YD8U 2LD9A 2NR2A 4F7GA 1WJ6A 3Q3JA 1DBHA 3CXBB 4NY0A 2COFA 1XODA 3KRXA 1EF1A 3NZUA 2MWNB 5D27A 1TBEA 1Q67A 5E6NA 3ZO5B 3APCA 2M0XA 2WX1A 3O96A 3DCGA 2J59M 5KQ1A 4EJNA 1P98A 4M8MA 1WGGA 2LKOA 3QIJA 3M62B 4HVBA 1WE7A 3K9OB 2ZEQA 3H7PB 2R0DA 3A8QA 1U29A 5EDSA 2CHXA 4F7UP 4I6LB 4A6KA 1WI1A 2D9XA 3VFKA 2ZCCA 3VTVA 2MBBB 1X86A 2DYBA 2BGFA 1BTNA 1NDDA 2DX5A 5D7GA 4OVVA 2XEWA 4HAUB 2KQSA 2YVCA 4MGIE 3FEHA 1P0RA 3TIXA 4KAXB 3TL5A 5TR5A 1XD3B 5DPTA 3ML4A 3H9DA 4W9DA 4A20A 3DDCB 5D3VA 2V1YA 5EFXA 3ML8A 3SO6A 3W1SA 5DI9B 2DHJA 4KVGB 2ZCBA 1OGWA 2MBEA 2KX3A 1ST7A 3BJIA 1LXDA 2IBIB 2FIDA 4Z2NA 3P6AA 4W9KA 2GJYA 2DHKA 1I7AA 1ZVRA 2GBKA 2RUKB 1HE8A 1OEYA 3A1QA 3A98B 2VKIA 3RT3B 2GMIC 4KHOA 3EPYA 3ZNZB 2ZVNA 2D2QA 3PLUA 4EEWA 1YX6B 3A9KA 3VH3B 5KHQA 3ZUNA 3A4SC 1X11A 2FAZA 5C79A 4W9GA 2Z0DB 4IWQA 1W1GA 4MH0E 1QZEA 5DHFB 4F7HA 2D9ZA 4FHKA 1DDWA 1M7RA 1K8RB 3FM8C 2I1KA 1L7YA 4NAWA 2RSUA 3RCPA 3AXCA 1YJ1A 4AJYB 1TGZB 1NTVA 3ODWA 4GDKA 3N30A 3APFA 4GMXB 3GOEA 5IAAC 4E74A 1XD4A 1UH6A 1P9DU 2C7HA 5AZHA 3VTUA 2MSED 4PNKA 2CU1A 2DX1A
chains in the Genus database with same CATH superfamily
1BT0A 1B1ZA 1PLSA 3PT2B 3DHIC 3AMZA 3P4PB 3C0RB 4QXAB 2MDXA 1RRBA 4HRSA 4LCDE 4A3PA 2LVQA 2XN9C 1I4PA 3DBHI 3AEFB 3S2AA 1JDEA 2N23A 3PO0A 4DXGA 1VRAB 2G45B 5IP4D 2GBJA 3RULA 2QHOA 2KN5A 3GE3C 1WXVA 3HUIA 1J7BA 1B55A 1K53A 1QT9A 1XEEA 2WU2B 3RNAC 4DHJB 3PZDA 5D3XA 3Q8CA 1HZ6A 5E6OA 4NJ6A 3PV1A 2DKQA 3QARA 1K5GB 4MELA 3AE1B 2V4IB 1L5PA 1UELA 4NQLB 1I4HA 2RDHA 1U5DA 2YF0A 3ZRCA 5HKHA 4IC7B 4TYZA 1WZ0A 2RMMA 4US9A 1FHOA 2BKRB 3ALBA 3OWEB 4O1NA 3ZGZA 5AEKB 2NBWB 4XZ4A 4GB9A 4P7IA 5IKCM 2OQBA 1WGHA 4FHJA 2WXHA 1J0WA 2MRPA 1AYFA 5E6JA 1TKEA 2W3SA 2V0GA 2JPHA 2NBVB 2X8XX 1B9RA 2INNE 4LLGM 4P6VF 2H7EA 3FKYA 3NY5A 1A5RA 2WP9B 3RMKC 2BBCA 2QEJC 4FJZA 5BYQA 3LDZE 2FUHB 1FNWA 3UGBB 4GXBA 1QOAA 2FBWB 2CRFA 3RPFC 3U52E 2A4ZA 5C5BB 1XLPA 2K2JA 3IXSA 3MC9A 4FN2A 2ZVOA 1BAKA 4F7ZA 1WXQA 2NPTB 2G4SA 2KWDA 5FI0A 2M17A 1NYRA 2DFKA 4K1RB 4MM3B 3LXFA 4MACA 1WH3A 1KM7A 1P7EA 1H4RA 2LMCA 4A6HA 5J2RA 2R09A 2Q5WD 1OY2A 1I2HA 4GMVA 2DZMA 4M0WA 1WZ3A 2IY0B 1JW9D 4ACFA 4L23A 4BFRA 2E6XA 3VRBB 4KHBA 2KN4A 2LUMA 3J9CA 2ZW0A 3Q3MC 1FFVA 1UNRA 4GNKB 2MBOA 2WDTB 1UWXA 3U4EG 1TKGA 2I2YA 3SDLC 2KMAA 1JWUD 2YRYA 4LNFA 1NVID 1RFKA 2R61A 1EM7A 1BWNA 2SAKA 2ON8A 3ENEA 3TFMA 4WJPA 4JKGB 1WSPA 2QC8A 1AWDA 1SF0A 5HG2A 3Q8FA 4LNOA 4EOYA 4BOSC 3SEBA 3A33B 3DPDA 3TEWA 5C6RA 2QMTA 1V5MA 2ZJDA 3W5UB 3D8DA 1IRSA 4C7ZA 4F8CB 1P6SA 2DKPA 4QAYA 1WR6E 3NSUA 3N3KB 2L2IA 2XK5B 2O2VA 1DOYA 2UYZB 4DK5A 5FR3A 1FAOA 3NUHB 3VOQA 4BBNC 1BXTA 4HAXB 3AE8B 1OMWA 1X1MA 5LXIB 3U12A 2DAFA 3DWGC 1WX7A 2CAYA 2ELAA 3H6NA 2LVOA 5L95C 1ACCA 2J0JA 2LRWA 1ZDXA 3RNBC 2FCNA 1QQGA 1E8WA 1Q1OA 1N62A 3FC4A 2L76A 4BAXA 4HPPA 1XCTL 2L83A 2IO0B 2DYQA 4ZRKA 1P3QU 4IM2A 4XDCA 1UWMA 3KWLA 3QC8B 2LBBA 2M0AA 3AV8A 2Y5PA 3NWAA 2WHIA 2P8VA 3VUXA 5D3DA 3VTWA 1WVHA 1ET6A 2CQUA 4ILHA 4JKBA 5LONB 2FJUB 2M19A 2MJ3A 2NCNA 3UF8A 1YNTE 3D8EA 2HDEA 1QQRA 1WM2A 2LASA 3ETRA 3A4RA 5DPWA 1SE9A 2D3BA 3VDZA 3P4SB 1ZUD2 1FIQA 3B77A 1ZYIA 2PE9A 1R4NI 2AL3A 3NS1A 3NVVA 3AU5A 4K17A 1NTIA 3WANA 5C23A 1N5XA 2KWCA 2WWZA 4HCPB 2KZRA 1GC7A 3M3JA 1IBXA 1WJ4A 4TV3A 2JUOA 2INCC 3D32A 2D11A 1V5PA 1AQCA 2KQ7A 3GB1A 4TQ1A 5LOPB 3BYYB 4JKHA 1K52A 3DQVA 3DBHB 3RCZA 3PSEB 4AUQC 5BYSA 2PJHA 3KUCB 3N20C 2LXAA 4HHVA 1E5WA 2JSVX 4RH6A 4J3OD 4L1RA 1UGJA 1T0QC 2DZJA 2IZVB 4MGYE 3VH4B 1N3HA 3PVLA 2MBQA 2DENB 2LGYA 5HE1A 1MI0A 1GGOA 2G4DB 2WXLA 2BS3B 1XKEA 4A6FA 3NG0A 1NTYA 2N9EB 2W9NA 4MSQB 2K5PA 1FRDA 1MHXA 2K6DB 2QILA 4JQWC 4NZLB 2JZPA 4B95A 2NBUA 1D5MC 4JKFA 2KC1A 5JHGA 1PFDA 2Z8LA 2LGDA 1C77A 3R2TA 4TUUA 3TVVA 1EO6A 3PHWB 1Y56A 4WWMA 3I63C 1GG3A 1MG4A 4IFSA 2YEPB 1Z2MA 1ZM0A 2GLSA 1YN4A 5JH5C 2YEPF 3ONSA 1IYFA 1RFAA 2JWUA 1G6JA 2J53A 3KYCD 1C4PA 1EVHA 2OEDA 2MCNB 4MGKE 4FLHA 3H7SA 4EFOA 1KF6B 1E7PB 1TTNA 1XXGA 4USAA 4GDLB 2MFQA 3R8BA 5C3JB 3PVWA 4G11A 1KBLA 2HRJA 2ELBA 4ZYNA 3NWDA 1EU4A 3FP5A 1QLBB 3V5WA 4IWOA 1D4BA 2M56B 4PK1A 2BYEA 4L1BA 3ZNID 1NI3A 4A8XC 2O6VB 2HD5B 4KZCA 4NQKE 2CB8A 4GLSC 2COAA 5IRSA 2IFSA 1V88A 4YSXB 1V80A 3IHPC 1ET9A 2ROVA 2YS5A 1GC6A 1K5DB 2DLBA 3P4QB 2MP2A 3Q3OC 3TMPB 3PSCA 2PW9A 4JKCA 3HW2B 4ZRIA 1WJMA 3NZSA 1SGHA 2CHZA 4KIKB 4ZRJA 3DBLI 1PGBA 3NVWA 1H10A 3C8YA 3LYYA 2YT1A 3KQ4A 3P63A 1WGKA 2LUEA 2UZSA 2KHWB 3SR6A 3ODXA 3I3TB 4WAAA 4W9HA 2KACA 2Z0OA 1ZDVA 4WJQA 3K9PB 3PTFC 2KKCA 2D10A 4M02A 3T9LA 4AOFA 3LJUX 2BTEA 4ZRQA 4TKNA 1U4AA 2W82A 1WGYA 2JRHA 3TW1A 4K81A 4D2KA 2NMQA 4YSYB 4HAZB 4FJVB 3AE2B 4HB0B 2QKLA 2R82A 2BYTA 5D94A 1PUTA 2PVOD 2PEAA 4BKSD 2WXFA 3DWMA 2OJRA 3RN9C 1TQZA 3SV1A 3L08A 3PG7A 2MLBA 2FJLA 2BCJA 2WXIA 5JHHA 2L8JA 1ACAA 4GU2A 3QBVB 5H92C 4XWXA 3WYFB 4KZ0A 1WGQA 4WURA 1HQRD 1WF9A 4BVUC 1ENFA 1I42A 1TXDA 3KUDB 1KJTA 1UNQA 4YONA 2D9YA 3GYPA 3EUB2 4A5KA 3TCAA 1EAZA 5HE0A 1V49A 2OTXA 3AEDB 1MG8A 2KDBA 1HB8A 2D4QA 1IGCA 1PDXA 2GBMA 4LJPB 3LB8C 4RM9A 3GZNB 1TJ6A 2BF8B 1R4NB 4K3BA 4OVUA 4ITKA 2XBBC 3KSYA 1Q0WB 1QC6A 2RGNB 2X18A 2BS2B 4P16A 2K6QA 4HDQA 1FEHA 2WXQA 1JRUA 1EWCA 2DHZA 1NI2A 5BMIA 2KDMA 1L4DB 5C1ZA 4YL8A 3AJ4A 4I6PA 2K8BA 2WX0A 3HVDA 3Q2AC 4Q2JA 3WAMA 2WXJA 3VUYA 1U2BA 1VD2A 4RFBA 3IVFA 3Q8EA 3T3NA 4EZKA 1U5GA 1KC7A 1C76A 1K51A 3MC0B 2NZ8B 2BPSA 3W1YA 3WAOA 3OANA 3A9JB 4WQMA 1HTQA 2KR0A 1TY0A 1FCCC 3FILA 2IYDB 2PIAA 4GIVA 2L05A 5AZFA 2SEBD 4X57B 3ZNGC 1YJJA 2LOZA 3D8FA 4JLCA 2FDQA 4KKIA 3U7DA 3NS8A 2R2YA 3NWFA 1LQBA 1R7SA 3N9YC 3U7ZA 3UIPB 3ZW3A 5FI1A 4K7UA 3ULBA 1JRPA 2LGSA 2BQQA 2Y8GA 4CYEA 3OG5A 1SIFA 3P4RB 2ADZA 1J0GA 2WXKA 3AI5A 3U8ZA 2PLPA 3EHVA 2BB5A 2K2UA 2C9WB 3ZJTA 3EFCA 3WCQA 1WXAA 1WM3A 1XT9B 1ZE3D 3PRPB 2BB6A 1V2YA 2PVGC 3DBRB 1WY8A 5TSSA 1P1AA 1L2NA 2PE6B 3VXWA 2Y5BB 3B1LX 1ZKHA 4WIPA 2RD0A 2GBNA 5DHAB 4KGSA 1J7AA 3QCAA 3N1ZC 5CHWA 4Y94A 2K8HA 4BBNF 3DXDA 2DNFA 1WXMA 4FA6A 3AH7A 2L52A 4DX90 1Q5WB 2K49A 4MJSA 1D5ZC 3B2GA 4NAWB 1YQBA 3IG3A 3QAQA 1FXIA 2KC2A 2INDC 3V62A 2P0DA 2N4FA 4HLEA 1MKEA 1KLUD 4LDTB 2V4LA 4DDID 2MH7A 4NJ7A 2Y7BA 3AE9B 1Q10A 1V1PB 4QJ4B 1KRHA 3DVNU 2UVMA 1UGMA 2N9LA 1WMHB 1MHHE 3RUIB 5JXVA 1WX8A 5HFYA 2L1AA 3N1XC 2ACZB 1JWAD 5JLJB 2DN6A 1Y8RC 4W9IA 5C16A 4AS1A 3OLMD 4YTPB 1XCGA 3DBLB 2JU6X 1IPGA 1SJHD 1WG7A 1GNUA 5GXGB 2WH5A 1V61A 2NBVA 2KTFA 4OT1A 4PS8A 4DQOC 3E66A 1ZXIA 2NS5A 3N7CA 1AN8A 1ZP0B 1JWSD 1F0ZA 2BKFA 3GE8C 4JE3B 4A3OA 2RDGA 3IFWB 4JK9A 5D3WA 2MJEA 2Z4DA 3PPAA 2KQ4X 1RRPB 1WIAA 3W9CB 2RVBB 4PYZA 1DROA 2B3AA 3QHTA 3ZKJC 4N58A 1SXTA 3KZ1A 1JWBD 3IAM1 3M95A 3MPXA 2NPTA 1RYJA 3X0WA 2KFKA 2V3NA 1GOZA 4W9JA 1MAIA 4MM3A 3WAPA 3O65B 4ANWA 1D5XC 1E7UA 1XLOA 5I2MA 4BKSA 4WWNA 3RZFA 4YWGG 2GI9A 1AWEA 3HHMA 3Q3FA 4R3DA 2L1CA 1GPXA 1K50A 1OQYA 2O6VD 1WI0A 4OW0A 2DLWA 4TSSA 2L0TA 3OJ4B 3AULA 1PYWD 3ZIMA 2QIEB 4IOYX 1WWTA 3SFDB 3N32A 1UNPA 1J7CA 2MBHA 2LGXA 4C56C 2LGIA 2D3CA 4P1BC 4AWJA 4ICUA 4MH8A 3MHSD 2YS3A 4DHZB 4G3XB 1V5UA 2KTRB 2KUQA 2JY6A 3DVGX 2HTHB 2WYQA 1OEYJ 2ZPNA 5JVLA 2NVUI 3DXEA 1Z5SB 4ANVA 1XR0B 3HIEA 1WXSA 2YSZA 3R7QA 3UINB 1STEA 4WWPA 3UQBA 3M63B 4QJ5B 4HWIB 3UZTA 2E2XA 4IM3A 1E90A 1KH0A 3HRDD 4KHBB 2XK5A 2N1VA 2KIEA 2JZZA 1XO3A 5AUKA 2JRIB 1A70A 5AUIA 2DIKA 2RNRB 2KDEB 2MKRA 2P0HA 4B0EA 5HHDG 2W55A 3F0WA 3NZ3A 4MEMA 5CX3A 3GP7A 1CJEA 2C7NB 1JMLA 2IGGA 2ZNVB 3TJPA 1ZC4B 3BVMA 3KWVA 2RPQA 4HJGE 4HKZE 4MSMB 3SFEB 1LB1A 2PTLA 2IY1B 3QA8A 3KH0A 4HSIA 1J19A 5CHVC 1HTOA 2I5CA 4HXDA 2LYDA 4XWWA 1VZ8A 5GMVA 4KDLB 1BMLC 2O2VB 1H8CA 4GZUA 5J18A 1GUAB 3QQ8B 1MK7B 1JWMD 3VR9B 3NVYA 1ZW7A 3BVGA 4ANUA 5LXHA 2R2QA 1KZ7A 1FD6A 3PRZA 3HSAA 2XQNM 1BTKA 2GRIA 4US8A 4H8SA 1SBBB 4GN1A 3SYXA 1YX5B 3KY9A 1XQQA 5D3YA 2KFJA 3R66C 4C7YA 4HAYB 3GZNI 3E9LA 2DAJA 4BBKA 2JVCA 4K3CA 4CHJA 4DX8A 3B08A 1FNVA 1VDVA 4NNJB 3RD2A 5G55A 4EZLA 2Z13A 4OZBA 3VAWA 4QJ3B 3ZJVA 2KO3A 2EELA 4OSNA 2BWES 5GOWB 4RF0A 4H2AA 1TZ1A 3SHQA 1S1QB 4EUTA 3E9SA 3DCXA 2V76A 1L0XB 4IM0A 2N7JA 3QJZA 2JX5A 4MT5A 1FHWA 5DIFB 2FCMA 4NSWA 1DDVA 5IA7A 1Z87A 2ABDA 3HK0A 1L0YB 1RJ2A 1YN3A 1F77A 3AE7B 1TZOA 2DYMA 2EC1A 2P0FA 2IDYA 2MA9B 4JK7A 5DCNA 1U27A 2ONQA 2CY5A 4GOUA 1T0RC 1WRDB 2LFIA 2Z59A 4BOZB 1UEFA 1VJKA 2JXTA 2KX0A 2N7DA 3P42A 2Y3AA 5KQ4A 1F1HA 2DHIA 3AM9A 1U5EA 3TBLD 5CLQB 2KLCA 3L0WB 2LRUA 2DYNA 2IYBA 3MTNB 5JHBA 1MI1A 3H1UA 3FAHA 1IGDA 2LVPA 1U5FA 1TYGB 2RSGA 2LWPA 4IW0A 1ESFA 4S17A 2QJLA 4CSQA 2DA0A 3DBRI 1NVLA 1BUIC 2FCSA 1RAXA 3T8MA 4E71A 3SBGA 5FKAC 4GDLA 3EECA 4JKEA 4DXAB 2VH2A 2X0SA 3MP9A 3TEXA 3W5VB 4K2PA 4CO7A 4XWTA 2DWQA 3RI7C 2W2XC 1NEKB 2MEKA 3I57A 3FLVA 2KGXB 1NBFC 2KUPA 3MC8A 3PGEA 4LDTD 2WDVB 1MK9B 3SD5A 1SJED 2LXCA 2KNBA 2ZPYA 2VRWB 5BMHA 1SE3A 1AW7A 2QSDA 1CZPA 3DHHC 2KWVB 2O6VA 2V3SA 4C00A 2K39A 3HM3A 2WDQB 1FCLA 4DHJD 4IWPA 5IOIA 5EE0A 2KAJA 2AQ1B 2EMSA 3VR8B 2ZNVC 1R4MB 2J0MA 3L4PA 2K9XA 2NTTA 1UPRA 3JSVB 3A58A 3JW0X 2I5FA 4KIKA 2DYOA 4B0MA 4A6QA 4LK0M 5J17A 2IPKD 2AL6A 2UWQA 3WALA 4CQNA 1AARA 3SNHA 1KOTA 3BY4B 4EKUA 4B6HA 3ZNHB 3P1MA 2K0PA 1DGJA 1LM8B 1OTRB 1N60A 1V86A 2ZZPB 4FXCA 5JZEB 1SE4A 2C60A 1HB6A 2YS1A 2H7DA 4ZHOA 3B9JA 3F5RA 3BINA 5DH9B 2E3TA 1RLFA 5DPSA 2M38A 2MX2A 4S0RA 1P5TA 1JCKB 2DZKA 3DBSA 2W2WA 2MP2B 5G5HA 2EJ8A 3H7PA 3CSTA 4FADA 5HE3A 1OFFA 2FCQA 1IP9A 2AEHA 2GCJA 4K7SA 3LJ3A 1XLQA 4IKGA 1TS5A 3T06A 3KVFB 2KXJA 1V81A 2EKIA 4Z2MB 2D07B 4RGOS 2K3UA 2RLOA 3ZDTA 4HATB 2KLGA 4PS7A 4ARCA 1CMXB 1EGXA 5AZGA 2Z0EB 5J3TA 3DVGY 4W9CA 4PS3A 2CODA 4MDKE 3ECIA 1T3QA 1E8YA 4ICVA 1GAQB 1QOFA 1UPQA 3TO1A 4JWUC 4FJYA 3PP2A 2HTME 1ZPSA 1P3RA 1WE6A 2W2XD 3KW5B 1C1YB 1NENB 3ZVRA 3B2FA 4NAMA 2G9HD 3T3OA 3X23A 3EGRA 3ZDMC 3G9WA 4XE0A 3IBEA 3SBTA 1C79A 4DDGD 2TSSA 5L81A 1M4VA 5KCVA 2DX5B 2L0FA 3AECB 3U2SC 1W1DA 4L6EA 2PZ1A 2LJ5A 5JHAA 3NW8A 4JKDA 4HAVB 3B0AA 1FXTB 2RQ1A 1T6BX 4WJ7A 2FIFA 4ILJA 5CTRC 2RGFA 3EFUA 3A9JA 2WQYB 3DVNV 3OAWA 2Y8FA 4IG7B 4YT0B 2C5LC 2L7RA 4ILGB 2ASQA 2K1FA 1EF5A 5G5GA 1E6EB 3CMMB 3WA0A 5D2MB 4II2B 2REXA 1QKZA 2WLBA 1VLBA 3ZXRA 1Y19B 2J4XA 2LULA 2G3QB 2HJ1A 2KIGA 2JF5A 3SU8X 1W1HA 2IO1B 4EE2A 3PS6A 2I1JA 4HEA1 3A1QB 2L00B 1LW3A 5M4YB 1V5TA 3R2IA 5KHOA 2AWTA 4GSWA 2KT7A 3CIKA 2INPE 4W9LA 3RNCC 4YSZB 4MY6A 1VBHA 2MQJA 2COPA 3FSSA 2D3GA 2LI5A 3JVZX 3V61A 1MJDA 1FO4A 3CSFA 1EUVB 2RRFA 3FILB 5T8IA 4JK8A 4LNNA 1E7VA 5CLLB 5D6JB 1WX9A 4WH4A 3A9KB 1J8CA 2WXRA 1UBIA 4KDIC 2KJHB 1HBKA 4WJNA 3VUWA 3PLVA 4AJWA 1ZOYB 3VRAB 4IDIA 2KANA 4KSKC 1L6UA 3HVZA 1UF0A 4PQ0A 4C4VB 4AQ7A 3NHEB 1FB8A 3PHXB 5E6PA 3ZLZA 3E56A 4DHZE 2MWSB 1MFWA 4E3CA 2KYWA 2WXPA 2CU3A 2IGHA 2WU5B 4AP4C 2YT0A 1V1PA 4NPNA 4A9AA 1UNSA 1GB1A 1TS2A 2IO2B 2ZKMX 4TQ0A 3E9PA 2KWUB 1V6EA 1SHCA 2KDIA 1KZGA 4GDKB 1WMHA 3ZQ4A 4A90A 1FMAD 2JP2A 4KHAA 1YIWA 1TS4A 2CJOA 2V9HA 1I4RA 4N9F4 1DYNA 3A8PA 2FJ9A 1FPYA 4K2OA 1SIJA 3VQIA 4HPLB 1T5XD 3L17A 4BKTA 1NU2A 3Q8BA 2KDFB 4DBBA 3URYA 4LTUA 4JKAA 4ZDVA 5CHFA 1F2RI 1ZC3B 4YTMB 3IT4B 4MJSB 3HM6X 4KX6B 2V3PA 2J7QB 1ISNA 4F1SA 2MW5A 3ZXVA 3ZJUA 1DOIA 2K8EA 4HB4B 2XNAC 5J3QA 2OOBB 3NVZA 2LHDA 3Q3NC 5IJMA 2N0YA 2RR9A 3I9V1 2LJIA 1M94A 1N6ZA 3KRWA 2JXXA 2N1WA 4JX1C 5DPRA 4WAFA 2BYVE 3ULCA 2GS0A 4WWOA 1UD7A 1QF6A 3APDA 3BK1A 5HI1A 5C2TB 1ZGUB 1KFYB 5C5BA 3PEGA 1HXYD 4KKJA 2KJ6A 2L3ZA 2G35A 1FOEA 3AU4A 1KLGD 1WRIA 2GCLA 4RMAA 4JWSC 1X1FA 4B9KA 3NOBA 4HK2A 1GB4A 1FXAA 2ROZB 2FUG1 3DHGC 3RYTA 2M4NA 4EMOA 4KSLC 5FR6A 2C7MB 2VH1A 3ML9A 3NJTA 1WGRA 3BZDB 3CWIA 3PRMB 2WXOA 4KGTA 5LLIA 4WVFB 2DZIA 1D3ZA 3I5JC 1C4AA 5D3IB 2KTRA 3W1SC 1V1OA 3KUZA 1TT5B 1FM0D 2D3AA 4OVZA 2KMMA 2BWFA 2HTHA 2KFKB 1OQNA 3UIOB 4HDOA 1DDMA 4ZOHC 1R4MI 4HAWB 4DBGA 2BYFA 2EKEC 3MJWA 1VBGA 2M8SA 2J52A 1PFJA 5BYRA 3R7RA 4C0AA 3L54A 4JKGA 3AEAB 4XYCA 4G0NB 3TEYA 3V6EB 1VCBA 4BKGA 2COCA 1T0YA 2L32A 4KGRA 2CS4A 2QKMA 3HIZA 1YN5A 3Q8AA 2BVCA 2JT4B 2UU7A 4M0WB 4WSFA 1XX0A 1I4QA 1V97A 4XX5A 2CR5A 3WIMA 1C3TA 1YJIA 2VSZA 4FULA 2RPVA 4G50A 4C80A 4ZRPA 1SEBD 2K25A 1XCQL 4HB3B 1JQ4A 3QX1A 2DTCA 3EC8A 1NYQA 3AB5A 3QWMA 1P7FA 4WQOB 3E9OA 2R2OA 2UZRA 4MGZE 1MVKA 2Z0PA 4OZCA 2CJNA 4EZJA 2D9VA 4GPTB 2H89B 4GGQA 2LEKA 2Y5CA 1L4ZB 1GJZA 3RNEC 1KI1B 4LNKA 4JL9A 3HQCA 1L0VB 3AE5B 2M1MA 4FBJB 3V3XA 1V5OA 2HJ8A 2KD0A 2N0SB 4LNIA 4RCOA 1YQ4B 2PPHA 5H8YE 3GYOA 1DIKA 1ZSQA 2FE8A 2J0KA 1MIXA 3AEEB 4W9EA 1WYWB 4RGNA 2VZKB 3ODOA 3RZWC 1WYGA 1WR1A 2RDBC 2N7EA 4M00A 5G2NA 1WJUA 2K8CA 4P1CC 4IUMB 1FGYA 4MK0A 3AN1A 4NJCA 1OQQA 2WNMA 3ZTCA 1SE2A 2WGSA 5I2SA 4M8NA 4K7WA 5I4DA 1VZ6A 3P2BA 2KOXA 4M01A 3TUOA 1PGXA 1C4CA 3L13A 2K00A 2IJ0A 1MPHA 2ICIA 4CHKA 2CKHB 4OZAA 4YTNB 4ANXA 1RM6C 5IN7A 1KLVA 4URKA 1C78A 3KYDD 2OHFA 4PYUA 4GOCA 4ZYSA 1V89A 1DYQA 4D0NB 2CY4A 4DWFA 2KMCA 3QK0A 4RGTA 4RM8A 1MPEA 4PT5A 5EE9A 1ROEA 2EMTA 1JALA 4W9FA 2Z0QA 3CIRB 2GOWA 3UQAA 1YQ3B 2FNJB 3L10B 1IBXB 2AX5A 3BWUD 3TSSA 1TY2A 2N9PC 1KTKA 2Q13A 2IO3B 5MPOA 2YLMA 4JIOU 5HE2A 1S3SG 1L6VA 1OQRA 4B6WA 1WFYA 1WGDA 4KV2A 1PQSA 1UZXB 3V6CB 5LG4B 5EE3A 1SSNA 1WJNA 4BZAA 2JZ3B 1PMSA 5BO4B 2JWZA 4ASWC 2GB1A 4HPMB 1I35A 3ZVVA 1CK1A 4N6EB 4HCNB 3V60A 3PVUA 4A6FB 1HA5A 4IOIE 1N61A 2KK8A 2WXGA 2QDFA 2N9XA 3CF6E 5IO9A 2KVRA 4HJKA 2M14A 2Z59B 3OHMB 3VHTC 4J6IA 3R3MA 1WGUA 2AYOB 2LZ6A 2HE7A 1V9JA 1E8XA 2WXNA 2WS3B 2KCJA 2BS4B 5L83A 3JYUA 4MT7A 3P7ZA 4CHMA 4N59A 2DBYA 3SUZA 1HEZE 3JSVA 2CHWA 4JGHB 1FNUA 3C19A 3BVZA 4WJOA 2GUMA 2A5UA 3MDBC 3Q14C 3VIAA 3L16A 2GBRA 2MJDA 3BIID 1FGZA 1E8ZA 4LJOB 1F9JA 2NTSA 1X1GA 1X05A 1M7EA 4D6WA 4RF1A 2KJRA 2LG1A 3QWZB 1D6EC 3ZTDA 2VRRB 5J3YA 1E10A 2D9WA 3Q69A 3KLSX 4RNAA 3PZ7A 4ZHPA 1WJ1A 1UBQA 1MIZB 1Y5OA 3M1IB 4HB2B 1IUEA 1DOXA 3DXCA 3VVWB 3PREA 2I38A 4XC2A 1LFDA 4A55A 2NMBA 3ENBA 2LOXA 1EWYC 3ZRFA 2YT2A 1RWSA 4I6NB 4IAPA 1FHXA 5JP4A 1FRRA 3OJ3A 2JQRB 2OJWA 4L2YA 2WDRB 4YXDB 3DOWA 4II3B 3U30A 1YD8U 1PGAA 2LD9A 2NR2A 2W54A 2N9KA 4F7GA 1WJ6A 3Q3JA 1DBHA 3Q6BA 4OHJA 3CXBB 4NY0A 1YOVB 2COFA 1TKYA 1XODA 3KRXA 1EF1A 3NZUA 2WXMA 1HZ5A 2MWNB 3NRZA 5LNK1 2AQ3B 5D27A 1TBEA 1Q67A 5E6NA 4RGMA 3RFZB 1EU3A 3ZO5B 2JYTA 3APCA 2M0XA 2WX1A 4REZA 3AE3B 3MFGA 2JYEA 2ZW1A 3O96A 2J59M 5KQ1A 4EJNA 1T0SC 1P98A 3DCGA 4M8MA 1WGGA 2LKOA 3QIJA 3M62B 4HVBA 1WE7A 4JPSA 2G1EA 3AE6B 3K9OB 2ZEQA 3H7PB 2R0DA 3EA6A 3A8QA 1U29A 5EDSA 1C9FA 2CHXA 4F7UP 1E0ZA 4I6LB 1F2RC 4A6KA 1WI1A 2D9XA 3VFKA 2AQ2B 2ZCCA 3VTVA 3GS2A 2MBBB 5BMGA 1I4GA 4XGAB 2K22A 1X86A 2DYBA 2BGFA 1BTNA 1NDDA 1VR9A 1QOBA 2DX5A 1XF5L 5D7GA 4OVVA 2MHJA 1LGRA 2XEWA 2H88B 3AEGB 4HAUB 2KQSA 2YVCA 4MGIE 3FEHA 1P0RA 3TIXA 4KAXB 3TL5A 1I4XA 2PKOA 5TR5A 1VZ7A 1XD3B 3MJ5A 1JROA 5DPTA 3ML4A 3AE4B 3H9DA 4W9DA 4A20A 1SB3C 3DDCB 3FVCA 5D3VA 2V1YA 5EFXA 3ML8A 3SO6A 3W1SA 5DI9B 2DHJA 3W2DA 4KVGB 2ZCBA 1OGWA 1LO5D 1QOGA 2MBEA 1T77A 2KX3A 2IGDA 1ST7A 1FFUA 3BJIA 1LXDA 3AEBB 2IBIB 2PMVA 2FIDA 4Z2NA 3P6AA 4W9KA 3O13A 3TEZA 2GJYA 1TS3A 1TJEA 3RNGC 2DHKA 4DXFA 1I7AA 1ZVRA 2GBKA 2RUKB 1ZXHA 3RNFC 3UI3A 1HE8A 2B76B 4DIXA 1OEYA 3A1QA 4UDUC 2D5GA 3A98B 3BK2A 2VKIA 2X38A 3RT3B 3IT6B 4TMAB 2J42A 2GMIC 1YMHE 4ARIA 4KHOA 3EPYA 3ABVB 3ZNZB 1V8CA 2VZKD 2ZVNA 2D2QA 3PLUA 4EEWA 1YX6B 4XDDA 5FK9C 3A9KA 1N63A 3VH3B 5KHQA 3ZUNA 3A4SC 1X11A 3ZYYX 2FAZA 5C79A 4W9GA 2Z0DB 2BT6A 4IWQA 1W1GA 4C4VA 1TIFA 4MH0E 1QZEA 1UUPA 5DHFB 4HROA 4F7HA 3BYTB 3N1YC 2D9ZA 4FHKA 1DDWA 1M7RA 1K8RB 2W3RA 3FM8C 2I1KA 2LHEA 1L7YA 4NAWA 2RSUA 3RCPA 3AXCA 1I7HA 1YJ1A 4AJYB 1F52A 1TGZB 1NTVA 3ODWA 4GDKA 3PZ8A 5EE1A 1CQVA 2KVZA 3N30A 3APFA 2QCZA 4GMXB 3GOEA 5IAAC 1QILA 4E74A 2Z14A 1XD4A 1UH6A 3V05A 1P9DU 2C7HA 5AZHA 3MHZA 3IAS1 1E9MA 1N5WA 2BW2A 3VTUA 2MSED 4PNKA 2CU1A 4HKQA 3H8HA 2DX1A 1XLNA
chains in the Genus database with same CATH topology
1BT0A 1PLSA 3PT2B 3C0RB 2MDXA 1RRBA 4LCDE 4A3PA 2LVQA 3S2AA 3DBHI 1JDEA 2N23A 2G45B 2GBJA 3RULA 2QHOA 2KN5A 1WXVA 1B55A 4DHJB 3PZDA 5D3XA 5E6OA 4NJ6A 3PV1A 2DKQA 3QARA 1K5GB 4MELA 1UELA 4NQLB 1U5DA 2YF0A 3ZRCA 5HKHA 4IC7B 4TYZA 1WZ0A 1FHOA 2BKRB 3ALBA 5AEKB 2NBWB 4XZ4A 4GB9A 4P7IA 2OQBA 1WGHA 4FHJA 1J0WA 2MRPA 2JPHA 2NBVB 2H7EA 3NY5A 1A5RA 4FJZA 3LDZE 2FUHB 3UGBB 4GXBA 2CRFA 2A4ZA 5C5BB 2K2JA 4FN2A 2ZVOA 1BAKA 4F7ZA 2NPTB 2G4SA 2M17A 5FI0A 2DFKA 4K1RB 1WH3A 1KM7A 1H4RA 4A6HA 5J2RA 2R09A 1OY2A 1I2HA 4GMVA 2DZMA 1WZ3A 2IY0B 4BFRA 1UNRA 2MBOA 2WDTB 3SDLC 2KMAA 2YRYA 1BWNA 3ENEA 3TFMA 4WJPA 4JKGB 4EOYA 4BOSC 3A33B 3DPDA 5C6RA 1V5MA 2ZJDA 3D8DA 1IRSA 4F8CB 1P6SA 2DKPA 1WR6E 3NSUA 3N3KB 2L2IA 2XK5B 2O2VA 2UYZB 4DK5A 1FAOA 3VOQA 4BBNC 4HAXB 1OMWA 1X1MA 5LXIB 2DAFA 1WX7A 2CAYA 2ELAA 3H6NA 2LVOA 5L95C 2J0JA 2LRWA 2FCNA 1QQGA 1E8WA 1Q1OA 2L76A 2IO0B 2DYQA 4ZRKA 1P3QU 4IM2A 3QC8B 2LBBA 2P8VA 3VUXA 3VTWA 1WVHA 2CQUA 4ILHA 4JKBA 5LONB 2NCNA 3UF8A 3D8EA 1WM2A 2LASA 3A4RA 5DPWA 1SE9A 3VDZA 2PE9A 1R4NI 2AL3A 3AU5A 4K17A 1NTIA 3WANA 5C23A 2KWCA 2WWZA 4HCPB 2KZRA 1GC7A 3M3JA 1WJ4A 4TV3A 2JUOA 3D32A 2D11A 1V5PA 1AQCA 2KQ7A 4TQ1A 5LOPB 4JKHA 3DQVA 3RCZA 3PSEB 4AUQC 2PJHA 3KUCB 2LXAA 4HHVA 1E5WA 2IZVB 2DZJA 4MGYE 3VH4B 1N3HA 3PVLA 2MBQA 2DENB 2LGYA 5HE1A 1GGOA 2G4DB 1XKEA 4A6FA 1NTYA 2N9EB 2W9NA 4MSQB 2K6DB 4JQWC 4B95A 2NBUA 4JKFA 2KC1A 5JHGA 2LGDA 4TUUA 3TVVA 1EO6A 3PHWB 1GG3A 4IFSA 1Z2MA 1ZM0A 5JH5C 3ONSA 1IYFA 1RFAA 1G6JA 3KYCD 1EVHA 2MCNB 4MGKE 4FLHA 3H7SA 4EFOA 1TTNA 4GDLB 2MFQA 3PVWA 4G11A 1KBLA 2HRJA 2ELBA 4ZYNA 3FP5A 3V5WA 4IWOA 2BYEA 3ZNID 2O6VB 2HD5B 4KZCA 4NQKE 2CB8A 2COAA 2IFSA 1V88A 1V80A 3IHPC 2ROVA 2YS5A 1GC6A 1K5DB 2MP2A 3TMPB 3PSCA 4JKCA 3HW2B 4ZRIA 1WJMA 3NZSA 1SGHA 2CHZA 4KIKB 4ZRJA 3DBLI 1H10A 2YT1A 2UZSA 2LUEA 2KHWB 3ODXA 3I3TB 4WAAA 4W9HA 2Z0OA 4WJQA 3K9PB 3PTFC 2KKCA 2D10A 3T9LA 4AOFA 3LJUX 4TKNA 1U4AA 1WGYA 2JRHA 3TW1A 4K81A 4HAZB 4FJVB 4HB0B 2QKLA 2R82A 5D94A 2PEAA 4BKSD 2OJRA 1TQZA 3SV1A 3L08A 3PG7A 2MLBA 2FJLA 2BCJA 5JHHA 2L8JA 1ACAA 4GU2A 3QBVB 4XWXA 3WYFB 4KZ0A 1WGQA 1WF9A 4BVUC 1I42A 1TXDA 3KUDB 1KJTA 1UNQA 4YONA 2D9YA 3GYPA 4A5KA 3TCAA 1EAZA 5HE0A 1V49A 2OTXA 1MG8A 2KDBA 1HB8A 2D4QA 2GBMA 4LJPB 4RM9A 1TJ6A 2BF8B 4OVUA 2XBBC 3KSYA 1Q0WB 1QC6A 2RGNB 2X18A 2K6QA 4HDQA 1JRUA 2DHZA 1NI2A 5C1ZA 4YL8A 3AJ4A 4I6PA 2K8BA 2WX0A 3WAMA 3VUYA 1U2BA 1VD2A 3IVFA 4EZKA 1U5GA 1KC7A 2NZ8B 2BPSA 3W1YA 3WAOA 3OANA 3A9JB 2IYDB 4GIVA 2L05A 5AZFA 4X57B 3ZNGC 2LOZA 3D8FA 4JLCA 2FDQA 3U7DA 3NS8A 1LQBA 3UIPB 3ZW3A 5FI1A 4K7UA 3ULBA 2Y8GA 4CYEA 1SIFA 2ADZA 1J0GA 3AI5A 3U8ZA 3EHVA 2K2UA 2C9WB 1WXAA 1WM3A 1XT9B 3PRPB 1V2YA 1WY8A 1P1AA 1L2NA 2PE6B 3VXWA 2Y5BB 3B1LX 1ZKHA 2RD0A 2GBNA 5DHAB 3QCAA 5CHWA 4Y94A 2K8HA 4BBNF 3DXDA 1WXMA 4FA6A 4DX90 1Q5WB 4MJSA 4NAWB 1YQBA 3IG3A 3QAQA 2KC2A 3V62A 2P0DA 2N4FA 4HLEA 1MKEA 4LDTB 2V4LA 4DDID 4NJ7A 2Y7BA 3DVNU 2UVMA 1UGMA 1WMHB 3RUIB 1WX8A 5JLJB 2DN6A 1Y8RC 4W9IA 5C16A 3OLMD 1XCGA 1IPGA 1WG7A 1GNUA 2WH5A 1V61A 2KTFA 4PS8A 3E66A 2NS5A 3N7CA 2BKFA 4A3OA 3IFWB 4JK9A 5D3WA 3PPAA 1RRPB 1WIAA 2RVBB 4PYZA 1DROA 2B3AA 3QHTA 3ZKJC 3KZ1A 3M95A 3MPXA 2NPTA 3X0WA 2KFKA 4W9JA 1MAIA 4MM3A 3WAPA 3O65B 4ANWA 1E7UA 4BKSA 4WWNA 3RZFA 3HHMA 1AWEA 3Q3FA 2L1CA 1OQYA 2O6VD 1WI0A 2DLWA 2L0TA 3OJ4B 3AULA 3ZIMA 4IOYX 3N32A 1UNPA 2MBHA 2LGXA 4AWJA 4ICUA 3MHSD 2YS3A 4DHZB 4G3XB 1V5UA 2KTRB 2JY6A 3DVGX 2HTHB 2WYQA 1OEYJ 2ZPNA 5JVLA 2NVUI 3DXEA 1Z5SB 4ANVA 1XR0B 1WXSA 2YSZA 3R7QA 3UINB 4WWPA 3UQBA 3M63B 4HWIB 3UZTA 2E2XA 4IM3A 1E90A 4KHBB 2XK5A 2N1VA 2JZZA 2JRIB 2DIKA 2RNRB 2KDEB 2MKRA 2P0HA 3F0WA 4MEMA 5CX3A 2C7NB 2ZNVB 3TJPA 1ZC4B 2RPQA 4MSMB 1LB1A 2IY1B 3QA8A 3KH0A 1J19A 5CHVC 2I5CA 4HXDA 2LYDA 5GMVA 4KDLB 2O2VB 1H8CA 4GZUA 5J18A 1GUAB 3QQ8B 1MK7B 1ZW7A 4ANUA 5LXHA 2R2QA 1KZ7A 3PRZA 2XQNM 1BTKA 4H8SA 4GN1A 3SYXA 1YX5B 3KY9A 1XQQA 5D3YA 2KFJA 3R66C 4HAYB 3GZNI 3E9LA 2DAJA 4BBKA 2JVCA 4CHJA 4DX8A 3B08A 4NNJB 3RD2A 5G55A 4EZLA 3VAWA 2KO3A 2BWES 5GOWB 1TZ1A 3SHQA 1S1QB 4EUTA 2V76A 4IM0A 3QJZA 1FHWA 5DIFB 2FCMA 4NSWA 1DDVA 5IA7A 1Z87A 2ABDA 3HK0A 1RJ2A 2DYMA 2EC1A 2P0FA 2MA9B 4JK7A 5DCNA 1U27A 2CY5A 1WRDB 4BOZB 1UEFA 2KX0A 2N7DA 5KQ4A 2DHIA 1U5EA 3TBLD 5CLQB 2KLCA 3L0WB 2LRUA 2DYNA 2IYBA 3MTNB 5JHBA 3H1UA 2LVPA 1U5FA 2RSGA 2LWPA 4IW0A 2DA0A 3DBRI 1NVLA 2FCSA 3T8MA 1RAXA 4E71A 3SBGA 4GDLA 3EECA 4JKEA 4DXAB 2X0SA 4K2PA 4CO7A 2W2XC 3FLVA 2KGXB 1NBFC 2KUPA 3PGEA 4LDTD 1MK9B 3SD5A 2LXCA 2KNBA 2ZPYA 2VRWB 2KWVB 2O6VA 2V3SA 2K39A 3HM3A 4DHJD 4IWPA 2EMSA 2ZNVC 2J0MA 1UPRA 3JSVB 3JW0X 2I5FA 4KIKA 2DYOA 5J17A 2AL6A 2UWQA 3WALA 1AARA 3SNHA 1KOTA 3BY4B 4EKUA 4B6HA 3ZNHB 1LM8B 1OTRB 1V86A 2ZZPB 5JZEB 2C60A 1HB6A 2YS1A 2H7DA 3F5RA 3BINA 5DH9B 1RLFA 5DPSA 2M38A 2MX2A 1P5TA 3DBSA 2DZKA 2W2WA 2MP2B 2EJ8A 3H7PA 3CSTA 4FADA 5HE3A 2FCQA 1IP9A 2AEHA 2GCJA 4K7SA 3LJ3A 3T06A 3KVFB 2KXJA 1V81A 4Z2MB 2D07B 2RLOA 3ZDTA 4HATB 2KLGA 4PS7A 1CMXB 1EGXA 5AZGA 2Z0EB 5J3TA 3DVGY 4W9CA 4PS3A 2CODA 4MDKE 3ECIA 1E8YA 4ICVA 1UPQA 3TO1A 4FJYA 3PP2A 1P3RA 1WE6A 2W2XD 3KW5B 1C1YB 3ZVRA 3X23A 3ZDMC 3G9WA 3IBEA 3SBTA 4DDGD 5L81A 5KCVA 2DX5B 2L0FA 1W1DA 4L6EA 2PZ1A 2LJ5A 5JHAA 4JKDA 4HAVB 3B0AA 1FXTB 2RQ1A 4WJ7A 2FIFA 4ILJA 5CTRC 2RGFA 3EFUA 3A9JA 3DVNV 3OAWA 2Y8FA 4IG7B 2C5LC 2L7RA 4ILGB 2ASQA 2K1FA 1EF5A 3CMMB 3WA0A 5D2MB 4II2B 2REXA 1Y19B 2LULA 2G3QB 2JF5A 3SU8X 1W1HA 2IO1B 3PS6A 2I1JA 3A1QB 2L00B 1LW3A 1V5TA 5KHOA 2AWTA 4GSWA 3CIKA 4W9LA 4MY6A 1VBHA 2MQJA 2COPA 3FSSA 2D3GA 2LI5A 3JVZX 3V61A 3CSFA 1EUVB 4JK8A 1E7VA 5CLLB 5D6JB 1WX9A 3A9KB 1J8CA 1UBIA 4KDIC 2KJHB 1HBKA 4WJNA 3VUWA 3PLVA 4AJWA 2KANA 4KSKC 4PQ0A 3NHEB 1FB8A 3PHXB 5E6PA 3ZLZA 4DHZE 2MWSB 4E3CA 4AP4C 2YT0A 4NPNA 2IO2B 4TQ0A 3E9PA 2KWUB 1V6EA 1SHCA 2KDIA 1KZGA 4GDKB 1WMHA 2JP2A 4KHAA 1YIWA 4N9F4 1DYNA 3A8PA 2FJ9A 4K2OA 3VQIA 4HPLB 3L17A 4BKTA 1NU2A 2KDFB 4DBBA 4JKAA 4ZDVA 5CHFA 1ZC3B 4MJSB 3HM6X 2J7QB 1ISNA 4F1SA 2MW5A 4HB4B 5J3QA 2OOBB 5IJMA 2N0YA 2RR9A 1M94A 2N1WA 3KRWA 2JXXA 5DPRA 2BYVE 3ULCA 2GS0A 4WWOA 1UD7A 3APDA 1ZGUB 5C5BA 3PEGA 2KJ6A 2L3ZA 2G35A 1FOEA 3AU4A 4RMAA 2GCLA 1X1FA 4B9KA 3NOBA 4HK2A 2ROZB 3RYTA 2M4NA 4EMOA 4KSLC 5FR6A 2C7MB 3ML9A 1WGRA 3PRMB 5LLIA 4WVFB 2DZIA 1D3ZA 2KTRA 3W1SC 3KUZA 2BWFA 2HTHA 2KFKB 1OQNA 3UIOB 4HDOA 1DDMA 1R4MI 4HAWB 4DBGA 2BYFA 2EKEC 3MJWA 1VBGA 2M8SA 1PFJA 3R7RA 4C0AA 3L54A 4JKGA 4G0NB 3V6EB 1VCBA 4BKGA 2COCA 1T0YA 2CS4A 2QKMA 3HIZA 2JT4B 4M0WB 4WSFA 1XX0A 4XX5A 2CR5A 3WIMA 1C3TA 2VSZA 4FULA 4G50A 2K25A 4HB3B 3QX1A 2DTCA 3EC8A 3QWMA 4WQOB 3E9OA 2R2OA 2UZRA 4MGZE 2Z0PA 4EZJA 2D9VA 4GPTB 4GGQA 1GJZA 1KI1B 4JL9A 3HQCA 2M1MA 4FBJB 1V5OA 2HJ8A 2KD0A 2PPHA 3GYOA 1DIKA 1ZSQA 2J0KA 1MIXA 4W9EA 1WYWB 3ODOA 3RZWC 1WR1A 2N7EA 5G2NA 1WJUA 2K8CA 4IUMB 1FGYA 4MK0A 3ZTCA 4M8NA 4K7WA 3P2BA 2KOXA 3L13A 2K00A 1MPHA 4CHKA 2CKHB 4ANXA 1KLVA 4URKA 3KYDD 4PYUA 4GOCA 1V89A 4D0NB 2CY4A 4DWFA 2KMCA 3QK0A 4RM8A 2EMTA 4W9FA 2Z0QA 2GOWA 3UQAA 2FNJB 3L10B 2N9PC 2Q13A 2IO3B 2YLMA 4JIOU 5HE2A 1S3SG 4B6WA 1WFYA 1WGDA 4KV2A 1PQSA 1UZXB 3V6CB 1WJNA 2JZ3B 1PMSA 5BO4B 2JWZA 4ASWC 4HPMB 1I35A 3ZVVA 4HCNB 3V60A 3PVUA 4A6FB 2KK8A 3CF6E 2N9XA 2KVRA 4HJKA 2M14A 2Z59B 3VHTC 4J6IA 3R3MA 1WGUA 2AYOB 2LZ6A 2HE7A 1V9JA 1E8XA 2KCJA 5L83A 3JYUA 4MT7A 3P7ZA 4CHMA 3SUZA 3JSVA 2CHWA 4JGHB 4WJOA 2A5UA 3MDBC 3VIAA 3L16A 2GBRA 1FGZA 1E8ZA 4LJOB 1F9JA 1X1GA 1X05A 1M7EA 2KJRA 2LG1A 3QWZB 3ZTDA 2VRRB 5J3YA 2D9WA 1WJ1A 1UBQA 1MIZB 1Y5OA 3M1IB 4HB2B 3DXCA 3VVWB 3PREA 4XC2A 1LFDA 2NMBA 3ENBA 2LOXA 3ZRFA 4I6NB 4IAPA 1FHXA 5JP4A 3OJ3A 3DOWA 4II3B 3U30A 1YD8U 2LD9A 2NR2A 4F7GA 1WJ6A 3Q3JA 1DBHA 3CXBB 4NY0A 2COFA 1XODA 3KRXA 1EF1A 3NZUA 2MWNB 5D27A 1TBEA 1Q67A 5E6NA 3ZO5B 3APCA 2M0XA 2WX1A 3O96A 3DCGA 2J59M 5KQ1A 4EJNA 1P98A 4M8MA 1WGGA 2LKOA 3QIJA 3M62B 4HVBA 1WE7A 3K9OB 2ZEQA 3H7PB 2R0DA 3A8QA 1U29A 5EDSA 2CHXA 4F7UP 4I6LB 4A6KA 1WI1A 2D9XA 3VFKA 2ZCCA 3VTVA 2MBBB 1X86A 2DYBA 2BGFA 1BTNA 1NDDA 2DX5A 5D7GA 4OVVA 2XEWA 4HAUB 2KQSA 2YVCA 4MGIE 3FEHA 1P0RA 3TIXA 4KAXB 3TL5A 5TR5A 1XD3B 5DPTA 3ML4A 3H9DA 4W9DA 4A20A 3DDCB 5D3VA 2V1YA 5EFXA 3ML8A 3SO6A 3W1SA 5DI9B 2DHJA 4KVGB 2ZCBA 1OGWA 2MBEA 2KX3A 1ST7A 3BJIA 1LXDA 2IBIB 2FIDA 4Z2NA 3P6AA 4W9KA 2GJYA 2DHKA 1I7AA 1ZVRA 2GBKA 2RUKB 1HE8A 1OEYA 3A1QA 3A98B 2VKIA 3RT3B 2GMIC 4KHOA 3EPYA 3ZNZB 2ZVNA 2D2QA 3PLUA 4EEWA 1YX6B 3A9KA 3VH3B 5KHQA 3ZUNA 3A4SC 1X11A 2FAZA 5C79A 4W9GA 2Z0DB 4IWQA 1W1GA 4MH0E 1QZEA 5DHFB 4F7HA 2D9ZA 4FHKA 1DDWA 1M7RA 1K8RB 3FM8C 2I1KA 1L7YA 4NAWA 2RSUA 3RCPA 3AXCA 1YJ1A 4AJYB 1TGZB 1NTVA 3ODWA 4GDKA 3N30A 3APFA 4GMXB 3GOEA 5IAAC 4E74A 1XD4A 1UH6A 1P9DU 2C7HA 5AZHA 3VTUA 2MSED 4PNKA 2CU1A 2DX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT0 A;  1PLS A;  3PT2 B;  3C0R B;  2MDX A;  1RRB A;  4LCD E;  4A3P A;  2LVQ A;  3S2A A;  3DBH I;  2N23 A;  2G45 B;  2GBJ A;  3RUL A;  2QHO A;  2KN5 A;  1WXV A;  1B55 A;  4DHJ B;  3PZD A;  5D3X A;  5E6O A;  4NJ6 A;  3PV1 A;  2DKQ A;  3QAR A;  1K5G B;  4MEL A;  1UEL A;  4NQL B;  1U5D A;  2YF0 A;  3ZRC A;  5HKH A;  4IC7 B;  4TYZ A;  1WZ0 A;  1FHO A;  2BKR B;  3ALB A;  5AEK B;  2NBW B;  4XZ4 A;  4GB9 A;  4P7I A;  2OQB A;  1WGH A;  4FHJ A;  1J0W A;  2MRP A;  2JPH A;  2NBV B;  2H7E A;  3NY5 A;  1A5R A;  4FJZ A;  3LDZ E;  2FUH B;  3UGB B;  4GXB A;  2CRF A;  2A4Z A;  5C5B B;  2K2J A;  4FN2 A;  2ZVO A;  1BAK A;  4F7Z A;  2NPT B;  2G4S A;  2M17 A;  5FI0 A;  2DFK A;  4K1R B;  1WH3 A;  1KM7 A;  1H4R A;  4A6H A;  5J2R A;  2R09 A;  1OY2 A;  1I2H A;  4GMV A;  2DZM A;  1WZ3 A;  2IY0 B;  4BFR A;  1UNR A;  2MBO A;  2WDT B;  3SDL C;  2KMA A;  2YRY A;  1BWN A;  3ENE A;  3TFM A;  4WJP A;  4EOY A;  4BOS C;  3A33 B;  3DPD A;  5C6R A;  1V5M A;  2ZJD A;  3D8D A;  1IRS A;  4F8C B;  1P6S A;  2DKP A;  1WR6 E;  3NSU A;  3N3K B;  2L2I A;  2XK5 B;  2O2V A;  2UYZ B;  4DK5 A;  1FAO A;  3VOQ A;  4BBN C;  4HAX B;  1OMW A;  1X1M A;  5LXI B;  2DAF A;  1WX7 A;  2CAY A;  2ELA A;  3H6N A;  2LVO A;  5L95 C;  2J0J A;  2LRW A;  2FCN A;  1QQG A;  1E8W A;  1Q1O A;  2L76 A;  2IO0 B;  2DYQ A;  4ZRK A;  1P3Q U;  4IM2 A;  3QC8 B;  2LBB A;  2P8V A;  3VUX A;  3VTW A;  1WVH A;  2CQU A;  5LON B;  2NCN A;  3UF8 A;  3D8E A;  1WM2 A;  2LAS A;  3A4R A;  5DPW A;  1SE9 A;  3VDZ A;  2PE9 A;  1R4N I;  2AL3 A;  3AU5 A;  4K17 A;  1NTI A;  3WAN A;  5C23 A;  2KWC A;  2WWZ A;  4HCP B;  2KZR A;  1GC7 A;  3M3J A;  1WJ4 A;  4TV3 A;  2JUO A;  3D32 A;  2D11 A;  1V5P A;  1AQC A;  2KQ7 A;  4TQ1 A;  5LOP B;  3DQV A;  3RCZ A;  3PSE B;  4AUQ C;  2PJH A;  3KUC B;  2LXA A;  4HHV A;  1E5W A;  2IZV B;  2DZJ A;  4MGY E;  3VH4 B;  1N3H A;  3PVL A;  2MBQ A;  2DEN B;  2LGY A;  5HE1 A;  2G4D B;  1XKE A;  4A6F A;  1NTY A;  2N9E B;  2W9N A;  4MSQ B;  2K6D B;  4JQW C;  4B95 A;  2NBU A;  2KC1 A;  5JHG A;  2LGD A;  4TUU A;  3TVV A;  1EO6 A;  3PHW B;  1GG3 A;  4IFS A;  1Z2M A;  1ZM0 A;  5JH5 C;  3ONS A;  1IYF A;  1RFA A;  1G6J A;  3KYC D;  1EVH A;  2MCN B;  4MGK E;  4FLH A;  3H7S A;  4EFO A;  1TTN A;  4GDL B;  2MFQ A;  3PVW A;  4G11 A;  2HRJ A;  2ELB A;  4ZYN A;  3FP5 A;  3V5W A;  4IWO A;  2BYE A;  3ZNI D;  2O6V B;  2HD5 B;  4KZC A;  4NQK E;  2CB8 A;  2COA A;  2IFS A;  1V88 A;  1V80 A;  3IHP C;  2ROV A;  2YS5 A;  1GC6 A;  1K5D B;  2MP2 A;  3TMP B;  3PSC A;  3HW2 B;  4ZRI A;  1WJM A;  3NZS A;  1SGH A;  2CHZ A;  4KIK B;  4ZRJ A;  3DBL I;  1H10 A;  2YT1 A;  2UZS A;  2LUE A;  2KHW B;  3ODX A;  3I3T B;  4WAA A;  4W9H A;  2Z0O A;  4WJQ A;  3K9P B;  3PTF C;  2KKC A;  2D10 A;  3T9L A;  4AOF A;  3LJU X;  4TKN A;  1U4A A;  1WGY A;  2JRH A;  3TW1 A;  4K81 A;  4HAZ B;  4FJV B;  4HB0 B;  2QKL A;  5D94 A;  2PEA A;  4BKS D;  2OJR A;  1TQZ A;  3SV1 A;  3L08 A;  3PG7 A;  2MLB A;  2FJL A;  2BCJ A;  5JHH A;  2L8J A;  1ACA A;  4GU2 A;  3QBV B;  4XWX A;  3WYF B;  4KZ0 A;  1WGQ A;  1WF9 A;  4BVU C;  1I42 A;  1TXD A;  3KUD B;  1KJT A;  1UNQ A;  4YON A;  2D9Y A;  3GYP A;  4A5K A;  3TCA A;  1EAZ A;  5HE0 A;  1V49 A;  2OTX A;  1MG8 A;  2KDB A;  1HB8 A;  2D4Q A;  2GBM A;  4LJP B;  4RM9 A;  1TJ6 A;  2BF8 B;  4OVU A;  2XBB C;  3KSY A;  1Q0W B;  1QC6 A;  2RGN B;  2X18 A;  2K6Q A;  4HDQ A;  1JRU A;  2DHZ A;  1NI2 A;  5C1Z A;  4YL8 A;  3AJ4 A;  4I6P A;  2K8B A;  2WX0 A;  3WAM A;  3VUY A;  1U2B A;  1VD2 A;  3IVF A;  4EZK A;  1U5G A;  2NZ8 B;  2BPS A;  3W1Y A;  3WAO A;  3OAN A;  3A9J B;  2IYD B;  4GIV A;  2L05 A;  5AZF A;  4X57 B;  3ZNG C;  2LOZ A;  3D8F A;  4JLC A;  2FDQ A;  3U7D A;  3NS8 A;  1LQB A;  3UIP B;  3ZW3 A;  5FI1 A;  4K7U A;  3ULB A;  2Y8G A;  4CYE A;  1SIF A;  2ADZ A;  1J0G A;  3AI5 A;  3U8Z A;  3EHV A;  2K2U A;  2C9W B;  1WXA A;  1WM3 A;  1XT9 B;  3PRP B;  1V2Y A;  1WY8 A;  1P1A A;  1L2N A;  2PE6 B;  3VXW A;  2Y5B B;  3B1L X;  1ZKH A;  2RD0 A;  2GBN A;  5DHA B;  3QCA A;  5CHW A;  4Y94 A;  2K8H A;  4BBN F;  3DXD A;  1WXM A;  4FA6 A;  4DX9 0;  1Q5W B;  4MJS A;  4NAW B;  1YQB A;  3IG3 A;  3QAQ A;  2KC2 A;  3V62 A;  2P0D A;  2N4F A;  4HLE A;  1MKE A;  4LDT B;  2V4L A;  4DDI D;  4NJ7 A;  2Y7B A;  3DVN U;  2UVM A;  1UGM A;  1WMH B;  3RUI B;  1WX8 A;  5JLJ B;  2DN6 A;  1Y8R C;  4W9I A;  5C16 A;  3OLM D;  1XCG A;  1IPG A;  1WG7 A;  1GNU A;  2WH5 A;  1V61 A;  2KTF A;  4PS8 A;  2NS5 A;  3N7C A;  2BKF A;  4A3O A;  3IFW B;  5D3W A;  3PPA A;  1RRP B;  1WIA A;  2RVB B;  4PYZ A;  1DRO A;  2B3A A;  3QHT A;  3ZKJ C;  3KZ1 A;  3M95 A;  3MPX A;  2NPT A;  3X0W A;  2KFK A;  4W9J A;  1MAI A;  4MM3 A;  3WAP A;  3O65 B;  4ANW A;  1E7U A;  4BKS A;  4WWN A;  3RZF A;  3HHM A;  1AWE A;  3Q3F A;  2L1C A;  1OQY A;  2O6V D;  1WI0 A;  2DLW A;  2L0T A;  3OJ4 B;  3AUL A;  3ZIM A;  4IOY X;  3N32 A;  1UNP A;  2MBH A;  2LGX A;  4AWJ A;  4ICU A;  3MHS D;  2YS3 A;  4DHZ B;  4G3X B;  1V5U A;  2KTR B;  2JY6 A;  3DVG X;  2HTH B;  2WYQ A;  1OEY J;  2ZPN A;  2NVU I;  3DXE A;  1Z5S B;  4ANV A;  1XR0 B;  1WXS A;  2YSZ A;  3R7Q A;  3UIN B;  4WWP A;  3UQB A;  3M63 B;  4HWI B;  3UZT A;  2E2X A;  4IM3 A;  1E90 A;  4KHB B;  2XK5 A;  2N1V A;  2JZZ A;  2JRI B;  2RNR B;  2KDE B;  2MKR A;  2P0H A;  3F0W A;  4MEM A;  5CX3 A;  2C7N B;  2ZNV B;  3TJP A;  1ZC4 B;  2RPQ A;  4MSM B;  1LB1 A;  2IY1 B;  3QA8 A;  3KH0 A;  1J19 A;  5CHV C;  2I5C A;  4HXD A;  2LYD A;  5GMV A;  4KDL B;  2O2V B;  1H8C A;  4GZU A;  5J18 A;  1GUA B;  3QQ8 B;  1MK7 B;  1ZW7 A;  4ANU A;  5LXH A;  2R2Q A;  1KZ7 A;  3PRZ A;  2XQN M;  1BTK A;  4H8S A;  4GN1 A;  3SYX A;  1YX5 B;  3KY9 A;  1XQQ A;  5D3Y A;  2KFJ A;  3R66 C;  4HAY B;  3GZN I;  2DAJ A;  4BBK A;  2JVC A;  4CHJ A;  4DX8 A;  3B08 A;  4NNJ B;  3RD2 A;  5G55 A;  4EZL A;  3VAW A;  2KO3 A;  2BWE S;  5GOW B;  1TZ1 A;  3SHQ A;  1S1Q B;  4EUT A;  2V76 A;  4IM0 A;  3QJZ A;  1FHW A;  5DIF B;  2FCM A;  4NSW A;  1DDV A;  5IA7 A;  1Z87 A;  2ABD A;  3HK0 A;  1RJ2 A;  2DYM A;  2EC1 A;  2P0F A;  2MA9 B;  5DCN A;  1U27 A;  2CY5 A;  1WRD B;  4BOZ B;  1UEF A;  2KX0 A;  2N7D A;  5KQ4 A;  2DHI A;  1U5E A;  3TBL D;  5CLQ B;  2KLC A;  3L0W B;  2LRU A;  2DYN A;  2IYB A;  3MTN B;  5JHB A;  3H1U A;  2LVP A;  1U5F A;  2RSG A;  2LWP A;  4IW0 A;  2DA0 A;  3DBR I;  1NVL A;  2FCS A;  3T8M A;  1RAX A;  4E71 A;  4GDL A;  3EEC A;  4DXA B;  4K2P A;  4CO7 A;  2W2X C;  3FLV A;  2KGX B;  1NBF C;  2KUP A;  3PGE A;  4LDT D;  1MK9 B;  3SD5 A;  2LXC A;  2KNB A;  2ZPY A;  2VRW B;  2KWV B;  2O6V A;  2V3S A;  2K39 A;  3HM3 A;  4DHJ D;  4IWP A;  2EMS A;  2ZNV C;  2J0M A;  1UPR A;  3JSV B;  3JW0 X;  2I5F A;  4KIK A;  2DYO A;  5J17 A;  2AL6 A;  2UWQ A;  3WAL A;  1AAR A;  3SNH A;  1KOT A;  3BY4 B;  4EKU A;  4B6H A;  3ZNH B;  1LM8 B;  1OTR B;  1V86 A;  2ZZP B;  5JZE B;  2C60 A;  1HB6 A;  2YS1 A;  2H7D A;  3F5R A;  3BIN A;  5DH9 B;  1RLF A;  5DPS A;  2M38 A;  2MX2 A;  1P5T A;  3DBS A;  2DZK A;  2W2W A;  2MP2 B;  2EJ8 A;  3H7P A;  3CST A;  4FAD A;  5HE3 A;  2FCQ A;  1IP9 A;  2AEH A;  2GCJ A;  4K7S A;  3LJ3 A;  3T06 A;  3KVF B;  2KXJ A;  1V81 A;  4Z2M B;  2D07 B;  2RLO A;  3ZDT A;  4HAT B;  2KLG A;  4PS7 A;  1CMX B;  1EGX A;  5AZG A;  2Z0E B;  5J3T A;  3DVG Y;  4W9C A;  4PS3 A;  2COD A;  4MDK E;  3ECI A;  1E8Y A;  4ICV A;  1UPQ A;  3TO1 A;  4FJY A;  3PP2 A;  1P3R A;  1WE6 A;  2W2X D;  3KW5 B;  1C1Y B;  3ZVR A;  3X23 A;  3ZDM C;  3G9W A;  3IBE A;  4DDG D;  5L81 A;  5KCV A;  2DX5 B;  2L0F A;  1W1D A;  4L6E A;  2PZ1 A;  2LJ5 A;  5JHA A;  4HAV B;  3B0A A;  1FXT B;  2RQ1 A;  4WJ7 A;  2FIF A;  5CTR C;  2RGF A;  3EFU A;  3A9J A;  3DVN V;  3OAW A;  2Y8F A;  4IG7 B;  2C5L C;  2L7R A;  2ASQ A;  2K1F A;  1EF5 A;  3CMM B;  3WA0 A;  5D2M B;  4II2 B;  2REX A;  1Y19 B;  2LUL A;  2G3Q B;  2JF5 A;  3SU8 X;  1W1H A;  2IO1 B;  3PS6 A;  2I1J A;  3A1Q B;  2L00 B;  1LW3 A;  1V5T A;  5KHO A;  2AWT A;  4GSW A;  3CIK A;  4W9L A;  4MY6 A;  2MQJ A;  2COP A;  3FSS A;  2D3G A;  2LI5 A;  3JVZ X;  3V61 A;  3CSF A;  1EUV B;  1E7V A;  5CLL B;  5D6J B;  1WX9 A;  3A9K B;  1J8C A;  1UBI A;  4KDI C;  2KJH B;  1HBK A;  4WJN A;  3VUW A;  3PLV A;  4AJW A;  2KAN A;  4KSK C;  4PQ0 A;  3NHE B;  1FB8 A;  3PHX B;  5E6P A;  3ZLZ A;  4DHZ E;  2MWS B;  4E3C A;  4AP4 C;  2YT0 A;  4NPN A;  2IO2 B;  4TQ0 A;  2KWU B;  1V6E A;  1SHC A;  2KDI A;  1KZG A;  4GDK B;  1WMH A;  2JP2 A;  4KHA A;  1YIW A;  4N9F 4;  1DYN A;  3A8P A;  2FJ9 A;  4K2O A;  3VQI A;  4HPL B;  3L17 A;  4BKT A;  1NU2 A;  2KDF B;  4DBB A;  4ZDV A;  5CHF A;  1ZC3 B;  4MJS B;  3HM6 X;  2J7Q B;  1ISN A;  4F1S A;  2MW5 A;  4HB4 B;  5J3Q A;  2OOB B;  5IJM A;  2N0Y A;  2RR9 A;  1M94 A;  2N1W A;  3KRW A;  2JXX A;  5DPR A;  2BYV E;  3ULC A;  2GS0 A;  4WWO A;  1UD7 A;  3APD A;  1ZGU B;  5C5B A;  3PEG A;  2KJ6 A;  2L3Z A;  2G35 A;  1FOE A;  3AU4 A;  4RMA A;  2GCL A;  1X1F A;  4B9K A;  3NOB A;  4HK2 A;  2ROZ B;  3RYT A;  2M4N A;  4EMO A;  4KSL C;  5FR6 A;  2C7M B;  3ML9 A;  1WGR A;  3PRM B;  5LLI A;  4WVF B;  2DZI A;  1D3Z A;  2KTR A;  3W1S C;  3KUZ A;  2BWF A;  2HTH A;  2KFK B;  1OQN A;  3UIO B;  4HDO A;  1DDM A;  1R4M I;  4HAW B;  4DBG A;  2BYF A;  2EKE C;  3MJW A;  2M8S A;  1PFJ A;  3R7R A;  4C0A A;  3L54 A;  4G0N B;  3V6E B;  1VCB A;  4BKG A;  2COC A;  1T0Y A;  2CS4 A;  2QKM A;  3HIZ A;  2JT4 B;  4M0W B;  4WSF A;  1XX0 A;  4XX5 A;  2CR5 A;  3WIM A;  1C3T A;  2VSZ A;  4FUL A;  4G50 A;  2K25 A;  4HB3 B;  3QX1 A;  2DTC A;  3EC8 A;  3QWM A;  4WQO B;  2R2O A;  4MGZ E;  2UZR A;  2Z0P A;  4EZJ A;  2D9V A;  4GPT B;  4GGQ A;  1GJZ A;  1KI1 B;  4JL9 A;  3HQC A;  2M1M A;  4FBJ B;  1V5O A;  2HJ8 A;  2KD0 A;  2PPH A;  3GYO A;  1ZSQ A;  2J0K A;  1MIX A;  4W9E A;  1WYW B;  3ODO A;  3RZW C;  1WR1 A;  2N7E A;  5G2N A;  1WJU A;  2K8C A;  4IUM B;  1FGY A;  4MK0 A;  3ZTC A;  4M8N A;  4K7W A;  3P2B A;  2KOX A;  3L13 A;  2K00 A;  1MPH A;  4CHK A;  2CKH B;  4ANX A;  1KLV A;  4URK A;  3KYD D;  4PYU A;  4GOC A;  1V89 A;  4D0N B;  2CY4 A;  4DWF A;  2KMC A;  3QK0 A;  4RM8 A;  2EMT A;  4W9F A;  2Z0Q A;  2GOW A;  3UQA A;  2FNJ B;  3L10 B;  2N9P C;  2Q13 A;  2IO3 B;  2YLM A;  4JIO U;  5HE2 A;  1S3S G;  4B6W A;  1WFY A;  1WGD A;  4KV2 A;  1PQS A;  1UZX B;  3V6C B;  1WJN A;  2JZ3 B;  1PMS A;  5BO4 B;  2JWZ A;  4ASW C;  4HPM B;  1I35 A;  3ZVV A;  4HCN B;  3V60 A;  3PVU A;  4A6F B;  2KK8 A;  3CF6 E;  2N9X A;  2KVR A;  4HJK A;  2M14 A;  2Z59 B;  3VHT C;  4J6I A;  3R3M A;  1WGU A;  2AYO B;  2LZ6 A;  2HE7 A;  1V9J A;  1E8X A;  2KCJ A;  5L83 A;  3JYU A;  4MT7 A;  3P7Z A;  4CHM A;  3SUZ A;  3JSV A;  2CHW A;  4JGH B;  4WJO A;  2A5U A;  3MDB C;  3VIA A;  3L16 A;  2GBR A;  1FGZ A;  1E8Z A;  4LJO B;  1F9J A;  1X1G A;  1X05 A;  1M7E A;  2KJR A;  2LG1 A;  3QWZ B;  3ZTD A;  2VRR B;  5J3Y A;  2D9W A;  1WJ1 A;  1UBQ A;  1MIZ B;  1Y5O A;  3M1I B;  4HB2 B;  3DXC A;  3VVW B;  3PRE A;  4XC2 A;  1LFD A;  2NMB A;  2LOX A;  3ZRF A;  4I6N B;  4IAP A;  1FHX A;  5JP4 A;  3OJ3 A;  3DOW A;  4II3 B;  3U30 A;  1YD8 U;  2LD9 A;  2NR2 A;  4F7G A;  1WJ6 A;  3Q3J A;  1DBH A;  3CXB B;  4NY0 A;  2COF A;  1XOD A;  3KRX A;  1EF1 A;  3NZU A;  2MWN B;  5D27 A;  1TBE A;  1Q67 A;  5E6N A;  3ZO5 B;  3APC A;  2M0X A;  2WX1 A;  3O96 A;  3DCG A;  2J59 M;  5KQ1 A;  4EJN A;  1P98 A;  4M8M A;  1WGG A;  2LKO A;  3QIJ A;  3M62 B;  4HVB A;  1WE7 A;  3K9O B;  2ZEQ A;  3H7P B;  2R0D A;  3A8Q A;  1U29 A;  5EDS A;  2CHX A;  4F7U P;  4I6L B;  4A6K A;  1WI1 A;  2D9X A;  3VFK A;  2ZCC A;  3VTV A;  2MBB B;  1X86 A;  2DYB A;  2BGF A;  1BTN A;  1NDD A;  2DX5 A;  5D7G A;  4OVV A;  2XEW A;  4HAU B;  2KQS A;  2YVC A;  4MGI E;  3FEH A;  1P0R A;  3TIX A;  4KAX B;  3TL5 A;  5TR5 A;  1XD3 B;  5DPT A;  3ML4 A;  3H9D A;  4W9D A;  4A20 A;  3DDC B;  5D3V A;  2V1Y A;  5EFX A;  3ML8 A;  3SO6 A;  3W1S A;  5DI9 B;  2DHJ A;  4KVG B;  2ZCB A;  1OGW A;  2MBE A;  2KX3 A;  1ST7 A;  3BJI A;  1LXD A;  2IBI B;  2FID A;  4Z2N A;  3P6A A;  4W9K A;  2GJY A;  2DHK A;  1I7A A;  1ZVR A;  2GBK A;  2RUK B;  1HE8 A;  1OEY A;  3A1Q A;  3A98 B;  2VKI A;  3RT3 B;  2GMI C;  4KHO A;  3EPY A;  3ZNZ B;  2ZVN A;  2D2Q A;  3PLU A;  4EEW A;  1YX6 B;  3A9K A;  3VH3 B;  5KHQ A;  3ZUN A;  3A4S C;  1X11 A;  2FAZ A;  5C79 A;  4W9G A;  2Z0D B;  4IWQ A;  1W1G A;  4MH0 E;  1QZE A;  5DHF B;  4F7H A;  2D9Z A;  4FHK A;  1DDW A;  1M7R A;  1K8R B;  3FM8 C;  2I1K A;  1L7Y A;  4NAW A;  2RSU A;  3RCP A;  3AXC A;  1YJ1 A;  4AJY B;  1TGZ B;  1NTV A;  3ODW A;  4GDK A;  3N30 A;  3APF A;  4GMX B;  3GOE A;  5IAA C;  4E74 A;  1XD4 A;  1UH6 A;  1P9D U;  2C7H A;  5AZH A;  3VTU A;  2MSE D;  4PNK A;  2CU1 A;  2DX1 A; 
#chains in the Genus database with same CATH topology
 1BT0 A;  1B1Z A;  1PLS A;  3PT2 B;  3DHI C;  3AMZ A;  3P4P B;  3C0R B;  4QXA B;  2MDX A;  1RRB A;  4HRS A;  4LCD E;  4A3P A;  2LVQ A;  2XN9 C;  1I4P A;  3DBH I;  3AEF B;  3S2A A;  1JDE A;  2N23 A;  3PO0 A;  4DXG A;  1VRA B;  2G45 B;  5IP4 D;  2GBJ A;  3RUL A;  2QHO A;  2KN5 A;  3GE3 C;  1WXV A;  3HUI A;  1J7B A;  1B55 A;  1K53 A;  1QT9 A;  1XEE A;  2WU2 B;  3RNA C;  4DHJ B;  3PZD A;  5D3X A;  3Q8C A;  1HZ6 A;  5E6O A;  4NJ6 A;  3PV1 A;  2DKQ A;  3QAR A;  1K5G B;  4MEL A;  3AE1 B;  2V4I B;  1L5P A;  1UEL A;  4NQL B;  1I4H A;  2RDH A;  1U5D A;  2YF0 A;  3ZRC A;  5HKH A;  4IC7 B;  4TYZ A;  1WZ0 A;  2RMM A;  4US9 A;  1FHO A;  2BKR B;  3ALB A;  3OWE B;  4O1N A;  3ZGZ A;  5AEK B;  2NBW B;  4XZ4 A;  4GB9 A;  4P7I A;  5IKC M;  2OQB A;  1WGH A;  4FHJ A;  2WXH A;  1J0W A;  2MRP A;  1AYF A;  5E6J A;  1TKE A;  2W3S A;  2V0G A;  2JPH A;  2NBV B;  2X8X X;  1B9R A;  2INN E;  4LLG M;  4P6V F;  2H7E A;  3FKY A;  3NY5 A;  1A5R A;  2WP9 B;  3RMK C;  2BBC A;  2QEJ C;  4FJZ A;  5BYQ A;  3LDZ E;  2FUH B;  1FNW A;  3UGB B;  4GXB A;  1QOA A;  2FBW B;  2CRF A;  3RPF C;  3U52 E;  2A4Z A;  5C5B B;  1XLP A;  2K2J A;  3IXS A;  3MC9 A;  4FN2 A;  2ZVO A;  1BAK A;  4F7Z A;  1WXQ A;  2NPT B;  2G4S A;  2KWD A;  5FI0 A;  2M17 A;  1NYR A;  2DFK A;  4K1R B;  4MM3 B;  3LXF A;  4MAC A;  1WH3 A;  1KM7 A;  1P7E A;  1H4R A;  2LMC A;  4A6H A;  5J2R A;  2R09 A;  2Q5W D;  1OY2 A;  1I2H A;  4GMV A;  2DZM A;  4M0W A;  1WZ3 A;  2IY0 B;  1JW9 D;  4ACF A;  4L23 A;  4BFR A;  2E6X A;  3VRB B;  4KHB A;  2KN4 A;  2LUM A;  3J9C A;  2ZW0 A;  3Q3M C;  1FFV A;  1UNR A;  4GNK B;  2MBO A;  2WDT B;  1UWX A;  3U4E G;  1TKG A;  2I2Y A;  3SDL C;  2KMA A;  1JWU D;  2YRY A;  4LNF A;  1NVI D;  1RFK A;  2R61 A;  1EM7 A;  1BWN A;  2SAK A;  2ON8 A;  3ENE A;  3TFM A;  4WJP A;  4JKG B;  1WSP A;  2QC8 A;  1AWD A;  1SF0 A;  5HG2 A;  3Q8F A;  4LNO A;  4EOY A;  4BOS C;  3SEB A;  3A33 B;  3DPD A;  3TEW A;  5C6R A;  2QMT A;  1V5M A;  2ZJD A;  3W5U B;  3D8D A;  1IRS A;  4C7Z A;  4F8C B;  1P6S A;  2DKP A;  4QAY A;  1WR6 E;  3NSU A;  3N3K B;  2L2I A;  2XK5 B;  2O2V A;  1DOY A;  2UYZ B;  4DK5 A;  5FR3 A;  1FAO A;  3NUH B;  3VOQ A;  4BBN C;  1BXT A;  4HAX B;  3AE8 B;  1OMW A;  1X1M A;  5LXI B;  3U12 A;  2DAF A;  3DWG C;  1WX7 A;  2CAY A;  2ELA A;  3H6N A;  2LVO A;  5L95 C;  1ACC A;  2J0J A;  2LRW A;  1ZDX A;  3RNB C;  2FCN A;  1QQG A;  1E8W A;  1Q1O A;  1N62 A;  3FC4 A;  2L76 A;  4BAX A;  4HPP A;  1XCT L;  2L83 A;  2IO0 B;  2DYQ A;  4ZRK A;  1P3Q U;  4IM2 A;  4XDC A;  1UWM A;  3KWL A;  3QC8 B;  2LBB A;  2M0A A;  3AV8 A;  2Y5P A;  3NWA A;  2WHI A;  2P8V A;  3VUX A;  5D3D A;  3VTW A;  1WVH A;  1ET6 A;  2CQU A;  4ILH A;  4JKB A;  5LON B;  2FJU B;  2M19 A;  2MJ3 A;  2NCN A;  3UF8 A;  1YNT E;  3D8E A;  2HDE A;  1QQR A;  1WM2 A;  2LAS A;  3ETR A;  3A4R A;  5DPW A;  1SE9 A;  2D3B A;  3VDZ A;  3P4S B;  1ZUD 2;  1FIQ A;  3B77 A;  1ZYI A;  2PE9 A;  1R4N I;  2AL3 A;  3NS1 A;  3NVV A;  3AU5 A;  4K17 A;  1NTI A;  3WAN A;  5C23 A;  1N5X A;  2KWC A;  2WWZ A;  4HCP B;  2KZR A;  1GC7 A;  3M3J A;  1IBX A;  1WJ4 A;  4TV3 A;  2JUO A;  2INC C;  3D32 A;  2D11 A;  1V5P A;  1AQC A;  2KQ7 A;  3GB1 A;  4TQ1 A;  5LOP B;  3BYY B;  4JKH A;  1K52 A;  3DQV A;  3DBH B;  3RCZ A;  3PSE B;  4AUQ C;  5BYS A;  2PJH A;  3KUC B;  3N20 C;  2LXA A;  4HHV A;  1E5W A;  2JSV X;  4RH6 A;  4J3O D;  4L1R A;  1UGJ A;  1T0Q C;  2DZJ A;  2IZV B;  4MGY E;  3VH4 B;  1N3H A;  3PVL A;  2MBQ A;  2DEN B;  2LGY A;  5HE1 A;  1MI0 A;  1GGO A;  2G4D B;  2WXL A;  2BS3 B;  1XKE A;  4A6F A;  3NG0 A;  1NTY A;  2N9E B;  2W9N A;  4MSQ B;  2K5P A;  1FRD A;  1MHX A;  2K6D B;  2QIL A;  4JQW C;  4NZL B;  2JZP A;  4B95 A;  2NBU A;  1D5M C;  4JKF A;  2KC1 A;  5JHG A;  1PFD A;  2Z8L A;  2LGD A;  1C77 A;  3R2T A;  4TUU A;  3TVV A;  1EO6 A;  3PHW B;  1Y56 A;  4WWM A;  3I63 C;  1GG3 A;  1MG4 A;  4IFS A;  2YEP B;  1Z2M A;  1ZM0 A;  2GLS A;  1YN4 A;  5JH5 C;  2YEP F;  3ONS A;  1IYF A;  1RFA A;  2JWU A;  1G6J A;  2J53 A;  3KYC D;  1C4P A;  1EVH A;  2OED A;  2MCN B;  4MGK E;  4FLH A;  3H7S A;  4EFO A;  1KF6 B;  1E7P B;  1TTN A;  1XXG A;  4USA A;  4GDL B;  2MFQ A;  3R8B A;  5C3J B;  3PVW A;  4G11 A;  1KBL A;  2HRJ A;  2ELB A;  4ZYN A;  3NWD A;  1EU4 A;  3FP5 A;  1QLB B;  3V5W A;  4IWO A;  1D4B A;  2M56 B;  4PK1 A;  2BYE A;  4L1B A;  3ZNI D;  1NI3 A;  4A8X C;  2O6V B;  2HD5 B;  4KZC A;  4NQK E;  2CB8 A;  4GLS C;  2COA A;  5IRS A;  2IFS A;  1V88 A;  4YSX B;  1V80 A;  3IHP C;  1ET9 A;  2ROV A;  2YS5 A;  1GC6 A;  1K5D B;  2DLB A;  3P4Q B;  2MP2 A;  3Q3O C;  3TMP B;  3PSC A;  2PW9 A;  4JKC A;  3HW2 B;  4ZRI A;  1WJM A;  3NZS A;  1SGH A;  2CHZ A;  4KIK B;  4ZRJ A;  3DBL I;  1PGB A;  3NVW A;  1H10 A;  3C8Y A;  3LYY A;  2YT1 A;  3KQ4 A;  3P63 A;  1WGK A;  2LUE A;  2UZS A;  2KHW B;  3SR6 A;  3ODX A;  3I3T B;  4WAA A;  4W9H A;  2KAC A;  2Z0O A;  1ZDV A;  4WJQ A;  3K9P B;  3PTF C;  2KKC A;  2D10 A;  4M02 A;  3T9L A;  4AOF A;  3LJU X;  2BTE A;  4ZRQ A;  4TKN A;  1U4A A;  2W82 A;  1WGY A;  2JRH A;  3TW1 A;  4K81 A;  4D2K A;  2NMQ A;  4YSY B;  4HAZ B;  4FJV B;  3AE2 B;  4HB0 B;  2QKL A;  2R82 A;  2BYT A;  5D94 A;  1PUT A;  2PVO D;  2PEA A;  4BKS D;  2WXF A;  3DWM A;  2OJR A;  3RN9 C;  1TQZ A;  3SV1 A;  3L08 A;  3PG7 A;  2MLB A;  2FJL A;  2BCJ A;  2WXI A;  5JHH A;  2L8J A;  1ACA A;  4GU2 A;  3QBV B;  5H92 C;  4XWX A;  3WYF B;  4KZ0 A;  1WGQ A;  4WUR A;  1HQR D;  1WF9 A;  4BVU C;  1ENF A;  1I42 A;  1TXD A;  3KUD B;  1KJT A;  1UNQ A;  4YON A;  2D9Y A;  3GYP A;  3EUB 2;  4A5K A;  3TCA A;  1EAZ A;  5HE0 A;  1V49 A;  2OTX A;  3AED B;  1MG8 A;  2KDB A;  1HB8 A;  2D4Q A;  1IGC A;  1PDX A;  2GBM A;  4LJP B;  3LB8 C;  4RM9 A;  3GZN B;  1TJ6 A;  2BF8 B;  1R4N B;  4K3B A;  4OVU A;  4ITK A;  2XBB C;  3KSY A;  1Q0W B;  1QC6 A;  2RGN B;  2X18 A;  2BS2 B;  4P16 A;  2K6Q A;  4HDQ A;  1FEH A;  2WXQ A;  1JRU A;  1EWC A;  2DHZ A;  1NI2 A;  5BMI A;  2KDM A;  1L4D B;  5C1Z A;  4YL8 A;  3AJ4 A;  4I6P A;  2K8B A;  2WX0 A;  3HVD A;  3Q2A C;  4Q2J A;  3WAM A;  2WXJ A;  3VUY A;  1U2B A;  1VD2 A;  4RFB A;  3IVF A;  3Q8E A;  3T3N A;  4EZK A;  1U5G A;  1KC7 A;  1C76 A;  1K51 A;  3MC0 B;  2NZ8 B;  2BPS A;  3W1Y A;  3WAO A;  3OAN A;  3A9J B;  4WQM A;  1HTQ A;  2KR0 A;  1TY0 A;  1FCC C;  3FIL A;  2IYD B;  2PIA A;  4GIV A;  2L05 A;  5AZF A;  2SEB D;  4X57 B;  3ZNG C;  1YJJ A;  2LOZ A;  3D8F A;  4JLC A;  2FDQ A;  4KKI A;  3U7D A;  3NS8 A;  2R2Y A;  3NWF A;  1LQB A;  1R7S A;  3N9Y C;  3U7Z A;  3UIP B;  3ZW3 A;  5FI1 A;  4K7U A;  3ULB A;  1JRP A;  2LGS A;  2BQQ A;  2Y8G A;  4CYE A;  3OG5 A;  1SIF A;  3P4R B;  2ADZ A;  1J0G A;  2WXK A;  3AI5 A;  3U8Z A;  2PLP A;  3EHV A;  2BB5 A;  2K2U A;  2C9W B;  3ZJT A;  3EFC A;  3WCQ A;  1WXA A;  1WM3 A;  1XT9 B;  1ZE3 D;  3PRP B;  2BB6 A;  1V2Y A;  2PVG C;  3DBR B;  1WY8 A;  5TSS A;  1P1A A;  1L2N A;  2PE6 B;  3VXW A;  2Y5B B;  3B1L X;  1ZKH A;  4WIP A;  2RD0 A;  2GBN A;  5DHA B;  4KGS A;  1J7A A;  3QCA A;  3N1Z C;  5CHW A;  4Y94 A;  2K8H A;  4BBN F;  3DXD A;  2DNF A;  1WXM A;  4FA6 A;  3AH7 A;  2L52 A;  4DX9 0;  1Q5W B;  2K49 A;  4MJS A;  1D5Z C;  3B2G A;  4NAW B;  1YQB A;  3IG3 A;  3QAQ A;  1FXI A;  2KC2 A;  2IND C;  3V62 A;  2P0D A;  2N4F A;  4HLE A;  1MKE A;  1KLU D;  4LDT B;  2V4L A;  4DDI D;  2MH7 A;  4NJ7 A;  2Y7B A;  3AE9 B;  1Q10 A;  1V1P B;  4QJ4 B;  1KRH A;  3DVN U;  2UVM A;  1UGM A;  2N9L A;  1WMH B;  1MHH E;  3RUI B;  5JXV A;  1WX8 A;  5HFY A;  2L1A A;  3N1X C;  2ACZ B;  1JWA D;  5JLJ B;  2DN6 A;  1Y8R C;  4W9I A;  5C16 A;  4AS1 A;  3OLM D;  4YTP B;  1XCG A;  3DBL B;  2JU6 X;  1IPG A;  1SJH D;  1WG7 A;  1GNU A;  5GXG B;  2WH5 A;  1V61 A;  2NBV A;  2KTF A;  4OT1 A;  4PS8 A;  4DQO C;  3E66 A;  1ZXI A;  2NS5 A;  3N7C A;  1AN8 A;  1ZP0 B;  1JWS D;  1F0Z A;  2BKF A;  3GE8 C;  4JE3 B;  4A3O A;  2RDG A;  3IFW B;  4JK9 A;  5D3W A;  2MJE A;  2Z4D A;  3PPA A;  2KQ4 X;  1RRP B;  1WIA A;  3W9C B;  2RVB B;  4PYZ A;  1DRO A;  2B3A A;  3QHT A;  3ZKJ C;  4N58 A;  1SXT A;  3KZ1 A;  1JWB D;  3IAM 1;  3M95 A;  3MPX A;  2NPT A;  1RYJ A;  3X0W A;  2KFK A;  2V3N A;  1GOZ A;  4W9J A;  1MAI A;  4MM3 A;  3WAP A;  3O65 B;  4ANW A;  1D5X C;  1E7U A;  1XLO A;  5I2M A;  4BKS A;  4WWN A;  3RZF A;  4YWG G;  2GI9 A;  1AWE A;  3HHM A;  3Q3F A;  4R3D A;  2L1C A;  1GPX A;  1K50 A;  1OQY A;  2O6V D;  1WI0 A;  4OW0 A;  2DLW A;  4TSS A;  2L0T A;  3OJ4 B;  3AUL A;  1PYW D;  3ZIM A;  2QIE B;  4IOY X;  1WWT A;  3SFD B;  3N32 A;  1UNP A;  1J7C A;  2MBH A;  2LGX A;  4C56 C;  2LGI A;  2D3C A;  4P1B C;  4AWJ A;  4ICU A;  4MH8 A;  3MHS D;  2YS3 A;  4DHZ B;  4G3X B;  1V5U A;  2KTR B;  2KUQ A;  2JY6 A;  3DVG X;  2HTH B;  2WYQ A;  1OEY J;  2ZPN A;  5JVL A;  2NVU I;  3DXE A;  1Z5S B;  4ANV A;  1XR0 B;  3HIE A;  1WXS A;  2YSZ A;  3R7Q A;  3UIN B;  1STE A;  4WWP A;  3UQB A;  3M63 B;  4QJ5 B;  4HWI B;  3UZT A;  2E2X A;  4IM3 A;  1E90 A;  1KH0 A;  3HRD D;  4KHB B;  2XK5 A;  2N1V A;  2KIE A;  2JZZ A;  1XO3 A;  5AUK A;  2JRI B;  1A70 A;  5AUI A;  2DIK A;  2RNR B;  2KDE B;  2MKR A;  2P0H A;  4B0E A;  5HHD G;  2W55 A;  3F0W A;  3NZ3 A;  4MEM A;  5CX3 A;  3GP7 A;  1CJE A;  2C7N B;  1JML A;  2IGG A;  2ZNV B;  3TJP A;  1ZC4 B;  3BVM A;  3KWV A;  2RPQ A;  4HJG E;  4HKZ E;  4MSM B;  3SFE B;  1LB1 A;  2PTL A;  2IY1 B;  3QA8 A;  3KH0 A;  4HSI A;  1J19 A;  5CHV C;  1HTO A;  2I5C A;  4HXD A;  2LYD A;  4XWW A;  1VZ8 A;  5GMV A;  4KDL B;  1BML C;  2O2V B;  1H8C A;  4GZU A;  5J18 A;  1GUA B;  3QQ8 B;  1MK7 B;  1JWM D;  3VR9 B;  3NVY A;  1ZW7 A;  3BVG A;  4ANU A;  5LXH A;  2R2Q A;  1KZ7 A;  1FD6 A;  3PRZ A;  3HSA A;  2XQN M;  1BTK A;  2GRI A;  4US8 A;  4H8S A;  1SBB B;  4GN1 A;  3SYX A;  1YX5 B;  3KY9 A;  1XQQ A;  5D3Y A;  2KFJ A;  3R66 C;  4C7Y A;  4HAY B;  3GZN I;  3E9L A;  2DAJ A;  4BBK A;  2JVC A;  4K3C A;  4CHJ A;  4DX8 A;  3B08 A;  1FNV A;  1VDV A;  4NNJ B;  3RD2 A;  5G55 A;  4EZL A;  2Z13 A;  4OZB A;  3VAW A;  4QJ3 B;  3ZJV A;  2KO3 A;  2EEL A;  4OSN A;  2BWE S;  5GOW B;  4RF0 A;  4H2A A;  1TZ1 A;  3SHQ A;  1S1Q B;  4EUT A;  3E9S A;  3DCX A;  2V76 A;  1L0X B;  4IM0 A;  2N7J A;  3QJZ A;  2JX5 A;  4MT5 A;  1FHW A;  5DIF B;  2FCM A;  4NSW A;  1DDV A;  5IA7 A;  1Z87 A;  2ABD A;  3HK0 A;  1L0Y B;  1RJ2 A;  1YN3 A;  1F77 A;  3AE7 B;  1TZO A;  2DYM A;  2EC1 A;  2P0F A;  2IDY A;  2MA9 B;  4JK7 A;  5DCN A;  1U27 A;  2ONQ A;  2CY5 A;  4GOU A;  1T0R C;  1WRD B;  2LFI A;  2Z59 A;  4BOZ B;  1UEF A;  1VJK A;  2JXT A;  2KX0 A;  2N7D A;  3P42 A;  2Y3A A;  5KQ4 A;  1F1H A;  2DHI A;  3AM9 A;  1U5E A;  3TBL D;  5CLQ B;  2KLC A;  3L0W B;  2LRU A;  2DYN A;  2IYB A;  3MTN B;  5JHB A;  1MI1 A;  3H1U A;  3FAH A;  1IGD A;  2LVP A;  1U5F A;  1TYG B;  2RSG A;  2LWP A;  4IW0 A;  1ESF A;  4S17 A;  2QJL A;  4CSQ A;  2DA0 A;  3DBR I;  1NVL A;  1BUI C;  2FCS A;  1RAX A;  3T8M A;  4E71 A;  3SBG A;  5FKA C;  4GDL A;  3EEC A;  4JKE A;  4DXA B;  2VH2 A;  2X0S A;  3MP9 A;  3TEX A;  3W5V B;  4K2P A;  4CO7 A;  4XWT A;  2DWQ A;  3RI7 C;  2W2X C;  1NEK B;  2MEK A;  3I57 A;  3FLV A;  2KGX B;  1NBF C;  2KUP A;  3MC8 A;  3PGE A;  4LDT D;  2WDV B;  1MK9 B;  3SD5 A;  1SJE D;  2LXC A;  2KNB A;  2ZPY A;  2VRW B;  5BMH A;  1SE3 A;  1AW7 A;  2QSD A;  1CZP A;  3DHH C;  2KWV B;  2O6V A;  2V3S A;  4C00 A;  2K39 A;  3HM3 A;  2WDQ B;  1FCL A;  4DHJ D;  4IWP A;  5IOI A;  5EE0 A;  2KAJ A;  2AQ1 B;  2EMS A;  3VR8 B;  2ZNV C;  1R4M B;  2J0M A;  3L4P A;  2K9X A;  2NTT A;  1UPR A;  3JSV B;  3A58 A;  3JW0 X;  2I5F A;  4KIK A;  2DYO A;  4B0M A;  4A6Q A;  4LK0 M;  5J17 A;  2IPK D;  2AL6 A;  2UWQ A;  3WAL A;  4CQN A;  1AAR A;  3SNH A;  1KOT A;  3BY4 B;  4EKU A;  4B6H A;  3ZNH B;  3P1M A;  2K0P A;  1DGJ A;  1LM8 B;  1OTR B;  1N60 A;  1V86 A;  2ZZP B;  4FXC A;  5JZE B;  1SE4 A;  2C60 A;  1HB6 A;  2YS1 A;  2H7D A;  4ZHO A;  3B9J A;  3F5R A;  3BIN A;  5DH9 B;  2E3T A;  1RLF A;  5DPS A;  2M38 A;  2MX2 A;  4S0R A;  1P5T A;  1JCK B;  2DZK A;  3DBS A;  2W2W A;  2MP2 B;  5G5H A;  2EJ8 A;  3H7P A;  3CST A;  4FAD A;  5HE3 A;  1OFF A;  2FCQ A;  1IP9 A;  2AEH A;  2GCJ A;  4K7S A;  3LJ3 A;  1XLQ A;  4IKG A;  1TS5 A;  3T06 A;  3KVF B;  2KXJ A;  1V81 A;  2EKI A;  4Z2M B;  2D07 B;  4RGO S;  2K3U A;  2RLO A;  3ZDT A;  4HAT B;  2KLG A;  4PS7 A;  4ARC A;  1CMX B;  1EGX A;  5AZG A;  2Z0E B;  5J3T A;  3DVG Y;  4W9C A;  4PS3 A;  2COD A;  4MDK E;  3ECI A;  1T3Q A;  1E8Y A;  4ICV A;  1GAQ B;  1QOF A;  1UPQ A;  3TO1 A;  4JWU C;  4FJY A;  3PP2 A;  2HTM E;  1ZPS A;  1P3R A;  1WE6 A;  2W2X D;  3KW5 B;  1C1Y B;  1NEN B;  3ZVR A;  3B2F A;  4NAM A;  2G9H D;  3T3O A;  3X23 A;  3EGR A;  3ZDM C;  3G9W A;  4XE0 A;  3IBE A;  3SBT A;  1C79 A;  4DDG D;  2TSS A;  5L81 A;  1M4V A;  5KCV A;  2DX5 B;  2L0F A;  3AEC B;  3U2S C;  1W1D A;  4L6E A;  2PZ1 A;  2LJ5 A;  5JHA A;  3NW8 A;  4JKD A;  4HAV B;  3B0A A;  1FXT B;  2RQ1 A;  1T6B X;  4WJ7 A;  2FIF A;  4ILJ A;  5CTR C;  2RGF A;  3EFU A;  3A9J A;  2WQY B;  3DVN V;  3OAW A;  2Y8F A;  4IG7 B;  4YT0 B;  2C5L C;  2L7R A;  4ILG B;  2ASQ A;  2K1F A;  1EF5 A;  5G5G A;  1E6E B;  3CMM B;  3WA0 A;  5D2M B;  4II2 B;  2REX A;  1QKZ A;  2WLB A;  1VLB A;  3ZXR A;  1Y19 B;  2J4X A;  2LUL A;  2G3Q B;  2HJ1 A;  2KIG A;  2JF5 A;  3SU8 X;  1W1H A;  2IO1 B;  4EE2 A;  3PS6 A;  2I1J A;  4HEA 1;  3A1Q B;  2L00 B;  1LW3 A;  5M4Y B;  1V5T A;  3R2I A;  5KHO A;  2AWT A;  4GSW A;  2KT7 A;  3CIK A;  2INP E;  4W9L A;  3RNC C;  4YSZ B;  4MY6 A;  1VBH A;  2MQJ A;  2COP A;  3FSS A;  2D3G A;  2LI5 A;  3JVZ X;  3V61 A;  1MJD A;  1FO4 A;  3CSF A;  1EUV B;  2RRF A;  3FIL B;  5T8I A;  4JK8 A;  4LNN A;  1E7V A;  5CLL B;  5D6J B;  1WX9 A;  4WH4 A;  3A9K B;  1J8C A;  2WXR A;  1UBI A;  4KDI C;  2KJH B;  1HBK A;  4WJN A;  3VUW A;  3PLV A;  4AJW A;  1ZOY B;  3VRA B;  4IDI A;  2KAN A;  4KSK C;  1L6U A;  3HVZ A;  1UF0 A;  4PQ0 A;  4C4V B;  4AQ7 A;  3NHE B;  1FB8 A;  3PHX B;  5E6P A;  3ZLZ A;  3E56 A;  4DHZ E;  2MWS B;  1MFW A;  4E3C A;  2KYW A;  2WXP A;  2CU3 A;  2IGH A;  2WU5 B;  4AP4 C;  2YT0 A;  1V1P A;  4NPN A;  4A9A A;  1UNS A;  1GB1 A;  1TS2 A;  2IO2 B;  2ZKM X;  4TQ0 A;  3E9P A;  2KWU B;  1V6E A;  1SHC A;  2KDI A;  1KZG A;  4GDK B;  1WMH A;  3ZQ4 A;  4A90 A;  1FMA D;  2JP2 A;  4KHA A;  1YIW A;  1TS4 A;  2CJO A;  2V9H A;  1I4R A;  4N9F 4;  1DYN A;  3A8P A;  2FJ9 A;  1FPY A;  4K2O A;  1SIJ A;  3VQI A;  4HPL B;  1T5X D;  3L17 A;  4BKT A;  1NU2 A;  3Q8B A;  2KDF B;  4DBB A;  3URY A;  4LTU A;  4JKA A;  4ZDV A;  5CHF A;  1F2R I;  1ZC3 B;  4YTM B;  3IT4 B;  4MJS B;  3HM6 X;  4KX6 B;  2V3P A;  2J7Q B;  1ISN A;  4F1S A;  2MW5 A;  3ZXV A;  3ZJU A;  1DOI A;  2K8E A;  4HB4 B;  2XNA C;  5J3Q A;  2OOB B;  3NVZ A;  2LHD A;  3Q3N C;  5IJM A;  2N0Y A;  2RR9 A;  3I9V 1;  2LJI A;  1M94 A;  1N6Z A;  3KRW A;  2JXX A;  2N1W A;  4JX1 C;  5DPR A;  4WAF A;  2BYV E;  3ULC A;  2GS0 A;  4WWO A;  1UD7 A;  1QF6 A;  3APD A;  3BK1 A;  5HI1 A;  5C2T B;  1ZGU B;  1KFY B;  5C5B A;  3PEG A;  1HXY D;  4KKJ A;  2KJ6 A;  2L3Z A;  2G35 A;  1FOE A;  3AU4 A;  1KLG D;  1WRI A;  2GCL A;  4RMA A;  4JWS C;  1X1F A;  4B9K A;  3NOB A;  4HK2 A;  1GB4 A;  1FXA A;  2ROZ B;  2FUG 1;  3DHG C;  3RYT A;  2M4N A;  4EMO A;  4KSL C;  5FR6 A;  2C7M B;  2VH1 A;  3ML9 A;  3NJT A;  1WGR A;  3BZD B;  3CWI A;  3PRM B;  2WXO A;  4KGT A;  5LLI A;  4WVF B;  2DZI A;  1D3Z A;  3I5J C;  1C4A A;  5D3I B;  2KTR A;  3W1S C;  1V1O A;  3KUZ A;  1TT5 B;  1FM0 D;  2D3A A;  4OVZ A;  2KMM A;  2BWF A;  2HTH A;  2KFK B;  1OQN A;  3UIO B;  4HDO A;  1DDM A;  4ZOH C;  1R4M I;  4HAW B;  4DBG A;  2BYF A;  2EKE C;  3MJW A;  1VBG A;  2M8S A;  2J52 A;  1PFJ A;  5BYR A;  3R7R A;  4C0A A;  3L54 A;  4JKG A;  3AEA B;  4XYC A;  4G0N B;  3TEY A;  3V6E B;  1VCB A;  4BKG A;  2COC A;  1T0Y A;  2L32 A;  4KGR A;  2CS4 A;  2QKM A;  3HIZ A;  1YN5 A;  3Q8A A;  2BVC A;  2JT4 B;  2UU7 A;  4M0W B;  4WSF A;  1XX0 A;  1I4Q A;  1V97 A;  4XX5 A;  2CR5 A;  3WIM A;  1C3T A;  1YJI A;  2VSZ A;  4FUL A;  2RPV A;  4G50 A;  4C80 A;  4ZRP A;  1SEB D;  2K25 A;  1XCQ L;  4HB3 B;  1JQ4 A;  3QX1 A;  2DTC A;  3EC8 A;  1NYQ A;  3AB5 A;  3QWM A;  1P7F A;  4WQO B;  3E9O A;  2R2O A;  2UZR A;  4MGZ E;  1MVK A;  2Z0P A;  4OZC A;  2CJN A;  4EZJ A;  2D9V A;  4GPT B;  2H89 B;  4GGQ A;  2LEK A;  2Y5C A;  1L4Z B;  1GJZ A;  3RNE C;  1KI1 B;  4LNK A;  4JL9 A;  3HQC A;  1L0V B;  3AE5 B;  2M1M A;  4FBJ B;  3V3X A;  1V5O A;  2HJ8 A;  2KD0 A;  2N0S B;  4LNI A;  4RCO A;  1YQ4 B;  2PPH A;  5H8Y E;  3GYO A;  1DIK A;  1ZSQ A;  2FE8 A;  2J0K A;  1MIX A;  3AEE B;  4W9E A;  1WYW B;  4RGN A;  2VZK B;  3ODO A;  3RZW C;  1WYG A;  1WR1 A;  2RDB C;  2N7E A;  4M00 A;  5G2N A;  1WJU A;  2K8C A;  4P1C C;  4IUM B;  1FGY A;  4MK0 A;  3AN1 A;  4NJC A;  1OQQ A;  2WNM A;  3ZTC A;  1SE2 A;  2WGS A;  5I2S A;  4M8N A;  4K7W A;  5I4D A;  1VZ6 A;  3P2B A;  2KOX A;  4M01 A;  3TUO A;  1PGX A;  1C4C A;  3L13 A;  2K00 A;  2IJ0 A;  1MPH A;  2ICI A;  4CHK A;  2CKH B;  4OZA A;  4YTN B;  4ANX A;  1RM6 C;  5IN7 A;  1KLV A;  4URK A;  1C78 A;  3KYD D;  2OHF A;  4PYU A;  4GOC A;  4ZYS A;  1V89 A;  1DYQ A;  4D0N B;  2CY4 A;  4DWF A;  2KMC A;  3QK0 A;  4RGT A;  4RM8 A;  1MPE A;  4PT5 A;  5EE9 A;  1ROE A;  2EMT A;  1JAL A;  4W9F A;  2Z0Q A;  3CIR B;  2GOW A;  3UQA A;  1YQ3 B;  2FNJ B;  3L10 B;  1IBX B;  2AX5 A;  3BWU D;  3TSS A;  1TY2 A;  2N9P C;  1KTK A;  2Q13 A;  2IO3 B;  5MPO A;  2YLM A;  4JIO U;  5HE2 A;  1S3S G;  1L6V A;  1OQR A;  4B6W A;  1WFY A;  1WGD A;  4KV2 A;  1PQS A;  1UZX B;  3V6C B;  5LG4 B;  5EE3 A;  1SSN A;  1WJN A;  4BZA A;  2JZ3 B;  1PMS A;  5BO4 B;  2JWZ A;  4ASW C;  2GB1 A;  4HPM B;  1I35 A;  3ZVV A;  1CK1 A;  4N6E B;  4HCN B;  3V60 A;  3PVU A;  4A6F B;  1HA5 A;  4IOI E;  1N61 A;  2KK8 A;  2WXG A;  2QDF A;  2N9X A;  3CF6 E;  5IO9 A;  2KVR A;  4HJK A;  2M14 A;  2Z59 B;  3OHM B;  3VHT C;  4J6I A;  3R3M A;  1WGU A;  2AYO B;  2LZ6 A;  2HE7 A;  1V9J A;  1E8X A;  2WXN A;  2WS3 B;  2KCJ A;  2BS4 B;  5L83 A;  3JYU A;  4MT7 A;  3P7Z A;  4CHM A;  4N59 A;  2DBY A;  3SUZ A;  1HEZ E;  3JSV A;  2CHW A;  4JGH B;  1FNU A;  3C19 A;  3BVZ A;  4WJO A;  2GUM A;  2A5U A;  3MDB C;  3Q14 C;  3VIA A;  3L16 A;  2GBR A;  2MJD A;  3BII D;  1FGZ A;  1E8Z A;  4LJO B;  1F9J A;  2NTS A;  1X1G A;  1X05 A;  1M7E A;  4D6W A;  4RF1 A;  2KJR A;  2LG1 A;  3QWZ B;  1D6E C;  3ZTD A;  2VRR B;  5J3Y A;  1E10 A;  2D9W A;  3Q69 A;  3KLS X;  4RNA A;  3PZ7 A;  4ZHP A;  1WJ1 A;  1UBQ A;  1MIZ B;  1Y5O A;  3M1I B;  4HB2 B;  1IUE A;  1DOX A;  3DXC A;  3VVW B;  3PRE A;  2I38 A;  4XC2 A;  1LFD A;  4A55 A;  2NMB A;  3ENB A;  2LOX A;  1EWY C;  3ZRF A;  2YT2 A;  1RWS A;  4I6N B;  4IAP A;  1FHX A;  5JP4 A;  1FRR A;  3OJ3 A;  2JQR B;  2OJW A;  4L2Y A;  2WDR B;  4YXD B;  3DOW A;  4II3 B;  3U30 A;  1YD8 U;  1PGA A;  2LD9 A;  2NR2 A;  2W54 A;  2N9K A;  4F7G A;  1WJ6 A;  3Q3J A;  1DBH A;  3Q6B A;  4OHJ A;  3CXB B;  4NY0 A;  1YOV B;  2COF A;  1TKY A;  1XOD A;  3KRX A;  1EF1 A;  3NZU A;  2WXM A;  1HZ5 A;  2MWN B;  3NRZ A;  5LNK 1;  2AQ3 B;  5D27 A;  1TBE A;  1Q67 A;  5E6N A;  4RGM A;  3RFZ B;  1EU3 A;  3ZO5 B;  2JYT A;  3APC A;  2M0X A;  2WX1 A;  4REZ A;  3AE3 B;  3MFG A;  2JYE A;  2ZW1 A;  3O96 A;  2J59 M;  5KQ1 A;  4EJN A;  1T0S C;  1P98 A;  3DCG A;  4M8M A;  1WGG A;  2LKO A;  3QIJ A;  3M62 B;  4HVB A;  1WE7 A;  4JPS A;  2G1E A;  3AE6 B;  3K9O B;  2ZEQ A;  3H7P B;  2R0D A;  3EA6 A;  3A8Q A;  1U29 A;  5EDS A;  1C9F A;  2CHX A;  4F7U P;  1E0Z A;  4I6L B;  1F2R C;  4A6K A;  1WI1 A;  2D9X A;  3VFK A;  2AQ2 B;  2ZCC A;  3VTV A;  3GS2 A;  2MBB B;  5BMG A;  1I4G A;  4XGA B;  2K22 A;  1X86 A;  2DYB A;  2BGF A;  1BTN A;  1NDD A;  1VR9 A;  1QOB A;  2DX5 A;  1XF5 L;  5D7G A;  4OVV A;  2MHJ A;  1LGR A;  2XEW A;  2H88 B;  3AEG B;  4HAU B;  2KQS A;  2YVC A;  4MGI E;  3FEH A;  1P0R A;  3TIX A;  4KAX B;  3TL5 A;  1I4X A;  2PKO A;  5TR5 A;  1VZ7 A;  1XD3 B;  3MJ5 A;  1JRO A;  5DPT A;  3ML4 A;  3AE4 B;  3H9D A;  4W9D A;  4A20 A;  1SB3 C;  3DDC B;  3FVC A;  5D3V A;  2V1Y A;  5EFX A;  3ML8 A;  3SO6 A;  3W1S A;  5DI9 B;  2DHJ A;  3W2D A;  4KVG B;  2ZCB A;  1OGW A;  1LO5 D;  1QOG A;  2MBE A;  1T77 A;  2KX3 A;  2IGD A;  1ST7 A;  1FFU A;  3BJI A;  1LXD A;  3AEB B;  2IBI B;  2PMV A;  2FID A;  4Z2N A;  3P6A A;  4W9K A;  3O13 A;  3TEZ A;  2GJY A;  1TS3 A;  1TJE A;  3RNG C;  2DHK A;  4DXF A;  1I7A A;  1ZVR A;  2GBK A;  2RUK B;  1ZXH A;  3RNF C;  3UI3 A;  1HE8 A;  2B76 B;  4DIX A;  1OEY A;  3A1Q A;  4UDU C;  2D5G A;  3A98 B;  3BK2 A;  2VKI A;  2X38 A;  3RT3 B;  3IT6 B;  4TMA B;  2J42 A;  2GMI C;  1YMH E;  4ARI A;  4KHO A;  3EPY A;  3ABV B;  3ZNZ B;  1V8C A;  2VZK D;  2ZVN A;  2D2Q A;  3PLU A;  4EEW A;  1YX6 B;  4XDD A;  5FK9 C;  3A9K A;  1N63 A;  3VH3 B;  5KHQ A;  3ZUN A;  3A4S C;  1X11 A;  3ZYY X;  2FAZ A;  5C79 A;  4W9G A;  2Z0D B;  2BT6 A;  4IWQ A;  1W1G A;  4C4V A;  1TIF A;  4MH0 E;  1QZE A;  1UUP A;  5DHF B;  4HRO A;  4F7H A;  3BYT B;  3N1Y C;  2D9Z A;  4FHK A;  1DDW A;  1M7R A;  1K8R B;  2W3R A;  3FM8 C;  2I1K A;  2LHE A;  1L7Y A;  4NAW A;  2RSU A;  3RCP A;  3AXC A;  1I7H A;  1YJ1 A;  4AJY B;  1F52 A;  1TGZ B;  1NTV A;  3ODW A;  4GDK A;  3PZ8 A;  5EE1 A;  1CQV A;  2KVZ A;  3N30 A;  3APF A;  2QCZ A;  4GMX B;  3GOE A;  5IAA C;  1QIL A;  4E74 A;  2Z14 A;  1XD4 A;  1UH6 A;  3V05 A;  1P9D U;  2C7H A;  5AZH A;  3MHZ A;  3IAS 1;  1E9M A;  1N5W A;  2BW2 A;  3VTU A;  2MSE D;  4PNK A;  2CU1 A;  4HKQ A;  3H8H A;  2DX1 A;  1XLN A; 
#chains in the Genus database with same CATH homology
 1BT0 A;  1PLS A;  3PT2 B;  3C0R B;  2MDX A;  1RRB A;  4LCD E;  4A3P A;  2LVQ A;  3S2A A;  3DBH I;  1JDE A;  2N23 A;  2G45 B;  2GBJ A;  3RUL A;  2QHO A;  2KN5 A;  1WXV A;  1B55 A;  4DHJ B;  3PZD A;  5D3X A;  5E6O A;  4NJ6 A;  3PV1 A;  2DKQ A;  3QAR A;  1K5G B;  4MEL A;  1UEL A;  4NQL B;  1U5D A;  2YF0 A;  3ZRC A;  5HKH A;  4IC7 B;  4TYZ A;  1WZ0 A;  1FHO A;  2BKR B;  3ALB A;  5AEK B;  2NBW B;  4XZ4 A;  4GB9 A;  4P7I A;  2OQB A;  1WGH A;  4FHJ A;  1J0W A;  2MRP A;  2JPH A;  2NBV B;  2H7E A;  3NY5 A;  1A5R A;  4FJZ A;  3LDZ E;  2FUH B;  3UGB B;  4GXB A;  2CRF A;  2A4Z A;  5C5B B;  2K2J A;  4FN2 A;  2ZVO A;  1BAK A;  4F7Z A;  2NPT B;  2G4S A;  2M17 A;  5FI0 A;  2DFK A;  4K1R B;  1WH3 A;  1KM7 A;  1H4R A;  4A6H A;  5J2R A;  2R09 A;  1OY2 A;  1I2H A;  4GMV A;  2DZM A;  1WZ3 A;  2IY0 B;  4BFR A;  1UNR A;  2MBO A;  2WDT B;  3SDL C;  2KMA A;  2YRY A;  1BWN A;  3ENE A;  3TFM A;  4WJP A;  4JKG B;  4EOY A;  4BOS C;  3A33 B;  3DPD A;  5C6R A;  1V5M A;  2ZJD A;  3D8D A;  1IRS A;  4F8C B;  1P6S A;  2DKP A;  1WR6 E;  3NSU A;  3N3K B;  2L2I A;  2XK5 B;  2O2V A;  2UYZ B;  4DK5 A;  1FAO A;  3VOQ A;  4BBN C;  4HAX B;  1OMW A;  1X1M A;  5LXI B;  2DAF A;  1WX7 A;  2CAY A;  2ELA A;  3H6N A;  2LVO A;  5L95 C;  2J0J A;  2LRW A;  2FCN A;  1QQG A;  1E8W A;  1Q1O A;  2L76 A;  2IO0 B;  2DYQ A;  4ZRK A;  1P3Q U;  4IM2 A;  3QC8 B;  2LBB A;  2P8V A;  3VUX A;  3VTW A;  1WVH A;  2CQU A;  4ILH A;  4JKB A;  5LON B;  2NCN A;  3UF8 A;  3D8E A;  1WM2 A;  2LAS A;  3A4R A;  5DPW A;  1SE9 A;  3VDZ A;  2PE9 A;  1R4N I;  2AL3 A;  3AU5 A;  4K17 A;  1NTI A;  3WAN A;  5C23 A;  2KWC A;  2WWZ A;  4HCP B;  2KZR A;  1GC7 A;  3M3J A;  1WJ4 A;  4TV3 A;  2JUO A;  3D32 A;  2D11 A;  1V5P A;  1AQC A;  2KQ7 A;  4TQ1 A;  5LOP B;  4JKH A;  3DQV A;  3RCZ A;  3PSE B;  4AUQ C;  2PJH A;  3KUC B;  2LXA A;  4HHV A;  1E5W A;  2IZV B;  2DZJ A;  4MGY E;  3VH4 B;  1N3H A;  3PVL A;  2MBQ A;  2DEN B;  2LGY A;  5HE1 A;  1GGO A;  2G4D B;  1XKE A;  4A6F A;  1NTY A;  2N9E B;  2W9N A;  4MSQ B;  2K6D B;  4JQW C;  4B95 A;  2NBU A;  4JKF A;  2KC1 A;  5JHG A;  2LGD A;  4TUU A;  3TVV A;  1EO6 A;  3PHW B;  1GG3 A;  4IFS A;  1Z2M A;  1ZM0 A;  5JH5 C;  3ONS A;  1IYF A;  1RFA A;  1G6J A;  3KYC D;  1EVH A;  2MCN B;  4MGK E;  4FLH A;  3H7S A;  4EFO A;  1TTN A;  4GDL B;  2MFQ A;  3PVW A;  4G11 A;  1KBL A;  2HRJ A;  2ELB A;  4ZYN A;  3FP5 A;  3V5W A;  4IWO A;  2BYE A;  3ZNI D;  2O6V B;  2HD5 B;  4KZC A;  4NQK E;  2CB8 A;  2COA A;  2IFS A;  1V88 A;  1V80 A;  3IHP C;  2ROV A;  2YS5 A;  1GC6 A;  1K5D B;  2MP2 A;  3TMP B;  3PSC A;  4JKC A;  3HW2 B;  4ZRI A;  1WJM A;  3NZS A;  1SGH A;  2CHZ A;  4KIK B;  4ZRJ A;  3DBL I;  1H10 A;  2YT1 A;  2UZS A;  2LUE A;  2KHW B;  3ODX A;  3I3T B;  4WAA A;  4W9H A;  2Z0O A;  4WJQ A;  3K9P B;  3PTF C;  2KKC A;  2D10 A;  3T9L A;  4AOF A;  3LJU X;  4TKN A;  1U4A A;  1WGY A;  2JRH A;  3TW1 A;  4K81 A;  4HAZ B;  4FJV B;  4HB0 B;  2QKL A;  2R82 A;  5D94 A;  2PEA A;  4BKS D;  2OJR A;  1TQZ A;  3SV1 A;  3L08 A;  3PG7 A;  2MLB A;  2FJL A;  2BCJ A;  5JHH A;  2L8J A;  1ACA A;  4GU2 A;  3QBV B;  4XWX A;  3WYF B;  4KZ0 A;  1WGQ A;  1WF9 A;  4BVU C;  1I42 A;  1TXD A;  3KUD B;  1KJT A;  1UNQ A;  4YON A;  2D9Y A;  3GYP A;  4A5K A;  3TCA A;  1EAZ A;  5HE0 A;  1V49 A;  2OTX A;  1MG8 A;  2KDB A;  1HB8 A;  2D4Q A;  2GBM A;  4LJP B;  4RM9 A;  1TJ6 A;  2BF8 B;  4OVU A;  2XBB C;  3KSY A;  1Q0W B;  1QC6 A;  2RGN B;  2X18 A;  2K6Q A;  4HDQ A;  1JRU A;  2DHZ A;  1NI2 A;  5C1Z A;  4YL8 A;  3AJ4 A;  4I6P A;  2K8B A;  2WX0 A;  3WAM A;  3VUY A;  1U2B A;  1VD2 A;  3IVF A;  4EZK A;  1U5G A;  1KC7 A;  2NZ8 B;  2BPS A;  3W1Y A;  3WAO A;  3OAN A;  3A9J B;  2IYD B;  4GIV A;  2L05 A;  5AZF A;  4X57 B;  3ZNG C;  2LOZ A;  3D8F A;  4JLC A;  2FDQ A;  3U7D A;  3NS8 A;  1LQB A;  3UIP B;  3ZW3 A;  5FI1 A;  4K7U A;  3ULB A;  2Y8G A;  4CYE A;  1SIF A;  2ADZ A;  1J0G A;  3AI5 A;  3U8Z A;  3EHV A;  2K2U A;  2C9W B;  1WXA A;  1WM3 A;  1XT9 B;  3PRP B;  1V2Y A;  1WY8 A;  1P1A A;  1L2N A;  2PE6 B;  3VXW A;  2Y5B B;  3B1L X;  1ZKH A;  2RD0 A;  2GBN A;  5DHA B;  3QCA A;  5CHW A;  4Y94 A;  2K8H A;  4BBN F;  3DXD A;  1WXM A;  4FA6 A;  4DX9 0;  1Q5W B;  4MJS A;  4NAW B;  1YQB A;  3IG3 A;  3QAQ A;  2KC2 A;  3V62 A;  2P0D A;  2N4F A;  4HLE A;  1MKE A;  4LDT B;  2V4L A;  4DDI D;  4NJ7 A;  2Y7B A;  3DVN U;  2UVM A;  1UGM A;  1WMH B;  3RUI B;  1WX8 A;  5JLJ B;  2DN6 A;  1Y8R C;  4W9I A;  5C16 A;  3OLM D;  1XCG A;  1IPG A;  1WG7 A;  1GNU A;  2WH5 A;  1V61 A;  2KTF A;  4PS8 A;  3E66 A;  2NS5 A;  3N7C A;  2BKF A;  4A3O A;  3IFW B;  4JK9 A;  5D3W A;  3PPA A;  1RRP B;  1WIA A;  2RVB B;  4PYZ A;  1DRO A;  2B3A A;  3QHT A;  3ZKJ C;  3KZ1 A;  3M95 A;  3MPX A;  2NPT A;  3X0W A;  2KFK A;  4W9J A;  1MAI A;  4MM3 A;  3WAP A;  3O65 B;  4ANW A;  1E7U A;  4BKS A;  4WWN A;  3RZF A;  3HHM A;  1AWE A;  3Q3F A;  2L1C A;  1OQY A;  2O6V D;  1WI0 A;  2DLW A;  2L0T A;  3OJ4 B;  3AUL A;  3ZIM A;  4IOY X;  3N32 A;  1UNP A;  2MBH A;  2LGX A;  4AWJ A;  4ICU A;  3MHS D;  2YS3 A;  4DHZ B;  4G3X B;  1V5U A;  2KTR B;  2JY6 A;  3DVG X;  2HTH B;  2WYQ A;  1OEY J;  2ZPN A;  5JVL A;  2NVU I;  3DXE A;  1Z5S B;  4ANV A;  1XR0 B;  1WXS A;  2YSZ A;  3R7Q A;  3UIN B;  4WWP A;  3UQB A;  3M63 B;  4HWI B;  3UZT A;  2E2X A;  4IM3 A;  1E90 A;  4KHB B;  2XK5 A;  2N1V A;  2JZZ A;  2JRI B;  2DIK A;  2RNR B;  2KDE B;  2MKR A;  2P0H A;  3F0W A;  4MEM A;  5CX3 A;  2C7N B;  2ZNV B;  3TJP A;  1ZC4 B;  2RPQ A;  4MSM B;  1LB1 A;  2IY1 B;  3QA8 A;  3KH0 A;  1J19 A;  5CHV C;  2I5C A;  4HXD A;  2LYD A;  5GMV A;  4KDL B;  2O2V B;  1H8C A;  4GZU A;  5J18 A;  1GUA B;  3QQ8 B;  1MK7 B;  1ZW7 A;  4ANU A;  5LXH A;  2R2Q A;  1KZ7 A;  3PRZ A;  2XQN M;  1BTK A;  4H8S A;  4GN1 A;  3SYX A;  1YX5 B;  3KY9 A;  1XQQ A;  5D3Y A;  2KFJ A;  3R66 C;  4HAY B;  3GZN I;  3E9L A;  2DAJ A;  4BBK A;  2JVC A;  4CHJ A;  4DX8 A;  3B08 A;  4NNJ B;  3RD2 A;  5G55 A;  4EZL A;  3VAW A;  2KO3 A;  2BWE S;  5GOW B;  1TZ1 A;  3SHQ A;  1S1Q B;  4EUT A;  2V76 A;  4IM0 A;  3QJZ A;  1FHW A;  5DIF B;  2FCM A;  4NSW A;  1DDV A;  5IA7 A;  1Z87 A;  2ABD A;  3HK0 A;  1RJ2 A;  2DYM A;  2EC1 A;  2P0F A;  2MA9 B;  4JK7 A;  5DCN A;  1U27 A;  2CY5 A;  1WRD B;  4BOZ B;  1UEF A;  2KX0 A;  2N7D A;  5KQ4 A;  2DHI A;  1U5E A;  3TBL D;  5CLQ B;  2KLC A;  3L0W B;  2LRU A;  2DYN A;  2IYB A;  3MTN B;  5JHB A;  3H1U A;  2LVP A;  1U5F A;  2RSG A;  2LWP A;  4IW0 A;  2DA0 A;  3DBR I;  1NVL A;  2FCS A;  3T8M A;  1RAX A;  4E71 A;  3SBG A;  4GDL A;  3EEC A;  4JKE A;  4DXA B;  2X0S A;  4K2P A;  4CO7 A;  2W2X C;  3FLV A;  2KGX B;  1NBF C;  2KUP A;  3PGE A;  4LDT D;  1MK9 B;  3SD5 A;  2LXC A;  2KNB A;  2ZPY A;  2VRW B;  2KWV B;  2O6V A;  2V3S A;  2K39 A;  3HM3 A;  4DHJ D;  4IWP A;  2EMS A;  2ZNV C;  2J0M A;  1UPR A;  3JSV B;  3JW0 X;  2I5F A;  4KIK A;  2DYO A;  5J17 A;  2AL6 A;  2UWQ A;  3WAL A;  1AAR A;  3SNH A;  1KOT A;  3BY4 B;  4EKU A;  4B6H A;  3ZNH B;  1LM8 B;  1OTR B;  1V86 A;  2ZZP B;  5JZE B;  2C60 A;  1HB6 A;  2YS1 A;  2H7D A;  3F5R A;  3BIN A;  5DH9 B;  1RLF A;  5DPS A;  2M38 A;  2MX2 A;  1P5T A;  3DBS A;  2DZK A;  2W2W A;  2MP2 B;  2EJ8 A;  3H7P A;  3CST A;  4FAD A;  5HE3 A;  2FCQ A;  1IP9 A;  2AEH A;  2GCJ A;  4K7S A;  3LJ3 A;  3T06 A;  3KVF B;  2KXJ A;  1V81 A;  4Z2M B;  2D07 B;  2RLO A;  3ZDT A;  4HAT B;  2KLG A;  4PS7 A;  1CMX B;  1EGX A;  5AZG A;  2Z0E B;  5J3T A;  3DVG Y;  4W9C A;  4PS3 A;  2COD A;  4MDK E;  3ECI A;  1E8Y A;  4ICV A;  1UPQ A;  3TO1 A;  4FJY A;  3PP2 A;  1P3R A;  1WE6 A;  2W2X D;  3KW5 B;  1C1Y B;  3ZVR A;  3X23 A;  3ZDM C;  3G9W A;  3IBE A;  3SBT A;  4DDG D;  5L81 A;  5KCV A;  2DX5 B;  2L0F A;  1W1D A;  4L6E A;  2PZ1 A;  2LJ5 A;  5JHA A;  4JKD A;  4HAV B;  3B0A A;  1FXT B;  2RQ1 A;  4WJ7 A;  2FIF A;  4ILJ A;  5CTR C;  2RGF A;  3EFU A;  3A9J A;  3DVN V;  3OAW A;  2Y8F A;  4IG7 B;  2C5L C;  2L7R A;  4ILG B;  2ASQ A;  2K1F A;  1EF5 A;  3CMM B;  3WA0 A;  5D2M B;  4II2 B;  2REX A;  1Y19 B;  2LUL A;  2G3Q B;  2JF5 A;  3SU8 X;  1W1H A;  2IO1 B;  3PS6 A;  2I1J A;  3A1Q B;  2L00 B;  1LW3 A;  1V5T A;  5KHO A;  2AWT A;  4GSW A;  3CIK A;  4W9L A;  4MY6 A;  1VBH A;  2MQJ A;  2COP A;  3FSS A;  2D3G A;  2LI5 A;  3JVZ X;  3V61 A;  3CSF A;  1EUV B;  4JK8 A;  1E7V A;  5CLL B;  5D6J B;  1WX9 A;  3A9K B;  1J8C A;  1UBI A;  4KDI C;  2KJH B;  1HBK A;  4WJN A;  3VUW A;  3PLV A;  4AJW A;  2KAN A;  4KSK C;  4PQ0 A;  3NHE B;  1FB8 A;  3PHX B;  5E6P A;  3ZLZ A;  4DHZ E;  2MWS B;  4E3C A;  4AP4 C;  2YT0 A;  4NPN A;  2IO2 B;  4TQ0 A;  3E9P A;  2KWU B;  1V6E A;  1SHC A;  2KDI A;  1KZG A;  4GDK B;  1WMH A;  2JP2 A;  4KHA A;  1YIW A;  4N9F 4;  1DYN A;  3A8P A;  2FJ9 A;  4K2O A;  3VQI A;  4HPL B;  3L17 A;  4BKT A;  1NU2 A;  2KDF B;  4DBB A;  4JKA A;  4ZDV A;  5CHF A;  1ZC3 B;  4MJS B;  3HM6 X;  2J7Q B;  1ISN A;  4F1S A;  2MW5 A;  4HB4 B;  5J3Q A;  2OOB B;  5IJM A;  2N0Y A;  2RR9 A;  1M94 A;  2N1W A;  3KRW A;  2JXX A;  5DPR A;  2BYV E;  3ULC A;  2GS0 A;  4WWO A;  1UD7 A;  3APD A;  1ZGU B;  5C5B A;  3PEG A;  2KJ6 A;  2L3Z A;  2G35 A;  1FOE A;  3AU4 A;  4RMA A;  2GCL A;  1X1F A;  4B9K A;  3NOB A;  4HK2 A;  2ROZ B;  3RYT A;  2M4N A;  4EMO A;  4KSL C;  5FR6 A;  2C7M B;  3ML9 A;  1WGR A;  3PRM B;  5LLI A;  4WVF B;  2DZI A;  1D3Z A;  2KTR A;  3W1S C;  3KUZ A;  2BWF A;  2HTH A;  2KFK B;  1OQN A;  3UIO B;  4HDO A;  1DDM A;  1R4M I;  4HAW B;  4DBG A;  2BYF A;  2EKE C;  3MJW A;  1VBG A;  2M8S A;  1PFJ A;  3R7R A;  4C0A A;  3L54 A;  4JKG A;  4G0N B;  3V6E B;  1VCB A;  4BKG A;  2COC A;  1T0Y A;  2CS4 A;  2QKM A;  3HIZ A;  2JT4 B;  4M0W B;  4WSF A;  1XX0 A;  4XX5 A;  2CR5 A;  3WIM A;  1C3T A;  2VSZ A;  4FUL A;  4G50 A;  2K25 A;  4HB3 B;  3QX1 A;  2DTC A;  3EC8 A;  3QWM A;  4WQO B;  3E9O A;  2R2O A;  2UZR A;  4MGZ E;  2Z0P A;  4EZJ A;  2D9V A;  4GPT B;  4GGQ A;  1GJZ A;  1KI1 B;  4JL9 A;  3HQC A;  2M1M A;  4FBJ B;  1V5O A;  2HJ8 A;  2KD0 A;  2PPH A;  3GYO A;  1DIK A;  1ZSQ A;  2J0K A;  1MIX A;  4W9E A;  1WYW B;  3ODO A;  3RZW C;  1WR1 A;  2N7E A;  5G2N A;  1WJU A;  2K8C A;  4IUM B;  1FGY A;  4MK0 A;  3ZTC A;  4M8N A;  4K7W A;  3P2B A;  2KOX A;  3L13 A;  2K00 A;  1MPH A;  4CHK A;  2CKH B;  4ANX A;  1KLV A;  4URK A;  3KYD D;  4PYU A;  4GOC A;  1V89 A;  4D0N B;  2CY4 A;  4DWF A;  2KMC A;  3QK0 A;  4RM8 A;  2EMT A;  4W9F A;  2Z0Q A;  2GOW A;  3UQA A;  2FNJ B;  3L10 B;  2N9P C;  2Q13 A;  2IO3 B;  2YLM A;  4JIO U;  5HE2 A;  1S3S G;  4B6W A;  1WFY A;  1WGD A;  4KV2 A;  1PQS A;  1UZX B;  3V6C B;  1WJN A;  2JZ3 B;  1PMS A;  5BO4 B;  2JWZ A;  4ASW C;  4HPM B;  1I35 A;  3ZVV A;  4HCN B;  3V60 A;  3PVU A;  4A6F B;  2KK8 A;  3CF6 E;  2N9X A;  2KVR A;  4HJK A;  2M14 A;  2Z59 B;  3VHT C;  4J6I A;  3R3M A;  1WGU A;  2AYO B;  2LZ6 A;  2HE7 A;  1V9J A;  1E8X A;  2KCJ A;  5L83 A;  3JYU A;  4MT7 A;  3P7Z A;  4CHM A;  3SUZ A;  3JSV A;  2CHW A;  4JGH B;  4WJO A;  2A5U A;  3MDB C;  3VIA A;  3L16 A;  2GBR A;  1FGZ A;  1E8Z A;  4LJO B;  1F9J A;  1X1G A;  1X05 A;  1M7E A;  2KJR A;  2LG1 A;  3QWZ B;  3ZTD A;  2VRR B;  5J3Y A;  2D9W A;  1WJ1 A;  1UBQ A;  1MIZ B;  1Y5O A;  3M1I B;  4HB2 B;  3DXC A;  3VVW B;  3PRE A;  4XC2 A;  1LFD A;  2NMB A;  3ENB A;  2LOX A;  3ZRF A;  4I6N B;  4IAP A;  1FHX A;  5JP4 A;  3OJ3 A;  3DOW A;  4II3 B;  3U30 A;  1YD8 U;  2LD9 A;  2NR2 A;  4F7G A;  1WJ6 A;  3Q3J A;  1DBH A;  3CXB B;  4NY0 A;  2COF A;  1XOD A;  3KRX A;  1EF1 A;  3NZU A;  2MWN B;  5D27 A;  1TBE A;  1Q67 A;  5E6N A;  3ZO5 B;  3APC A;  2M0X A;  2WX1 A;  3O96 A;  3DCG A;  2J59 M;  5KQ1 A;  4EJN A;  1P98 A;  4M8M A;  1WGG A;  2LKO A;  3QIJ A;  3M62 B;  4HVB A;  1WE7 A;  3K9O B;  2ZEQ A;  3H7P B;  2R0D A;  3A8Q A;  1U29 A;  5EDS A;  2CHX A;  4F7U P;  4I6L B;  4A6K A;  1WI1 A;  2D9X A;  3VFK A;  2ZCC A;  3VTV A;  2MBB B;  1X86 A;  2DYB A;  2BGF A;  1BTN A;  1NDD A;  2DX5 A;  5D7G A;  4OVV A;  2XEW A;  4HAU B;  2KQS A;  2YVC A;  4MGI E;  3FEH A;  1P0R A;  3TIX A;  4KAX B;  3TL5 A;  5TR5 A;  1XD3 B;  5DPT A;  3ML4 A;  3H9D A;  4W9D A;  4A20 A;  3DDC B;  5D3V A;  2V1Y A;  5EFX A;  3ML8 A;  3SO6 A;  3W1S A;  5DI9 B;  2DHJ A;  4KVG B;  2ZCB A;  1OGW A;  2MBE A;  2KX3 A;  1ST7 A;  3BJI A;  1LXD A;  2IBI B;  2FID A;  4Z2N A;  3P6A A;  4W9K A;  2GJY A;  2DHK A;  1I7A A;  1ZVR A;  2GBK A;  2RUK B;  1HE8 A;  1OEY A;  3A1Q A;  3A98 B;  2VKI A;  3RT3 B;  2GMI C;  4KHO A;  3EPY A;  3ZNZ B;  2ZVN A;  2D2Q A;  3PLU A;  4EEW A;  1YX6 B;  3A9K A;  3VH3 B;  5KHQ A;  3ZUN A;  3A4S C;  1X11 A;  2FAZ A;  5C79 A;  4W9G A;  2Z0D B;  4IWQ A;  1W1G A;  4MH0 E;  1QZE A;  5DHF B;  4F7H A;  2D9Z A;  4FHK A;  1DDW A;  1M7R A;  1K8R B;  3FM8 C;  2I1K A;  1L7Y A;  4NAW A;  2RSU A;  3RCP A;  3AXC A;  1YJ1 A;  4AJY B;  1TGZ B;  1NTV A;  3ODW A;  4GDK A;  3N30 A;  3APF A;  4GMX B;  3GOE A;  5IAA C;  4E74 A;  1XD4 A;  1UH6 A;  1P9D U;  2C7H A;  5AZH A;  3VTU A;  2MSE D;  4PNK A;  2CU1 A;  2DX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...