3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
3PS6A 3V5WA 5DPRA 3N3KB 3L08A 1R4MI 2K8BA 2MDXA 1KOTA 2GBMA 5JHBA 2GMIC 3L17A 1WGDA 1C3TA 2WX1A 3NZUA 1V88A 4KDIC 4NJ7A 1GJZA 5HE1A 2KZRA 2DFKA 1NVLA 4YONA 2ROVA 4CHMA 3H7SA 4BOSC 2V3SA 3KYCD 2FUHB 2OTXA 4DWFA 2E2XA 5JZEB 3QA8A 3SYXA 3M63B 1BTNA 2KANA 2L0TA 3X23A 1AQCA 5FI1A 1NDDA 1P9DU 2K6QA 1XR0B 1H8CA 1WVHA 1WG7A 2FIFA 3KVFB 3OAWA 1E8YA 4HLEA 1XD3B 1RRBA 3OANA 3OLMD 3R3MA 2DN6A 1EF5A 4ICVA 4BBNC 1DDMA 1WXMA 2YRYA 2KNBA 3QWZB 3TW1A 3VTVA 3F0WA 3SO6A 4MM3A 3KH0A 1AWEA 4B95A 3JVZX 1V6EA 3RZWC 1F9JA 1ZGUB 3SV1A 3ML8A 3QARA 1V5UA 2LJ5A 1OGWA 2Q13A 4K2OA 2ASQA 4MSQB 5J3TA 3PPAA 3PTFC 2LYDA 4DHZB 3IFWB 1KJTA 4M0WB 4HAXB 2OQBA 1OQNA 3ZKJC 3WAMA 5AZHA 3MHSD 2VRWB 1XODA 2ZVNA 2LUEA 1BTKA 5C1ZA 3UQBA 2I1KA 2K8HA 3ZDMC 5JH5C 2LRUA 1P0RA 2DZKA 2I5FA 2PE9A 3ZDTA 2CODA 3P7ZA 1I42A 5D3WA 5D27A 4W9JA 2N9XA 3I3TB 1EAZA 2MP2A 5JLJB 2JVCA 4BOZB 1WJ4A 1WE6A 3HM3A 2M0XA 4IM3A 1WX9A 2GBNA 3VUYA 2PEAA 3JYUA 3PEGA 2JXXA 1TGZB 4TKNA 2L05A 3ZNHB 1E8XA 1IRSA 2NMBA 4BKSA 1MIZB 3GYOA 1FXTB 4XX5A 4NAWB 2J59M 4E3CA 2WH5A 2YS1A 2EKEC 4KSLC 2DYBA 1MG8A 5GOWB 2Z0DB 4FA6A 2YT1A 5IAAC 4DK5A 1NBFC 2OOBB 1E7VA 1UNQA 4WWNA 2DAFA 3NSUA 3HQCA 2EJ8A 1XT9B 1GG3A 4WJNA 5KHOA 3PVWA 1QQGA 4GIVA 3VOQA 1X11A 2KOXA 3PRPB 4HK2A 2KFJA 5L81A 4GZUA 2FCQA 4F8CB 3ML4A 4BBNF 1WF9A 1BT0A 3QWMA 4IWQA 1YX6B 3UF8A 3D8FA 3U7DA 3H6NA 1PMSA 2G4SA 2ZCCA 3ENEA 3QAQA 4B6WA 2KX3A 2KCJA 2AL6A 5AEKB 3UIOB 1XQQA 3L13A 3S2AA 1WRDB 5HE2A 3RD2A 4EZLA 3A4RA 1UPRA 4DDGD 3ZUNA 2Z0PA 3GZNI 2DHKA 3DXCA 4MGYE 2V4LA 3CSTA 3H7PB 3A1QA 2NZ8B 1UBIA 2IO0B 1GC6A 2QHOA 5LXIB 3N32A 5JHHA 3T8MA 2L3ZA 3N7CA 2GBKA 2ZJDA 2CS4A 1P1AA 2DX5B 3Q3FA 3V6EB 1IPGA 1WZ3A 2KN5A 4GDKA 3B1LX 4DXAB 4OVVA 3VHTC 1V5TA 1ZM0A 4GOCA 1L2NA 2V76A 2LRWA 1NI2A 4K81A 3TFMA 3ODXA 1NTYA 2MLBA 4MJSB 3AJ4A 1VD2A 3CIKA 4NQLB 2IYDB 2GCJA 4LCDE 4WJQA 2WDTB 2KDEB 1MKEA 1HBKA 1X05A 3IG3A 3X0WA 2YVCA 2BGFA 5GMVA 2C7MB 2KHWB 1WMHA 1UD7A 3DVGY 5TR5A 5C6RA 3EHVA 4HAZB 4HB4B 2NBWB 4MGZE 4II2B 3PLUA 2O2VA 2ZNVC 3KW5B 4C0AA 3NZSA 2JRHA 3HIZA 4P7IA 3L16A 1WFYA 2MBEA 3M1IB 5D3XA 4ZDVA 3QIJA 2DLWA 1Z5SB 3GOEA 1V5OA 3TL5A 3HW2B 2REXA 1HB8A 4FLHA 4B9KA 4WSFA 1HB6A 2CHWA 5DHFB 1U27A 3A9KB 5FI0A 1WY8A 1PLSA 2K2JA 2COPA 2ROZB 4JLCA 1WX8A 3B0AA 2CQUA 2YLMA 2C5LC 3W1SC 2LGDA 4KAXB 2LI5A 1S3SG 4K7SA 4I6NB 1V81A 5LXHA 3EPYA 4JL9A 1U4AA 1WM3A 4L6EA 5E6OA 2UZRA 2M38A 2BKFA 4K7UA 3KZ1A 3A33B 1RJ2A 3P6AA 2COAA 1DBHA 4W9HA 3NHEB 3VFKA 4MK0A 5D6JB 1G6JA 3ULBA 4KHBB 2KC1A 1MIXA 2C60A 4W9FA 2GJYA 1BWNA 1Q67A 2KWCA 1D3ZA 1WJNA 1N3HA 1ZSQA 2KD0A 2VKIA 2NCNA 1DROA 2O6VA 1V61A 3ALBA 2W9NA 2ZPNA 3LDZE 2K1FA 2L8JA 2IBIB 5D2MB 1WJ1A 4A20A 3EC8A 3CMMB 4Z2MB 2MX2A 3WALA 4ICUA 4XZ4A 1LW3A 2G45B 2BKRB 3N30A 1DYNA 1Y8RC 3LJ3A 2RQ1A 2B3AA 1YX5B 1WR6E 4ANXA 2K2UA 2JUOA 4DX8A 3WIMA 4GSWA 2COFA 3V60A 2DZJA 2JF5A 4K1RB 1H4RA 1EF1A 3DVNU 4WJPA 2V1YA 1WGGA 1ZW7A 2R2QA 2AEHA 2BWES 4TV3A 1MK9B 4TQ0A 1UH6A 2KJ6A 4FJVB 3K9PB 2WWZA 1ISNA 1WI0A 3SD5A 2BWFA 2UWQA 3H1UA 4LJPB 4RM8A 5AZFA 4F7GA 2JY6A 2ZNVB 2YT0A 4EEWA 4DHJB 3ML9A 1LB1A 2IY1B 1FHOA 1UGMA 4HPLB 4NPNA 4AP4C 3DQVA 1YQBA 4PS7A 5G2NA 1S1QB 2HD5B 3H9DA 1E7UA 2FIDA 3MTNB 2N9EB 3U8ZA 4HCNB 2MQJA 2ZPYA 3F5RA 3SUZA 2RD0A 2D9WA 4EZKA 2IFSA 4GGQA 3RYTA 2UVMA 3UQAA 5HE3A 2KTRA 1GC7A 2JPHA 3HHMA 4AJYB 5JP4A 4WWOA 2KLGA 2LXCA 3FLVA 2L0FA 4A6FB 4G3XB 3QHTA 3ZO5B 3G9WA 2IO1B 3K9OB 2CHXA 4I6PA 5KHQA 2XK5A 3NS8A 1K5DB 4NJ6A 2KUPA 5CHWA 2KMAA 3OJ3A 3V61A 2L7RA 3ZRFA 4GPTB 4I6LB 2N4FA 2YSZA 4PQ0A 3DXDA 3DCGA 2DZIA 5BO4B 4Z2NA 1NU2A 1U5DA 4HDQA 2DZMA 1TXDA 2Z0OA 5JHGA 4G50A 1NTIA 2IZVB 2N1VA 2N23A 4ZRIA 2PE6B 3TJPA 2MWNB 2JRIB 3ZVRA 5C16A 4WQOB 1C1YB 2RR9A 1ZC3B 2BYEA 3PGEA 1LM8B 3PZDA 1X86A 2CY5A 3DDCB 2DYOA 3JSVB 4N9F4 2DENB 3VH4B 4AJWA 1V5MA 4MT7A 3PP2A 3TCAA 1H10A 3A9JA 4KIKA 4ANWA 4WJ7A 2J7QB 2MWSB 1FGYA 2H7EA 1WGQA 1QZEA 2CY4A 2DHIA 1WM2A 3HK0A 3IHPC 3M62B 3BINA 2Z0EB 2ZVOA 2NPTA 2CB8A 3NY5A 1Y5OA 1SHCA 1AARA 3M95A 4PS8A 3KYDD 3RCPA 3WANA 3QCAA 3RZFA 3P2BA 2G4DB 2MFQA 2KJRA 4PYZA 2RNRB 4IOYX 2NS5A 2R2OA 2Y7BA 1V2YA 1U29A 2FNJB 2WYQA 2FCSA 3PV1A 4TUUA 1U5FA 4F7ZA 1RLFA 3RULA 2KDBA 1UNPA 4F7HA 5DPTA 2GBJA 3BJIA 1UEFA 1X1MA 4ASWC 1X1GA 2KFKB 4HWIB 4W9GA 3VH3B 4EMOA 3ULCA 3RT3B 1KZGA 4RM9A 5C79A 3PVUA 3PSCA 2FCMA 1ZC4B 2DYMA 3DBRI 2LWPA 2YF0A 4K7WA 5KQ1A 3VUWA 1VCBA 3TO1A 1J0WA 2P0HA 2W2WA 4W9EA 2ABDA 5LOPB 3RCZA 1LXDA 2N0YA 4BKSD 3PHWB 2RSUA 5J17A 2N1WA 3A4SC 1GUAB 4AUQC 2RGNB 2C7NB 1RAXA 4HAUB 3GYPA 2DHJA 2HTHB 1OMWA 4XWXA 4PNKA 4K17A 1NTVA 2ZEQA 4BFRA 2KK8A 3ZLZA 2A4ZA 4A6HA 2P8VA 3EFUA 1WYWB 1K5GB 2N7EA 4GU2A 4KSKC 4IM0A 2YS5A 1RFAA 5LONB 2J0JA 3MDBC 4GMVA 1WE7A 3DOWA 1WJMA 3AULA 4JGHB 1OY2A 2DYNA 3UGBB 3PT2B 4HAVB 1FOEA 3SNHA 2XBBC 5HE0A 4MELA 2FCNA 2KVRA 1FHXA 2FDQA 4GDLA 1UBQA 2ZZPB 1TZ1A 3QQ8B 4Y94A 1Q5WB 4YL8A 1Z87A 2KDFB 3HM6X 3R66C 3UINB 1W1GA 5CLLB 3FEHA 2EMSA 3AU5A 3VDZA 2MBOA 4W9KA 5CHVC 1K8RB 1Q1OA 2LBBA 1J8CA 4KZ0A 5C5BA 3ZW3A 1R4NI 5IJMA 2RVBB 2G3QB 2N9PC 4FHKA 3A1QB 1OTRB 4DX90 3T06A 2A5UA 4BVUC 2NR2A 3JW0X 5C23A 1A5RA 3W1YA 4M8NA 2KQSA 3ZTDA 4A3OA 1YIWA 1ZKHA 4KHAA 1HE8A 3V6CB 2NVUI 3L54A 1KI1B 3Q3JA 4GDKB 1U2BA 1FB8A 1TBEA 4PYUA 2OJRA 2Z0QA 4WJOA 2BYVE 2JZZA 2MBBB 3A98B 1EUVB 4HAYB 4B6HA 4ANUA 1WZ0A 3O65B 2IY0B 3V62A 4W9IA 1J19A 4GMXB 1W1DA 3EECA 5G55A 3KSYA 3DBSA 2AL3A 4FADA 2ELBA 2LXAA 1OEYA 4BBKA 3VAWA 1P3RA 4A6FA 4HVBA 1JRUA 2K8CA 4A5KA 4M8MA 3ZRCA 3R7QA 2IO2B 1TQZA 2XEWA 2JP2A 2LD9A 1UELA 2Z59B 4DHJD 3VVWB 5E6PA 1DDVA 1DDWA 3CF6E 2UZSA 5DH9B 5J18A 4TYZA 4MH0E 4A6KA 4MY6A 3TMPB 2AYOB 1EVHA 2XQNM 3PG7A 3AU4A 1P6SA 4MGKE 4BKTA 2LVPA 4KDLB 2EMTA 5HKHA 3PRMB 2K25A 3QBVB 1MK7B 3UIPB 3O96A 4D0NB 2I1JA 2WX0A 1V80A 3QJZA 2D2QA 2BPSA 1X1FA 1WGRA 2KC2A 4LJOB 1XCGA 1MPHA 4LDTB 1BAKA 2LVOA 2O6VD 2VSZA 3MJWA 5D7GA 4AWJA 2K00A 2GBRA 2N7DA 3JSVA 4ZRKA 4IC7B 4K2PA 2H7DA 4NQKE 4NAWA 1WXSA 2LVQA 2IO3B 2CAYA 2NBVB 3KUZA 4EKUA 5L95C 4NY0A 1U5EA 2ELAA 1TJ6A 1FAOA 4FJZA 4TQ1A 2GOWA 4F7UP 2M14A 1I35A 3A8QA 1V89A 2LGXA 2O6VB 3WA0A 4IAPA 4EOYA 3D8EA 3PSEB 3KUCB 3IVFA 2J0MA 4HDOA 1WIAA 4X57B 1W1HA 1V5PA 4E74A 4HPMB 2LULA 2KFKA 3APFA 1YD8U 3ODWA 1FGZA 3ZNZB 2J0KA 1SGHA 3ZNID 2MKRA 5LLIA 2LASA 1Q0WB 4HATB 2LOZA 4FJYA 1UNRA 4IFSA 2MCNB 1B55A 1ZVRA 4EJNA 1Y19B 1E5WA 2M8SA 3H7PA 2D9VA 4MEMA 2RPQA 2COCA 4DHZE 3AXCA 2JT4B 3T9LA 4ZYNA 2DA0A 2LKOA 1V9JA 2DX5A 2KWVB 2HTHA 1M7RA 4GB9A 3AI5A 4EUTA 2KX0A 1ST7A 4JQWC 4WVFB 3TIXA 1RRPB 3MPXA 3SU8X 3DVNV 4MJSA 4IWOA 2DTCA 1E8ZA 1FHWA 5D3YA 2KXJA 4XC2A 2BCJA 2MRPA 1P3QU 4MDKE 3ZNGC 2M4NA 2R0DA 5KCVA 2KJHB 1MAIA 2JWZA 4HAWB 1V86A 2UYZB 5AZGA 2KTRB 4W9CA 4URKA 2PZ1A 2EC1A 4FULA 3ODOA 3VXWA 3SDLC 4W9DA 3OJ4B 2W2XC 4J6IA 3ZIMA 4CHKA 1XD4A 2GS0A 4GXBA 2L76A 2XK5B 2L2IA 2D07B 2KKCA 1SIFA 4DBBA 3WYFB 3PHXB 1WGHA 2Y8GA 5CLQB 1ACAA 1PQSA 4FHJA 1KZ7A 4RMAA 4HB2B 3ZVVA 4WAAA 4W9LA 3WAPA 2DYQA 3D8DA 5EDSA 1KLVA 3A9KA 4FBJB 3TVVA 2KMCA 3M3JA 4IM2A 3KUDB 5DIFB 3KY9A 5D94A 3PRZA 4E71A 4AOFA 3DXEA 4G11A 2I5CA 1T0YA 3VTWA 1XX0A 2K39A 5J2RA 5CX3A 4GN1A 5DI9B 2MP2B 3B08A 3D32A 3NOBA 3QK0A 5EFXA 4H8SA 1P5TA 2DKQA 4IG7B 3FM8C 3RUIB 1IP9A 2G35A 2KQ7A 2DX1A 1EGXA 4CHJA 2CKHB 1WX7A 4HXDA 5J3YA 2D4QA 1GNUA 4IW0A 4KIKB 2CRFA 3A9JB 2PPHA 2RSGA 3VTUA 2KO3A 3KRWA 4II3B 1WJUA 3KRXA 2L1CA 1I2HA 2NPTB 1UPQA 2D3GA 4MSMB 2R09A 3DPDA 4KZCA 1P98A 2BF8B 1CMXB 4JIOU 2MBQA 4CO7A 4A3PA 4KVGB 2M17A 4HB0B 1E8WA 2CHZA 4HHVA 2FAZA 2IYBA 3PVLA 2VRRB 2LG1A 2RUKB 2M1MA 3ZTCA 2P0DA 2LOXA 2RGFA 3R7RA 2C7HA 2K6DB 2NBUA 1M94A 4MGIE 2GCLA 2RLOA 1LFDA 5KQ4A 4OVUA 5D3VA 3PLVA 1SE9A 1TTNA 2W2XD 2KTFA 2LGYA 2JZ3B 4HJKA 4IWPA 3QX1A 1XKEA 5FR6A 2KDIA 3PREA 1U5GA 1WJ6A 4DDID 2QKLA 3ECIA 3L10B 2MSED 1OQYA 2BYFA 2X18A 2ZCBA 1IYFA 2FJLA 1OEYJ 2HJ8A 5IA7A 3IBEA 3VUXA 2P0FA 1YJ1A 1WXAA 5J3QA 4IUMB 1PFJA 2D11A 2ADZA 4F1SA 3WAOA 2DAJA 3L0WB 1WI1A 1M7EA 4BKGA 2HRJA 3BY4B 4KHOA 5DHAB 1WGUA 1V49A 2MW5A 2D9ZA 3DBHI 3CSFA 1I7AA 3DVGX 4NNJB 3ONSA 2KWUB 2YS3A 1E90A 3SHQA 2AWTA 3UZTA 2FJ9A 3APDA 3FSSA 1J0GA 2Y8FA 2MBHA 1WMHB 4NSWA 3W1SA 3QC8B 4FN2A 1L7YA 3LJUX 4HB3B 5CHFA 2O2VB 2CR5A 3A8PA 2C9WB 4PS3A 5DPSA 2HE7A 4ZRJA 5JHAA 4HCPB 2KGXB 3FP5A 4DBGA 4KV2A 1WH3A 2L00B 1EO6A 4GDLB 2Y5BB 5E6NA 1UZXB 3DBLI 1QC6A 2MA9B 2D9YA 2D9XA 1Z2MA 5CTRC 3C0RB 4ANVA 3VQIA 4EZJA 1WGYA 2PJHA 2KLCA 1LQBA 4LDTD 2DKPA 2LZ6A 5DCNA 4CYEA 2CU1A 2DHZA 3TBLD 5L83A 2QKMA 3VIAA 4EFOA 1WR1A 1WXVA 1KM7A 2D10A 5C5BB 3APCA 5DPWA 3CXBB 4G0NB 3U30A 4WWPA
chains in the Genus database with same CATH superfamily
3PS6A 3V5WA 5DPRA 3N3KB 3L08A 4ITKA 1R4MI 2K8BA 3AE9B 1NYRA 2MDXA 5FKAC 2JWUA 4JKEA 1KOTA 2GBMA 2JQRB 4YSXB 5JHBA 2WXOA 2GMIC 4JK8A 1XLQA 3L17A 1WGDA 2LGSA 3URYA 3HVZA 1C3TA 2WX1A 3NZUA 1V88A 2GRIA 4YTNB 2W54A 1ET9A 4KDIC 4NJ7A 1GJZA 5HE1A 2KZRA 4JKDA 2DFKA 1NVLA 4YONA 2ROVA 4BAXA 4CHMA 3H7SA 4BOSC 2V3SA 1VR9A 4A6QA 4OHJA 2VH1A 3U7ZA 3KYCD 2V3NA 3IAM1 2FUHB 2OTXA 4DWFA 2E2XA 5JZEB 3QA8A 1YJJA 3AM9A 3SYXA 3M63B 1BTNA 2WU5B 2L0TA 3X23A 1YJIA 1AQCA 3AMZA 1N6ZA 5FI1A 1NDDA 1P9DU 1FXIA 1TIFA 2M56B 2K6QA 1XR0B 3N1XC 1H8CA 2X8XX 1WVHA 1WG7A 2FIFA 4ZRPA 1YQ3B 3KVFB 3OAWA 1E8YA 3RNFC 4HLEA 4JK9A 1XD3B 1RRBA 1TT5B 1L6VA 3OANA 1XLOA 3OLMD 3R3MA 2DN6A 1EF5A 4ICVA 4BBNC 1DDMA 1WXMA 2YRYA 4IOIE 2GB1A 2KNBA 3QWZB 5C3JB 1JALA 3TW1A 3VTVA 3F0WA 1D4BA 3SO6A 2BB6A 1E0ZA 4MM3A 5M4YB 1OQQA 3TEXA 1A70A 4XDCA 3KH0A 2AQ2B 2LFIA 1AWEA 4B95A 3JVZX 1SE3A 1V6EA 3RZWC 1F9JA 1ZGUB 2WLBA 3SV1A 3Q14C 2CJNA 4C7YA 3ML8A 3QARA 1V5UA 4YWGG 2LJ5A 2KWDA 1OGWA 2Q13A 4K2OA 2ASQA 4MSQB 3NWAA 4AQ7A 5J3TA 1AWDA 3PPAA 3PTFC 2BYTA 2RMMA 3NWFA 3FVCA 2LYDA 4DHZB 3IFWB 1KJTA 4JPSA 4M0WB 4HAXB 2OQBA 1OQNA 5AZHA 3WAMA 3ZKJC 3MHSD 2VRWB 1IBXB 1XODA 2ZVNA 2LUEA 1BTKA 1CZPA 5C1ZA 4HROA 4ZOHC 3UQBA 4REZA 2I1KA 1JWSD 2K8HA 3ZDMC 5JH5C 1V1PA 2LRUA 1P0RA 4KGSA 2DZKA 2I5FA 1C4AA 2PE9A 1N63A 3ZDTA 2CODA 3P7ZA 4MT5A 5D3WA 2MH7A 1I42A 5D27A 4W9JA 2N9XA 2W3RA 3I3TB 1EAZA 2MP2A 5JLJB 2JVCA 4BOZB 5C2TB 1WJ4A 1WE6A 3Q8AA 2EKIA 3HM3A 2M0XA 4JKFA 4IM3A 1WX9A 2GBNA 3VUYA 2PEAA 1T0RC 4BZAA 1QF6A 1I4GA 2AX5A 1E10A 3JYUA 4XGAB 3PEGA 2JXXA 1TGZB 2QMTA 4TKNA 2L05A 3T3OA 1P7EA 3ZNHB 4ILHA 1E8XA 1IRSA 4LNFA 2NMBA 1MI1A 4BKSA 1MIZB 3GYOA 1FXTB 1QOFA 4XX5A 4NAWB 2BS3B 2WXMA 2J59M 4E3CA 2WH5A 1YN3A 2YS1A 2EKEC 4KSLC 2DYBA 1MG8A 5GOWB 2Z0DB 1E6EB 4FA6A 2YT1A 4HRSA 5IAAC 4LNOA 2WGSA 4DK5A 3AE2B 1NBFC 2OOBB 1UNSA 1E7VA 1UNQA 1RFKA 4WWNA 2DAFA 3NSUA 3HQCA 2EJ8A 1XT9B 1GG3A 1FFVA 4GLSC 4WJNA 2WU2B 5KHOA 5T8IA 3PVWA 3P63A 1ET6A 1QQGA 2WHIA 3VOQA 1X11A 4GIVA 4DQOC 2KOXA 3NG0A 3PRPB 4HK2A 2KFJA 5L81A 4GZUA 2FCQA 3B77A 3RN9C 4F8CB 2MHJA 3ML4A 4BBNF 1FO4A 1WF9A 1BT0A 1HA5A 2WXQA 4EE2A 3QWMA 2PKOA 3DHHC 4IWQA 1YX6B 3UF8A 3D8FA 3U7DA 3W9CB 3H6NA 1PMSA 2G4SA 2ZCCA 3ENEA 3QAQA 4B6WA 1J7CA 4RF1A 2KX3A 2KCJA 2AL6A 4KKJA 5AEKB 3UIOB 1XQQA 3AEFB 3L13A 3S2AA 1WRDB 2WXIA 5HE2A 3B2FA 3RD2A 4EZLA 3A4RA 1UPRA 4DDGD 1J7AA 3ZUNA 2Z0PA 3GZNI 1QOBA 1J7BA 3AEBB 1F52A 2M0AA 2DHKA 1SEBD 3DXCA 4D2KA 4C7ZA 4MGYE 2V4LA 4JKGA 3CSTA 3H7PB 3A1QA 2NZ8B 1UBIA 2WP9B 2IO0B 1GC6A 1ZDVA 2QHOA 5LXIB 1C4PA 4JWUC 1ZOYB 2WXHA 3N32A 5JHHA 3T8MA 2L3ZA 3N7CA 2GBKA 2ZJDA 2CS4A 4HKZE 1P1AA 1QOAA 2DX5B 3OWEB 3NJTA 4XYCA 1FIQA 4WH4A 3Q3FA 3V6EB 1IPGA 3GP7A 4A8XC 4JKAA 1WZ3A 2KN5A 3B1LX 4GDKA 1EWCA 4DXAB 4OVVA 3VHTC 1V5TA 1ZM0A 4GOCA 1L2NA 2V76A 2LRWA 1NI2A 4K81A 2KVZA 3TFMA 3AE8B 4YTPB 3ODXA 1NTYA 2MLBA 3EFCA 4MJSB 3AJ4A 1VD2A 3CIKA 1GB4A 3MP9A 4NQLB 2IYDB 2GCJA 2L83A 1L0XB 4LCDE 4WJQA 2WDTB 3E9SA 2KDEB 1EWYC 1MKEA 1HBKA 5IRSA 1X05A 1SJHD 3IG3A 3ZQ4A 3X0WA 2YVCA 3IT4B 2BGFA 1D5MC 5GMVA 2C7MB 2KHWB 2DLBA 2VZKD 2K5PA 1WMHA 1UD7A 3DVGY 5TR5A 5C6RA 3EHVA 2G1EA 4HAZB 1VLBA 4HB4B 2PMVA 2NBWB 4MGZE 4II2B 3PLUA 2O2VA 1ZUD2 3AEAB 3E9PA 3VR8B 2ZNVC 1GOZA 3KW5B 4C0AA 3NZSA 2K49A 2VH2A 2JRHA 3HIZA 3AECB 4P7IA 3L16A 1WFYA 2MBEA 2GLSA 3M1IB 1TY2A 5D3XA 4ZDVA 3QIJA 4WAFA 2DLWA 1Z5SB 4DIXA 2Z59A 4P1CC 3GOEA 1V5OA 4KGRA 4YXDB 4RNAA 3TL5A 3HW2B 2REXA 1SXTA 1HB8A 4FLHA 2W82A 2KDMA 4B9KA 3Q3NC 4WSFA 1DIKA 2HTME 3FILA 1HB6A 2CHWA 3DBLB 5DHFB 1MVKA 1U27A 3A9KB 5FI0A 1WY8A 5D3DA 1PLSA 1NVID 2K2JA 2COPA 3U12A 1LGRA 2ROZB 4JLCA 5IO9A 1WX8A 3B0AA 2CQUA 2YLMA 2C5LC 2D3BA 3W1SC 2LGDA 4KAXB 2LI5A 4N59A 1S3SG 3GS2A 4K7SA 4I6NB 1V81A 5LXHA 3EPYA 4JL9A 1U4AA 1WM3A 2WXJA 5JVLA 4CSQA 1XXGA 4L6EA 5E6OA 2UZRA 2INNE 2M38A 2BKFA 4K7UA 3KZ1A 2R82A 3A33B 1RJ2A 3ZYYX 3P6AA 1VBGA 1TJEA 2COAA 3N1ZC 1DBHA 4W9HA 3NHEB 3VFKA 1R4MB 4MK0A 1YN4A 5D6JB 1G6JA 3ULBA 4KHBB 2E6XA 2NBVA 2KC1A 1MIXA 3EUB2 2C60A 4C80A 4W9FA 2GJYA 3U52E 1BWNA 3AE3B 1Q67A 1ZDXA 2KWCA 1D3ZA 2MJ3A 1MFWA 3VRAB 2ON8A 1WJNA 4P16A 4OT1A 4RGMA 1PFDA 1N3HA 1ZSQA 2KD0A 1DYQA 4TSSA 2R61A 2VKIA 3IXSA 1FPYA 2NCNA 1DROA 1KC7A 2O6VA 1V61A 3HVDA 5EE9A 3N20C 1ACCA 4XDDA 3ALBA 1FMAD 4KX6B 3I63C 3ZJUA 2W9NA 2ZPNA 2FJUB 2Y5CA 2K1FA 3LDZE 2L8JA 2IBIB 5D2MB 1KRHA 1WJ1A 4A20A 3EC8A 3CMMB 1D5ZC 4Z2MB 2MX2A 3BVZA 3NVVA 3WALA 1TY0A 2BBCA 4ICUA 3E9OA 4XZ4A 1LW3A 5EE1A 1JWBD 2G45B 2BKRB 2TSSA 3N30A 1DYNA 3RFZB 1Y8RC 2KIEA 3LJ3A 1NEKB 2RQ1A 1MI0A 2B3AA 3L4PA 3P4RB 1E9MA 1GPXA 1YX5B 1WR6E 4LNNA 4ANXA 2K2UA 2JUOA 1K52A 2QJLA 4DX8A 3WIMA 1NI3A 4YTMB 4GSWA 1C4CA 2COFA 4L1BA 3V60A 1QT9A 2DZJA 2JF5A 4NZLB 4K1RB 1H4RA 1EF1A 1OFFA 1VRAB 4A9AA 3HIEA 3DVNU 4WJPA 2V1YA 1WGGA 1ZW7A 2R2QA 2AEHA 2BWES 2H89B 1YQ4B 4TV3A 1MK9B 4TQ0A 2DWQA 1UH6A 1L4ZB 2KJ6A 1ENFA 1L5PA 1I4QA 4FJVB 3K9PB 4GOUA 3OG5A 2WWZA 3ZGZA 1ISNA 1WI0A 3SD5A 2BWFA 2UWQA 4DXFA 3H1UA 4LJPB 4RM8A 5AZFA 4F7GA 1AN8A 1KFYB 2LHEA 2JY6A 2ZNVB 4PT5A 1XCQL 2YT0A 4EEWA 2LHDA 4DHJB 1V1OA 3ML9A 2INDC 1LB1A 3MHZA 2CU3A 2IY1B 1KLUD 1FHOA 4HPPA 1UGMA 4HPLB 4NPNA 4AP4C 4AS1A 3DQVA 1YQBA 4PS7A 5G2NA 4KGTA 1S1QB 2HD5B 3H9DA 1E7UA 2FIDA 1HZ5A 5E6JA 3MTNB 2N9EB 3U8ZA 4HCNB 2MQJA 4YT0B 2ZPYA 3F5RA 3SUZA 2RD0A 2D9WA 3DHIC 2INCC 4R3DA 4EZKA 2IFSA 2FUG1 4GGQA 3RYTA 2ZKMX 2UVMA 4S0RA 1XLPA 2I38A 3UQAA 5HE3A 4IKGA 2KTRA 1GC7A 2JPHA 3HHMA 4AJYB 5JP4A 4WWOA 2KLGA 5EE3A 2LXCA 3FLVA 2L0FA 2PW9A 4A6FB 4G3XB 2J53A 2JXTA 3QHTA 1HQRD 1K53A 3RNCC 3ZO5B 3G9WA 3GE3C 2IO1B 4OVZA 3K9OB 2CHXA 4I6PA 5KHQA 2LMCA 2XK5A 3E56A 3NS8A 1K5DB 4NJ6A 2KUPA 5CHWA 2KMAA 3OJ3A 1DGJA 3V61A 1B1ZA 2L7RA 3ZRFA 2RRFA 4GPTB 4QJ4B 4I6LB 2N4FA 2YSZA 4PQ0A 3DXDA 1HEZE 3DCGA 1WRIA 1F0ZA 1F2RI 5AUKA 2DZIA 5BO4B 4Z2NA 4NJCA 1NU2A 3RNGC 1U5DA 4HDQA 2DZMA 1TXDA 2Z0OA 5JHGA 2CJOA 5HI1A 4G50A 3GE8C 1NTIA 4P1BC 2IZVB 2N1VA 3MFGA 1SBBB 2N23A 3AE5B 4ZRIA 3Q6BA 3KWLA 1DOXA 3AH7A 2PE6B 3GZNB 3TJPA 3KLSX 3UI3A 2MWNB 5HFYA 2JRIB 3ZVRA 5C16A 3Q3MC 1PGAA 2RDGA 4WQOB 1AW7A 4OSNA 1C1YB 2RR9A 1ZC3B 3J9CA 2K8EA 2BYEA 3PGEA 1LM8B 4ARCA 1TS2A 3PZDA 1X86A 2CY5A 3DDCB 2DYOA 1FM0D 4N6EB 3JSVB 4N9F4 2DENB 3VH4B 3W5UB 4AJWA 1R7SA 1V5MA 4MT7A 3PP2A 3Q8CA 4LK0M 3TCAA 1H10A 3A9JA 4KIKA 4ANWA 4WJ7A 2J7QB 2MWSB 1FGYA 4LNKA 2H7EA 1WGQA 1QZEA 4ZYSA 2CY4A 2DHIA 1WM2A 3HK0A 3IHPC 3M62B 3BINA 4OZCA 2Z0EB 2ZVOA 1N60A 2NPTA 2CB8A 3NY5A 2ZW1A 3BK1A 1I4PA 1Y5OA 1SHCA 1CQVA 1AARA 3M95A 4PS8A 3KYDD 3RCPA 1PDXA 1C78A 1NYQA 3QCAA 3WANA 3RZFA 3W5VB 3RMKC 3P2BA 2G4DB 2MFQA 2KJRA 4PYZA 2RNRB 4IOYX 2NS5A 2R2OA 1C77A 1EU4A 2Y7BA 2KMMA 5TSSA 1V2YA 1U29A 2FNJB 2QIEB 2WYQA 2FCSA 4WURA 3PV1A 4TUUA 1U5FA 3AE4B 4F7ZA 1RLFA 3RULA 2KDBA 1UNPA 4F7HA 4C4VB 5DPTA 3RPFC 2GBJA 3BJIA 1UEFA 1X1MA 4ASWC 1X1GA 2KFKB 3R2IA 5BYQA 4HWIB 4W9GA 4MM3B 3VH3B 4EMOA 3ULCA 3RT3B 1KZGA 4J3OD 2OJWA 4RM9A 4FXCA 5C79A 3PVUA 1T0QC 3PSCA 2FCMA 2LUMA 1ZC4B 5G5HA 2DYMA 1FNVA 4A55A 2NTSA 1F1HA 1YMHE 2BVCA 3DBRI 2JX5A 2LWPA 4Q2JA 2YF0A 5HG2A 4K7WA 5KQ1A 1UWMA 3VUWA 3RNEC 1VCBA 1PUTA 3AB5A 5IKCM 3TO1A 1J0WA 2P0HA 2W2WA 2V0GA 4W9EA 2ABDA 4ARIA 1FFUA 3BYTB 5LOPB 2I2YA 3AE7B 3RCZA 1ZXHA 2W3SA 1LXDA 2N0YA 4ZRQA 4BKSD 1V1PB 3PHWB 3V3XA 2RSUA 2FBWB 1VDVA 2N1WA 3A4SC 5J17A 1GUAB 4AUQC 1L6UA 2RGNB 3I9V1 1VBHA 2C7NB 1RAXA 4HAUB 3GYPA 3NW8A 2E3TA 2DHJA 2HTHB 2X38A 4M01A 1I4XA 1OMWA 3I57A 4XWXA 1I7HA 4C00A 4PNKA 4K17A 1NTVA 2ZEQA 4BFRA 1C76A 1JMLA 2KK8A 3ZLZA 3DHGC 3Q8BA 2KYWA 2A4ZA 4A6HA 2P8VA 3EFUA 5EE0A 4TMAB 1WYWB 1K5GB 2WDVB 2N7EA 4GU2A 4KSKC 4WWPA 1RYJA 1XO3A 3Q69A 4LLGM 4IM0A 2YS5A 3RI7C 2Z8LA 2JYTA 1RFAA 3ZXRA 1Y56A 3FAHA 5LONB 2K0PA 1B9RA 4C56C 2J0JA 3MDBC 2WQYB 4GMVA 1WE7A 1ZE3D 3DOWA 1WJMA 3AULA 4JGHB 1OY2A 2DYNA 3UGBB 3PT2B 4HAVB 1FOEA 3SNHA 2XBBC 1F2RC 2N7JA 2IGHA 5HE0A 4MELA 2FCNA 2R2YA 2KVRA 1V97A 3I5JC 4A90A 1FHXA 2FDQA 4GDLA 3MC0B 2WXNA 1UBQA 1TS5A 2ZZPB 1T6BX 1JQ4A 1TZ1A 3QQ8B 1ZPSA 4Y94A 1Q5WB 4YL8A 1Z87A 3VR9B 2KDFB 3HM6X 3R66C 3UINB 1W1GA 5CLLB 3FEHA 2EMSA 3AU5A 1ZYIA 3VDZA 1JRPA 2MBOA 4W9KA 1K50A 5CHVC 3BZDB 5FK9C 1K8RB 1Q1OA 2LBBA 2BS2B 2JYEA 1J8CA 4KZ0A 5C5BA 2L1AA 3ZW3A 1R4NI 5IJMA 2RVBB 2G3QB 2N9PC 4JKGB 2FE8A 4FHKA 2WXGA 3A1QB 1OTRB 2KUQA 4DX90 2JZPA 3T06A 2WXLA 2A5UA 4BVUC 2NR2A 4S17A 3JW0X 5C23A 1T77A 3HRDD 1A5RA 3W1YA 4O1NA 1KH0A 4M8NA 3TEWA 1PGBA 5H92C 4B0EA 2RDHA 2KQSA 4OZBA 3ZTDA 4A3OA 1YIWA 1ZKHA 4KHAA 4PK1A 1CJEA 1HE8A 3V6CB 1XLNA 1T3QA 2NVUI 3L54A 1KI1B 3Q3JA 3NZ3A 4GDKB 1U2BA 1FB8A 2QDFA 3BIID 1TBEA 3BWUD 2OJRA 4PYUA 3HSAA 4US8A 2HDEA 2Z0QA 4WJOA 2BYVE 2JZZA 3AEDB 2INPE 2MBBB 3C19A 3A98B 1EUVB 1ROEA 4HAYB 4B6HA 4ANUA 1SJED 4NAMA 1WZ0A 2OEDA 3O65B 2IY0B 3V62A 4W9IA 1J19A 4GMXB 1W1DA 3EECA 1EM7A 5G55A 3PO0A 3Q3OC 3KSYA 2UU7A 4WIPA 1WWTA 3DBSA 1N61A 2AL3A 3B9JA 2N9KA 1K51A 2XNAC 4FADA 2ELBA 1VZ6A 4OW0A 2LXAA 2Z13A 1OEYA 2N9LA 3B2GA 4BBKA 3KWVA 3SR6A 1P7FA 3VAWA 1P3RA 1KLGD 4A6FA 4HVBA 1JRUA 2K8CA 4A5KA 4USAA 2NTTA 3P4QB 4M8MA 3ZRCA 1DOIA 1VJKA 3R7QA 1L4DB 2IO2B 2ONQA 2PVOD 3BYYB 1TQZA 2XEWA 3NVWA 2JP2A 2LD9A 1UELA 2Z59B 3N9YC 4DHJD 2PLPA 4JE3B 3VVWB 4QJ3B 5E6PA 1DDVA 1DDWA 1NENB 3CF6E 5BMHA 2UZSA 5DH9B 5J18A 4TYZA 1HXYD 3V05A 2IPKD 2KT7A 2MEKA 4M0WA 3FILB 4MH0E 3ENBA 1IBXA 4A6KA 4MY6A 1F77A 1QKZA 2KACA 3TMPB 1T0SC 2AYOB 1EVHA 2XQNM 3AEEB 2QSDA 3PG7A 3U2SC 1TKGA 3AU4A 1P6SA 4MGKE 4BKTA 5IN7A 2LVPA 4KDLB 2EMTA 3EA6A 5HKHA 3PRMB 2K25A 2GUMA 1GGOA 3QBVB 1MHHE 2ZW0A 1MK7B 3UIPB 2KIGA 3O96A 4D0NB 4LTUA 2I1JA 3SFDB 3PZ8A 2WX0A 1V80A 2WNMA 3ETRA 3QJZA 2D2QA 2BPSA 2BW2A 1X1FA 1WGRA 2KC2A 4LJOB 1XCGA 3BVMA 1MPHA 1N5WA 4LDTB 1BAKA 2LVOA 2O6VD 2VSZA 3MJWA 1HTOA 5I4DA 5D7GA 4AWJA 2K00A 1SE4A 4B0MA 2GBRA 2N7DA 2BQQA 3JSVA 4ZRKA 4IC7B 2D5GA 3NVYA 1GAQB 4K2PA 1CK1A 2H7DA 4NQKE 4NAWA 5D3IB 5BYRA 1WXSA 2LVQA 2IO3B 2CAYA 2NBVB 4XWTA 4D6WA 4H2AA 1N62A 3HUIA 1AYFA 3KUZA 4JK7A 4EKUA 5L95C 3U4EG 4NY0A 3CIRB 1U5EA 2ELAA 1TJ6A 1I4RA 2PVGC 1FAOA 1C79A 1OQRA 4M00A 4FJZA 1FCLA 1EU3A 1TS3A 4N58A 4TQ1A 2GOWA 4L2YA 4F7UP 3AEGB 2M14A 1I35A 3A8QA 1V89A 1IUEA 2LGXA 4DXGA 4RGNA 4XE0A 2O6VB 3WA0A 4IAPA 4EOYA 3AN1A 4RFBA 1QLBB 3D8EA 1RWSA 3PSEB 3KUCB 3IVFA 2J0MA 2DBYA 2IDYA 4HDOA 1WIAA 4X57B 2PTLA 4C4VA 1W1HA 1V5PA 4E74A 3ZJVA 2Z4DA 1PYWD 2WDRB 1L0VB 4HPMB 2LULA 2KFKA 3R8BA 3APFA 5AUIA 1YD8U 1MG4A 1FRDA 1SF0A 3ODWA 1FGZA 3ZNZB 2J0KA 1SGHA 3ZNID 2MKRA 5LLIA 1SE2A 4L23A 2LASA 1TYGB 2JU6X 1Q0WB 3NVZA 1XF5L 4HATB 2LOZA 2BT6A 1KTKA 4FJYA 1UNRA 4IFSA 1SSNA 2OHFA 2MCNB 1B55A 1ZVRA 4EJNA 1VZ8A 1Y19B 1FD6A 1TS4A 1E5WA 2M8SA 3H7PA 2D9VA 3MC9A 4MEMA 3CWIA 2RPQA 4IDIA 2COCA 4DHZE 3AXCA 3DBRB 5H8YE 2JT4B 3EGRA 3T9LA 1KF6B 4ZYNA 1DOYA 1GB1A 4OZAA 2DA0A 2LKOA 1TKEA 1V9JA 4QAYA 1XEEA 2DX5A 3ZXVA 1WXQA 3AV8A 3NRZA 2KWVB 3MJ5A 5BMIA 4WQMA 2B76B 4HJGE 2HTHA 1M7RA 4GB9A 3AI5A 4EUTA 3WCQA 2KX0A 4US9A 1ST7A 1LO5D 4JQWC 4WVFB 2JSVX 2AQ3B 3TIXA 5IP4D 3C8YA 1RRPB 3MPXA 3SU8X 3TEYA 3DWMA 3DVNV 4MJSA 3BK2A 1MHXA 4IWOA 2V4IB 2DTCA 1E8ZA 1FHWA 1ZXIA 2M19A 5D3YA 2KXJA 4ZHOA 2V9HA 4XC2A 5LNK1 1L0YB 2BCJA 1T5XD 1Q10A 2MRPA 1P3QU 4MDKE 3ZNGC 2KR0A 2R0DA 2M4NA 5JXVA 3P42A 3O13A 1JWUD 3LB8C 5KCVA 2KJHB 3SBTA 1MAIA 2JWZA 4HAWB 1JWMD 2LJIA 1V86A 1M4VA 2UYZB 4RH6A 5AZGA 1TZOA 2KTRB 2LGIA 4W9CA 5BYSA 4URKA 1BUIC 2PZ1A 2EC1A 4FULA 3ZJTA 3ODOA 3E66A 2IGDA 3VXWA 2WXFA 1HZ6A 3W2DA 3SDLC 4W9DA 5I2MA 1WYGA 3Q8EA 2K9XA 3OJ4B 1ZP0B 3T3NA 2X0SA 1BXTA 1JROA 2W2XC 4J6IA 3FKYA 3ZIMA 2BS4B 4CHKA 1XD4A 2GS0A 2QCZA 4GXBA 2L76A 2XK5B 5BMGA 1MPEA 1UWXA 2L2IA 1TKYA 4QJ5B 2D07B 2KKCA 1SIFA 4DBBA 3WYFB 3PHXB 1WGHA 2Y8GA 4GNKB 1FEHA 3PZ7A 1V8CA 5CLQB 2WXRA 1QILA 1ACAA 1PQSA 1JCKB 4FHJA 1KZ7A 4RMAA 4HB2B 3ZVVA 4WAAA 4W9LA 3WAPA 2DYQA 3D8DA 5EDSA 1KLVA 3A9KA 1STEA 3TVVA 2KMCA 4FBJB 3M3JA 2KQ4X 1WSPA 1RM6C 4MH8A 4IM2A 3KUDB 5DIFB 3KY9A 2D3CA 1VZ7A 5G5GA 5D94A 1HTQA 3P4SB 3PRZA 1YOVB 4E71A 4AOFA 3DXEA 4RGTA 3TEZA 4L1RA 1QOGA 3VRBB 4M02A 4G11A 2I5CA 2K3UA 1T0YA 3VTWA 1XX0A 2K39A 5J2RA 4JKCA 5CX3A 4GN1A 5DI9B 3AE1B 1E7PB 2MP2B 3B08A 3D32A 3SEBA 3NOBA 3QK0A 5MPOA 5EFXA 4ILGB 1R4NB 4H8SA 4KKIA 1P5TA 3TUOA 1JW9D 2DKQA 2BTEA 4IG7B 2SAKA 3FM8C 2J52A 3RUIB 4JKHA 1IP9A 4K3BA 3RNAC 1XCTL 2G35A 2KQ7A 2DX1A 2YT2A 3NWDA 1EGXA 4KHBA 5HHDG 4CHJA 2CKHB 1WX7A 4HXDA 5J3YA 2NMQA 2D4QA 1GNUA 4IW0A 4KIKB 2CRFA 3A9JB 4RGOS 2PPHA 2RSGA 5IOIA 2V3PA 3VTUA 2KO3A 4P6VF 3KRWA 3GB1A 4II3B 1WJUA 3KRXA 1UUPA 2L1CA 1I2HA 3RNBC 2NPTB 1UPQA 2D3GA 4MSMB 2MJDA 2IJ0A 2R09A 3N1YC 2Y3AA 2WS3B 3DPDA 2KAJA 4KZCA 1P98A 2L32A 2BF8B 1CMXB 4JIOU 2MBQA 4CO7A 2PIAA 4A3PA 5FR3A 3DBHB 4KVGB 2M17A 4JWSC 4HB0B 1E8WA 1N5XA 2CHZA 2YEPF 1IGDA 5I2SA 2RDBC 3P4PB 4HHVA 2WXKA 2FAZA 2IYBA 3PVLA 2VRRB 1C9FA 2LG1A 2RUKB 2M1MA 3ZTCA 4YSZB 2Q5WD 2P0DA 2LOXA 1D6EC 2RGFA 1YNTE 3R7RA 2C7HA 1FCCC 1ESFA 2K6DB 2NBUA 1M94A 4MGIE 2GCLA 2RLOA 1LFDA 5KQ4A 4OVUA 1FNWA 1SB3C 2GI9A 3SBGA 5D3VA 3PLVA 1SE9A 1TTNA 2W2XD 2KTFA 2Z14A 2LGYA 1I4HA 1UGJA 2JZ3B 2VZKB 4HJKA 4IWPA 3QX1A 4K3CA 1XKEA 2H88B 5FR6A 2KDIA 4ILJA 3PREA 1U5GA 3ABVB 3LXFA 1WJ6A 4DDID 4YSYB 3FC4A 4UDUC 2QKLA 3ECIA 2YEPB 3L10B 4JKBA 2MSED 4CQNA 3A58A 1OQYA 1YN5A 1UF0A 2BYFA 2X18A 2ZCBA 4XWWA 2IGGA 4WWMA 1IYFA 2FJLA 1OEYJ 1D5XC 2HJ8A 4MACA 3P1MA 2XN9C 5IA7A 3IBEA 3VUXA 2P0FA 1YJ1A 3LYYA 1WXAA 3BVGA 5J3QA 1FXAA 3H8HA 4IUMB 1PFJA 2D11A 2ADZA 4F1SA 2MJEA 2N0SB 3WAOA 3IT6B 3MC8A 2DAJA 3L0WB 1WI1A 1M7EA 4BKGA 2HRJA 3OHMB 3BY4B 4KHOA 5LG4B 5DHAB 1WGUA 1V49A 2MW5A 3AE6B 3IAS1 4HEA1 1KBLA 2D9ZA 3DBHI 3CSFA 4LNIA 1I7AA 2J4XA 3DVGX 4NNJB 3ONSA 1JWAD 2KWUB 2YS3A 2EELA 1E90A 2WDQB 3SHQA 2AWTA 4HSIA 3UZTA 4JX1C 2FJ9A 2ACZB 3FSSA 3APDA 1J0GA 4HKQA 2Y8FA 4ZHPA 2MBHA 1WMHB 4NSWA 3W1SA 3QC8B 4FN2A 4RCOA 2BB5A 1L7YA 3LJUX 4HB3B 5CHFA 2O2VB 3SFEB 2CR5A 3A8PA 2C9WB 3NS1A 4PS3A 5DPSA 2HE7A 4ZRJA 5JHAA 1BMLC 2ICIA 4HCPB 2KGXB 2Y5PA 3FP5A 4DBGA 2KN4A 4KV2A 1WH3A 2L00B 1EO6A 4GDLB 2Y5BB 5E6NA 4QXAB 2QEJC 1UZXB 3KQ4A 3DBLI 2W55A 1PGXA 1QC6A 1IGCA 4ACFA 2MA9B 2G9HD 2D9YA 2D9XA 2WXPA 1Z2MA 2DNFA 1WGKA 5CTRC 2RPVA 3C0RB 4ANVA 1FNUA 3VQIA 4EZJA 1WGYA 2PJHA 2KLCA 1FRRA 2LEKA 5GXGB 1LQBA 4LDTD 2DKPA 2DIKA 2LZ6A 2HJ1A 5DCNA 2SEBD 1QQRA 4CYEA 2CU1A 2DHZA 3TBLD 5L83A 2QKMA 3VIAA 4EFOA 1WR1A 2L52A 1WXVA 2QILA 3TSSA 2K22A 3R2TA 1KM7A 2D3AA 2J42A 2QC8A 3Q2AC 2D10A 5C5BB 1JDEA 1SIJA 3APCA 5DPWA 3Q8FA 3CXBB 3NUHB 3E9LA 2AQ1B 4G0NB 1MJDA 4RF0A 3DWGC 3U30A 3DCXA 2KANA
chains in the Genus database with same CATH topology
3PS6A 3V5WA 5DPRA 3N3KB 3L08A 1R4MI 2K8BA 2MDXA 4JKEA 1KOTA 2GBMA 5JHBA 2GMIC 4JK8A 3L17A 1WGDA 1C3TA 2WX1A 3NZUA 1V88A 4KDIC 4NJ7A 1GJZA 5HE1A 2KZRA 4JKDA 2DFKA 1NVLA 4YONA 2ROVA 4CHMA 3H7SA 4BOSC 2V3SA 3KYCD 2FUHB 2OTXA 4DWFA 2E2XA 5JZEB 3QA8A 3SYXA 3M63B 1BTNA 2KANA 2L0TA 3X23A 1AQCA 5FI1A 1NDDA 1P9DU 2K6QA 1XR0B 1H8CA 1WVHA 1WG7A 2FIFA 3KVFB 3OAWA 1E8YA 4HLEA 4JK9A 1XD3B 1RRBA 3OANA 3OLMD 3R3MA 2DN6A 1EF5A 4ICVA 4BBNC 1DDMA 1WXMA 2YRYA 2KNBA 3QWZB 3TW1A 3VTVA 3F0WA 3SO6A 4MM3A 3KH0A 1AWEA 4B95A 3JVZX 1V6EA 3RZWC 1F9JA 1ZGUB 3SV1A 3ML8A 3QARA 1V5UA 2LJ5A 1OGWA 2Q13A 4K2OA 2ASQA 4MSQB 5J3TA 3PPAA 3PTFC 2LYDA 4DHZB 3IFWB 1KJTA 4M0WB 4HAXB 2OQBA 1OQNA 5AZHA 3WAMA 3ZKJC 3MHSD 2VRWB 1XODA 2ZVNA 2LUEA 1BTKA 5C1ZA 3UQBA 2I1KA 2K8HA 3ZDMC 5JH5C 2LRUA 1P0RA 2DZKA 2I5FA 2PE9A 3ZDTA 2CODA 3P7ZA 1I42A 5D3WA 5D27A 4W9JA 2N9XA 3I3TB 1EAZA 2MP2A 5JLJB 2JVCA 4BOZB 1WJ4A 1WE6A 3HM3A 2M0XA 4JKFA 4IM3A 1WX9A 2GBNA 3VUYA 2PEAA 3JYUA 3PEGA 2JXXA 1TGZB 4TKNA 2L05A 3ZNHB 4ILHA 1E8XA 1IRSA 2NMBA 4BKSA 1MIZB 3GYOA 1FXTB 4XX5A 4NAWB 2J59M 4E3CA 2WH5A 2YS1A 2EKEC 4KSLC 2DYBA 1MG8A 5GOWB 2Z0DB 4FA6A 2YT1A 5IAAC 4DK5A 1NBFC 2OOBB 1E7VA 1UNQA 4WWNA 2DAFA 3NSUA 3HQCA 2EJ8A 1XT9B 1GG3A 4WJNA 5KHOA 3PVWA 1QQGA 4GIVA 3VOQA 1X11A 2KOXA 3PRPB 4HK2A 2KFJA 5L81A 4GZUA 2FCQA 4F8CB 3ML4A 4BBNF 1WF9A 1BT0A 3QWMA 4IWQA 1YX6B 3UF8A 3D8FA 3U7DA 3H6NA 1PMSA 2G4SA 2ZCCA 3ENEA 3QAQA 4B6WA 2KX3A 2KCJA 2AL6A 5AEKB 3UIOB 1XQQA 3L13A 3S2AA 1WRDB 5HE2A 3RD2A 4EZLA 3A4RA 1UPRA 4DDGD 3ZUNA 2Z0PA 3GZNI 2DHKA 3DXCA 4MGYE 2V4LA 4JKGA 3CSTA 3H7PB 3A1QA 2NZ8B 1UBIA 2IO0B 1GC6A 2QHOA 5LXIB 3N32A 5JHHA 3T8MA 2L3ZA 3N7CA 2GBKA 2ZJDA 2CS4A 1P1AA 2DX5B 3Q3FA 3V6EB 1IPGA 4JKAA 1WZ3A 2KN5A 4GDKA 3B1LX 4DXAB 4OVVA 3VHTC 1V5TA 1ZM0A 4GOCA 1L2NA 2V76A 2LRWA 1NI2A 4K81A 3TFMA 3ODXA 1NTYA 2MLBA 4MJSB 3AJ4A 1VD2A 3CIKA 4NQLB 2IYDB 2GCJA 4LCDE 4WJQA 2WDTB 2KDEB 1MKEA 1HBKA 1X05A 3IG3A 3X0WA 2YVCA 2BGFA 5GMVA 2C7MB 2KHWB 1WMHA 1UD7A 3DVGY 5TR5A 5C6RA 3EHVA 4HAZB 4HB4B 2NBWB 4MGZE 4II2B 3PLUA 2O2VA 3E9PA 2ZNVC 3KW5B 4C0AA 3NZSA 2JRHA 3HIZA 4P7IA 3L16A 1WFYA 2MBEA 3M1IB 5D3XA 4ZDVA 3QIJA 2DLWA 1Z5SB 3GOEA 1V5OA 3TL5A 3HW2B 2REXA 1HB8A 4FLHA 4B9KA 4WSFA 1DIKA 1HB6A 2CHWA 5DHFB 1U27A 3A9KB 5FI0A 1WY8A 1PLSA 2K2JA 2COPA 2ROZB 4JLCA 1WX8A 3B0AA 2CQUA 2YLMA 2C5LC 3W1SC 2LGDA 4KAXB 2LI5A 1S3SG 4K7SA 4I6NB 1V81A 5LXHA 3EPYA 4JL9A 1U4AA 1WM3A 5JVLA 4L6EA 5E6OA 2UZRA 2M38A 2BKFA 4K7UA 3KZ1A 2R82A 3A33B 1RJ2A 3P6AA 1VBGA 2COAA 1DBHA 4W9HA 3NHEB 3VFKA 4MK0A 5D6JB 1G6JA 3ULBA 4KHBB 2KC1A 1MIXA 2C60A 4W9FA 2GJYA 1BWNA 1Q67A 2KWCA 1D3ZA 1WJNA 1N3HA 1ZSQA 2KD0A 2VKIA 2NCNA 1DROA 1KC7A 2O6VA 1V61A 3ALBA 2W9NA 2ZPNA 3LDZE 2K1FA 2L8JA 2IBIB 5D2MB 1WJ1A 4A20A 3EC8A 3CMMB 4Z2MB 2MX2A 3WALA 4ICUA 3E9OA 4XZ4A 1LW3A 2G45B 2BKRB 3N30A 1DYNA 1Y8RC 3LJ3A 2RQ1A 2B3AA 1YX5B 1WR6E 4ANXA 2K2UA 2JUOA 4DX8A 3WIMA 4GSWA 2COFA 3V60A 2DZJA 2JF5A 4K1RB 1H4RA 1EF1A 3DVNU 4WJPA 2V1YA 1WGGA 1ZW7A 2R2QA 2AEHA 2BWES 4TV3A 1MK9B 4TQ0A 1UH6A 2KJ6A 4FJVB 3K9PB 2WWZA 1ISNA 1WI0A 3SD5A 2BWFA 2UWQA 3H1UA 4LJPB 4RM8A 5AZFA 4F7GA 2JY6A 2ZNVB 2YT0A 4EEWA 4DHJB 3ML9A 1LB1A 2IY1B 1FHOA 1UGMA 4HPLB 4NPNA 4AP4C 3DQVA 1YQBA 4PS7A 5G2NA 1S1QB 2HD5B 3H9DA 1E7UA 2FIDA 3MTNB 2N9EB 3U8ZA 4HCNB 2MQJA 2ZPYA 3F5RA 3SUZA 2RD0A 2D9WA 4EZKA 2IFSA 4GGQA 3RYTA 2UVMA 3UQAA 5HE3A 2KTRA 1GC7A 2JPHA 3HHMA 4AJYB 5JP4A 4WWOA 2KLGA 2LXCA 3FLVA 2L0FA 4A6FB 4G3XB 3QHTA 3ZO5B 3G9WA 2IO1B 3K9OB 2CHXA 4I6PA 5KHQA 2XK5A 3NS8A 1K5DB 4NJ6A 2KUPA 5CHWA 2KMAA 3OJ3A 3V61A 2L7RA 3ZRFA 4GPTB 4I6LB 2N4FA 2YSZA 4PQ0A 3DXDA 3DCGA 2DZIA 5BO4B 4Z2NA 1NU2A 1U5DA 4HDQA 2DZMA 1TXDA 2Z0OA 5JHGA 4G50A 1NTIA 2IZVB 2N1VA 2N23A 4ZRIA 2PE6B 3TJPA 2MWNB 2JRIB 3ZVRA 5C16A 4WQOB 1C1YB 2RR9A 1ZC3B 2BYEA 3PGEA 1LM8B 3PZDA 1X86A 2CY5A 3DDCB 2DYOA 3JSVB 4N9F4 2DENB 3VH4B 4AJWA 1V5MA 4MT7A 3PP2A 3TCAA 1H10A 3A9JA 4KIKA 4ANWA 4WJ7A 2J7QB 2MWSB 1FGYA 2H7EA 1WGQA 1QZEA 2CY4A 2DHIA 1WM2A 3HK0A 3IHPC 3M62B 3BINA 2Z0EB 2ZVOA 2NPTA 2CB8A 3NY5A 1Y5OA 1SHCA 1AARA 3M95A 4PS8A 3KYDD 3RCPA 3WANA 3QCAA 3RZFA 3P2BA 2G4DB 2MFQA 2KJRA 4PYZA 2RNRB 4IOYX 2NS5A 2R2OA 2Y7BA 1V2YA 1U29A 2FNJB 2WYQA 2FCSA 3PV1A 4TUUA 1U5FA 4F7ZA 1RLFA 3RULA 2KDBA 1UNPA 4F7HA 5DPTA 2GBJA 3BJIA 1UEFA 1X1MA 4ASWC 1X1GA 2KFKB 4HWIB 4W9GA 3VH3B 4EMOA 3ULCA 3RT3B 1KZGA 4RM9A 5C79A 3PVUA 3PSCA 2FCMA 1ZC4B 2DYMA 3DBRI 2LWPA 2YF0A 4K7WA 5KQ1A 3VUWA 1VCBA 3TO1A 1J0WA 2P0HA 2W2WA 4W9EA 2ABDA 5LOPB 3RCZA 1LXDA 2N0YA 4BKSD 3PHWB 2RSUA 5J17A 2N1WA 3A4SC 1GUAB 4AUQC 2RGNB 1VBHA 2C7NB 1RAXA 4HAUB 3GYPA 2DHJA 2HTHB 1OMWA 4XWXA 4PNKA 4K17A 1NTVA 2ZEQA 4BFRA 2KK8A 3ZLZA 2A4ZA 4A6HA 2P8VA 3EFUA 1WYWB 1K5GB 2N7EA 4GU2A 4KSKC 4IM0A 2YS5A 1RFAA 5LONB 2J0JA 3MDBC 4GMVA 1WE7A 3DOWA 1WJMA 3AULA 4JGHB 1OY2A 2DYNA 3UGBB 3PT2B 4HAVB 1FOEA 3SNHA 2XBBC 5HE0A 4MELA 2FCNA 2KVRA 1FHXA 2FDQA 4GDLA 1UBQA 2ZZPB 1TZ1A 3QQ8B 4Y94A 1Q5WB 4YL8A 1Z87A 2KDFB 3HM6X 3R66C 3UINB 1W1GA 5CLLB 3FEHA 2EMSA 3AU5A 3VDZA 2MBOA 4W9KA 5CHVC 1K8RB 1Q1OA 2LBBA 1J8CA 4KZ0A 5C5BA 3ZW3A 1R4NI 5IJMA 2RVBB 2G3QB 2N9PC 4JKGB 4FHKA 3A1QB 1OTRB 4DX90 3T06A 2A5UA 4BVUC 2NR2A 3JW0X 5C23A 1A5RA 3W1YA 4M8NA 2KQSA 3ZTDA 4A3OA 1YIWA 1ZKHA 4KHAA 1HE8A 3V6CB 2NVUI 3L54A 1KI1B 3Q3JA 4GDKB 1U2BA 1FB8A 1TBEA 4PYUA 2OJRA 2Z0QA 4WJOA 2BYVE 2JZZA 2MBBB 3A98B 1EUVB 4HAYB 4B6HA 4ANUA 1WZ0A 3O65B 2IY0B 3V62A 4W9IA 1J19A 4GMXB 1W1DA 3EECA 5G55A 3KSYA 3DBSA 2AL3A 4FADA 2ELBA 2LXAA 1OEYA 4BBKA 3VAWA 1P3RA 4A6FA 4HVBA 1JRUA 2K8CA 4A5KA 4M8MA 3ZRCA 3R7QA 2IO2B 1TQZA 2XEWA 2JP2A 2LD9A 1UELA 2Z59B 4DHJD 3VVWB 5E6PA 1DDVA 1DDWA 3CF6E 2UZSA 5DH9B 5J18A 4TYZA 4MH0E 3ENBA 4A6KA 4MY6A 3TMPB 2AYOB 1EVHA 2XQNM 3PG7A 3AU4A 1P6SA 4MGKE 4BKTA 2LVPA 4KDLB 2EMTA 5HKHA 3PRMB 2K25A 1GGOA 3QBVB 1MK7B 3UIPB 3O96A 4D0NB 2I1JA 2WX0A 1V80A 3QJZA 2D2QA 2BPSA 1X1FA 1WGRA 2KC2A 4LJOB 1XCGA 1MPHA 4LDTB 1BAKA 2LVOA 2O6VD 2VSZA 3MJWA 5D7GA 4AWJA 2K00A 2GBRA 2N7DA 3JSVA 4ZRKA 4IC7B 4K2PA 2H7DA 4NQKE 4NAWA 1WXSA 2LVQA 2IO3B 2CAYA 2NBVB 3KUZA 4JK7A 4EKUA 5L95C 4NY0A 1U5EA 2ELAA 1TJ6A 1FAOA 4FJZA 4TQ1A 2GOWA 4F7UP 2M14A 1I35A 3A8QA 1V89A 2LGXA 2O6VB 3WA0A 4IAPA 4EOYA 3D8EA 3PSEB 3KUCB 3IVFA 2J0MA 4HDOA 1WIAA 4X57B 1W1HA 1V5PA 4E74A 4HPMB 2LULA 2KFKA 3APFA 1YD8U 3ODWA 1FGZA 3ZNZB 2J0KA 1SGHA 3ZNID 2MKRA 5LLIA 2LASA 1Q0WB 4HATB 2LOZA 4FJYA 1UNRA 4IFSA 2MCNB 1B55A 1ZVRA 4EJNA 1Y19B 1E5WA 2M8SA 3H7PA 2D9VA 4MEMA 2RPQA 2COCA 4DHZE 3AXCA 2JT4B 3T9LA 4ZYNA 2DA0A 2LKOA 1V9JA 2DX5A 2KWVB 2HTHA 1M7RA 4GB9A 3AI5A 4EUTA 2KX0A 1ST7A 4JQWC 4WVFB 3TIXA 1RRPB 3MPXA 3SU8X 3DVNV 4MJSA 4IWOA 2DTCA 1E8ZA 1FHWA 5D3YA 2KXJA 4XC2A 2BCJA 2MRPA 1P3QU 4MDKE 3ZNGC 2M4NA 2R0DA 5KCVA 2KJHB 3SBTA 1MAIA 2JWZA 4HAWB 1V86A 2UYZB 5AZGA 2KTRB 4W9CA 4URKA 2PZ1A 2EC1A 4FULA 3ODOA 3E66A 3VXWA 3SDLC 4W9DA 3OJ4B 2X0SA 2W2XC 4J6IA 3ZIMA 4CHKA 1XD4A 2GS0A 4GXBA 2L76A 2XK5B 2L2IA 2D07B 2KKCA 1SIFA 4DBBA 3WYFB 3PHXB 1WGHA 2Y8GA 5CLQB 1ACAA 1PQSA 4FHJA 1KZ7A 4RMAA 4HB2B 3ZVVA 4WAAA 4W9LA 3WAPA 2DYQA 3D8DA 5EDSA 1KLVA 3A9KA 4FBJB 3TVVA 2KMCA 3M3JA 4IM2A 3KUDB 5DIFB 3KY9A 5D94A 3PRZA 4E71A 4AOFA 3DXEA 4G11A 2I5CA 1T0YA 3VTWA 1XX0A 2K39A 5J2RA 4JKCA 5CX3A 4GN1A 5DI9B 2MP2B 3B08A 3D32A 3NOBA 3QK0A 5EFXA 4ILGB 4H8SA 1P5TA 2DKQA 4IG7B 3FM8C 3RUIB 4JKHA 1IP9A 2G35A 2KQ7A 2DX1A 1EGXA 4CHJA 2CKHB 1WX7A 4HXDA 5J3YA 2D4QA 1GNUA 4IW0A 4KIKB 2CRFA 3A9JB 2PPHA 2RSGA 3VTUA 2KO3A 3KRWA 4II3B 1WJUA 3KRXA 2L1CA 1I2HA 2NPTB 1UPQA 2D3GA 4MSMB 2R09A 3DPDA 4KZCA 1P98A 2BF8B 1CMXB 4JIOU 2MBQA 4CO7A 4A3PA 4KVGB 2M17A 4HB0B 1E8WA 2CHZA 4HHVA 2FAZA 2IYBA 3PVLA 2VRRB 2LG1A 2RUKB 2M1MA 3ZTCA 2P0DA 2LOXA 2RGFA 3R7RA 2C7HA 2K6DB 2NBUA 1M94A 4MGIE 2GCLA 2RLOA 1LFDA 5KQ4A 4OVUA 3SBGA 5D3VA 3PLVA 1SE9A 1TTNA 2W2XD 2KTFA 2LGYA 2JZ3B 4HJKA 4IWPA 3QX1A 1XKEA 5FR6A 2KDIA 4ILJA 3PREA 1U5GA 1WJ6A 4DDID 2QKLA 3ECIA 3L10B 4JKBA 2MSED 1OQYA 2BYFA 2X18A 2ZCBA 1IYFA 2FJLA 1OEYJ 2HJ8A 5IA7A 3IBEA 3VUXA 2P0FA 1YJ1A 1WXAA 5J3QA 4IUMB 1PFJA 2D11A 2ADZA 4F1SA 3WAOA 2DAJA 3L0WB 1WI1A 1M7EA 4BKGA 2HRJA 3BY4B 4KHOA 5DHAB 1WGUA 1V49A 2MW5A 1KBLA 2D9ZA 3DBHI 3CSFA 1I7AA 3DVGX 4NNJB 3ONSA 2KWUB 2YS3A 1E90A 3SHQA 2AWTA 3UZTA 2FJ9A 3APDA 3FSSA 1J0GA 2Y8FA 2MBHA 1WMHB 4NSWA 3W1SA 3QC8B 4FN2A 1L7YA 3LJUX 4HB3B 5CHFA 2O2VB 2CR5A 3A8PA 2C9WB 4PS3A 5DPSA 2HE7A 4ZRJA 5JHAA 4HCPB 2KGXB 3FP5A 4DBGA 4KV2A 1WH3A 2L00B 1EO6A 4GDLB 2Y5BB 5E6NA 1UZXB 3DBLI 1QC6A 2MA9B 2D9YA 2D9XA 1Z2MA 5CTRC 3C0RB 4ANVA 3VQIA 4EZJA 1WGYA 2PJHA 2KLCA 1LQBA 4LDTD 2DKPA 2DIKA 2LZ6A 5DCNA 4CYEA 2CU1A 2DHZA 3TBLD 5L83A 2QKMA 3VIAA 4EFOA 1WR1A 1WXVA 1KM7A 2D10A 5C5BB 1JDEA 3APCA 5DPWA 3CXBB 3E9LA 4G0NB 3U30A 4WWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS6 A;  3V5W A;  5DPR A;  3N3K B;  3L08 A;  1R4M I;  2K8B A;  2MDX A;  1KOT A;  2GBM A;  5JHB A;  2GMI C;  3L17 A;  1WGD A;  1C3T A;  2WX1 A;  3NZU A;  1V88 A;  4KDI C;  4NJ7 A;  1GJZ A;  5HE1 A;  2KZR A;  2DFK A;  1NVL A;  4YON A;  2ROV A;  4CHM A;  3H7S A;  4BOS C;  2V3S A;  3KYC D;  2FUH B;  2OTX A;  4DWF A;  2E2X A;  5JZE B;  3QA8 A;  3SYX A;  3M63 B;  1BTN A;  2KAN A;  2L0T A;  3X23 A;  1AQC A;  5FI1 A;  1NDD A;  1P9D U;  2K6Q A;  1XR0 B;  1H8C A;  1WVH A;  1WG7 A;  2FIF A;  3KVF B;  3OAW A;  1E8Y A;  4HLE A;  1XD3 B;  1RRB A;  3OAN A;  3OLM D;  3R3M A;  2DN6 A;  1EF5 A;  4ICV A;  4BBN C;  1DDM A;  1WXM A;  2YRY A;  2KNB A;  3QWZ B;  3TW1 A;  3VTV A;  3F0W A;  3SO6 A;  4MM3 A;  3KH0 A;  1AWE A;  4B95 A;  3JVZ X;  1V6E A;  3RZW C;  1F9J A;  1ZGU B;  3SV1 A;  3ML8 A;  3QAR A;  1V5U A;  2LJ5 A;  1OGW A;  2Q13 A;  4K2O A;  2ASQ A;  4MSQ B;  5J3T A;  3PPA A;  3PTF C;  2LYD A;  4DHZ B;  3IFW B;  1KJT A;  4M0W B;  4HAX B;  2OQB A;  1OQN A;  3ZKJ C;  3WAM A;  5AZH A;  3MHS D;  2VRW B;  1XOD A;  2ZVN A;  2LUE A;  1BTK A;  5C1Z A;  3UQB A;  2I1K A;  2K8H A;  3ZDM C;  5JH5 C;  2LRU A;  1P0R A;  2DZK A;  2I5F A;  2PE9 A;  3ZDT A;  2COD A;  3P7Z A;  1I42 A;  5D3W A;  5D27 A;  4W9J A;  2N9X A;  3I3T B;  1EAZ A;  2MP2 A;  5JLJ B;  2JVC A;  4BOZ B;  1WJ4 A;  1WE6 A;  3HM3 A;  2M0X A;  4IM3 A;  1WX9 A;  2GBN A;  3VUY A;  2PEA A;  3JYU A;  3PEG A;  2JXX A;  1TGZ B;  4TKN A;  2L05 A;  3ZNH B;  1E8X A;  1IRS A;  2NMB A;  4BKS A;  1MIZ B;  3GYO A;  1FXT B;  4XX5 A;  4NAW B;  2J59 M;  4E3C A;  2WH5 A;  2YS1 A;  2EKE C;  4KSL C;  2DYB A;  1MG8 A;  5GOW B;  2Z0D B;  4FA6 A;  2YT1 A;  5IAA C;  4DK5 A;  1NBF C;  2OOB B;  1E7V A;  1UNQ A;  4WWN A;  2DAF A;  3NSU A;  3HQC A;  2EJ8 A;  1XT9 B;  1GG3 A;  4WJN A;  5KHO A;  3PVW A;  1QQG A;  4GIV A;  3VOQ A;  1X11 A;  2KOX A;  3PRP B;  4HK2 A;  2KFJ A;  5L81 A;  4GZU A;  2FCQ A;  4F8C B;  3ML4 A;  4BBN F;  1WF9 A;  1BT0 A;  3QWM A;  4IWQ A;  1YX6 B;  3UF8 A;  3D8F A;  3U7D A;  3H6N A;  1PMS A;  2G4S A;  2ZCC A;  3ENE A;  3QAQ A;  4B6W A;  2KX3 A;  2KCJ A;  2AL6 A;  5AEK B;  3UIO B;  1XQQ A;  3L13 A;  3S2A A;  1WRD B;  5HE2 A;  3RD2 A;  4EZL A;  3A4R A;  1UPR A;  4DDG D;  3ZUN A;  2Z0P A;  3GZN I;  2DHK A;  3DXC A;  4MGY E;  2V4L A;  3CST A;  3H7P B;  3A1Q A;  2NZ8 B;  1UBI A;  2IO0 B;  1GC6 A;  2QHO A;  5LXI B;  3N32 A;  5JHH A;  3T8M A;  2L3Z A;  3N7C A;  2GBK A;  2ZJD A;  2CS4 A;  1P1A A;  2DX5 B;  3Q3F A;  3V6E B;  1IPG A;  1WZ3 A;  2KN5 A;  4GDK A;  3B1L X;  4DXA B;  4OVV A;  3VHT C;  1V5T A;  1ZM0 A;  4GOC A;  1L2N A;  2V76 A;  2LRW A;  1NI2 A;  4K81 A;  3TFM A;  3ODX A;  1NTY A;  2MLB A;  4MJS B;  3AJ4 A;  1VD2 A;  3CIK A;  4NQL B;  2IYD B;  2GCJ A;  4LCD E;  4WJQ A;  2WDT B;  2KDE B;  1MKE A;  1HBK A;  1X05 A;  3IG3 A;  3X0W A;  2YVC A;  2BGF A;  5GMV A;  2C7M B;  2KHW B;  1WMH A;  1UD7 A;  3DVG Y;  5TR5 A;  5C6R A;  3EHV A;  4HAZ B;  4HB4 B;  2NBW B;  4MGZ E;  4II2 B;  3PLU A;  2O2V A;  2ZNV C;  3KW5 B;  4C0A A;  3NZS A;  2JRH A;  3HIZ A;  4P7I A;  3L16 A;  1WFY A;  2MBE A;  3M1I B;  5D3X A;  4ZDV A;  3QIJ A;  2DLW A;  1Z5S B;  3GOE A;  1V5O A;  3TL5 A;  3HW2 B;  2REX A;  1HB8 A;  4FLH A;  4B9K A;  4WSF A;  1HB6 A;  2CHW A;  5DHF B;  1U27 A;  3A9K B;  5FI0 A;  1WY8 A;  1PLS A;  2K2J A;  2COP A;  2ROZ B;  4JLC A;  1WX8 A;  3B0A A;  2CQU A;  2YLM A;  2C5L C;  3W1S C;  2LGD A;  4KAX B;  2LI5 A;  1S3S G;  4K7S A;  4I6N B;  1V81 A;  5LXH A;  3EPY A;  4JL9 A;  1U4A A;  1WM3 A;  4L6E A;  5E6O A;  2UZR A;  2M38 A;  2BKF A;  4K7U A;  3KZ1 A;  3A33 B;  1RJ2 A;  3P6A A;  2COA A;  1DBH A;  4W9H A;  3NHE B;  3VFK A;  4MK0 A;  5D6J B;  1G6J A;  3ULB A;  4KHB B;  2KC1 A;  1MIX A;  2C60 A;  4W9F A;  2GJY A;  1BWN A;  1Q67 A;  2KWC A;  1D3Z A;  1WJN A;  1N3H A;  1ZSQ A;  2KD0 A;  2VKI A;  2NCN A;  1DRO A;  2O6V A;  1V61 A;  3ALB A;  2W9N A;  2ZPN A;  3LDZ E;  2K1F A;  2L8J A;  2IBI B;  5D2M B;  1WJ1 A;  4A20 A;  3EC8 A;  3CMM B;  4Z2M B;  2MX2 A;  3WAL A;  4ICU A;  4XZ4 A;  1LW3 A;  2G45 B;  2BKR B;  3N30 A;  1DYN A;  1Y8R C;  3LJ3 A;  2RQ1 A;  2B3A A;  1YX5 B;  1WR6 E;  4ANX A;  2K2U A;  2JUO A;  4DX8 A;  3WIM A;  4GSW A;  2COF A;  3V60 A;  2DZJ A;  2JF5 A;  4K1R B;  1H4R A;  1EF1 A;  3DVN U;  4WJP A;  2V1Y A;  1WGG A;  1ZW7 A;  2R2Q A;  2AEH A;  2BWE S;  4TV3 A;  1MK9 B;  4TQ0 A;  1UH6 A;  2KJ6 A;  4FJV B;  3K9P B;  2WWZ A;  1ISN A;  1WI0 A;  3SD5 A;  2BWF A;  2UWQ A;  3H1U A;  4LJP B;  4RM8 A;  5AZF A;  4F7G A;  2JY6 A;  2ZNV B;  2YT0 A;  4EEW A;  4DHJ B;  3ML9 A;  1LB1 A;  2IY1 B;  1FHO A;  1UGM A;  4HPL B;  4NPN A;  4AP4 C;  3DQV A;  1YQB A;  4PS7 A;  5G2N A;  1S1Q B;  2HD5 B;  3H9D A;  1E7U A;  2FID A;  3MTN B;  2N9E B;  3U8Z A;  4HCN B;  2MQJ A;  2ZPY A;  3F5R A;  3SUZ A;  2RD0 A;  2D9W A;  4EZK A;  2IFS A;  4GGQ A;  3RYT A;  2UVM A;  3UQA A;  5HE3 A;  2KTR A;  1GC7 A;  2JPH A;  3HHM A;  4AJY B;  5JP4 A;  4WWO A;  2KLG A;  2LXC A;  3FLV A;  2L0F A;  4A6F B;  4G3X B;  3QHT A;  3ZO5 B;  3G9W A;  2IO1 B;  3K9O B;  2CHX A;  4I6P A;  5KHQ A;  2XK5 A;  3NS8 A;  1K5D B;  4NJ6 A;  2KUP A;  5CHW A;  2KMA A;  3OJ3 A;  3V61 A;  2L7R A;  3ZRF A;  4GPT B;  4I6L B;  2N4F A;  2YSZ A;  4PQ0 A;  3DXD A;  3DCG A;  2DZI A;  5BO4 B;  4Z2N A;  1NU2 A;  1U5D A;  4HDQ A;  2DZM A;  1TXD A;  2Z0O A;  5JHG A;  4G50 A;  1NTI A;  2IZV B;  2N1V A;  2N23 A;  4ZRI A;  2PE6 B;  3TJP A;  2MWN B;  2JRI B;  3ZVR A;  5C16 A;  4WQO B;  1C1Y B;  2RR9 A;  1ZC3 B;  2BYE A;  3PGE A;  1LM8 B;  3PZD A;  1X86 A;  2CY5 A;  3DDC B;  2DYO A;  3JSV B;  4N9F 4;  2DEN B;  3VH4 B;  4AJW A;  1V5M A;  4MT7 A;  3PP2 A;  3TCA A;  1H10 A;  3A9J A;  4KIK A;  4ANW A;  4WJ7 A;  2J7Q B;  2MWS B;  1FGY A;  2H7E A;  1WGQ A;  1QZE A;  2CY4 A;  2DHI A;  1WM2 A;  3HK0 A;  3IHP C;  3M62 B;  3BIN A;  2Z0E B;  2ZVO A;  2NPT A;  2CB8 A;  3NY5 A;  1Y5O A;  1SHC A;  1AAR A;  3M95 A;  4PS8 A;  3KYD D;  3RCP A;  3WAN A;  3QCA A;  3RZF A;  3P2B A;  2G4D B;  2MFQ A;  2KJR A;  4PYZ A;  2RNR B;  4IOY X;  2NS5 A;  2R2O A;  2Y7B A;  1V2Y A;  1U29 A;  2FNJ B;  2WYQ A;  2FCS A;  3PV1 A;  4TUU A;  1U5F A;  4F7Z A;  1RLF A;  3RUL A;  2KDB A;  1UNP A;  4F7H A;  5DPT A;  2GBJ A;  3BJI A;  1UEF A;  1X1M A;  4ASW C;  1X1G A;  2KFK B;  4HWI B;  4W9G A;  3VH3 B;  4EMO A;  3ULC A;  3RT3 B;  1KZG A;  4RM9 A;  5C79 A;  3PVU A;  3PSC A;  2FCM A;  1ZC4 B;  2DYM A;  3DBR I;  2LWP A;  2YF0 A;  4K7W A;  5KQ1 A;  3VUW A;  1VCB A;  3TO1 A;  1J0W A;  2P0H A;  2W2W A;  4W9E A;  2ABD A;  5LOP B;  3RCZ A;  1LXD A;  2N0Y A;  4BKS D;  3PHW B;  2RSU A;  5J17 A;  2N1W A;  3A4S C;  1GUA B;  4AUQ C;  2RGN B;  2C7N B;  1RAX A;  4HAU B;  3GYP A;  2DHJ A;  2HTH B;  1OMW A;  4XWX A;  4PNK A;  4K17 A;  1NTV A;  2ZEQ A;  4BFR A;  2KK8 A;  3ZLZ A;  2A4Z A;  4A6H A;  2P8V A;  3EFU A;  1WYW B;  1K5G B;  2N7E A;  4GU2 A;  4KSK C;  4IM0 A;  2YS5 A;  1RFA A;  5LON B;  2J0J A;  3MDB C;  4GMV A;  1WE7 A;  3DOW A;  1WJM A;  3AUL A;  4JGH B;  1OY2 A;  2DYN A;  3UGB B;  3PT2 B;  4HAV B;  1FOE A;  3SNH A;  2XBB C;  5HE0 A;  4MEL A;  2FCN A;  2KVR A;  1FHX A;  2FDQ A;  4GDL A;  1UBQ A;  2ZZP B;  1TZ1 A;  3QQ8 B;  4Y94 A;  1Q5W B;  4YL8 A;  1Z87 A;  2KDF B;  3HM6 X;  3R66 C;  3UIN B;  1W1G A;  5CLL B;  3FEH A;  2EMS A;  3AU5 A;  3VDZ A;  2MBO A;  4W9K A;  5CHV C;  1K8R B;  1Q1O A;  2LBB A;  1J8C A;  4KZ0 A;  5C5B A;  3ZW3 A;  1R4N I;  5IJM A;  2RVB B;  2G3Q B;  2N9P C;  4FHK A;  3A1Q B;  1OTR B;  4DX9 0;  3T06 A;  2A5U A;  4BVU C;  2NR2 A;  3JW0 X;  5C23 A;  1A5R A;  3W1Y A;  4M8N A;  2KQS A;  3ZTD A;  4A3O A;  1YIW A;  1ZKH A;  4KHA A;  1HE8 A;  3V6C B;  2NVU I;  3L54 A;  1KI1 B;  3Q3J A;  4GDK B;  1U2B A;  1FB8 A;  1TBE A;  4PYU A;  2OJR A;  2Z0Q A;  4WJO A;  2BYV E;  2JZZ A;  2MBB B;  3A98 B;  1EUV B;  4HAY B;  4B6H A;  4ANU A;  1WZ0 A;  3O65 B;  2IY0 B;  3V62 A;  4W9I A;  1J19 A;  4GMX B;  1W1D A;  3EEC A;  5G55 A;  3KSY A;  3DBS A;  2AL3 A;  4FAD A;  2ELB A;  2LXA A;  1OEY A;  4BBK A;  3VAW A;  1P3R A;  4A6F A;  4HVB A;  1JRU A;  2K8C A;  4A5K A;  4M8M A;  3ZRC A;  3R7Q A;  2IO2 B;  1TQZ A;  2XEW A;  2JP2 A;  2LD9 A;  1UEL A;  2Z59 B;  4DHJ D;  3VVW B;  5E6P A;  1DDV A;  1DDW A;  3CF6 E;  2UZS A;  5DH9 B;  5J18 A;  4TYZ A;  4MH0 E;  4A6K A;  4MY6 A;  3TMP B;  2AYO B;  1EVH A;  2XQN M;  3PG7 A;  3AU4 A;  1P6S A;  4MGK E;  4BKT A;  2LVP A;  4KDL B;  2EMT A;  5HKH A;  3PRM B;  2K25 A;  3QBV B;  1MK7 B;  3UIP B;  3O96 A;  4D0N B;  2I1J A;  2WX0 A;  1V80 A;  3QJZ A;  2D2Q A;  2BPS A;  1X1F A;  1WGR A;  2KC2 A;  4LJO B;  1XCG A;  1MPH A;  4LDT B;  1BAK A;  2LVO A;  2O6V D;  2VSZ A;  3MJW A;  5D7G A;  4AWJ A;  2K00 A;  2GBR A;  2N7D A;  3JSV A;  4ZRK A;  4IC7 B;  4K2P A;  2H7D A;  4NQK E;  4NAW A;  1WXS A;  2LVQ A;  2IO3 B;  2CAY A;  2NBV B;  3KUZ A;  4EKU A;  5L95 C;  4NY0 A;  1U5E A;  2ELA A;  1TJ6 A;  1FAO A;  4FJZ A;  4TQ1 A;  2GOW A;  4F7U P;  2M14 A;  1I35 A;  3A8Q A;  1V89 A;  2LGX A;  2O6V B;  3WA0 A;  4IAP A;  4EOY A;  3D8E A;  3PSE B;  3KUC B;  3IVF A;  2J0M A;  4HDO A;  1WIA A;  4X57 B;  1W1H A;  1V5P A;  4E74 A;  4HPM B;  2LUL A;  2KFK A;  3APF A;  1YD8 U;  3ODW A;  1FGZ A;  3ZNZ B;  2J0K A;  1SGH A;  3ZNI D;  2MKR A;  5LLI A;  2LAS A;  1Q0W B;  4HAT B;  2LOZ A;  4FJY A;  1UNR A;  4IFS A;  2MCN B;  1B55 A;  1ZVR A;  4EJN A;  1Y19 B;  1E5W A;  2M8S A;  3H7P A;  2D9V A;  4MEM A;  2RPQ A;  2COC A;  4DHZ E;  3AXC A;  2JT4 B;  3T9L A;  4ZYN A;  2DA0 A;  2LKO A;  1V9J A;  2DX5 A;  2KWV B;  2HTH A;  1M7R A;  4GB9 A;  3AI5 A;  4EUT A;  2KX0 A;  1ST7 A;  4JQW C;  4WVF B;  3TIX A;  1RRP B;  3MPX A;  3SU8 X;  3DVN V;  4MJS A;  4IWO A;  2DTC A;  1E8Z A;  1FHW A;  5D3Y A;  2KXJ A;  4XC2 A;  2BCJ A;  2MRP A;  1P3Q U;  4MDK E;  3ZNG C;  2M4N A;  2R0D A;  5KCV A;  2KJH B;  1MAI A;  2JWZ A;  4HAW B;  1V86 A;  2UYZ B;  5AZG A;  2KTR B;  4W9C A;  4URK A;  2PZ1 A;  2EC1 A;  4FUL A;  3ODO A;  3VXW A;  3SDL C;  4W9D A;  3OJ4 B;  2W2X C;  4J6I A;  3ZIM A;  4CHK A;  1XD4 A;  2GS0 A;  4GXB A;  2L76 A;  2XK5 B;  2L2I A;  2D07 B;  2KKC A;  1SIF A;  4DBB A;  3WYF B;  3PHX B;  1WGH A;  2Y8G A;  5CLQ B;  1ACA A;  1PQS A;  4FHJ A;  1KZ7 A;  4RMA A;  4HB2 B;  3ZVV A;  4WAA A;  4W9L A;  3WAP A;  2DYQ A;  3D8D A;  5EDS A;  1KLV A;  3A9K A;  4FBJ B;  3TVV A;  2KMC A;  3M3J A;  4IM2 A;  3KUD B;  5DIF B;  3KY9 A;  5D94 A;  3PRZ A;  4E71 A;  4AOF A;  3DXE A;  4G11 A;  2I5C A;  1T0Y A;  3VTW A;  1XX0 A;  2K39 A;  5J2R A;  5CX3 A;  4GN1 A;  5DI9 B;  2MP2 B;  3B08 A;  3D32 A;  3NOB A;  3QK0 A;  5EFX A;  4H8S A;  1P5T A;  2DKQ A;  4IG7 B;  3FM8 C;  3RUI B;  1IP9 A;  2G35 A;  2KQ7 A;  2DX1 A;  1EGX A;  4CHJ A;  2CKH B;  1WX7 A;  4HXD A;  5J3Y A;  2D4Q A;  1GNU A;  4IW0 A;  4KIK B;  2CRF A;  3A9J B;  2PPH A;  2RSG A;  3VTU A;  2KO3 A;  3KRW A;  4II3 B;  1WJU A;  3KRX A;  2L1C A;  1I2H A;  2NPT B;  1UPQ A;  2D3G A;  4MSM B;  2R09 A;  3DPD A;  4KZC A;  1P98 A;  2BF8 B;  1CMX B;  4JIO U;  2MBQ A;  4CO7 A;  4A3P A;  4KVG B;  2M17 A;  4HB0 B;  1E8W A;  2CHZ A;  4HHV A;  2FAZ A;  2IYB A;  3PVL A;  2VRR B;  2LG1 A;  2RUK B;  2M1M A;  3ZTC A;  2P0D A;  2LOX A;  2RGF A;  3R7R A;  2C7H A;  2K6D B;  2NBU A;  1M94 A;  4MGI E;  2GCL A;  2RLO A;  1LFD A;  5KQ4 A;  4OVU A;  5D3V A;  3PLV A;  1SE9 A;  1TTN A;  2W2X D;  2KTF A;  2LGY A;  2JZ3 B;  4HJK A;  4IWP A;  3QX1 A;  1XKE A;  5FR6 A;  2KDI A;  3PRE A;  1U5G A;  1WJ6 A;  4DDI D;  2QKL A;  3ECI A;  3L10 B;  2MSE D;  1OQY A;  2BYF A;  2X18 A;  2ZCB A;  1IYF A;  2FJL A;  1OEY J;  2HJ8 A;  5IA7 A;  3IBE A;  3VUX A;  2P0F A;  1YJ1 A;  1WXA A;  5J3Q A;  4IUM B;  1PFJ A;  2D11 A;  2ADZ A;  4F1S A;  3WAO A;  2DAJ A;  3L0W B;  1WI1 A;  1M7E A;  4BKG A;  2HRJ A;  3BY4 B;  4KHO A;  5DHA B;  1WGU A;  1V49 A;  2MW5 A;  2D9Z A;  3DBH I;  3CSF A;  1I7A A;  3DVG X;  4NNJ B;  3ONS A;  2KWU B;  2YS3 A;  1E90 A;  3SHQ A;  2AWT A;  3UZT A;  2FJ9 A;  3APD A;  3FSS A;  1J0G A;  2Y8F A;  2MBH A;  1WMH B;  4NSW A;  3W1S A;  3QC8 B;  4FN2 A;  1L7Y A;  3LJU X;  4HB3 B;  5CHF A;  2O2V B;  2CR5 A;  3A8P A;  2C9W B;  4PS3 A;  5DPS A;  2HE7 A;  4ZRJ A;  5JHA A;  4HCP B;  2KGX B;  3FP5 A;  4DBG A;  4KV2 A;  1WH3 A;  2L00 B;  1EO6 A;  4GDL B;  2Y5B B;  5E6N A;  1UZX B;  3DBL I;  1QC6 A;  2MA9 B;  2D9Y A;  2D9X A;  1Z2M A;  5CTR C;  3C0R B;  4ANV A;  3VQI A;  4EZJ A;  1WGY A;  2PJH A;  2KLC A;  1LQB A;  4LDT D;  2DKP A;  2LZ6 A;  5DCN A;  4CYE A;  2CU1 A;  2DHZ A;  3TBL D;  5L83 A;  2QKM A;  3VIA A;  4EFO A;  1WR1 A;  1WXV A;  1KM7 A;  2D10 A;  5C5B B;  3APC A;  5DPW A;  3CXB B;  4G0N B;  3U30 A;  4WWP A; 
#chains in the Genus database with same CATH topology
 3PS6 A;  3V5W A;  5DPR A;  3N3K B;  3L08 A;  4ITK A;  1R4M I;  2K8B A;  3AE9 B;  1NYR A;  2MDX A;  5FKA C;  2JWU A;  4JKE A;  1KOT A;  2GBM A;  2JQR B;  4YSX B;  5JHB A;  2WXO A;  2GMI C;  4JK8 A;  1XLQ A;  3L17 A;  1WGD A;  2LGS A;  3URY A;  3HVZ A;  1C3T A;  2WX1 A;  3NZU A;  1V88 A;  2GRI A;  4YTN B;  2W54 A;  1ET9 A;  4KDI C;  4NJ7 A;  1GJZ A;  5HE1 A;  2KZR A;  4JKD A;  2DFK A;  1NVL A;  4YON A;  2ROV A;  4BAX A;  4CHM A;  3H7S A;  4BOS C;  2V3S A;  1VR9 A;  4A6Q A;  4OHJ A;  2VH1 A;  3U7Z A;  3KYC D;  2V3N A;  3IAM 1;  2FUH B;  2OTX A;  4DWF A;  2E2X A;  5JZE B;  3QA8 A;  1YJJ A;  3AM9 A;  3SYX A;  3M63 B;  1BTN A;  2WU5 B;  2L0T A;  3X23 A;  1YJI A;  1AQC A;  3AMZ A;  1N6Z A;  5FI1 A;  1NDD A;  1P9D U;  1FXI A;  1TIF A;  2M56 B;  2K6Q A;  1XR0 B;  3N1X C;  1H8C A;  2X8X X;  1WVH A;  1WG7 A;  2FIF A;  4ZRP A;  1YQ3 B;  3KVF B;  3OAW A;  1E8Y A;  3RNF C;  4HLE A;  4JK9 A;  1XD3 B;  1RRB A;  1TT5 B;  1L6V A;  3OAN A;  1XLO A;  3OLM D;  3R3M A;  2DN6 A;  1EF5 A;  4ICV A;  4BBN C;  1DDM A;  1WXM A;  2YRY A;  4IOI E;  2GB1 A;  2KNB A;  3QWZ B;  5C3J B;  1JAL A;  3TW1 A;  3VTV A;  3F0W A;  1D4B A;  3SO6 A;  2BB6 A;  1E0Z A;  4MM3 A;  5M4Y B;  1OQQ A;  3TEX A;  1A70 A;  4XDC A;  3KH0 A;  2AQ2 B;  2LFI A;  1AWE A;  4B95 A;  3JVZ X;  1SE3 A;  1V6E A;  3RZW C;  1F9J A;  1ZGU B;  2WLB A;  3SV1 A;  3Q14 C;  2CJN A;  4C7Y A;  3ML8 A;  3QAR A;  1V5U A;  4YWG G;  2LJ5 A;  2KWD A;  1OGW A;  2Q13 A;  4K2O A;  2ASQ A;  4MSQ B;  3NWA A;  4AQ7 A;  5J3T A;  1AWD A;  3PPA A;  3PTF C;  2BYT A;  2RMM A;  3NWF A;  3FVC A;  2LYD A;  4DHZ B;  3IFW B;  1KJT A;  4JPS A;  4M0W B;  4HAX B;  2OQB A;  1OQN A;  5AZH A;  3WAM A;  3ZKJ C;  3MHS D;  2VRW B;  1IBX B;  1XOD A;  2ZVN A;  2LUE A;  1BTK A;  1CZP A;  5C1Z A;  4HRO A;  4ZOH C;  3UQB A;  4REZ A;  2I1K A;  1JWS D;  2K8H A;  3ZDM C;  5JH5 C;  1V1P A;  2LRU A;  1P0R A;  4KGS A;  2DZK A;  2I5F A;  1C4A A;  2PE9 A;  1N63 A;  3ZDT A;  2COD A;  3P7Z A;  4MT5 A;  5D3W A;  2MH7 A;  1I42 A;  5D27 A;  4W9J A;  2N9X A;  2W3R A;  3I3T B;  1EAZ A;  2MP2 A;  5JLJ B;  2JVC A;  4BOZ B;  5C2T B;  1WJ4 A;  1WE6 A;  3Q8A A;  2EKI A;  3HM3 A;  2M0X A;  4JKF A;  4IM3 A;  1WX9 A;  2GBN A;  3VUY A;  2PEA A;  1T0R C;  4BZA A;  1QF6 A;  1I4G A;  2AX5 A;  1E10 A;  3JYU A;  4XGA B;  3PEG A;  2JXX A;  1TGZ B;  2QMT A;  4TKN A;  2L05 A;  3T3O A;  1P7E A;  3ZNH B;  4ILH A;  1E8X A;  1IRS A;  4LNF A;  2NMB A;  1MI1 A;  4BKS A;  1MIZ B;  3GYO A;  1FXT B;  1QOF A;  4XX5 A;  4NAW B;  2BS3 B;  2WXM A;  2J59 M;  4E3C A;  2WH5 A;  1YN3 A;  2YS1 A;  2EKE C;  4KSL C;  2DYB A;  1MG8 A;  5GOW B;  2Z0D B;  1E6E B;  4FA6 A;  2YT1 A;  4HRS A;  5IAA C;  4LNO A;  2WGS A;  4DK5 A;  3AE2 B;  1NBF C;  2OOB B;  1UNS A;  1E7V A;  1UNQ A;  1RFK A;  4WWN A;  2DAF A;  3NSU A;  3HQC A;  2EJ8 A;  1XT9 B;  1GG3 A;  1FFV A;  4GLS C;  4WJN A;  2WU2 B;  5KHO A;  5T8I A;  3PVW A;  3P63 A;  1ET6 A;  1QQG A;  2WHI A;  3VOQ A;  1X11 A;  4GIV A;  4DQO C;  2KOX A;  3NG0 A;  3PRP B;  4HK2 A;  2KFJ A;  5L81 A;  4GZU A;  2FCQ A;  3B77 A;  3RN9 C;  4F8C B;  2MHJ A;  3ML4 A;  4BBN F;  1FO4 A;  1WF9 A;  1BT0 A;  1HA5 A;  2WXQ A;  4EE2 A;  3QWM A;  2PKO A;  3DHH C;  4IWQ A;  1YX6 B;  3UF8 A;  3D8F A;  3U7D A;  3W9C B;  3H6N A;  1PMS A;  2G4S A;  2ZCC A;  3ENE A;  3QAQ A;  4B6W A;  1J7C A;  4RF1 A;  2KX3 A;  2KCJ A;  2AL6 A;  4KKJ A;  5AEK B;  3UIO B;  1XQQ A;  3AEF B;  3L13 A;  3S2A A;  1WRD B;  2WXI A;  5HE2 A;  3B2F A;  3RD2 A;  4EZL A;  3A4R A;  1UPR A;  4DDG D;  1J7A A;  3ZUN A;  2Z0P A;  3GZN I;  1QOB A;  1J7B A;  3AEB B;  1F52 A;  2M0A A;  2DHK A;  1SEB D;  3DXC A;  4D2K A;  4C7Z A;  4MGY E;  2V4L A;  4JKG A;  3CST A;  3H7P B;  3A1Q A;  2NZ8 B;  1UBI A;  2WP9 B;  2IO0 B;  1GC6 A;  1ZDV A;  2QHO A;  5LXI B;  1C4P A;  4JWU C;  1ZOY B;  2WXH A;  3N32 A;  5JHH A;  3T8M A;  2L3Z A;  3N7C A;  2GBK A;  2ZJD A;  2CS4 A;  4HKZ E;  1P1A A;  1QOA A;  2DX5 B;  3OWE B;  3NJT A;  4XYC A;  1FIQ A;  4WH4 A;  3Q3F A;  3V6E B;  1IPG A;  3GP7 A;  4A8X C;  4JKA A;  1WZ3 A;  2KN5 A;  3B1L X;  4GDK A;  1EWC A;  4DXA B;  4OVV A;  3VHT C;  1V5T A;  1ZM0 A;  4GOC A;  1L2N A;  2V76 A;  2LRW A;  1NI2 A;  4K81 A;  2KVZ A;  3TFM A;  3AE8 B;  4YTP B;  3ODX A;  1NTY A;  2MLB A;  3EFC A;  4MJS B;  3AJ4 A;  1VD2 A;  3CIK A;  1GB4 A;  3MP9 A;  4NQL B;  2IYD B;  2GCJ A;  2L83 A;  1L0X B;  4LCD E;  4WJQ A;  2WDT B;  3E9S A;  2KDE B;  1EWY C;  1MKE A;  1HBK A;  5IRS A;  1X05 A;  1SJH D;  3IG3 A;  3ZQ4 A;  3X0W A;  2YVC A;  3IT4 B;  2BGF A;  1D5M C;  5GMV A;  2C7M B;  2KHW B;  2DLB A;  2VZK D;  2K5P A;  1WMH A;  1UD7 A;  3DVG Y;  5TR5 A;  5C6R A;  3EHV A;  2G1E A;  4HAZ B;  1VLB A;  4HB4 B;  2PMV A;  2NBW B;  4MGZ E;  4II2 B;  3PLU A;  2O2V A;  1ZUD 2;  3AEA B;  3E9P A;  3VR8 B;  2ZNV C;  1GOZ A;  3KW5 B;  4C0A A;  3NZS A;  2K49 A;  2VH2 A;  2JRH A;  3HIZ A;  3AEC B;  4P7I A;  3L16 A;  1WFY A;  2MBE A;  2GLS A;  3M1I B;  1TY2 A;  5D3X A;  4ZDV A;  3QIJ A;  4WAF A;  2DLW A;  1Z5S B;  4DIX A;  2Z59 A;  4P1C C;  3GOE A;  1V5O A;  4KGR A;  4YXD B;  4RNA A;  3TL5 A;  3HW2 B;  2REX A;  1SXT A;  1HB8 A;  4FLH A;  2W82 A;  2KDM A;  4B9K A;  3Q3N C;  4WSF A;  1DIK A;  2HTM E;  3FIL A;  1HB6 A;  2CHW A;  3DBL B;  5DHF B;  1MVK A;  1U27 A;  3A9K B;  5FI0 A;  1WY8 A;  5D3D A;  1PLS A;  1NVI D;  2K2J A;  2COP A;  3U12 A;  1LGR A;  2ROZ B;  4JLC A;  5IO9 A;  1WX8 A;  3B0A A;  2CQU A;  2YLM A;  2C5L C;  2D3B A;  3W1S C;  2LGD A;  4KAX B;  2LI5 A;  4N59 A;  1S3S G;  3GS2 A;  4K7S A;  4I6N B;  1V81 A;  5LXH A;  3EPY A;  4JL9 A;  1U4A A;  1WM3 A;  2WXJ A;  5JVL A;  4CSQ A;  1XXG A;  4L6E A;  5E6O A;  2UZR A;  2INN E;  2M38 A;  2BKF A;  4K7U A;  3KZ1 A;  2R82 A;  3A33 B;  1RJ2 A;  3ZYY X;  3P6A A;  1VBG A;  1TJE A;  2COA A;  3N1Z C;  1DBH A;  4W9H A;  3NHE B;  3VFK A;  1R4M B;  4MK0 A;  1YN4 A;  5D6J B;  1G6J A;  3ULB A;  4KHB B;  2E6X A;  2NBV A;  2KC1 A;  1MIX A;  3EUB 2;  2C60 A;  4C80 A;  4W9F A;  2GJY A;  3U52 E;  1BWN A;  3AE3 B;  1Q67 A;  1ZDX A;  2KWC A;  1D3Z A;  2MJ3 A;  1MFW A;  3VRA B;  2ON8 A;  1WJN A;  4P16 A;  4OT1 A;  4RGM A;  1PFD A;  1N3H A;  1ZSQ A;  2KD0 A;  1DYQ A;  4TSS A;  2R61 A;  2VKI A;  3IXS A;  1FPY A;  2NCN A;  1DRO A;  1KC7 A;  2O6V A;  1V61 A;  3HVD A;  5EE9 A;  3N20 C;  1ACC A;  4XDD A;  3ALB A;  1FMA D;  4KX6 B;  3I63 C;  3ZJU A;  2W9N A;  2ZPN A;  2FJU B;  2Y5C A;  2K1F A;  3LDZ E;  2L8J A;  2IBI B;  5D2M B;  1KRH A;  1WJ1 A;  4A20 A;  3EC8 A;  3CMM B;  1D5Z C;  4Z2M B;  2MX2 A;  3BVZ A;  3NVV A;  3WAL A;  1TY0 A;  2BBC A;  4ICU A;  3E9O A;  4XZ4 A;  1LW3 A;  5EE1 A;  1JWB D;  2G45 B;  2BKR B;  2TSS A;  3N30 A;  1DYN A;  3RFZ B;  1Y8R C;  2KIE A;  3LJ3 A;  1NEK B;  2RQ1 A;  1MI0 A;  2B3A A;  3L4P A;  3P4R B;  1E9M A;  1GPX A;  1YX5 B;  1WR6 E;  4LNN A;  4ANX A;  2K2U A;  2JUO A;  1K52 A;  2QJL A;  4DX8 A;  3WIM A;  1NI3 A;  4YTM B;  4GSW A;  1C4C A;  2COF A;  4L1B A;  3V60 A;  1QT9 A;  2DZJ A;  2JF5 A;  4NZL B;  4K1R B;  1H4R A;  1EF1 A;  1OFF A;  1VRA B;  4A9A A;  3HIE A;  3DVN U;  4WJP A;  2V1Y A;  1WGG A;  1ZW7 A;  2R2Q A;  2AEH A;  2BWE S;  2H89 B;  1YQ4 B;  4TV3 A;  1MK9 B;  4TQ0 A;  2DWQ A;  1UH6 A;  1L4Z B;  2KJ6 A;  1ENF A;  1L5P A;  1I4Q A;  4FJV B;  3K9P B;  4GOU A;  3OG5 A;  2WWZ A;  3ZGZ A;  1ISN A;  1WI0 A;  3SD5 A;  2BWF A;  2UWQ A;  4DXF A;  3H1U A;  4LJP B;  4RM8 A;  5AZF A;  4F7G A;  1AN8 A;  1KFY B;  2LHE A;  2JY6 A;  2ZNV B;  4PT5 A;  1XCQ L;  2YT0 A;  4EEW A;  2LHD A;  4DHJ B;  1V1O A;  3ML9 A;  2IND C;  1LB1 A;  3MHZ A;  2CU3 A;  2IY1 B;  1KLU D;  1FHO A;  4HPP A;  1UGM A;  4HPL B;  4NPN A;  4AP4 C;  4AS1 A;  3DQV A;  1YQB A;  4PS7 A;  5G2N A;  4KGT A;  1S1Q B;  2HD5 B;  3H9D A;  1E7U A;  2FID A;  1HZ5 A;  5E6J A;  3MTN B;  2N9E B;  3U8Z A;  4HCN B;  2MQJ A;  4YT0 B;  2ZPY A;  3F5R A;  3SUZ A;  2RD0 A;  2D9W A;  3DHI C;  2INC C;  4R3D A;  4EZK A;  2IFS A;  2FUG 1;  4GGQ A;  3RYT A;  2ZKM X;  2UVM A;  4S0R A;  1XLP A;  2I38 A;  3UQA A;  5HE3 A;  4IKG A;  2KTR A;  1GC7 A;  2JPH A;  3HHM A;  4AJY B;  5JP4 A;  4WWO A;  2KLG A;  5EE3 A;  2LXC A;  3FLV A;  2L0F A;  2PW9 A;  4A6F B;  4G3X B;  2J53 A;  2JXT A;  3QHT A;  1HQR D;  1K53 A;  3RNC C;  3ZO5 B;  3G9W A;  3GE3 C;  2IO1 B;  4OVZ A;  3K9O B;  2CHX A;  4I6P A;  5KHQ A;  2LMC A;  2XK5 A;  3E56 A;  3NS8 A;  1K5D B;  4NJ6 A;  2KUP A;  5CHW A;  2KMA A;  3OJ3 A;  1DGJ A;  3V61 A;  1B1Z A;  2L7R A;  3ZRF A;  2RRF A;  4GPT B;  4QJ4 B;  4I6L B;  2N4F A;  2YSZ A;  4PQ0 A;  3DXD A;  1HEZ E;  3DCG A;  1WRI A;  1F0Z A;  1F2R I;  5AUK A;  2DZI A;  5BO4 B;  4Z2N A;  4NJC A;  1NU2 A;  3RNG C;  1U5D A;  4HDQ A;  2DZM A;  1TXD A;  2Z0O A;  5JHG A;  2CJO A;  5HI1 A;  4G50 A;  3GE8 C;  1NTI A;  4P1B C;  2IZV B;  2N1V A;  3MFG A;  1SBB B;  2N23 A;  3AE5 B;  4ZRI A;  3Q6B A;  3KWL A;  1DOX A;  3AH7 A;  2PE6 B;  3GZN B;  3TJP A;  3KLS X;  3UI3 A;  2MWN B;  5HFY A;  2JRI B;  3ZVR A;  5C16 A;  3Q3M C;  1PGA A;  2RDG A;  4WQO B;  1AW7 A;  4OSN A;  1C1Y B;  2RR9 A;  1ZC3 B;  3J9C A;  2K8E A;  2BYE A;  3PGE A;  1LM8 B;  4ARC A;  1TS2 A;  3PZD A;  1X86 A;  2CY5 A;  3DDC B;  2DYO A;  1FM0 D;  4N6E B;  3JSV B;  4N9F 4;  2DEN B;  3VH4 B;  3W5U B;  4AJW A;  1R7S A;  1V5M A;  4MT7 A;  3PP2 A;  3Q8C A;  4LK0 M;  3TCA A;  1H10 A;  3A9J A;  4KIK A;  4ANW A;  4WJ7 A;  2J7Q B;  2MWS B;  1FGY A;  4LNK A;  2H7E A;  1WGQ A;  1QZE A;  4ZYS A;  2CY4 A;  2DHI A;  1WM2 A;  3HK0 A;  3IHP C;  3M62 B;  3BIN A;  4OZC A;  2Z0E B;  2ZVO A;  1N60 A;  2NPT A;  2CB8 A;  3NY5 A;  2ZW1 A;  3BK1 A;  1I4P A;  1Y5O A;  1SHC A;  1CQV A;  1AAR A;  3M95 A;  4PS8 A;  3KYD D;  3RCP A;  1PDX A;  1C78 A;  1NYQ A;  3QCA A;  3WAN A;  3RZF A;  3W5V B;  3RMK C;  3P2B A;  2G4D B;  2MFQ A;  2KJR A;  4PYZ A;  2RNR B;  4IOY X;  2NS5 A;  2R2O A;  1C77 A;  1EU4 A;  2Y7B A;  2KMM A;  5TSS A;  1V2Y A;  1U29 A;  2FNJ B;  2QIE B;  2WYQ A;  2FCS A;  4WUR A;  3PV1 A;  4TUU A;  1U5F A;  3AE4 B;  4F7Z A;  1RLF A;  3RUL A;  2KDB A;  1UNP A;  4F7H A;  4C4V B;  5DPT A;  3RPF C;  2GBJ A;  3BJI A;  1UEF A;  1X1M A;  4ASW C;  1X1G A;  2KFK B;  3R2I A;  5BYQ A;  4HWI B;  4W9G A;  4MM3 B;  3VH3 B;  4EMO A;  3ULC A;  3RT3 B;  1KZG A;  4J3O D;  2OJW A;  4RM9 A;  4FXC A;  5C79 A;  3PVU A;  1T0Q C;  3PSC A;  2FCM A;  2LUM A;  1ZC4 B;  5G5H A;  2DYM A;  1FNV A;  4A55 A;  2NTS A;  1F1H A;  1YMH E;  2BVC A;  3DBR I;  2JX5 A;  2LWP A;  4Q2J A;  2YF0 A;  5HG2 A;  4K7W A;  5KQ1 A;  1UWM A;  3VUW A;  3RNE C;  1VCB A;  1PUT A;  3AB5 A;  5IKC M;  3TO1 A;  1J0W A;  2P0H A;  2W2W A;  2V0G A;  4W9E A;  2ABD A;  4ARI A;  1FFU A;  3BYT B;  5LOP B;  2I2Y A;  3AE7 B;  3RCZ A;  1ZXH A;  2W3S A;  1LXD A;  2N0Y A;  4ZRQ A;  4BKS D;  1V1P B;  3PHW B;  3V3X A;  2RSU A;  2FBW B;  1VDV A;  2N1W A;  3A4S C;  5J17 A;  1GUA B;  4AUQ C;  1L6U A;  2RGN B;  3I9V 1;  1VBH A;  2C7N B;  1RAX A;  4HAU B;  3GYP A;  3NW8 A;  2E3T A;  2DHJ A;  2HTH B;  2X38 A;  4M01 A;  1I4X A;  1OMW A;  3I57 A;  4XWX A;  1I7H A;  4C00 A;  4PNK A;  4K17 A;  1NTV A;  2ZEQ A;  4BFR A;  1C76 A;  1JML A;  2KK8 A;  3ZLZ A;  3DHG C;  3Q8B A;  2KYW A;  2A4Z A;  4A6H A;  2P8V A;  3EFU A;  5EE0 A;  4TMA B;  1WYW B;  1K5G B;  2WDV B;  2N7E A;  4GU2 A;  4KSK C;  4WWP A;  1RYJ A;  1XO3 A;  3Q69 A;  4LLG M;  4IM0 A;  2YS5 A;  3RI7 C;  2Z8L A;  2JYT A;  1RFA A;  3ZXR A;  1Y56 A;  3FAH A;  5LON B;  2K0P A;  1B9R A;  4C56 C;  2J0J A;  3MDB C;  2WQY B;  4GMV A;  1WE7 A;  1ZE3 D;  3DOW A;  1WJM A;  3AUL A;  4JGH B;  1OY2 A;  2DYN A;  3UGB B;  3PT2 B;  4HAV B;  1FOE A;  3SNH A;  2XBB C;  1F2R C;  2N7J A;  2IGH A;  5HE0 A;  4MEL A;  2FCN A;  2R2Y A;  2KVR A;  1V97 A;  3I5J C;  4A90 A;  1FHX A;  2FDQ A;  4GDL A;  3MC0 B;  2WXN A;  1UBQ A;  1TS5 A;  2ZZP B;  1T6B X;  1JQ4 A;  1TZ1 A;  3QQ8 B;  1ZPS A;  4Y94 A;  1Q5W B;  4YL8 A;  1Z87 A;  3VR9 B;  2KDF B;  3HM6 X;  3R66 C;  3UIN B;  1W1G A;  5CLL B;  3FEH A;  2EMS A;  3AU5 A;  1ZYI A;  3VDZ A;  1JRP A;  2MBO A;  4W9K A;  1K50 A;  5CHV C;  3BZD B;  5FK9 C;  1K8R B;  1Q1O A;  2LBB A;  2BS2 B;  2JYE A;  1J8C A;  4KZ0 A;  5C5B A;  2L1A A;  3ZW3 A;  1R4N I;  5IJM A;  2RVB B;  2G3Q B;  2N9P C;  4JKG B;  2FE8 A;  4FHK A;  2WXG A;  3A1Q B;  1OTR B;  2KUQ A;  4DX9 0;  2JZP A;  3T06 A;  2WXL A;  2A5U A;  4BVU C;  2NR2 A;  4S17 A;  3JW0 X;  5C23 A;  1T77 A;  3HRD D;  1A5R A;  3W1Y A;  4O1N A;  1KH0 A;  4M8N A;  3TEW A;  1PGB A;  5H92 C;  4B0E A;  2RDH A;  2KQS A;  4OZB A;  3ZTD A;  4A3O A;  1YIW A;  1ZKH A;  4KHA A;  4PK1 A;  1CJE A;  1HE8 A;  3V6C B;  1XLN A;  1T3Q A;  2NVU I;  3L54 A;  1KI1 B;  3Q3J A;  3NZ3 A;  4GDK B;  1U2B A;  1FB8 A;  2QDF A;  3BII D;  1TBE A;  3BWU D;  2OJR A;  4PYU A;  3HSA A;  4US8 A;  2HDE A;  2Z0Q A;  4WJO A;  2BYV E;  2JZZ A;  3AED B;  2INP E;  2MBB B;  3C19 A;  3A98 B;  1EUV B;  1ROE A;  4HAY B;  4B6H A;  4ANU A;  1SJE D;  4NAM A;  1WZ0 A;  2OED A;  3O65 B;  2IY0 B;  3V62 A;  4W9I A;  1J19 A;  4GMX B;  1W1D A;  3EEC A;  1EM7 A;  5G55 A;  3PO0 A;  3Q3O C;  3KSY A;  2UU7 A;  4WIP A;  1WWT A;  3DBS A;  1N61 A;  2AL3 A;  3B9J A;  2N9K A;  1K51 A;  2XNA C;  4FAD A;  2ELB A;  1VZ6 A;  4OW0 A;  2LXA A;  2Z13 A;  1OEY A;  2N9L A;  3B2G A;  4BBK A;  3KWV A;  3SR6 A;  1P7F A;  3VAW A;  1P3R A;  1KLG D;  4A6F A;  4HVB A;  1JRU A;  2K8C A;  4A5K A;  4USA A;  2NTT A;  3P4Q B;  4M8M A;  3ZRC A;  1DOI A;  1VJK A;  3R7Q A;  1L4D B;  2IO2 B;  2ONQ A;  2PVO D;  3BYY B;  1TQZ A;  2XEW A;  3NVW A;  2JP2 A;  2LD9 A;  1UEL A;  2Z59 B;  3N9Y C;  4DHJ D;  2PLP A;  4JE3 B;  3VVW B;  4QJ3 B;  5E6P A;  1DDV A;  1DDW A;  1NEN B;  3CF6 E;  5BMH A;  2UZS A;  5DH9 B;  5J18 A;  4TYZ A;  1HXY D;  3V05 A;  2IPK D;  2KT7 A;  2MEK A;  4M0W A;  3FIL B;  4MH0 E;  3ENB A;  1IBX A;  4A6K A;  4MY6 A;  1F77 A;  1QKZ A;  2KAC A;  3TMP B;  1T0S C;  2AYO B;  1EVH A;  2XQN M;  3AEE B;  2QSD A;  3PG7 A;  3U2S C;  1TKG A;  3AU4 A;  1P6S A;  4MGK E;  4BKT A;  5IN7 A;  2LVP A;  4KDL B;  2EMT A;  3EA6 A;  5HKH A;  3PRM B;  2K25 A;  2GUM A;  1GGO A;  3QBV B;  1MHH E;  2ZW0 A;  1MK7 B;  3UIP B;  2KIG A;  3O96 A;  4D0N B;  4LTU A;  2I1J A;  3SFD B;  3PZ8 A;  2WX0 A;  1V80 A;  2WNM A;  3ETR A;  3QJZ A;  2D2Q A;  2BPS A;  2BW2 A;  1X1F A;  1WGR A;  2KC2 A;  4LJO B;  1XCG A;  3BVM A;  1MPH A;  1N5W A;  4LDT B;  1BAK A;  2LVO A;  2O6V D;  2VSZ A;  3MJW A;  1HTO A;  5I4D A;  5D7G A;  4AWJ A;  2K00 A;  1SE4 A;  4B0M A;  2GBR A;  2N7D A;  2BQQ A;  3JSV A;  4ZRK A;  4IC7 B;  2D5G A;  3NVY A;  1GAQ B;  4K2P A;  1CK1 A;  2H7D A;  4NQK E;  4NAW A;  5D3I B;  5BYR A;  1WXS A;  2LVQ A;  2IO3 B;  2CAY A;  2NBV B;  4XWT A;  4D6W A;  4H2A A;  1N62 A;  3HUI A;  1AYF A;  3KUZ A;  4JK7 A;  4EKU A;  5L95 C;  3U4E G;  4NY0 A;  3CIR B;  1U5E A;  2ELA A;  1TJ6 A;  1I4R A;  2PVG C;  1FAO A;  1C79 A;  1OQR A;  4M00 A;  4FJZ A;  1FCL A;  1EU3 A;  1TS3 A;  4N58 A;  4TQ1 A;  2GOW A;  4L2Y A;  4F7U P;  3AEG B;  2M14 A;  1I35 A;  3A8Q A;  1V89 A;  1IUE A;  2LGX A;  4DXG A;  4RGN A;  4XE0 A;  2O6V B;  3WA0 A;  4IAP A;  4EOY A;  3AN1 A;  4RFB A;  1QLB B;  3D8E A;  1RWS A;  3PSE B;  3KUC B;  3IVF A;  2J0M A;  2DBY A;  2IDY A;  4HDO A;  1WIA A;  4X57 B;  2PTL A;  4C4V A;  1W1H A;  1V5P A;  4E74 A;  3ZJV A;  2Z4D A;  1PYW D;  2WDR B;  1L0V B;  4HPM B;  2LUL A;  2KFK A;  3R8B A;  3APF A;  5AUI A;  1YD8 U;  1MG4 A;  1FRD A;  1SF0 A;  3ODW A;  1FGZ A;  3ZNZ B;  2J0K A;  1SGH A;  3ZNI D;  2MKR A;  5LLI A;  1SE2 A;  4L23 A;  2LAS A;  1TYG B;  2JU6 X;  1Q0W B;  3NVZ A;  1XF5 L;  4HAT B;  2LOZ A;  2BT6 A;  1KTK A;  4FJY A;  1UNR A;  4IFS A;  1SSN A;  2OHF A;  2MCN B;  1B55 A;  1ZVR A;  4EJN A;  1VZ8 A;  1Y19 B;  1FD6 A;  1TS4 A;  1E5W A;  2M8S A;  3H7P A;  2D9V A;  3MC9 A;  4MEM A;  3CWI A;  2RPQ A;  4IDI A;  2COC A;  4DHZ E;  3AXC A;  3DBR B;  5H8Y E;  2JT4 B;  3EGR A;  3T9L A;  1KF6 B;  4ZYN A;  1DOY A;  1GB1 A;  4OZA A;  2DA0 A;  2LKO A;  1TKE A;  1V9J A;  4QAY A;  1XEE A;  2DX5 A;  3ZXV A;  1WXQ A;  3AV8 A;  3NRZ A;  2KWV B;  3MJ5 A;  5BMI A;  4WQM A;  2B76 B;  4HJG E;  2HTH A;  1M7R A;  4GB9 A;  3AI5 A;  4EUT A;  3WCQ A;  2KX0 A;  4US9 A;  1ST7 A;  1LO5 D;  4JQW C;  4WVF B;  2JSV X;  2AQ3 B;  3TIX A;  5IP4 D;  3C8Y A;  1RRP B;  3MPX A;  3SU8 X;  3TEY A;  3DWM A;  3DVN V;  4MJS A;  3BK2 A;  1MHX A;  4IWO A;  2V4I B;  2DTC A;  1E8Z A;  1FHW A;  1ZXI A;  2M19 A;  5D3Y A;  2KXJ A;  4ZHO A;  2V9H A;  4XC2 A;  5LNK 1;  1L0Y B;  2BCJ A;  1T5X D;  1Q10 A;  2MRP A;  1P3Q U;  4MDK E;  3ZNG C;  2KR0 A;  2R0D A;  2M4N A;  5JXV A;  3P42 A;  3O13 A;  1JWU D;  3LB8 C;  5KCV A;  2KJH B;  3SBT A;  1MAI A;  2JWZ A;  4HAW B;  1JWM D;  2LJI A;  1V86 A;  1M4V A;  2UYZ B;  4RH6 A;  5AZG A;  1TZO A;  2KTR B;  2LGI A;  4W9C A;  5BYS A;  4URK A;  1BUI C;  2PZ1 A;  2EC1 A;  4FUL A;  3ZJT A;  3ODO A;  3E66 A;  2IGD A;  3VXW A;  2WXF A;  1HZ6 A;  3W2D A;  3SDL C;  4W9D A;  5I2M A;  1WYG A;  3Q8E A;  2K9X A;  3OJ4 B;  1ZP0 B;  3T3N A;  2X0S A;  1BXT A;  1JRO A;  2W2X C;  4J6I A;  3FKY A;  3ZIM A;  2BS4 B;  4CHK A;  1XD4 A;  2GS0 A;  2QCZ A;  4GXB A;  2L76 A;  2XK5 B;  5BMG A;  1MPE A;  1UWX A;  2L2I A;  1TKY A;  4QJ5 B;  2D07 B;  2KKC A;  1SIF A;  4DBB A;  3WYF B;  3PHX B;  1WGH A;  2Y8G A;  4GNK B;  1FEH A;  3PZ7 A;  1V8C A;  5CLQ B;  2WXR A;  1QIL A;  1ACA A;  1PQS A;  1JCK B;  4FHJ A;  1KZ7 A;  4RMA A;  4HB2 B;  3ZVV A;  4WAA A;  4W9L A;  3WAP A;  2DYQ A;  3D8D A;  5EDS A;  1KLV A;  3A9K A;  1STE A;  3TVV A;  2KMC A;  4FBJ B;  3M3J A;  2KQ4 X;  1WSP A;  1RM6 C;  4MH8 A;  4IM2 A;  3KUD B;  5DIF B;  3KY9 A;  2D3C A;  1VZ7 A;  5G5G A;  5D94 A;  1HTQ A;  3P4S B;  3PRZ A;  1YOV B;  4E71 A;  4AOF A;  3DXE A;  4RGT A;  3TEZ A;  4L1R A;  1QOG A;  3VRB B;  4M02 A;  4G11 A;  2I5C A;  2K3U A;  1T0Y A;  3VTW A;  1XX0 A;  2K39 A;  5J2R A;  4JKC A;  5CX3 A;  4GN1 A;  5DI9 B;  3AE1 B;  1E7P B;  2MP2 B;  3B08 A;  3D32 A;  3SEB A;  3NOB A;  3QK0 A;  5MPO A;  5EFX A;  4ILG B;  1R4N B;  4H8S A;  4KKI A;  1P5T A;  3TUO A;  1JW9 D;  2DKQ A;  2BTE A;  4IG7 B;  2SAK A;  3FM8 C;  2J52 A;  3RUI B;  4JKH A;  1IP9 A;  4K3B A;  3RNA C;  1XCT L;  2G35 A;  2KQ7 A;  2DX1 A;  2YT2 A;  3NWD A;  1EGX A;  4KHB A;  5HHD G;  4CHJ A;  2CKH B;  1WX7 A;  4HXD A;  5J3Y A;  2NMQ A;  2D4Q A;  1GNU A;  4IW0 A;  4KIK B;  2CRF A;  3A9J B;  4RGO S;  2PPH A;  2RSG A;  5IOI A;  2V3P A;  3VTU A;  2KO3 A;  4P6V F;  3KRW A;  3GB1 A;  4II3 B;  1WJU A;  3KRX A;  1UUP A;  2L1C A;  1I2H A;  3RNB C;  2NPT B;  1UPQ A;  2D3G A;  4MSM B;  2MJD A;  2IJ0 A;  2R09 A;  3N1Y C;  2Y3A A;  2WS3 B;  3DPD A;  2KAJ A;  4KZC A;  1P98 A;  2L32 A;  2BF8 B;  1CMX B;  4JIO U;  2MBQ A;  4CO7 A;  2PIA A;  4A3P A;  5FR3 A;  3DBH B;  4KVG B;  2M17 A;  4JWS C;  4HB0 B;  1E8W A;  1N5X A;  2CHZ A;  2YEP F;  1IGD A;  5I2S A;  2RDB C;  3P4P B;  4HHV A;  2WXK A;  2FAZ A;  2IYB A;  3PVL A;  2VRR B;  1C9F A;  2LG1 A;  2RUK B;  2M1M A;  3ZTC A;  4YSZ B;  2Q5W D;  2P0D A;  2LOX A;  1D6E C;  2RGF A;  1YNT E;  3R7R A;  2C7H A;  1FCC C;  1ESF A;  2K6D B;  2NBU A;  1M94 A;  4MGI E;  2GCL A;  2RLO A;  1LFD A;  5KQ4 A;  4OVU A;  1FNW A;  1SB3 C;  2GI9 A;  3SBG A;  5D3V A;  3PLV A;  1SE9 A;  1TTN A;  2W2X D;  2KTF A;  2Z14 A;  2LGY A;  1I4H A;  1UGJ A;  2JZ3 B;  2VZK B;  4HJK A;  4IWP A;  3QX1 A;  4K3C A;  1XKE A;  2H88 B;  5FR6 A;  2KDI A;  4ILJ A;  3PRE A;  1U5G A;  3ABV B;  3LXF A;  1WJ6 A;  4DDI D;  4YSY B;  3FC4 A;  4UDU C;  2QKL A;  3ECI A;  2YEP B;  3L10 B;  4JKB A;  2MSE D;  4CQN A;  3A58 A;  1OQY A;  1YN5 A;  1UF0 A;  2BYF A;  2X18 A;  2ZCB A;  4XWW A;  2IGG A;  4WWM A;  1IYF A;  2FJL A;  1OEY J;  1D5X C;  2HJ8 A;  4MAC A;  3P1M A;  2XN9 C;  5IA7 A;  3IBE A;  3VUX A;  2P0F A;  1YJ1 A;  3LYY A;  1WXA A;  3BVG A;  5J3Q A;  1FXA A;  3H8H A;  4IUM B;  1PFJ A;  2D11 A;  2ADZ A;  4F1S A;  2MJE A;  2N0S B;  3WAO A;  3IT6 B;  3MC8 A;  2DAJ A;  3L0W B;  1WI1 A;  1M7E A;  4BKG A;  2HRJ A;  3OHM B;  3BY4 B;  4KHO A;  5LG4 B;  5DHA B;  1WGU A;  1V49 A;  2MW5 A;  3AE6 B;  3IAS 1;  4HEA 1;  1KBL A;  2D9Z A;  3DBH I;  3CSF A;  4LNI A;  1I7A A;  2J4X A;  3DVG X;  4NNJ B;  3ONS A;  1JWA D;  2KWU B;  2YS3 A;  2EEL A;  1E90 A;  2WDQ B;  3SHQ A;  2AWT A;  4HSI A;  3UZT A;  4JX1 C;  2FJ9 A;  2ACZ B;  3FSS A;  3APD A;  1J0G A;  4HKQ A;  2Y8F A;  4ZHP A;  2MBH A;  1WMH B;  4NSW A;  3W1S A;  3QC8 B;  4FN2 A;  4RCO A;  2BB5 A;  1L7Y A;  3LJU X;  4HB3 B;  5CHF A;  2O2V B;  3SFE B;  2CR5 A;  3A8P A;  2C9W B;  3NS1 A;  4PS3 A;  5DPS A;  2HE7 A;  4ZRJ A;  5JHA A;  1BML C;  2ICI A;  4HCP B;  2KGX B;  2Y5P A;  3FP5 A;  4DBG A;  2KN4 A;  4KV2 A;  1WH3 A;  2L00 B;  1EO6 A;  4GDL B;  2Y5B B;  5E6N A;  4QXA B;  2QEJ C;  1UZX B;  3KQ4 A;  3DBL I;  2W55 A;  1PGX A;  1QC6 A;  1IGC A;  4ACF A;  2MA9 B;  2G9H D;  2D9Y A;  2D9X A;  2WXP A;  1Z2M A;  2DNF A;  1WGK A;  5CTR C;  2RPV A;  3C0R B;  4ANV A;  1FNU A;  3VQI A;  4EZJ A;  1WGY A;  2PJH A;  2KLC A;  1FRR A;  2LEK A;  5GXG B;  1LQB A;  4LDT D;  2DKP A;  2DIK A;  2LZ6 A;  2HJ1 A;  5DCN A;  2SEB D;  1QQR A;  4CYE A;  2CU1 A;  2DHZ A;  3TBL D;  5L83 A;  2QKM A;  3VIA A;  4EFO A;  1WR1 A;  2L52 A;  1WXV A;  2QIL A;  3TSS A;  2K22 A;  3R2T A;  1KM7 A;  2D3A A;  2J42 A;  2QC8 A;  3Q2A C;  2D10 A;  5C5B B;  1JDE A;  1SIJ A;  3APC A;  5DPW A;  3Q8F A;  3CXB B;  3NUH B;  3E9L A;  2AQ1 B;  4G0N B;  1MJD A;  4RF0 A;  3DWG C;  3U30 A;  3DCX A;  2KAN A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  3V5W A;  5DPR A;  3N3K B;  3L08 A;  1R4M I;  2K8B A;  2MDX A;  4JKE A;  1KOT A;  2GBM A;  5JHB A;  2GMI C;  4JK8 A;  3L17 A;  1WGD A;  1C3T A;  2WX1 A;  3NZU A;  1V88 A;  4KDI C;  4NJ7 A;  1GJZ A;  5HE1 A;  2KZR A;  4JKD A;  2DFK A;  1NVL A;  4YON A;  2ROV A;  4CHM A;  3H7S A;  4BOS C;  2V3S A;  3KYC D;  2FUH B;  2OTX A;  4DWF A;  2E2X A;  5JZE B;  3QA8 A;  3SYX A;  3M63 B;  1BTN A;  2KAN A;  2L0T A;  3X23 A;  1AQC A;  5FI1 A;  1NDD A;  1P9D U;  2K6Q A;  1XR0 B;  1H8C A;  1WVH A;  1WG7 A;  2FIF A;  3KVF B;  3OAW A;  1E8Y A;  4HLE A;  4JK9 A;  1XD3 B;  1RRB A;  3OAN A;  3OLM D;  3R3M A;  2DN6 A;  1EF5 A;  4ICV A;  4BBN C;  1DDM A;  1WXM A;  2YRY A;  2KNB A;  3QWZ B;  3TW1 A;  3VTV A;  3F0W A;  3SO6 A;  4MM3 A;  3KH0 A;  1AWE A;  4B95 A;  3JVZ X;  1V6E A;  3RZW C;  1F9J A;  1ZGU B;  3SV1 A;  3ML8 A;  3QAR A;  1V5U A;  2LJ5 A;  1OGW A;  2Q13 A;  4K2O A;  2ASQ A;  4MSQ B;  5J3T A;  3PPA A;  3PTF C;  2LYD A;  4DHZ B;  3IFW B;  1KJT A;  4M0W B;  4HAX B;  2OQB A;  1OQN A;  5AZH A;  3WAM A;  3ZKJ C;  3MHS D;  2VRW B;  1XOD A;  2ZVN A;  2LUE A;  1BTK A;  5C1Z A;  3UQB A;  2I1K A;  2K8H A;  3ZDM C;  5JH5 C;  2LRU A;  1P0R A;  2DZK A;  2I5F A;  2PE9 A;  3ZDT A;  2COD A;  3P7Z A;  1I42 A;  5D3W A;  5D27 A;  4W9J A;  2N9X A;  3I3T B;  1EAZ A;  2MP2 A;  5JLJ B;  2JVC A;  4BOZ B;  1WJ4 A;  1WE6 A;  3HM3 A;  2M0X A;  4JKF A;  4IM3 A;  1WX9 A;  2GBN A;  3VUY A;  2PEA A;  3JYU A;  3PEG A;  2JXX A;  1TGZ B;  4TKN A;  2L05 A;  3ZNH B;  4ILH A;  1E8X A;  1IRS A;  2NMB A;  4BKS A;  1MIZ B;  3GYO A;  1FXT B;  4XX5 A;  4NAW B;  2J59 M;  4E3C A;  2WH5 A;  2YS1 A;  2EKE C;  4KSL C;  2DYB A;  1MG8 A;  5GOW B;  2Z0D B;  4FA6 A;  2YT1 A;  5IAA C;  4DK5 A;  1NBF C;  2OOB B;  1E7V A;  1UNQ A;  4WWN A;  2DAF A;  3NSU A;  3HQC A;  2EJ8 A;  1XT9 B;  1GG3 A;  4WJN A;  5KHO A;  3PVW A;  1QQG A;  4GIV A;  3VOQ A;  1X11 A;  2KOX A;  3PRP B;  4HK2 A;  2KFJ A;  5L81 A;  4GZU A;  2FCQ A;  4F8C B;  3ML4 A;  4BBN F;  1WF9 A;  1BT0 A;  3QWM A;  4IWQ A;  1YX6 B;  3UF8 A;  3D8F A;  3U7D A;  3H6N A;  1PMS A;  2G4S A;  2ZCC A;  3ENE A;  3QAQ A;  4B6W A;  2KX3 A;  2KCJ A;  2AL6 A;  5AEK B;  3UIO B;  1XQQ A;  3L13 A;  3S2A A;  1WRD B;  5HE2 A;  3RD2 A;  4EZL A;  3A4R A;  1UPR A;  4DDG D;  3ZUN A;  2Z0P A;  3GZN I;  2DHK A;  3DXC A;  4MGY E;  2V4L A;  4JKG A;  3CST A;  3H7P B;  3A1Q A;  2NZ8 B;  1UBI A;  2IO0 B;  1GC6 A;  2QHO A;  5LXI B;  3N32 A;  5JHH A;  3T8M A;  2L3Z A;  3N7C A;  2GBK A;  2ZJD A;  2CS4 A;  1P1A A;  2DX5 B;  3Q3F A;  3V6E B;  1IPG A;  4JKA A;  1WZ3 A;  2KN5 A;  4GDK A;  3B1L X;  4DXA B;  4OVV A;  3VHT C;  1V5T A;  1ZM0 A;  4GOC A;  1L2N A;  2V76 A;  2LRW A;  1NI2 A;  4K81 A;  3TFM A;  3ODX A;  1NTY A;  2MLB A;  4MJS B;  3AJ4 A;  1VD2 A;  3CIK A;  4NQL B;  2IYD B;  2GCJ A;  4LCD E;  4WJQ A;  2WDT B;  2KDE B;  1MKE A;  1HBK A;  1X05 A;  3IG3 A;  3X0W A;  2YVC A;  2BGF A;  5GMV A;  2C7M B;  2KHW B;  1WMH A;  1UD7 A;  3DVG Y;  5TR5 A;  5C6R A;  3EHV A;  4HAZ B;  4HB4 B;  2NBW B;  4MGZ E;  4II2 B;  3PLU A;  2O2V A;  3E9P A;  2ZNV C;  3KW5 B;  4C0A A;  3NZS A;  2JRH A;  3HIZ A;  4P7I A;  3L16 A;  1WFY A;  2MBE A;  3M1I B;  5D3X A;  4ZDV A;  3QIJ A;  2DLW A;  1Z5S B;  3GOE A;  1V5O A;  3TL5 A;  3HW2 B;  2REX A;  1HB8 A;  4FLH A;  4B9K A;  4WSF A;  1DIK A;  1HB6 A;  2CHW A;  5DHF B;  1U27 A;  3A9K B;  5FI0 A;  1WY8 A;  1PLS A;  2K2J A;  2COP A;  2ROZ B;  4JLC A;  1WX8 A;  3B0A A;  2CQU A;  2YLM A;  2C5L C;  3W1S C;  2LGD A;  4KAX B;  2LI5 A;  1S3S G;  4K7S A;  4I6N B;  1V81 A;  5LXH A;  3EPY A;  4JL9 A;  1U4A A;  1WM3 A;  5JVL A;  4L6E A;  5E6O A;  2UZR A;  2M38 A;  2BKF A;  4K7U A;  3KZ1 A;  2R82 A;  3A33 B;  1RJ2 A;  3P6A A;  1VBG A;  2COA A;  1DBH A;  4W9H A;  3NHE B;  3VFK A;  4MK0 A;  5D6J B;  1G6J A;  3ULB A;  4KHB B;  2KC1 A;  1MIX A;  2C60 A;  4W9F A;  2GJY A;  1BWN A;  1Q67 A;  2KWC A;  1D3Z A;  1WJN A;  1N3H A;  1ZSQ A;  2KD0 A;  2VKI A;  2NCN A;  1DRO A;  1KC7 A;  2O6V A;  1V61 A;  3ALB A;  2W9N A;  2ZPN A;  3LDZ E;  2K1F A;  2L8J A;  2IBI B;  5D2M B;  1WJ1 A;  4A20 A;  3EC8 A;  3CMM B;  4Z2M B;  2MX2 A;  3WAL A;  4ICU A;  3E9O A;  4XZ4 A;  1LW3 A;  2G45 B;  2BKR B;  3N30 A;  1DYN A;  1Y8R C;  3LJ3 A;  2RQ1 A;  2B3A A;  1YX5 B;  1WR6 E;  4ANX A;  2K2U A;  2JUO A;  4DX8 A;  3WIM A;  4GSW A;  2COF A;  3V60 A;  2DZJ A;  2JF5 A;  4K1R B;  1H4R A;  1EF1 A;  3DVN U;  4WJP A;  2V1Y A;  1WGG A;  1ZW7 A;  2R2Q A;  2AEH A;  2BWE S;  4TV3 A;  1MK9 B;  4TQ0 A;  1UH6 A;  2KJ6 A;  4FJV B;  3K9P B;  2WWZ A;  1ISN A;  1WI0 A;  3SD5 A;  2BWF A;  2UWQ A;  3H1U A;  4LJP B;  4RM8 A;  5AZF A;  4F7G A;  2JY6 A;  2ZNV B;  2YT0 A;  4EEW A;  4DHJ B;  3ML9 A;  1LB1 A;  2IY1 B;  1FHO A;  1UGM A;  4HPL B;  4NPN A;  4AP4 C;  3DQV A;  1YQB A;  4PS7 A;  5G2N A;  1S1Q B;  2HD5 B;  3H9D A;  1E7U A;  2FID A;  3MTN B;  2N9E B;  3U8Z A;  4HCN B;  2MQJ A;  2ZPY A;  3F5R A;  3SUZ A;  2RD0 A;  2D9W A;  4EZK A;  2IFS A;  4GGQ A;  3RYT A;  2UVM A;  3UQA A;  5HE3 A;  2KTR A;  1GC7 A;  2JPH A;  3HHM A;  4AJY B;  5JP4 A;  4WWO A;  2KLG A;  2LXC A;  3FLV A;  2L0F A;  4A6F B;  4G3X B;  3QHT A;  3ZO5 B;  3G9W A;  2IO1 B;  3K9O B;  2CHX A;  4I6P A;  5KHQ A;  2XK5 A;  3NS8 A;  1K5D B;  4NJ6 A;  2KUP A;  5CHW A;  2KMA A;  3OJ3 A;  3V61 A;  2L7R A;  3ZRF A;  4GPT B;  4I6L B;  2N4F A;  2YSZ A;  4PQ0 A;  3DXD A;  3DCG A;  2DZI A;  5BO4 B;  4Z2N A;  1NU2 A;  1U5D A;  4HDQ A;  2DZM A;  1TXD A;  2Z0O A;  5JHG A;  4G50 A;  1NTI A;  2IZV B;  2N1V A;  2N23 A;  4ZRI A;  2PE6 B;  3TJP A;  2MWN B;  2JRI B;  3ZVR A;  5C16 A;  4WQO B;  1C1Y B;  2RR9 A;  1ZC3 B;  2BYE A;  3PGE A;  1LM8 B;  3PZD A;  1X86 A;  2CY5 A;  3DDC B;  2DYO A;  3JSV B;  4N9F 4;  2DEN B;  3VH4 B;  4AJW A;  1V5M A;  4MT7 A;  3PP2 A;  3TCA A;  1H10 A;  3A9J A;  4KIK A;  4ANW A;  4WJ7 A;  2J7Q B;  2MWS B;  1FGY A;  2H7E A;  1WGQ A;  1QZE A;  2CY4 A;  2DHI A;  1WM2 A;  3HK0 A;  3IHP C;  3M62 B;  3BIN A;  2Z0E B;  2ZVO A;  2NPT A;  2CB8 A;  3NY5 A;  1Y5O A;  1SHC A;  1AAR A;  3M95 A;  4PS8 A;  3KYD D;  3RCP A;  3WAN A;  3QCA A;  3RZF A;  3P2B A;  2G4D B;  2MFQ A;  2KJR A;  4PYZ A;  2RNR B;  4IOY X;  2NS5 A;  2R2O A;  2Y7B A;  1V2Y A;  1U29 A;  2FNJ B;  2WYQ A;  2FCS A;  3PV1 A;  4TUU A;  1U5F A;  4F7Z A;  1RLF A;  3RUL A;  2KDB A;  1UNP A;  4F7H A;  5DPT A;  2GBJ A;  3BJI A;  1UEF A;  1X1M A;  4ASW C;  1X1G A;  2KFK B;  4HWI B;  4W9G A;  3VH3 B;  4EMO A;  3ULC A;  3RT3 B;  1KZG A;  4RM9 A;  5C79 A;  3PVU A;  3PSC A;  2FCM A;  1ZC4 B;  2DYM A;  3DBR I;  2LWP A;  2YF0 A;  4K7W A;  5KQ1 A;  3VUW A;  1VCB A;  3TO1 A;  1J0W A;  2P0H A;  2W2W A;  4W9E A;  2ABD A;  5LOP B;  3RCZ A;  1LXD A;  2N0Y A;  4BKS D;  3PHW B;  2RSU A;  5J17 A;  2N1W A;  3A4S C;  1GUA B;  4AUQ C;  2RGN B;  1VBH A;  2C7N B;  1RAX A;  4HAU B;  3GYP A;  2DHJ A;  2HTH B;  1OMW A;  4XWX A;  4PNK A;  4K17 A;  1NTV A;  2ZEQ A;  4BFR A;  2KK8 A;  3ZLZ A;  2A4Z A;  4A6H A;  2P8V A;  3EFU A;  1WYW B;  1K5G B;  2N7E A;  4GU2 A;  4KSK C;  4IM0 A;  2YS5 A;  1RFA A;  5LON B;  2J0J A;  3MDB C;  4GMV A;  1WE7 A;  3DOW A;  1WJM A;  3AUL A;  4JGH B;  1OY2 A;  2DYN A;  3UGB B;  3PT2 B;  4HAV B;  1FOE A;  3SNH A;  2XBB C;  5HE0 A;  4MEL A;  2FCN A;  2KVR A;  1FHX A;  2FDQ A;  4GDL A;  1UBQ A;  2ZZP B;  1TZ1 A;  3QQ8 B;  4Y94 A;  1Q5W B;  4YL8 A;  1Z87 A;  2KDF B;  3HM6 X;  3R66 C;  3UIN B;  1W1G A;  5CLL B;  3FEH A;  2EMS A;  3AU5 A;  3VDZ A;  2MBO A;  4W9K A;  5CHV C;  1K8R B;  1Q1O A;  2LBB A;  1J8C A;  4KZ0 A;  5C5B A;  3ZW3 A;  1R4N I;  5IJM A;  2RVB B;  2G3Q B;  2N9P C;  4JKG B;  4FHK A;  3A1Q B;  1OTR B;  4DX9 0;  3T06 A;  2A5U A;  4BVU C;  2NR2 A;  3JW0 X;  5C23 A;  1A5R A;  3W1Y A;  4M8N A;  2KQS A;  3ZTD A;  4A3O A;  1YIW A;  1ZKH A;  4KHA A;  1HE8 A;  3V6C B;  2NVU I;  3L54 A;  1KI1 B;  3Q3J A;  4GDK B;  1U2B A;  1FB8 A;  1TBE A;  4PYU A;  2OJR A;  2Z0Q A;  4WJO A;  2BYV E;  2JZZ A;  2MBB B;  3A98 B;  1EUV B;  4HAY B;  4B6H A;  4ANU A;  1WZ0 A;  3O65 B;  2IY0 B;  3V62 A;  4W9I A;  1J19 A;  4GMX B;  1W1D A;  3EEC A;  5G55 A;  3KSY A;  3DBS A;  2AL3 A;  4FAD A;  2ELB A;  2LXA A;  1OEY A;  4BBK A;  3VAW A;  1P3R A;  4A6F A;  4HVB A;  1JRU A;  2K8C A;  4A5K A;  4M8M A;  3ZRC A;  3R7Q A;  2IO2 B;  1TQZ A;  2XEW A;  2JP2 A;  2LD9 A;  1UEL A;  2Z59 B;  4DHJ D;  3VVW B;  5E6P A;  1DDV A;  1DDW A;  3CF6 E;  2UZS A;  5DH9 B;  5J18 A;  4TYZ A;  4MH0 E;  3ENB A;  4A6K A;  4MY6 A;  3TMP B;  2AYO B;  1EVH A;  2XQN M;  3PG7 A;  3AU4 A;  1P6S A;  4MGK E;  4BKT A;  2LVP A;  4KDL B;  2EMT A;  5HKH A;  3PRM B;  2K25 A;  1GGO A;  3QBV B;  1MK7 B;  3UIP B;  3O96 A;  4D0N B;  2I1J A;  2WX0 A;  1V80 A;  3QJZ A;  2D2Q A;  2BPS A;  1X1F A;  1WGR A;  2KC2 A;  4LJO B;  1XCG A;  1MPH A;  4LDT B;  1BAK A;  2LVO A;  2O6V D;  2VSZ A;  3MJW A;  5D7G A;  4AWJ A;  2K00 A;  2GBR A;  2N7D A;  3JSV A;  4ZRK A;  4IC7 B;  4K2P A;  2H7D A;  4NQK E;  4NAW A;  1WXS A;  2LVQ A;  2IO3 B;  2CAY A;  2NBV B;  3KUZ A;  4JK7 A;  4EKU A;  5L95 C;  4NY0 A;  1U5E A;  2ELA A;  1TJ6 A;  1FAO A;  4FJZ A;  4TQ1 A;  2GOW A;  4F7U P;  2M14 A;  1I35 A;  3A8Q A;  1V89 A;  2LGX A;  2O6V B;  3WA0 A;  4IAP A;  4EOY A;  3D8E A;  3PSE B;  3KUC B;  3IVF A;  2J0M A;  4HDO A;  1WIA A;  4X57 B;  1W1H A;  1V5P A;  4E74 A;  4HPM B;  2LUL A;  2KFK A;  3APF A;  1YD8 U;  3ODW A;  1FGZ A;  3ZNZ B;  2J0K A;  1SGH A;  3ZNI D;  2MKR A;  5LLI A;  2LAS A;  1Q0W B;  4HAT B;  2LOZ A;  4FJY A;  1UNR A;  4IFS A;  2MCN B;  1B55 A;  1ZVR A;  4EJN A;  1Y19 B;  1E5W A;  2M8S A;  3H7P A;  2D9V A;  4MEM A;  2RPQ A;  2COC A;  4DHZ E;  3AXC A;  2JT4 B;  3T9L A;  4ZYN A;  2DA0 A;  2LKO A;  1V9J A;  2DX5 A;  2KWV B;  2HTH A;  1M7R A;  4GB9 A;  3AI5 A;  4EUT A;  2KX0 A;  1ST7 A;  4JQW C;  4WVF B;  3TIX A;  1RRP B;  3MPX A;  3SU8 X;  3DVN V;  4MJS A;  4IWO A;  2DTC A;  1E8Z A;  1FHW A;  5D3Y A;  2KXJ A;  4XC2 A;  2BCJ A;  2MRP A;  1P3Q U;  4MDK E;  3ZNG C;  2M4N A;  2R0D A;  5KCV A;  2KJH B;  3SBT A;  1MAI A;  2JWZ A;  4HAW B;  1V86 A;  2UYZ B;  5AZG A;  2KTR B;  4W9C A;  4URK A;  2PZ1 A;  2EC1 A;  4FUL A;  3ODO A;  3E66 A;  3VXW A;  3SDL C;  4W9D A;  3OJ4 B;  2X0S A;  2W2X C;  4J6I A;  3ZIM A;  4CHK A;  1XD4 A;  2GS0 A;  4GXB A;  2L76 A;  2XK5 B;  2L2I A;  2D07 B;  2KKC A;  1SIF A;  4DBB A;  3WYF B;  3PHX B;  1WGH A;  2Y8G A;  5CLQ B;  1ACA A;  1PQS A;  4FHJ A;  1KZ7 A;  4RMA A;  4HB2 B;  3ZVV A;  4WAA A;  4W9L A;  3WAP A;  2DYQ A;  3D8D A;  5EDS A;  1KLV A;  3A9K A;  4FBJ B;  3TVV A;  2KMC A;  3M3J A;  4IM2 A;  3KUD B;  5DIF B;  3KY9 A;  5D94 A;  3PRZ A;  4E71 A;  4AOF A;  3DXE A;  4G11 A;  2I5C A;  1T0Y A;  3VTW A;  1XX0 A;  2K39 A;  5J2R A;  4JKC A;  5CX3 A;  4GN1 A;  5DI9 B;  2MP2 B;  3B08 A;  3D32 A;  3NOB A;  3QK0 A;  5EFX A;  4ILG B;  4H8S A;  1P5T A;  2DKQ A;  4IG7 B;  3FM8 C;  3RUI B;  4JKH A;  1IP9 A;  2G35 A;  2KQ7 A;  2DX1 A;  1EGX A;  4CHJ A;  2CKH B;  1WX7 A;  4HXD A;  5J3Y A;  2D4Q A;  1GNU A;  4IW0 A;  4KIK B;  2CRF A;  3A9J B;  2PPH A;  2RSG A;  3VTU A;  2KO3 A;  3KRW A;  4II3 B;  1WJU A;  3KRX A;  2L1C A;  1I2H A;  2NPT B;  1UPQ A;  2D3G A;  4MSM B;  2R09 A;  3DPD A;  4KZC A;  1P98 A;  2BF8 B;  1CMX B;  4JIO U;  2MBQ A;  4CO7 A;  4A3P A;  4KVG B;  2M17 A;  4HB0 B;  1E8W A;  2CHZ A;  4HHV A;  2FAZ A;  2IYB A;  3PVL A;  2VRR B;  2LG1 A;  2RUK B;  2M1M A;  3ZTC A;  2P0D A;  2LOX A;  2RGF A;  3R7R A;  2C7H A;  2K6D B;  2NBU A;  1M94 A;  4MGI E;  2GCL A;  2RLO A;  1LFD A;  5KQ4 A;  4OVU A;  3SBG A;  5D3V A;  3PLV A;  1SE9 A;  1TTN A;  2W2X D;  2KTF A;  2LGY A;  2JZ3 B;  4HJK A;  4IWP A;  3QX1 A;  1XKE A;  5FR6 A;  2KDI A;  4ILJ A;  3PRE A;  1U5G A;  1WJ6 A;  4DDI D;  2QKL A;  3ECI A;  3L10 B;  4JKB A;  2MSE D;  1OQY A;  2BYF A;  2X18 A;  2ZCB A;  1IYF A;  2FJL A;  1OEY J;  2HJ8 A;  5IA7 A;  3IBE A;  3VUX A;  2P0F A;  1YJ1 A;  1WXA A;  5J3Q A;  4IUM B;  1PFJ A;  2D11 A;  2ADZ A;  4F1S A;  3WAO A;  2DAJ A;  3L0W B;  1WI1 A;  1M7E A;  4BKG A;  2HRJ A;  3BY4 B;  4KHO A;  5DHA B;  1WGU A;  1V49 A;  2MW5 A;  1KBL A;  2D9Z A;  3DBH I;  3CSF A;  1I7A A;  3DVG X;  4NNJ B;  3ONS A;  2KWU B;  2YS3 A;  1E90 A;  3SHQ A;  2AWT A;  3UZT A;  2FJ9 A;  3APD A;  3FSS A;  1J0G A;  2Y8F A;  2MBH A;  1WMH B;  4NSW A;  3W1S A;  3QC8 B;  4FN2 A;  1L7Y A;  3LJU X;  4HB3 B;  5CHF A;  2O2V B;  2CR5 A;  3A8P A;  2C9W B;  4PS3 A;  5DPS A;  2HE7 A;  4ZRJ A;  5JHA A;  4HCP B;  2KGX B;  3FP5 A;  4DBG A;  4KV2 A;  1WH3 A;  2L00 B;  1EO6 A;  4GDL B;  2Y5B B;  5E6N A;  1UZX B;  3DBL I;  1QC6 A;  2MA9 B;  2D9Y A;  2D9X A;  1Z2M A;  5CTR C;  3C0R B;  4ANV A;  3VQI A;  4EZJ A;  1WGY A;  2PJH A;  2KLC A;  1LQB A;  4LDT D;  2DKP A;  2DIK A;  2LZ6 A;  5DCN A;  4CYE A;  2CU1 A;  2DHZ A;  3TBL D;  5L83 A;  2QKM A;  3VIA A;  4EFO A;  1WR1 A;  1WXV A;  1KM7 A;  2D10 A;  5C5B B;  1JDE A;  3APC A;  5DPW A;  3CXB B;  3E9L A;  4G0N B;  3U30 A;  4WWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...