3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
4XC2A 1MK7B 1HE8A 4BOSC 1XD4A 3KUCB 4PYUA 4BKSA 3L13A 1LQBA 2K00A 1FAOA 1Z5SB 1NVLA 3UIPB 1Y5OA 3PGEA 1X86A 2KK8A 2RLOA 3UZTA 1Y8RC 1GJZA 3L17A 3RCPA 5JH5C 1AQCA 3HW2B 3NSUA 3N7CA 1GUAB 1UBQA 3VH4B 5KQ1A 1NI2A 1UNPA 2KVRA 1KJTA 2KJHB 4HB4B 2I5FA 5AZGA 5CHWA 1YIWA 2D3GA 2YS5A 3VH3B 1Y19B 2BCJA 1ZGUB 3HQCA 2L3ZA 1UZXB 4DHJB 1YJ1A 3LDZE 1KZ7A 1WGQA 4KSKC 3V60A 2KD0A 2YT0A 3HM3A 4LJOB 3SU8X 2LVQA 1XQQA 2N4FA 3PHWB 2KJRA 3PP2A 2GBKA 3F5RA 3CIKA 3PV1A 3VDZA 4WWPA 3WA0A 3MJWA 3QARA 5D3YA 1BTNA 3B1LX 1H10A 4ZRIA 4CHKA 4WJNA 3WYFB 2KZRA 2KDBA 1BTKA 2CY5A 1E7VA 4DXAB 2KX3A 2IY0B 2NS5A 2DN6A 2MP2A 3H6NA 2LYDA 1LXDA 2MCNB 4NQKE 1UPQA 2RD0A 4AJWA 2P0HA 4YONA 4FA6A 2DKPA 3TW1A 3VFKA 1WJ4A 3CF6E 2N7EA 2D11A 2REXA 2PE9A 1OMWA 2Y7BA 1RAXA 3PRMB 2CHZA 1WI0A 2COFA 4OVVA 4KDIC 3K9OB 2P0DA 3PTFC 1WMHA 1LFDA 1BT0A 2WDTB 1W1GA 4HB0B 4EKUA 5D94A 5G55A 3HHMA 1OQYA 1PQSA 1E7UA 2J0MA 3RZFA 1J0WA 2MBHA 2ZPYA 3ZRCA 2NMBA 5E6NA 1TZ1A 2I1KA 3OJ3A 2ZNVC 3KW5B 4MSMB 4IOYX 1SIFA 2ROVA 2CU1A 2N0YA 3A4RA 1WGUA 3D32A 3QK0A 1DYNA 1PFJA 2KFJA 4NAWB 4M8NA 2BGFA 2DZKA 2LBBA 1OTRB 2UVMA 2G3QB 3KVFB 4BVUC 3IG3A 2KMAA 1V81A 1Q5WB 3NZSA 4NNJB 2VKIA 1WVHA 3A9KB 4KIKA 2KHWB 4WVFB 3CXBB 3OAWA 4IW0A 4FULA 4PS3A 5LOPB 3SO6A 3UQBA 2DHKA 4ZRJA 5D3VA 5G2NA 3QHTA 2JT4B 2KTRB 4PYZA 4HDQA 4KVGB 2L05A 3DVGY 3MPXA 2MBBB 2FAZA 4MJSB 1D3ZA 2ZZPB 2LG1A 2KDEB 4RM9A 2G35A 2ELAA 3ZO5B 1ACAA 3ECIA 3DBRI 3AULA 3NY5A 1WYWB 4HJKA 2GS0A 3KRWA 1B55A 5L95C 3A1QB 4BKSD 3WANA 4GSWA 2KC1A 3L10B 2WX1A 2Y5BB 2LOZA 5AZFA 3AU5A 2AWTA 3ZUNA 1M7RA 5D6JB 2DAJA 2LRWA 4HVBA 4MGKE 3L54A 4L6EA 3PZDA 3HK0A 4RM8A 1U4AA 3ODOA 1U2BA 4F7GA 2I1JA 1V80A 2RVBB 2C7NB 4FN2A 2K8HA 2IO1B 2LVPA 1XD3B 1UD7A 1SGHA 4W9JA 3KYDD 4ANXA 4K81A 1FHWA 4LDTB 3DDCB 3DCGA 2BYEA 2G4SA 3B0AA 1WGHA 3AU4A 2JRHA 2J0JA 1UEFA 4HCPB 5DPTA 4F8CB 5EDSA 3Q3FA 5HE1A 2CR5A 1TXDA 3HM6X 1V5MA 3ZKJC 2C7MB 1TBEA 2Q13A 1NTIA 2N9EB 5DPSA 3NS8A 4Y94A 3L16A 1J8CA 1OQNA 4KHBB 2PZ1A 2O2VA 4BKGA 4AWJA 1E8YA 3WALA 4ASWC 4YL8A 2IBIB 2K1FA 3TO1A 2DTCA 3IBEA 3PLUA 4JQWC 5CX3A 5J3TA 5CHFA 3SHQA 2Z0DB 2R0DA 4MEMA 3DVGX 3ZRFA 4WJPA 5C5BA 3ODWA 4GDKA 2CODA 3ML8A 5KCVA 5C6RA 2WWZA 3A98B 2K8CA 2IO0B 4TYZA 4W9HA 1ST7A 1YD8U 3H7SA 2D9ZA 3L0WB 2W2XC 2UYZB 2GCJA 5CHVC 4MGIE 2MX2A 5D7GA 5EFXA 2C5LC 1V2YA 4K17A 2NPTA 5KHOA 2CAYA 4GDLB 4Z2MB 1FGZA 4B95A 2ZVNA 4II2B 2G45B 3ZNZB 1UNRA 1R4MI 2YS3A 3ZNGC 3SNHA 2IY1B 3RT3B 4IM3A 4WQOB 2D9VA 1QZEA 2N1WA 3R7RA 4BFRA 1WXSA 4HXDA 2Z0PA 4GXBA 4EEWA 5D3XA 4BOZB 4HAVB 2KKCA 3JYUA 3ZTCA 1NTVA 2KLCA 2A5UA 2VRRB 2R09A 2DX5B 2FIFA 4NQLB 2L0FA 5D27A 3KYCD 4GPTB 3RCZA 2LOXA 3A8QA 3ZDMC 2DKQA 3PEGA 1V5PA 3UIOB 3V61A 2IFSA 4KZCA 2WX0A 4URKA 2DHIA 3DQVA 2L00B 1ZC4B 4PS8A 2LASA 3OLMD 1WJNA 2KNBA 4KDLB 3VUWA 4ZDVA 2M14A 2V76A 2DZJA 1GNUA 4K7WA 2WYQA 2PEAA 1X1FA 1U27A 2M4NA 3VTVA 2DYNA 5HKHA 2Z0QA 4FLHA 4GMVA 4G3XB 4BBNF 2DX1A 4P7IA 1UBIA 2KOXA 2FNJB 2D07B 2JZZA 3KY9A 4FHKA 1EF1A 2DYBA 1WR1A 4DBGA 3TFMA 5C23A 2LI5A 4FJZA 4IM2A 1V6EA 4K7UA 4HAWB 2UZSA 2D9YA 1WR6E 3VXWA 3T8MA 4H8SA 2JY6A 4EMOA 3DPDA 2GCLA 3EHVA 4K7SA 2UZRA 5DIFB 1Z2MA 1GG3A 3QBVB 1WX7A 4AP4C 2NBWB 3PT2B 3QA8A 4WWOA 2EC1A 4W9EA 3TVVA 1EO6A 2KUPA 4KHAA 4PS7A 5HE3A 3PSCA 3QWZB 3R66C 3ZLZA 4Z2NA 4HB3B 5HE2A 4GZUA 3VTUA 2YS1A 3SV1A 3DOWA 1L7YA 3AXCA 4LCDE 1U5GA 2BWES 5C79A 5FI1A 2BPSA 1LM8B 4ANWA 4RMAA 4BBKA 2X18A 4EZJA 2ZCBA 5C16A 1WJMA 3PVWA 3F0WA 2I5CA 3TBLD 3P6AA 2M17A 1UH6A 4JLCA 4PQ0A 1UNQA 1WY8A 2DYQA 4IUMB 4IWPA 2RSGA 1V89A 5GOWB 2BF8B 3ML9A 3O96A 3VUYA 3JSVB 1WI1A 3GZNI 1KZGA 2FCMA 3V62A 3KSYA 3RZWC 3RUIB 2JWZA 2LXAA 3M62B 2KQSA 2W2WA 3FSSA 3N30A 2RUKB 2Z0EB 1HB8A 4A6FA 3GOEA 2EMTA 1FHOA 3TMPB 3PPAA 1PMSA 2C60A 2K25A 4TQ0A 3ALBA 3QX1A 3WAPA 5CTRC 4I6NB 2GBJA 3G9WA 2LKOA 1TTNA 2CB8A 1V5OA 1J0GA 2GBNA 1XX0A 3QC8B 2PE6B 2DA0A 4W9FA 5LXHA 3SUZA 2K2JA 1NDDA 1M94A 5E6OA 2KLGA 3JVZX 3VQIA 5AZHA 4ZRKA 1XT9B 4FHJA 1ZSQA 2N1VA 1VCBA 1WGYA 1P1AA 1K5DB 4EZKA 3DBLI 5IAAC 2MP2B 2DHZA 1OEYA 2O6VA 1WE6A 2DYOA 4LJPB 4DDGD 2LGDA 2L8JA 3QAQA 2NBUA 2HTHB 1NU2A 2M8SA 2IYDB 2QHOA 1U5DA 3QQ8B 2YLMA 4CO7A 3W1SC 1YQBA 4BBNC 5E6PA 3NHEB 4A6HA 4ICVA 4F7UP 4DX8A 3N32A 2N9XA 2LULA 4EFOA 3CSTA 1WZ0A 4DHJD 2Y8GA 3P2BA 3NOBA 1I7AA 3H7PB 3N3KB 2MA9B 1WM3A 2GMIC 2ABDA 1WMHB 2LUEA 2CQUA 1S1QB 2MDXA 1UELA 1S3SG 1V49A 1EUVB 4MELA 3VUXA 1NBFC 1WXAA 4DDID 3ULBA 3VTWA 2LD9A 3PVUA 3ZDTA 3WAOA 3EPYA 2DAFA 4MY6A 4X57B 1R4NI 1TGZB 2XK5B 1SE9A 4HLEA 1Z87A 3DBHI 5J17A 3SYXA 1E8XA 3ZVVA 1DBHA 2ASQA 2V4LA 1QQGA 2KMCA 2FUHB 1I2HA 2NVUI 3FEHA 2WH5A 2N7DA 1ZM0A 3QCAA 3KZ1A 1RJ2A 4KIKB 2ZJDA 5L81A 3UQAA 1IP9A 2RQ1A 2K2UA 4HHVA 1EF5A 1N3HA 3MHSD 2DZIA 4TQ1A 2L2IA 4TV3A 3PVLA 1IRSA 5J3QA 4XX5A 3T06A 2NR2A 3ZNHB 4FBJB 4F1SA 2N9PC 4DHZE 4E3CA 4I6LB 4FJYA 1HBKA 3DXCA 1YX5B 5GMVA 3EC8A 1Q0WB 1AWEA 1KOTA 2JF5A 1P5TA 1WE7A 2E2XA 2FCNA 4HK2A 4IWQA 1XR0B 1FXTB 3X0WA 4WJOA 4M0WB 1WG7A 3TJPA 2GBMA 2C7HA 4A3OA 3VVWB 4MH0E 2FCSA 4HB2B 4D0NB 2FDQA 4B6WA 4IM0A 2DFKA 4E74A 2LZ6A 4IFSA 1U5FA 5FR6A 3DVNV 1E8WA 3M1IB 5JHAA 2JUOA 2HJ8A 2JXXA 3RYTA 4WJ7A 4WJQA 2FIDA 3ZW3A 1MIXA 4A6KA 2GOWA 5J2RA 3A9JB 3DBSA 1LB1A 4M8MA 1WGRA 3X23A 1H4RA 3IHPC 5JHBA 1BWNA 4A20A 3GYPA 3ONSA 4A3PA 2ELBA 4NPNA 2RR9A 2DZMA 2MLBA 2KO3A 1UGMA 4MGYE 3FP5A 3KH0A 3NZUA 2KWUB 4W9IA 1MIZB 1KM7A 1X05A 4G11A 2RPQA 2L1CA 2Y8FA 2DLWA 2GJYA 1C1YB 2DYMA 1BAKA 3O65B 3TCAA 4K1RB 3PRPB 4KZ0A 1YX6B 1V61A 1SHCA 3U7DA 2K6DB 2JRIB 1WX8A 2KXJA 2O6VD 4JIOU 1I35A 4GDKB 3DVNU 4EOYA 4KV2A 4TUUA 3UF8A 1W1DA 1AARA 1P98A 2K8BA 3UGBB 2FJ9A 4A5KA 3M63B 3TIXA 4DWFA 2LXCA 1ZW7A 2MBEA 5TR5A 2ZCCA 2NZ8B 3QIJA 3SD5A 2KANA 4W9KA 4BKTA 2KWVB 1EGXA 3BY4B 4W9DA 4PNKA 2FJLA 2DENB 1XKEA 2EMSA 4GU2A 2KC2A 3VAWA 3PRZA 1I42A 1U29A 1RFAA 4W9LA 1MKEA 1LW3A 1F9JA 4HAYB 3H9DA 3WIMA 1XCGA 3GYOA 4XWXA 1Q67A 5DH9B 3JSVA 3ML4A 2PPHA 1OY2A 2J7QB 3VOQA 5IJMA 4HAZB 2IO2B 4GIVA 1DROA 3BINA 2LGXA 1TJ6A 1A5RA 5DHAB 1ISNA 2BKRB 2UWQA 2D9WA 2EKEC 2Z59B 4II3B 3CMMB 1P3QU 4GGQA 1RLFA 2MQJA 2ZEQA 1P6SA 2N23A 2KFKB 3K9PB 2A4ZA 2QKLA 1E5WA 3ENEA 2RGFA 4KHOA 2L76A 3JW0X 2OQBA 2KX0A 2D9XA 2IYBA 2KCJA 3T9LA 2P0FA 3L08A 4K2OA 3HIZA 4NAWA 3V6CB 5JP4A 2HRJA 2M1MA 2AL3A 2MBOA 3WAMA 4WWNA 3Q3JA 1G6JA 5FI0A 3FLVA 3CSFA 3DXEA 2BKFA 3ZVRA 4CHJA 3A9KA 4EZLA 3LJUX 4W9CA 5JZEB 2BWFA 2D4QA 2HTHA 2D10A 2MWNB 3PG7A 3KUDB 2KTRA 3U8ZA 5DI9B 1EAZA 2W2XD 1WJUA 4G0NB 2KQ7A 3PHXB 5CLLB 2MFQA 2G4DB 3SDLC 5LONB 2C9WB 3EFUA 2K6QA 4MJSA 1NTYA 4HAXB 2LGYA 3H7PA 2COPA 2MSED 4GMXB 2P8VA 4F7ZA 2BYVE 1X1MA 1FOEA 2CHWA 3UINB 3A33B 3DXDA 4B9KA 3I3TB 3A1QA 1MAIA 2H7DA 1U5EA 2ROZB 2L0TA 5DCNA 5JLJB 4F7HA 4HWIB 1RRPB 4HPMB 4MSQB 3MTNB 3QJZA 3C0RB 1TQZA 4MT7A 4CYEA 2CY4A 2R2OA 2XK5A 1T0YA 4G50A 4DBBA 1QC6A 2KJ6A 1K5GB 1XODA 2YT1A 2RSUA 4EUTA 2OOBB 2KGXB 1WF9A 3W1SA 1WM2A 1WXMA 3APDA 2Z0OA 4NSWA 1ZC3B 3FM8C 4HAUB 3AI5A 2YF0A 4B6HA 2CRFA 1WIAA 1FGYA 5IA7A 4MDKE 4ZYNA 3A8PA 1WXVA 1P9DU 3H1UA 3PLVA 4A6FB 2YRYA 5D3WA 3ZTDA 2KWCA 2MBQA 1KI1B 5BO4B 1WH3A 1J19A 4MK0A 4N9F4 2CKHB 2LRUA 2COCA 4K2PA 2XQNM 2ZNVB 1V88A 3ULCA 4NY0A 4ANUA 3BJIA 2YSZA 4CHMA 3APCA 5DHFB 4ICUA 3EECA 4IC7B 2H7EA 2VRWB 5CLQB 3M95A 2KN5A 4MGZE 4HDOA 1KLVA 2QKMA 2XBBC 1IYFA 4J6IA 2ZVOA 4JGHB 1WFYA 2JVCA 3R3MA 3PREA 3LJ3A 4DHZB 2DHJA 5AEKB 2RNRB 4IG7B 4NJ6A 2MW5A 2O6VB 3IVFA 4WSFA 2KDFB 3D8EA 1OEYJ 4AOFA 5KHQA 2NBVB 3S2AA 1GC7A 1V5TA 4GDLA 4DK5A 5LLIA 1DDMA 3A9JA 2PJHA 2M38A 2J59M 2LJ5A 2KTFA 2JPHA 2NCNA 4MM3A 4GB9A 2BYFA 1W1HA 2OJRA 4HATB 5L83A 5JHGA 1CMXB 1X11A 2LVOA 1M7EA 2D2QA 4FADA 1MPHA 4WAAA 2AL6A 1P0RA 4EJNA 2DX5A 3V5WA 4AUQC 1K8RB 4XZ4A 3KUZA 4E71A 1WZ3A 2MKRA 2ZPNA 4JL9A 3D8FA 1WRDB 3APFA 3ODXA 2EJ8A 2XEWA 2W9NA 4GOCA 5J3YA 4DX90 4IAPA 1UPRA 1P3RA 2CHXA 3VIAA 5LXIB 2K39A 2M0XA 2HD5B 3D8DA 1IPGA 4AJYB 2J0KA 4TKNA 3A4SC 2AYOB 5JHHA 4OVUA 3P7ZA 4HPLB 1EVHA 2FCQA 1GC6A 4ANVA 1FHXA 1FB8A 1WGDA 1WJ1A 3KRXA 1E90A 1V86A 4KAXB 3B08A 3ZNID 3W1YA 2MRPA 4C0AA 3AJ4A 1Q1OA 1V9JA 1C3TA 2AEHA 1PLSA 3R7QA 3RULA 3RD2A 5J18A 2V3SA 3PSEB 2IO3B 2CS4A 3OJ4B 3TL5A 2B3AA 4HCNB 3MDBC 3QWMA 2O2VB 5KQ4A 1JRUA 5D2MB 5DPRA 2JZ3B 2HE7A 1OGWA 2L7RA 1MK9B 1RRBA 1H8CA 2OTXA 2YVCA 5C1ZA 3IFWB 5DPWA 1V5UA 3ZIMA 4GN1A 4IWOA 3VHTC 1HB6A 2VSZA 5C5BB 2MWSB 1X1GA 1L2NA 1WGGA 4W9GA 4LDTD 2LWPA 3V6EB 1WJ6A 1DDWA 1VD2A 1MG8A 2JP2A 2IZVB 2GBRA 2COAA 4FJVB 4NJ7A 4I6PA 5HE0A 2R2QA 2V1YA 3M3JA 3U30A 2RGNB 2NPTB 1ZVRA 2KDIA 2KFKA 2ADZA 1WX9A 3PS6A 1DDVA 3OANA 1E8ZA 4KSLC 1ZKHA
chains in the Genus database with same CATH superfamily
5AUIA 2ICIA 4XC2A 4HKQA 1MK7B 1L6VA 4A8XC 1HE8A 4BOSC 5D3DA 1XD4A 2DIKA 3KUCB 4PYUA 4BKSA 4RH6A 4JKFA 3L13A 4JKGA 1LQBA 2K00A 1FAOA 1Z5SB 1NVLA 3UIPB 1Y5OA 1N62A 3NVWA 3PGEA 1X86A 2KK8A 4JWSC 2RLOA 3B77A 3UZTA 5I2SA 4RGNA 1D4BA 1Y8RC 1GJZA 3L17A 3RCPA 2QEJC 5BYSA 5JH5C 1AQCA 3HW2B 3NSUA 3N7CA 1JCKB 1GUAB 2X38A 3Q8EA 1SE3A 1ZDVA 1IBXA 1UBQA 3EGRA 4HROA 4YSYB 4KKJA 3VH4B 4ZYSA 5KQ1A 1NI2A 1UNPA 1KFYB 2KVRA 3PZ7A 1KJTA 2KJHB 5EE0A 4HB4B 2I5FA 1QKZA 1QOGA 3L4PA 5AZGA 5CHWA 1YIWA 1AW7A 2D3GA 2YS5A 3VH3B 4LLGM 1Y19B 2BCJA 1MHHE 3Q8CA 2JSVX 1ZGUB 1XLNA 3HQCA 2L3ZA 4A90A 3AE7B 1UZXB 4DHJB 3NJTA 1YJ1A 3LDZE 1KZ7A 1WGQA 4B0EA 4KSKC 3V60A 2KD0A 1NENB 2YT0A 3HM3A 4LJOB 1FM0D 3SU8X 2LVQA 1XQQA 1L5PA 2RDGA 1NEKB 3AEDB 2N4FA 3PHWB 2INNE 2JU6X 2KJRA 3PP2A 2GBKA 3F5RA 3EUB2 3CIKA 3PV1A 1TYGB 3VDZA 4WWPA 3WA0A 2QSDA 3MJWA 3QARA 3LB8C 5D3YA 3MC8A 1BTNA 3R2IA 3B1LX 4XYCA 1H10A 1L4DB 4ZRIA 4CHKA 1QT9A 5EE1A 4WJNA 1JROA 3WYFB 1D5MC 2KZRA 2KDBA 1YMHE 1BTKA 2CY5A 1E7VA 4DXAB 2KX3A 1QLBB 2JYTA 2IY0B 2NS5A 2DN6A 3AEFB 2MP2A 3BYTB 3E66A 1YJIA 2KWDA 1T0SC 3H6NA 4ITKA 4HEA1 2LYDA 1LXDA 4C80A 2MCNB 4NQKE 2NTTA 1YQ3B 1PGBA 3RNGC 2B76B 2SAKA 1UPQA 2RD0A 2I38A 4AJWA 3BYYB 2P0HA 2KR0A 4YONA 4FA6A 3U7ZA 3RNAC 2DKPA 3TW1A 3VFKA 1WJ4A 3HIEA 3CF6E 4ILHA 2N7EA 1XLQA 2D11A 3VR9B 1AYFA 2REXA 2PE9A 4MACA 3T3OA 1OMWA 2Y7BA 1BMLC 1RAXA 5BMIA 3PRMB 2CHZA 1KF6B 1V1PA 1WI0A 2E6XA 2COFA 4OVVA 4KDIC 3K9OB 1CJEA 2P0DA 3PTFC 1JWAD 1WMHA 1LFDA 1WXQA 1BT0A 2WDTB 3RNFC 2QCZA 1W1GA 4HB0B 4EKUA 5D94A 5G55A 3HHMA 1OQYA 3I63C 4PK1A 1PQSA 3HVZA 1E7UA 3O13A 1JMLA 2J0MA 3RZFA 4ZRPA 1J0WA 2MBHA 2ZPYA 3ZRCA 2NMBA 3P4QB 5E6NA 1TZ1A 2I1KA 3OJ3A 1K50A 1TKYA 2ZNVC 3KW5B 4MSMB 4IOYX 4RFBA 1SIFA 2ROVA 2CU1A 2N0YA 2PIAA 3A4RA 1WGUA 3D32A 3QK0A 2IGDA 3NS1A 1DYNA 1M4VA 1PFJA 2KFJA 4NAWB 4M8NA 2BGFA 2DZKA 1KTKA 2LBBA 1OTRB 2UVMA 1P7FA 2G3QB 3KVFB 4BVUC 1SJHD 3CWIA 4RF1A 3IG3A 2KMAA 1V81A 1Q5WB 3NZSA 4NNJB 2VKIA 2X0SA 4FXCA 1FXIA 2W3RA 1WVHA 2YEPF 3A9KB 4KIKA 4YTNB 2KHWB 4WVFB 2QC8A 3CXBB 3OAWA 4XWTA 4BZAA 2W82A 3BIID 4IW0A 4FULA 4PS3A 4M00A 1DIKA 5LOPB 3SO6A 2NBVA 3UQBA 2DHKA 4ZRJA 5D3VA 5G2NA 3QHTA 2JT4B 2KTRB 1VZ7A 3ZJVA 1YNTE 4PYZA 4HDQA 4KVGB 2L05A 3BVZA 3DVGY 4LNNA 3MPXA 3AEEB 2MBBB 1TY2A 2VZKB 1E9MA 2Z13A 2FAZA 5IP4D 1TIFA 3FVCA 4MJSB 1D3ZA 2ZZPB 5I4DA 2LG1A 2KDEB 4RM9A 2BB5A 2BQQA 2G35A 2WXRA 2ELAA 3ZO5B 4QJ4B 1ACAA 3ECIA 3DBRI 4A55A 3AULA 3NY5A 3SFEB 2KQ4X 1WYWB 4HJKA 2GS0A 3KRWA 3TEXA 1B55A 5L95C 3A1QB 4XWWA 1GGOA 2WDRB 1C78A 1TKEA 2KC1A 4GSWA 5AUKA 3WANA 1TS5A 2N7JA 3L10B 4BKSD 2WX1A 2Y5BB 4ZHOA 4HRSA 2LOZA 5AZFA 3RFZB 3AU5A 2AWTA 3ZUNA 4L23A 1M7RA 5D6JB 3B2FA 2DAJA 4KKIA 2LRWA 4AQ7A 4HVBA 4MGKE 3L54A 4L6EA 3PZDA 2JX5A 3HK0A 4RM8A 1U4AA 3ODOA 1U2BA 1MI0A 4F7GA 5JVLA 4N58A 4ILJA 4OVZA 2I1JA 1V80A 4O1NA 1XLPA 2RVBB 2C7NB 4FN2A 2K8HA 2IO1B 2LVPA 4OZCA 1XD3B 1UD7A 3FAHA 1SGHA 4W9JA 3U12A 3KYDD 4ANXA 4K81A 1FHWA 1QOAA 4JWUC 4LDTB 3DDCB 3DCGA 2BYEA 2G4SA 3B0AA 2IGGA 1WGHA 2KDMA 3AU4A 2JRHA 2J0JA 1UEFA 4HCPB 5DPTA 3Q6BA 4F8CB 5EDSA 1VDVA 3Q3FA 5HE1A 2CR5A 4KGRA 1TXDA 2OHFA 1RFKA 3HM6X 4OZAA 1V5MA 3KWLA 5IO9A 3ZKJC 1R7SA 2C7MB 2LGIA 3AV8A 1TBEA 1V8CA 2Q13A 4DXFA 1NTIA 2N9EB 5DPSA 1QOBA 3NS8A 4Y94A 1YN3A 3MC9A 4D6WA 5D3IB 3L16A 1J8CA 3ZGZA 1ACCA 1D5XC 3FILB 1OQNA 4KHBB 2PZ1A 2O2VA 4BKGA 1ZPSA 4AWJA 1E8YA 3WALA 4ASWC 2GLSA 2G1EA 4YL8A 2BT6A 2IBIB 5IKCM 2K1FA 3TO1A 2DTCA 3IBEA 3PLUA 4JQWC 5H92C 5CX3A 5J3TA 5CHFA 3SHQA 2Z0DB 2R0DA 4MEMA 1FIQA 4BAXA 3DVGX 3TSSA 3ZRFA 4WJPA 2V3PA 5C5BA 4IDIA 3ODWA 2M0AA 2PKOA 5FK9C 4GDKA 1FCCC 1J7BA 1CK1A 1JWMD 2CODA 3NWAA 1DGJA 5KCVA 3ML8A 4JK7A 5C6RA 2INPE 2WXMA 2RMMA 2WWZA 3A98B 2K8CA 2IO0B 1C4AA 4TYZA 4W9HA 1ST7A 1YD8U 3H7SA 2D9ZA 4HJGE 4RCOA 3L0WB 2W2XC 2UYZB 2GCJA 3EFCA 2CJNA 3VR8B 2PLPA 5LNK1 4RGOS 1VZ8A 5CHVC 4MGIE 2MX2A 2ZKMX 3DBLB 5D7GA 5EFXA 2C5LC 2JXTA 1V2YA 1FNUA 4K17A 3Q14C 2NPTA 5KHOA 3BK1A 1RWSA 2CAYA 4GDLB 4Z2MB 1FGZA 4B95A 2ZVNA 4II2B 4L1BA 2G45B 3ZNZB 1SJED 2RRFA 2GB1A 1XLOA 1UNRA 1R4MI 1P7EA 2WXIA 2YS3A 3ZNGC 3SNHA 2IY1B 2MEKA 2J52A 3RT3B 3H8HA 1KC7A 4IM3A 4N59A 4WQOB 2D9VA 1F52A 1QZEA 1FD6A 2N1WA 3R7RA 4BFRA 1WXSA 4HXDA 3FKYA 2KT7A 2Z0PA 3NZ3A 4GXBA 4EEWA 2ACZB 5D3XA 4BOZB 4HAVB 4LNKA 2KKCA 3JYUA 3ZTCA 3N1XC 1NTVA 3OG5A 4DXGA 2KLCA 3DBRB 2A5UA 2VRRB 2R09A 2DX5B 2FIFA 4NQLB 2L0FA 5D27A 1GB4A 3KYCD 1AWDA 4GPTB 3RCZA 2LOXA 3A8QA 3ZDMC 2DKQA 4PT5A 5EE9A 3PEGA 2FBWB 1V5PA 2GRIA 3UIOB 3V61A 2IFSA 4KZCA 3HRDD 2WX0A 2WXKA 3AEBB 2RDBC 4URKA 2DHIA 3DQVA 2L00B 3ZYYX 1ZC4B 4PS8A 3MHZA 2LASA 3OLMD 1IGDA 1F77A 1WJNA 2KNBA 4KDLB 3VUWA 1R4NB 4ZDVA 1FEHA 2M14A 2MJDA 2V76A 2DZJA 1GNUA 3KQ4A 4K7WA 3OWEB 4CQNA 2WYQA 2PEAA 1FXAA 1X1FA 2YT2A 1U27A 1JALA 2M4NA 3VTVA 4RGMA 4LNIA 2DYNA 5HKHA 2Z0QA 4ARCA 4FLHA 1L6UA 4GMVA 1L0VB 3AN1A 4G3XB 4BBNF 2DX1A 4P7IA 1UBIA 2KOXA 1I4QA 2LFIA 2D5GA 2FNJB 2D07B 1PGAA 2JZZA 3SFDB 3KY9A 1SBBB 3TEZA 4FHKA 4YWGG 2QJLA 1EF1A 2DYBA 1WR1A 2HTME 4DBGA 1SE4A 4N6EB 3TFMA 5C23A 2LI5A 1B1ZA 1DOIA 2YEPB 4H2AA 1I4PA 3PZ8A 1I4GA 4RGTA 3PO0A 3ZJUA 3I5JC 4FJZA 1LGRA 4IM2A 1V6EA 4K7UA 4HAWB 2UZSA 3HVDA 2D9YA 5H8YE 2WXOA 5TSSA 1WR6E 2WDVB 3VXWA 1NI3A 3T8MA 4H8SA 2JY6A 4EMOA 3DPDA 3P4RB 4UDUC 2GCLA 3EHVA 4K7SA 2UZRA 3IXSA 1RYJA 5DIFB 1Z2MA 1GG3A 3QBVB 3P42A 1WX7A 1N60A 4AP4C 1KRHA 2NBWB 4JKAA 4JX1C 3EA6A 3NVVA 3PT2B 3QA8A 4WWOA 5EE3A 2EC1A 4W9EA 3TVVA 4XGAB 4QAYA 3ENBA 3NWDA 1EO6A 2KUPA 4KHAA 4QJ5B 4PS7A 5HE3A 3PSCA 3A58A 1F1HA 2WU5B 3QWZB 3R66C 3ZLZA 4Z2NA 4HB3B 1T0RC 5HE2A 4GZUA 3RPFC 3VTUA 2W54A 2YS1A 3NRZA 4LNFA 3SV1A 3W5UB 4JK8A 3DOWA 2J53A 2ZW0A 1L7YA 2WXGA 3AXCA 4LCDE 3N1ZC 1U5GA 3NVZA 2BWES 1TZOA 5C79A 5FI1A 3DCXA 4M02A 2BPSA 1LM8B 4ANWA 4RMAA 4BBKA 2BYTA 5FKAC 4QJ3B 2X18A 4C4VB 2BB6A 1C4CA 4EZJA 2ZCBA 5C16A 2RPVA 1WJMA 3PVWA 2IJ0A 4JKHA 3F0WA 2PVOD 2I5CA 1R4MB 3AH7A 3P6AA 5HHDG 3TBLD 2M17A 1JWBD 5G5HA 1UH6A 2K22A 2WDQB 4JLCA 4PQ0A 3AE5B 2WXJA 1UNQA 1STEA 1WY8A 2DYQA 1N61A 4IUMB 4IWPA 1PUTA 2RSGA 1V89A 5GOWB 1FCLA 2BF8B 3ML9A 2R2YA 2Y3AA 3O96A 3VUYA 3JSVB 1VBHA 2ONQA 1WI1A 3GZNI 1KZGA 1TJEA 2KUQA 4NJCA 4YTMB 2FCMA 2PMVA 3ZXRA 4C00A 3V62A 3KSYA 3RZWC 1K51A 3RUIB 2JWZA 2LXAA 5T8IA 1MFWA 4OHJA 2WLBA 2E3TA 3M62B 2KQSA 2W2WA 3FSSA 1KBLA 3N30A 2RUKB 2Z0EB 1HB8A 4A6FA 3AEGB 3GOEA 2XN9C 2EMTA 1FHOA 3TMPB 2MJEA 3PPAA 1PMSA 2C60A 4KGSA 2K25A 2MJ3A 3AMZA 4TQ0A 4ZRQA 3VRBB 3ALBA 3QX1A 3WAPA 4C7YA 5CTRC 1TY0A 4KGTA 1GPXA 1YQ4B 4OT1A 4I6NB 2GBJA 3G9WA 1ZXIA 2LKOA 1TTNA 2CB8A 1V5OA 2MH7A 1J0GA 2GBNA 1XX0A 3QC8B 1DOXA 1GB1A 4S17A 2PE6B 2K49A 2DA0A 4W9FA 5LXHA 3SUZA 2K2JA 1N5WA 1NDDA 1M94A 4REZA 5E6OA 2KLGA 3JVZX 3VQIA 2LHDA 1WSPA 5AZHA 2W3SA 2Y5PA 1D6EC 4ZRKA 1NVID 1F2RI 1XT9B 1LO5D 4FHJA 1ZSQA 2N1VA 1VCBA 1WGYA 1P1AA 1ZKHA 4IKGA 1K5DB 4EZKA 1I7HA 3Q69A 3DBLI 5IAAC 1C9FA 1MI1A 2JYEA 2MP2B 2DHZA 1OEYA 3U4EG 2O6VA 1WE6A 4QXAB 2DYOA 4LJPB 4DDGD 2LGDA 2L8JA 3QAQA 3LYYA 2NBUA 2HTHB 1NU2A 2M8SA 2IYDB 3VRAB 2QHOA 1UGJA 1U5DA 1SE2A 2YLMA 3QQ8B 2W55A 3AB5A 4CO7A 3W1SC 4USAA 1EU4A 3W9CB 1YQBA 4BBNC 2DBYA 5E6PA 3GS2A 3NHEB 4A6HA 2UU7A 1VRAB 3NUHB 4JKBA 1RM6C 4ICVA 5E6JA 3V05A 4F7UP 1PYWD 4DX8A 3N32A 2N9XA 2LULA 4EFOA 4NAMA 3CSTA 1WZ0A 3DWGC 4DHJD 2Y8GA 2LUMA 3P2BA 3NOBA 1I7AA 3H7PB 2K9XA 4J3OD 1BUIC 3N3KB 3E9PA 5BYRA 2MA9B 3U52E 4GLSC 1C4PA 2KVZA 1FFUA 1WM3A 2GMIC 1N5XA 2ABDA 1WMHB 3RNBC 4KHBA 2LUEA 2CQUA 1S1QB 2MDXA 1UELA 4WWMA 1S3SG 1V49A 1EUVB 4YSZB 4MELA 1MVKA 3VUXA 3SBGA 1NBFC 1WXAA 4DDID 1VBGA 3ULBA 1GOZA 3VTWA 2LD9A 3PVUA 2I2YA 3ZDTA 4WH4A 3WAOA 3EPYA 2GUMA 2DAFA 4MY6A 3TEYA 3T3NA 4X57B 1R4NI 1TGZB 2XK5B 3E9LA 1SE9A 5BMHA 3J9CA 4HLEA 4WQMA 1Z87A 3DBHI 5J17A 4US9A 3SYXA 1E8XA 3ZVVA 2PTLA 1DBHA 2ASQA 2V4LA 1QQGA 2KMCA 2FUHB 1I2HA 2NTSA 2NVUI 3FEHA 2WH5A 1ET9A 2N7DA 1ZM0A 1F2RC 3QCAA 3KZ1A 1RJ2A 2JWUA 4KIKB 2ZJDA 4R3DA 4XE0A 2H88B 1J7CA 5L81A 1MHXA 1QQRA 4P16A 3UQAA 1IP9A 2RQ1A 3IAS1 1K53A 2K2UA 1SF0A 4HHVA 1OQQA 2VH1A 3GZNB 1EF5A 1N3HA 3MHSD 2DZIA 4WURA 4TQ1A 2L2IA 4TV3A 3PVLA 1IRSA 5J3QA 4XX5A 3T06A 2NR2A 3ZNHB 4FBJB 4F1SA 1F0ZA 2N9PC 1YN4A 1ZDXA 1FPYA 5GXGB 1IUEA 1DOYA 1ZP0B 4DHZE 2WXLA 4E3CA 1FNVA 1EWCA 4I6LB 2LHEA 4FJYA 1HBKA 3DXCA 2Z4DA 1YX5B 5GMVA 3DHGC 3EC8A 1Q0WB 4ARIA 1AWEA 1KOTA 1SXTA 1N6ZA 2WU2B 4NZLB 2JF5A 1P5TA 1HQRD 3BVMA 1ROEA 2BW2A 1TS2A 1WE7A 1B9RA 2E2XA 2FCNA 2WGSA 4HK2A 2WXNA 3B9JA 1VZ6A 1KH0A 3KWVA 4IWQA 1XR0B 3TEWA 1FXTB 3ZQ4A 3X0WA 4WJOA 1TS3A 3AE1B 4M0WB 4ZHPA 2BS2B 1WG7A 2V9HA 1CZPA 3TJPA 4HPPA 2GBMA 2VH2A 2M56B 2C7HA 4A3OA 3VVWB 4MH0E 2FCSA 4HB2B 4D0NB 2FDQA 4B6WA 4IM0A 3C19A 2DFKA 4GOUA 2WP9B 4E74A 2LZ6A 4IFSA 2KACA 3AEAB 1U5FA 3AE2B 2EELA 5FR6A 3DVNV 1E8WA 1PGXA 3M1IB 5JHAA 2JUOA 1HTOA 1J7AA 2HJ8A 2JXXA 3URYA 3RYTA 4WJ7A 3AE8B 4WJQA 2FIDA 1ET6A 3ZW3A 1MIXA 4A6KA 2GOWA 2VZKD 3Q8AA 5JXVA 5J2RA 4LK0M 3A9JB 3GE3C 2CU3A 2BBCA 3DBSA 3RMKC 1LB1A 4M8MA 1WGRA 3X23A 1H4RA 2DLBA 3IHPC 4MM3B 5JHBA 1BWNA 3N9YC 1E6EB 3C8YA 4A20A 3GYPA 3BWUD 3P4SB 3ONSA 4A3PA 2ELBA 2Y5CA 4NPNA 2RR9A 4DIXA 2DZMA 2MLBA 1N63A 4HSIA 2KO3A 2ON8A 4KX6B 2MHJA 2XNAC 1UGMA 3I9V1 4MGYE 3FP5A 2V3NA 3KH0A 5IN7A 3NZUA 2KWUB 4W9IA 1MIZB 1EM7A 1KM7A 1X05A 2QMTA 4G11A 2WXFA 2BVCA 2RPQA 2L1CA 2Y8FA 2DLWA 2GJYA 4OSNA 1C1YB 2DYMA 3AE9B 4ILGB 1BAKA 3O65B 3TCAA 4P6VF 4K1RB 3PRPB 4KZ0A 3N20C 1YX6B 1V61A 1SHCA 5I2MA 3U7DA 2K6DB 4WAFA 2JRIB 1WX8A 2KXJA 2O6VD 4JIOU 1XCQL 4JKCA 3MFGA 3DBHB 1I35A 4GDKB 4M01A 3DVNU 4EOYA 4KV2A 4TUUA 2H89B 3V3XA 2J4XA 3E9SA 3UF8A 5IRSA 1W1DA 1AARA 1P98A 2KN4A 2K8BA 3UGBB 2TSSA 4YT0B 2FJ9A 4A5KA 3M63B 3TIXA 4DWFA 2LXCA 2QDFA 1ZW7A 2AQ2B 2DNFA 2MBEA 3ZXVA 1YJJA 5TR5A 1FO4A 4YXDB 2ZCCA 2NZ8B 3QIJA 3SD5A 2KANA 4W9KA 2J42A 1OQRA 5BMGA 3GP7A 2CJOA 4BKTA 5MPOA 2KWVB 1EGXA 3BY4B 4W9DA 1T0QC 4PNKA 2FJLA 1I4HA 2DENB 1XKEA 1L0YB 2EMSA 4GU2A 1K52A 4Q2JA 3Q8BA 2KC2A 3PRZA 3VAWA 1I42A 1U29A 1RFAA 3HSAA 4W9LA 1TT5B 1WRIA 1MKEA 1LW3A 2IPKD 1FRDA 2PW9A 3E56A 1F9JA 3MC0B 3P63A 4HAYB 4HKZE 3H9DA 3WIMA 1XCGA 3GYOA 4XWXA 2IDYA 3Q3OC 1Q67A 4C7ZA 5DH9B 4P1BC 2LGSA 3JSVA 3ML4A 2PPHA 1OY2A 3AE4B 2HJ1A 2J7QB 3CIRB 3VOQA 3B2GA 1AN8A 2N9KA 1EU3A 2WNMA 3BK2A 5IJMA 4ACFA 2HDEA 1HTQA 4HAZB 2IO2B 4GIVA 1DROA 3BINA 2LGXA 3Q3MC 1TJ6A 1A5RA 1IGCA 3KLSX 5DHAB 1ISNA 3P1MA 2BKRB 3SBTA 2UWQA 2D9WA 1UUPA 1MG4A 2EKEC 1TKGA 2Z59B 1QF6A 5HFYA 3BVGA 1D5ZC 4II3B 3CMMB 1P3QU 1T77A 3RNEC 4GGQA 2L32A 1RLFA 2MQJA 1GAQB 2ZEQA 3FC4A 1V97A 1P6SA 2FJUB 1UWXA 2N23A 2KFKB 4P1CC 3K9PB 2A4ZA 3DWMA 1QILA 2QKLA 1E5WA 3ENEA 2RGFA 4KHOA 2L76A 3JW0X 2OQBA 2KX0A 3U2SC 2D9XA 2IYBA 3SEBA 3GE8C 2KCJA 3T9LA 2P0FA 3AECB 2LEKA 3L08A 4K2OA 3HIZA 3NG0A 4JKGB 4NAWA 3V6CB 5JP4A 2HRJA 2M1MA 2AL3A 2MBOA 3WAMA 4WWNA 3Q3JA 1TS4A 5IOIA 2R82A 1WGKA 1G6JA 5FI0A 3FLVA 3CSFA 3DXEA 2BKFA 3ZVRA 4CHJA 1ENFA 3A9KA 4EZLA 3LJUX 4W9CA 2D3AA 1VLBA 2X8XX 4TMAB 5JZEB 2BWFA 2G9HD 1KLUD 4A6QA 2RDHA 3IAM1 2D4QA 2HTHA 2D10A 2MWNB 3PG7A 3KUDB 2KTRA 1A70A 3U8ZA 3Q2AC 1IBXB 1FMAD 5DI9B 1EAZA 2W2XD 1WJUA 3GB1A 1BXTA 4G0NB 4RF0A 2KQ7A 1KLGD 1XO3A 4TSSA 2KYWA 1CQVA 3PHXB 1NYRA 4ZOHC 5CLLB 4JKDA 2MFQA 5HG2A 1ZUD2 3TUOA 2FUG1 2G4DB 2R61A 2V0GA 3SDLC 5LONB 2C9WB 1L0XB 2V4IB 3EFUA 2K6QA 4MJSA 1NTYA 4HAXB 2LGYA 3ETRA 3H7PA 1EWYC 2COPA 2MSED 4GMXB 2P8VA 4F7ZA 2BYVE 1X1MA 1FOEA 2CHWA 4S0RA 3UINB 1Q10A 3A33B 3DXDA 3MJ5A 4LNOA 4B9KA 3I3TB 3A1QA 2OJWA 1MAIA 2H7DA 1U5EA 2ROZB 2WQYB 2L0TA 5DCNA 5JLJB 4F7HA 4HWIB 2K5PA 1RRPB 4HPMB 4MSQB 3MTNB 3QJZA 2JZPA 2WXQA 3C0RB 2KIEA 1TQZA 2BS4B 4MT7A 2BS3B 4CYEA 2CY4A 1YOVB 2R2OA 2XK5A 1T0YA 4G50A 1DYQA 4DBBA 1SEBD 1XEEA 1QC6A 2KJ6A 4JKEA 1K5GB 1JWSD 1XODA 2YT1A 1WYGA 2AQ3B 3IT4B 2RSUA 4IOIE 1FNWA 4EUTA 1QOFA 2OOBB 2KGXB 3NW8A 1WF9A 1Y56A 3W1SA 1JWUD 2AQ1B 1WM2A 1WXMA 3APDA 2Z0OA 4CSQA 4NSWA 4DQOC 1L4ZB 1ZC3B 3FM8C 4HAUB 2K3UA 3AI5A 2YF0A 4B6HA 2CRFA 3NVYA 3AE6B 4A9AA 1WIAA 4YTPB 1FGYA 3DHIC 1I4XA 4GNKB 2KMMA 5C2TB 5IA7A 3R2TA 4MDKE 4ZYNA 3A8PA 1C77A 1WXVA 1P9DU 1E7PB 2AX5A 2K8EA 3H1UA 1V1PB 4K3BA 4EE2A 3PLVA 4A6FB 1JQ4A 1XCTL 2YRYA 3WCQA 1E10A 3FILA 5D3WA 3ZTDA 5G5GA 1NYQA 4L1RA 2KWCA 2MBQA 1OFFA 1KI1B 3IT6B 5BO4B 1WH3A 4RNAA 1J19A 4MK0A 3ABVB 2KAJA 4N9F4 2CKHB 2LRUA 2COCA 4K2PA 2XQNM 2ZNVB 1V88A 3ULCA 4NY0A 4ANUA 1C79A 2IGHA 3AE3B 3N1YC 3BJIA 2YSZA 4CHMA 1C76A 3APCA 4M0WA 5DHFB 4ICUA 3EECA 4IC7B 2L1AA 2H7EA 3BZDB 1I4RA 2VRWB 5CLQB 3E9OA 3M95A 2KN5A 2INDC 4MGZE 4HDOA 2JQRB 1KLVA 2QKMA 2XBBC 1IYFA 5BYQA 4J6IA 2ZVOA 4JGHB 4OZBA 1WFYA 2JVCA 3R3MA 3PREA 3LJ3A 4DHZB 2DHJA 5AEKB 2RNRB 1V1OA 4IG7B 3RNCC 4NJ6A 2MW5A 2O6VB 3IVFA 4WSFA 2KDFB 3D8EA 1OEYJ 4AOFA 5KHQA 2NBVB 3S2AA 1GC7A 1V5TA 1SSNA 2LJIA 4GDLA 4DK5A 2WXPA 1HA5A 5LLIA 4B0MA 2QILA 1DDMA 3Q8FA 1JDEA 3A9JA 2PJHA 2M38A 1HEZE 2J59M 2LJ5A 2KTFA 3P4PB 2D3BA 2JPHA 2NCNA 4MM3A 3MP9A 4GB9A 2BYFA 1W1HA 2OJRA 4MT5A 4HATB 5L83A 5JHGA 1CMXB 1X11A 2N9LA 2LVOA 1M7EA 1VJKA 2D2QA 3W5VB 4FADA 1MPHA 3OHMB 4WAAA 2AL6A 4OW0A 1P0RA 4EJNA 2DX5A 3V5WA 4AUQC 1XXGA 1K8RB 3HUIA 4XZ4A 3KUZA 2EKIA 2OEDA 4E71A 1WZ3A 2MKRA 3UI3A 4AS1A 2ZPNA 4JL9A 3D8FA 1WRDB 5LG4B 3APFA 3ODXA 4K3CA 4LTUA 5C3JB 2EJ8A 2XEWA 2W9NA 4D2KA 4GOCA 2WS3B 2D3CA 5J3YA 4DX90 1ZE3D 4IAPA 5M4YB 5HI1A 1UPRA 1JRPA 1T5XD 2SEBD 1P3RA 2L52A 1UF0A 1HXYD 2N0SB 2CHXA 3VIAA 5LXIB 1YN5A 2K39A 1SB3C 1PFDA 2M0XA 2HD5B 2WHIA 3D8DA 1IPGA 4AJYB 2J0KA 4TKNA 4JE3B 1ZYIA 3A4SC 2AYOB 5JHHA 4OVUA 2KIGA 3P7ZA 4HPLB 1EVHA 4JPSA 2FCQA 1GC6A 4ANVA 1FHXA 1FB8A 3NWFA 1WGDA 4L2YA 1WJ1A 3KRXA 1E90A 1V86A 4KAXB 3B08A 3ZNID 2ZW1A 4XDDA 3W1YA 2MRPA 1VR9A 4JK9A 4C0AA 3AJ4A 1Q1OA 2L83A 1ZXHA 1V9JA 1WWTA 1C3TA 2AEHA 1PLSA 3R7QA 3RULA 3RD2A 5J18A 1T6BX 2V3SA 3PSEB 2IO3B 1T3QA 2CS4A 3OJ4B 1HZ6A 3Q3NC 1E0ZA 1MJDA 3I57A 3TL5A 2B3AA 4HCNB 3MDBC 3QWMA 2QIEB 2O2VB 5KQ4A 1JRUA 5D2MB 5DPRA 1UNSA 2JZ3B 2HE7A 1OGWA 3LXFA 2L7RA 1MK9B 1RRBA 1HZ5A 4YSXB 1H8CA 3SR6A 2OTXA 2YVCA 5C1ZA 1MPEA 2Z8LA 3IFWB 5DPWA 1PDXA 1V5UA 3RN9C 3ZIMA 4GN1A 4IWOA 3VHTC 3AM9A 1HB6A 4MH8A 2VSZA 5C5BB 2MWSB 3DHHC 1X1GA 1JW9D 2NMQA 2Z14A 1SIJA 1L2NA 1WGGA 4W9GA 4LDTD 1FFVA 2FE8A 5FR3A 2LWPA 3V6EB 1WJ6A 1DDWA 4US8A 2LMCA 2M19A 1VD2A 1MG8A 2JP2A 2IZVB 2GBRA 3W2DA 2COAA 1ESFA 2Z59A 3RI7C 4FJVB 4NJ7A 4I6PA 5HE0A 4WIPA 2BTEA 2WXHA 2R2QA 1ZOYB 2V1YA 2INCC 3M3JA 4XDCA 1UWMA 3U30A 2RGNB 2NPTB 1ZVRA 3ZJTA 2GI9A 2KDIA 2PVGC 2KFKA 3R8BA 2ADZA 1XF5L 2K0PA 1WX9A 3PS6A 1DDVA 3OANA 4C56C 4C4VA 1E8ZA 1FRRA 2Q5WD 4KSLC 2DWQA
chains in the Genus database with same CATH topology
4XC2A 1MK7B 1HE8A 4BOSC 1XD4A 2DIKA 3KUCB 4PYUA 4BKSA 4JKFA 3L13A 4JKGA 1LQBA 2K00A 1FAOA 1Z5SB 1NVLA 3UIPB 1Y5OA 3PGEA 1X86A 2KK8A 2RLOA 3UZTA 1Y8RC 1GJZA 3L17A 3RCPA 5JH5C 1AQCA 3HW2B 3NSUA 3N7CA 1GUAB 1UBQA 3VH4B 5KQ1A 1NI2A 1UNPA 2KVRA 1KJTA 2KJHB 4HB4B 2I5FA 5AZGA 5CHWA 1YIWA 2D3GA 2YS5A 3VH3B 1Y19B 2BCJA 1ZGUB 3HQCA 2L3ZA 1UZXB 4DHJB 1YJ1A 3LDZE 1KZ7A 1WGQA 4KSKC 3V60A 2KD0A 2YT0A 3HM3A 4LJOB 3SU8X 2LVQA 1XQQA 2N4FA 3PHWB 2KJRA 3PP2A 2GBKA 3F5RA 3CIKA 3PV1A 3VDZA 4WWPA 3WA0A 3MJWA 3QARA 5D3YA 1BTNA 3B1LX 1H10A 4ZRIA 4CHKA 4WJNA 3WYFB 2KZRA 2KDBA 1BTKA 2CY5A 1E7VA 4DXAB 2KX3A 2IY0B 2NS5A 2DN6A 2MP2A 3E66A 3H6NA 2LYDA 1LXDA 2MCNB 4NQKE 1UPQA 2RD0A 4AJWA 2P0HA 4YONA 4FA6A 2DKPA 3TW1A 3VFKA 1WJ4A 3CF6E 4ILHA 2N7EA 2D11A 2REXA 2PE9A 1OMWA 2Y7BA 1RAXA 3PRMB 2CHZA 1WI0A 2COFA 4OVVA 4KDIC 3K9OB 2P0DA 3PTFC 1WMHA 1LFDA 1BT0A 2WDTB 1W1GA 4HB0B 4EKUA 5D94A 5G55A 3HHMA 1OQYA 1PQSA 1E7UA 2J0MA 3RZFA 1J0WA 2MBHA 2ZPYA 3ZRCA 2NMBA 5E6NA 1TZ1A 2I1KA 3OJ3A 2ZNVC 3KW5B 4MSMB 4IOYX 1SIFA 2ROVA 2CU1A 2N0YA 3A4RA 1WGUA 3D32A 3QK0A 1DYNA 1PFJA 2KFJA 4NAWB 4M8NA 2BGFA 2DZKA 2LBBA 1OTRB 2UVMA 2G3QB 3KVFB 4BVUC 3IG3A 2KMAA 1V81A 1Q5WB 3NZSA 4NNJB 2VKIA 2X0SA 1WVHA 3A9KB 4KIKA 2KHWB 4WVFB 3CXBB 3OAWA 4IW0A 4FULA 4PS3A 1DIKA 5LOPB 3SO6A 3UQBA 2DHKA 4ZRJA 5D3VA 5G2NA 3QHTA 2JT4B 2KTRB 4PYZA 4HDQA 4KVGB 2L05A 3DVGY 3MPXA 2MBBB 2FAZA 4MJSB 1D3ZA 2ZZPB 2LG1A 2KDEB 4RM9A 2G35A 2ELAA 3ZO5B 1ACAA 3ECIA 3DBRI 3AULA 3NY5A 1WYWB 4HJKA 2GS0A 3KRWA 1B55A 5L95C 3A1QB 1GGOA 4BKSD 3WANA 4GSWA 2KC1A 3L10B 2WX1A 2Y5BB 2LOZA 5AZFA 3AU5A 2AWTA 3ZUNA 1M7RA 5D6JB 2DAJA 2LRWA 4HVBA 4MGKE 3L54A 4L6EA 3PZDA 3HK0A 4RM8A 1U4AA 3ODOA 1U2BA 4F7GA 5JVLA 4ILJA 2I1JA 1V80A 2RVBB 2C7NB 4FN2A 2K8HA 2IO1B 2LVPA 1XD3B 1UD7A 1SGHA 4W9JA 3KYDD 4ANXA 4K81A 1FHWA 4LDTB 3DDCB 3DCGA 2BYEA 2G4SA 3B0AA 1WGHA 3AU4A 2JRHA 2J0JA 1UEFA 4HCPB 5DPTA 4F8CB 5EDSA 3Q3FA 5HE1A 2CR5A 1TXDA 3HM6X 1V5MA 3ZKJC 2C7MB 1TBEA 2Q13A 1NTIA 2N9EB 5DPSA 3NS8A 4Y94A 3L16A 1J8CA 1OQNA 4KHBB 2PZ1A 2O2VA 4BKGA 4AWJA 1E8YA 3WALA 4ASWC 4YL8A 2IBIB 2K1FA 3TO1A 2DTCA 3IBEA 3PLUA 4JQWC 5CX3A 5J3TA 5CHFA 3SHQA 2Z0DB 2R0DA 4MEMA 3DVGX 3ZRFA 4WJPA 5C5BA 3ODWA 4GDKA 2CODA 3ML8A 5KCVA 4JK7A 5C6RA 2WWZA 3A98B 2K8CA 2IO0B 4TYZA 4W9HA 1ST7A 1YD8U 3H7SA 2D9ZA 3L0WB 2W2XC 2UYZB 2GCJA 5CHVC 4MGIE 2MX2A 5D7GA 5EFXA 2C5LC 1V2YA 4K17A 2NPTA 5KHOA 2CAYA 4GDLB 4Z2MB 1FGZA 4B95A 2ZVNA 4II2B 2G45B 3ZNZB 1UNRA 1R4MI 2YS3A 3ZNGC 3SNHA 2IY1B 3RT3B 1KC7A 4IM3A 4WQOB 2D9VA 1QZEA 2N1WA 3R7RA 4BFRA 1WXSA 4HXDA 2Z0PA 4GXBA 4EEWA 5D3XA 4BOZB 4HAVB 2KKCA 3JYUA 3ZTCA 1NTVA 2KLCA 2A5UA 2VRRB 2R09A 2DX5B 2FIFA 4NQLB 2L0FA 5D27A 3KYCD 4GPTB 3RCZA 2LOXA 3A8QA 3ZDMC 2DKQA 3PEGA 1V5PA 3UIOB 3V61A 2IFSA 4KZCA 2WX0A 4URKA 2DHIA 3DQVA 2L00B 1ZC4B 4PS8A 2LASA 3OLMD 1WJNA 2KNBA 4KDLB 3VUWA 4ZDVA 2M14A 2V76A 2DZJA 1GNUA 4K7WA 2WYQA 2PEAA 1X1FA 1U27A 2M4NA 3VTVA 2DYNA 5HKHA 2Z0QA 4FLHA 4GMVA 4G3XB 4BBNF 2DX1A 4P7IA 1UBIA 2KOXA 2FNJB 2D07B 2JZZA 3KY9A 4FHKA 1EF1A 2DYBA 1WR1A 4DBGA 3TFMA 5C23A 2LI5A 4FJZA 4IM2A 1V6EA 4K7UA 4HAWB 2UZSA 2D9YA 1WR6E 3VXWA 3T8MA 4H8SA 2JY6A 4EMOA 3DPDA 2GCLA 3EHVA 4K7SA 2UZRA 5DIFB 1Z2MA 1GG3A 3QBVB 1WX7A 4AP4C 2NBWB 4JKAA 3PT2B 3QA8A 4WWOA 2EC1A 4W9EA 3TVVA 3ENBA 1EO6A 2KUPA 4KHAA 4PS7A 5HE3A 3PSCA 3QWZB 3R66C 3ZLZA 4Z2NA 4HB3B 5HE2A 4GZUA 3VTUA 2YS1A 3SV1A 4JK8A 3DOWA 1L7YA 3AXCA 4LCDE 1U5GA 2BWES 5C79A 5FI1A 2BPSA 1LM8B 4ANWA 4RMAA 4BBKA 2X18A 4EZJA 2ZCBA 5C16A 1WJMA 3PVWA 4JKHA 3F0WA 2I5CA 3TBLD 3P6AA 2M17A 1UH6A 4JLCA 4PQ0A 1UNQA 1WY8A 2DYQA 4IUMB 4IWPA 2RSGA 1V89A 5GOWB 2BF8B 3ML9A 3O96A 3VUYA 3JSVB 1VBHA 1WI1A 3GZNI 1KZGA 2FCMA 3V62A 3KSYA 3RZWC 3RUIB 2JWZA 2LXAA 3M62B 2KQSA 2W2WA 3N30A 3FSSA 1KBLA 2RUKB 2Z0EB 1HB8A 4A6FA 3GOEA 2EMTA 1FHOA 3TMPB 3PPAA 1PMSA 2C60A 2K25A 4TQ0A 3ALBA 3QX1A 3WAPA 5CTRC 4I6NB 2GBJA 3G9WA 2LKOA 1TTNA 2CB8A 1V5OA 1J0GA 2GBNA 1XX0A 3QC8B 2PE6B 2DA0A 4W9FA 5LXHA 3SUZA 2K2JA 1NDDA 1M94A 5E6OA 2KLGA 3JVZX 3VQIA 5AZHA 4ZRKA 1XT9B 4FHJA 1ZSQA 2N1VA 1VCBA 1WGYA 1P1AA 1K5DB 4EZKA 3DBLI 5IAAC 2MP2B 2DHZA 1OEYA 2O6VA 1WE6A 2DYOA 4LJPB 4DDGD 2LGDA 2L8JA 3QAQA 2NBUA 2HTHB 1NU2A 2M8SA 2IYDB 2QHOA 1U5DA 3QQ8B 2YLMA 4CO7A 3W1SC 1YQBA 4BBNC 5E6PA 3NHEB 4A6HA 4JKBA 4ICVA 4F7UP 4DX8A 3N32A 2N9XA 2LULA 4EFOA 3CSTA 1WZ0A 4DHJD 2Y8GA 3P2BA 3NOBA 1I7AA 3H7PB 3N3KB 3E9PA 2MA9B 1WM3A 2GMIC 2ABDA 1WMHB 2LUEA 2CQUA 1S1QB 2MDXA 1UELA 1S3SG 1V49A 1EUVB 4MELA 3VUXA 3SBGA 1NBFC 1WXAA 4DDID 1VBGA 3ULBA 3VTWA 2LD9A 3PVUA 3ZDTA 3WAOA 3EPYA 2DAFA 4MY6A 4X57B 1R4NI 1TGZB 2XK5B 3E9LA 1SE9A 4HLEA 1Z87A 3DBHI 5J17A 3SYXA 1E8XA 3ZVVA 1DBHA 2ASQA 2V4LA 1QQGA 2KMCA 2FUHB 1I2HA 2NVUI 3FEHA 2WH5A 2N7DA 1ZM0A 3QCAA 3KZ1A 1RJ2A 4KIKB 2ZJDA 5L81A 3UQAA 1IP9A 2RQ1A 2K2UA 4HHVA 1EF5A 1N3HA 3MHSD 2DZIA 4TQ1A 2L2IA 4TV3A 3PVLA 1IRSA 5J3QA 4XX5A 3T06A 2NR2A 3ZNHB 4FBJB 4F1SA 2N9PC 4DHZE 4E3CA 4I6LB 4FJYA 1HBKA 3DXCA 1YX5B 5GMVA 3EC8A 1Q0WB 1AWEA 1KOTA 2JF5A 1P5TA 1WE7A 2E2XA 2FCNA 4HK2A 4IWQA 1XR0B 1FXTB 3X0WA 4WJOA 4M0WB 1WG7A 3TJPA 2GBMA 2C7HA 4A3OA 3VVWB 4MH0E 2FCSA 4HB2B 4D0NB 2FDQA 4B6WA 4IM0A 2DFKA 4E74A 2LZ6A 4IFSA 1U5FA 5FR6A 3DVNV 1E8WA 3M1IB 5JHAA 2JUOA 2HJ8A 2JXXA 3RYTA 4WJ7A 4WJQA 2FIDA 3ZW3A 1MIXA 4A6KA 2GOWA 5J2RA 3A9JB 3DBSA 1LB1A 4M8MA 1WGRA 3X23A 1H4RA 3IHPC 5JHBA 1BWNA 4A20A 3GYPA 3ONSA 4A3PA 2ELBA 4NPNA 2RR9A 2DZMA 2MLBA 2KO3A 1UGMA 4MGYE 3FP5A 3KH0A 3NZUA 2KWUB 4W9IA 1MIZB 1KM7A 1X05A 4G11A 2RPQA 2L1CA 2Y8FA 2DLWA 2GJYA 1C1YB 2DYMA 4ILGB 1BAKA 3O65B 3TCAA 4K1RB 3PRPB 4KZ0A 1YX6B 1V61A 1SHCA 3U7DA 2K6DB 2JRIB 1WX8A 2KXJA 2O6VD 4JIOU 4JKCA 1I35A 4GDKB 3DVNU 4EOYA 4KV2A 4TUUA 3UF8A 1W1DA 1AARA 1P98A 2K8BA 3UGBB 2FJ9A 4A5KA 3M63B 3TIXA 4DWFA 2LXCA 1ZW7A 2MBEA 5TR5A 2ZCCA 2NZ8B 3QIJA 3SD5A 2KANA 4W9KA 4BKTA 2KWVB 1EGXA 3BY4B 4W9DA 4PNKA 2FJLA 2DENB 1XKEA 2EMSA 4GU2A 2KC2A 3PRZA 3VAWA 1I42A 1U29A 1RFAA 4W9LA 1MKEA 1LW3A 1F9JA 4HAYB 3H9DA 3WIMA 1XCGA 3GYOA 4XWXA 1Q67A 5DH9B 3JSVA 3ML4A 2PPHA 1OY2A 2J7QB 3VOQA 5IJMA 4HAZB 2IO2B 4GIVA 1DROA 3BINA 2LGXA 1TJ6A 1A5RA 5DHAB 1ISNA 2BKRB 3SBTA 2UWQA 2D9WA 2EKEC 2Z59B 4II3B 3CMMB 1P3QU 4GGQA 1RLFA 2MQJA 2ZEQA 1P6SA 2N23A 2KFKB 3K9PB 2A4ZA 2QKLA 1E5WA 3ENEA 2RGFA 4KHOA 2L76A 3JW0X 2OQBA 2KX0A 2D9XA 2IYBA 2KCJA 3T9LA 2P0FA 3L08A 4K2OA 3HIZA 4JKGB 4NAWA 3V6CB 5JP4A 2HRJA 2M1MA 2AL3A 2MBOA 3WAMA 4WWNA 3Q3JA 2R82A 1G6JA 5FI0A 3FLVA 3CSFA 3DXEA 2BKFA 3ZVRA 4CHJA 3A9KA 4EZLA 3LJUX 4W9CA 5JZEB 2BWFA 2D4QA 2HTHA 2D10A 2MWNB 3PG7A 3KUDB 2KTRA 3U8ZA 5DI9B 1EAZA 2W2XD 1WJUA 4G0NB 2KQ7A 3PHXB 5CLLB 4JKDA 2MFQA 2G4DB 3SDLC 5LONB 2C9WB 3EFUA 2K6QA 4MJSA 1NTYA 4HAXB 2LGYA 3H7PA 2COPA 2MSED 4GMXB 2P8VA 4F7ZA 2BYVE 1X1MA 1FOEA 2CHWA 3UINB 3A33B 3DXDA 4B9KA 3I3TB 3A1QA 1MAIA 2H7DA 1U5EA 2ROZB 2L0TA 5DCNA 5JLJB 4F7HA 4HWIB 1RRPB 4HPMB 4MSQB 3MTNB 3QJZA 3C0RB 1TQZA 4MT7A 4CYEA 2CY4A 2R2OA 2XK5A 1T0YA 4G50A 4DBBA 1QC6A 2KJ6A 4JKEA 1K5GB 1XODA 2YT1A 2RSUA 4EUTA 2OOBB 2KGXB 1WF9A 3W1SA 1WM2A 1WXMA 3APDA 2Z0OA 4NSWA 1ZC3B 3FM8C 4HAUB 3AI5A 2YF0A 4B6HA 2CRFA 1WIAA 1FGYA 5IA7A 4MDKE 4ZYNA 3A8PA 1WXVA 1P9DU 3H1UA 3PLVA 4A6FB 2YRYA 5D3WA 3ZTDA 2KWCA 2MBQA 1KI1B 5BO4B 1WH3A 1J19A 4MK0A 4N9F4 2CKHB 2LRUA 2COCA 4K2PA 2XQNM 2ZNVB 1V88A 3ULCA 4NY0A 4ANUA 3BJIA 2YSZA 4CHMA 3APCA 5DHFB 4ICUA 3EECA 4IC7B 2H7EA 2VRWB 5CLQB 3E9OA 3M95A 2KN5A 4MGZE 4HDOA 1KLVA 2QKMA 2XBBC 1IYFA 4J6IA 2ZVOA 4JGHB 1WFYA 2JVCA 3R3MA 3PREA 3LJ3A 4DHZB 2DHJA 5AEKB 2RNRB 4IG7B 4NJ6A 2MW5A 2O6VB 3IVFA 4WSFA 2KDFB 3D8EA 1OEYJ 4AOFA 5KHQA 2NBVB 3S2AA 1GC7A 1V5TA 4GDLA 4DK5A 5LLIA 1DDMA 1JDEA 3A9JA 2PJHA 2M38A 2J59M 2LJ5A 2KTFA 2JPHA 2NCNA 4MM3A 4GB9A 2BYFA 1W1HA 2OJRA 4HATB 5L83A 5JHGA 1CMXB 1X11A 2LVOA 1M7EA 2D2QA 4FADA 1MPHA 4WAAA 2AL6A 1P0RA 4EJNA 2DX5A 3V5WA 4AUQC 1K8RB 4XZ4A 3KUZA 4E71A 1WZ3A 2MKRA 2ZPNA 4JL9A 3D8FA 1WRDB 3APFA 3ODXA 2EJ8A 2XEWA 2W9NA 4GOCA 5J3YA 4DX90 4IAPA 1UPRA 1P3RA 2CHXA 3VIAA 5LXIB 2K39A 2M0XA 2HD5B 3D8DA 1IPGA 4AJYB 2J0KA 4TKNA 3A4SC 2AYOB 5JHHA 4OVUA 3P7ZA 4HPLB 1EVHA 2FCQA 1GC6A 4ANVA 1FHXA 1FB8A 1WGDA 1WJ1A 3KRXA 1E90A 1V86A 4KAXB 3B08A 3ZNID 3W1YA 2MRPA 4JK9A 4C0AA 3AJ4A 1Q1OA 1V9JA 1C3TA 2AEHA 1PLSA 3R7QA 3RULA 3RD2A 5J18A 2V3SA 3PSEB 2IO3B 2CS4A 3OJ4B 3TL5A 2B3AA 4HCNB 3MDBC 3QWMA 2O2VB 5KQ4A 1JRUA 5D2MB 5DPRA 2JZ3B 2HE7A 1OGWA 2L7RA 1MK9B 1RRBA 1H8CA 2OTXA 2YVCA 5C1ZA 3IFWB 5DPWA 1V5UA 3ZIMA 4GN1A 4IWOA 3VHTC 1HB6A 2VSZA 5C5BB 2MWSB 1X1GA 1L2NA 1WGGA 4W9GA 4LDTD 2LWPA 3V6EB 1WJ6A 1DDWA 1VD2A 1MG8A 2JP2A 2IZVB 2GBRA 2COAA 4FJVB 4NJ7A 4I6PA 5HE0A 2R2QA 2V1YA 3M3JA 3U30A 2RGNB 2NPTB 1ZVRA 2KDIA 2KFKA 2ADZA 1WX9A 3PS6A 1DDVA 3OANA 1E8ZA 4KSLC 1ZKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XC2 A;  1MK7 B;  1HE8 A;  4BOS C;  1XD4 A;  3KUC B;  4PYU A;  4BKS A;  3L13 A;  1LQB A;  2K00 A;  1FAO A;  1Z5S B;  1NVL A;  3UIP B;  1Y5O A;  3PGE A;  1X86 A;  2KK8 A;  2RLO A;  3UZT A;  1Y8R C;  1GJZ A;  3L17 A;  3RCP A;  5JH5 C;  1AQC A;  3HW2 B;  3NSU A;  3N7C A;  1GUA B;  1UBQ A;  3VH4 B;  5KQ1 A;  1NI2 A;  1UNP A;  2KVR A;  1KJT A;  2KJH B;  4HB4 B;  2I5F A;  5AZG A;  5CHW A;  1YIW A;  2D3G A;  2YS5 A;  3VH3 B;  1Y19 B;  2BCJ A;  1ZGU B;  3HQC A;  2L3Z A;  1UZX B;  4DHJ B;  1YJ1 A;  3LDZ E;  1KZ7 A;  1WGQ A;  4KSK C;  3V60 A;  2KD0 A;  2YT0 A;  3HM3 A;  4LJO B;  3SU8 X;  2LVQ A;  1XQQ A;  2N4F A;  3PHW B;  2KJR A;  3PP2 A;  2GBK A;  3F5R A;  3CIK A;  3PV1 A;  3VDZ A;  4WWP A;  3WA0 A;  3MJW A;  3QAR A;  5D3Y A;  1BTN A;  3B1L X;  1H10 A;  4ZRI A;  4CHK A;  4WJN A;  3WYF B;  2KZR A;  2KDB A;  1BTK A;  2CY5 A;  1E7V A;  4DXA B;  2KX3 A;  2IY0 B;  2NS5 A;  2DN6 A;  2MP2 A;  3H6N A;  2LYD A;  1LXD A;  2MCN B;  4NQK E;  1UPQ A;  2RD0 A;  4AJW A;  2P0H A;  4YON A;  4FA6 A;  2DKP A;  3TW1 A;  3VFK A;  1WJ4 A;  3CF6 E;  2N7E A;  2D11 A;  2REX A;  2PE9 A;  1OMW A;  2Y7B A;  1RAX A;  3PRM B;  2CHZ A;  1WI0 A;  2COF A;  4OVV A;  4KDI C;  3K9O B;  2P0D A;  3PTF C;  1WMH A;  1LFD A;  1BT0 A;  2WDT B;  1W1G A;  4HB0 B;  4EKU A;  5D94 A;  5G55 A;  3HHM A;  1OQY A;  1PQS A;  1E7U A;  2J0M A;  3RZF A;  1J0W A;  2MBH A;  2ZPY A;  3ZRC A;  2NMB A;  5E6N A;  1TZ1 A;  2I1K A;  3OJ3 A;  2ZNV C;  3KW5 B;  4MSM B;  4IOY X;  1SIF A;  2ROV A;  2CU1 A;  2N0Y A;  3A4R A;  1WGU A;  3D32 A;  3QK0 A;  1DYN A;  1PFJ A;  2KFJ A;  4NAW B;  4M8N A;  2BGF A;  2DZK A;  2LBB A;  1OTR B;  2UVM A;  2G3Q B;  3KVF B;  4BVU C;  3IG3 A;  2KMA A;  1V81 A;  1Q5W B;  3NZS A;  4NNJ B;  2VKI A;  1WVH A;  3A9K B;  4KIK A;  2KHW B;  4WVF B;  3CXB B;  3OAW A;  4IW0 A;  4FUL A;  4PS3 A;  5LOP B;  3SO6 A;  3UQB A;  2DHK A;  4ZRJ A;  5D3V A;  5G2N A;  3QHT A;  2JT4 B;  2KTR B;  4PYZ A;  4HDQ A;  4KVG B;  2L05 A;  3DVG Y;  3MPX A;  2MBB B;  2FAZ A;  4MJS B;  1D3Z A;  2ZZP B;  2LG1 A;  2KDE B;  4RM9 A;  2G35 A;  2ELA A;  3ZO5 B;  1ACA A;  3ECI A;  3DBR I;  3AUL A;  3NY5 A;  1WYW B;  4HJK A;  2GS0 A;  3KRW A;  1B55 A;  5L95 C;  3A1Q B;  4BKS D;  3WAN A;  4GSW A;  2KC1 A;  3L10 B;  2WX1 A;  2Y5B B;  2LOZ A;  5AZF A;  3AU5 A;  2AWT A;  3ZUN A;  1M7R A;  5D6J B;  2DAJ A;  2LRW A;  4HVB A;  4MGK E;  3L54 A;  4L6E A;  3PZD A;  3HK0 A;  4RM8 A;  1U4A A;  3ODO A;  1U2B A;  4F7G A;  2I1J A;  1V80 A;  2RVB B;  2C7N B;  4FN2 A;  2K8H A;  2IO1 B;  2LVP A;  1XD3 B;  1UD7 A;  1SGH A;  4W9J A;  3KYD D;  4ANX A;  4K81 A;  1FHW A;  4LDT B;  3DDC B;  3DCG A;  2BYE A;  2G4S A;  3B0A A;  1WGH A;  3AU4 A;  2JRH A;  2J0J A;  1UEF A;  4HCP B;  5DPT A;  4F8C B;  5EDS A;  3Q3F A;  5HE1 A;  2CR5 A;  1TXD A;  3HM6 X;  1V5M A;  3ZKJ C;  2C7M B;  1TBE A;  2Q13 A;  1NTI A;  2N9E B;  5DPS A;  3NS8 A;  4Y94 A;  3L16 A;  1J8C A;  1OQN A;  4KHB B;  2PZ1 A;  2O2V A;  4BKG A;  4AWJ A;  1E8Y A;  3WAL A;  4ASW C;  4YL8 A;  2IBI B;  2K1F A;  3TO1 A;  2DTC A;  3IBE A;  3PLU A;  4JQW C;  5CX3 A;  5J3T A;  5CHF A;  3SHQ A;  2Z0D B;  2R0D A;  4MEM A;  3DVG X;  3ZRF A;  4WJP A;  5C5B A;  3ODW A;  4GDK A;  2COD A;  3ML8 A;  5KCV A;  5C6R A;  2WWZ A;  3A98 B;  2K8C A;  2IO0 B;  4TYZ A;  4W9H A;  1ST7 A;  1YD8 U;  3H7S A;  2D9Z A;  3L0W B;  2W2X C;  2UYZ B;  2GCJ A;  5CHV C;  4MGI E;  2MX2 A;  5D7G A;  5EFX A;  2C5L C;  1V2Y A;  4K17 A;  2NPT A;  5KHO A;  2CAY A;  4GDL B;  4Z2M B;  1FGZ A;  4B95 A;  2ZVN A;  4II2 B;  2G45 B;  3ZNZ B;  1UNR A;  1R4M I;  2YS3 A;  3ZNG C;  3SNH A;  2IY1 B;  3RT3 B;  4IM3 A;  4WQO B;  2D9V A;  1QZE A;  2N1W A;  3R7R A;  4BFR A;  1WXS A;  4HXD A;  2Z0P A;  4GXB A;  4EEW A;  5D3X A;  4BOZ B;  4HAV B;  2KKC A;  3JYU A;  3ZTC A;  1NTV A;  2KLC A;  2A5U A;  2VRR B;  2R09 A;  2DX5 B;  2FIF A;  4NQL B;  2L0F A;  5D27 A;  3KYC D;  4GPT B;  3RCZ A;  2LOX A;  3A8Q A;  3ZDM C;  2DKQ A;  3PEG A;  1V5P A;  3UIO B;  3V61 A;  2IFS A;  4KZC A;  2WX0 A;  4URK A;  2DHI A;  3DQV A;  2L00 B;  1ZC4 B;  4PS8 A;  2LAS A;  3OLM D;  1WJN A;  2KNB A;  4KDL B;  3VUW A;  4ZDV A;  2M14 A;  2V76 A;  2DZJ A;  1GNU A;  4K7W A;  2WYQ A;  2PEA A;  1X1F A;  1U27 A;  2M4N A;  3VTV A;  2DYN A;  5HKH A;  2Z0Q A;  4FLH A;  4GMV A;  4G3X B;  4BBN F;  2DX1 A;  4P7I A;  1UBI A;  2KOX A;  2FNJ B;  2D07 B;  2JZZ A;  3KY9 A;  4FHK A;  1EF1 A;  2DYB A;  1WR1 A;  4DBG A;  3TFM A;  5C23 A;  2LI5 A;  4FJZ A;  4IM2 A;  1V6E A;  4K7U A;  4HAW B;  2UZS A;  2D9Y A;  1WR6 E;  3VXW A;  3T8M A;  4H8S A;  2JY6 A;  4EMO A;  3DPD A;  2GCL A;  3EHV A;  4K7S A;  2UZR A;  5DIF B;  1Z2M A;  1GG3 A;  3QBV B;  1WX7 A;  4AP4 C;  2NBW B;  3PT2 B;  3QA8 A;  4WWO A;  2EC1 A;  4W9E A;  3TVV A;  1EO6 A;  2KUP A;  4KHA A;  4PS7 A;  5HE3 A;  3PSC A;  3QWZ B;  3R66 C;  3ZLZ A;  4Z2N A;  4HB3 B;  5HE2 A;  4GZU A;  3VTU A;  2YS1 A;  3SV1 A;  3DOW A;  1L7Y A;  3AXC A;  4LCD E;  1U5G A;  2BWE S;  5C79 A;  5FI1 A;  2BPS A;  1LM8 B;  4ANW A;  4RMA A;  4BBK A;  2X18 A;  4EZJ A;  2ZCB A;  5C16 A;  1WJM A;  3PVW A;  3F0W A;  2I5C A;  3TBL D;  3P6A A;  2M17 A;  1UH6 A;  4JLC A;  4PQ0 A;  1UNQ A;  1WY8 A;  2DYQ A;  4IUM B;  4IWP A;  2RSG A;  1V89 A;  5GOW B;  2BF8 B;  3ML9 A;  3O96 A;  3VUY A;  3JSV B;  1WI1 A;  3GZN I;  1KZG A;  2FCM A;  3V62 A;  3KSY A;  3RZW C;  3RUI B;  2JWZ A;  2LXA A;  3M62 B;  2KQS A;  2W2W A;  3FSS A;  3N30 A;  2RUK B;  2Z0E B;  1HB8 A;  4A6F A;  3GOE A;  2EMT A;  1FHO A;  3TMP B;  3PPA A;  1PMS A;  2C60 A;  2K25 A;  4TQ0 A;  3ALB A;  3QX1 A;  3WAP A;  5CTR C;  4I6N B;  2GBJ A;  3G9W A;  2LKO A;  1TTN A;  2CB8 A;  1V5O A;  1J0G A;  2GBN A;  1XX0 A;  3QC8 B;  2PE6 B;  2DA0 A;  4W9F A;  5LXH A;  3SUZ A;  2K2J A;  1NDD A;  1M94 A;  5E6O A;  2KLG A;  3JVZ X;  3VQI A;  5AZH A;  4ZRK A;  1XT9 B;  4FHJ A;  1ZSQ A;  2N1V A;  1VCB A;  1WGY A;  1P1A A;  1K5D B;  4EZK A;  3DBL I;  5IAA C;  2MP2 B;  2DHZ A;  1OEY A;  2O6V A;  1WE6 A;  2DYO A;  4LJP B;  4DDG D;  2LGD A;  2L8J A;  3QAQ A;  2NBU A;  2HTH B;  1NU2 A;  2M8S A;  2IYD B;  2QHO A;  1U5D A;  3QQ8 B;  2YLM A;  4CO7 A;  3W1S C;  1YQB A;  4BBN C;  5E6P A;  3NHE B;  4A6H A;  4ICV A;  4F7U P;  4DX8 A;  3N32 A;  2N9X A;  2LUL A;  4EFO A;  3CST A;  1WZ0 A;  4DHJ D;  2Y8G A;  3P2B A;  3NOB A;  1I7A A;  3H7P B;  3N3K B;  2MA9 B;  1WM3 A;  2GMI C;  2ABD A;  1WMH B;  2LUE A;  2CQU A;  1S1Q B;  2MDX A;  1UEL A;  1S3S G;  1V49 A;  1EUV B;  4MEL A;  3VUX A;  1NBF C;  1WXA A;  4DDI D;  3ULB A;  3VTW A;  2LD9 A;  3PVU A;  3ZDT A;  3WAO A;  3EPY A;  2DAF A;  4MY6 A;  4X57 B;  1R4N I;  1TGZ B;  2XK5 B;  1SE9 A;  4HLE A;  1Z87 A;  3DBH I;  5J17 A;  3SYX A;  1E8X A;  3ZVV A;  1DBH A;  2ASQ A;  2V4L A;  1QQG A;  2KMC A;  2FUH B;  1I2H A;  2NVU I;  3FEH A;  2WH5 A;  2N7D A;  1ZM0 A;  3QCA A;  3KZ1 A;  1RJ2 A;  4KIK B;  2ZJD A;  5L81 A;  3UQA A;  1IP9 A;  2RQ1 A;  2K2U A;  4HHV A;  1EF5 A;  1N3H A;  3MHS D;  2DZI A;  4TQ1 A;  2L2I A;  4TV3 A;  3PVL A;  1IRS A;  5J3Q A;  4XX5 A;  3T06 A;  2NR2 A;  3ZNH B;  4FBJ B;  4F1S A;  2N9P C;  4DHZ E;  4E3C A;  4I6L B;  4FJY A;  1HBK A;  3DXC A;  1YX5 B;  5GMV A;  3EC8 A;  1Q0W B;  1AWE A;  1KOT A;  2JF5 A;  1P5T A;  1WE7 A;  2E2X A;  2FCN A;  4HK2 A;  4IWQ A;  1XR0 B;  1FXT B;  3X0W A;  4WJO A;  4M0W B;  1WG7 A;  3TJP A;  2GBM A;  2C7H A;  4A3O A;  3VVW B;  4MH0 E;  2FCS A;  4HB2 B;  4D0N B;  2FDQ A;  4B6W A;  4IM0 A;  2DFK A;  4E74 A;  2LZ6 A;  4IFS A;  1U5F A;  5FR6 A;  3DVN V;  1E8W A;  3M1I B;  5JHA A;  2JUO A;  2HJ8 A;  2JXX A;  3RYT A;  4WJ7 A;  4WJQ A;  2FID A;  3ZW3 A;  1MIX A;  4A6K A;  2GOW A;  5J2R A;  3A9J B;  3DBS A;  1LB1 A;  4M8M A;  1WGR A;  3X23 A;  1H4R A;  3IHP C;  5JHB A;  1BWN A;  4A20 A;  3GYP A;  3ONS A;  4A3P A;  2ELB A;  4NPN A;  2RR9 A;  2DZM A;  2MLB A;  2KO3 A;  1UGM A;  4MGY E;  3FP5 A;  3KH0 A;  3NZU A;  2KWU B;  4W9I A;  1MIZ B;  1KM7 A;  1X05 A;  4G11 A;  2RPQ A;  2L1C A;  2Y8F A;  2DLW A;  2GJY A;  1C1Y B;  2DYM A;  1BAK A;  3O65 B;  3TCA A;  4K1R B;  3PRP B;  4KZ0 A;  1YX6 B;  1V61 A;  1SHC A;  3U7D A;  2K6D B;  2JRI B;  1WX8 A;  2KXJ A;  2O6V D;  4JIO U;  1I35 A;  4GDK B;  3DVN U;  4EOY A;  4KV2 A;  4TUU A;  3UF8 A;  1W1D A;  1AAR A;  1P98 A;  2K8B A;  3UGB B;  2FJ9 A;  4A5K A;  3M63 B;  3TIX A;  4DWF A;  2LXC A;  1ZW7 A;  2MBE A;  5TR5 A;  2ZCC A;  2NZ8 B;  3QIJ A;  3SD5 A;  2KAN A;  4W9K A;  4BKT A;  2KWV B;  1EGX A;  3BY4 B;  4W9D A;  4PNK A;  2FJL A;  2DEN B;  1XKE A;  2EMS A;  4GU2 A;  2KC2 A;  3VAW A;  3PRZ A;  1I42 A;  1U29 A;  1RFA A;  4W9L A;  1MKE A;  1LW3 A;  1F9J A;  4HAY B;  3H9D A;  3WIM A;  1XCG A;  3GYO A;  4XWX A;  1Q67 A;  5DH9 B;  3JSV A;  3ML4 A;  2PPH A;  1OY2 A;  2J7Q B;  3VOQ A;  5IJM A;  4HAZ B;  2IO2 B;  4GIV A;  1DRO A;  3BIN A;  2LGX A;  1TJ6 A;  1A5R A;  5DHA B;  1ISN A;  2BKR B;  2UWQ A;  2D9W A;  2EKE C;  2Z59 B;  4II3 B;  3CMM B;  1P3Q U;  4GGQ A;  1RLF A;  2MQJ A;  2ZEQ A;  1P6S A;  2N23 A;  2KFK B;  3K9P B;  2A4Z A;  2QKL A;  1E5W A;  3ENE A;  2RGF A;  4KHO A;  2L76 A;  3JW0 X;  2OQB A;  2KX0 A;  2D9X A;  2IYB A;  2KCJ A;  3T9L A;  2P0F A;  3L08 A;  4K2O A;  3HIZ A;  4NAW A;  3V6C B;  5JP4 A;  2HRJ A;  2M1M A;  2AL3 A;  2MBO A;  3WAM A;  4WWN A;  3Q3J A;  1G6J A;  5FI0 A;  3FLV A;  3CSF A;  3DXE A;  2BKF A;  3ZVR A;  4CHJ A;  3A9K A;  4EZL A;  3LJU X;  4W9C A;  5JZE B;  2BWF A;  2D4Q A;  2HTH A;  2D10 A;  2MWN B;  3PG7 A;  3KUD B;  2KTR A;  3U8Z A;  5DI9 B;  1EAZ A;  2W2X D;  1WJU A;  4G0N B;  2KQ7 A;  3PHX B;  5CLL B;  2MFQ A;  2G4D B;  3SDL C;  5LON B;  2C9W B;  3EFU A;  2K6Q A;  4MJS A;  1NTY A;  4HAX B;  2LGY A;  3H7P A;  2COP A;  2MSE D;  4GMX B;  2P8V A;  4F7Z A;  2BYV E;  1X1M A;  1FOE A;  2CHW A;  3UIN B;  3A33 B;  3DXD A;  4B9K A;  3I3T B;  3A1Q A;  1MAI A;  2H7D A;  1U5E A;  2ROZ B;  2L0T A;  5DCN A;  5JLJ B;  4F7H A;  4HWI B;  1RRP B;  4HPM B;  4MSQ B;  3MTN B;  3QJZ A;  3C0R B;  1TQZ A;  4MT7 A;  4CYE A;  2CY4 A;  2R2O A;  2XK5 A;  1T0Y A;  4G50 A;  4DBB A;  1QC6 A;  2KJ6 A;  1K5G B;  1XOD A;  2YT1 A;  2RSU A;  4EUT A;  2OOB B;  2KGX B;  1WF9 A;  3W1S A;  1WM2 A;  1WXM A;  3APD A;  2Z0O A;  4NSW A;  1ZC3 B;  3FM8 C;  4HAU B;  3AI5 A;  2YF0 A;  4B6H A;  2CRF A;  1WIA A;  1FGY A;  5IA7 A;  4MDK E;  4ZYN A;  3A8P A;  1WXV A;  1P9D U;  3H1U A;  3PLV A;  4A6F B;  2YRY A;  5D3W A;  3ZTD A;  2KWC A;  2MBQ A;  1KI1 B;  5BO4 B;  1WH3 A;  1J19 A;  4MK0 A;  4N9F 4;  2CKH B;  2LRU A;  2COC A;  4K2P A;  2XQN M;  2ZNV B;  1V88 A;  3ULC A;  4NY0 A;  4ANU A;  3BJI A;  2YSZ A;  4CHM A;  3APC A;  5DHF B;  4ICU A;  3EEC A;  4IC7 B;  2H7E A;  2VRW B;  5CLQ B;  3M95 A;  2KN5 A;  4MGZ E;  4HDO A;  1KLV A;  2QKM A;  2XBB C;  1IYF A;  4J6I A;  2ZVO A;  4JGH B;  1WFY A;  2JVC A;  3R3M A;  3PRE A;  3LJ3 A;  4DHZ B;  2DHJ A;  5AEK B;  2RNR B;  4IG7 B;  4NJ6 A;  2MW5 A;  2O6V B;  3IVF A;  4WSF A;  2KDF B;  3D8E A;  1OEY J;  4AOF A;  5KHQ A;  2NBV B;  3S2A A;  1GC7 A;  1V5T A;  4GDL A;  4DK5 A;  5LLI A;  1DDM A;  3A9J A;  2PJH A;  2M38 A;  2J59 M;  2LJ5 A;  2KTF A;  2JPH A;  2NCN A;  4MM3 A;  4GB9 A;  2BYF A;  1W1H A;  2OJR A;  4HAT B;  5L83 A;  5JHG A;  1CMX B;  1X11 A;  2LVO A;  1M7E A;  2D2Q A;  4FAD A;  1MPH A;  4WAA A;  2AL6 A;  1P0R A;  4EJN A;  2DX5 A;  3V5W A;  4AUQ C;  1K8R B;  4XZ4 A;  3KUZ A;  4E71 A;  1WZ3 A;  2MKR A;  2ZPN A;  4JL9 A;  3D8F A;  1WRD B;  3APF A;  3ODX A;  2EJ8 A;  2XEW A;  2W9N A;  4GOC A;  5J3Y A;  4DX9 0;  4IAP A;  1UPR A;  1P3R A;  2CHX A;  3VIA A;  5LXI B;  2K39 A;  2M0X A;  2HD5 B;  3D8D A;  1IPG A;  4AJY B;  2J0K A;  4TKN A;  3A4S C;  2AYO B;  5JHH A;  4OVU A;  3P7Z A;  4HPL B;  1EVH A;  2FCQ A;  1GC6 A;  4ANV A;  1FHX A;  1FB8 A;  1WGD A;  1WJ1 A;  3KRX A;  1E90 A;  1V86 A;  4KAX B;  3B08 A;  3ZNI D;  3W1Y A;  2MRP A;  4C0A A;  3AJ4 A;  1Q1O A;  1V9J A;  1C3T A;  2AEH A;  1PLS A;  3R7Q A;  3RUL A;  3RD2 A;  5J18 A;  2V3S A;  3PSE B;  2IO3 B;  2CS4 A;  3OJ4 B;  3TL5 A;  2B3A A;  4HCN B;  3MDB C;  3QWM A;  2O2V B;  5KQ4 A;  1JRU A;  5D2M B;  5DPR A;  2JZ3 B;  2HE7 A;  1OGW A;  2L7R A;  1MK9 B;  1RRB A;  1H8C A;  2OTX A;  2YVC A;  5C1Z A;  3IFW B;  5DPW A;  1V5U A;  3ZIM A;  4GN1 A;  4IWO A;  3VHT C;  1HB6 A;  2VSZ A;  5C5B B;  2MWS B;  1X1G A;  1L2N A;  1WGG A;  4W9G A;  4LDT D;  2LWP A;  3V6E B;  1WJ6 A;  1DDW A;  1VD2 A;  1MG8 A;  2JP2 A;  2IZV B;  2GBR A;  2COA A;  4FJV B;  4NJ7 A;  4I6P A;  5HE0 A;  2R2Q A;  2V1Y A;  3M3J A;  3U30 A;  2RGN B;  2NPT B;  1ZVR A;  2KDI A;  2KFK A;  2ADZ A;  1WX9 A;  3PS6 A;  1DDV A;  3OAN A;  1E8Z A;  4KSL C;  1ZKH A; 
#chains in the Genus database with same CATH topology
 5AUI A;  2ICI A;  4XC2 A;  4HKQ A;  1MK7 B;  1L6V A;  4A8X C;  1HE8 A;  4BOS C;  5D3D A;  1XD4 A;  2DIK A;  3KUC B;  4PYU A;  4BKS A;  4RH6 A;  4JKF A;  3L13 A;  4JKG A;  1LQB A;  2K00 A;  1FAO A;  1Z5S B;  1NVL A;  3UIP B;  1Y5O A;  1N62 A;  3NVW A;  3PGE A;  1X86 A;  2KK8 A;  4JWS C;  2RLO A;  3B77 A;  3UZT A;  5I2S A;  4RGN A;  1D4B A;  1Y8R C;  1GJZ A;  3L17 A;  3RCP A;  2QEJ C;  5BYS A;  5JH5 C;  1AQC A;  3HW2 B;  3NSU A;  3N7C A;  1JCK B;  1GUA B;  2X38 A;  3Q8E A;  1SE3 A;  1ZDV A;  1IBX A;  1UBQ A;  3EGR A;  4HRO A;  4YSY B;  4KKJ A;  3VH4 B;  4ZYS A;  5KQ1 A;  1NI2 A;  1UNP A;  1KFY B;  2KVR A;  3PZ7 A;  1KJT A;  2KJH B;  5EE0 A;  4HB4 B;  2I5F A;  1QKZ A;  1QOG A;  3L4P A;  5AZG A;  5CHW A;  1YIW A;  1AW7 A;  2D3G A;  2YS5 A;  3VH3 B;  4LLG M;  1Y19 B;  2BCJ A;  1MHH E;  3Q8C A;  2JSV X;  1ZGU B;  1XLN A;  3HQC A;  2L3Z A;  4A90 A;  3AE7 B;  1UZX B;  4DHJ B;  3NJT A;  1YJ1 A;  3LDZ E;  1KZ7 A;  1WGQ A;  4B0E A;  4KSK C;  3V60 A;  2KD0 A;  1NEN B;  2YT0 A;  3HM3 A;  4LJO B;  1FM0 D;  3SU8 X;  2LVQ A;  1XQQ A;  1L5P A;  2RDG A;  1NEK B;  3AED B;  2N4F A;  3PHW B;  2INN E;  2JU6 X;  2KJR A;  3PP2 A;  2GBK A;  3F5R A;  3EUB 2;  3CIK A;  3PV1 A;  1TYG B;  3VDZ A;  4WWP A;  3WA0 A;  2QSD A;  3MJW A;  3QAR A;  3LB8 C;  5D3Y A;  3MC8 A;  1BTN A;  3R2I A;  3B1L X;  4XYC A;  1H10 A;  1L4D B;  4ZRI A;  4CHK A;  1QT9 A;  5EE1 A;  4WJN A;  1JRO A;  3WYF B;  1D5M C;  2KZR A;  2KDB A;  1YMH E;  1BTK A;  2CY5 A;  1E7V A;  4DXA B;  2KX3 A;  1QLB B;  2JYT A;  2IY0 B;  2NS5 A;  2DN6 A;  3AEF B;  2MP2 A;  3BYT B;  3E66 A;  1YJI A;  2KWD A;  1T0S C;  3H6N A;  4ITK A;  4HEA 1;  2LYD A;  1LXD A;  4C80 A;  2MCN B;  4NQK E;  2NTT A;  1YQ3 B;  1PGB A;  3RNG C;  2B76 B;  2SAK A;  1UPQ A;  2RD0 A;  2I38 A;  4AJW A;  3BYY B;  2P0H A;  2KR0 A;  4YON A;  4FA6 A;  3U7Z A;  3RNA C;  2DKP A;  3TW1 A;  3VFK A;  1WJ4 A;  3HIE A;  3CF6 E;  4ILH A;  2N7E A;  1XLQ A;  2D11 A;  3VR9 B;  1AYF A;  2REX A;  2PE9 A;  4MAC A;  3T3O A;  1OMW A;  2Y7B A;  1BML C;  1RAX A;  5BMI A;  3PRM B;  2CHZ A;  1KF6 B;  1V1P A;  1WI0 A;  2E6X A;  2COF A;  4OVV A;  4KDI C;  3K9O B;  1CJE A;  2P0D A;  3PTF C;  1JWA D;  1WMH A;  1LFD A;  1WXQ A;  1BT0 A;  2WDT B;  3RNF C;  2QCZ A;  1W1G A;  4HB0 B;  4EKU A;  5D94 A;  5G55 A;  3HHM A;  1OQY A;  3I63 C;  4PK1 A;  1PQS A;  3HVZ A;  1E7U A;  3O13 A;  1JML A;  2J0M A;  3RZF A;  4ZRP A;  1J0W A;  2MBH A;  2ZPY A;  3ZRC A;  2NMB A;  3P4Q B;  5E6N A;  1TZ1 A;  2I1K A;  3OJ3 A;  1K50 A;  1TKY A;  2ZNV C;  3KW5 B;  4MSM B;  4IOY X;  4RFB A;  1SIF A;  2ROV A;  2CU1 A;  2N0Y A;  2PIA A;  3A4R A;  1WGU A;  3D32 A;  3QK0 A;  2IGD A;  3NS1 A;  1DYN A;  1M4V A;  1PFJ A;  2KFJ A;  4NAW B;  4M8N A;  2BGF A;  2DZK A;  1KTK A;  2LBB A;  1OTR B;  2UVM A;  1P7F A;  2G3Q B;  3KVF B;  4BVU C;  1SJH D;  3CWI A;  4RF1 A;  3IG3 A;  2KMA A;  1V81 A;  1Q5W B;  3NZS A;  4NNJ B;  2VKI A;  2X0S A;  4FXC A;  1FXI A;  2W3R A;  1WVH A;  2YEP F;  3A9K B;  4KIK A;  4YTN B;  2KHW B;  4WVF B;  2QC8 A;  3CXB B;  3OAW A;  4XWT A;  4BZA A;  2W82 A;  3BII D;  4IW0 A;  4FUL A;  4PS3 A;  4M00 A;  1DIK A;  5LOP B;  3SO6 A;  2NBV A;  3UQB A;  2DHK A;  4ZRJ A;  5D3V A;  5G2N A;  3QHT A;  2JT4 B;  2KTR B;  1VZ7 A;  3ZJV A;  1YNT E;  4PYZ A;  4HDQ A;  4KVG B;  2L05 A;  3BVZ A;  3DVG Y;  4LNN A;  3MPX A;  3AEE B;  2MBB B;  1TY2 A;  2VZK B;  1E9M A;  2Z13 A;  2FAZ A;  5IP4 D;  1TIF A;  3FVC A;  4MJS B;  1D3Z A;  2ZZP B;  5I4D A;  2LG1 A;  2KDE B;  4RM9 A;  2BB5 A;  2BQQ A;  2G35 A;  2WXR A;  2ELA A;  3ZO5 B;  4QJ4 B;  1ACA A;  3ECI A;  3DBR I;  4A55 A;  3AUL A;  3NY5 A;  3SFE B;  2KQ4 X;  1WYW B;  4HJK A;  2GS0 A;  3KRW A;  3TEX A;  1B55 A;  5L95 C;  3A1Q B;  4XWW A;  1GGO A;  2WDR B;  1C78 A;  1TKE A;  2KC1 A;  4GSW A;  5AUK A;  3WAN A;  1TS5 A;  2N7J A;  3L10 B;  4BKS D;  2WX1 A;  2Y5B B;  4ZHO A;  4HRS A;  2LOZ A;  5AZF A;  3RFZ B;  3AU5 A;  2AWT A;  3ZUN A;  4L23 A;  1M7R A;  5D6J B;  3B2F A;  2DAJ A;  4KKI A;  2LRW A;  4AQ7 A;  4HVB A;  4MGK E;  3L54 A;  4L6E A;  3PZD A;  2JX5 A;  3HK0 A;  4RM8 A;  1U4A A;  3ODO A;  1U2B A;  1MI0 A;  4F7G A;  5JVL A;  4N58 A;  4ILJ A;  4OVZ A;  2I1J A;  1V80 A;  4O1N A;  1XLP A;  2RVB B;  2C7N B;  4FN2 A;  2K8H A;  2IO1 B;  2LVP A;  4OZC A;  1XD3 B;  1UD7 A;  3FAH A;  1SGH A;  4W9J A;  3U12 A;  3KYD D;  4ANX A;  4K81 A;  1FHW A;  1QOA A;  4JWU C;  4LDT B;  3DDC B;  3DCG A;  2BYE A;  2G4S A;  3B0A A;  2IGG A;  1WGH A;  2KDM A;  3AU4 A;  2JRH A;  2J0J A;  1UEF A;  4HCP B;  5DPT A;  3Q6B A;  4F8C B;  5EDS A;  1VDV A;  3Q3F A;  5HE1 A;  2CR5 A;  4KGR A;  1TXD A;  2OHF A;  1RFK A;  3HM6 X;  4OZA A;  1V5M A;  3KWL A;  5IO9 A;  3ZKJ C;  1R7S A;  2C7M B;  2LGI A;  3AV8 A;  1TBE A;  1V8C A;  2Q13 A;  4DXF A;  1NTI A;  2N9E B;  5DPS A;  1QOB A;  3NS8 A;  4Y94 A;  1YN3 A;  3MC9 A;  4D6W A;  5D3I B;  3L16 A;  1J8C A;  3ZGZ A;  1ACC A;  1D5X C;  3FIL B;  1OQN A;  4KHB B;  2PZ1 A;  2O2V A;  4BKG A;  1ZPS A;  4AWJ A;  1E8Y A;  3WAL A;  4ASW C;  2GLS A;  2G1E A;  4YL8 A;  2BT6 A;  2IBI B;  5IKC M;  2K1F A;  3TO1 A;  2DTC A;  3IBE A;  3PLU A;  4JQW C;  5H92 C;  5CX3 A;  5J3T A;  5CHF A;  3SHQ A;  2Z0D B;  2R0D A;  4MEM A;  1FIQ A;  4BAX A;  3DVG X;  3TSS A;  3ZRF A;  4WJP A;  2V3P A;  5C5B A;  4IDI A;  3ODW A;  2M0A A;  2PKO A;  5FK9 C;  4GDK A;  1FCC C;  1J7B A;  1CK1 A;  1JWM D;  2COD A;  3NWA A;  1DGJ A;  5KCV A;  3ML8 A;  4JK7 A;  5C6R A;  2INP E;  2WXM A;  2RMM A;  2WWZ A;  3A98 B;  2K8C A;  2IO0 B;  1C4A A;  4TYZ A;  4W9H A;  1ST7 A;  1YD8 U;  3H7S A;  2D9Z A;  4HJG E;  4RCO A;  3L0W B;  2W2X C;  2UYZ B;  2GCJ A;  3EFC A;  2CJN A;  3VR8 B;  2PLP A;  5LNK 1;  4RGO S;  1VZ8 A;  5CHV C;  4MGI E;  2MX2 A;  2ZKM X;  3DBL B;  5D7G A;  5EFX A;  2C5L C;  2JXT A;  1V2Y A;  1FNU A;  4K17 A;  3Q14 C;  2NPT A;  5KHO A;  3BK1 A;  1RWS A;  2CAY A;  4GDL B;  4Z2M B;  1FGZ A;  4B95 A;  2ZVN A;  4II2 B;  4L1B A;  2G45 B;  3ZNZ B;  1SJE D;  2RRF A;  2GB1 A;  1XLO A;  1UNR A;  1R4M I;  1P7E A;  2WXI A;  2YS3 A;  3ZNG C;  3SNH A;  2IY1 B;  2MEK A;  2J52 A;  3RT3 B;  3H8H A;  1KC7 A;  4IM3 A;  4N59 A;  4WQO B;  2D9V A;  1F52 A;  1QZE A;  1FD6 A;  2N1W A;  3R7R A;  4BFR A;  1WXS A;  4HXD A;  3FKY A;  2KT7 A;  2Z0P A;  3NZ3 A;  4GXB A;  4EEW A;  2ACZ B;  5D3X A;  4BOZ B;  4HAV B;  4LNK A;  2KKC A;  3JYU A;  3ZTC A;  3N1X C;  1NTV A;  3OG5 A;  4DXG A;  2KLC A;  3DBR B;  2A5U A;  2VRR B;  2R09 A;  2DX5 B;  2FIF A;  4NQL B;  2L0F A;  5D27 A;  1GB4 A;  3KYC D;  1AWD A;  4GPT B;  3RCZ A;  2LOX A;  3A8Q A;  3ZDM C;  2DKQ A;  4PT5 A;  5EE9 A;  3PEG A;  2FBW B;  1V5P A;  2GRI A;  3UIO B;  3V61 A;  2IFS A;  4KZC A;  3HRD D;  2WX0 A;  2WXK A;  3AEB B;  2RDB C;  4URK A;  2DHI A;  3DQV A;  2L00 B;  3ZYY X;  1ZC4 B;  4PS8 A;  3MHZ A;  2LAS A;  3OLM D;  1IGD A;  1F77 A;  1WJN A;  2KNB A;  4KDL B;  3VUW A;  1R4N B;  4ZDV A;  1FEH A;  2M14 A;  2MJD A;  2V76 A;  2DZJ A;  1GNU A;  3KQ4 A;  4K7W A;  3OWE B;  4CQN A;  2WYQ A;  2PEA A;  1FXA A;  1X1F A;  2YT2 A;  1U27 A;  1JAL A;  2M4N A;  3VTV A;  4RGM A;  4LNI A;  2DYN A;  5HKH A;  2Z0Q A;  4ARC A;  4FLH A;  1L6U A;  4GMV A;  1L0V B;  3AN1 A;  4G3X B;  4BBN F;  2DX1 A;  4P7I A;  1UBI A;  2KOX A;  1I4Q A;  2LFI A;  2D5G A;  2FNJ B;  2D07 B;  1PGA A;  2JZZ A;  3SFD B;  3KY9 A;  1SBB B;  3TEZ A;  4FHK A;  4YWG G;  2QJL A;  1EF1 A;  2DYB A;  1WR1 A;  2HTM E;  4DBG A;  1SE4 A;  4N6E B;  3TFM A;  5C23 A;  2LI5 A;  1B1Z A;  1DOI A;  2YEP B;  4H2A A;  1I4P A;  3PZ8 A;  1I4G A;  4RGT A;  3PO0 A;  3ZJU A;  3I5J C;  4FJZ A;  1LGR A;  4IM2 A;  1V6E A;  4K7U A;  4HAW B;  2UZS A;  3HVD A;  2D9Y A;  5H8Y E;  2WXO A;  5TSS A;  1WR6 E;  2WDV B;  3VXW A;  1NI3 A;  3T8M A;  4H8S A;  2JY6 A;  4EMO A;  3DPD A;  3P4R B;  4UDU C;  2GCL A;  3EHV A;  4K7S A;  2UZR A;  3IXS A;  1RYJ A;  5DIF B;  1Z2M A;  1GG3 A;  3QBV B;  3P42 A;  1WX7 A;  1N60 A;  4AP4 C;  1KRH A;  2NBW B;  4JKA A;  4JX1 C;  3EA6 A;  3NVV A;  3PT2 B;  3QA8 A;  4WWO A;  5EE3 A;  2EC1 A;  4W9E A;  3TVV A;  4XGA B;  4QAY A;  3ENB A;  3NWD A;  1EO6 A;  2KUP A;  4KHA A;  4QJ5 B;  4PS7 A;  5HE3 A;  3PSC A;  3A58 A;  1F1H A;  2WU5 B;  3QWZ B;  3R66 C;  3ZLZ A;  4Z2N A;  4HB3 B;  1T0R C;  5HE2 A;  4GZU A;  3RPF C;  3VTU A;  2W54 A;  2YS1 A;  3NRZ A;  4LNF A;  3SV1 A;  3W5U B;  4JK8 A;  3DOW A;  2J53 A;  2ZW0 A;  1L7Y A;  2WXG A;  3AXC A;  4LCD E;  3N1Z C;  1U5G A;  3NVZ A;  2BWE S;  1TZO A;  5C79 A;  5FI1 A;  3DCX A;  4M02 A;  2BPS A;  1LM8 B;  4ANW A;  4RMA A;  4BBK A;  2BYT A;  5FKA C;  4QJ3 B;  2X18 A;  4C4V B;  2BB6 A;  1C4C A;  4EZJ A;  2ZCB A;  5C16 A;  2RPV A;  1WJM A;  3PVW A;  2IJ0 A;  4JKH A;  3F0W A;  2PVO D;  2I5C A;  1R4M B;  3AH7 A;  3P6A A;  5HHD G;  3TBL D;  2M17 A;  1JWB D;  5G5H A;  1UH6 A;  2K22 A;  2WDQ B;  4JLC A;  4PQ0 A;  3AE5 B;  2WXJ A;  1UNQ A;  1STE A;  1WY8 A;  2DYQ A;  1N61 A;  4IUM B;  4IWP A;  1PUT A;  2RSG A;  1V89 A;  5GOW B;  1FCL A;  2BF8 B;  3ML9 A;  2R2Y A;  2Y3A A;  3O96 A;  3VUY A;  3JSV B;  1VBH A;  2ONQ A;  1WI1 A;  3GZN I;  1KZG A;  1TJE A;  2KUQ A;  4NJC A;  4YTM B;  2FCM A;  2PMV A;  3ZXR A;  4C00 A;  3V62 A;  3KSY A;  3RZW C;  1K51 A;  3RUI B;  2JWZ A;  2LXA A;  5T8I A;  1MFW A;  4OHJ A;  2WLB A;  2E3T A;  3M62 B;  2KQS A;  2W2W A;  3FSS A;  1KBL A;  3N30 A;  2RUK B;  2Z0E B;  1HB8 A;  4A6F A;  3AEG B;  3GOE A;  2XN9 C;  2EMT A;  1FHO A;  3TMP B;  2MJE A;  3PPA A;  1PMS A;  2C60 A;  4KGS A;  2K25 A;  2MJ3 A;  3AMZ A;  4TQ0 A;  4ZRQ A;  3VRB B;  3ALB A;  3QX1 A;  3WAP A;  4C7Y A;  5CTR C;  1TY0 A;  4KGT A;  1GPX A;  1YQ4 B;  4OT1 A;  4I6N B;  2GBJ A;  3G9W A;  1ZXI A;  2LKO A;  1TTN A;  2CB8 A;  1V5O A;  2MH7 A;  1J0G A;  2GBN A;  1XX0 A;  3QC8 B;  1DOX A;  1GB1 A;  4S17 A;  2PE6 B;  2K49 A;  2DA0 A;  4W9F A;  5LXH A;  3SUZ A;  2K2J A;  1N5W A;  1NDD A;  1M94 A;  4REZ A;  5E6O A;  2KLG A;  3JVZ X;  3VQI A;  2LHD A;  1WSP A;  5AZH A;  2W3S A;  2Y5P A;  1D6E C;  4ZRK A;  1NVI D;  1F2R I;  1XT9 B;  1LO5 D;  4FHJ A;  1ZSQ A;  2N1V A;  1VCB A;  1WGY A;  1P1A A;  1ZKH A;  4IKG A;  1K5D B;  4EZK A;  1I7H A;  3Q69 A;  3DBL I;  5IAA C;  1C9F A;  1MI1 A;  2JYE A;  2MP2 B;  2DHZ A;  1OEY A;  3U4E G;  2O6V A;  1WE6 A;  4QXA B;  2DYO A;  4LJP B;  4DDG D;  2LGD A;  2L8J A;  3QAQ A;  3LYY A;  2NBU A;  2HTH B;  1NU2 A;  2M8S A;  2IYD B;  3VRA B;  2QHO A;  1UGJ A;  1U5D A;  1SE2 A;  2YLM A;  3QQ8 B;  2W55 A;  3AB5 A;  4CO7 A;  3W1S C;  4USA A;  1EU4 A;  3W9C B;  1YQB A;  4BBN C;  2DBY A;  5E6P A;  3GS2 A;  3NHE B;  4A6H A;  2UU7 A;  1VRA B;  3NUH B;  4JKB A;  1RM6 C;  4ICV A;  5E6J A;  3V05 A;  4F7U P;  1PYW D;  4DX8 A;  3N32 A;  2N9X A;  2LUL A;  4EFO A;  4NAM A;  3CST A;  1WZ0 A;  3DWG C;  4DHJ D;  2Y8G A;  2LUM A;  3P2B A;  3NOB A;  1I7A A;  3H7P B;  2K9X A;  4J3O D;  1BUI C;  3N3K B;  3E9P A;  5BYR A;  2MA9 B;  3U52 E;  4GLS C;  1C4P A;  2KVZ A;  1FFU A;  1WM3 A;  2GMI C;  1N5X A;  2ABD A;  1WMH B;  3RNB C;  4KHB A;  2LUE A;  2CQU A;  1S1Q B;  2MDX A;  1UEL A;  4WWM A;  1S3S G;  1V49 A;  1EUV B;  4YSZ B;  4MEL A;  1MVK A;  3VUX A;  3SBG A;  1NBF C;  1WXA A;  4DDI D;  1VBG A;  3ULB A;  1GOZ A;  3VTW A;  2LD9 A;  3PVU A;  2I2Y A;  3ZDT A;  4WH4 A;  3WAO A;  3EPY A;  2GUM A;  2DAF A;  4MY6 A;  3TEY A;  3T3N A;  4X57 B;  1R4N I;  1TGZ B;  2XK5 B;  3E9L A;  1SE9 A;  5BMH A;  3J9C A;  4HLE A;  4WQM A;  1Z87 A;  3DBH I;  5J17 A;  4US9 A;  3SYX A;  1E8X A;  3ZVV A;  2PTL A;  1DBH A;  2ASQ A;  2V4L A;  1QQG A;  2KMC A;  2FUH B;  1I2H A;  2NTS A;  2NVU I;  3FEH A;  2WH5 A;  1ET9 A;  2N7D A;  1ZM0 A;  1F2R C;  3QCA A;  3KZ1 A;  1RJ2 A;  2JWU A;  4KIK B;  2ZJD A;  4R3D A;  4XE0 A;  2H88 B;  1J7C A;  5L81 A;  1MHX A;  1QQR A;  4P16 A;  3UQA A;  1IP9 A;  2RQ1 A;  3IAS 1;  1K53 A;  2K2U A;  1SF0 A;  4HHV A;  1OQQ A;  2VH1 A;  3GZN B;  1EF5 A;  1N3H A;  3MHS D;  2DZI A;  4WUR A;  4TQ1 A;  2L2I A;  4TV3 A;  3PVL A;  1IRS A;  5J3Q A;  4XX5 A;  3T06 A;  2NR2 A;  3ZNH B;  4FBJ B;  4F1S A;  1F0Z A;  2N9P C;  1YN4 A;  1ZDX A;  1FPY A;  5GXG B;  1IUE A;  1DOY A;  1ZP0 B;  4DHZ E;  2WXL A;  4E3C A;  1FNV A;  1EWC A;  4I6L B;  2LHE A;  4FJY A;  1HBK A;  3DXC A;  2Z4D A;  1YX5 B;  5GMV A;  3DHG C;  3EC8 A;  1Q0W B;  4ARI A;  1AWE A;  1KOT A;  1SXT A;  1N6Z A;  2WU2 B;  4NZL B;  2JF5 A;  1P5T A;  1HQR D;  3BVM A;  1ROE A;  2BW2 A;  1TS2 A;  1WE7 A;  1B9R A;  2E2X A;  2FCN A;  2WGS A;  4HK2 A;  2WXN A;  3B9J A;  1VZ6 A;  1KH0 A;  3KWV A;  4IWQ A;  1XR0 B;  3TEW A;  1FXT B;  3ZQ4 A;  3X0W A;  4WJO A;  1TS3 A;  3AE1 B;  4M0W B;  4ZHP A;  2BS2 B;  1WG7 A;  2V9H A;  1CZP A;  3TJP A;  4HPP A;  2GBM A;  2VH2 A;  2M56 B;  2C7H A;  4A3O A;  3VVW B;  4MH0 E;  2FCS A;  4HB2 B;  4D0N B;  2FDQ A;  4B6W A;  4IM0 A;  3C19 A;  2DFK A;  4GOU A;  2WP9 B;  4E74 A;  2LZ6 A;  4IFS A;  2KAC A;  3AEA B;  1U5F A;  3AE2 B;  2EEL A;  5FR6 A;  3DVN V;  1E8W A;  1PGX A;  3M1I B;  5JHA A;  2JUO A;  1HTO A;  1J7A A;  2HJ8 A;  2JXX A;  3URY A;  3RYT A;  4WJ7 A;  3AE8 B;  4WJQ A;  2FID A;  1ET6 A;  3ZW3 A;  1MIX A;  4A6K A;  2GOW A;  2VZK D;  3Q8A A;  5JXV A;  5J2R A;  4LK0 M;  3A9J B;  3GE3 C;  2CU3 A;  2BBC A;  3DBS A;  3RMK C;  1LB1 A;  4M8M A;  1WGR A;  3X23 A;  1H4R A;  2DLB A;  3IHP C;  4MM3 B;  5JHB A;  1BWN A;  3N9Y C;  1E6E B;  3C8Y A;  4A20 A;  3GYP A;  3BWU D;  3P4S B;  3ONS A;  4A3P A;  2ELB A;  2Y5C A;  4NPN A;  2RR9 A;  4DIX A;  2DZM A;  2MLB A;  1N63 A;  4HSI A;  2KO3 A;  2ON8 A;  4KX6 B;  2MHJ A;  2XNA C;  1UGM A;  3I9V 1;  4MGY E;  3FP5 A;  2V3N A;  3KH0 A;  5IN7 A;  3NZU A;  2KWU B;  4W9I A;  1MIZ B;  1EM7 A;  1KM7 A;  1X05 A;  2QMT A;  4G11 A;  2WXF A;  2BVC A;  2RPQ A;  2L1C A;  2Y8F A;  2DLW A;  2GJY A;  4OSN A;  1C1Y B;  2DYM A;  3AE9 B;  4ILG B;  1BAK A;  3O65 B;  3TCA A;  4P6V F;  4K1R B;  3PRP B;  4KZ0 A;  3N20 C;  1YX6 B;  1V61 A;  1SHC A;  5I2M A;  3U7D A;  2K6D B;  4WAF A;  2JRI B;  1WX8 A;  2KXJ A;  2O6V D;  4JIO U;  1XCQ L;  4JKC A;  3MFG A;  3DBH B;  1I35 A;  4GDK B;  4M01 A;  3DVN U;  4EOY A;  4KV2 A;  4TUU A;  2H89 B;  3V3X A;  2J4X A;  3E9S A;  3UF8 A;  5IRS A;  1W1D A;  1AAR A;  1P98 A;  2KN4 A;  2K8B A;  3UGB B;  2TSS A;  4YT0 B;  2FJ9 A;  4A5K A;  3M63 B;  3TIX A;  4DWF A;  2LXC A;  2QDF A;  1ZW7 A;  2AQ2 B;  2DNF A;  2MBE A;  3ZXV A;  1YJJ A;  5TR5 A;  1FO4 A;  4YXD B;  2ZCC A;  2NZ8 B;  3QIJ A;  3SD5 A;  2KAN A;  4W9K A;  2J42 A;  1OQR A;  5BMG A;  3GP7 A;  2CJO A;  4BKT A;  5MPO A;  2KWV B;  1EGX A;  3BY4 B;  4W9D A;  1T0Q C;  4PNK A;  2FJL A;  1I4H A;  2DEN B;  1XKE A;  1L0Y B;  2EMS A;  4GU2 A;  1K52 A;  4Q2J A;  3Q8B A;  2KC2 A;  3PRZ A;  3VAW A;  1I42 A;  1U29 A;  1RFA A;  3HSA A;  4W9L A;  1TT5 B;  1WRI A;  1MKE A;  1LW3 A;  2IPK D;  1FRD A;  2PW9 A;  3E56 A;  1F9J A;  3MC0 B;  3P63 A;  4HAY B;  4HKZ E;  3H9D A;  3WIM A;  1XCG A;  3GYO A;  4XWX A;  2IDY A;  3Q3O C;  1Q67 A;  4C7Z A;  5DH9 B;  4P1B C;  2LGS A;  3JSV A;  3ML4 A;  2PPH A;  1OY2 A;  3AE4 B;  2HJ1 A;  2J7Q B;  3CIR B;  3VOQ A;  3B2G A;  1AN8 A;  2N9K A;  1EU3 A;  2WNM A;  3BK2 A;  5IJM A;  4ACF A;  2HDE A;  1HTQ A;  4HAZ B;  2IO2 B;  4GIV A;  1DRO A;  3BIN A;  2LGX A;  3Q3M C;  1TJ6 A;  1A5R A;  1IGC A;  3KLS X;  5DHA B;  1ISN A;  3P1M A;  2BKR B;  3SBT A;  2UWQ A;  2D9W A;  1UUP A;  1MG4 A;  2EKE C;  1TKG A;  2Z59 B;  1QF6 A;  5HFY A;  3BVG A;  1D5Z C;  4II3 B;  3CMM B;  1P3Q U;  1T77 A;  3RNE C;  4GGQ A;  2L32 A;  1RLF A;  2MQJ A;  1GAQ B;  2ZEQ A;  3FC4 A;  1V97 A;  1P6S A;  2FJU B;  1UWX A;  2N23 A;  2KFK B;  4P1C C;  3K9P B;  2A4Z A;  3DWM A;  1QIL A;  2QKL A;  1E5W A;  3ENE A;  2RGF A;  4KHO A;  2L76 A;  3JW0 X;  2OQB A;  2KX0 A;  3U2S C;  2D9X A;  2IYB A;  3SEB A;  3GE8 C;  2KCJ A;  3T9L A;  2P0F A;  3AEC B;  2LEK A;  3L08 A;  4K2O A;  3HIZ A;  3NG0 A;  4JKG B;  4NAW A;  3V6C B;  5JP4 A;  2HRJ A;  2M1M A;  2AL3 A;  2MBO A;  3WAM A;  4WWN A;  3Q3J A;  1TS4 A;  5IOI A;  2R82 A;  1WGK A;  1G6J A;  5FI0 A;  3FLV A;  3CSF A;  3DXE A;  2BKF A;  3ZVR A;  4CHJ A;  1ENF A;  3A9K A;  4EZL A;  3LJU X;  4W9C A;  2D3A A;  1VLB A;  2X8X X;  4TMA B;  5JZE B;  2BWF A;  2G9H D;  1KLU D;  4A6Q A;  2RDH A;  3IAM 1;  2D4Q A;  2HTH A;  2D10 A;  2MWN B;  3PG7 A;  3KUD B;  2KTR A;  1A70 A;  3U8Z A;  3Q2A C;  1IBX B;  1FMA D;  5DI9 B;  1EAZ A;  2W2X D;  1WJU A;  3GB1 A;  1BXT A;  4G0N B;  4RF0 A;  2KQ7 A;  1KLG D;  1XO3 A;  4TSS A;  2KYW A;  1CQV A;  3PHX B;  1NYR A;  4ZOH C;  5CLL B;  4JKD A;  2MFQ A;  5HG2 A;  1ZUD 2;  3TUO A;  2FUG 1;  2G4D B;  2R61 A;  2V0G A;  3SDL C;  5LON B;  2C9W B;  1L0X B;  2V4I B;  3EFU A;  2K6Q A;  4MJS A;  1NTY A;  4HAX B;  2LGY A;  3ETR A;  3H7P A;  1EWY C;  2COP A;  2MSE D;  4GMX B;  2P8V A;  4F7Z A;  2BYV E;  1X1M A;  1FOE A;  2CHW A;  4S0R A;  3UIN B;  1Q10 A;  3A33 B;  3DXD A;  3MJ5 A;  4LNO A;  4B9K A;  3I3T B;  3A1Q A;  2OJW A;  1MAI A;  2H7D A;  1U5E A;  2ROZ B;  2WQY B;  2L0T A;  5DCN A;  5JLJ B;  4F7H A;  4HWI B;  2K5P A;  1RRP B;  4HPM B;  4MSQ B;  3MTN B;  3QJZ A;  2JZP A;  2WXQ A;  3C0R B;  2KIE A;  1TQZ A;  2BS4 B;  4MT7 A;  2BS3 B;  4CYE A;  2CY4 A;  1YOV B;  2R2O A;  2XK5 A;  1T0Y A;  4G50 A;  1DYQ A;  4DBB A;  1SEB D;  1XEE A;  1QC6 A;  2KJ6 A;  4JKE A;  1K5G B;  1JWS D;  1XOD A;  2YT1 A;  1WYG A;  2AQ3 B;  3IT4 B;  2RSU A;  4IOI E;  1FNW A;  4EUT A;  1QOF A;  2OOB B;  2KGX B;  3NW8 A;  1WF9 A;  1Y56 A;  3W1S A;  1JWU D;  2AQ1 B;  1WM2 A;  1WXM A;  3APD A;  2Z0O A;  4CSQ A;  4NSW A;  4DQO C;  1L4Z B;  1ZC3 B;  3FM8 C;  4HAU B;  2K3U A;  3AI5 A;  2YF0 A;  4B6H A;  2CRF A;  3NVY A;  3AE6 B;  4A9A A;  1WIA A;  4YTP B;  1FGY A;  3DHI C;  1I4X A;  4GNK B;  2KMM A;  5C2T B;  5IA7 A;  3R2T A;  4MDK E;  4ZYN A;  3A8P A;  1C77 A;  1WXV A;  1P9D U;  1E7P B;  2AX5 A;  2K8E A;  3H1U A;  1V1P B;  4K3B A;  4EE2 A;  3PLV A;  4A6F B;  1JQ4 A;  1XCT L;  2YRY A;  3WCQ A;  1E10 A;  3FIL A;  5D3W A;  3ZTD A;  5G5G A;  1NYQ A;  4L1R A;  2KWC A;  2MBQ A;  1OFF A;  1KI1 B;  3IT6 B;  5BO4 B;  1WH3 A;  4RNA A;  1J19 A;  4MK0 A;  3ABV B;  2KAJ A;  4N9F 4;  2CKH B;  2LRU A;  2COC A;  4K2P A;  2XQN M;  2ZNV B;  1V88 A;  3ULC A;  4NY0 A;  4ANU A;  1C79 A;  2IGH A;  3AE3 B;  3N1Y C;  3BJI A;  2YSZ A;  4CHM A;  1C76 A;  3APC A;  4M0W A;  5DHF B;  4ICU A;  3EEC A;  4IC7 B;  2L1A A;  2H7E A;  3BZD B;  1I4R A;  2VRW B;  5CLQ B;  3E9O A;  3M95 A;  2KN5 A;  2IND C;  4MGZ E;  4HDO A;  2JQR B;  1KLV A;  2QKM A;  2XBB C;  1IYF A;  5BYQ A;  4J6I A;  2ZVO A;  4JGH B;  4OZB A;  1WFY A;  2JVC A;  3R3M A;  3PRE A;  3LJ3 A;  4DHZ B;  2DHJ A;  5AEK B;  2RNR B;  1V1O A;  4IG7 B;  3RNC C;  4NJ6 A;  2MW5 A;  2O6V B;  3IVF A;  4WSF A;  2KDF B;  3D8E A;  1OEY J;  4AOF A;  5KHQ A;  2NBV B;  3S2A A;  1GC7 A;  1V5T A;  1SSN A;  2LJI A;  4GDL A;  4DK5 A;  2WXP A;  1HA5 A;  5LLI A;  4B0M A;  2QIL A;  1DDM A;  3Q8F A;  1JDE A;  3A9J A;  2PJH A;  2M38 A;  1HEZ E;  2J59 M;  2LJ5 A;  2KTF A;  3P4P B;  2D3B A;  2JPH A;  2NCN A;  4MM3 A;  3MP9 A;  4GB9 A;  2BYF A;  1W1H A;  2OJR A;  4MT5 A;  4HAT B;  5L83 A;  5JHG A;  1CMX B;  1X11 A;  2N9L A;  2LVO A;  1M7E A;  1VJK A;  2D2Q A;  3W5V B;  4FAD A;  1MPH A;  3OHM B;  4WAA A;  2AL6 A;  4OW0 A;  1P0R A;  4EJN A;  2DX5 A;  3V5W A;  4AUQ C;  1XXG A;  1K8R B;  3HUI A;  4XZ4 A;  3KUZ A;  2EKI A;  2OED A;  4E71 A;  1WZ3 A;  2MKR A;  3UI3 A;  4AS1 A;  2ZPN A;  4JL9 A;  3D8F A;  1WRD B;  5LG4 B;  3APF A;  3ODX A;  4K3C A;  4LTU A;  5C3J B;  2EJ8 A;  2XEW A;  2W9N A;  4D2K A;  4GOC A;  2WS3 B;  2D3C A;  5J3Y A;  4DX9 0;  1ZE3 D;  4IAP A;  5M4Y B;  5HI1 A;  1UPR A;  1JRP A;  1T5X D;  2SEB D;  1P3R A;  2L52 A;  1UF0 A;  1HXY D;  2N0S B;  2CHX A;  3VIA A;  5LXI B;  1YN5 A;  2K39 A;  1SB3 C;  1PFD A;  2M0X A;  2HD5 B;  2WHI A;  3D8D A;  1IPG A;  4AJY B;  2J0K A;  4TKN A;  4JE3 B;  1ZYI A;  3A4S C;  2AYO B;  5JHH A;  4OVU A;  2KIG A;  3P7Z A;  4HPL B;  1EVH A;  4JPS A;  2FCQ A;  1GC6 A;  4ANV A;  1FHX A;  1FB8 A;  3NWF A;  1WGD A;  4L2Y A;  1WJ1 A;  3KRX A;  1E90 A;  1V86 A;  4KAX B;  3B08 A;  3ZNI D;  2ZW1 A;  4XDD A;  3W1Y A;  2MRP A;  1VR9 A;  4JK9 A;  4C0A A;  3AJ4 A;  1Q1O A;  2L83 A;  1ZXH A;  1V9J A;  1WWT A;  1C3T A;  2AEH A;  1PLS A;  3R7Q A;  3RUL A;  3RD2 A;  5J18 A;  1T6B X;  2V3S A;  3PSE B;  2IO3 B;  1T3Q A;  2CS4 A;  3OJ4 B;  1HZ6 A;  3Q3N C;  1E0Z A;  1MJD A;  3I57 A;  3TL5 A;  2B3A A;  4HCN B;  3MDB C;  3QWM A;  2QIE B;  2O2V B;  5KQ4 A;  1JRU A;  5D2M B;  5DPR A;  1UNS A;  2JZ3 B;  2HE7 A;  1OGW A;  3LXF A;  2L7R A;  1MK9 B;  1RRB A;  1HZ5 A;  4YSX B;  1H8C A;  3SR6 A;  2OTX A;  2YVC A;  5C1Z A;  1MPE A;  2Z8L A;  3IFW B;  5DPW A;  1PDX A;  1V5U A;  3RN9 C;  3ZIM A;  4GN1 A;  4IWO A;  3VHT C;  3AM9 A;  1HB6 A;  4MH8 A;  2VSZ A;  5C5B B;  2MWS B;  3DHH C;  1X1G A;  1JW9 D;  2NMQ A;  2Z14 A;  1SIJ A;  1L2N A;  1WGG A;  4W9G A;  4LDT D;  1FFV A;  2FE8 A;  5FR3 A;  2LWP A;  3V6E B;  1WJ6 A;  1DDW A;  4US8 A;  2LMC A;  2M19 A;  1VD2 A;  1MG8 A;  2JP2 A;  2IZV B;  2GBR A;  3W2D A;  2COA A;  1ESF A;  2Z59 A;  3RI7 C;  4FJV B;  4NJ7 A;  4I6P A;  5HE0 A;  4WIP A;  2BTE A;  2WXH A;  2R2Q A;  1ZOY B;  2V1Y A;  2INC C;  3M3J A;  4XDC A;  1UWM A;  3U30 A;  2RGN B;  2NPT B;  1ZVR A;  3ZJT A;  2GI9 A;  2KDI A;  2PVG C;  2KFK A;  3R8B A;  2ADZ A;  1XF5 L;  2K0P A;  1WX9 A;  3PS6 A;  1DDV A;  3OAN A;  4C56 C;  4C4V A;  1E8Z A;  1FRR A;  2Q5W D;  4KSL C;  2DWQ A; 
#chains in the Genus database with same CATH homology
 4XC2 A;  1MK7 B;  1HE8 A;  4BOS C;  1XD4 A;  2DIK A;  3KUC B;  4PYU A;  4BKS A;  4JKF A;  3L13 A;  4JKG A;  1LQB A;  2K00 A;  1FAO A;  1Z5S B;  1NVL A;  3UIP B;  1Y5O A;  3PGE A;  1X86 A;  2KK8 A;  2RLO A;  3UZT A;  1Y8R C;  1GJZ A;  3L17 A;  3RCP A;  5JH5 C;  1AQC A;  3HW2 B;  3NSU A;  3N7C A;  1GUA B;  1UBQ A;  3VH4 B;  5KQ1 A;  1NI2 A;  1UNP A;  2KVR A;  1KJT A;  2KJH B;  4HB4 B;  2I5F A;  5AZG A;  5CHW A;  1YIW A;  2D3G A;  2YS5 A;  3VH3 B;  1Y19 B;  2BCJ A;  1ZGU B;  3HQC A;  2L3Z A;  1UZX B;  4DHJ B;  1YJ1 A;  3LDZ E;  1KZ7 A;  1WGQ A;  4KSK C;  3V60 A;  2KD0 A;  2YT0 A;  3HM3 A;  4LJO B;  3SU8 X;  2LVQ A;  1XQQ A;  2N4F A;  3PHW B;  2KJR A;  3PP2 A;  2GBK A;  3F5R A;  3CIK A;  3PV1 A;  3VDZ A;  4WWP A;  3WA0 A;  3MJW A;  3QAR A;  5D3Y A;  1BTN A;  3B1L X;  1H10 A;  4ZRI A;  4CHK A;  4WJN A;  3WYF B;  2KZR A;  2KDB A;  1BTK A;  2CY5 A;  1E7V A;  4DXA B;  2KX3 A;  2IY0 B;  2NS5 A;  2DN6 A;  2MP2 A;  3E66 A;  3H6N A;  2LYD A;  1LXD A;  2MCN B;  4NQK E;  1UPQ A;  2RD0 A;  4AJW A;  2P0H A;  4YON A;  4FA6 A;  2DKP A;  3TW1 A;  3VFK A;  1WJ4 A;  3CF6 E;  4ILH A;  2N7E A;  2D11 A;  2REX A;  2PE9 A;  1OMW A;  2Y7B A;  1RAX A;  3PRM B;  2CHZ A;  1WI0 A;  2COF A;  4OVV A;  4KDI C;  3K9O B;  2P0D A;  3PTF C;  1WMH A;  1LFD A;  1BT0 A;  2WDT B;  1W1G A;  4HB0 B;  4EKU A;  5D94 A;  5G55 A;  3HHM A;  1OQY A;  1PQS A;  1E7U A;  2J0M A;  3RZF A;  1J0W A;  2MBH A;  2ZPY A;  3ZRC A;  2NMB A;  5E6N A;  1TZ1 A;  2I1K A;  3OJ3 A;  2ZNV C;  3KW5 B;  4MSM B;  4IOY X;  1SIF A;  2ROV A;  2CU1 A;  2N0Y A;  3A4R A;  1WGU A;  3D32 A;  3QK0 A;  1DYN A;  1PFJ A;  2KFJ A;  4NAW B;  4M8N A;  2BGF A;  2DZK A;  2LBB A;  1OTR B;  2UVM A;  2G3Q B;  3KVF B;  4BVU C;  3IG3 A;  2KMA A;  1V81 A;  1Q5W B;  3NZS A;  4NNJ B;  2VKI A;  2X0S A;  1WVH A;  3A9K B;  4KIK A;  2KHW B;  4WVF B;  3CXB B;  3OAW A;  4IW0 A;  4FUL A;  4PS3 A;  1DIK A;  5LOP B;  3SO6 A;  3UQB A;  2DHK A;  4ZRJ A;  5D3V A;  5G2N A;  3QHT A;  2JT4 B;  2KTR B;  4PYZ A;  4HDQ A;  4KVG B;  2L05 A;  3DVG Y;  3MPX A;  2MBB B;  2FAZ A;  4MJS B;  1D3Z A;  2ZZP B;  2LG1 A;  2KDE B;  4RM9 A;  2G35 A;  2ELA A;  3ZO5 B;  1ACA A;  3ECI A;  3DBR I;  3AUL A;  3NY5 A;  1WYW B;  4HJK A;  2GS0 A;  3KRW A;  1B55 A;  5L95 C;  3A1Q B;  1GGO A;  4BKS D;  3WAN A;  4GSW A;  2KC1 A;  3L10 B;  2WX1 A;  2Y5B B;  2LOZ A;  5AZF A;  3AU5 A;  2AWT A;  3ZUN A;  1M7R A;  5D6J B;  2DAJ A;  2LRW A;  4HVB A;  4MGK E;  3L54 A;  4L6E A;  3PZD A;  3HK0 A;  4RM8 A;  1U4A A;  3ODO A;  1U2B A;  4F7G A;  5JVL A;  4ILJ A;  2I1J A;  1V80 A;  2RVB B;  2C7N B;  4FN2 A;  2K8H A;  2IO1 B;  2LVP A;  1XD3 B;  1UD7 A;  1SGH A;  4W9J A;  3KYD D;  4ANX A;  4K81 A;  1FHW A;  4LDT B;  3DDC B;  3DCG A;  2BYE A;  2G4S A;  3B0A A;  1WGH A;  3AU4 A;  2JRH A;  2J0J A;  1UEF A;  4HCP B;  5DPT A;  4F8C B;  5EDS A;  3Q3F A;  5HE1 A;  2CR5 A;  1TXD A;  3HM6 X;  1V5M A;  3ZKJ C;  2C7M B;  1TBE A;  2Q13 A;  1NTI A;  2N9E B;  5DPS A;  3NS8 A;  4Y94 A;  3L16 A;  1J8C A;  1OQN A;  4KHB B;  2PZ1 A;  2O2V A;  4BKG A;  4AWJ A;  1E8Y A;  3WAL A;  4ASW C;  4YL8 A;  2IBI B;  2K1F A;  3TO1 A;  2DTC A;  3IBE A;  3PLU A;  4JQW C;  5CX3 A;  5J3T A;  5CHF A;  3SHQ A;  2Z0D B;  2R0D A;  4MEM A;  3DVG X;  3ZRF A;  4WJP A;  5C5B A;  3ODW A;  4GDK A;  2COD A;  3ML8 A;  5KCV A;  4JK7 A;  5C6R A;  2WWZ A;  3A98 B;  2K8C A;  2IO0 B;  4TYZ A;  4W9H A;  1ST7 A;  1YD8 U;  3H7S A;  2D9Z A;  3L0W B;  2W2X C;  2UYZ B;  2GCJ A;  5CHV C;  4MGI E;  2MX2 A;  5D7G A;  5EFX A;  2C5L C;  1V2Y A;  4K17 A;  2NPT A;  5KHO A;  2CAY A;  4GDL B;  4Z2M B;  1FGZ A;  4B95 A;  2ZVN A;  4II2 B;  2G45 B;  3ZNZ B;  1UNR A;  1R4M I;  2YS3 A;  3ZNG C;  3SNH A;  2IY1 B;  3RT3 B;  1KC7 A;  4IM3 A;  4WQO B;  2D9V A;  1QZE A;  2N1W A;  3R7R A;  4BFR A;  1WXS A;  4HXD A;  2Z0P A;  4GXB A;  4EEW A;  5D3X A;  4BOZ B;  4HAV B;  2KKC A;  3JYU A;  3ZTC A;  1NTV A;  2KLC A;  2A5U A;  2VRR B;  2R09 A;  2DX5 B;  2FIF A;  4NQL B;  2L0F A;  5D27 A;  3KYC D;  4GPT B;  3RCZ A;  2LOX A;  3A8Q A;  3ZDM C;  2DKQ A;  3PEG A;  1V5P A;  3UIO B;  3V61 A;  2IFS A;  4KZC A;  2WX0 A;  4URK A;  2DHI A;  3DQV A;  2L00 B;  1ZC4 B;  4PS8 A;  2LAS A;  3OLM D;  1WJN A;  2KNB A;  4KDL B;  3VUW A;  4ZDV A;  2M14 A;  2V76 A;  2DZJ A;  1GNU A;  4K7W A;  2WYQ A;  2PEA A;  1X1F A;  1U27 A;  2M4N A;  3VTV A;  2DYN A;  5HKH A;  2Z0Q A;  4FLH A;  4GMV A;  4G3X B;  4BBN F;  2DX1 A;  4P7I A;  1UBI A;  2KOX A;  2FNJ B;  2D07 B;  2JZZ A;  3KY9 A;  4FHK A;  1EF1 A;  2DYB A;  1WR1 A;  4DBG A;  3TFM A;  5C23 A;  2LI5 A;  4FJZ A;  4IM2 A;  1V6E A;  4K7U A;  4HAW B;  2UZS A;  2D9Y A;  1WR6 E;  3VXW A;  3T8M A;  4H8S A;  2JY6 A;  4EMO A;  3DPD A;  2GCL A;  3EHV A;  4K7S A;  2UZR A;  5DIF B;  1Z2M A;  1GG3 A;  3QBV B;  1WX7 A;  4AP4 C;  2NBW B;  4JKA A;  3PT2 B;  3QA8 A;  4WWO A;  2EC1 A;  4W9E A;  3TVV A;  3ENB A;  1EO6 A;  2KUP A;  4KHA A;  4PS7 A;  5HE3 A;  3PSC A;  3QWZ B;  3R66 C;  3ZLZ A;  4Z2N A;  4HB3 B;  5HE2 A;  4GZU A;  3VTU A;  2YS1 A;  3SV1 A;  4JK8 A;  3DOW A;  1L7Y A;  3AXC A;  4LCD E;  1U5G A;  2BWE S;  5C79 A;  5FI1 A;  2BPS A;  1LM8 B;  4ANW A;  4RMA A;  4BBK A;  2X18 A;  4EZJ A;  2ZCB A;  5C16 A;  1WJM A;  3PVW A;  4JKH A;  3F0W A;  2I5C A;  3TBL D;  3P6A A;  2M17 A;  1UH6 A;  4JLC A;  4PQ0 A;  1UNQ A;  1WY8 A;  2DYQ A;  4IUM B;  4IWP A;  2RSG A;  1V89 A;  5GOW B;  2BF8 B;  3ML9 A;  3O96 A;  3VUY A;  3JSV B;  1VBH A;  1WI1 A;  3GZN I;  1KZG A;  2FCM A;  3V62 A;  3KSY A;  3RZW C;  3RUI B;  2JWZ A;  2LXA A;  3M62 B;  2KQS A;  2W2W A;  3N30 A;  3FSS A;  1KBL A;  2RUK B;  2Z0E B;  1HB8 A;  4A6F A;  3GOE A;  2EMT A;  1FHO A;  3TMP B;  3PPA A;  1PMS A;  2C60 A;  2K25 A;  4TQ0 A;  3ALB A;  3QX1 A;  3WAP A;  5CTR C;  4I6N B;  2GBJ A;  3G9W A;  2LKO A;  1TTN A;  2CB8 A;  1V5O A;  1J0G A;  2GBN A;  1XX0 A;  3QC8 B;  2PE6 B;  2DA0 A;  4W9F A;  5LXH A;  3SUZ A;  2K2J A;  1NDD A;  1M94 A;  5E6O A;  2KLG A;  3JVZ X;  3VQI A;  5AZH A;  4ZRK A;  1XT9 B;  4FHJ A;  1ZSQ A;  2N1V A;  1VCB A;  1WGY A;  1P1A A;  1K5D B;  4EZK A;  3DBL I;  5IAA C;  2MP2 B;  2DHZ A;  1OEY A;  2O6V A;  1WE6 A;  2DYO A;  4LJP B;  4DDG D;  2LGD A;  2L8J A;  3QAQ A;  2NBU A;  2HTH B;  1NU2 A;  2M8S A;  2IYD B;  2QHO A;  1U5D A;  3QQ8 B;  2YLM A;  4CO7 A;  3W1S C;  1YQB A;  4BBN C;  5E6P A;  3NHE B;  4A6H A;  4JKB A;  4ICV A;  4F7U P;  4DX8 A;  3N32 A;  2N9X A;  2LUL A;  4EFO A;  3CST A;  1WZ0 A;  4DHJ D;  2Y8G A;  3P2B A;  3NOB A;  1I7A A;  3H7P B;  3N3K B;  3E9P A;  2MA9 B;  1WM3 A;  2GMI C;  2ABD A;  1WMH B;  2LUE A;  2CQU A;  1S1Q B;  2MDX A;  1UEL A;  1S3S G;  1V49 A;  1EUV B;  4MEL A;  3VUX A;  3SBG A;  1NBF C;  1WXA A;  4DDI D;  1VBG A;  3ULB A;  3VTW A;  2LD9 A;  3PVU A;  3ZDT A;  3WAO A;  3EPY A;  2DAF A;  4MY6 A;  4X57 B;  1R4N I;  1TGZ B;  2XK5 B;  3E9L A;  1SE9 A;  4HLE A;  1Z87 A;  3DBH I;  5J17 A;  3SYX A;  1E8X A;  3ZVV A;  1DBH A;  2ASQ A;  2V4L A;  1QQG A;  2KMC A;  2FUH B;  1I2H A;  2NVU I;  3FEH A;  2WH5 A;  2N7D A;  1ZM0 A;  3QCA A;  3KZ1 A;  1RJ2 A;  4KIK B;  2ZJD A;  5L81 A;  3UQA A;  1IP9 A;  2RQ1 A;  2K2U A;  4HHV A;  1EF5 A;  1N3H A;  3MHS D;  2DZI A;  4TQ1 A;  2L2I A;  4TV3 A;  3PVL A;  1IRS A;  5J3Q A;  4XX5 A;  3T06 A;  2NR2 A;  3ZNH B;  4FBJ B;  4F1S A;  2N9P C;  4DHZ E;  4E3C A;  4I6L B;  4FJY A;  1HBK A;  3DXC A;  1YX5 B;  5GMV A;  3EC8 A;  1Q0W B;  1AWE A;  1KOT A;  2JF5 A;  1P5T A;  1WE7 A;  2E2X A;  2FCN A;  4HK2 A;  4IWQ A;  1XR0 B;  1FXT B;  3X0W A;  4WJO A;  4M0W B;  1WG7 A;  3TJP A;  2GBM A;  2C7H A;  4A3O A;  3VVW B;  4MH0 E;  2FCS A;  4HB2 B;  4D0N B;  2FDQ A;  4B6W A;  4IM0 A;  2DFK A;  4E74 A;  2LZ6 A;  4IFS A;  1U5F A;  5FR6 A;  3DVN V;  1E8W A;  3M1I B;  5JHA A;  2JUO A;  2HJ8 A;  2JXX A;  3RYT A;  4WJ7 A;  4WJQ A;  2FID A;  3ZW3 A;  1MIX A;  4A6K A;  2GOW A;  5J2R A;  3A9J B;  3DBS A;  1LB1 A;  4M8M A;  1WGR A;  3X23 A;  1H4R A;  3IHP C;  5JHB A;  1BWN A;  4A20 A;  3GYP A;  3ONS A;  4A3P A;  2ELB A;  4NPN A;  2RR9 A;  2DZM A;  2MLB A;  2KO3 A;  1UGM A;  4MGY E;  3FP5 A;  3KH0 A;  3NZU A;  2KWU B;  4W9I A;  1MIZ B;  1KM7 A;  1X05 A;  4G11 A;  2RPQ A;  2L1C A;  2Y8F A;  2DLW A;  2GJY A;  1C1Y B;  2DYM A;  4ILG B;  1BAK A;  3O65 B;  3TCA A;  4K1R B;  3PRP B;  4KZ0 A;  1YX6 B;  1V61 A;  1SHC A;  3U7D A;  2K6D B;  2JRI B;  1WX8 A;  2KXJ A;  2O6V D;  4JIO U;  4JKC A;  1I35 A;  4GDK B;  3DVN U;  4EOY A;  4KV2 A;  4TUU A;  3UF8 A;  1W1D A;  1AAR A;  1P98 A;  2K8B A;  3UGB B;  2FJ9 A;  4A5K A;  3M63 B;  3TIX A;  4DWF A;  2LXC A;  1ZW7 A;  2MBE A;  5TR5 A;  2ZCC A;  2NZ8 B;  3QIJ A;  3SD5 A;  2KAN A;  4W9K A;  4BKT A;  2KWV B;  1EGX A;  3BY4 B;  4W9D A;  4PNK A;  2FJL A;  2DEN B;  1XKE A;  2EMS A;  4GU2 A;  2KC2 A;  3PRZ A;  3VAW A;  1I42 A;  1U29 A;  1RFA A;  4W9L A;  1MKE A;  1LW3 A;  1F9J A;  4HAY B;  3H9D A;  3WIM A;  1XCG A;  3GYO A;  4XWX A;  1Q67 A;  5DH9 B;  3JSV A;  3ML4 A;  2PPH A;  1OY2 A;  2J7Q B;  3VOQ A;  5IJM A;  4HAZ B;  2IO2 B;  4GIV A;  1DRO A;  3BIN A;  2LGX A;  1TJ6 A;  1A5R A;  5DHA B;  1ISN A;  2BKR B;  3SBT A;  2UWQ A;  2D9W A;  2EKE C;  2Z59 B;  4II3 B;  3CMM B;  1P3Q U;  4GGQ A;  1RLF A;  2MQJ A;  2ZEQ A;  1P6S A;  2N23 A;  2KFK B;  3K9P B;  2A4Z A;  2QKL A;  1E5W A;  3ENE A;  2RGF A;  4KHO A;  2L76 A;  3JW0 X;  2OQB A;  2KX0 A;  2D9X A;  2IYB A;  2KCJ A;  3T9L A;  2P0F A;  3L08 A;  4K2O A;  3HIZ A;  4JKG B;  4NAW A;  3V6C B;  5JP4 A;  2HRJ A;  2M1M A;  2AL3 A;  2MBO A;  3WAM A;  4WWN A;  3Q3J A;  2R82 A;  1G6J A;  5FI0 A;  3FLV A;  3CSF A;  3DXE A;  2BKF A;  3ZVR A;  4CHJ A;  3A9K A;  4EZL A;  3LJU X;  4W9C A;  5JZE B;  2BWF A;  2D4Q A;  2HTH A;  2D10 A;  2MWN B;  3PG7 A;  3KUD B;  2KTR A;  3U8Z A;  5DI9 B;  1EAZ A;  2W2X D;  1WJU A;  4G0N B;  2KQ7 A;  3PHX B;  5CLL B;  4JKD A;  2MFQ A;  2G4D B;  3SDL C;  5LON B;  2C9W B;  3EFU A;  2K6Q A;  4MJS A;  1NTY A;  4HAX B;  2LGY A;  3H7P A;  2COP A;  2MSE D;  4GMX B;  2P8V A;  4F7Z A;  2BYV E;  1X1M A;  1FOE A;  2CHW A;  3UIN B;  3A33 B;  3DXD A;  4B9K A;  3I3T B;  3A1Q A;  1MAI A;  2H7D A;  1U5E A;  2ROZ B;  2L0T A;  5DCN A;  5JLJ B;  4F7H A;  4HWI B;  1RRP B;  4HPM B;  4MSQ B;  3MTN B;  3QJZ A;  3C0R B;  1TQZ A;  4MT7 A;  4CYE A;  2CY4 A;  2R2O A;  2XK5 A;  1T0Y A;  4G50 A;  4DBB A;  1QC6 A;  2KJ6 A;  4JKE A;  1K5G B;  1XOD A;  2YT1 A;  2RSU A;  4EUT A;  2OOB B;  2KGX B;  1WF9 A;  3W1S A;  1WM2 A;  1WXM A;  3APD A;  2Z0O A;  4NSW A;  1ZC3 B;  3FM8 C;  4HAU B;  3AI5 A;  2YF0 A;  4B6H A;  2CRF A;  1WIA A;  1FGY A;  5IA7 A;  4MDK E;  4ZYN A;  3A8P A;  1WXV A;  1P9D U;  3H1U A;  3PLV A;  4A6F B;  2YRY A;  5D3W A;  3ZTD A;  2KWC A;  2MBQ A;  1KI1 B;  5BO4 B;  1WH3 A;  1J19 A;  4MK0 A;  4N9F 4;  2CKH B;  2LRU A;  2COC A;  4K2P A;  2XQN M;  2ZNV B;  1V88 A;  3ULC A;  4NY0 A;  4ANU A;  3BJI A;  2YSZ A;  4CHM A;  3APC A;  5DHF B;  4ICU A;  3EEC A;  4IC7 B;  2H7E A;  2VRW B;  5CLQ B;  3E9O A;  3M95 A;  2KN5 A;  4MGZ E;  4HDO A;  1KLV A;  2QKM A;  2XBB C;  1IYF A;  4J6I A;  2ZVO A;  4JGH B;  1WFY A;  2JVC A;  3R3M A;  3PRE A;  3LJ3 A;  4DHZ B;  2DHJ A;  5AEK B;  2RNR B;  4IG7 B;  4NJ6 A;  2MW5 A;  2O6V B;  3IVF A;  4WSF A;  2KDF B;  3D8E A;  1OEY J;  4AOF A;  5KHQ A;  2NBV B;  3S2A A;  1GC7 A;  1V5T A;  4GDL A;  4DK5 A;  5LLI A;  1DDM A;  1JDE A;  3A9J A;  2PJH A;  2M38 A;  2J59 M;  2LJ5 A;  2KTF A;  2JPH A;  2NCN A;  4MM3 A;  4GB9 A;  2BYF A;  1W1H A;  2OJR A;  4HAT B;  5L83 A;  5JHG A;  1CMX B;  1X11 A;  2LVO A;  1M7E A;  2D2Q A;  4FAD A;  1MPH A;  4WAA A;  2AL6 A;  1P0R A;  4EJN A;  2DX5 A;  3V5W A;  4AUQ C;  1K8R B;  4XZ4 A;  3KUZ A;  4E71 A;  1WZ3 A;  2MKR A;  2ZPN A;  4JL9 A;  3D8F A;  1WRD B;  3APF A;  3ODX A;  2EJ8 A;  2XEW A;  2W9N A;  4GOC A;  5J3Y A;  4DX9 0;  4IAP A;  1UPR A;  1P3R A;  2CHX A;  3VIA A;  5LXI B;  2K39 A;  2M0X A;  2HD5 B;  3D8D A;  1IPG A;  4AJY B;  2J0K A;  4TKN A;  3A4S C;  2AYO B;  5JHH A;  4OVU A;  3P7Z A;  4HPL B;  1EVH A;  2FCQ A;  1GC6 A;  4ANV A;  1FHX A;  1FB8 A;  1WGD A;  1WJ1 A;  3KRX A;  1E90 A;  1V86 A;  4KAX B;  3B08 A;  3ZNI D;  3W1Y A;  2MRP A;  4JK9 A;  4C0A A;  3AJ4 A;  1Q1O A;  1V9J A;  1C3T A;  2AEH A;  1PLS A;  3R7Q A;  3RUL A;  3RD2 A;  5J18 A;  2V3S A;  3PSE B;  2IO3 B;  2CS4 A;  3OJ4 B;  3TL5 A;  2B3A A;  4HCN B;  3MDB C;  3QWM A;  2O2V B;  5KQ4 A;  1JRU A;  5D2M B;  5DPR A;  2JZ3 B;  2HE7 A;  1OGW A;  2L7R A;  1MK9 B;  1RRB A;  1H8C A;  2OTX A;  2YVC A;  5C1Z A;  3IFW B;  5DPW A;  1V5U A;  3ZIM A;  4GN1 A;  4IWO A;  3VHT C;  1HB6 A;  2VSZ A;  5C5B B;  2MWS B;  1X1G A;  1L2N A;  1WGG A;  4W9G A;  4LDT D;  2LWP A;  3V6E B;  1WJ6 A;  1DDW A;  1VD2 A;  1MG8 A;  2JP2 A;  2IZV B;  2GBR A;  2COA A;  4FJV B;  4NJ7 A;  4I6P A;  5HE0 A;  2R2Q A;  2V1Y A;  3M3J A;  3U30 A;  2RGN B;  2NPT B;  1ZVR A;  2KDI A;  2KFK A;  2ADZ A;  1WX9 A;  3PS6 A;  1DDV A;  3OAN A;  1E8Z A;  4KSL C;  1ZKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...