3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Merlin
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
2AL3A 3T06A 3ENEA 2COPA 4NNJB 3VH4B 2ADZA 1HB6A 3BJIA 2L2IA 3PEGA 1P9DU 1V5OA 1RLFA 1IPGA 2NPTB 3PZDA 3LDZE 1ZVRA 5GOWB 4PS8A 1GC6A 4EKUA 1V88A 5IJMA 3M1IB 5C6RA 2FIDA 2IY1B 2KFKA 3PGEA 2C7NB 5JLJB 4XZ4A 1H10A 5D2MB 4FBJB 1W1HA 3LJ3A 1WR1A 3ZLZA 3M63B 4IUMB 3GOEA 3KUDB 3M3JA 2FDQA 1Q0WB 5CX3A 3V61A 5AZGA 1S3SG 5D3VA 4DWFA 4ICVA 2KGXB 2YT0A 1WRDB 2BKRB 2N4FA 4HB4B 3A4RA 2E2XA 2DZJA 2BGFA 4IOYX 3H9DA 3WANA 4GOCA 4HXDA 2YS1A 3ZIMA 1DROA 1X1FA 4GIVA 1KOTA 2N9PC 3DBSA 1ZM0A 2MBQA 2MLBA 1UD7A 4CHJA 3APDA 3FP5A 4KVGB 3RT3B 3U7DA 4A6HA 4WWOA 3DXDA 3P6AA 2PE9A 2G45B 1NI2A 1U5EA 4HWIB 3ZNZB 3KUCB 4GB9A 1BWNA 1XQQA 2LUEA 4IWOA 2LGDA 4MSMB 2JP2A 1TGZB 4J6IA 1TBEA 1BAKA 3DQVA 4IC7B 5L81A 3VOQA 2FIFA 4W9FA 2WH5A 4IWQA 1WX8A 3V62A 3UINB 4DHZB 3RD2A 2MDXA 2YS5A 3H7PB 2KLGA 2CU1A 2JXXA 2Z0DB 4G50A 2OJRA 4NQKE 2I1KA 2L8JA 3CSTA 4EFOA 1WZ0A 2KQ7A 1WY8A 2MP2B 3TW1A 3RZFA 2DAFA 3V60A 2V4LA 3UQBA 4WJ7A 2W2XC 4GPTB 1K8RB 4I6PA 1EO6A 2HTHA 2ZVOA 5DPRA 2GBRA 4ASWC 2GBMA 1EF5A 1VCBA 3QX1A 1ZGUB 4NJ7A 3D8EA 2JPHA 5C79A 4HAYB 1Y19B 2DZKA 2N0YA 1BTNA 3ODWA 2KQSA 2LVQA 3PVWA 1ZW7A 2LZ6A 3VUXA 4AP4C 3ZRFA 4BKSA 4A3PA 3P7ZA 2DHJA 2L7RA 1L7YA 3A33B 3BINA 4TUUA 1P3RA 2LVPA 4II2B 3VXWA 4AUQC 2DFKA 5JHBA 1AWEA 1PQSA 1NTYA 1UNQA 1ZKHA 2UYZB 4WJPA 2RVBB 4CHMA 3IFWB 4Z2NA 1J8CA 3F0WA 4B6HA 2W2WA 3U8ZA 1UZXB 5DPSA 1PFJA 2R2OA 4RMAA 3UIPB 2H7DA 2YRYA 3KZ1A 4HAXB 2IO1B 4FHJA 2Z59B 3I3TB 1FAOA 5FR6A 4DDID 2MBHA 2AEHA 2ASQA 4W9DA 2N1VA 5LLIA 2R2QA 3CF6E 4JGHB 2CR5A 5DCNA 2L00B 4PNKA 1DDMA 2M0XA 3DBHI 2JY6A 3EECA 4WWNA 5BO4B 2ROZB 2D3GA 3RYTA 1HBKA 1QZEA 5C16A 2R09A 4FJZA 5IAAC 1UBQA 4HK2A 4MGKE 2KJRA 3ZTCA 4BBNF 3NOBA 5DH9B 3U30A 4CHKA 1DDVA 3RCPA 1YQBA 3S2AA 4AJWA 1UGMA 4OVVA 4HVBA 1GJZA 3ALBA 1K5DB 3MPXA 3IVFA 5AZFA 5L95C 4KHAA 1WIAA 4W9JA 1M7RA 2K00A 5D7GA 2FCSA 3PVUA 1BTKA 2NBWB 3X23A 4HDQA 1I2HA 1P1AA 2RPQA 1WGUA 4IM2A 3JSVA 4BBNC 2MW5A 4E71A 3VAWA 4IAPA 2Y8GA 1U29A 2MWNB 4OVUA 1T0YA 1S1QB 4IM3A 5J18A 1UELA 1TJ6A 2HJ8A 4A5KA 4B6WA 1X1GA 3TBLD 1M94A 2MKRA 1Y5OA 2P0HA 2M17A 3L0WB 1DDWA 1UPRA 3L17A 2L0TA 2QKLA 5HKHA 4GN1A 4LJPB 1WJMA 1EUVB 3WAMA 3JW0X 1P3QU 3HK0A 1VD2A 3DBRI 3PSEB 4IWPA 4DHZE 2J0JA 2Z0EB 1MAIA 1OEYA 4AJYB 3QA8A 4HPMB 3VTUA 4K7UA 2VRRB 1IRSA 1NDDA 4G0NB 3LJUX 2WDTB 5G2NA 2DTCA 4NSWA 2KKCA 3DVGX 1RJ2A 2A5UA 2WWZA 1Z87A 2GOWA 4HCPB 4F7ZA 1DBHA 2YF0A 1TTNA 3QWZB 3UGBB 3KW5B 4MJSA 3V5WA 3A8PA 5J3TA 3N3KB 3PS6A 1GC7A 1FGYA 4XWXA 4I6NB 1WVHA 2LXCA 3ML8A 3ZUNA 4F1SA 4K2OA 2DKQA 2N9XA 2O2VA 2M4NA 2N23A 2LOXA 3PP2A 3GYOA 2BPSA 2N9EB 1ZSQA 2XBBC 3IBEA 1E7UA 2DZMA 4K7SA 4W9HA 2FCQA 3K9PB 2QKMA 3SO6A 3AJ4A 3ULBA 5C23A 2KWCA 2W2XD 2ZPYA 1Q1OA 3HM3A 2KFKB 1R4MI 2YLMA 3DVNU 3MJWA 3V6EB 3VHTC 1WGGA 4FADA 1I42A 3KYCD 4LDTD 3ULCA 1X86A 1YJ1A 2GBNA 2N7EA 4H8SA 3L13A 1A5RA 1SE9A 3UZTA 2AL6A 3QIJA 2X18A 3M62B 2KCJA 2LULA 2UZRA 1P6SA 2HE7A 3A98B 5DIFB 1UH6A 4KZ0A 3UIOB 4ANVA 4HB3B 5J3QA 2L76A 3OJ4B 5J17A 3W1SC 3N7CA 3ODOA 2CS4A 3RCZA 3WALA 3DCGA 4ZRKA 2BYFA 4F8CB 4W9LA 2K2JA 2NBVB 4GMVA 4FN2A 3SNHA 2KANA 4MEMA 2MBOA 1WX7A 1WZ3A 4WJNA 1WI1A 4Y94A 2PZ1A 1IYFA 2NMBA 2XQNM 1XX0A 2MFQA 2Z0PA 2CB8A 4F7HA 2BWFA 2JZZA 2NCNA 4E74A 2VRWB 2KWUB 1UPQA 4MT7A 2BF8B 2CHZA 5DHAB 1OQYA 2LGYA 1NTVA 4A6FA 1N3HA 4HJKA 5C1ZA 2KDFB 1KZ7A 1OY2A 1KM7A 3CSFA 4ANUA 3DDCB 1WI0A 2KMCA 2J0MA 2YT1A 3NHEB 1MKEA 3QHTA 3H1UA 3ZNID 1V86A 3ZRCA 3KRXA 2NVUI 4BKTA 4ANWA 2K2UA 2GCLA 5EFXA 1V5TA 2RR9A 2RGFA 2Z0QA 2LWPA 3MHSD 5HE0A 2DYMA 2D9XA 5GMVA 3ML9A 4BKGA 3G9WA 3WA0A 1WE7A 5LONB 2WX0A 3PV1A 4DXAB 4IG7B 5D94A 3L16A 1L2NA 3RUIB 4HDOA 4GDLA 5CTRC 3ECIA 3O65B 3PLUA 1J0GA 3APCA 4FULA 5E6NA 4CO7A 5JHAA 4MK0A 3RZWC 1Z5SB 2GJYA 3D32A 2D2QA 2DN6A 4GXBA 1WX9A 2Y8FA 1U4AA 2KFJA 4DX90 2MX2A 3IG3A 3SUZA 2DYBA 2MRPA 3A9KB 4FJYA 1XKEA 3FEHA 4AOFA 3H7SA 1Y8RC 2VKIA 1E8XA 2XK5A 4DHJB 3DXEA 5C5BA 1KJTA 3B08A 2DKPA 5D6JB 1BT0A 2CRFA 2I5FA 1H4RA 2DA0A 4EMOA 3APFA 1LW3A 4LDTB 2M38A 2V76A 3ODXA 2KVRA 1NTIA 1MK9B 3KSYA 3DOWA 3PHWB 1LFDA 3TFMA 4EUTA 2C9WB 2JRHA 2LBBA 2ELAA 3ZDTA 2LKOA 1U27A 3ML4A 4K17A 3ZVRA 2DX5A 1WJNA 2NS5A 3HM6X 5J2RA 1I35A 2YVCA 4MM3A 1J0WA 3QBVB 1Q5WB 2DHZA 1HB8A 5DPWA 2O6VB 4KV2A 5CHWA 3NZUA 4MELA 3GYPA 1UEFA 4TQ0A 2DX1A 2ZCBA 2DX5B 1W1GA 4GDKA 4W9EA 4KHBB 3F5RA 1FHWA 4FLHA 4MGIE 4NAWB 3VIAA 2KK8A 1WM3A 3PTFC 4PYZA 3V6CB 2RQ1A 4F7GA 1WH3A 2MBEA 3PG7A 2MCNB 3UQAA 2PEAA 1ISNA 1QC6A 4Z2MB 2KZRA 1MK7B 3AU5A 2L05A 3W1YA 1XD4A 3DVGY 1TXDA 4HB2B 4HAUB 5D27A 1NBFC 2IY0B 1V6EA 4NPNA 5FI0A 5L83A 4K81A 2MA9B 4FHKA 1ZC4B 1WJ6A 1KI1B 2KO3A 5KHOA 2WX1A 1V5MA 1E5WA 2KTFA 2LVOA 1WMHB 4M0WB 1V2YA 4GZUA 2D9WA 2CHWA 3ZO5B 4ZDVA 2IO2B 4HPLB 3EC8A 2MQJA 1PMSA 4YL8A 2ZJDA 1LB1A 2V3SA 2KNBA 2CAYA 3JVZX 1EVHA 4KDIC 4W9CA 3R7RA 5IA7A 3AU4A 2I1JA 1Q67A 3DBLI 1TQZA 2L1CA 5CLLB 2G3QB 4KZCA 2DHKA 2K25A 2HD5B 2IYDB 1RRPB 2R0DA 2KDIA 5FI1A 3A9JB 4HLEA 1MPHA 4EJNA 4BOSC 3TCAA 4GMXB 3N30A 2CODA 2JT4B 3L08A 4I6LB 1WFYA 3RULA 3PLVA 2EKEC 2ZEQA 1LM8B 3FSSA 4FA6A 2NR2A 2FJ9A 4KDLB 3W1SA 1P98A 5DI9B 3K9OB 1UNPA 1EAZA 3H7PA 3PPAA 2FJLA 2UVMA 2LRUA 3PRZA 3WAOA 1FB8A 2KTRB 2DHIA 4W9IA 1GG3A 5D3YA 1E8ZA 5E6PA 3UF8A 2CKHB 1H8CA 3ZW3A 2FUHB 2DLWA 3ZNGC 3L10B 4HHVA 2D9YA 1M7EA 4MGZE 2I5CA 2IZVB 1UBIA 4GSWA 2RD0A 1X1MA 1OMWA 4WSFA 1E8YA 1QQGA 1C1YB 2FNJB 1TZ1A 2G35A 2G4SA 1ACAA 3JYUA 3ZKJC 1OGWA 3NS8A 2GMIC 5KQ4A 3AXCA 5CHFA 3A1QB 1D3ZA 1J19A 1MG8A 2L0FA 3QWMA 4EZKA 2PE6B 3DPDA 1FGZA 1V61A 2J7QB 1FHXA 2KWVB 2IO0B 4MH0E 4WJOA 2K6QA 3MTNB 4BOZB 1RAXA 3KH0A 1V89A 2BKFA 2MSED 2ZNVC 2GCJA 3SHQA 4A20A 3AI5A 1OEYJ 2KC2A 2D10A 1RFAA 3PSCA 4JL9A 4MDKE 1OQNA 3NSUA 1F9JA 4MJSB 1G6JA 2DZIA 4A3OA 2K8BA 1WXSA 2LD9A 3VH3B 1HE8A 1JRUA 5JHGA 4WJQA 4DX8A 1GUAB 4IW0A 2CHXA 2D11A 4ANXA 4MSQB 4TYZA 4A6KA 3QQ8B 4ZRIA 2DYQA 3O96A 4JIOU 3PVLA 2KJHB 2LXAA 3TJPA 2RLOA 1WG7A 2O6VA 3A4SC 3T9LA 1MIZB 3ZDMC 5D3XA 4DK5A 1P0RA 5TR5A 3A9JA 1WXMA 2K6DB 1NVLA 2BYEA 5CLQB 2N7DA 2LGXA 2JF5A 3L54A 4ICUA 3PRMB 1V5UA 2OQBA 2DENB 2G4DB 2EMTA 2KC1A 4HB0B 3VVWB 2GBJA 1XR0B 2XEWA 1B55A 1GNUA 2FAZA 2ZVNA 1V49A 2JRIB 2REXA 3CMMB 1WGQA 2GS0A 1XODA 4JQWC 4WAAA 2COCA 1U5DA 5AEKB 2CY5A 1X05A 1E7VA 2C7HA 4K1RB 1ZC3B 3KRWA 4URKA 1FOEA 3R3MA 2RUKB 2DYOA 2A4ZA 3NY5A 5E6OA 3TMPB 3ZNHB 4BKSD 1LQBA 1E8WA 4HAZB 3HIZA 3X0WA 4KIKA 4MGYE 2D4QA 2UWQA 3TVVA 2COAA 3A8QA 1YIWA 5JP4A 2Y5BB 3IHPC 2COFA 2IFSA 5EDSA 4G3XB 3ONSA 1WJUA 3VTWA 2M8SA 4DBGA 3KY9A 5KQ1A 5HE1A 3KUZA 3ZVVA 4EZJA 2W9NA 2P8VA 2PJHA 2UZSA 2RNRB 5J3YA 4GU2A 4CYEA 1R4NI 5KHQA 2NPTA 2KDEB 4M8NA 3DVNV 4W9KA 2ROVA 3VUWA 2D07B 3B0AA 4EOYA 2ABDA 3Q3FA 4K7WA 4KHOA 2RSUA 3FLVA 5HE2A 4IFSA 5JH5C 2LJ5A 2MWSB 2IBIB 1WYWB 3D8FA 4XX5A 3R7QA 2DAJA 2FCNA 2JUOA 3EHVA 3SDLC 4DHJD 1SIFA 2XK5B 1U5FA 2J59M 4HATB 5JHHA 1NU2A 4TQ1A 2AYOB 4B9KA 4MY6A 2D9VA 1WGRA 4XC2A 3P2BA 2BYVE 2CQUA 4HAVB 3VDZA 3EPYA 1WF9A 3PT2B 1WMHA 1LXDA 3BY4B 4KAXB 3CXBB 2ELBA 2K8CA 4BBKA 3SU8X 4FJVB 3A9KA 1MIXA 4ZYNA 4KSKC 5LOPB 3Q3JA 1XT9B 3FM8C 1WJ4A 2ZCCA 1V81A 5CHVC 2H7EA 2IYBA 2ZZPB 1AARA 1WXAA 4C0AA 1YX5B 2KTRA 4ZRJA 2KJ6A 4D0NB 4DBBA 3VFKA 4PQ0A 4NAWA 1KLVA 2NZ8B 1EF1A 1KZGA 2LYDA 1OTRB 3DXCA 2Y7BA 2MP2A 2MBBB 4P7IA 1Z2MA 1WJ1A 4M8MA 4PS7A 1W1DA 1U2BA 4B95A 4EZLA 2IO3B 4BFRA 3R66C 5G55A 2BWES 2O2VB 2KXJA 3QC8B 2YS3A 1WR6E 3A1QA 4WQOB 4X57B 4K2PA 4L6EA 1WGHA 1U5GA 3TIXA 3JSVB 4II3B 2O6VD 4WVFB 2EJ8A 3KYDD 5AZHA 4EEWA 2Q13A 1FHOA 1E90A 3OLMD 4NJ6A 3PREA 3HHMA 2LOZA 3PRPB 4TV3A 2KN5A 4PS3A 4E3CA 3QAQA 2DYNA 1V80A 4NQLB 5DHFB 5C5BB 3KVFB 2KD0A 2PPHA 4LCDE 2ZPNA 2ZNVB 3OAWA 2HRJA 3HW2B 2HTHB 3N32A 2WYQA 5DPTA 3VUYA 2VSZA 2OOBB 2LRWA 2KLCA 4JLCA 4RM9A 2D9ZA 2N1WA 2KHWB 1UNRA 3SYXA 1FXTB 1X11A 2LI5A 5HE3A 1C3TA 1K5GB 1ST7A 1XD3B 2C60A 2QHOA 5LXIB 1SHCA 4N9F4 2C5LC 1I7AA 2YSZA 2K1FA 2KDBA 2J0KA 3H6NA 4HCNB 1CMXB 3OJ3A 4WWPA 3TO1A 4YONA 3ZTDA 4DDGD 1V9JA 2K8HA 2JWZA 2FCMA 4W9GA 3QJZA 4GGQA 4KIKB 5JZEB 1DYNA 2LG1A 4TKNA 2KX0A 3C0RB 3SD5A 3VTVA 3HQCA 4BVUC 4GDKB 1WE6A 2C7MB 4AWJA 1WGYA 2B3AA 1XCGA 2P0FA 4LJOB 2CY4A 3M95A 1SGHA 3QARA 2OTXA 2JZ3B 2NBUA 3GZNI 2JVCA 3EFUA 4G11A 3WAPA 2L3ZA 1P5TA 1PLSA 1V5PA 4A6FB 2KX3A 2BCJA 1EGXA 2LASA 3QK0A 4IM0A 5D3WA 1RRBA 2M14A 2EMSA 2RSGA 4F7UP 1WM2A 3WYFB 2M1MA 4KSLC 3D8DA 3MDBC 1WXVA 3B1LX 2K39A 3QCAA 1IP9A 3VQIA 5LXHA 4PYUA 2GBKA 2KMAA 3OANA 2V1YA 2P0DA 3AULA 4GDLB 3WIMA 1WGDA 2KUPA 4RM8A 1YX6B 2KOXA 3PHXB 1AQCA 1YD8U 3SV1A 3T8MA 5KCVA 4NY0A 2RGNB 3CIKA 4HAWB 2Z0OA 3TL5A 2AWTA 2EC1A 3NZSA
chains in the Genus database with same CATH superfamily
2AL3A 4KGSA 2ADZA 3BJIA 3SBGA 1NENB 2WXHA 2NPTB 3DHHC 4PS8A 5GOWB 1V88A 3PGEA 4BAXA 4HVBA 4FBJB 2GI9A 2C7NB 4RGMA 4IUMB 3RNFC 2VZKD 4DWFA 2YT0A 4HB4B 1MHXA 2BGFA 2WXNA 4S0RA 1F2RC 2YS1A 1J7BA 1VZ8A 2N9PC 2MBQA 2MLBA 3GE8C 1UD7A 2L52A 4WWOA 3DXDA 2WXQA 3ZNZB 4GB9A 1F0ZA 4MSMB 4NAMA 1FFUA 1WGKA 1C78A 4IWQA 1WX8A 1NYRA 4DHZB 2MDXA 2YS5A 5EE1A 2KLGA 2X8XX 2CJNA 4G50A 2I1KA 2L8JA 4N6EB 1SJED 2KUQA 1TY0A 5AUIA 4WJ7A 2W2XC 1EO6A 4ASWC 3KWLA 3D8EA 1Y19B 4AP4C 3ZRFA 3I9V1 3BINA 1ZDVA 2INNE 2LVPA 5JHBA 1ZKHA 1UNQA 2UYZB 4B6HA 2YRYA 2UU7A 4HAXB 1FAOA 2MBHA 5I2MA 2EELA 2JY6A 4WWNA 2ROZB 3RYTA 4FJZA 5IAAC 1UBQA 4BBNF 4CHKA 3U30A 4OVVA 2H89B 5L95C 4KHAA 1B9RA 2V0GA 5D7GA 1BTKA 4ITKA 4HSIA 3X23A 3Q8AA 4HDQA 2RPQA 4C80A 2NTTA 1E0ZA 2MWNB 3N9YC 4LTUA 1S1QB 3RNCC 1UELA 1WWTA 2HJ8A 5E6JA 4XDCA 3TBLD 2MKRA 1DDWA 5HKHA 4K3BA 1EUVB 3BVGA 3PSEB 4HPMB 3N1ZC 4K7UA 2VRRB 1QOAA 3U12A 4OHJA 1RJ2A 2GOWA 4OZCA 4F7ZA 5IP4D 1DBHA 2YF0A 2ACZB 4MJSA 3V5WA 1TKYA 4IKGA 3T3NA 1GC7A 4K2OA 4GLSC 2N23A 3IBEA 2FCQA 3SO6A 5EE9A 1Q1OA 3HM3A 3MJWA 1R4MI 2Z13A 2M0AA 2I2YA 3KYCD 4LDTD 1ZDXA 4H8SA 2FE8A 1SE9A 3SEBA 2WXOA 2AL6A 3ZVVA 3MC9A 1UH6A 2HE7A 4HB3B 5J17A 3N7CA 1KC7A 4ZRKA 1SB3C 3E66A 4WWMA 2MBOA 1WX7A 3R8BA 4Y94A 2Z0PA 2CB8A 4F7HA 3Q8CA 2WXIA 2VRWB 2CHZA 2BF8B 1WYGA 4HJKA 1XCQL 2KDFB 1KZ7A 4RGNA 3H1UA 3O13A 1VR9A 2RR9A 2K2UA 2RGFA 2LWPA 3ZYYX 1A70A 5HE0A 4OSNA 1MFWA 3ML9A 3WA0A 3AEGB 4N59A 2QILA 1C4PA 3GZNB 5CTRC 3O65B 1J0GA 5JHAA 5E6NA 4GXBA 1WX9A 1U4AA 4OZBA 3SUZA 4FJYA 1XKEA 1SBBB 2QMTA 3H7SA 1E8XA 2HTME 3ZJUA 3Q8BA 1KJTA 4M01A 5HFYA 4EMOA 3APFA 1QT9A 2J4XA 1I4XA 3MJ5A 3WCQA 3TFMA 2LBBA 3ZDTA 1WJNA 2NS5A 3Q8FA 1J0WA 3QBVB 1Q5WB 5IKCM 4KV2A 5CHWA 4TQ0A 2DX1A 4WAFA 1IBXA 4W9EA 4QJ4B 3AH7A 2KK8A 4JKDA 2JYTA 2MCNB 2PEAA 1QC6A 4Z2MB 3DVGY 4ARIA 4HJGE 1WJ6A 2KO3A 1E5WA 2AQ3B 2LVOA 2MJEA 1WMHB 1V2YA 3EC8A 1EM7A 4YSXB 4KGRA 1TS4A 3AN1A 4W9CA 3AU4A 1SF0A 2G3QB 4KZCA 1ZUD2 2V4IB 2HD5B 4AS1A 5FI1A 4HLEA 2LEKA 4HRSA 2K5PA 4GMXB 4I6LB 2CODA 3ZJVA 2ZEQA 4LNFA 4FA6A 2M56B 3ZQ4A 4KDLB 1P98A 3H7PA 3PPAA 2BS4B 1FNWA 1GG3A 1E8ZA 3RFZB 1DIKA 4MGZE 3BWUD 1HA5A 3FILB 2WU5B 2RD0A 4DXFA 1E8YA 1C1YB 3SBTA 1QILA 3NS8A 2GMIC 5KQ4A 2L0FA 2N0SB 1T77A 2PE6B 3DPDA 4QJ3B 1FHXA 3DHGC 4BOZB 2K6QA 3KH0A 2BKFA 3CIRB 2H88B 1XLQA 1FRRA 2KC2A 2INDC 3DBRB 2D10A 2OEDA 4ZYSA 5H92C 1V1OA 2KIGA 1YQ3B 4IW0A 2QEJC 3AEEB 4ANXA 1ENFA 3QQ8B 4ZRIA 1LGRA 4L1RA 1L5PA 3O96A 2PKOA 4FXCA 3TJPA 2RLOA 3Q2AC 3A4SC 1MIZB 1P0RA 3A9JA 2L83A 2WXLA 2BYEA 5CLQB 3TEZA 3PRMB 2DENB 2XEWA 1B55A 2ZVNA 3JSVB 3CMMB 1SJHD 2REXA 2MJ3A 4JQWC 4WAAA 2GS0A 5AEKB 4LK0M 1ZC3B 3KRWA 1UGJA 2KR0A 4BKSD 2WDRB 4YTPB 2Y5BB 2R82A 2COFA 1E7PB 1WJUA 4DBGA 3AE6B 1VRAB 3KY9A 3KUZA 1DOYA 4DQOC 4MM3B 2PJHA 2NPTA 3VUWA 3B0AA 4K7WA 5HE2A 5JH5C 2LJ5A 4C56C 2KMMA 2JUOA 1SIFA 2FBWB 1FCCC 2DLBA 1JROA 3U2SC 4MY6A 3GB1A 2BYVE 4HAVB 1WF9A 3TEYA 3Q3JA 4IOIE 1XT9B 4R3DA 5CHVC 1WXQA 2H7EA 1WXAA 1V1PA 1YX5B 4D0NB 5FKAC 1KLVA 2LYDA 3DXCA 4P7IA 1U2BA 4X57B 2YS3A 3A1QA 1WGHA 1U5GA 1M4VA 2O6VD 3KYDD 4NJ6A 3HHMA 3AEBB 1IBXB 2KN5A 4PS3A 1V80A 1RWSA 5DHFB 1D5XC 5C5BB 4QJ5B 2KD0A 2ZPNA 3AEDB 3VUYA 2HRJA 3N32A 2HTHB 2D9ZA 2N1WA 1UNRA 1C3TA 1X11A 3OG5A 2YEPB 2D3BA 2IGDA 1SHCA 1I7AA 1V8CA 2KDBA 4WWPA 3TO1A 1ESFA 4DDGD 2JWZA 4MACA 3QJZA 4GGQA 4KIKB 4TKNA 2ZKMX 2KX0A 1AW7A 3VTVA 4GDKB 1L0VB 1XCGA 1E10A 5BMHA 3IT4B 3CWIA 4JWUC 3WAPA 4ZOHC 2AQ2B 4A6FB 2LASA 2BCJA 1PDXA 5D3WA 5FK9C 2MH7A 1WM2A 4WURA 2R2YA 3LB8C 3QCAA 3RPFC 5LXHA 3MFGA 3OANA 3KQ4A 4YXDB 1ET9A 3Q8EA 2W55A 4USAA 4JKHA 1AQCA 1FM0D 1VBHA 3SV1A 4NY0A 2RGNB 2Z0OA 2AWTA 3T06A 4KHBA 3B2GA 3S2AA 1I4RA 1Y56A 1ZVRA 3M1IB 5C6RA 4XZ4A 1H10A 1W1HA 3ZLZA 1D4BA 3GOEA 3M3JA 2FDQA 1Q0WB 5CX3A 3V61A 5AZGA 5D3VA 1UWXA 1FD6A 3A4RA 2N4FA 2E2XA 1MHHE 3WANA 4GOCA 3ZIMA 2CU3A 1QF6A 2DNFA 3VR9B 3ZXVA 3NVVA 4CHJA 4KVGB 4A6HA 4E71A 2PE9A 2G45B 4P16A 1BWNA 1XQQA 4IWOA 4JK7A 3AECB 2Y5PA 2DWQA 2QDFA 3DQVA 3H8HA 4IC7B 5L81A 3VOQA 3OWEB 3DCXA 3H7PB 2CU1A 2JXXA 2Z0DB 1T0QC 2AQ1B 1JQ4A 4EFOA 1WY8A 3RZFA 3V60A 2DAFA 2V4LA 1K8RB 4I6PA 2JYEA 3HUIA 2ZVOA 3E56A 1ZGUB 2RDBC 5C79A 4HAYB 5D6JB 1XO3A 2LVQA 3NRZA 4XWTA 4BKSA 2J53A 2L7RA 2DHJA 3VXWA 1P3RA 4RNAA 2WXMA 1KRHA 2RVBB 3F0WA 1UZXB 3UIPB 4RCOA 3NVYA 5AUKA 3KLSX 5LLIA 3CF6E 3Q14C 2M0XA 5BO4B 2D3GA 1HBKA 2G9HD 4PT5A 1KLGD 3I63C 1F77A 3NOBA 3ALBA 3IVFA 1SEBD 1WIAA 2K00A 2W3RA 2WXFA 3MP9A 5D3DA 4TMAB 4HPPA 2MW5A 4XYCA 3VAWA 1T0YA 4B6WA 3ETRA 3VRAB 1KBLA 1ZXHA 3L0WB 1DGJA 3U4EG 1L0XB 1ACCA 1JWAD 3WAMA 4IWPA 3HK0A 1D5MC 4H2AA 2J0JA 1TYGB 5G2NA 1ZOYB 4NSWA 1C4AA 1GAQB 2WWZA 3AE4B 3HVDA 1TTNA 3A8PA 2K49A 3PS6A 4RF0A 4XWXA 2LXCA 3ZUNA 4ARCA 1NYQA 2LOXA 2BPSA 2XBBC 2KN4A 1E7UA 5C3JB 3K9PB 1HQRD 4GOUA 2IGHA 2KWCA 2KFKB 2YLMA 5TSSA 3V6EB 5BYQA 1KTKA 3HVZA 1X86A 2N7EA 1QKZA 3UZTA 3M62B 2X18A 3A98B 5DIFB 2L76A 3OJ4B 4S17A 3WALA 2BYFA 4W9LA 1KFYB 3DHIC 4ZHPA 2KANA 4WJNA 5JXVA 2MFQA 2LUMA 4E74A 1UPQA 3B77A 4MT7A 5DHAB 5C1ZA 1OY2A 1KM7A 1WI0A 1XXGA 5C2TB 1V86A 3KRXA 4BKTA 3Q3MC 4ANWA 2N9LA 4CSQA 2Z0QA 2DYMA 3SFEB 1WE7A 3FKYA 4IG7B 5D94A 1YN5A 3BVMA 3APCA 2WDVB 1R7SA 1JALA 4RGTA 4MK0A 3RZWC 1Z5SB 2D2QA 2DN6A 2KFJA 3VTWA 4DX90 3IG3A 2MRPA 3LYYA 3FEHA 1I7HA 3DXEA 1UNSA 1ZYIA 3B08A 2GB1A 3DBLB 4P1CC 4LDTB 3ODXA 1NTIA 3DOWA 3A58A 3PHWB 1LFDA 2RMMA 2ELAA 3ZVRA 1L6VA 5J2RA 2DX5A 1I35A 4MM3A 2DHZA 5DPWA 2O6VB 3GYPA 1UEFA 1W1GA 3F5RA 3RNEC 3VIAA 1EU4A 2RQ1A 4F7GA 2LGIA 1ISNA 3NG0A 1UWMA 4QAYA 3IXSA 1MK7B 3W1YA 4HB2B 5D27A 1FNUA 4K81A 4JKAA 2MA9B 1ZC4B 2KTFA 4M0WB 2D9WA 3BK1A 1N6ZA 4LLGM 4ACFA 2NMQA 1PMSA 4A8XC 2ZJDA 1LB1A 1EVHA 3P4RB 5CLLB 1C79A 1MG4A 2DHKA 2K25A 2IYDB 2R0DA 2KDIA 2GRIA 2Z14A 3TCAA 2JT4B 2K8EA 2L1AA 2BB5A 3K9OB 1UNPA 2BYTA 3PRZA 3GS2A 2DHIA 1N60A 2QSDA 1H8CA 3ZW3A 2DLWA 1PGXA 3L10B 3GP7A 1YN3A 3VR8B 1HTQA 1X1MA 1QQGA 1QOFA 3ZKJC 2KAJA 1FIQA 3AXCA 5CHFA 3NS1A 3BZDB 2RDGA 1FCLA 1P7EA 3BIID 2IO0B 4WJOA 1PUTA 3MTNB 1RAXA 1V89A 2ZNVC 2GCJA 2LHDA 2D3CA 1RFAA 3PSCA 4JL9A 4MJSB 2K8BA 1WXSA 2LD9A 2NTSA 1HE8A 1JRUA 5JHGA 4DX8A 1SIJA 3PO0A 4N58A 2D11A 3N1XC 5BYSA 4MSQB 4TYZA 1J7AA 3PVLA 2KJHB 2LXAA 1WG7A 3T9LA 2JX5A 2K6DB 1MPEA 1V5UA 4HB0B 1C4CA 1WGQA 4JKCA 2COCA 1FRDA 4K1RB 4MT5A 1FOEA 2RUKB 1MJDA 2A4ZA 2DYOA 3NY5A 3TMPB 2LFIA 2I38A 3RNAC 2D4QA 2UWQA 3TVVA 2COAA 3A8QA 1YIWA 2JU6X 2KVZA 3EUB2 3IHPC 3DWMA 2CJOA 1F52A 2M8SA 1TKEA 5HE1A 2WXJA 2VZKB 2P8VA 2UZSA 3DVNV 2ROVA 1XF5L 5D3IB 4KHOA 2RSUA 3FLVA 2MWSB 2YEPF 2DAJA 2FCNA 3P4SB 3EHVA 3SDLC 4DHJD 1U5FA 1KH0A 5JHHA 1NU2A 4TQ1A 4NZLB 2RRFA 4C7YA 3EPYA 1LXDA 4KAXB 3CXBB 2ELBA 4FJVB 5LG4B 4ILGB 2GLSA 3EA6A 1JRPA 3PZ7A 3FM8C 1D5ZC 1V81A 2IYBA 4C0AA 4YSZB 2KJ6A 4DBBA 3VFKA 2NZ8B 3A9KB 4RF1A 4M8MA 4PS7A 3B2FA 4B95A 2XNAC 5G55A 4C4VA 2O2VB 2KXJA 1WR6E 4II3B 1N62A 1NEKB 3BK2A 4O1NA 2Q13A 1TS5A 5MPOA 3MHZA 4E3CA 1L4ZB 5I4DA 2LMCA 1N61A 3KVFB 4LCDE 2BVCA 4YSYB 2WYQA 2WP9B 2VSZA 2OOBB 4JKEA 3BYYB 1XLPA 4JLCA 1K50A 2KHWB 3SYXA 5HE3A 4JKGB 1K5GB 1ST7A 2QHOA 5LXIB 4N9F4 2C5LC 4HCNB 2K1FA 1EWCA 2J0KA 3URYA 3OJ3A 3ZTDA 4YONA 2WDQB 4D2KA 2K8HA 2FCMA 1DYNA 2LG1A 3SD5A 2MHJA 1P7FA 1YNTE 3M95A 1SGHA 3GZNI 1GB4A 2L3ZA 2KX3A 1ZXIA 3N1YC 5I2SA 1EGXA 1QQRA 4P6VF 1RRBA 2EMSA 1B1ZA 1E6EB 2M1MA 3D8DA 1WXVA 3B1LX 1MVKA 3TEWA 2J42A 4GDLB 4CQNA 2D3AA 1YD8U 1WRIA 3TL5A 1RM6C 1JW9D 2O2VA 2WHIA 3W9CB 4DDID 3FAHA 4DHJB 1H4RA 3VHTC 1N5WA 3Q3NC 4NNJB 4MGIE 2L2IA 1V5OA 1IPGA 4EZJA 3PZDA 2KFKA 4EKUA 1JCKB 1STEA 2IY1B 5D2MB 3LJ3A 3KUDB 4ICVA 2KGXB 2BKRB 2K3UA 3H9DA 4IOYX 3I5JC 1X1FA 2WGSA 1ZM0A 3APDA 1CJEA 3RT3B 1R4MB 3U7DA 1U5EA 3KUCB 4HEA1 2LGDA 1TIFA 1TGZB 1BXTA 1BAKA 1TBEA 3Q3OC 4EE2A 1OQQA 3V62A 3RD2A 4JK8A 2BTEA 2KQ7A 2EKIA 3T3OA 2MP2B 3TW1A 2V3PA 3UQBA 4GPTB 5DPRA 2GBMA 1VCBA 4DXGA 3QX1A 4NJ7A 2JPHA 2DZKA 2N0YA 3ODWA 1KF6B 1ZW7A 1R4NB 2LZ6A 4OVZA 4A3PA 3P7ZA 3A33B 1L7YA 4TUUA 4II2B 2DFKA 4WJPA 3IFWB 1J8CA 3U8ZA 3NWDA 1PFJA 4JKGA 2R2OA 4RMAA 5DPSA 1FO4A 4REZA 2H7DA 1YQ4B 1XCTL 3KZ1A 5GXGB 2Z59B 3I57A 5FR6A 4JK9A 4XGAB 2AEHA 2N1VA 2ZW1A 4JGHB 2PVOD 5DCNA 2YT2A 3DBHI 4GNKB 3EECA 2R09A 4HKQA 3ZTCA 2KJRA 3RCPA 4AJWA 1UGMA 1K5DB 3MPXA 4HKZE 1M7RA 4WH4A 2K0PA 2FCSA 2PW9A 2NBWB 1P1AA 1WGUA 3E9OA 4RH6A 4BBNC 2JQRB 2Y8GA 1U29A 2VH1A 4OVUA 1CZPA 4XE0A 2M19A 1X1GA 1Y5OA 2P0HA 3L17A 5IOIA 2L0TA 4GN1A 1VD2A 4DHZE 2Z0EB 1MAIA 3W2DA 4G0NB 1NDDA 2VH2A 2KKCA 2A5UA 1Z87A 3N20C 4HCPB 3QWZB 5J3TA 4I6NB 1FGYA 1WVHA 2ZW0A 3ML8A 5T8IA 2N9XA 2N9EB 3GYOA 3FVCA 4W9HA 5HHDG 4ANVA 2QKMA 4ZRPA 3AJ4A 3ULBA 5C23A 4XDDA 3P4PB 2ZPYA 3Q69A 3BVZA 1WGGA 1E9MA 2W3SA 1I42A 3ULCA 2GBNA 1YJ1A 3L13A 1A5RA 1FMAD 3QIJA 2UZRA 2LULA 1P6SA 4Q2JA 3UIOB 5J3QA 4JE3B 3W1SC 2CS4A 3RCZA 3NW8A 4NJCA 1HZ6A 3NUHB 4F8CB 2K2JA 4GMVA 4FN2A 3SNHA 4MEMA 1WZ3A 1WI1A 2WLBA 2NMBA 1XX0A 1K53A 2KWUB 1NTVA 1N3HA 3CSFA 4P1BC 1MKEA 4RFBA 2NVUI 2GCLA 5EFXA 3MHSD 3EGRA 5GMVA 3G9WA 5LONB 3PV1A 1T6BX 4DXAB 1L2NA 3RUIB 4GDLA 4CO7A 4ILJA 3MC0B 1YOVB 2MX2A 4W9KA 1GB1A 2Y8FA 3TEXA 1CQVA 2DYBA 3V3XA 1Y8RC 2VKIA 2XK5A 3AE8B 1BT0A 2CRFA 2I5FA 5BMGA 2KVRA 1MK9B 3KSYA 4EUTA 5EE3A 3RNGC 2JRHA 4K17A 1XLNA 3R2IA 4L1BA 2YVCA 2R61A 1HB8A 2OJWA 1FPYA 1C9FA 4KHBB 4FLHA 1FHWA 3V6CB 4NAWB 3PTFC 2MBEA 2WXKA 3UQAA 2WXGA 2KZRA 3AU5A 2L05A 1XD4A 4MH8A 1TXDA 4HAUB 2IY0B 1OQRA 1V6EA 4NPNA 1JDEA 4FHKA 1KI1B 5KHOA 3HRDD 2JSVX 5IN7A 2IPKD 4ZDVA 3ZO5B 2IO2B 2MQJA 4YL8A 2V3SA 2KNBA 2CAYA 1AN8A 3JVZX 4L2YA 4ZRQA 3NZ3A 3AE5B 2I1JA 1Q67A 3AB5A 1DYQA 1RRPB 4YTNB 1FNVA 1MPHA 1TS3A 1T0SC 3AE9B 4EJNA 4BOSC 3RULA 3PLVA 2EKEC 1LM8B 2QC8A 2NR2A 4RGOS 5DI9B 3AEFB 1EAZA 4JPSA 2LRUA 3AE7B 3FILA 4OW0A 1FB8A 5D3YA 5E6PA 3UF8A 1RYJA 1TY2A 2CKHB 2HJ1A 4HHVA 2I5CA 2IZVB 4GSWA 4M00A 3W5UB 1OMWA 2FNJB 4QXAB 1TZ1A 1OGWA 3A1QB 1DOXA 2WU2B 1V61A 4MH0E 1XLOA 3SHQA 1OEYJ 1QOGA 2E3TA 1OQNA 3NSUA 1F9JA 4A3OA 3VH3B 4WIPA 4C4VB 5G5HA 4A6KA 4DIXA 4A9AA 4JIOU 3E9SA 3ZDMC 3IT6B 1WXMA 2LGXA 3L54A 5FR3A 2G4DB 2GBJA 4JWSC 4XWWA 4ICUA 1XODA 1U5DA 1X05A 1E7VA 2C7HA 2FUG1 4WQMA 3ZNHB 4HAZB 3X0WA 4KIKA 3KWVA 4G3XB 5KQ1A 2W9NA 1TJEA 2RNRB 5J3YA 4GU2A 4CYEA 1YMHE 5KHQA 2KDEB 2D07B 4EOYA 2ABDA 3Q3FA 4XX5A 3D8FA 1ROEA 2RDHA 4HATB 3AE1B 3DBHB 4A6QA 3AE2B 2AYOB 1WGRA 4XC2A 1AYFA 2CQUA 3VDZA 3FC4A 1WMHA 3BY4B 1NVID 2K8CA 5H8YE 3J9CA 5M4YB 1GOZA 4KKIA 5LOPB 3AMZA 1HEZE 1WJ4A 4YT0B 2ZZPB 1AARA 2KTRA 3RNBC 4NAWA 1KZGA 2Y7BA 2MP2A 2MBBB 1WJ1A 1VZ7A 1W1DA 4EZLA 2ONQA 3E9PA 1F1HA 2ICIA 4YTMB 2K9XA 2QIEB 4A90A 4US8A 4WVFB 4K3CA 2JXTA 5AZHA 1SXTA 2LOZA 2XN9C 3PRPB 1KLUD 3HIEA 2PIAA 2DYNA 1VBGA 2PPHA 1VJKA 2ZNVB 3OAWA 3HW2B 5DPTA 1YJIA 4RM9A 2WXPA 2KLCA 1FXTB 3W5VB 1ET6A 1XD3B 2N7JA 3R2TA 4JKBA 3U52E 1EU3A 1NI3A 4JKFA 2PVGC 4W9GA 5JZEB 1Q10A 4BVUC 2B3AA 2P0FA 1HZ5A 1JWBD 3QARA 2OTXA 2JZ3B 2NBUA 2JVCA 3EFUA 2Z8LA 1V5PA 1PLSA 2G1EA 4IM0A 4LNIA 2RSGA 4L23A 4F7UP 3WYFB 4KSLC 3MDBC 3VQIA 4PYUA 5LNK1 1N5XA 1WGDA 1UF0A 4RM8A 3NWFA 2KOXA 1FFVA 5KCVA 3CIKA 2LJIA 2EC1A 3P42A 2WXRA 3ENEA 2COPA 3VH4B 1P9DU 1HB6A 3PEGA 3RN9C 3VUXA 1RLFA 3LDZE 1GC6A 2D5GA 2FIDA 5IJMA 5JLJB 2X0SA 1WR1A 3M63B 1SE2A 5JVLA 1S3SG 1WRDB 4M02A 2JZPA 2DZJA 4HXDA 1DROA 4GIVA 1KOTA 5HG2A 3DBSA 1FXAA 3FP5A 1I4HA 3P6AA 4HWIB 4AOFA 3U7ZA 1NI2A 2KQ4X 1V97A 2LUEA 2IDYA 2JP2A 1K52A 3ABVB 1GGOA 4J6IA 1IGCA 2FIFA 4W9FA 2WH5A 3UINB 2IGGA 2SAKA 4NQKE 2OJRA 3CSTA 1WZ0A 1IGDA 3HSAA 5HI1A 1QLBB 2HTHA 2GBRA 2QCZA 2GUMA 4J3OD 2PTLA 2MEKA 1BTNA 2KQSA 3PVWA 3ENBA 4BZAA 2Z4DA 4AUQC 3RI7C 2KT7A 2LGSA 1AWEA 1PQSA 1NTYA 2Z59A 4AQ7A 4CHMA 4Z2NA 3Q6BA 2W2WA 2IO1B 4FHJA 3I3TB 1C76A 2ASQA 4W9DA 2R2QA 1J7CA 2CR5A 2W82A 2L00B 4PNKA 1DDMA 4ZHOA 1QZEA 5C16A 1PGBA 4HK2A 4MGKE 5DH9B 1DDVA 1YQBA 1L4DB 1GJZA 5AZFA 4W9JA 1N63A 3PVUA 1VZ6A 1I2HA 4IM2A 3JSVA 4IAPA 5J18A 4IM3A 1TJ6A 1EWYC 4A5KA 1M94A 1BUIC 1JWUD 2M17A 1UPRA 2DBYA 2QKLA 2BT6A 4D6WA 4LJPB 1WJMA 3JW0X 1P3QU 1WSPA 3DBRI 1L0YB 1OEYA 4LNKA 4LNOA 3QA8A 3VTUA 4AJYB 1IRSA 2X38A 3LJUX 1ZPSA 2WDTB 2DTCA 4YWGG 3DVGX 3C19A 3MC8A 3AEAB 3UGBB 3KW5B 3P1MA 3N3KB 3AV8A 4F1SA 2DKQA 2M4NA 3PP2A 4K7SA 4KSKC 1ZSQA 1D6EC 2DZMA 2BS3B 1C77A 1MI0A 2W2XD 3DVNU 4FADA 1JWMD 1SSNA 2AX5A 1TZOA 3NZUA 2KCJA 4KZ0A 4PK1A 3ODOA 1I4GA 3DCGA 2NBVB 2Q5WD 2PZ1A 2SEBD 1IYFA 2NCNA 2XQNM 2JZZA 2BWFA 3P63A 4KDIC 1PYWD 2LGYA 1OQYA 4A6FA 2RPVA 3DDCB 4ANUA 2WS3B 3QHTA 2KMCA 2J0MA 2YT1A 3NHEB 3ZNID 3TUOA 3ZRCA 1V5TA 2PLPA 2L32A 2D9XA 4BKGA 4URKA 2WX0A 1T3QA 3L16A 4HDOA 3ECIA 3PLUA 3OHMB 2KDMA 4FULA 4OZAA 2GJYA 3D32A 3L4PA 1GPXA 5G5GA 1I4PA 5C5BA 2DKPA 1V1PB 2DA0A 1JMLA 1LW3A 2V76A 2M38A 4A55A 2C9WB 4OT1A 2HDEA 4B0MA 2LKOA 3ML4A 1IP9A 1U27A 3HM6X 3NWAA 3DWGC 2ON8A 3NVZA 4MELA 2ZCBA 2DX5B 4GDKA 3C8YA 5BMIA 2N9KA 4PYZA 1WM3A 1SE4A 1WH3A 3PG7A 1YN4A 2NBVA 1MI1A 1NBFC 4C00A 2E6XA 2MJDA 5FI0A 5L83A 2QJLA 3GE3C 1LO5D 2WX1A 1V5MA 1DOIA 3ZJTA 2CHWA 4GZUA 4HPLB 1TS2A 3R7RA 5IA7A 3IAS1 1I4QA 3DBLI 1TQZA 2L1CA 3BYTB 2TSSA 3A9JB 2INCC 3N30A 3L08A 1WFYA 3FSSA 2FJUB 2FJ9A 3W1SA 3ZXRA 2V9HA 2FJLA 2UVMA 3WAOA 2KYWA 2KTRB 5EE0A 4W9IA 2K22A 2FUHB 3ZNGC 2D9YA 1M7EA 1T0RC 1UBIA 4WSFA 2PMVA 2G35A 2G4SA 1ACAA 3JYUA 2JWUA 1D3ZA 1J19A 1MG8A 3QWMA 1TT5B 4EZKA 1FGZA 2J7QB 2KWVB 1RFKA 1VDVA 2MSED 4A20A 3P4QB 3AI5A 5BYRA 1ZP0B 1G6JA 4MDKE 1ZE3D 3B9JA 2DZIA 4WJQA 1GUAB 2BW2A 2CHXA 2DYQA 2BBCA 4IDIA 1UUPA 2O6VA 5D3XA 4DK5A 5TR5A 4JX1C 1NVLA 1L6UA 2N7DA 2JF5A 4ILHA 2KIEA 2OQBA 2EMTA 2KC1A 3VVWB 1XR0B 1GNUA 2FAZA 1V49A 2JRIB 4TSSA 1K51A 2CY5A 2B76B 3R3MA 2IJ0A 5E6OA 1YJJA 1LQBA 1E8WA 3HIZA 1QOBA 4MGYE 5EDSA 5JP4A 4KGTA 2IFSA 3ONSA 1CK1A 4UDUC 2KWDA 1PFDA 1R4NI 4M8NA 3SFDB 4C7ZA 4IFSA 3UI3A 3E9LA 2IBIB 1WYWB 3R7QA 4KX6B 4LNNA 3EFCA 2XK5B 2J59M 1XEEA 3AE3B 4B9KA 1F2RI 2D9VA 2W54A 3NJTA 1PGAA 3P2BA 2DIKA 3LXFA 3PT2B 3PZ8A 3AM9A 4M0WA 1FXIA 4BBKA 3SU8X 3A9KA 1MIXA 4ZYNA 4HROA 2BQQA 3V05A 2ZCCA 3IAM1 2WNMA 4ZRJA 5IRSA 4PQ0A 1EF1A 4BFRA 1OTRB 1BMLC 1Z2MA 2IO3B 3R66C 2BB6A 1OFFA 2BWES 3QC8B 4WQOB 4K2PA 4L6EA 3TIXA 1JWSD 2EJ8A 4EEWA 2INPE 1FHOA 1E90A 3OLMD 3PREA 1VLBA 4TV3A 3QAQA 4NQLB 3NVWA 1TKGA 2LHEA 2Y3AA 3ZGZA 1HXYD 2J52A 2LRWA 2LI5A 1T5XD 4B0EA 2C60A 2OHFA 2YSZA 3H6NA 1CMXB 2BS2B 1HTOA 1FEHA 1SE3A 1V9JA 2Y5CA 4KKJA 4US9A 3C0RB 2KACA 3HQCA 5IO9A 1WE6A 2C7MB 4AWJA 1WGYA 4LJOB 2CY4A 4G11A 1P5TA 3QK0A 2M14A 1AWDA 2WQYB 3VRBB 2K39A 2GBKA 2KMAA 2V1YA 2P0DA 3AULA 3WIMA 3TSSA 2KUPA 1YX6B 3SR6A 3RMKC 3PHXB 2V3NA 3T8MA 4HAWB 1IUEA 1EF5A 3NZSA
chains in the Genus database with same CATH topology
2AL3A 2ADZA 3BJIA 3SBGA 2NPTB 4PS8A 5GOWB 1V88A 3PGEA 4HVBA 4FBJB 2C7NB 4IUMB 4DWFA 2YT0A 4HB4B 2BGFA 2YS1A 2N9PC 2MBQA 2MLBA 1UD7A 4WWOA 3DXDA 3ZNZB 4GB9A 4MSMB 4IWQA 1WX8A 4DHZB 2MDXA 2YS5A 2KLGA 4G50A 2I1KA 2L8JA 4WJ7A 2W2XC 1EO6A 4ASWC 3D8EA 1Y19B 4AP4C 3ZRFA 3BINA 5JHBA 2LVPA 1ZKHA 1UNQA 2UYZB 4B6HA 2YRYA 4HAXB 1FAOA 2MBHA 2JY6A 4WWNA 2ROZB 3RYTA 4FJZA 5IAAC 1UBQA 4BBNF 4CHKA 3U30A 4OVVA 5L95C 4KHAA 5D7GA 1BTKA 3X23A 4HDQA 2RPQA 2MWNB 1S1QB 1UELA 2HJ8A 3TBLD 2MKRA 1DDWA 5HKHA 1EUVB 3PSEB 4HPMB 4K7UA 2VRRB 1RJ2A 2GOWA 4F7ZA 1DBHA 2YF0A 4MJSA 3V5WA 1GC7A 4K2OA 2N23A 3IBEA 2FCQA 3SO6A 1Q1OA 3HM3A 3MJWA 1R4MI 3KYCD 4LDTD 4H8SA 1SE9A 2AL6A 3ZVVA 1UH6A 2HE7A 4HB3B 5J17A 3N7CA 1KC7A 4ZRKA 3E66A 2MBOA 1WX7A 4Y94A 2Z0PA 2CB8A 4F7HA 2VRWB 2CHZA 2BF8B 4HJKA 2KDFB 1KZ7A 3H1UA 2K2UA 2RR9A 2RGFA 2LWPA 5HE0A 3ML9A 3WA0A 5CTRC 3O65B 1J0GA 5JHAA 5E6NA 4GXBA 1WX9A 1U4AA 3SUZA 4FJYA 1XKEA 3H7SA 1E8XA 1KJTA 4EMOA 3APFA 3TFMA 2LBBA 3ZDTA 1WJNA 2NS5A 1J0WA 3QBVB 1Q5WB 4KV2A 5CHWA 4TQ0A 2DX1A 4W9EA 2KK8A 4JKDA 2MCNB 2PEAA 1QC6A 4Z2MB 3DVGY 1WJ6A 2KO3A 1E5WA 2LVOA 1WMHB 1V2YA 3EC8A 4W9CA 3AU4A 2G3QB 4KZCA 2HD5B 5FI1A 4HLEA 4I6LB 4GMXB 2CODA 2ZEQA 4FA6A 4KDLB 1P98A 3H7PA 3PPAA 1GG3A 1E8ZA 1DIKA 4MGZE 2RD0A 1E8YA 1C1YB 3SBTA 3NS8A 2GMIC 5KQ4A 2L0FA 2PE6B 3DPDA 1FHXA 4BOZB 2K6QA 3KH0A 2BKFA 2KC2A 2D10A 4IW0A 4ANXA 3QQ8B 4ZRIA 3O96A 3TJPA 2RLOA 3A4SC 1MIZB 1P0RA 3A9JA 2BYEA 5CLQB 3PRMB 2DENB 2XEWA 1B55A 2ZVNA 4JQWC 3CMMB 3JSVB 2REXA 4WAAA 2GS0A 5AEKB 1ZC3B 3KRWA 4BKSD 2Y5BB 2R82A 2COFA 1WJUA 4DBGA 3KY9A 3KUZA 2PJHA 2NPTA 3VUWA 3B0AA 4K7WA 5HE2A 5JH5C 2LJ5A 2JUOA 1SIFA 4MY6A 2BYVE 4HAVB 1WF9A 3Q3JA 1XT9B 5CHVC 2H7EA 1WXAA 1YX5B 4D0NB 1KLVA 2LYDA 3DXCA 4P7IA 1U2BA 4X57B 2YS3A 3A1QA 1WGHA 1U5GA 2O6VD 3KYDD 4NJ6A 3HHMA 2KN5A 4PS3A 1V80A 5DHFB 5C5BB 2KD0A 2ZPNA 3VUYA 2HRJA 3N32A 2HTHB 2D9ZA 2N1WA 1UNRA 1C3TA 1X11A 1SHCA 1I7AA 2KDBA 4WWPA 3TO1A 4DDGD 2JWZA 3QJZA 4GGQA 4KIKB 4TKNA 3VTVA 2KX0A 4GDKB 1XCGA 3WAPA 4A6FB 2LASA 2BCJA 5D3WA 1WM2A 3QCAA 5LXHA 3OANA 4JKHA 1AQCA 1VBHA 3SV1A 4NY0A 2RGNB 2Z0OA 2AWTA 3T06A 3S2AA 1ZVRA 3M1IB 5C6RA 4XZ4A 1H10A 1W1HA 3ZLZA 3GOEA 3M3JA 2FDQA 1Q0WB 5CX3A 3V61A 5AZGA 5D3VA 3A4RA 2N4FA 2E2XA 3WANA 4GOCA 3ZIMA 4CHJA 4KVGB 4A6HA 4E71A 2PE9A 2G45B 1BWNA 1XQQA 4IWOA 4JK7A 3DQVA 4IC7B 5L81A 3VOQA 3H7PB 2CU1A 2JXXA 2Z0DB 4EFOA 1WY8A 3RZFA 3V60A 2DAFA 2V4LA 1K8RB 4I6PA 2ZVOA 1ZGUB 5C79A 4HAYB 5D6JB 2LVQA 4BKSA 2L7RA 2DHJA 3VXWA 1P3RA 2RVBB 3F0WA 1UZXB 3UIPB 5LLIA 3CF6E 2M0XA 5BO4B 2D3GA 1HBKA 3NOBA 3ALBA 3IVFA 1WIAA 2K00A 2MW5A 3VAWA 1T0YA 4B6WA 1KBLA 3L0WB 3WAMA 4IWPA 3HK0A 2J0JA 5G2NA 4NSWA 2WWZA 1TTNA 3A8PA 3PS6A 4XWXA 2LXCA 3ZUNA 2LOXA 2BPSA 2XBBC 1E7UA 3K9PB 2KWCA 2KFKB 2YLMA 3V6EB 1X86A 2N7EA 3UZTA 3M62B 2X18A 3A98B 5DIFB 2L76A 3OJ4B 3WALA 2BYFA 4W9LA 2KANA 4WJNA 2MFQA 4E74A 1UPQA 4MT7A 5DHAB 5C1ZA 1OY2A 1KM7A 1WI0A 1V86A 3KRXA 4BKTA 4ANWA 2Z0QA 2DYMA 1WE7A 4IG7B 5D94A 3APCA 4MK0A 3RZWC 1Z5SB 2D2QA 2DN6A 2KFJA 3VTWA 4DX90 3IG3A 2MRPA 3FEHA 3DXEA 3B08A 4LDTB 3ODXA 1NTIA 3DOWA 3PHWB 1LFDA 2ELAA 3ZVRA 5J2RA 2DX5A 1I35A 4MM3A 2DHZA 5DPWA 2O6VB 3GYPA 1UEFA 1W1GA 3F5RA 3VIAA 2RQ1A 4F7GA 1ISNA 1MK7B 3W1YA 4HB2B 5D27A 4K81A 4JKAA 2MA9B 1ZC4B 2KTFA 4M0WB 2D9WA 1PMSA 2ZJDA 1LB1A 1EVHA 5CLLB 2DHKA 2K25A 2IYDB 2R0DA 2KDIA 3TCAA 2JT4B 3K9OB 1UNPA 3PRZA 2DHIA 1H8CA 3ZW3A 2DLWA 3L10B 1X1MA 1QQGA 3ZKJC 3AXCA 5CHFA 2IO0B 4WJOA 3MTNB 1RAXA 1V89A 2ZNVC 2GCJA 1RFAA 3PSCA 4JL9A 4MJSB 2K8BA 1WXSA 2LD9A 1HE8A 1JRUA 5JHGA 4DX8A 2D11A 4MSQB 4TYZA 3PVLA 2KJHB 2LXAA 1WG7A 3T9LA 2K6DB 1V5UA 4HB0B 1WGQA 4JKCA 2COCA 4K1RB 1FOEA 2RUKB 2DYOA 2A4ZA 3NY5A 3TMPB 2D4QA 2UWQA 3TVVA 2COAA 3A8QA 1YIWA 3IHPC 2M8SA 5HE1A 2P8VA 2UZSA 3DVNV 2ROVA 4KHOA 2RSUA 3FLVA 2MWSB 2DAJA 2FCNA 3EHVA 3SDLC 4DHJD 1U5FA 5JHHA 1NU2A 4TQ1A 3EPYA 1LXDA 4KAXB 3CXBB 2ELBA 4FJVB 4ILGB 3FM8C 1V81A 2IYBA 4C0AA 2KJ6A 4DBBA 3VFKA 2NZ8B 3A9KB 4M8MA 4PS7A 4B95A 5G55A 2O2VB 2KXJA 1WR6E 4II3B 2Q13A 4E3CA 3KVFB 4LCDE 2WYQA 2VSZA 2OOBB 4JKEA 4JLCA 2KHWB 3SYXA 5HE3A 4JKGB 1K5GB 1ST7A 2QHOA 5LXIB 4N9F4 4HCNB 2C5LC 2K1FA 2J0KA 3OJ3A 3ZTDA 4YONA 2K8HA 2FCMA 1DYNA 2LG1A 3SD5A 3M95A 1SGHA 3GZNI 2L3ZA 2KX3A 1EGXA 1RRBA 2EMSA 2M1MA 3D8DA 1WXVA 3B1LX 4GDLB 1YD8U 3TL5A 2O2VA 4DDID 4DHJB 3VHTC 1H4RA 4NNJB 4MGIE 2L2IA 1V5OA 1IPGA 4EZJA 3PZDA 2KFKA 4EKUA 2IY1B 5D2MB 3LJ3A 3KUDB 4ICVA 2KGXB 2BKRB 3H9DA 4IOYX 1X1FA 1ZM0A 3APDA 3RT3B 3U7DA 1U5EA 3KUCB 2LGDA 1TGZB 1TBEA 1BAKA 3V62A 3RD2A 4JK8A 2KQ7A 2MP2B 3TW1A 3UQBA 4GPTB 5DPRA 2GBMA 1VCBA 3QX1A 4NJ7A 2JPHA 2DZKA 2N0YA 3ODWA 1ZW7A 2LZ6A 4A3PA 3P7ZA 3A33B 1L7YA 4TUUA 4II2B 2DFKA 4WJPA 3IFWB 1J8CA 3U8ZA 5DPSA 1PFJA 4JKGA 2R2OA 4RMAA 2H7DA 3KZ1A 2Z59B 5FR6A 4JK9A 2AEHA 2N1VA 4JGHB 5DCNA 3DBHI 3EECA 2R09A 3ZTCA 2KJRA 3RCPA 4AJWA 1UGMA 1K5DB 3MPXA 1M7RA 2FCSA 2NBWB 1P1AA 1WGUA 3E9OA 4BBNC 2Y8GA 1U29A 4OVUA 1X1GA 1Y5OA 2P0HA 3L17A 2L0TA 4GN1A 1VD2A 4DHZE 2Z0EB 1MAIA 4G0NB 1NDDA 2KKCA 2A5UA 1Z87A 4HCPB 3QWZB 5J3TA 4I6NB 1FGYA 1WVHA 3ML8A 2N9XA 2N9EB 3GYOA 4W9HA 4ANVA 2QKMA 3AJ4A 3ULBA 5C23A 2ZPYA 1WGGA 1I42A 3ULCA 2GBNA 1YJ1A 3L13A 1A5RA 3QIJA 2UZRA 2LULA 1P6SA 3UIOB 5J3QA 3W1SC 2CS4A 3RCZA 4F8CB 2K2JA 4GMVA 4FN2A 3SNHA 4MEMA 1WZ3A 1WI1A 2NMBA 1XX0A 2KWUB 1NTVA 1N3HA 3CSFA 1MKEA 2NVUI 2GCLA 5EFXA 3MHSD 5GMVA 3G9WA 5LONB 3PV1A 1L2NA 4DXAB 3RUIB 4GDLA 4CO7A 4ILJA 2MX2A 4W9KA 2Y8FA 2DYBA 1Y8RC 2VKIA 2XK5A 1BT0A 2CRFA 2I5FA 2KVRA 1MK9B 3KSYA 4EUTA 2JRHA 4K17A 2YVCA 1HB8A 4KHBB 4FLHA 1FHWA 3V6CB 4NAWB 3PTFC 2MBEA 3UQAA 2KZRA 3AU5A 2L05A 1XD4A 1TXDA 4HAUB 2IY0B 1V6EA 4NPNA 1JDEA 4FHKA 1KI1B 5KHOA 4ZDVA 3ZO5B 2IO2B 2MQJA 4YL8A 2V3SA 2KNBA 2CAYA 3JVZX 2I1JA 1Q67A 1RRPB 1MPHA 4EJNA 4BOSC 3RULA 3PLVA 2EKEC 1LM8B 2NR2A 5DI9B 1EAZA 2LRUA 1FB8A 5D3YA 5E6PA 3UF8A 2CKHB 4HHVA 2I5CA 2IZVB 4GSWA 1OMWA 2FNJB 1TZ1A 1OGWA 3A1QB 1V61A 4MH0E 3SHQA 1OEYJ 1OQNA 3NSUA 1F9JA 4A3OA 3VH3B 4A6KA 4JIOU 3ZDMC 1WXMA 2LGXA 3L54A 2G4DB 2GBJA 4ICUA 1XODA 1U5DA 1X05A 1E7VA 2C7HA 3ZNHB 4HAZB 3X0WA 4KIKA 4G3XB 5KQ1A 2W9NA 2RNRB 5J3YA 4GU2A 4CYEA 5KHQA 2KDEB 2D07B 4EOYA 2ABDA 3Q3FA 4XX5A 3D8FA 4HATB 2AYOB 1WGRA 4XC2A 2CQUA 3VDZA 1WMHA 3BY4B 2K8CA 5LOPB 1WJ4A 2ZZPB 1AARA 2KTRA 4NAWA 1KZGA 2Y7BA 2MP2A 2MBBB 1WJ1A 1W1DA 4EZLA 3E9PA 4WVFB 5AZHA 2LOZA 3PRPB 2DYNA 1VBGA 2PPHA 2ZNVB 3OAWA 3HW2B 5DPTA 4RM9A 2KLCA 1FXTB 1XD3B 4JKBA 4JKFA 4W9GA 5JZEB 4BVUC 2B3AA 2P0FA 3QARA 2OTXA 2JZ3B 2NBUA 2JVCA 3EFUA 1V5PA 1PLSA 4IM0A 2RSGA 4F7UP 3WYFB 4KSLC 3MDBC 3VQIA 4PYUA 1WGDA 4RM8A 2KOXA 5KCVA 3CIKA 2EC1A 3ENEA 2COPA 3VH4B 1P9DU 1HB6A 3PEGA 3VUXA 1RLFA 3LDZE 1GC6A 2FIDA 5IJMA 5JLJB 2X0SA 1WR1A 3M63B 5JVLA 1S3SG 1WRDB 2DZJA 4HXDA 1DROA 4GIVA 1KOTA 3DBSA 3FP5A 4AOFA 3P6AA 4HWIB 1NI2A 2LUEA 2JP2A 1GGOA 4J6IA 2FIFA 4W9FA 2WH5A 3UINB 4NQKE 2OJRA 3CSTA 1WZ0A 2HTHA 2GBRA 1BTNA 2KQSA 3PVWA 3ENBA 4AUQC 1AWEA 1PQSA 1NTYA 4CHMA 4Z2NA 2W2WA 2IO1B 4FHJA 3I3TB 2ASQA 4W9DA 2R2QA 2CR5A 2L00B 4PNKA 1DDMA 1QZEA 5C16A 4HK2A 4MGKE 5DH9B 1DDVA 1YQBA 1GJZA 5AZFA 4W9JA 3PVUA 1I2HA 4IM2A 3JSVA 4IAPA 5J18A 4IM3A 1TJ6A 4A5KA 1M94A 2M17A 1UPRA 2QKLA 4LJPB 1WJMA 3JW0X 1P3QU 3DBRI 1OEYA 4AJYB 3QA8A 3VTUA 1IRSA 3LJUX 2WDTB 2DTCA 3DVGX 3UGBB 3KW5B 3N3KB 4F1SA 2DKQA 2M4NA 3PP2A 4K7SA 4KSKC 1ZSQA 2DZMA 2W2XD 3DVNU 4FADA 3NZUA 2KCJA 4KZ0A 3ODOA 3DCGA 2NBVB 2PZ1A 1IYFA 2NCNA 2XQNM 2JZZA 2BWFA 4KDIC 1OQYA 2LGYA 4A6FA 4ANUA 3DDCB 3QHTA 2KMCA 2J0MA 2YT1A 3NHEB 3ZNID 3ZRCA 1V5TA 2D9XA 4BKGA 4URKA 2WX0A 3L16A 4HDOA 3ECIA 3PLUA 4FULA 2GJYA 3D32A 5C5BA 2DKPA 2DA0A 1LW3A 2V76A 2M38A 2C9WB 1IP9A 2LKOA 3ML4A 1U27A 3HM6X 4MELA 2ZCBA 2DX5B 4GDKA 4PYZA 1WM3A 1WH3A 3PG7A 1NBFC 5FI0A 5L83A 2WX1A 1V5MA 2CHWA 4GZUA 4HPLB 3R7RA 5IA7A 3DBLI 1TQZA 2L1CA 3A9JB 3N30A 3L08A 1WFYA 3FSSA 2FJ9A 3W1SA 2FJLA 2UVMA 3WAOA 2KTRB 4W9IA 2FUHB 3ZNGC 2D9YA 1M7EA 1UBIA 4WSFA 2G35A 2G4SA 1ACAA 3JYUA 1D3ZA 1J19A 1MG8A 3QWMA 4EZKA 1FGZA 2J7QB 2KWVB 2MSED 4A20A 3AI5A 1G6JA 4MDKE 2DZIA 4WJQA 1GUAB 2CHXA 2DYQA 2O6VA 5D3XA 4DK5A 5TR5A 1NVLA 2N7DA 2JF5A 4ILHA 2OQBA 2EMTA 2KC1A 3VVWB 1XR0B 1GNUA 2FAZA 1V49A 2JRIB 2CY5A 3R3MA 5E6OA 1LQBA 1E8WA 3HIZA 4MGYE 5JP4A 2IFSA 3ONSA 1R4NI 4M8NA 4IFSA 3E9LA 2IBIB 1WYWB 3R7QA 2XK5B 2J59M 4B9KA 2D9VA 3P2BA 2DIKA 3PT2B 4BBKA 3SU8X 3A9KA 1MIXA 4ZYNA 2ZCCA 4ZRJA 4PQ0A 1EF1A 4BFRA 1OTRB 1Z2MA 2IO3B 3R66C 2BWES 3QC8B 4WQOB 4K2PA 4L6EA 3TIXA 2EJ8A 4EEWA 1FHOA 1E90A 3OLMD 3PREA 4TV3A 3QAQA 4NQLB 2LRWA 2LI5A 2C60A 2YSZA 3H6NA 1CMXB 1V9JA 3C0RB 3HQCA 1WE6A 2C7MB 4AWJA 1WGYA 4LJOB 2CY4A 4G11A 1P5TA 3QK0A 2M14A 2K39A 2GBKA 2KMAA 2V1YA 2P0DA 3AULA 3WIMA 2KUPA 1YX6B 3PHXB 3T8MA 4HAWB 5EDSA 1EF5A 3NZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL3 A;  3T06 A;  3ENE A;  2COP A;  4NNJ B;  3VH4 B;  2ADZ A;  1HB6 A;  3BJI A;  2L2I A;  3PEG A;  1P9D U;  1V5O A;  1RLF A;  1IPG A;  2NPT B;  3PZD A;  3LDZ E;  1ZVR A;  5GOW B;  4PS8 A;  1GC6 A;  4EKU A;  1V88 A;  5IJM A;  3M1I B;  5C6R A;  2FID A;  2IY1 B;  2KFK A;  3PGE A;  2C7N B;  5JLJ B;  4XZ4 A;  1H10 A;  5D2M B;  4FBJ B;  1W1H A;  3LJ3 A;  1WR1 A;  3ZLZ A;  3M63 B;  4IUM B;  3GOE A;  3KUD B;  3M3J A;  2FDQ A;  1Q0W B;  5CX3 A;  3V61 A;  5AZG A;  1S3S G;  5D3V A;  4DWF A;  4ICV A;  2KGX B;  2YT0 A;  1WRD B;  2BKR B;  2N4F A;  4HB4 B;  3A4R A;  2E2X A;  2DZJ A;  2BGF A;  4IOY X;  3H9D A;  3WAN A;  4GOC A;  4HXD A;  2YS1 A;  3ZIM A;  1DRO A;  1X1F A;  4GIV A;  1KOT A;  2N9P C;  3DBS A;  1ZM0 A;  2MBQ A;  2MLB A;  1UD7 A;  4CHJ A;  3APD A;  3FP5 A;  4KVG B;  3RT3 B;  3U7D A;  4A6H A;  4WWO A;  3DXD A;  3P6A A;  2PE9 A;  2G45 B;  1NI2 A;  1U5E A;  4HWI B;  3ZNZ B;  3KUC B;  4GB9 A;  1BWN A;  1XQQ A;  2LUE A;  4IWO A;  2LGD A;  4MSM B;  2JP2 A;  1TGZ B;  4J6I A;  1TBE A;  1BAK A;  3DQV A;  4IC7 B;  5L81 A;  3VOQ A;  2FIF A;  4W9F A;  2WH5 A;  4IWQ A;  1WX8 A;  3V62 A;  3UIN B;  4DHZ B;  3RD2 A;  2MDX A;  2YS5 A;  3H7P B;  2KLG A;  2CU1 A;  2JXX A;  2Z0D B;  4G50 A;  2OJR A;  4NQK E;  2I1K A;  2L8J A;  3CST A;  4EFO A;  1WZ0 A;  2KQ7 A;  1WY8 A;  2MP2 B;  3TW1 A;  3RZF A;  2DAF A;  3V60 A;  2V4L A;  3UQB A;  4WJ7 A;  2W2X C;  4GPT B;  1K8R B;  4I6P A;  1EO6 A;  2HTH A;  2ZVO A;  5DPR A;  2GBR A;  4ASW C;  2GBM A;  1EF5 A;  1VCB A;  3QX1 A;  1ZGU B;  4NJ7 A;  3D8E A;  2JPH A;  5C79 A;  4HAY B;  1Y19 B;  2DZK A;  2N0Y A;  1BTN A;  3ODW A;  2KQS A;  2LVQ A;  3PVW A;  1ZW7 A;  2LZ6 A;  3VUX A;  4AP4 C;  3ZRF A;  4BKS A;  4A3P A;  3P7Z A;  2DHJ A;  2L7R A;  1L7Y A;  3A33 B;  3BIN A;  4TUU A;  1P3R A;  2LVP A;  4II2 B;  3VXW A;  4AUQ C;  2DFK A;  5JHB A;  1AWE A;  1PQS A;  1NTY A;  1UNQ A;  1ZKH A;  2UYZ B;  4WJP A;  2RVB B;  4CHM A;  3IFW B;  4Z2N A;  1J8C A;  3F0W A;  4B6H A;  2W2W A;  3U8Z A;  1UZX B;  5DPS A;  1PFJ A;  2R2O A;  4RMA A;  3UIP B;  2H7D A;  2YRY A;  3KZ1 A;  4HAX B;  2IO1 B;  4FHJ A;  2Z59 B;  3I3T B;  1FAO A;  5FR6 A;  4DDI D;  2MBH A;  2AEH A;  2ASQ A;  4W9D A;  2N1V A;  5LLI A;  2R2Q A;  3CF6 E;  4JGH B;  2CR5 A;  5DCN A;  2L00 B;  4PNK A;  1DDM A;  2M0X A;  3DBH I;  2JY6 A;  3EEC A;  4WWN A;  5BO4 B;  2ROZ B;  2D3G A;  3RYT A;  1HBK A;  1QZE A;  5C16 A;  2R09 A;  4FJZ A;  5IAA C;  1UBQ A;  4HK2 A;  4MGK E;  2KJR A;  3ZTC A;  4BBN F;  3NOB A;  5DH9 B;  3U30 A;  4CHK A;  1DDV A;  3RCP A;  1YQB A;  3S2A A;  4AJW A;  1UGM A;  4OVV A;  4HVB A;  1GJZ A;  3ALB A;  1K5D B;  3MPX A;  3IVF A;  5AZF A;  5L95 C;  4KHA A;  1WIA A;  4W9J A;  1M7R A;  2K00 A;  5D7G A;  2FCS A;  3PVU A;  1BTK A;  2NBW B;  3X23 A;  4HDQ A;  1I2H A;  1P1A A;  2RPQ A;  1WGU A;  4IM2 A;  3JSV A;  4BBN C;  2MW5 A;  4E71 A;  3VAW A;  4IAP A;  2Y8G A;  1U29 A;  2MWN B;  4OVU A;  1T0Y A;  1S1Q B;  4IM3 A;  5J18 A;  1UEL A;  1TJ6 A;  2HJ8 A;  4A5K A;  4B6W A;  1X1G A;  3TBL D;  1M94 A;  2MKR A;  1Y5O A;  2P0H A;  2M17 A;  3L0W B;  1DDW A;  1UPR A;  3L17 A;  2L0T A;  2QKL A;  5HKH A;  4GN1 A;  4LJP B;  1WJM A;  1EUV B;  3WAM A;  3JW0 X;  1P3Q U;  3HK0 A;  1VD2 A;  3DBR I;  3PSE B;  4IWP A;  4DHZ E;  2J0J A;  2Z0E B;  1MAI A;  1OEY A;  4AJY B;  3QA8 A;  4HPM B;  3VTU A;  4K7U A;  2VRR B;  1IRS A;  1NDD A;  4G0N B;  3LJU X;  2WDT B;  5G2N A;  2DTC A;  4NSW A;  2KKC A;  3DVG X;  1RJ2 A;  2A5U A;  2WWZ A;  1Z87 A;  2GOW A;  4HCP B;  4F7Z A;  1DBH A;  2YF0 A;  1TTN A;  3QWZ B;  3UGB B;  3KW5 B;  4MJS A;  3V5W A;  3A8P A;  5J3T A;  3N3K B;  3PS6 A;  1GC7 A;  1FGY A;  4XWX A;  4I6N B;  1WVH A;  2LXC A;  3ML8 A;  3ZUN A;  4F1S A;  4K2O A;  2DKQ A;  2N9X A;  2O2V A;  2M4N A;  2N23 A;  2LOX A;  3PP2 A;  3GYO A;  2BPS A;  2N9E B;  1ZSQ A;  2XBB C;  3IBE A;  1E7U A;  2DZM A;  4K7S A;  4W9H A;  2FCQ A;  3K9P B;  2QKM A;  3SO6 A;  3AJ4 A;  3ULB A;  5C23 A;  2KWC A;  2W2X D;  2ZPY A;  1Q1O A;  3HM3 A;  2KFK B;  1R4M I;  2YLM A;  3DVN U;  3MJW A;  3V6E B;  3VHT C;  1WGG A;  4FAD A;  1I42 A;  3KYC D;  4LDT D;  3ULC A;  1X86 A;  1YJ1 A;  2GBN A;  2N7E A;  4H8S A;  3L13 A;  1A5R A;  1SE9 A;  3UZT A;  2AL6 A;  3QIJ A;  2X18 A;  3M62 B;  2KCJ A;  2LUL A;  2UZR A;  1P6S A;  2HE7 A;  3A98 B;  5DIF B;  1UH6 A;  4KZ0 A;  3UIO B;  4ANV A;  4HB3 B;  5J3Q A;  2L76 A;  3OJ4 B;  5J17 A;  3W1S C;  3N7C A;  3ODO A;  2CS4 A;  3RCZ A;  3WAL A;  3DCG A;  4ZRK A;  2BYF A;  4F8C B;  4W9L A;  2K2J A;  2NBV B;  4GMV A;  4FN2 A;  3SNH A;  2KAN A;  4MEM A;  2MBO A;  1WX7 A;  1WZ3 A;  4WJN A;  1WI1 A;  4Y94 A;  2PZ1 A;  1IYF A;  2NMB A;  2XQN M;  1XX0 A;  2MFQ A;  2Z0P A;  2CB8 A;  4F7H A;  2BWF A;  2JZZ A;  2NCN A;  4E74 A;  2VRW B;  2KWU B;  1UPQ A;  4MT7 A;  2BF8 B;  2CHZ A;  5DHA B;  1OQY A;  2LGY A;  1NTV A;  4A6F A;  1N3H A;  4HJK A;  5C1Z A;  2KDF B;  1KZ7 A;  1OY2 A;  1KM7 A;  3CSF A;  4ANU A;  3DDC B;  1WI0 A;  2KMC A;  2J0M A;  2YT1 A;  3NHE B;  1MKE A;  3QHT A;  3H1U A;  3ZNI D;  1V86 A;  3ZRC A;  3KRX A;  2NVU I;  4BKT A;  4ANW A;  2K2U A;  2GCL A;  5EFX A;  1V5T A;  2RR9 A;  2RGF A;  2Z0Q A;  2LWP A;  3MHS D;  5HE0 A;  2DYM A;  2D9X A;  5GMV A;  3ML9 A;  4BKG A;  3G9W A;  3WA0 A;  1WE7 A;  5LON B;  2WX0 A;  3PV1 A;  4DXA B;  4IG7 B;  5D94 A;  3L16 A;  1L2N A;  3RUI B;  4HDO A;  4GDL A;  5CTR C;  3ECI A;  3O65 B;  3PLU A;  1J0G A;  3APC A;  4FUL A;  5E6N A;  4CO7 A;  5JHA A;  4MK0 A;  3RZW C;  1Z5S B;  2GJY A;  3D32 A;  2D2Q A;  2DN6 A;  4GXB A;  1WX9 A;  2Y8F A;  1U4A A;  2KFJ A;  4DX9 0;  2MX2 A;  3IG3 A;  3SUZ A;  2DYB A;  2MRP A;  3A9K B;  4FJY A;  1XKE A;  3FEH A;  4AOF A;  3H7S A;  1Y8R C;  2VKI A;  1E8X A;  2XK5 A;  4DHJ B;  3DXE A;  5C5B A;  1KJT A;  3B08 A;  2DKP A;  5D6J B;  1BT0 A;  2CRF A;  2I5F A;  1H4R A;  2DA0 A;  4EMO A;  3APF A;  1LW3 A;  4LDT B;  2M38 A;  2V76 A;  3ODX A;  2KVR A;  1NTI A;  1MK9 B;  3KSY A;  3DOW A;  3PHW B;  1LFD A;  3TFM A;  4EUT A;  2C9W B;  2JRH A;  2LBB A;  2ELA A;  3ZDT A;  2LKO A;  1U27 A;  3ML4 A;  4K17 A;  3ZVR A;  2DX5 A;  1WJN A;  2NS5 A;  3HM6 X;  5J2R A;  1I35 A;  2YVC A;  4MM3 A;  1J0W A;  3QBV B;  1Q5W B;  2DHZ A;  1HB8 A;  5DPW A;  2O6V B;  4KV2 A;  5CHW A;  3NZU A;  4MEL A;  3GYP A;  1UEF A;  4TQ0 A;  2DX1 A;  2ZCB A;  2DX5 B;  1W1G A;  4GDK A;  4W9E A;  4KHB B;  3F5R A;  1FHW A;  4FLH A;  4MGI E;  4NAW B;  3VIA A;  2KK8 A;  1WM3 A;  3PTF C;  4PYZ A;  3V6C B;  2RQ1 A;  4F7G A;  1WH3 A;  2MBE A;  3PG7 A;  2MCN B;  3UQA A;  2PEA A;  1ISN A;  1QC6 A;  4Z2M B;  2KZR A;  1MK7 B;  3AU5 A;  2L05 A;  3W1Y A;  1XD4 A;  3DVG Y;  1TXD A;  4HB2 B;  4HAU B;  5D27 A;  1NBF C;  2IY0 B;  1V6E A;  4NPN A;  5FI0 A;  5L83 A;  4K81 A;  2MA9 B;  4FHK A;  1ZC4 B;  1WJ6 A;  1KI1 B;  2KO3 A;  5KHO A;  2WX1 A;  1V5M A;  1E5W A;  2KTF A;  2LVO A;  1WMH B;  4M0W B;  1V2Y A;  4GZU A;  2D9W A;  2CHW A;  3ZO5 B;  4ZDV A;  2IO2 B;  4HPL B;  3EC8 A;  2MQJ A;  1PMS A;  4YL8 A;  2ZJD A;  1LB1 A;  2V3S A;  2KNB A;  2CAY A;  3JVZ X;  1EVH A;  4KDI C;  4W9C A;  3R7R A;  5IA7 A;  3AU4 A;  2I1J A;  1Q67 A;  3DBL I;  1TQZ A;  2L1C A;  5CLL B;  2G3Q B;  4KZC A;  2DHK A;  2K25 A;  2HD5 B;  2IYD B;  1RRP B;  2R0D A;  2KDI A;  5FI1 A;  3A9J B;  4HLE A;  1MPH A;  4EJN A;  4BOS C;  3TCA A;  4GMX B;  3N30 A;  2COD A;  2JT4 B;  3L08 A;  4I6L B;  1WFY A;  3RUL A;  3PLV A;  2EKE C;  2ZEQ A;  1LM8 B;  3FSS A;  4FA6 A;  2NR2 A;  2FJ9 A;  4KDL B;  3W1S A;  1P98 A;  5DI9 B;  3K9O B;  1UNP A;  1EAZ A;  3H7P A;  3PPA A;  2FJL A;  2UVM A;  2LRU A;  3PRZ A;  3WAO A;  1FB8 A;  2KTR B;  2DHI A;  4W9I A;  1GG3 A;  5D3Y A;  1E8Z A;  5E6P A;  3UF8 A;  2CKH B;  1H8C A;  3ZW3 A;  2FUH B;  2DLW A;  3ZNG C;  3L10 B;  4HHV A;  2D9Y A;  1M7E A;  4MGZ E;  2I5C A;  2IZV B;  1UBI A;  4GSW A;  2RD0 A;  1X1M A;  1OMW A;  4WSF A;  1E8Y A;  1QQG A;  1C1Y B;  2FNJ B;  1TZ1 A;  2G35 A;  2G4S A;  1ACA A;  3JYU A;  3ZKJ C;  1OGW A;  3NS8 A;  2GMI C;  5KQ4 A;  3AXC A;  5CHF A;  3A1Q B;  1D3Z A;  1J19 A;  1MG8 A;  2L0F A;  3QWM A;  4EZK A;  2PE6 B;  3DPD A;  1FGZ A;  1V61 A;  2J7Q B;  1FHX A;  2KWV B;  2IO0 B;  4MH0 E;  4WJO A;  2K6Q A;  3MTN B;  4BOZ B;  1RAX A;  3KH0 A;  1V89 A;  2BKF A;  2MSE D;  2ZNV C;  2GCJ A;  3SHQ A;  4A20 A;  3AI5 A;  1OEY J;  2KC2 A;  2D10 A;  1RFA A;  3PSC A;  4JL9 A;  4MDK E;  1OQN A;  3NSU A;  1F9J A;  4MJS B;  1G6J A;  2DZI A;  4A3O A;  2K8B A;  1WXS A;  2LD9 A;  3VH3 B;  1HE8 A;  1JRU A;  5JHG A;  4WJQ A;  4DX8 A;  1GUA B;  4IW0 A;  2CHX A;  2D11 A;  4ANX A;  4MSQ B;  4TYZ A;  4A6K A;  3QQ8 B;  4ZRI A;  2DYQ A;  3O96 A;  4JIO U;  3PVL A;  2KJH B;  2LXA A;  3TJP A;  2RLO A;  1WG7 A;  2O6V A;  3A4S C;  3T9L A;  1MIZ B;  3ZDM C;  5D3X A;  4DK5 A;  1P0R A;  5TR5 A;  3A9J A;  1WXM A;  2K6D B;  1NVL A;  2BYE A;  5CLQ B;  2N7D A;  2LGX A;  2JF5 A;  3L54 A;  4ICU A;  3PRM B;  1V5U A;  2OQB A;  2DEN B;  2G4D B;  2EMT A;  2KC1 A;  4HB0 B;  3VVW B;  2GBJ A;  1XR0 B;  2XEW A;  1B55 A;  1GNU A;  2FAZ A;  2ZVN A;  1V49 A;  2JRI B;  2REX A;  3CMM B;  1WGQ A;  2GS0 A;  1XOD A;  4JQW C;  4WAA A;  2COC A;  1U5D A;  5AEK B;  2CY5 A;  1X05 A;  1E7V A;  2C7H A;  4K1R B;  1ZC3 B;  3KRW A;  4URK A;  1FOE A;  3R3M A;  2RUK B;  2DYO A;  2A4Z A;  3NY5 A;  5E6O A;  3TMP B;  3ZNH B;  4BKS D;  1LQB A;  1E8W A;  4HAZ B;  3HIZ A;  3X0W A;  4KIK A;  4MGY E;  2D4Q A;  2UWQ A;  3TVV A;  2COA A;  3A8Q A;  1YIW A;  5JP4 A;  2Y5B B;  3IHP C;  2COF A;  2IFS A;  5EDS A;  4G3X B;  3ONS A;  1WJU A;  3VTW A;  2M8S A;  4DBG A;  3KY9 A;  5KQ1 A;  5HE1 A;  3KUZ A;  3ZVV A;  4EZJ A;  2W9N A;  2P8V A;  2PJH A;  2UZS A;  2RNR B;  5J3Y A;  4GU2 A;  4CYE A;  1R4N I;  5KHQ A;  2NPT A;  2KDE B;  4M8N A;  3DVN V;  4W9K A;  2ROV A;  3VUW A;  2D07 B;  3B0A A;  4EOY A;  2ABD A;  3Q3F A;  4K7W A;  4KHO A;  2RSU A;  3FLV A;  5HE2 A;  4IFS A;  5JH5 C;  2LJ5 A;  2MWS B;  2IBI B;  1WYW B;  3D8F A;  4XX5 A;  3R7Q A;  2DAJ A;  2FCN A;  2JUO A;  3EHV A;  3SDL C;  4DHJ D;  1SIF A;  2XK5 B;  1U5F A;  2J59 M;  4HAT B;  5JHH A;  1NU2 A;  4TQ1 A;  2AYO B;  4B9K A;  4MY6 A;  2D9V A;  1WGR A;  4XC2 A;  3P2B A;  2BYV E;  2CQU A;  4HAV B;  3VDZ A;  3EPY A;  1WF9 A;  3PT2 B;  1WMH A;  1LXD A;  3BY4 B;  4KAX B;  3CXB B;  2ELB A;  2K8C A;  4BBK A;  3SU8 X;  4FJV B;  3A9K A;  1MIX A;  4ZYN A;  4KSK C;  5LOP B;  3Q3J A;  1XT9 B;  3FM8 C;  1WJ4 A;  2ZCC A;  1V81 A;  5CHV C;  2H7E A;  2IYB A;  2ZZP B;  1AAR A;  1WXA A;  4C0A A;  1YX5 B;  2KTR A;  4ZRJ A;  2KJ6 A;  4D0N B;  4DBB A;  3VFK A;  4PQ0 A;  4NAW A;  1KLV A;  2NZ8 B;  1EF1 A;  1KZG A;  2LYD A;  1OTR B;  3DXC A;  2Y7B A;  2MP2 A;  2MBB B;  4P7I A;  1Z2M A;  1WJ1 A;  4M8M A;  4PS7 A;  1W1D A;  1U2B A;  4B95 A;  4EZL A;  2IO3 B;  4BFR A;  3R66 C;  5G55 A;  2BWE S;  2O2V B;  2KXJ A;  3QC8 B;  2YS3 A;  1WR6 E;  3A1Q A;  4WQO B;  4X57 B;  4K2P A;  4L6E A;  1WGH A;  1U5G A;  3TIX A;  3JSV B;  4II3 B;  2O6V D;  4WVF B;  2EJ8 A;  3KYD D;  5AZH A;  4EEW A;  2Q13 A;  1FHO A;  1E90 A;  3OLM D;  4NJ6 A;  3PRE A;  3HHM A;  2LOZ A;  3PRP B;  4TV3 A;  2KN5 A;  4PS3 A;  4E3C A;  3QAQ A;  2DYN A;  1V80 A;  4NQL B;  5DHF B;  5C5B B;  3KVF B;  2KD0 A;  2PPH A;  4LCD E;  2ZPN A;  2ZNV B;  3OAW A;  2HRJ A;  3HW2 B;  2HTH B;  3N32 A;  2WYQ A;  5DPT A;  3VUY A;  2VSZ A;  2OOB B;  2LRW A;  2KLC A;  4JLC A;  4RM9 A;  2D9Z A;  2N1W A;  2KHW B;  1UNR A;  3SYX A;  1FXT B;  1X11 A;  2LI5 A;  5HE3 A;  1C3T A;  1K5G B;  1ST7 A;  1XD3 B;  2C60 A;  2QHO A;  5LXI B;  1SHC A;  4N9F 4;  2C5L C;  1I7A A;  2YSZ A;  2K1F A;  2KDB A;  2J0K A;  3H6N A;  4HCN B;  1CMX B;  3OJ3 A;  4WWP A;  3TO1 A;  4YON A;  3ZTD A;  4DDG D;  1V9J A;  2K8H A;  2JWZ A;  2FCM A;  4W9G A;  3QJZ A;  4GGQ A;  4KIK B;  5JZE B;  1DYN A;  2LG1 A;  4TKN A;  2KX0 A;  3C0R B;  3SD5 A;  3VTV A;  3HQC A;  4BVU C;  4GDK B;  1WE6 A;  2C7M B;  4AWJ A;  1WGY A;  2B3A A;  1XCG A;  2P0F A;  4LJO B;  2CY4 A;  3M95 A;  1SGH A;  3QAR A;  2OTX A;  2JZ3 B;  2NBU A;  3GZN I;  2JVC A;  3EFU A;  4G11 A;  3WAP A;  2L3Z A;  1P5T A;  1PLS A;  1V5P A;  4A6F B;  2KX3 A;  2BCJ A;  1EGX A;  2LAS A;  3QK0 A;  4IM0 A;  5D3W A;  1RRB A;  2M14 A;  2EMS A;  2RSG A;  4F7U P;  1WM2 A;  3WYF B;  2M1M A;  4KSL C;  3D8D A;  3MDB C;  1WXV A;  3B1L X;  2K39 A;  3QCA A;  1IP9 A;  3VQI A;  5LXH A;  4PYU A;  2GBK A;  2KMA A;  3OAN A;  2V1Y A;  2P0D A;  3AUL A;  4GDL B;  3WIM A;  1WGD A;  2KUP A;  4RM8 A;  1YX6 B;  2KOX A;  3PHX B;  1AQC A;  1YD8 U;  3SV1 A;  3T8M A;  5KCV A;  4NY0 A;  2RGN B;  3CIK A;  4HAW B;  2Z0O A;  3TL5 A;  2AWT A;  2EC1 A;  3NZS A; 
#chains in the Genus database with same CATH topology
 2AL3 A;  4KGS A;  2ADZ A;  3BJI A;  3SBG A;  1NEN B;  2WXH A;  2NPT B;  3DHH C;  4PS8 A;  5GOW B;  1V88 A;  3PGE A;  4BAX A;  4HVB A;  4FBJ B;  2GI9 A;  2C7N B;  4RGM A;  4IUM B;  3RNF C;  2VZK D;  4DWF A;  2YT0 A;  4HB4 B;  1MHX A;  2BGF A;  2WXN A;  4S0R A;  1F2R C;  2YS1 A;  1J7B A;  1VZ8 A;  2N9P C;  2MBQ A;  2MLB A;  3GE8 C;  1UD7 A;  2L52 A;  4WWO A;  3DXD A;  2WXQ A;  3ZNZ B;  4GB9 A;  1F0Z A;  4MSM B;  4NAM A;  1FFU A;  1WGK A;  1C78 A;  4IWQ A;  1WX8 A;  1NYR A;  4DHZ B;  2MDX A;  2YS5 A;  5EE1 A;  2KLG A;  2X8X X;  2CJN A;  4G50 A;  2I1K A;  2L8J A;  4N6E B;  1SJE D;  2KUQ A;  1TY0 A;  5AUI A;  4WJ7 A;  2W2X C;  1EO6 A;  4ASW C;  3KWL A;  3D8E A;  1Y19 B;  4AP4 C;  3ZRF A;  3I9V 1;  3BIN A;  1ZDV A;  2INN E;  2LVP A;  5JHB A;  1ZKH A;  1UNQ A;  2UYZ B;  4B6H A;  2YRY A;  2UU7 A;  4HAX B;  1FAO A;  2MBH A;  5I2M A;  2EEL A;  2JY6 A;  4WWN A;  2ROZ B;  3RYT A;  4FJZ A;  5IAA C;  1UBQ A;  4BBN F;  4CHK A;  3U30 A;  4OVV A;  2H89 B;  5L95 C;  4KHA A;  1B9R A;  2V0G A;  5D7G A;  1BTK A;  4ITK A;  4HSI A;  3X23 A;  3Q8A A;  4HDQ A;  2RPQ A;  4C80 A;  2NTT A;  1E0Z A;  2MWN B;  3N9Y C;  4LTU A;  1S1Q B;  3RNC C;  1UEL A;  1WWT A;  2HJ8 A;  5E6J A;  4XDC A;  3TBL D;  2MKR A;  1DDW A;  5HKH A;  4K3B A;  1EUV B;  3BVG A;  3PSE B;  4HPM B;  3N1Z C;  4K7U A;  2VRR B;  1QOA A;  3U12 A;  4OHJ A;  1RJ2 A;  2GOW A;  4OZC A;  4F7Z A;  5IP4 D;  1DBH A;  2YF0 A;  2ACZ B;  4MJS A;  3V5W A;  1TKY A;  4IKG A;  3T3N A;  1GC7 A;  4K2O A;  4GLS C;  2N23 A;  3IBE A;  2FCQ A;  3SO6 A;  5EE9 A;  1Q1O A;  3HM3 A;  3MJW A;  1R4M I;  2Z13 A;  2M0A A;  2I2Y A;  3KYC D;  4LDT D;  1ZDX A;  4H8S A;  2FE8 A;  1SE9 A;  3SEB A;  2WXO A;  2AL6 A;  3ZVV A;  3MC9 A;  1UH6 A;  2HE7 A;  4HB3 B;  5J17 A;  3N7C A;  1KC7 A;  4ZRK A;  1SB3 C;  3E66 A;  4WWM A;  2MBO A;  1WX7 A;  3R8B A;  4Y94 A;  2Z0P A;  2CB8 A;  4F7H A;  3Q8C A;  2WXI A;  2VRW B;  2CHZ A;  2BF8 B;  1WYG A;  4HJK A;  1XCQ L;  2KDF B;  1KZ7 A;  4RGN A;  3H1U A;  3O13 A;  1VR9 A;  2RR9 A;  2K2U A;  2RGF A;  2LWP A;  3ZYY X;  1A70 A;  5HE0 A;  4OSN A;  1MFW A;  3ML9 A;  3WA0 A;  3AEG B;  4N59 A;  2QIL A;  1C4P A;  3GZN B;  5CTR C;  3O65 B;  1J0G A;  5JHA A;  5E6N A;  4GXB A;  1WX9 A;  1U4A A;  4OZB A;  3SUZ A;  4FJY A;  1XKE A;  1SBB B;  2QMT A;  3H7S A;  1E8X A;  2HTM E;  3ZJU A;  3Q8B A;  1KJT A;  4M01 A;  5HFY A;  4EMO A;  3APF A;  1QT9 A;  2J4X A;  1I4X A;  3MJ5 A;  3WCQ A;  3TFM A;  2LBB A;  3ZDT A;  1WJN A;  2NS5 A;  3Q8F A;  1J0W A;  3QBV B;  1Q5W B;  5IKC M;  4KV2 A;  5CHW A;  4TQ0 A;  2DX1 A;  4WAF A;  1IBX A;  4W9E A;  4QJ4 B;  3AH7 A;  2KK8 A;  4JKD A;  2JYT A;  2MCN B;  2PEA A;  1QC6 A;  4Z2M B;  3DVG Y;  4ARI A;  4HJG E;  1WJ6 A;  2KO3 A;  1E5W A;  2AQ3 B;  2LVO A;  2MJE A;  1WMH B;  1V2Y A;  3EC8 A;  1EM7 A;  4YSX B;  4KGR A;  1TS4 A;  3AN1 A;  4W9C A;  3AU4 A;  1SF0 A;  2G3Q B;  4KZC A;  1ZUD 2;  2V4I B;  2HD5 B;  4AS1 A;  5FI1 A;  4HLE A;  2LEK A;  4HRS A;  2K5P A;  4GMX B;  4I6L B;  2COD A;  3ZJV A;  2ZEQ A;  4LNF A;  4FA6 A;  2M56 B;  3ZQ4 A;  4KDL B;  1P98 A;  3H7P A;  3PPA A;  2BS4 B;  1FNW A;  1GG3 A;  1E8Z A;  3RFZ B;  1DIK A;  4MGZ E;  3BWU D;  1HA5 A;  3FIL B;  2WU5 B;  2RD0 A;  4DXF A;  1E8Y A;  1C1Y B;  3SBT A;  1QIL A;  3NS8 A;  2GMI C;  5KQ4 A;  2L0F A;  2N0S B;  1T77 A;  2PE6 B;  3DPD A;  4QJ3 B;  1FHX A;  3DHG C;  4BOZ B;  2K6Q A;  3KH0 A;  2BKF A;  3CIR B;  2H88 B;  1XLQ A;  1FRR A;  2KC2 A;  2IND C;  3DBR B;  2D10 A;  2OED A;  4ZYS A;  5H92 C;  1V1O A;  2KIG A;  1YQ3 B;  4IW0 A;  2QEJ C;  3AEE B;  4ANX A;  1ENF A;  3QQ8 B;  4ZRI A;  1LGR A;  4L1R A;  1L5P A;  3O96 A;  2PKO A;  4FXC A;  3TJP A;  2RLO A;  3Q2A C;  3A4S C;  1MIZ B;  1P0R A;  3A9J A;  2L83 A;  2WXL A;  2BYE A;  5CLQ B;  3TEZ A;  3PRM B;  2DEN B;  2XEW A;  1B55 A;  2ZVN A;  3JSV B;  3CMM B;  1SJH D;  2REX A;  2MJ3 A;  4JQW C;  4WAA A;  2GS0 A;  5AEK B;  4LK0 M;  1ZC3 B;  3KRW A;  1UGJ A;  2KR0 A;  4BKS D;  2WDR B;  4YTP B;  2Y5B B;  2R82 A;  2COF A;  1E7P B;  1WJU A;  4DBG A;  3AE6 B;  1VRA B;  3KY9 A;  3KUZ A;  1DOY A;  4DQO C;  4MM3 B;  2PJH A;  2NPT A;  3VUW A;  3B0A A;  4K7W A;  5HE2 A;  5JH5 C;  2LJ5 A;  4C56 C;  2KMM A;  2JUO A;  1SIF A;  2FBW B;  1FCC C;  2DLB A;  1JRO A;  3U2S C;  4MY6 A;  3GB1 A;  2BYV E;  4HAV B;  1WF9 A;  3TEY A;  3Q3J A;  4IOI E;  1XT9 B;  4R3D A;  5CHV C;  1WXQ A;  2H7E A;  1WXA A;  1V1P A;  1YX5 B;  4D0N B;  5FKA C;  1KLV A;  2LYD A;  3DXC A;  4P7I A;  1U2B A;  4X57 B;  2YS3 A;  3A1Q A;  1WGH A;  1U5G A;  1M4V A;  2O6V D;  3KYD D;  4NJ6 A;  3HHM A;  3AEB B;  1IBX B;  2KN5 A;  4PS3 A;  1V80 A;  1RWS A;  5DHF B;  1D5X C;  5C5B B;  4QJ5 B;  2KD0 A;  2ZPN A;  3AED B;  3VUY A;  2HRJ A;  3N32 A;  2HTH B;  2D9Z A;  2N1W A;  1UNR A;  1C3T A;  1X11 A;  3OG5 A;  2YEP B;  2D3B A;  2IGD A;  1SHC A;  1I7A A;  1V8C A;  2KDB A;  4WWP A;  3TO1 A;  1ESF A;  4DDG D;  2JWZ A;  4MAC A;  3QJZ A;  4GGQ A;  4KIK B;  4TKN A;  2ZKM X;  2KX0 A;  1AW7 A;  3VTV A;  4GDK B;  1L0V B;  1XCG A;  1E10 A;  5BMH A;  3IT4 B;  3CWI A;  4JWU C;  3WAP A;  4ZOH C;  2AQ2 B;  4A6F B;  2LAS A;  2BCJ A;  1PDX A;  5D3W A;  5FK9 C;  2MH7 A;  1WM2 A;  4WUR A;  2R2Y A;  3LB8 C;  3QCA A;  3RPF C;  5LXH A;  3MFG A;  3OAN A;  3KQ4 A;  4YXD B;  1ET9 A;  3Q8E A;  2W55 A;  4USA A;  4JKH A;  1AQC A;  1FM0 D;  1VBH A;  3SV1 A;  4NY0 A;  2RGN B;  2Z0O A;  2AWT A;  3T06 A;  4KHB A;  3B2G A;  3S2A A;  1I4R A;  1Y56 A;  1ZVR A;  3M1I B;  5C6R A;  4XZ4 A;  1H10 A;  1W1H A;  3ZLZ A;  1D4B A;  3GOE A;  3M3J A;  2FDQ A;  1Q0W B;  5CX3 A;  3V61 A;  5AZG A;  5D3V A;  1UWX A;  1FD6 A;  3A4R A;  2N4F A;  2E2X A;  1MHH E;  3WAN A;  4GOC A;  3ZIM A;  2CU3 A;  1QF6 A;  2DNF A;  3VR9 B;  3ZXV A;  3NVV A;  4CHJ A;  4KVG B;  4A6H A;  4E71 A;  2PE9 A;  2G45 B;  4P16 A;  1BWN A;  1XQQ A;  4IWO A;  4JK7 A;  3AEC B;  2Y5P A;  2DWQ A;  2QDF A;  3DQV A;  3H8H A;  4IC7 B;  5L81 A;  3VOQ A;  3OWE B;  3DCX A;  3H7P B;  2CU1 A;  2JXX A;  2Z0D B;  1T0Q C;  2AQ1 B;  1JQ4 A;  4EFO A;  1WY8 A;  3RZF A;  3V60 A;  2DAF A;  2V4L A;  1K8R B;  4I6P A;  2JYE A;  3HUI A;  2ZVO A;  3E56 A;  1ZGU B;  2RDB C;  5C79 A;  4HAY B;  5D6J B;  1XO3 A;  2LVQ A;  3NRZ A;  4XWT A;  4BKS A;  2J53 A;  2L7R A;  2DHJ A;  3VXW A;  1P3R A;  4RNA A;  2WXM A;  1KRH A;  2RVB B;  3F0W A;  1UZX B;  3UIP B;  4RCO A;  3NVY A;  5AUK A;  3KLS X;  5LLI A;  3CF6 E;  3Q14 C;  2M0X A;  5BO4 B;  2D3G A;  1HBK A;  2G9H D;  4PT5 A;  1KLG D;  3I63 C;  1F77 A;  3NOB A;  3ALB A;  3IVF A;  1SEB D;  1WIA A;  2K00 A;  2W3R A;  2WXF A;  3MP9 A;  5D3D A;  4TMA B;  4HPP A;  2MW5 A;  4XYC A;  3VAW A;  1T0Y A;  4B6W A;  3ETR A;  3VRA B;  1KBL A;  1ZXH A;  3L0W B;  1DGJ A;  3U4E G;  1L0X B;  1ACC A;  1JWA D;  3WAM A;  4IWP A;  3HK0 A;  1D5M C;  4H2A A;  2J0J A;  1TYG B;  5G2N A;  1ZOY B;  4NSW A;  1C4A A;  1GAQ B;  2WWZ A;  3AE4 B;  3HVD A;  1TTN A;  3A8P A;  2K49 A;  3PS6 A;  4RF0 A;  4XWX A;  2LXC A;  3ZUN A;  4ARC A;  1NYQ A;  2LOX A;  2BPS A;  2XBB C;  2KN4 A;  1E7U A;  5C3J B;  3K9P B;  1HQR D;  4GOU A;  2IGH A;  2KWC A;  2KFK B;  2YLM A;  5TSS A;  3V6E B;  5BYQ A;  1KTK A;  3HVZ A;  1X86 A;  2N7E A;  1QKZ A;  3UZT A;  3M62 B;  2X18 A;  3A98 B;  5DIF B;  2L76 A;  3OJ4 B;  4S17 A;  3WAL A;  2BYF A;  4W9L A;  1KFY B;  3DHI C;  4ZHP A;  2KAN A;  4WJN A;  5JXV A;  2MFQ A;  2LUM A;  4E74 A;  1UPQ A;  3B77 A;  4MT7 A;  5DHA B;  5C1Z A;  1OY2 A;  1KM7 A;  1WI0 A;  1XXG A;  5C2T B;  1V86 A;  3KRX A;  4BKT A;  3Q3M C;  4ANW A;  2N9L A;  4CSQ A;  2Z0Q A;  2DYM A;  3SFE B;  1WE7 A;  3FKY A;  4IG7 B;  5D94 A;  1YN5 A;  3BVM A;  3APC A;  2WDV B;  1R7S A;  1JAL A;  4RGT A;  4MK0 A;  3RZW C;  1Z5S B;  2D2Q A;  2DN6 A;  2KFJ A;  3VTW A;  4DX9 0;  3IG3 A;  2MRP A;  3LYY A;  3FEH A;  1I7H A;  3DXE A;  1UNS A;  1ZYI A;  3B08 A;  2GB1 A;  3DBL B;  4P1C C;  4LDT B;  3ODX A;  1NTI A;  3DOW A;  3A58 A;  3PHW B;  1LFD A;  2RMM A;  2ELA A;  3ZVR A;  1L6V A;  5J2R A;  2DX5 A;  1I35 A;  4MM3 A;  2DHZ A;  5DPW A;  2O6V B;  3GYP A;  1UEF A;  1W1G A;  3F5R A;  3RNE C;  3VIA A;  1EU4 A;  2RQ1 A;  4F7G A;  2LGI A;  1ISN A;  3NG0 A;  1UWM A;  4QAY A;  3IXS A;  1MK7 B;  3W1Y A;  4HB2 B;  5D27 A;  1FNU A;  4K81 A;  4JKA A;  2MA9 B;  1ZC4 B;  2KTF A;  4M0W B;  2D9W A;  3BK1 A;  1N6Z A;  4LLG M;  4ACF A;  2NMQ A;  1PMS A;  4A8X C;  2ZJD A;  1LB1 A;  1EVH A;  3P4R B;  5CLL B;  1C79 A;  1MG4 A;  2DHK A;  2K25 A;  2IYD B;  2R0D A;  2KDI A;  2GRI A;  2Z14 A;  3TCA A;  2JT4 B;  2K8E A;  2L1A A;  2BB5 A;  3K9O B;  1UNP A;  2BYT A;  3PRZ A;  3GS2 A;  2DHI A;  1N60 A;  2QSD A;  1H8C A;  3ZW3 A;  2DLW A;  1PGX A;  3L10 B;  3GP7 A;  1YN3 A;  3VR8 B;  1HTQ A;  1X1M A;  1QQG A;  1QOF A;  3ZKJ C;  2KAJ A;  1FIQ A;  3AXC A;  5CHF A;  3NS1 A;  3BZD B;  2RDG A;  1FCL A;  1P7E A;  3BII D;  2IO0 B;  4WJO A;  1PUT A;  3MTN B;  1RAX A;  1V89 A;  2ZNV C;  2GCJ A;  2LHD A;  2D3C A;  1RFA A;  3PSC A;  4JL9 A;  4MJS B;  2K8B A;  1WXS A;  2LD9 A;  2NTS A;  1HE8 A;  1JRU A;  5JHG A;  4DX8 A;  1SIJ A;  3PO0 A;  4N58 A;  2D11 A;  3N1X C;  5BYS A;  4MSQ B;  4TYZ A;  1J7A A;  3PVL A;  2KJH B;  2LXA A;  1WG7 A;  3T9L A;  2JX5 A;  2K6D B;  1MPE A;  1V5U A;  4HB0 B;  1C4C A;  1WGQ A;  4JKC A;  2COC A;  1FRD A;  4K1R B;  4MT5 A;  1FOE A;  2RUK B;  1MJD A;  2A4Z A;  2DYO A;  3NY5 A;  3TMP B;  2LFI A;  2I38 A;  3RNA C;  2D4Q A;  2UWQ A;  3TVV A;  2COA A;  3A8Q A;  1YIW A;  2JU6 X;  2KVZ A;  3EUB 2;  3IHP C;  3DWM A;  2CJO A;  1F52 A;  2M8S A;  1TKE A;  5HE1 A;  2WXJ A;  2VZK B;  2P8V A;  2UZS A;  3DVN V;  2ROV A;  1XF5 L;  5D3I B;  4KHO A;  2RSU A;  3FLV A;  2MWS B;  2YEP F;  2DAJ A;  2FCN A;  3P4S B;  3EHV A;  3SDL C;  4DHJ D;  1U5F A;  1KH0 A;  5JHH A;  1NU2 A;  4TQ1 A;  4NZL B;  2RRF A;  4C7Y A;  3EPY A;  1LXD A;  4KAX B;  3CXB B;  2ELB A;  4FJV B;  5LG4 B;  4ILG B;  2GLS A;  3EA6 A;  1JRP A;  3PZ7 A;  3FM8 C;  1D5Z C;  1V81 A;  2IYB A;  4C0A A;  4YSZ B;  2KJ6 A;  4DBB A;  3VFK A;  2NZ8 B;  3A9K B;  4RF1 A;  4M8M A;  4PS7 A;  3B2F A;  4B95 A;  2XNA C;  5G55 A;  4C4V A;  2O2V B;  2KXJ A;  1WR6 E;  4II3 B;  1N62 A;  1NEK B;  3BK2 A;  4O1N A;  2Q13 A;  1TS5 A;  5MPO A;  3MHZ A;  4E3C A;  1L4Z B;  5I4D A;  2LMC A;  1N61 A;  3KVF B;  4LCD E;  2BVC A;  4YSY B;  2WYQ A;  2WP9 B;  2VSZ A;  2OOB B;  4JKE A;  3BYY B;  1XLP A;  4JLC A;  1K50 A;  2KHW B;  3SYX A;  5HE3 A;  4JKG B;  1K5G B;  1ST7 A;  2QHO A;  5LXI B;  4N9F 4;  2C5L C;  4HCN B;  2K1F A;  1EWC A;  2J0K A;  3URY A;  3OJ3 A;  3ZTD A;  4YON A;  2WDQ B;  4D2K A;  2K8H A;  2FCM A;  1DYN A;  2LG1 A;  3SD5 A;  2MHJ A;  1P7F A;  1YNT E;  3M95 A;  1SGH A;  3GZN I;  1GB4 A;  2L3Z A;  2KX3 A;  1ZXI A;  3N1Y C;  5I2S A;  1EGX A;  1QQR A;  4P6V F;  1RRB A;  2EMS A;  1B1Z A;  1E6E B;  2M1M A;  3D8D A;  1WXV A;  3B1L X;  1MVK A;  3TEW A;  2J42 A;  4GDL B;  4CQN A;  2D3A A;  1YD8 U;  1WRI A;  3TL5 A;  1RM6 C;  1JW9 D;  2O2V A;  2WHI A;  3W9C B;  4DDI D;  3FAH A;  4DHJ B;  1H4R A;  3VHT C;  1N5W A;  3Q3N C;  4NNJ B;  4MGI E;  2L2I A;  1V5O A;  1IPG A;  4EZJ A;  3PZD A;  2KFK A;  4EKU A;  1JCK B;  1STE A;  2IY1 B;  5D2M B;  3LJ3 A;  3KUD B;  4ICV A;  2KGX B;  2BKR B;  2K3U A;  3H9D A;  4IOY X;  3I5J C;  1X1F A;  2WGS A;  1ZM0 A;  3APD A;  1CJE A;  3RT3 B;  1R4M B;  3U7D A;  1U5E A;  3KUC B;  4HEA 1;  2LGD A;  1TIF A;  1TGZ B;  1BXT A;  1BAK A;  1TBE A;  3Q3O C;  4EE2 A;  1OQQ A;  3V62 A;  3RD2 A;  4JK8 A;  2BTE A;  2KQ7 A;  2EKI A;  3T3O A;  2MP2 B;  3TW1 A;  2V3P A;  3UQB A;  4GPT B;  5DPR A;  2GBM A;  1VCB A;  4DXG A;  3QX1 A;  4NJ7 A;  2JPH A;  2DZK A;  2N0Y A;  3ODW A;  1KF6 B;  1ZW7 A;  1R4N B;  2LZ6 A;  4OVZ A;  4A3P A;  3P7Z A;  3A33 B;  1L7Y A;  4TUU A;  4II2 B;  2DFK A;  4WJP A;  3IFW B;  1J8C A;  3U8Z A;  3NWD A;  1PFJ A;  4JKG A;  2R2O A;  4RMA A;  5DPS A;  1FO4 A;  4REZ A;  2H7D A;  1YQ4 B;  1XCT L;  3KZ1 A;  5GXG B;  2Z59 B;  3I57 A;  5FR6 A;  4JK9 A;  4XGA B;  2AEH A;  2N1V A;  2ZW1 A;  4JGH B;  2PVO D;  5DCN A;  2YT2 A;  3DBH I;  4GNK B;  3EEC A;  2R09 A;  4HKQ A;  3ZTC A;  2KJR A;  3RCP A;  4AJW A;  1UGM A;  1K5D B;  3MPX A;  4HKZ E;  1M7R A;  4WH4 A;  2K0P A;  2FCS A;  2PW9 A;  2NBW B;  1P1A A;  1WGU A;  3E9O A;  4RH6 A;  4BBN C;  2JQR B;  2Y8G A;  1U29 A;  2VH1 A;  4OVU A;  1CZP A;  4XE0 A;  2M19 A;  1X1G A;  1Y5O A;  2P0H A;  3L17 A;  5IOI A;  2L0T A;  4GN1 A;  1VD2 A;  4DHZ E;  2Z0E B;  1MAI A;  3W2D A;  4G0N B;  1NDD A;  2VH2 A;  2KKC A;  2A5U A;  1Z87 A;  3N20 C;  4HCP B;  3QWZ B;  5J3T A;  4I6N B;  1FGY A;  1WVH A;  2ZW0 A;  3ML8 A;  5T8I A;  2N9X A;  2N9E B;  3GYO A;  3FVC A;  4W9H A;  5HHD G;  4ANV A;  2QKM A;  4ZRP A;  3AJ4 A;  3ULB A;  5C23 A;  4XDD A;  3P4P B;  2ZPY A;  3Q69 A;  3BVZ A;  1WGG A;  1E9M A;  2W3S A;  1I42 A;  3ULC A;  2GBN A;  1YJ1 A;  3L13 A;  1A5R A;  1FMA D;  3QIJ A;  2UZR A;  2LUL A;  1P6S A;  4Q2J A;  3UIO B;  5J3Q A;  4JE3 B;  3W1S C;  2CS4 A;  3RCZ A;  3NW8 A;  4NJC A;  1HZ6 A;  3NUH B;  4F8C B;  2K2J A;  4GMV A;  4FN2 A;  3SNH A;  4MEM A;  1WZ3 A;  1WI1 A;  2WLB A;  2NMB A;  1XX0 A;  1K53 A;  2KWU B;  1NTV A;  1N3H A;  3CSF A;  4P1B C;  1MKE A;  4RFB A;  2NVU I;  2GCL A;  5EFX A;  3MHS D;  3EGR A;  5GMV A;  3G9W A;  5LON B;  3PV1 A;  1T6B X;  4DXA B;  1L2N A;  3RUI B;  4GDL A;  4CO7 A;  4ILJ A;  3MC0 B;  1YOV B;  2MX2 A;  4W9K A;  1GB1 A;  2Y8F A;  3TEX A;  1CQV A;  2DYB A;  3V3X A;  1Y8R C;  2VKI A;  2XK5 A;  3AE8 B;  1BT0 A;  2CRF A;  2I5F A;  5BMG A;  2KVR A;  1MK9 B;  3KSY A;  4EUT A;  5EE3 A;  3RNG C;  2JRH A;  4K17 A;  1XLN A;  3R2I A;  4L1B A;  2YVC A;  2R61 A;  1HB8 A;  2OJW A;  1FPY A;  1C9F A;  4KHB B;  4FLH A;  1FHW A;  3V6C B;  4NAW B;  3PTF C;  2MBE A;  2WXK A;  3UQA A;  2WXG A;  2KZR A;  3AU5 A;  2L05 A;  1XD4 A;  4MH8 A;  1TXD A;  4HAU B;  2IY0 B;  1OQR A;  1V6E A;  4NPN A;  1JDE A;  4FHK A;  1KI1 B;  5KHO A;  3HRD D;  2JSV X;  5IN7 A;  2IPK D;  4ZDV A;  3ZO5 B;  2IO2 B;  2MQJ A;  4YL8 A;  2V3S A;  2KNB A;  2CAY A;  1AN8 A;  3JVZ X;  4L2Y A;  4ZRQ A;  3NZ3 A;  3AE5 B;  2I1J A;  1Q67 A;  3AB5 A;  1DYQ A;  1RRP B;  4YTN B;  1FNV A;  1MPH A;  1TS3 A;  1T0S C;  3AE9 B;  4EJN A;  4BOS C;  3RUL A;  3PLV A;  2EKE C;  1LM8 B;  2QC8 A;  2NR2 A;  4RGO S;  5DI9 B;  3AEF B;  1EAZ A;  4JPS A;  2LRU A;  3AE7 B;  3FIL A;  4OW0 A;  1FB8 A;  5D3Y A;  5E6P A;  3UF8 A;  1RYJ A;  1TY2 A;  2CKH B;  2HJ1 A;  4HHV A;  2I5C A;  2IZV B;  4GSW A;  4M00 A;  3W5U B;  1OMW A;  2FNJ B;  4QXA B;  1TZ1 A;  1OGW A;  3A1Q B;  1DOX A;  2WU2 B;  1V61 A;  4MH0 E;  1XLO A;  3SHQ A;  1OEY J;  1QOG A;  2E3T A;  1OQN A;  3NSU A;  1F9J A;  4A3O A;  3VH3 B;  4WIP A;  4C4V B;  5G5H A;  4A6K A;  4DIX A;  4A9A A;  4JIO U;  3E9S A;  3ZDM C;  3IT6 B;  1WXM A;  2LGX A;  3L54 A;  5FR3 A;  2G4D B;  2GBJ A;  4JWS C;  4XWW A;  4ICU A;  1XOD A;  1U5D A;  1X05 A;  1E7V A;  2C7H A;  2FUG 1;  4WQM A;  3ZNH B;  4HAZ B;  3X0W A;  4KIK A;  3KWV A;  4G3X B;  5KQ1 A;  2W9N A;  1TJE A;  2RNR B;  5J3Y A;  4GU2 A;  4CYE A;  1YMH E;  5KHQ A;  2KDE B;  2D07 B;  4EOY A;  2ABD A;  3Q3F A;  4XX5 A;  3D8F A;  1ROE A;  2RDH A;  4HAT B;  3AE1 B;  3DBH B;  4A6Q A;  3AE2 B;  2AYO B;  1WGR A;  4XC2 A;  1AYF A;  2CQU A;  3VDZ A;  3FC4 A;  1WMH A;  3BY4 B;  1NVI D;  2K8C A;  5H8Y E;  3J9C A;  5M4Y B;  1GOZ A;  4KKI A;  5LOP B;  3AMZ A;  1HEZ E;  1WJ4 A;  4YT0 B;  2ZZP B;  1AAR A;  2KTR A;  3RNB C;  4NAW A;  1KZG A;  2Y7B A;  2MP2 A;  2MBB B;  1WJ1 A;  1VZ7 A;  1W1D A;  4EZL A;  2ONQ A;  3E9P A;  1F1H A;  2ICI A;  4YTM B;  2K9X A;  2QIE B;  4A90 A;  4US8 A;  4WVF B;  4K3C A;  2JXT A;  5AZH A;  1SXT A;  2LOZ A;  2XN9 C;  3PRP B;  1KLU D;  3HIE A;  2PIA A;  2DYN A;  1VBG A;  2PPH A;  1VJK A;  2ZNV B;  3OAW A;  3HW2 B;  5DPT A;  1YJI A;  4RM9 A;  2WXP A;  2KLC A;  1FXT B;  3W5V B;  1ET6 A;  1XD3 B;  2N7J A;  3R2T A;  4JKB A;  3U52 E;  1EU3 A;  1NI3 A;  4JKF A;  2PVG C;  4W9G A;  5JZE B;  1Q10 A;  4BVU C;  2B3A A;  2P0F A;  1HZ5 A;  1JWB D;  3QAR A;  2OTX A;  2JZ3 B;  2NBU A;  2JVC A;  3EFU A;  2Z8L A;  1V5P A;  1PLS A;  2G1E A;  4IM0 A;  4LNI A;  2RSG A;  4L23 A;  4F7U P;  3WYF B;  4KSL C;  3MDB C;  3VQI A;  4PYU A;  5LNK 1;  1N5X A;  1WGD A;  1UF0 A;  4RM8 A;  3NWF A;  2KOX A;  1FFV A;  5KCV A;  3CIK A;  2LJI A;  2EC1 A;  3P42 A;  2WXR A;  3ENE A;  2COP A;  3VH4 B;  1P9D U;  1HB6 A;  3PEG A;  3RN9 C;  3VUX A;  1RLF A;  3LDZ E;  1GC6 A;  2D5G A;  2FID A;  5IJM A;  5JLJ B;  2X0S A;  1WR1 A;  3M63 B;  1SE2 A;  5JVL A;  1S3S G;  1WRD B;  4M02 A;  2JZP A;  2DZJ A;  4HXD A;  1DRO A;  4GIV A;  1KOT A;  5HG2 A;  3DBS A;  1FXA A;  3FP5 A;  1I4H A;  3P6A A;  4HWI B;  4AOF A;  3U7Z A;  1NI2 A;  2KQ4 X;  1V97 A;  2LUE A;  2IDY A;  2JP2 A;  1K52 A;  3ABV B;  1GGO A;  4J6I A;  1IGC A;  2FIF A;  4W9F A;  2WH5 A;  3UIN B;  2IGG A;  2SAK A;  4NQK E;  2OJR A;  3CST A;  1WZ0 A;  1IGD A;  3HSA A;  5HI1 A;  1QLB B;  2HTH A;  2GBR A;  2QCZ A;  2GUM A;  4J3O D;  2PTL A;  2MEK A;  1BTN A;  2KQS A;  3PVW A;  3ENB A;  4BZA A;  2Z4D A;  4AUQ C;  3RI7 C;  2KT7 A;  2LGS A;  1AWE A;  1PQS A;  1NTY A;  2Z59 A;  4AQ7 A;  4CHM A;  4Z2N A;  3Q6B A;  2W2W A;  2IO1 B;  4FHJ A;  3I3T B;  1C76 A;  2ASQ A;  4W9D A;  2R2Q A;  1J7C A;  2CR5 A;  2W82 A;  2L00 B;  4PNK A;  1DDM A;  4ZHO A;  1QZE A;  5C16 A;  1PGB A;  4HK2 A;  4MGK E;  5DH9 B;  1DDV A;  1YQB A;  1L4D B;  1GJZ A;  5AZF A;  4W9J A;  1N63 A;  3PVU A;  1VZ6 A;  1I2H A;  4IM2 A;  3JSV A;  4IAP A;  5J18 A;  4IM3 A;  1TJ6 A;  1EWY C;  4A5K A;  1M94 A;  1BUI C;  1JWU D;  2M17 A;  1UPR A;  2DBY A;  2QKL A;  2BT6 A;  4D6W A;  4LJP B;  1WJM A;  3JW0 X;  1P3Q U;  1WSP A;  3DBR I;  1L0Y B;  1OEY A;  4LNK A;  4LNO A;  3QA8 A;  3VTU A;  4AJY B;  1IRS A;  2X38 A;  3LJU X;  1ZPS A;  2WDT B;  2DTC A;  4YWG G;  3DVG X;  3C19 A;  3MC8 A;  3AEA B;  3UGB B;  3KW5 B;  3P1M A;  3N3K B;  3AV8 A;  4F1S A;  2DKQ A;  2M4N A;  3PP2 A;  4K7S A;  4KSK C;  1ZSQ A;  1D6E C;  2DZM A;  2BS3 B;  1C77 A;  1MI0 A;  2W2X D;  3DVN U;  4FAD A;  1JWM D;  1SSN A;  2AX5 A;  1TZO A;  3NZU A;  2KCJ A;  4KZ0 A;  4PK1 A;  3ODO A;  1I4G A;  3DCG A;  2NBV B;  2Q5W D;  2PZ1 A;  2SEB D;  1IYF A;  2NCN A;  2XQN M;  2JZZ A;  2BWF A;  3P63 A;  4KDI C;  1PYW D;  2LGY A;  1OQY A;  4A6F A;  2RPV A;  3DDC B;  4ANU A;  2WS3 B;  3QHT A;  2KMC A;  2J0M A;  2YT1 A;  3NHE B;  3ZNI D;  3TUO A;  3ZRC A;  1V5T A;  2PLP A;  2L32 A;  2D9X A;  4BKG A;  4URK A;  2WX0 A;  1T3Q A;  3L16 A;  4HDO A;  3ECI A;  3PLU A;  3OHM B;  2KDM A;  4FUL A;  4OZA A;  2GJY A;  3D32 A;  3L4P A;  1GPX A;  5G5G A;  1I4P A;  5C5B A;  2DKP A;  1V1P B;  2DA0 A;  1JML A;  1LW3 A;  2V76 A;  2M38 A;  4A55 A;  2C9W B;  4OT1 A;  2HDE A;  4B0M A;  2LKO A;  3ML4 A;  1IP9 A;  1U27 A;  3HM6 X;  3NWA A;  3DWG C;  2ON8 A;  3NVZ A;  4MEL A;  2ZCB A;  2DX5 B;  4GDK A;  3C8Y A;  5BMI A;  2N9K A;  4PYZ A;  1WM3 A;  1SE4 A;  1WH3 A;  3PG7 A;  1YN4 A;  2NBV A;  1MI1 A;  1NBF C;  4C00 A;  2E6X A;  2MJD A;  5FI0 A;  5L83 A;  2QJL A;  3GE3 C;  1LO5 D;  2WX1 A;  1V5M A;  1DOI A;  3ZJT A;  2CHW A;  4GZU A;  4HPL B;  1TS2 A;  3R7R A;  5IA7 A;  3IAS 1;  1I4Q A;  3DBL I;  1TQZ A;  2L1C A;  3BYT B;  2TSS A;  3A9J B;  2INC C;  3N30 A;  3L08 A;  1WFY A;  3FSS A;  2FJU B;  2FJ9 A;  3W1S A;  3ZXR A;  2V9H A;  2FJL A;  2UVM A;  3WAO A;  2KYW A;  2KTR B;  5EE0 A;  4W9I A;  2K22 A;  2FUH B;  3ZNG C;  2D9Y A;  1M7E A;  1T0R C;  1UBI A;  4WSF A;  2PMV A;  2G35 A;  2G4S A;  1ACA A;  3JYU A;  2JWU A;  1D3Z A;  1J19 A;  1MG8 A;  3QWM A;  1TT5 B;  4EZK A;  1FGZ A;  2J7Q B;  2KWV B;  1RFK A;  1VDV A;  2MSE D;  4A20 A;  3P4Q B;  3AI5 A;  5BYR A;  1ZP0 B;  1G6J A;  4MDK E;  1ZE3 D;  3B9J A;  2DZI A;  4WJQ A;  1GUA B;  2BW2 A;  2CHX A;  2DYQ A;  2BBC A;  4IDI A;  1UUP A;  2O6V A;  5D3X A;  4DK5 A;  5TR5 A;  4JX1 C;  1NVL A;  1L6U A;  2N7D A;  2JF5 A;  4ILH A;  2KIE A;  2OQB A;  2EMT A;  2KC1 A;  3VVW B;  1XR0 B;  1GNU A;  2FAZ A;  1V49 A;  2JRI B;  4TSS A;  1K51 A;  2CY5 A;  2B76 B;  3R3M A;  2IJ0 A;  5E6O A;  1YJJ A;  1LQB A;  1E8W A;  3HIZ A;  1QOB A;  4MGY E;  5EDS A;  5JP4 A;  4KGT A;  2IFS A;  3ONS A;  1CK1 A;  4UDU C;  2KWD A;  1PFD A;  1R4N I;  4M8N A;  3SFD B;  4C7Z A;  4IFS A;  3UI3 A;  3E9L A;  2IBI B;  1WYW B;  3R7Q A;  4KX6 B;  4LNN A;  3EFC A;  2XK5 B;  2J59 M;  1XEE A;  3AE3 B;  4B9K A;  1F2R I;  2D9V A;  2W54 A;  3NJT A;  1PGA A;  3P2B A;  2DIK A;  3LXF A;  3PT2 B;  3PZ8 A;  3AM9 A;  4M0W A;  1FXI A;  4BBK A;  3SU8 X;  3A9K A;  1MIX A;  4ZYN A;  4HRO A;  2BQQ A;  3V05 A;  2ZCC A;  3IAM 1;  2WNM A;  4ZRJ A;  5IRS A;  4PQ0 A;  1EF1 A;  4BFR A;  1OTR B;  1BML C;  1Z2M A;  2IO3 B;  3R66 C;  2BB6 A;  1OFF A;  2BWE S;  3QC8 B;  4WQO B;  4K2P A;  4L6E A;  3TIX A;  1JWS D;  2EJ8 A;  4EEW A;  2INP E;  1FHO A;  1E90 A;  3OLM D;  3PRE A;  1VLB A;  4TV3 A;  3QAQ A;  4NQL B;  3NVW A;  1TKG A;  2LHE A;  2Y3A A;  3ZGZ A;  1HXY D;  2J52 A;  2LRW A;  2LI5 A;  1T5X D;  4B0E A;  2C60 A;  2OHF A;  2YSZ A;  3H6N A;  1CMX B;  2BS2 B;  1HTO A;  1FEH A;  1SE3 A;  1V9J A;  2Y5C A;  4KKJ A;  4US9 A;  3C0R B;  2KAC A;  3HQC A;  5IO9 A;  1WE6 A;  2C7M B;  4AWJ A;  1WGY A;  4LJO B;  2CY4 A;  4G11 A;  1P5T A;  3QK0 A;  2M14 A;  1AWD A;  2WQY B;  3VRB B;  2K39 A;  2GBK A;  2KMA A;  2V1Y A;  2P0D A;  3AUL A;  3WIM A;  3TSS A;  2KUP A;  1YX6 B;  3SR6 A;  3RMK C;  3PHX B;  2V3N A;  3T8M A;  4HAW B;  1IUE A;  1EF5 A;  3NZS A; 
#chains in the Genus database with same CATH homology
 2AL3 A;  2ADZ A;  3BJI A;  3SBG A;  2NPT B;  4PS8 A;  5GOW B;  1V88 A;  3PGE A;  4HVB A;  4FBJ B;  2C7N B;  4IUM B;  4DWF A;  2YT0 A;  4HB4 B;  2BGF A;  2YS1 A;  2N9P C;  2MBQ A;  2MLB A;  1UD7 A;  4WWO A;  3DXD A;  3ZNZ B;  4GB9 A;  4MSM B;  4IWQ A;  1WX8 A;  4DHZ B;  2MDX A;  2YS5 A;  2KLG A;  4G50 A;  2I1K A;  2L8J A;  4WJ7 A;  2W2X C;  1EO6 A;  4ASW C;  3D8E A;  1Y19 B;  4AP4 C;  3ZRF A;  3BIN A;  5JHB A;  2LVP A;  1ZKH A;  1UNQ A;  2UYZ B;  4B6H A;  2YRY A;  4HAX B;  1FAO A;  2MBH A;  2JY6 A;  4WWN A;  2ROZ B;  3RYT A;  4FJZ A;  5IAA C;  1UBQ A;  4BBN F;  4CHK A;  3U30 A;  4OVV A;  5L95 C;  4KHA A;  5D7G A;  1BTK A;  3X23 A;  4HDQ A;  2RPQ A;  2MWN B;  1S1Q B;  1UEL A;  2HJ8 A;  3TBL D;  2MKR A;  1DDW A;  5HKH A;  1EUV B;  3PSE B;  4HPM B;  4K7U A;  2VRR B;  1RJ2 A;  2GOW A;  4F7Z A;  1DBH A;  2YF0 A;  4MJS A;  3V5W A;  1GC7 A;  4K2O A;  2N23 A;  3IBE A;  2FCQ A;  3SO6 A;  1Q1O A;  3HM3 A;  3MJW A;  1R4M I;  3KYC D;  4LDT D;  4H8S A;  1SE9 A;  2AL6 A;  3ZVV A;  1UH6 A;  2HE7 A;  4HB3 B;  5J17 A;  3N7C A;  1KC7 A;  4ZRK A;  3E66 A;  2MBO A;  1WX7 A;  4Y94 A;  2Z0P A;  2CB8 A;  4F7H A;  2VRW B;  2CHZ A;  2BF8 B;  4HJK A;  2KDF B;  1KZ7 A;  3H1U A;  2K2U A;  2RR9 A;  2RGF A;  2LWP A;  5HE0 A;  3ML9 A;  3WA0 A;  5CTR C;  3O65 B;  1J0G A;  5JHA A;  5E6N A;  4GXB A;  1WX9 A;  1U4A A;  3SUZ A;  4FJY A;  1XKE A;  3H7S A;  1E8X A;  1KJT A;  4EMO A;  3APF A;  3TFM A;  2LBB A;  3ZDT A;  1WJN A;  2NS5 A;  1J0W A;  3QBV B;  1Q5W B;  4KV2 A;  5CHW A;  4TQ0 A;  2DX1 A;  4W9E A;  2KK8 A;  4JKD A;  2MCN B;  2PEA A;  1QC6 A;  4Z2M B;  3DVG Y;  1WJ6 A;  2KO3 A;  1E5W A;  2LVO A;  1WMH B;  1V2Y A;  3EC8 A;  4W9C A;  3AU4 A;  2G3Q B;  4KZC A;  2HD5 B;  5FI1 A;  4HLE A;  4I6L B;  4GMX B;  2COD A;  2ZEQ A;  4FA6 A;  4KDL B;  1P98 A;  3H7P A;  3PPA A;  1GG3 A;  1E8Z A;  1DIK A;  4MGZ E;  2RD0 A;  1E8Y A;  1C1Y B;  3SBT A;  3NS8 A;  2GMI C;  5KQ4 A;  2L0F A;  2PE6 B;  3DPD A;  1FHX A;  4BOZ B;  2K6Q A;  3KH0 A;  2BKF A;  2KC2 A;  2D10 A;  4IW0 A;  4ANX A;  3QQ8 B;  4ZRI A;  3O96 A;  3TJP A;  2RLO A;  3A4S C;  1MIZ B;  1P0R A;  3A9J A;  2BYE A;  5CLQ B;  3PRM B;  2DEN B;  2XEW A;  1B55 A;  2ZVN A;  4JQW C;  3CMM B;  3JSV B;  2REX A;  4WAA A;  2GS0 A;  5AEK B;  1ZC3 B;  3KRW A;  4BKS D;  2Y5B B;  2R82 A;  2COF A;  1WJU A;  4DBG A;  3KY9 A;  3KUZ A;  2PJH A;  2NPT A;  3VUW A;  3B0A A;  4K7W A;  5HE2 A;  5JH5 C;  2LJ5 A;  2JUO A;  1SIF A;  4MY6 A;  2BYV E;  4HAV B;  1WF9 A;  3Q3J A;  1XT9 B;  5CHV C;  2H7E A;  1WXA A;  1YX5 B;  4D0N B;  1KLV A;  2LYD A;  3DXC A;  4P7I A;  1U2B A;  4X57 B;  2YS3 A;  3A1Q A;  1WGH A;  1U5G A;  2O6V D;  3KYD D;  4NJ6 A;  3HHM A;  2KN5 A;  4PS3 A;  1V80 A;  5DHF B;  5C5B B;  2KD0 A;  2ZPN A;  3VUY A;  2HRJ A;  3N32 A;  2HTH B;  2D9Z A;  2N1W A;  1UNR A;  1C3T A;  1X11 A;  1SHC A;  1I7A A;  2KDB A;  4WWP A;  3TO1 A;  4DDG D;  2JWZ A;  3QJZ A;  4GGQ A;  4KIK B;  4TKN A;  3VTV A;  2KX0 A;  4GDK B;  1XCG A;  3WAP A;  4A6F B;  2LAS A;  2BCJ A;  5D3W A;  1WM2 A;  3QCA A;  5LXH A;  3OAN A;  4JKH A;  1AQC A;  1VBH A;  3SV1 A;  4NY0 A;  2RGN B;  2Z0O A;  2AWT A;  3T06 A;  3S2A A;  1ZVR A;  3M1I B;  5C6R A;  4XZ4 A;  1H10 A;  1W1H A;  3ZLZ A;  3GOE A;  3M3J A;  2FDQ A;  1Q0W B;  5CX3 A;  3V61 A;  5AZG A;  5D3V A;  3A4R A;  2N4F A;  2E2X A;  3WAN A;  4GOC A;  3ZIM A;  4CHJ A;  4KVG B;  4A6H A;  4E71 A;  2PE9 A;  2G45 B;  1BWN A;  1XQQ A;  4IWO A;  4JK7 A;  3DQV A;  4IC7 B;  5L81 A;  3VOQ A;  3H7P B;  2CU1 A;  2JXX A;  2Z0D B;  4EFO A;  1WY8 A;  3RZF A;  3V60 A;  2DAF A;  2V4L A;  1K8R B;  4I6P A;  2ZVO A;  1ZGU B;  5C79 A;  4HAY B;  5D6J B;  2LVQ A;  4BKS A;  2L7R A;  2DHJ A;  3VXW A;  1P3R A;  2RVB B;  3F0W A;  1UZX B;  3UIP B;  5LLI A;  3CF6 E;  2M0X A;  5BO4 B;  2D3G A;  1HBK A;  3NOB A;  3ALB A;  3IVF A;  1WIA A;  2K00 A;  2MW5 A;  3VAW A;  1T0Y A;  4B6W A;  1KBL A;  3L0W B;  3WAM A;  4IWP A;  3HK0 A;  2J0J A;  5G2N A;  4NSW A;  2WWZ A;  1TTN A;  3A8P A;  3PS6 A;  4XWX A;  2LXC A;  3ZUN A;  2LOX A;  2BPS A;  2XBB C;  1E7U A;  3K9P B;  2KWC A;  2KFK B;  2YLM A;  3V6E B;  1X86 A;  2N7E A;  3UZT A;  3M62 B;  2X18 A;  3A98 B;  5DIF B;  2L76 A;  3OJ4 B;  3WAL A;  2BYF A;  4W9L A;  2KAN A;  4WJN A;  2MFQ A;  4E74 A;  1UPQ A;  4MT7 A;  5DHA B;  5C1Z A;  1OY2 A;  1KM7 A;  1WI0 A;  1V86 A;  3KRX A;  4BKT A;  4ANW A;  2Z0Q A;  2DYM A;  1WE7 A;  4IG7 B;  5D94 A;  3APC A;  4MK0 A;  3RZW C;  1Z5S B;  2D2Q A;  2DN6 A;  2KFJ A;  3VTW A;  4DX9 0;  3IG3 A;  2MRP A;  3FEH A;  3DXE A;  3B08 A;  4LDT B;  3ODX A;  1NTI A;  3DOW A;  3PHW B;  1LFD A;  2ELA A;  3ZVR A;  5J2R A;  2DX5 A;  1I35 A;  4MM3 A;  2DHZ A;  5DPW A;  2O6V B;  3GYP A;  1UEF A;  1W1G A;  3F5R A;  3VIA A;  2RQ1 A;  4F7G A;  1ISN A;  1MK7 B;  3W1Y A;  4HB2 B;  5D27 A;  4K81 A;  4JKA A;  2MA9 B;  1ZC4 B;  2KTF A;  4M0W B;  2D9W A;  1PMS A;  2ZJD A;  1LB1 A;  1EVH A;  5CLL B;  2DHK A;  2K25 A;  2IYD B;  2R0D A;  2KDI A;  3TCA A;  2JT4 B;  3K9O B;  1UNP A;  3PRZ A;  2DHI A;  1H8C A;  3ZW3 A;  2DLW A;  3L10 B;  1X1M A;  1QQG A;  3ZKJ C;  3AXC A;  5CHF A;  2IO0 B;  4WJO A;  3MTN B;  1RAX A;  1V89 A;  2ZNV C;  2GCJ A;  1RFA A;  3PSC A;  4JL9 A;  4MJS B;  2K8B A;  1WXS A;  2LD9 A;  1HE8 A;  1JRU A;  5JHG A;  4DX8 A;  2D11 A;  4MSQ B;  4TYZ A;  3PVL A;  2KJH B;  2LXA A;  1WG7 A;  3T9L A;  2K6D B;  1V5U A;  4HB0 B;  1WGQ A;  4JKC A;  2COC A;  4K1R B;  1FOE A;  2RUK B;  2DYO A;  2A4Z A;  3NY5 A;  3TMP B;  2D4Q A;  2UWQ A;  3TVV A;  2COA A;  3A8Q A;  1YIW A;  3IHP C;  2M8S A;  5HE1 A;  2P8V A;  2UZS A;  3DVN V;  2ROV A;  4KHO A;  2RSU A;  3FLV A;  2MWS B;  2DAJ A;  2FCN A;  3EHV A;  3SDL C;  4DHJ D;  1U5F A;  5JHH A;  1NU2 A;  4TQ1 A;  3EPY A;  1LXD A;  4KAX B;  3CXB B;  2ELB A;  4FJV B;  4ILG B;  3FM8 C;  1V81 A;  2IYB A;  4C0A A;  2KJ6 A;  4DBB A;  3VFK A;  2NZ8 B;  3A9K B;  4M8M A;  4PS7 A;  4B95 A;  5G55 A;  2O2V B;  2KXJ A;  1WR6 E;  4II3 B;  2Q13 A;  4E3C A;  3KVF B;  4LCD E;  2WYQ A;  2VSZ A;  2OOB B;  4JKE A;  4JLC A;  2KHW B;  3SYX A;  5HE3 A;  4JKG B;  1K5G B;  1ST7 A;  2QHO A;  5LXI B;  4N9F 4;  4HCN B;  2C5L C;  2K1F A;  2J0K A;  3OJ3 A;  3ZTD A;  4YON A;  2K8H A;  2FCM A;  1DYN A;  2LG1 A;  3SD5 A;  3M95 A;  1SGH A;  3GZN I;  2L3Z A;  2KX3 A;  1EGX A;  1RRB A;  2EMS A;  2M1M A;  3D8D A;  1WXV A;  3B1L X;  4GDL B;  1YD8 U;  3TL5 A;  2O2V A;  4DDI D;  4DHJ B;  3VHT C;  1H4R A;  4NNJ B;  4MGI E;  2L2I A;  1V5O A;  1IPG A;  4EZJ A;  3PZD A;  2KFK A;  4EKU A;  2IY1 B;  5D2M B;  3LJ3 A;  3KUD B;  4ICV A;  2KGX B;  2BKR B;  3H9D A;  4IOY X;  1X1F A;  1ZM0 A;  3APD A;  3RT3 B;  3U7D A;  1U5E A;  3KUC B;  2LGD A;  1TGZ B;  1TBE A;  1BAK A;  3V62 A;  3RD2 A;  4JK8 A;  2KQ7 A;  2MP2 B;  3TW1 A;  3UQB A;  4GPT B;  5DPR A;  2GBM A;  1VCB A;  3QX1 A;  4NJ7 A;  2JPH A;  2DZK A;  2N0Y A;  3ODW A;  1ZW7 A;  2LZ6 A;  4A3P A;  3P7Z A;  3A33 B;  1L7Y A;  4TUU A;  4II2 B;  2DFK A;  4WJP A;  3IFW B;  1J8C A;  3U8Z A;  5DPS A;  1PFJ A;  4JKG A;  2R2O A;  4RMA A;  2H7D A;  3KZ1 A;  2Z59 B;  5FR6 A;  4JK9 A;  2AEH A;  2N1V A;  4JGH B;  5DCN A;  3DBH I;  3EEC A;  2R09 A;  3ZTC A;  2KJR A;  3RCP A;  4AJW A;  1UGM A;  1K5D B;  3MPX A;  1M7R A;  2FCS A;  2NBW B;  1P1A A;  1WGU A;  3E9O A;  4BBN C;  2Y8G A;  1U29 A;  4OVU A;  1X1G A;  1Y5O A;  2P0H A;  3L17 A;  2L0T A;  4GN1 A;  1VD2 A;  4DHZ E;  2Z0E B;  1MAI A;  4G0N B;  1NDD A;  2KKC A;  2A5U A;  1Z87 A;  4HCP B;  3QWZ B;  5J3T A;  4I6N B;  1FGY A;  1WVH A;  3ML8 A;  2N9X A;  2N9E B;  3GYO A;  4W9H A;  4ANV A;  2QKM A;  3AJ4 A;  3ULB A;  5C23 A;  2ZPY A;  1WGG A;  1I42 A;  3ULC A;  2GBN A;  1YJ1 A;  3L13 A;  1A5R A;  3QIJ A;  2UZR A;  2LUL A;  1P6S A;  3UIO B;  5J3Q A;  3W1S C;  2CS4 A;  3RCZ A;  4F8C B;  2K2J A;  4GMV A;  4FN2 A;  3SNH A;  4MEM A;  1WZ3 A;  1WI1 A;  2NMB A;  1XX0 A;  2KWU B;  1NTV A;  1N3H A;  3CSF A;  1MKE A;  2NVU I;  2GCL A;  5EFX A;  3MHS D;  5GMV A;  3G9W A;  5LON B;  3PV1 A;  1L2N A;  4DXA B;  3RUI B;  4GDL A;  4CO7 A;  4ILJ A;  2MX2 A;  4W9K A;  2Y8F A;  2DYB A;  1Y8R C;  2VKI A;  2XK5 A;  1BT0 A;  2CRF A;  2I5F A;  2KVR A;  1MK9 B;  3KSY A;  4EUT A;  2JRH A;  4K17 A;  2YVC A;  1HB8 A;  4KHB B;  4FLH A;  1FHW A;  3V6C B;  4NAW B;  3PTF C;  2MBE A;  3UQA A;  2KZR A;  3AU5 A;  2L05 A;  1XD4 A;  1TXD A;  4HAU B;  2IY0 B;  1V6E A;  4NPN A;  1JDE A;  4FHK A;  1KI1 B;  5KHO A;  4ZDV A;  3ZO5 B;  2IO2 B;  2MQJ A;  4YL8 A;  2V3S A;  2KNB A;  2CAY A;  3JVZ X;  2I1J A;  1Q67 A;  1RRP B;  1MPH A;  4EJN A;  4BOS C;  3RUL A;  3PLV A;  2EKE C;  1LM8 B;  2NR2 A;  5DI9 B;  1EAZ A;  2LRU A;  1FB8 A;  5D3Y A;  5E6P A;  3UF8 A;  2CKH B;  4HHV A;  2I5C A;  2IZV B;  4GSW A;  1OMW A;  2FNJ B;  1TZ1 A;  1OGW A;  3A1Q B;  1V61 A;  4MH0 E;  3SHQ A;  1OEY J;  1OQN A;  3NSU A;  1F9J A;  4A3O A;  3VH3 B;  4A6K A;  4JIO U;  3ZDM C;  1WXM A;  2LGX A;  3L54 A;  2G4D B;  2GBJ A;  4ICU A;  1XOD A;  1U5D A;  1X05 A;  1E7V A;  2C7H A;  3ZNH B;  4HAZ B;  3X0W A;  4KIK A;  4G3X B;  5KQ1 A;  2W9N A;  2RNR B;  5J3Y A;  4GU2 A;  4CYE A;  5KHQ A;  2KDE B;  2D07 B;  4EOY A;  2ABD A;  3Q3F A;  4XX5 A;  3D8F A;  4HAT B;  2AYO B;  1WGR A;  4XC2 A;  2CQU A;  3VDZ A;  1WMH A;  3BY4 B;  2K8C A;  5LOP B;  1WJ4 A;  2ZZP B;  1AAR A;  2KTR A;  4NAW A;  1KZG A;  2Y7B A;  2MP2 A;  2MBB B;  1WJ1 A;  1W1D A;  4EZL A;  3E9P A;  4WVF B;  5AZH A;  2LOZ A;  3PRP B;  2DYN A;  1VBG A;  2PPH A;  2ZNV B;  3OAW A;  3HW2 B;  5DPT A;  4RM9 A;  2KLC A;  1FXT B;  1XD3 B;  4JKB A;  4JKF A;  4W9G A;  5JZE B;  4BVU C;  2B3A A;  2P0F A;  3QAR A;  2OTX A;  2JZ3 B;  2NBU A;  2JVC A;  3EFU A;  1V5P A;  1PLS A;  4IM0 A;  2RSG A;  4F7U P;  3WYF B;  4KSL C;  3MDB C;  3VQI A;  4PYU A;  1WGD A;  4RM8 A;  2KOX A;  5KCV A;  3CIK A;  2EC1 A;  3ENE A;  2COP A;  3VH4 B;  1P9D U;  1HB6 A;  3PEG A;  3VUX A;  1RLF A;  3LDZ E;  1GC6 A;  2FID A;  5IJM A;  5JLJ B;  2X0S A;  1WR1 A;  3M63 B;  5JVL A;  1S3S G;  1WRD B;  2DZJ A;  4HXD A;  1DRO A;  4GIV A;  1KOT A;  3DBS A;  3FP5 A;  4AOF A;  3P6A A;  4HWI B;  1NI2 A;  2LUE A;  2JP2 A;  1GGO A;  4J6I A;  2FIF A;  4W9F A;  2WH5 A;  3UIN B;  4NQK E;  2OJR A;  3CST A;  1WZ0 A;  2HTH A;  2GBR A;  1BTN A;  2KQS A;  3PVW A;  3ENB A;  4AUQ C;  1AWE A;  1PQS A;  1NTY A;  4CHM A;  4Z2N A;  2W2W A;  2IO1 B;  4FHJ A;  3I3T B;  2ASQ A;  4W9D A;  2R2Q A;  2CR5 A;  2L00 B;  4PNK A;  1DDM A;  1QZE A;  5C16 A;  4HK2 A;  4MGK E;  5DH9 B;  1DDV A;  1YQB A;  1GJZ A;  5AZF A;  4W9J A;  3PVU A;  1I2H A;  4IM2 A;  3JSV A;  4IAP A;  5J18 A;  4IM3 A;  1TJ6 A;  4A5K A;  1M94 A;  2M17 A;  1UPR A;  2QKL A;  4LJP B;  1WJM A;  3JW0 X;  1P3Q U;  3DBR I;  1OEY A;  4AJY B;  3QA8 A;  3VTU A;  1IRS A;  3LJU X;  2WDT B;  2DTC A;  3DVG X;  3UGB B;  3KW5 B;  3N3K B;  4F1S A;  2DKQ A;  2M4N A;  3PP2 A;  4K7S A;  4KSK C;  1ZSQ A;  2DZM A;  2W2X D;  3DVN U;  4FAD A;  3NZU A;  2KCJ A;  4KZ0 A;  3ODO A;  3DCG A;  2NBV B;  2PZ1 A;  1IYF A;  2NCN A;  2XQN M;  2JZZ A;  2BWF A;  4KDI C;  1OQY A;  2LGY A;  4A6F A;  4ANU A;  3DDC B;  3QHT A;  2KMC A;  2J0M A;  2YT1 A;  3NHE B;  3ZNI D;  3ZRC A;  1V5T A;  2D9X A;  4BKG A;  4URK A;  2WX0 A;  3L16 A;  4HDO A;  3ECI A;  3PLU A;  4FUL A;  2GJY A;  3D32 A;  5C5B A;  2DKP A;  2DA0 A;  1LW3 A;  2V76 A;  2M38 A;  2C9W B;  1IP9 A;  2LKO A;  3ML4 A;  1U27 A;  3HM6 X;  4MEL A;  2ZCB A;  2DX5 B;  4GDK A;  4PYZ A;  1WM3 A;  1WH3 A;  3PG7 A;  1NBF C;  5FI0 A;  5L83 A;  2WX1 A;  1V5M A;  2CHW A;  4GZU A;  4HPL B;  3R7R A;  5IA7 A;  3DBL I;  1TQZ A;  2L1C A;  3A9J B;  3N30 A;  3L08 A;  1WFY A;  3FSS A;  2FJ9 A;  3W1S A;  2FJL A;  2UVM A;  3WAO A;  2KTR B;  4W9I A;  2FUH B;  3ZNG C;  2D9Y A;  1M7E A;  1UBI A;  4WSF A;  2G35 A;  2G4S A;  1ACA A;  3JYU A;  1D3Z A;  1J19 A;  1MG8 A;  3QWM A;  4EZK A;  1FGZ A;  2J7Q B;  2KWV B;  2MSE D;  4A20 A;  3AI5 A;  1G6J A;  4MDK E;  2DZI A;  4WJQ A;  1GUA B;  2CHX A;  2DYQ A;  2O6V A;  5D3X A;  4DK5 A;  5TR5 A;  1NVL A;  2N7D A;  2JF5 A;  4ILH A;  2OQB A;  2EMT A;  2KC1 A;  3VVW B;  1XR0 B;  1GNU A;  2FAZ A;  1V49 A;  2JRI B;  2CY5 A;  3R3M A;  5E6O A;  1LQB A;  1E8W A;  3HIZ A;  4MGY E;  5JP4 A;  2IFS A;  3ONS A;  1R4N I;  4M8N A;  4IFS A;  3E9L A;  2IBI B;  1WYW B;  3R7Q A;  2XK5 B;  2J59 M;  4B9K A;  2D9V A;  3P2B A;  2DIK A;  3PT2 B;  4BBK A;  3SU8 X;  3A9K A;  1MIX A;  4ZYN A;  2ZCC A;  4ZRJ A;  4PQ0 A;  1EF1 A;  4BFR A;  1OTR B;  1Z2M A;  2IO3 B;  3R66 C;  2BWE S;  3QC8 B;  4WQO B;  4K2P A;  4L6E A;  3TIX A;  2EJ8 A;  4EEW A;  1FHO A;  1E90 A;  3OLM D;  3PRE A;  4TV3 A;  3QAQ A;  4NQL B;  2LRW A;  2LI5 A;  2C60 A;  2YSZ A;  3H6N A;  1CMX B;  1V9J A;  3C0R B;  3HQC A;  1WE6 A;  2C7M B;  4AWJ A;  1WGY A;  4LJO B;  2CY4 A;  4G11 A;  1P5T A;  3QK0 A;  2M14 A;  2K39 A;  2GBK A;  2KMA A;  2V1Y A;  2P0D A;  3AUL A;  3WIM A;  2KUP A;  1YX6 B;  3PHX B;  3T8M A;  4HAW B;  5EDS A;  1EF5 A;  3NZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...