3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Merlin
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
2KQ7A 1U27A 3CIKA 4B9KA 2D10A 2I5CA 2COPA 2ZJDA 3JYUA 4URKA 2LVOA 3VQIA 2GBRA 2HRJA 4YL8A 2HTHB 1V49A 2ZVNA 3H7SA 1AWEA 3QX1A 4HB2B 1PFJA 3A98B 2RR9A 1TZ1A 4MEMA 4PS7A 4E71A 4M0WB 3DCGA 4FHJA 2Z0PA 4DBGA 1WX9A 4M8MA 2RVBB 1M7EA 5E6OA 4B95A 2K8CA 2WX1A 4ZDVA 2BWFA 4ANUA 2WWZA 2G3QB 2FDQA 1OGWA 4K1RB 3UIOB 2E2XA 2CS4A 4A3PA 2LVQA 3H6NA 4EKUA 2D2QA 1E8XA 4GOCA 2ABDA 2RQ1A 2VKIA 2MWNB 3SNHA 5CHFA 4DDGD 2V76A 2COFA 4JLCA 1VD2A 5CTRC 3PSCA 3N30A 5C1ZA 5D3XA 4DBBA 3CSTA 1V9JA 1WIAA 1U29A 3PZDA 5CX3A 2IYBA 1IPGA 1EVHA 1SGHA 4HAYB 2KQSA 2M1MA 2MBEA 2PZ1A 1R4MI 3A9JA 2RLOA 3M62B 2MRPA 2C7NB 4PYZA 1J0GA 2GBMA 3MPXA 3DBLI 3IFWB 4W9LA 1RRPB 3VHTC 4AJYB 3D8DA 4K7SA 3VTWA 4HDQA 1XQQA 2RNRB 2QKMA 3WAMA 3ZNHB 4EUTA 4MJSB 2L7RA 1OMWA 3O96A 4K81A 2ZNVB 2D4QA 5J3YA 3VOQA 3KUZA 3VFKA 2ZZPB 3ZKJC 2O2VB 4HDOA 1E8YA 3PREA 3T8MA 3L17A 2KDBA 2Y7BA 3PS6A 4G50A 5LXHA 2YVCA 4GMXB 5DPTA 2NVUI 1SHCA 2Z0EB 4NJ7A 4NY0A 2FJ9A 4HHVA 2N1VA 1WGUA 3PV1A 2EMSA 2DFKA 4HPLB 3WANA 2KDIA 3GOEA 3G9WA 2XK5B 1OQNA 1Q0WB 3DOWA 2MDXA 3D8FA 3R7RA 2C5LC 2FIDA 2GOWA 3UQBA 5KHQA 2D3GA 3NHEB 4IFSA 4GU2A 2R0DA 2OJRA 2IFSA 2WDTB 4HAZB 1AQCA 1XD3B 4BVUC 1DDVA 1GG3A 1ZC4B 2I1JA 2LULA 2JPHA 3A1QB 5C23A 3V5WA 4DXAB 1KM7A 4NPNA 1ZC3B 5DPRA 4CYEA 1WJ1A 5HE3A 4Z2MB 4E3CA 2KO3A 2Z0OA 3EFUA 4EZJA 3U8ZA 2K25A 2LRWA 4W9HA 1XKEA 1J19A 5D3VA 4XC2A 1K5GB 3P6AA 4II3B 5JH5C 4GDKB 2K2UA 2DZMA 3PLVA 2KFKA 3ZDTA 4W9FA 3V6CB 3WA0A 2DHJA 1BT0A 3DBHI 2KFJA 3QIJA 4IM0A 2RSGA 4BOZB 2AEHA 5DHFB 2O6VD 3APCA 1NVLA 2MBQA 2CHZA 2YSZA 2DAFA 1R4NI 1WR6E 3I3TB 4IWQA 2D11A 4HCNB 1V88A 4BKGA 3ULCA 2KLGA 2KWUB 3QCAA 4AOFA 1Y19B 1WGHA 2XBBC 4IG7B 4XX5A 3PRPB 1FHOA 3L16A 5DHAB 3TJPA 2L0TA 2NBWB 1EAZA 3DVNV 4I6PA 2MA9B 2LOZA 4OVVA 1Z2MA 3VH3B 2AWTA 4FJZA 2GS0A 3M3JA 4WWPA 3DBSA 2LASA 3QBVB 3L54A 3T9LA 2DYOA 2N7EA 3BY4B 1MPHA 4K2OA 1P0RA 3Q3JA 3PVLA 2AL3A 5IJMA 2FJLA 4WQOB 3LJUX 3WIMA 3RCPA 3TFMA 1WM2A 3QHTA 3PGEA 2DYQA 2ROZB 2KHWB 4GDLA 4WWNA 5CLLB 4HAXB 1S3SG 3K9PB 2KJHB 1V6EA 1GC7A 1WJ6A 4WJOA 4DWFA 2C7MB 5KHOA 4II2B 3L10B 2YT0A 1ZVRA 4B6HA 4HB4B 1WY8A 1WXAA 2J0MA 3H7PB 4EFOA 1WF9A 2D9ZA 1P98A 3AULA 3PLUA 1V89A 1E7VA 3B1LX 3APDA 2ZVOA 3QWZB 4L6EA 2L3ZA 3P7ZA 3SHQA 2LG1A 4HAWB 2EJ8A 1X05A 2GBNA 2JF5A 2MX2A 2NPTB 4IW0A 4W9EA 1UNQA 1HE8A 3KSYA 1AARA 2JUOA 2KTRB 2V3SA 1DBHA 1QQGA 1ZM0A 2MBHA 1UELA 1ZGUB 2IZVB 2JZ3B 1TGZB 2L2IA 4FHKA 4FULA 4KZCA 1WVHA 4WJ7A 4ZYNA 2PPHA 3ZNID 4NAWA 5KQ1A 1V5MA 3OJ3A 1WZ3A 3PHXB 2FAZA 1X1MA 1MIXA 3DQVA 5E6PA 2RGNB 2FCQA 3ZLZA 4AUQC 4A6HA 3FLVA 2ZPYA 1E8ZA 4EEWA 2EC1A 4GXBA 4FBJB 5KCVA 1WI1A 1XD4A 4ZRKA 2N9PC 3KRWA 2KFKB 5D3WA 3KH0A 3P2BA 2DYNA 3HK0A 3ZVRA 4D0NB 2ZCBA 3QJZA 4GDKA 4JIOU 2YS1A 4MT7A 3SV1A 2GCLA 2Z59B 1SE9A 4DHJD 5C6RA 1I7AA 4IC7B 3PVWA 4GN1A 3ZNGC 1WRDB 2KMCA 1U2BA 3PHWB 2ROVA 3NZUA 3RZFA 1M94A 2IO2B 4GB9A 4PQ0A 4HJKA 5D2MB 3RT3B 1L7YA 2MP2A 3N32A 1UPQA 2X18A 2FCNA 1UEFA 2KZRA 3EHVA 4PS3A 1IYFA 2MFQA 4LCDE 4XZ4A 1VCBA 4EOYA 2N9EB 2KNBA 3TVVA 3UINB 3QC8B 2G4SA 4GZUA 3QARA 1KZ7A 1K5DB 1ACAA 1X11A 2NR2A 3UIPB 4MK0A 1Z5SB 1I2HA 4FN2A 4W9IA 1BWNA 2LXAA 4K7WA 4ZRJA 1BTNA 2DX1A 2KK8A 2NCNA 3JSVA 2CU1A 3ODXA 3SUZA 3IVFA 3VXWA 3QAQA 4TYZA 1YD8U 4IOYX 1G6JA 2DZKA 3JW0X 2CKHB 2M0XA 5DI9B 2XEWA 1H10A 1BAKA 3KRXA 1GNUA 4E74A 1F9JA 1DYNA 5JHGA 3A8QA 1EGXA 1Q1OA 4ICUA 4LDTD 2RPQA 2Y8GA 2J59M 4HAVB 1EF5A 1V2YA 2IYDB 2KD0A 3D32A 3EC8A 3DPDA 4IM3A 4ANWA 4BKSA 2H7EA 2CY5A 3APFA 3AU5A 4HATB 3U7DA 1WG7A 1FGYA 4A5KA 5C79A 3RCZA 1GC6A 1WJMA 2NBUA 4G0NB 3VUYA 1MIZB 2DHZA 3L0WB 1WR1A 2JVCA 4EZLA 3ODWA 1WXVA 5D7GA 3WALA 1OTRB 4BBKA 5L95C 2KCJA 2O2VA 4WJNA 4DHZB 2KVRA 2K2JA 4MY6A 1K8RB 2KN5A 1A5RA 3BJIA 1UPRA 1KJTA 3MHSD 4TUUA 5LONB 5C5BB 3ONSA 4ZRIA 1HB8A 1UNRA 4KVGB 2BYVE 3GZNI 4I6NB 1E90A 5D94A 4DDID 4TQ1A 4B6WA 3ZUNA 4F7GA 3FP5A 4WJPA 2XK5A 2LKOA 3DXCA 2N1WA 4GSWA 4MM3A 1I35A 2HE7A 1W1DA 2YS5A 2N7DA 1RRBA 4HLEA 2R09A 2LI5A 2IO1B 4CO7A 3H7PA 4KHBB 4GGQA 3VAWA 3RYTA 5JZEB 2CY4A 3SO6A 3LDZE 4KSKC 2MW5A 2MLBA 3BINA 2YRYA 1Q67A 1LM8B 3VUWA 3A33B 4M8NA 1QC6A 2DLWA 5C16A 3ODOA 2K8HA 3KZ1A 4PYUA 1ST7A 5J2RA 2LVPA 4FLHA 3N7CA 1DROA 2GMIC 2PJHA 2UZSA 1XT9B 2DYBA 2OTXA 3PTFC 3OJ4B 3ZRFA 4BKSD 2L1CA 1X1FA 1XODA 2AYOB 1IP9A 2KX3A 1UH6A 3B0AA 5EDSA 2HD5B 3R3MA 4MGIE 1LB1A 2FNJB 1WGDA 2IO3B 2MBOA 1P6SA 1PQSA 5DH9B 2C7HA 5D3YA 4NSWA 2CQUA 4HB3B 2L76A 2OOBB 4NQKE 1P3QU 3PRMB 2N4FA 3DVGX 1WXSA 4GIVA 3TW1A 5GMVA 2M38A 4IUMB 3R66C 1OY2A 2MKRA 5J17A 3MDBC 1UZXB 4IWOA 2P0FA 1WI0A 1HBKA 3ZTDA 4KIKA 4HAUB 2CB8A 1WE7A 2KX0A 1V5PA 2KUPA 2DZJA 2V4LA 3QQ8B 5G55A 4BBNF 1Z87A 2W2XC 2JY6A 3MJWA 3ZTCA 4NQLB 1OQYA 4HB0B 4BBNC 1WM3A 2ZEQA 5FI0A 1LFDA 2NPTA 4AP4C 2LWPA 1V86A 3CSFA 1V5UA 2DHIA 2DKPA 2Q13A 2Z0QA 4WVFB 1GUAB 1Y8RC 4MJSA 3UF8A 1TBEA 2JRHA 1MAIA 1N3HA 1WXMA 2N9XA 3A1QA 2K8BA 2W2XD 3HHMA 1WGYA 2JWZA 3A4RA 4RM8A 3TIXA 1C3TA 4BKTA 2M14A 3VTUA 2K00A 4W9JA 2C9WB 5JHHA 3IHPC 3PG7A 5DIFB 2GCJA 1WMHB 3FSSA 4KDIC 3L13A 1W1GA 2YF0A 4F7UP 2A5UA 2RUKB 3A8PA 2PEAA 1X1GA 4F7HA 2K6QA 1ZSQA 4K2PA 3KUCB 4DK5A 1D3ZA 2MP2B 2BCJA 5CHVC 2CR5A 1WGQA 3M95A 2BYEA 1PLSA 5IAAC 1XCGA 2D9XA 1P5TA 2C60A 1CMXB 1FHWA 3TCAA 5G2NA 3ML9A 3HIZA 2EKEC 3H1UA 4G11A 5J3TA 2KTFA 1Y5OA 1V61A 2LGXA 3KYDD 3D8EA 4JGHB 1EF1A 3ML4A 3PP2A 1RFAA 1WZ0A 5BO4B 3HW2B 2MSED 4JL9A 1QZEA 3KW5B 4AWJA 5D6JB 1YIWA 2J0JA 1U5EA 2LGYA 2MBBB 2L0FA 4KV2A 3K9OB 4W9KA 4PS8A 1E7UA 2P8VA 3SU8X 4DHJB 2O6VB 4WWOA 3JVZX 2BPSA 4YONA 1MKEA 3V61A 2DX5A 4MGKE 1V5OA 1T0YA 4NAWB 3VDZA 5AZGA 5L83A 4IWPA 2JRIB 1J0WA 3KYCD 5DPSA 1NTYA 4FADA 1TTNA 2DAJA 2MWSB 3A9KA 1E5WA 2HTHA 5JP4A 4EZKA 4K17A 4CHMA 3ZIMA 4TV3A 4CHKA 3C0RB 2KJRA 2G35A 2W9NA 5GOWB 2J0KA 2KDFB 1NDDA 1NI2A 1RAXA 4IM2A 1UBQA 4KHOA 2LOXA 2D9YA 3W1YA 1KOTA 3NY5A 5TR5A 3V62A 2CHWA 4F8CB 3PRZA 1ZW7A 3CMMB 3SYXA 1WX8A 2HJ8A 2LYDA 2G4DB 2BYFA 3B08A 3HM6X 4OVUA 2DX5B 1LQBA 3PEGA 2Z0DB 1WMHA 5HE2A 2WX0A 5AZHA 5KQ4A 1P1AA 1U4AA 1H8CA 2O6VA 3AI5A 2J7QB 2XQNM 2BGFA 3PSEB 4LDTB 3TL5A 3ZRCA 1S1QB 3A9KB 1TJ6A 2QKLA 2BWES 4Z2NA 3EECA 2ZNVC 2ELAA 1KI1B 5JHAA 1U5GA 1WFYA 4ICVA 3CXBB 1EUVB 2KXJA 2CHXA 3MTNB 5HKHA 3QK0A 1KLVA 2DN6A 1ISNA 3DVNU 2ZCCA 4TQ0A 2DTCA 5L81A 2NMBA 3Q3FA 1RJ2A 4KAXB 2UZRA 4DHZE 3RD2A 5E6NA 2D07B 3PPAA 1U5DA 3HQCA 4CHJA 5AZFA 1FOEA 5J3QA 1FHXA 3JSVB 2RSUA 3X23A 4Y94A 2M8SA 1MK7B 1GJZA 2NBVB 5FI1A 1XX0A 1Q5WB 1C1YB 3ECIA 3W1SC 3F0WA 2KWVB 2ELBA 2L00B 2REXA 3QA8A 4FJYA 3DXEA 4RMAA 5AEKB 1FGZA 4TKNA 5IA7A 2EMTA 3T06A 2IBIB 1M7RA 2JZZA 5HE1A 1OEYJ 2K39A 2KDEB 2KLCA 1WJ4A 4KDLB 3ENEA 3M1IB 1UNPA 2BKFA 2NZ8B 4W9GA 5DCNA 3AU4A 2JT4B 1DDWA 2KGXB 2QHOA 1WJNA 2KKCA 1LXDA 3ML8A 4WAAA 4PNKA 3RUIB 1TQZA 2KMAA 3ULBA 3VVWB 3LJ3A 3GYOA 3TMPB 4FA6A 5CLQB 4F1SA 4X57B 4BOSC 2KC1A 1WH3A 2Y8FA 1HB6A 1YQBA 2BF8B 2GBJA 2RD0A 4BFRA 3UQAA 1MG8A 1LW3A 2LUEA 2UWQA 4A6FB 2DYMA 5EFXA 3PVUA 1WGRA 4A20A 3ZVVA 2RGFA 2JXXA 2FCMA 4HXDA 4DX8A 4XWXA 2KC2A 3RZWC 2IY1B 4LJPB 1YJ1A 1EO6A 4HWIB 2KANA 3KY9A 2ASQA 1NU2A 1RLFA 4KZ0A 3U30A 4C0AA 3FEHA 1I42A 3OLMD 5LOPB 4GPTB 4G3XB 1WGGA 3W1SA 2UYZB 1P9DU 3SD5A 4A6KA 3QWMA 1B55A 1MK9B 3OANA 2DKQA 2FCSA 3L08A 2M4NA 3GYPA 3KVFB 3NZSA 2KWCA 3H9DA 3X0WA 1H4RA 1XR0B 3CF6E 2CAYA 1FXTB 4MSQB 3AXCA 4MGYE 3S2AA 3EPYA 4EJNA 1WYWB 2IO0B 2L05A 2FUHB 3KUDB 4WSFA 4HCPB 4IAPA 3VIAA 5JLJB 3V60A 3ALBA 4AJWA 1UD7A 1W1HA 2DENB 1V80A 1WX7A 2Y5BB 1FB8A 2COCA 4ANVA 5CHWA 3UGBB 1ZKHA 3ZO5B 2COAA 1NTIA 2K1FA 3HM3A 2PE6B 3IG3A 1TXDA 2KJ6A 5DPWA 2MCNB 1DDMA 2IY0B 3N3KB 4HK2A 3ZNZB 1IRSA 5JHBA 2N0YA 5C5BA 5J18A 1KZGA 2YT1A 3V6EB 1UGMA 3PT2B 3RULA 2N23A 2D9VA 2KTRA 2GJYA 3NS8A 4F7ZA 2ADZA 4MH0E 3NSUA 3DXDA 2LZ6A 3VUXA 3WAPA 1P3RA 2DA0A 4DX90 2FIFA 2K6DB 4I6LB 2AL6A 3DDCB 1OEYA 2VSZA 4J6IA 4NJ6A 1FAOA 1YX5B 4FJVB 3IBEA 3SDLC 3UZTA 3R7QA 2I5FA 2WH5A 2LXCA 2NS5A 3VTVA 4EMOA 4MELA 4ASWC 1U5FA 1JRUA 2BKRB 2D9WA 3A9JB 1NTVA 2CRFA 3M63B 1L2NA 1X86A 2LRUA 3AJ4A 2YS3A 1WJUA 2KOXA 3VH4B 2LJ5A 3OAWA 3ZDMC 2DHKA 2L8JA 3WYFB 2WYQA 3F5RA 1WE6A 3FM8C 2LGDA 2P0HA 4W9CA 2PE9A 2R2QA 5FR6A 4A3OA 4HVBA 3TO1A 1V81A 2W2WA 4W9DA 4N9F4 3TBLD 4WJQA 3DBRI 2VRWB 5D27A 1V5TA 3A4SC 4A6FA 4JQWC 4K7UA 5HE0A 4LJOB 2UVMA 1BTKA 3O65B 2JP2A 1UBIA 4KSLC 3WAOA 2H7DA 1NBFC 2VRRB 2MQJA 4MDKE 2A4ZA 2V1YA 4KHAA 2YLMA 4MSMB 2OQBA 5LLIA 3ZW3A 4P7IA 3NOBA 2G45B 2LBBA 4KIKB 4H8SA 2R2OA 1J8CA 2I1KA 4HPMB 3DVGY 4RM9A 1SIFA 4GMVA 2B3AA 5LXIB 1YX6B 2DZIA 4GDLB 4NNJB 2CODA 1PMSA 2GBKA 2P0DA 2ZPNA 1E8WA 2LD9A 4MGZE 2M17A 4ANXA
chains in the Genus database with same CATH superfamily
2KQ7A 4B9KA 2D10A 1V8CA 2D3BA 3AE5B 1RWSA 3QX1A 2VZKB 3A98B 2RR9A 1TZ1A 4FHJA 4ANUA 2WWZA 2FDQA 2CS4A 3BK2A 2INCC 2VKIA 5CHFA 1VD2A 5CTRC 5C1ZA 3PZDA 1SGHA 1R4MI 1XEEA 2GBMA 3DHIC 3DBLI 3SFDB 2B76B 4ARCA 3B9JA 4PT5A 4AJYB 3D8DA 3AMZA 2DNFA 2RNRB 2CJOA 3ZNHB 1FO4A 4MJSB 1F0ZA 2ZNVB 3VOQA 3NWDA 1NI3A 3NVVA 4HDOA 1E8YA 2Y7BA 1GOZA 2Z0EB 2FJ9A 4NY0A 2N1VA 3Q2AC 3WANA 3GOEA 1OQNA 3Q8EA 2MDXA 1HTQA 2BVCA 4M01A 3NHEB 2FBWB 4GU2A 3AEDB 1AQCA 1XD3B 1DDVA 3A1QB 1ZC4B 1PUTA 4NPNA 1KM7A 2BYTA 2WXMA 1ZC3B 5HE3A 4Z2MB 4E3CA 2KO3A 3U8ZA 2K25A 1J19A 3P6AA 4GDKB 2K2UA 4LNOA 2WU5B 3ZDTA 4W9FA 3V6CB 3WA0A 1BT0A 4JKGB 2AEHA 5DHFB 1QOBA 2YSZA 1R4NI 4N6EB 4IWQA 1QLBB 4BKGA 3ULCA 2KWUB 1Y19B 4XX5A 1PGXA 2QJLA 2KT7A 3NRZA 3L16A 4A9AA 4XWWA 4D2KA 2GS0A 2LASA 4LLGM 3BY4B 2PKOA 1J7BA 1FNWA 2BTEA 2AL3A 2IPKD 1C79A 2KHWB 1JROA 2KJHB 4DWFA 3R2TA 3LYYA 2X38A 1WXAA 1WF9A 5C3JB 3U4EG 1V89A 1K51A 2ZVOA 3NUHB 3QWZB 2L3ZA 3P7ZA 1UWXA 2MX2A 2SAKA 1D5MC 3KSYA 2KTRB 2V3SA 2IZVB 2JZ3B 2L2IA 4FULA 4LK0M 4WJ7A 4BAXA 5KQ1A 3OJ3A 3PHXB 3DQVA 1X1MA 1FD6A 4AUQC 1OQQA 2ZPYA 5KCVA 2KR0A 4ZRKA 3KH0A 2K5PA 2VZKD 4MT7A 1D4BA 3PVWA 3MC8A 1UWMA 2V4IB 4GB9A 5D2MB 1L7YA 3HIEA 3EHVA 4XZ4A 1JWAD 3UINB 3TVVA 5EE3A 3QC8B 3QARA 1KZ7A 2NR2A 1F77A 1T3QA 4C4VB 2QILA 4ZRJA 3JSVA 2NCNA 4HEA1 4TYZA 3JW0X 2M0XA 3OHMB 1C78A 1F9JA 2RPQA 4HAVB 1EF5A 1V2YA 2BS2B 2IYDB 4IM3A 1AN8A 4ZRQA 2H7EA 3NW8A 2EKIA 3APFA 1FGYA 4A5KA 1WJMA 4EZLA 2JVCA 2NTSA 1WXVA 1QT9A 2XN9C 2KCJA 4JKFA 1XLOA 2BBCA 4WJNA 1K8RB 4C7YA 5C5BB 1HB8A 1R4NB 2GI9A 3FP5A 1W1DA 4N58A 2R09A 3AV8A 5JZEB 2K22A 3RYTA 3NWFA 2CY4A 3LDZE 2MW5A 4US9A 4OHJA 2AQ3B 1Q67A 2M56B 2V3NA 2JXTA 3A33B 1QC6A 5C16A 1IBXB 1DROA 3IT4B 4WH4A 1EU4A 4JPSA 1XODA 2AYOB 3O13A 1UH6A 1JCKB 1I4HA 2MBOA 1P6SA 1PQSA 3Q8CA 1P7FA 1YJIA 2JX5A 2L76A 1P3QU 3CIRB 3Q8FA 1I4QA 3ABVB 4OZBA 2INPE 4L2YA 4IDIA 4IWOA 3ZJVA 2P0FA 2CB8A 2V4LA 2KUPA 2Q5WD 1OQYA 4HB0B 2NPTA 4AP4C 1V5UA 2DHIA 4WVFB 1TBEA 2JRHA 1MAIA 1N3HA 2N9XA 4K3CA 4RFBA 4RM8A 3TIXA 1WGYA 2JWZA 4BKTA 4NZLB 2C9WB 5JHHA 3IHPC 3PG7A 2GCJA 2KQ4X 4KDIC 2RUKB 2PEAA 1D3ZA 1X1GA 2JWUA 2MP2B 2X0SA 1PLSA 5IAAC 1XCGA 2I38A 2C60A 1I4XA 1FHWA 3NVZA 1TS4A 5G2NA 2WU2B 3HIZA 3ML9A 5G5HA 5J3TA 4KGSA 1EF1A 3IT6B 5FR3A 1BXTA 4JL9A 1QZEA 1YIWA 2BS3B 2LGYA 4KV2A 2MJDA 2O6VB 4YONA 1MKEA 2BB5A 3V61A 1CK1A 2DX5A 4S0RA 2ACZB 5L83A 2JRIB 4FADA 1GB1A 1TTNA 2DAJA 2KMMA 4QAYA 2SEBD 2HTHA 4RGNA 2IJ0A 4OZCA 2KDFB 3GP7A 1UBQA 2D9YA 1ET6A 3V62A 3PRZA 3CMMB 2LMCA 2LYDA 1LQBA 5AZHA 5HE2A 1N5XA 1OQRA 2O6VA 3PSEB 1TS5A 1S1QB 1BUIC 2YEPB 2QKLA 4MT5A 2KVZA 1UGJA 1U5GA 1EUVB 2X8XX 2KXJA 1HZ5A 3QK0A 2DN6A 2NMBA 2UZRA 3E9SA 3RD2A 5E6NA 4BZAA 1IGDA 4OT1A 1V97A 3ENBA 2M8SA 2IGHA 1Q5WB 1C1YB 1Q10A 4R3DA 2KWVB 1XF5L 2REXA 1NVID 5AEKB 5IA7A 2K39A 1WJ4A 1YQ4B 3M1IB 2BKFA 1ZUD2 2QHOA 3ML8A 1T77A 3RUIB 1ZPSA 3GYOA 3LJ3A 4BOSC 2KC1A 1WH3A 2Y8FA 2RD0A 2BF8B 4Q2JA 3W5VB 4BFRA 4ILJA 1TKEA 3NVYA 3ZVVA 3PVUA 4A20A 4C4VA 2K9XA 3ZGZA 4XWXA 1UF0A 4LJPB 1YJ1A 4KZ0A 3FEHA 1I42A 4ILGB 4G3XB 4JKEA 1P9DU 2J53A 3QWMA 1EU3A 3OANA 2LJIA 2M4NA 3GYPA 3NZSA 3ZQ4A 3KWLA 1H4RA 3X0WA 4C00A 2H89B 2L05A 2FUHB 4IAPA 3V60A 5EE0A 1UD7A 1W1HA 1WX7A 1FB8A 2COCA 2JZPA 3UGBB 3ZO5B 3IG3A 1MHXA 5JHBA 2N0YA 5C5BA 3PZ7A 1KZGA 3DBHB 2D9VA 2GJYA 4MH0E 3WAPA 4LNNA 4DX90 2K6DB 1OEYA 1YX5B 3R7QA 2I5FA 3VTVA 2MJEA 5I4DA 3A9JB 4C56C 3M63B 2LRUA 3AJ4A 1WJUA 3VH4B 3P4RB 3ZJTA 3ZDMC 5LG4B 3F5RA 4A3OA 2P0HA 4HPPA 3MP9A 3TO1A 4N9F4 1NEKB 4WJQA 3DBRI 4RF0A 1V5TA 2D3CA 2INDC 4KSLC 4OSNA 1B1ZA 3WAOA 2H7DA 2VRRB 3VRBB 4MDKE 2A4ZA 2V1YA 3HSAA 4MSMB 5BYRA 4H8SA 3DVGY 4RM9A 1SIFA 2ONQA 2M17A 3B1LX 3N3KB 2I5CA 2LVOA 1V49A 2HTHB 4E71A 4PS7A 4M0WB 3DCGA 2Z0PA 1WX9A 5E6OA 2K8CA 4K1RB 1L0VB 4A3PA 4EKUA 2D2QA 1E8XA 2K49A 1ZP0B 4JLCA 4DBBA 1V9JA 2MHJA 5CX3A 1GPXA 4OVZA 4GNKB 2WXGA 3A9JA 2C7NB 1J0GA 3MPXA 3VHTC 3HVZA 1VZ8A 4HDQA 1XQQA 1KLGD 4LTUA 1SE4A 2ICIA 4EUTA 2L7RA 1OMWA 4K81A 3DBLB 2D4QA 1YNTE 2G1EA 3L4PA 3PREA 4ACFA 3PS6A 5LXHA 4L23A 4RCOA 2WXPA 3N1XC 4GMXB 4NJ7A 1R7SA 2EMSA 2DFKA 3H8HA 2R61A 3P4SB 3P4QB 3BZDB 3TEYA 1QOAA 2C5LC 2UU7A 1LO5D 2WHIA 5FK9C 5KHQA 2D3GA 2EELA 2WDTB 3Q8AA 1N6ZA 3OWEB 1HA5A 4N59A 4DXAB 5DPRA 4EZJA 1DOYA 1XKEA 3NG0A 5JH5C 3PLVA 2LHEA 2DHJA 3CWIA 3DBHI 2KFJA 5IKCM 2MBQA 2DAFA 1WR6E 3I3TB 4HCNB 1V88A 4C7ZA 1C4PA 1WGHA 3DCXA 2XBBC 3ETRA 4IG7B 5AUKA 4OW0A 1T5XD 2ZW1A 5DHAB 3N20C 3TJPA 2NBWB 4OVVA 3VH3B 2LOZA 2WXIA 3W9CB 3QBVB 2DYOA 1MPHA 4K2OA 5IJMA 2FJLA 1QKZA 2W82A 2ROZB 4WWNA 3R8BA 4JWUC 4HAXB 2YT0A 1ZVRA 4B6HA 5H92C 1JDEA 4EFOA 1FEHA 2YT2A 3AULA 3PLUA 4WQMA 4MACA 4YSZB 3SHQA 1X05A 2NPTB 1ROEA 1NYRA 1UNQA 1F2RC 1UELA 1TGZB 4FHKA 4KZCA 2OHFA 3ZNID 2PPHA 1V5MA 2QCZA 3AE3B 5E6PA 1C3TA 1E7PB 1E8ZA 3FLVA 4GXBA 3RNEC 1NENB 2HTME 5D3WA 1VRAB 2DYNA 3ZVRA 4GDKA 4JIOU 2WP9B 1FPYA 2Z59B 1SE9A 5C6RA 4IC7B 1XLNA 1U2BA 2ROVA 3RZFA 4PQ0A 1UPQA 2KZRA 1IYFA 1K53A 2MFQA 4LCDE 1VCBA 4RGMA 3AE1B 4M0WA 3MC0B 1ACAA 1Z5SB 4YTMB 4B0MA 4P1BC 3SUZA 3QAQA 4A90A 1XXGA 4QJ3B 2I2YA 1GNUA 5JHGA 3N1YC 3EC8A 3D32A 1PYWD 4BKSA 3BVZA 4HATB 1GC6A 4G0NB 1WR1A 2CU3A 1TS2A 5D7GA 4ZHPA 3R2IA 4BBKA 2KVRA 2QEJC 4MY6A 2KIGA 2KN5A 3MHSD 1UPRA 1KJTA 3ONSA 1UNRA 2BYVE 4KVGB 4DQOC 2H88B 5D94A 4WAFA 4TQ1A 3ZUNA 4WJPA 3W2DA 2LKOA 3P63A 4MM3A 2N7DA 4HLEA 2LI5A 4CO7A 3H7PA 4GGQA 2Z4DA 2FJUB 2BS4B 4KSKC 3BINA 2DLWA 2K8HA 2UZSA 1XT9B 2OTXA 3PTFC 4O1NA 5IN7A 1QQRA 2HD5B 1IUEA 2FNJB 2IO3B 2WDRB 5DH9B 1KFYB 2C7HA 2OOBB 4NSWA 4HB3B 4NQKE 3PRMB 2N4FA 3IAM1 1SF0A 2M38A 2MKRA 3W5UB 3AE4B 3SR6A 1HBKA 3ZTDA 2RDHA 4KIKA 4JKBA 1WE7A 3QQ8B 1V5PA 4NJCA 3RNFC 1L2NA 4BBNC 1KBLA 1V86A 2D5GA 3CSFA 2Q13A 1ZDXA 3T3NA 1TJEA 2M19A 2ZW0A 3BVGA 3A4RA 2L83A 4RNAA 3HUIA 5DIFB 1FCCC 3L13A 1W1GA 2YF0A 3SFEB 3AECB 2A5UA 3A8PA 4F7HA 2K6QA 1WGKA 1F52A 2BCJA 1EWYC 5CHVC 2CR5A 1WGQA 1I4RA 3EUB2 2RRFA 1P5TA 1CMXB 3TCAA 2EKEC 2BT6A 3H1UA 4G11A 1V61A 2LGXA 3KYDD 1RFAA 1FIQA 2MSED 2KN4A 2RDGA 3ZXVA 4JX1C 3K9OB 1E7UA 4YSYB 2P8VA 1C77A 4WWOA 3OG5A 3KWVA 3T3OA 4JK8A 5H8YE 1C4CA 4EZKA 4CHMA 4HJGE 4IM2A 1NDDA 3Q6BA 1QF6A 2KAJA 2LOXA 3W1YA 5TR5A 4F8CB 1ZW7A 2L52A 3SYXA 1ET9A 1WX8A 2G4DB 2HJ8A 3B08A 4OVUA 2K0PA 2WX0A 1U4AA 2XQNM 2BGFA 3ZRCA 1WYGA 2LGIA 3A9KB 3EECA 2ZNVC 2GB1A 1WFYA 3CXBB 3E9LA 3BVMA 2CHXA 3AEGB 4XYCA 1KLVA 3V3XA 4TQ0A 3U2SC 4L1RA 4M02A 2D07B 4YXDB 4CHJA 4AQ7A 1DIKA 3X23A 2W54A 4Y94A 1MK7B 1GJZA 1TKYA 1XX0A 3W1SC 1XLQA 2L00B 2WS3B 3FILA 5LNK1 1EM7A 1M7RA 2JZZA 2Z59A 2KLCA 2KDEB 1HXYD 4KDLB 4W9GA 3AU4A 1DDWA 1I4PA 1JWMD 4FA6A 3NZ3A 2GLSA 1T0RC 1HB6A 3Q14C 5I2MA 3SEBA 1KF6B 2JSVX 4HXDA 4HKQA 1N63A 1L6VA 2KC2A 1K52A 2IDYA 3RZWC 2IY1B 1EO6A 2KANA 4YSXB 4DXFA 3U30A 4C0AA 1KC7A 4QJ5B 2UYZB 4A6KA 3GE3C 2FCSA 3H9DA 1XR0B 3CF6E 1B9RA 2MEKA 3S2AA 5DPSA 4LNKA 4WSFA 4AJWA 3VIAA 2GUMA 3ZJUA 5GXGB 4ANVA 2WDQB 1ZKHA 2PE6B 1TXDA 2MCNB 1L0YB 4HK2A 4JWSC 3RNAC 2WXRA 2KTRA 4F7ZA 1P3RA 2DA0A 2FIFA 4I6LB 4J6IA 3SDLC 4FJVB 3DWGC 4ASWC 2WH5A 2Z8LA 4EMOA 1U5FA 1V1PB 2CRFA 2N9KA 1X86A 1JALA 1L6UA 2YS3A 2DHKA 3WYFB 1WE6A 2R2QA 5FR6A 4W9DA 3TBLD 3SBTA 5D27A 5HE0A 3O65B 4TSSA 3KLSX 4ZRPA 3AEFB 2MQJA 5BMIA 1ZXIA 3ZW3A 3NOBA 2LBBA 3NVWA 2R2YA 1SB3C 2R2OA 1J8CA 2I1KA 1YX6B 2CODA 2LD9A 3CIKA 4PK1A 3EA6A 3AB5A 3JYUA 4XGAB 4URKA 2HRJA 2ZVNA 1AWEA 4HB2B 1PFJA 4MEMA 4M8MA 2RVBB 1M7EA 4KKJA 1IBXA 2WX1A 4ZDVA 2RDBC 2G3QB 4EE2A 2KACA 5EE9A 2E2XA 2D3AA 2ZKMX 2LVQA 4GOCA 2ABDA 2RQ1A 4DDGD 2V76A 2COFA 2TSSA 3I5JC 3PSCA 3N30A 5D3XA 1FXAA 1T0QC 3CSTA 1U29A 1EVHA 4HAYB 1V1PA 2MBEA 2PZ1A 1YJJA 2RLOA 2MRPA 3NJTA 4W9LA 3IFWB 4WURA 1RRPB 1E10A 4K7SA 3LB8C 1WXQA 3WAMA 3O96A 3KUZA 5J3YA 2ZZPB 3ZKJC 2GRIA 2BB6A 3T8MA 3L17A 2KDBA 4G50A 3N1ZC 2YVCA 2JYTA 2NVUI 3PV1A 1N61A 4A8XC 3G9WA 2WGSA 2XK5B 4XDCA 2WXHA 3WCQA 2LHDA 2AQ2B 2LGSA 1NYQA 2LULA 2JPHA 3V5WA 4CYEA 1WJ1A 3EFUA 4MH8A 2LRWA 4W9HA 5E6JA 4XC2A 2DZMA 2KFKA 2PVGC 3GZNB 4IM0A 3QIJA 4BOZB 2RSGA 2YEPF 2WDVB 2CHZA 4MM3B 2KLGA 1FHOA 4HSIA 2L0TA 3DVNV 4I6PA 1SE2A 4FJZA 1OFFA 3AE7B 4WWPA 1PDXA 3DBSA 2N7EA 1P0RA 3FVCA 1ZE3D 3PVLA 3Q3JA 3MC9A 1VR9A 4WQOB 3RCPA 1WM2A 3QHTA 3PGEA 1YMHE 2DYQA 2WXKA 5CLLB 3TEZA 1V6EA 1WJ6A 2C7MB 4II2B 3L10B 1L4DB 3H7PB 2D9ZA 2V0GA 1E7VA 3APDA 4QJ4B 1SBBB 4L6EA 1A70A 3HVDA 2GBNA 3Q3OC 1QQGA 1ZM0A 2MBHA 1ZGUB 2WXLA 1WVHA 3VR9B 4JE3B 4NAWA 3ZLZA 1MIXA 4A6HA 2EC1A 1WI1A 5D3DA 1C4AA 2N9PC 3KRWA 3P2BA 3HK0A 1D5XC 3RNBC 1UNSA 1GGOA 1QOGA 4DHJD 1I7AA 4GN1A 1L4ZB 2FUG1 4REZA 1MPEA 3AEEB 3ZNGC 3NZUA 1J7CA 1M94A 2QSDA 3MHZA 2AQ1B 4PS3A 2X18A 4J3OD 3FC4A 2KNBA 2LEKA 1K5DB 4MK0A 1YN5A 2LXAA 2DX1A 2KK8A 2QIEB 3PO0A 3VXWA 3E66A 2INNE 5FKAC 1G6JA 4IKGA 3P1MA 4JK9A 1CJEA 4ICUA 1DYNA 1EGXA 4LDTD 2Y8GA 4ANWA 3DPDA 1HTOA 3RCZA 2NBUA 1XO3A 3ODWA 3WALA 1V1OA 5L95C 3RFZB 3B2FA 2K2JA 1JW9D 1M4VA 1A5RA 3DWMA 4TUUA 5LONB 4ZRIA 4DDID 1JWBD 4I6NB 1JRPA 3MJ5A 4B6WA 2XK5A 2DIKA 3DXCA 4GSWA 1I35A 2CJNA 1RRBA 3AEBB 1L0XB 1IGCA 3AE9B 3NS1A 4DXGA 2MLBA 2YRYA 5IP4D 3VUWA 4M8NA 4M00A 3ODOA 5J2RA 2LVPA 4FLHA 3N7CA 4HRSA 4ZYSA 2DYBA 4BKSD 4AS1A 1FRRA 3U12A 3R3MA 5EDSA 1LB1A 1WWTA 1QILA 2CQUA 2NTTA 5C2TB 3DVGX 1WXSA 4GIVA 1SXTA 1SEBD 1OY2A 5J17A 1UZXB 4IOIE 1WI0A 4BBNF 1Z87A 2W2XC 1N62A 3MJWA 1TZOA 1WM3A 2ZEQA 1FCLA 1XLPA 2LWPA 1JQ4A 2DKPA 2Z0QA 4MJSA 4P16A 2V9HA 4FXCA 3C8YA 1T6BX 2M14A 4K3BA 3Q3MC 3FSSA 3KUCB 1ZSQA 4K2PA 4GOUA 2BYEA 3M95A 2N0SB 3V05A 4CQNA 2KTFA 1Y5OA 1VDVA 1JMLA 3ML4A 3PP2A 5BO4B 3GB1A 3HW2B 4AWJA 1FRDA 3KW5B 5D6JB 2J0JA 1U5EA 1I4GA 4W9KA 4YT0B 1V5OA 3VDZA 5AZGA 1T0SC 4KGRA 5IO9A 4RGTA 2W3SA 5JP4A 5HI1A 4TV3A 4CHKA 3C0RB 2OJWA 5GOWB 2W9NA 3GE8C 1RAXA 2Y3AA 2PLPA 4H2AA 1KOTA 2Y5PA 3PZ8A 3NY5A 2DWQA 1RM6C 3FAHA 1VJKA 4WIPA 2DX5B 2N9LA 5KQ4A 1FNVA 3TL5A 2J7QB 5AUIA 1TJ6A 4LNIA 5IOIA 2ELAA 4RH6A 5JHAA 3BIID 4ICVA 3MTNB 5HKHA 3I57A 1ISNA 3DVNU 5L81A 2JYEA 4DHZE 5AZFA 1U5DA 3HQCA 1FOEA 1FHXA 3JSVB 2RSUA 3ECIA 3QA8A 2ELBA 4HROA 3BYTB 4FJYA 3DXEA 4RMAA 3RMKC 4ARIA 4TKNA 1FGZA 2G9HD 2EMTA 3T06A 3SBGA 4L1BA 5HE1A 1OEYJ 2LFIA 2NZ8B 1SIJA 2NBVA 2JT4B 4JK7A 1WJNA 2KKCA 1LXDA 2QMTA 1VLBA 4WAAA 4PNKA 1TQZA 3ULBA 3B2GA 3VVWB 3TMPB 4ZOHC 5CLQB 4F1SA 3AN1A 2LUEA 2UWQA 4A6FB 1ACCA 2W55A 3VRAB 1WGRA 5MPOA 1FFUA 4DX8A 2KDMA 4JKCA 3KY9A 1NU2A 1RLFA 3OLMD 2K8EA 1WGGA 3W1SA 5BYQA 3RPFC 1MK9B 3KVFB 2KWCA 2CAYA 1MVKA 3KUDB 1WYWB 2PTLA 1PGAA 5JLJB 2LUMA 3ALBA 2DENB 2Y5BB 2V3PA 1YOVB 3HM3A 1NTIA 2K1FA 2QDFA 2KJ6A 5DPWA 1DDMA 2IY0B 5J18A 1ZOYB 4JKHA 1UGMA 3PT2B 3RULA 2N23A 2ADZA 1ESFA 3NSUA 2LZ6A 3VUXA 4QXAB 2XNAC 2DLBA 3URYA 2AL6A 3DDCB 3Q69A 3U7ZA 1I7HA 3IBEA 2NS5A 2J4XA 1J7AA 1JRUA 2BKRB 5IRSA 2KOXA 3OAWA 2WYQA 3FM8C 2QC8A 2HDEA 3RN9C 1V81A 2VH2A 2VRWB 3A4SC 2W3RA 2JP2A 1UBIA 1NBFC 2OQBA 5JXVA 4P7IA 2G45B 3P4PB 4HPMB 1L5PA 5LXIB 4GDLB 4JKAA 1E8WA 3A1QA 4W9CA 1VZ7A 1U27A 2COPA 2ZJDA 2WXJA 3VQIA 2GBRA 4YL8A 3H7SA 3TEXA 2L1AA 4JKGA 4DBGA 3IXSA 4B95A 2BWFA 2K3UA 1P7EA 1OGWA 3UIOB 3H6NA 2MWNB 3SNHA 4LNFA 1WIAA 3E9PA 2KUQA 2IYBA 1IPGA 2KQSA 3I9V1 1AW7A 2M1MA 3M62B 4PYZA 5EE1A 1YQ3B 1RFKA 4OZAA 4ILHA 1VBHA 3MFGA 5BMGA 3VTWA 1EWCA 2QKMA 4RGOS 3AH7A 2RPVA 3VFKA 4XDDA 1VZ6A 2O2VB 1R4MB 2E3TA 1HEZE 2WNMA 4TMAB 4D6WA 4YTNB 4ZHOA 1SHCA 5BYSA 4HHVA 1MHHE 1WGUA 4HPLB 3E56A 2KDIA 1Q0WB 3DOWA 3D8FA 3R7RA 2FIDA 2GOWA 3UQBA 4XWTA 4IFSA 3IAS1 5TSSA 2R0DA 2OJRA 2IFSA 4HAZB 3VR8B 2WXQA 1FFVA 1GG3A 4BVUC 2I1JA 5C23A 1D6EC 1ZYIA 2Z0OA 3ZXRA 3BYYB 5D3VA 1K5GB 4II3B 4XE0A 2BW2A 1E9MA 2O6VD 3APCA 3AM9A 1NVLA 1DOXA 1YN4A 3AE6B 1WSPA 2D11A 3RNGC 3QCAA 4AOFA 3EGRA 4A55A 3PRPB 5G5GA 1FM0D 1AWDA 1EAZA 1MI1A 2MA9B 1Z2MA 2AWTA 3M3JA 1CZPA 3L54A 3T9LA 3C19A 1SJHD 3LJUX 3WIMA 3BK1A 3AE8B 3TFMA 3RI7C 4GDLA 2JQRB 1S3SG 3K9PB 4WJOA 1GC7A 1C76A 5KHOA 4P6VF 4DIXA 4HB4B 1WY8A 3RNCC 2J0MA 1VBGA 1LGRA 2IGDA 1P98A 2LG1A 4HAWB 2EJ8A 2JF5A 2OEDA 4W9EA 4IW0A 1AYFA 1AARA 1HE8A 2JUOA 1DBHA 2R82A 5D3IB 1SE3A 4ZYNA 1WZ3A 2FAZA 3N9YC 2RGNB 2FCQA 1XCQL 4EEWA 4FBJB 1MG4A 1XD4A 1TY0A 2KFKB 2PW9A 3QJZA 4D0NB 2ZCBA 2YS1A 3SV1A 2GCLA 1K50A 1JWUD 3FILB 4KGTA 1WRDB 2KMCA 3PHWB 2ON8A 4HJKA 2IO2B 3RT3B 2MP2A 3N32A 2FCNA 1UEFA 1DYQA 2N9EB 2KWDA 3EFCA 5HFYA 2G4SA 4GZUA 1X11A 3UIPB 1GAQB 3FKYA 1I2HA 3P42A 4FN2A 4W9IA 1BWNA 4K7WA 1BTNA 2CU1A 3ODXA 3IVFA 1C9FA 1YD8U 4IOYX 2DZKA 2HJ1A 1F2RI 2CKHB 5DI9B 2XEWA 3Q8BA 1H10A 1BAKA 3KRXA 1FMAD 4E74A 1Q1OA 3A8QA 2J59M 2KD0A 1PGBA 4KKIA 2CY5A 3AU5A 3U7DA 1WG7A 5C79A 4P1CC 3B77A 1MIZB 2DHZA 3L0WB 3VUYA 1ZXHA 1KH0A 1OTRB 2O2VA 3BWUD 4DHZB 2J42A 3BJIA 3GZNI 1E90A 1D5ZC 4F7GA 4CSQA 2N1WA 2HE7A 2YS5A 2IO1B 2IGGA 4KHBB 1YN3A 3VAWA 2KYWA 3SO6A 1LM8B 1SSNA 3KZ1A 4PYUA 1ST7A 2PJHA 2GMIC 3ZRFA 1BMLC 3OJ4B 2L1CA 1X1FA 1IP9A 2KX3A 3B0AA 4MGIE 1WGDA 4HKZE 5D3YA 3NWAA 1PFDA 2PMVA 5HG2A 3TW1A 5GMVA 4IUMB 3R66C 3MDBC 1ZDVA 4DK5A 4HAUB 2KX0A 5G55A 2DZJA 3Q3NC 2KIEA 2JY6A 2PVOD 3ZTCA 4NQLB 5FI0A 1LFDA 3DHHC 4C80A 1GUAB 4YWGG 2NMQA 1Y8RC 3UF8A 3HHMA 1WXMA 4EOYA 2K8BA 2W2XD 3AEAB 3VTUA 2PIAA 2K00A 4W9JA 1TY2A 1WMHB 4F7UP 1HZ6A 2D9XA 1N60A 4NAMA 2DBYA 5M4YB 3TSSA 3D8EA 1MJDA 4JGHB 1WZ0A 1HQRD 3UI3A 2AX5A 1XCTL 2MBBB 2L32A 2L0FA 1GB4A 1TKGA 4PS8A 3SU8X 4DHJB 3JVZX 2BPSA 1MFWA 2M0AA 4MGKE 4NAWB 1T0YA 4IWPA 1J0WA 1FNUA 3KYCD 1NTYA 2MWSB 3A9KA 1E5WA 3TEWA 4K17A 3ZIMA 2KJRA 2G35A 2J0KA 5BMHA 1NI2A 4KHOA 4B0EA 2JU6X 2WQYB 2CHWA 2WXOA 2BYFA 3HM6X 1KLUD 3PEGA 2Z0DB 1WMHA 1H8CA 1P1AA 3AI5A 2N7JA 3TUOA 4LDTB 4YTPB 2BWES 4Z2NA 2Z13A 1KI1B 1N5WA 2WLBA 2MJ3A 2ZCCA 2DTCA 4JKDA 3Q3FA 1RJ2A 4KAXB 3DBRB 4UDUC 3PPAA 5J3QA 4RF1A 5HHDG 1F1HA 4KX6B 2NBVB 5FI1A 4S17A 2E6XA 3F0WA 2J52A 3ZYYX 1MI0A 3I63C 2IBIB 5DPTA 2WXNA 4MGZE 2BQQA 1TT5B 3ENEA 1UNPA 5DCNA 3HRDD 1WRIA 2KGXB 1UUPA 1Y56A 2KMAA 1E0ZA 4X57B 2GBJA 1YQBA 3U52E 3LXFA 2MH7A 4GLSC 3UQAA 1MG8A 1LW3A 1TYGB 2FE8A 2DYMA 3GS2A 4A6QA 5EFXA 2RGFA 2JXXA 2FCMA 1KRHA 4ITKA 4HWIB 1KTKA 2ASQA 4WWMA 5LOPB 4GPTB 1FXIA 3SD5A 1B55A 3L08A 2DKQA 1RYJA 4MGYE 1FXTB 4MSQB 3AXCA 3EPYA 4EJNA 2IO0B 4HCPB 5T8IA 3AE2B 1QOFA 1V80A 5CHWA 2COAA 4US8A 3E9OA 3ZNZB 1IRSA 2YT1A 3V6EB 3NS8A 1ENFA 1TS3A 1DOIA 2RMMA 1E6EB 3DXDA 2VH1A 3DHGC 1JWSD 2VSZA 4NJ6A 1FAOA 4KHBA 3UZTA 2LXCA 5I2SA 4MELA 1DGJA 2D9WA 1NTVA 2WXFA 2LJ5A 5JVLA 2L8JA 2LGDA 4HVBA 1TIFA 2PE9A 2W2WA 3KQ4A 4JQWC 4K7UA 4A6FA 4LJOB 2UVMA 1BTKA 1CQVA 2Y5CA 4KHAA 2YLMA 1SJED 5LLIA 4KIKB 4USAA 3J9CA 4GMVA 2B3AA 2DZIA 4NNJB 1PMSA 2GBKA 2P0DA 1STEA 2ZPNA 2Z14A 3A58A 4ANXA
chains in the Genus database with same CATH topology
2KQ7A 4B9KA 2D10A 3QX1A 3A98B 2RR9A 1TZ1A 4FHJA 4ANUA 2WWZA 2FDQA 2CS4A 2VKIA 5CHFA 1VD2A 5CTRC 5C1ZA 3PZDA 1SGHA 1R4MI 2GBMA 3DBLI 4AJYB 3D8DA 2RNRB 3ZNHB 4MJSB 2ZNVB 3VOQA 4HDOA 1E8YA 2Y7BA 2Z0EB 2FJ9A 4NY0A 2N1VA 3WANA 3GOEA 1OQNA 2MDXA 3NHEB 4GU2A 1AQCA 1XD3B 1DDVA 3A1QB 1ZC4B 4NPNA 1KM7A 1ZC3B 5HE3A 4Z2MB 4E3CA 2KO3A 3U8ZA 2K25A 1J19A 3P6AA 4GDKB 2K2UA 3ZDTA 4W9FA 3V6CB 3WA0A 1BT0A 4JKGB 2AEHA 5DHFB 2YSZA 1R4NI 4IWQA 4BKGA 3ULCA 2KWUB 1Y19B 4XX5A 3L16A 2GS0A 2LASA 3BY4B 2AL3A 2KHWB 2KJHB 4DWFA 1WXAA 1WF9A 1V89A 2ZVOA 3QWZB 2L3ZA 3P7ZA 2MX2A 3KSYA 2KTRB 2V3SA 2IZVB 2JZ3B 2L2IA 4FULA 4WJ7A 5KQ1A 3OJ3A 3PHXB 3DQVA 1X1MA 4AUQC 2ZPYA 5KCVA 4ZRKA 3KH0A 4MT7A 3PVWA 4GB9A 5D2MB 1L7YA 3EHVA 4XZ4A 3UINB 3TVVA 3QC8B 3QARA 1KZ7A 2NR2A 4ZRJA 3JSVA 2NCNA 4TYZA 3JW0X 2M0XA 1F9JA 2RPQA 4HAVB 1EF5A 1V2YA 2IYDB 4IM3A 2H7EA 3APFA 1FGYA 4A5KA 1WJMA 4EZLA 2JVCA 1WXVA 2KCJA 4JKFA 4WJNA 1K8RB 5C5BB 1HB8A 3FP5A 1W1DA 2R09A 5JZEB 3RYTA 2CY4A 3LDZE 2MW5A 1Q67A 3A33B 1QC6A 5C16A 1DROA 1XODA 2AYOB 1UH6A 2MBOA 1P6SA 1PQSA 2L76A 1P3QU 4IWOA 2P0FA 2CB8A 2V4LA 2KUPA 1OQYA 4HB0B 2NPTA 4AP4C 1V5UA 2DHIA 4WVFB 1TBEA 2JRHA 1MAIA 1N3HA 2N9XA 4RM8A 3TIXA 1WGYA 2JWZA 4BKTA 2C9WB 5JHHA 3IHPC 3PG7A 2GCJA 4KDIC 2RUKB 2PEAA 1D3ZA 1X1GA 2MP2B 2X0SA 1PLSA 5IAAC 1XCGA 2C60A 1FHWA 5G2NA 3ML9A 3HIZA 5J3TA 1EF1A 4JL9A 1QZEA 1YIWA 2LGYA 4KV2A 2O6VB 4YONA 1MKEA 3V61A 2DX5A 5L83A 2JRIB 4FADA 1TTNA 2DAJA 2HTHA 2KDFB 1UBQA 2D9YA 3V62A 3PRZA 3CMMB 2LYDA 1LQBA 5AZHA 5HE2A 2O6VA 3PSEB 1S1QB 2QKLA 1U5GA 1EUVB 2KXJA 3QK0A 2DN6A 2NMBA 2UZRA 3RD2A 5E6NA 2M8SA 3ENBA 1Q5WB 1C1YB 2KWVB 2REXA 5AEKB 5IA7A 2K39A 1WJ4A 3M1IB 2BKFA 2QHOA 3ML8A 3RUIB 3LJ3A 3GYOA 4BOSC 2KC1A 1WH3A 2Y8FA 2RD0A 2BF8B 4BFRA 4ILJA 3ZVVA 3PVUA 4A20A 4XWXA 4LJPB 1YJ1A 4KZ0A 3FEHA 1I42A 4ILGB 4G3XB 4JKEA 1P9DU 3QWMA 3OANA 2M4NA 3GYPA 3NZSA 3X0WA 1H4RA 2L05A 2FUHB 4IAPA 3V60A 1UD7A 1W1HA 1WX7A 1FB8A 2COCA 3UGBB 3ZO5B 3IG3A 5JHBA 2N0YA 5C5BA 1KZGA 2D9VA 2GJYA 4MH0E 3WAPA 4DX90 2K6DB 1OEYA 1YX5B 3R7QA 2I5FA 3VTVA 3A9JB 3M63B 2LRUA 3AJ4A 1WJUA 3VH4B 3ZDMC 3F5RA 4A3OA 2P0HA 3TO1A 4N9F4 4WJQA 3DBRI 1V5TA 4KSLC 3WAOA 2H7DA 2VRRB 4MDKE 2A4ZA 2V1YA 4MSMB 4H8SA 3DVGY 4RM9A 1SIFA 3B1LX 3N3KB 2M17A 2I5CA 2LVOA 1V49A 2HTHB 4E71A 4PS7A 4M0WB 3DCGA 2Z0PA 1WX9A 5E6OA 2K8CA 4K1RB 4A3PA 4EKUA 2D2QA 1E8XA 4JLCA 4DBBA 1V9JA 5CX3A 3A9JA 2C7NB 1J0GA 3MPXA 3VHTC 4HDQA 1XQQA 4EUTA 2L7RA 1OMWA 4K81A 2D4QA 3PREA 3PS6A 5LXHA 4GMXB 4NJ7A 2EMSA 2DFKA 2C5LC 5KHQA 2D3GA 2WDTB 4DXAB 5DPRA 4EZJA 1XKEA 5JH5C 3PLVA 2DHJA 3DBHI 2KFJA 2MBQA 2DAFA 1WR6E 3I3TB 4HCNB 1V88A 1WGHA 2XBBC 4IG7B 5DHAB 3TJPA 2NBWB 4OVVA 3VH3B 2LOZA 3QBVB 2DYOA 1MPHA 4K2OA 5IJMA 2FJLA 2ROZB 4WWNA 4HAXB 2YT0A 1ZVRA 4B6HA 1JDEA 4EFOA 3AULA 3PLUA 3SHQA 1X05A 2NPTB 1UNQA 1UELA 1TGZB 4FHKA 4KZCA 3ZNID 2PPHA 1V5MA 5E6PA 1C3TA 1E8ZA 3FLVA 4GXBA 5D3WA 2DYNA 3ZVRA 4GDKA 4JIOU 2Z59B 1SE9A 5C6RA 4IC7B 1U2BA 2ROVA 3RZFA 4PQ0A 1UPQA 2KZRA 1IYFA 2MFQA 1VCBA 1ACAA 1Z5SB 3SUZA 3QAQA 1GNUA 5JHGA 3EC8A 3D32A 4BKSA 4HATB 1GC6A 4G0NB 1WR1A 5D7GA 4BBKA 2KVRA 4MY6A 2KN5A 3MHSD 1UPRA 1KJTA 3ONSA 1UNRA 2BYVE 4KVGB 5D94A 4TQ1A 3ZUNA 4WJPA 2LKOA 4MM3A 2N7DA 4HLEA 2LI5A 4CO7A 3H7PA 4GGQA 4KSKC 3BINA 2DLWA 2K8HA 2UZSA 1XT9B 2OTXA 3PTFC 2HD5B 2FNJB 2IO3B 5DH9B 2C7HA 4NSWA 4HB3B 2OOBB 4NQKE 3PRMB 2N4FA 2M38A 2MKRA 1HBKA 3ZTDA 4KIKA 4JKBA 1WE7A 3QQ8B 1V5PA 1L2NA 4BBNC 1KBLA 1V86A 3CSFA 2Q13A 3A4RA 5DIFB 3L13A 1W1GA 2YF0A 2A5UA 3A8PA 4F7HA 2K6QA 2BCJA 5CHVC 2CR5A 1WGQA 1P5TA 1CMXB 3TCAA 2EKEC 3H1UA 4G11A 1V61A 2LGXA 3KYDD 1RFAA 2MSED 3K9OB 1E7UA 2P8VA 4WWOA 4JK8A 4EZKA 4CHMA 4IM2A 1NDDA 2LOXA 3W1YA 5TR5A 4F8CB 1ZW7A 3SYXA 1WX8A 2HJ8A 2G4DB 3B08A 4OVUA 2WX0A 1U4AA 2XQNM 2BGFA 3ZRCA 3A9KB 3EECA 2ZNVC 1WFYA 3CXBB 3E9LA 2CHXA 1KLVA 4TQ0A 2D07B 4CHJA 1DIKA 3X23A 4Y94A 1MK7B 1GJZA 1XX0A 3W1SC 2L00B 1M7RA 2JZZA 4KDLB 2KDEB 2KLCA 4W9GA 3AU4A 1DDWA 4FA6A 1HB6A 4HXDA 3RZWC 2KC2A 2IY1B 1EO6A 2KANA 3U30A 4C0AA 1KC7A 2UYZB 4A6KA 2FCSA 3H9DA 1XR0B 3CF6E 3S2AA 5DPSA 4WSFA 4AJWA 3VIAA 4ANVA 1ZKHA 2PE6B 1TXDA 2MCNB 4HK2A 2KTRA 4F7ZA 1P3RA 2DA0A 2FIFA 4I6LB 4J6IA 3SDLC 4FJVB 4ASWC 2WH5A 4EMOA 1U5FA 2CRFA 1X86A 2YS3A 2DHKA 3WYFB 1WE6A 2R2QA 5FR6A 4W9DA 3TBLD 3SBTA 5D27A 5HE0A 3O65B 2MQJA 3ZW3A 3NOBA 2LBBA 2R2OA 1J8CA 2I1KA 1YX6B 2CODA 2LD9A 3CIKA 3JYUA 4URKA 2HRJA 2ZVNA 1AWEA 4HB2B 1PFJA 4MEMA 4M8MA 2RVBB 1M7EA 2WX1A 4ZDVA 2G3QB 2E2XA 2LVQA 4GOCA 2ABDA 2RQ1A 4DDGD 2V76A 2COFA 3PSCA 3N30A 5D3XA 3CSTA 1U29A 1EVHA 4HAYB 2MBEA 2PZ1A 2RLOA 2MRPA 4W9LA 3IFWB 1RRPB 4K7SA 3WAMA 3O96A 3KUZA 5J3YA 2ZZPB 3ZKJC 3T8MA 3L17A 2KDBA 4G50A 2YVCA 2NVUI 3PV1A 3G9WA 2XK5B 2LULA 2JPHA 3V5WA 4CYEA 1WJ1A 3EFUA 2LRWA 4W9HA 4XC2A 2DZMA 2KFKA 4IM0A 3QIJA 4BOZB 2RSGA 2CHZA 2KLGA 1FHOA 2L0TA 3DVNV 4I6PA 4FJZA 4WWPA 3DBSA 2N7EA 1P0RA 3Q3JA 3PVLA 4WQOB 3RCPA 1WM2A 3QHTA 3PGEA 2DYQA 5CLLB 1V6EA 1WJ6A 2C7MB 4II2B 3L10B 3H7PB 2D9ZA 1E7VA 3APDA 4L6EA 2GBNA 1QQGA 1ZM0A 2MBHA 1ZGUB 1WVHA 4NAWA 3ZLZA 1MIXA 4A6HA 2EC1A 1WI1A 2N9PC 3KRWA 3P2BA 3HK0A 1GGOA 4DHJD 1I7AA 4GN1A 3ZNGC 3NZUA 1M94A 4PS3A 2X18A 2KNBA 1K5DB 4MK0A 2LXAA 2DX1A 2KK8A 3VXWA 3E66A 1G6JA 4JK9A 4ICUA 1DYNA 1EGXA 4LDTD 2Y8GA 4ANWA 3DPDA 3RCZA 2NBUA 3ODWA 3WALA 5L95C 2K2JA 1A5RA 4TUUA 5LONB 4ZRIA 4DDID 4I6NB 4B6WA 2XK5A 2DIKA 3DXCA 4GSWA 1I35A 1RRBA 2MLBA 2YRYA 3VUWA 4M8NA 3ODOA 5J2RA 2LVPA 4FLHA 3N7CA 2DYBA 4BKSD 5EDSA 3R3MA 1LB1A 2CQUA 3DVGX 1WXSA 4GIVA 5J17A 1OY2A 1UZXB 1WI0A 4BBNF 1Z87A 2W2XC 3MJWA 1WM3A 2ZEQA 2LWPA 2DKPA 2Z0QA 4MJSA 2M14A 3FSSA 3KUCB 1ZSQA 4K2PA 3M95A 2BYEA 2KTFA 1Y5OA 3ML4A 3PP2A 5BO4B 3HW2B 4AWJA 3KW5B 5D6JB 2J0JA 1U5EA 4W9KA 1V5OA 3VDZA 5AZGA 5JP4A 4TV3A 4CHKA 3C0RB 2W9NA 5GOWB 1RAXA 1KOTA 3NY5A 2DX5B 5KQ4A 3TL5A 2J7QB 1TJ6A 2ELAA 5JHAA 4ICVA 3MTNB 5HKHA 1ISNA 3DVNU 5L81A 4DHZE 5AZFA 1U5DA 3HQCA 1FOEA 1FHXA 3JSVB 2RSUA 3ECIA 3QA8A 2ELBA 4FJYA 3DXEA 4RMAA 4TKNA 1FGZA 2EMTA 3T06A 3SBGA 5HE1A 1OEYJ 2NZ8B 2JT4B 4JK7A 1WJNA 2KKCA 1LXDA 4WAAA 4PNKA 1TQZA 3ULBA 3VVWB 3TMPB 5CLQB 4F1SA 2LUEA 2UWQA 4A6FB 1WGRA 4DX8A 4JKCA 3KY9A 1NU2A 1RLFA 3OLMD 1WGGA 3W1SA 1MK9B 3KVFB 2KWCA 2CAYA 3KUDB 1WYWB 5JLJB 3ALBA 2DENB 2Y5BB 3HM3A 1NTIA 2K1FA 2KJ6A 5DPWA 1DDMA 2IY0B 5J18A 4JKHA 1UGMA 3PT2B 3RULA 2N23A 2ADZA 3NSUA 2LZ6A 3VUXA 2AL6A 3DDCB 3IBEA 2NS5A 1JRUA 2BKRB 2KOXA 3OAWA 2WYQA 3FM8C 1V81A 2VRWB 3A4SC 2JP2A 1UBIA 1NBFC 2OQBA 4P7IA 2G45B 4HPMB 5LXIB 4GDLB 4JKAA 3A1QA 4W9CA 1E8WA 1U27A 2COPA 2ZJDA 3VQIA 2GBRA 4YL8A 3H7SA 4JKGA 4DBGA 4B95A 2BWFA 1OGWA 3UIOB 3H6NA 2MWNB 3SNHA 1WIAA 3E9PA 2IYBA 1IPGA 2KQSA 2M1MA 3M62B 4PYZA 4ILHA 1VBHA 3VTWA 2QKMA 3VFKA 2O2VB 1SHCA 4HHVA 1WGUA 4HPLB 2KDIA 1Q0WB 3DOWA 3D8FA 3R7RA 2FIDA 2GOWA 3UQBA 4IFSA 2R0DA 2OJRA 2IFSA 4HAZB 4BVUC 1GG3A 2I1JA 5C23A 2Z0OA 5D3VA 1K5GB 4II3B 2O6VD 3APCA 1NVLA 2D11A 3QCAA 4AOFA 3PRPB 1EAZA 2MA9B 1Z2MA 2AWTA 3M3JA 3L54A 3T9LA 3LJUX 3WIMA 3TFMA 4GDLA 1S3SG 3K9PB 4WJOA 1GC7A 5KHOA 4HB4B 1WY8A 2J0MA 1VBGA 1P98A 2LG1A 4HAWB 2EJ8A 2JF5A 4W9EA 4IW0A 1HE8A 1AARA 2JUOA 1DBHA 2R82A 4ZYNA 1WZ3A 2FAZA 2RGNB 2FCQA 4EEWA 4FBJB 1XD4A 2KFKB 3QJZA 4D0NB 2ZCBA 2YS1A 3SV1A 2GCLA 1WRDB 2KMCA 3PHWB 4HJKA 2IO2B 3RT3B 2MP2A 3N32A 2FCNA 1UEFA 2N9EB 2G4SA 4GZUA 1X11A 3UIPB 1I2HA 4FN2A 4W9IA 1BWNA 4K7WA 1BTNA 2CU1A 3ODXA 3IVFA 1YD8U 4IOYX 2DZKA 2CKHB 5DI9B 2XEWA 1H10A 1BAKA 3KRXA 4E74A 1Q1OA 3A8QA 2J59M 2KD0A 2CY5A 3AU5A 3U7DA 1WG7A 5C79A 3VUYA 1MIZB 2DHZA 3L0WB 1OTRB 2O2VA 4DHZB 3BJIA 3GZNI 1E90A 4F7GA 2N1WA 2HE7A 2YS5A 2IO1B 4KHBB 3VAWA 3SO6A 1LM8B 3KZ1A 4PYUA 1ST7A 2PJHA 2GMIC 3ZRFA 3OJ4B 2L1CA 1X1FA 1IP9A 2KX3A 3B0AA 4MGIE 1WGDA 5D3YA 3TW1A 5GMVA 4IUMB 3R66C 3MDBC 4DK5A 4HAUB 2KX0A 5G55A 2DZJA 2JY6A 3ZTCA 4NQLB 5FI0A 1LFDA 1GUAB 3UF8A 1Y8RC 3HHMA 1WXMA 4EOYA 2K8BA 2W2XD 3VTUA 2K00A 4W9JA 1WMHB 4F7UP 2D9XA 3D8EA 4JGHB 1WZ0A 2MBBB 2L0FA 4PS8A 3SU8X 4DHJB 3JVZX 2BPSA 4MGKE 4NAWB 1T0YA 4IWPA 1J0WA 3KYCD 1NTYA 2MWSB 3A9KA 1E5WA 4K17A 3ZIMA 2KJRA 2G35A 2J0KA 1NI2A 4KHOA 2CHWA 2BYFA 3HM6X 3PEGA 2Z0DB 1WMHA 1H8CA 1P1AA 3AI5A 4LDTB 2BWES 4Z2NA 1KI1B 2ZCCA 2DTCA 4JKDA 3Q3FA 1RJ2A 4KAXB 3PPAA 5J3QA 2NBVB 5FI1A 3F0WA 5DPTA 2IBIB 4MGZE 3ENEA 1UNPA 5DCNA 2KGXB 2KMAA 4X57B 2GBJA 1YQBA 3UQAA 1MG8A 1LW3A 2DYMA 5EFXA 2RGFA 2JXXA 2FCMA 4HWIB 2ASQA 5LOPB 4GPTB 3SD5A 1B55A 3L08A 2DKQA 4MGYE 1FXTB 4MSQB 3AXCA 3EPYA 4EJNA 2IO0B 4HCPB 1V80A 5CHWA 2COAA 3E9OA 3ZNZB 1IRSA 2YT1A 3V6EB 3NS8A 3DXDA 2VSZA 4NJ6A 1FAOA 3UZTA 2LXCA 4MELA 2D9WA 1NTVA 2LJ5A 5JVLA 2L8JA 2LGDA 4HVBA 2PE9A 2W2WA 4JQWC 4K7UA 4LJOB 4A6FA 2UVMA 1BTKA 4KHAA 2YLMA 5LLIA 4KIKB 4GMVA 2B3AA 2DZIA 4NNJB 1PMSA 2GBKA 2P0DA 2ZPNA 4LCDE 4ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ7 A;  1U27 A;  3CIK A;  4B9K A;  2D10 A;  2I5C A;  2COP A;  2ZJD A;  3JYU A;  4URK A;  2LVO A;  3VQI A;  2GBR A;  2HRJ A;  4YL8 A;  2HTH B;  1V49 A;  2ZVN A;  3H7S A;  1AWE A;  3QX1 A;  4HB2 B;  1PFJ A;  3A98 B;  2RR9 A;  1TZ1 A;  4MEM A;  4PS7 A;  4E71 A;  4M0W B;  3DCG A;  4FHJ A;  2Z0P A;  4DBG A;  1WX9 A;  4M8M A;  2RVB B;  1M7E A;  5E6O A;  4B95 A;  2K8C A;  2WX1 A;  4ZDV A;  2BWF A;  4ANU A;  2WWZ A;  2G3Q B;  2FDQ A;  1OGW A;  4K1R B;  3UIO B;  2E2X A;  2CS4 A;  4A3P A;  2LVQ A;  3H6N A;  4EKU A;  2D2Q A;  1E8X A;  4GOC A;  2ABD A;  2RQ1 A;  2VKI A;  2MWN B;  3SNH A;  5CHF A;  4DDG D;  2V76 A;  2COF A;  4JLC A;  1VD2 A;  5CTR C;  3PSC A;  3N30 A;  5C1Z A;  5D3X A;  4DBB A;  3CST A;  1V9J A;  1WIA A;  1U29 A;  3PZD A;  5CX3 A;  2IYB A;  1IPG A;  1EVH A;  1SGH A;  4HAY B;  2KQS A;  2M1M A;  2MBE A;  2PZ1 A;  1R4M I;  3A9J A;  2RLO A;  3M62 B;  2MRP A;  2C7N B;  4PYZ A;  1J0G A;  2GBM A;  3MPX A;  3DBL I;  3IFW B;  4W9L A;  1RRP B;  3VHT C;  4AJY B;  3D8D A;  4K7S A;  3VTW A;  4HDQ A;  1XQQ A;  2RNR B;  2QKM A;  3WAM A;  3ZNH B;  4EUT A;  4MJS B;  2L7R A;  1OMW A;  3O96 A;  4K81 A;  2ZNV B;  2D4Q A;  5J3Y A;  3VOQ A;  3KUZ A;  3VFK A;  2ZZP B;  3ZKJ C;  2O2V B;  4HDO A;  1E8Y A;  3PRE A;  3T8M A;  3L17 A;  2KDB A;  2Y7B A;  3PS6 A;  4G50 A;  5LXH A;  2YVC A;  4GMX B;  5DPT A;  2NVU I;  1SHC A;  2Z0E B;  4NJ7 A;  4NY0 A;  2FJ9 A;  4HHV A;  2N1V A;  1WGU A;  3PV1 A;  2EMS A;  2DFK A;  4HPL B;  3WAN A;  2KDI A;  3GOE A;  3G9W A;  2XK5 B;  1OQN A;  1Q0W B;  3DOW A;  2MDX A;  3D8F A;  3R7R A;  2C5L C;  2FID A;  2GOW A;  3UQB A;  5KHQ A;  2D3G A;  3NHE B;  4IFS A;  4GU2 A;  2R0D A;  2OJR A;  2IFS A;  2WDT B;  4HAZ B;  1AQC A;  1XD3 B;  4BVU C;  1DDV A;  1GG3 A;  1ZC4 B;  2I1J A;  2LUL A;  2JPH A;  3A1Q B;  5C23 A;  3V5W A;  4DXA B;  1KM7 A;  4NPN A;  1ZC3 B;  5DPR A;  4CYE A;  1WJ1 A;  5HE3 A;  4Z2M B;  4E3C A;  2KO3 A;  2Z0O A;  3EFU A;  4EZJ A;  3U8Z A;  2K25 A;  2LRW A;  4W9H A;  1XKE A;  1J19 A;  5D3V A;  4XC2 A;  1K5G B;  3P6A A;  4II3 B;  5JH5 C;  4GDK B;  2K2U A;  2DZM A;  3PLV A;  2KFK A;  3ZDT A;  4W9F A;  3V6C B;  3WA0 A;  2DHJ A;  1BT0 A;  3DBH I;  2KFJ A;  3QIJ A;  4IM0 A;  2RSG A;  4BOZ B;  2AEH A;  5DHF B;  2O6V D;  3APC A;  1NVL A;  2MBQ A;  2CHZ A;  2YSZ A;  2DAF A;  1R4N I;  1WR6 E;  3I3T B;  4IWQ A;  2D11 A;  4HCN B;  1V88 A;  4BKG A;  3ULC A;  2KLG A;  2KWU B;  3QCA A;  4AOF A;  1Y19 B;  1WGH A;  2XBB C;  4IG7 B;  4XX5 A;  3PRP B;  1FHO A;  3L16 A;  5DHA B;  3TJP A;  2L0T A;  2NBW B;  1EAZ A;  3DVN V;  4I6P A;  2MA9 B;  2LOZ A;  4OVV A;  1Z2M A;  3VH3 B;  2AWT A;  4FJZ A;  2GS0 A;  3M3J A;  4WWP A;  3DBS A;  2LAS A;  3QBV B;  3L54 A;  3T9L A;  2DYO A;  2N7E A;  3BY4 B;  1MPH A;  4K2O A;  1P0R A;  3Q3J A;  3PVL A;  2AL3 A;  5IJM A;  2FJL A;  4WQO B;  3LJU X;  3WIM A;  3RCP A;  3TFM A;  1WM2 A;  3QHT A;  3PGE A;  2DYQ A;  2ROZ B;  2KHW B;  4GDL A;  4WWN A;  5CLL B;  4HAX B;  1S3S G;  3K9P B;  2KJH B;  1V6E A;  1GC7 A;  1WJ6 A;  4WJO A;  4DWF A;  2C7M B;  5KHO A;  4II2 B;  3L10 B;  2YT0 A;  1ZVR A;  4B6H A;  4HB4 B;  1WY8 A;  1WXA A;  2J0M A;  3H7P B;  4EFO A;  1WF9 A;  2D9Z A;  1P98 A;  3AUL A;  3PLU A;  1V89 A;  1E7V A;  3B1L X;  3APD A;  2ZVO A;  3QWZ B;  4L6E A;  2L3Z A;  3P7Z A;  3SHQ A;  2LG1 A;  4HAW B;  2EJ8 A;  1X05 A;  2GBN A;  2JF5 A;  2MX2 A;  2NPT B;  4IW0 A;  4W9E A;  1UNQ A;  1HE8 A;  3KSY A;  1AAR A;  2JUO A;  2KTR B;  2V3S A;  1DBH A;  1QQG A;  1ZM0 A;  2MBH A;  1UEL A;  1ZGU B;  2IZV B;  2JZ3 B;  1TGZ B;  2L2I A;  4FHK A;  4FUL A;  4KZC A;  1WVH A;  4WJ7 A;  4ZYN A;  2PPH A;  3ZNI D;  4NAW A;  5KQ1 A;  1V5M A;  3OJ3 A;  1WZ3 A;  3PHX B;  2FAZ A;  1X1M A;  1MIX A;  3DQV A;  5E6P A;  2RGN B;  2FCQ A;  3ZLZ A;  4AUQ C;  4A6H A;  3FLV A;  2ZPY A;  1E8Z A;  4EEW A;  2EC1 A;  4GXB A;  4FBJ B;  5KCV A;  1WI1 A;  1XD4 A;  4ZRK A;  2N9P C;  3KRW A;  2KFK B;  5D3W A;  3KH0 A;  3P2B A;  2DYN A;  3HK0 A;  3ZVR A;  4D0N B;  2ZCB A;  3QJZ A;  4GDK A;  4JIO U;  2YS1 A;  4MT7 A;  3SV1 A;  2GCL A;  2Z59 B;  1SE9 A;  4DHJ D;  5C6R A;  1I7A A;  4IC7 B;  3PVW A;  4GN1 A;  3ZNG C;  1WRD B;  2KMC A;  1U2B A;  3PHW B;  2ROV A;  3NZU A;  3RZF A;  1M94 A;  2IO2 B;  4GB9 A;  4PQ0 A;  4HJK A;  5D2M B;  3RT3 B;  1L7Y A;  2MP2 A;  3N32 A;  1UPQ A;  2X18 A;  2FCN A;  1UEF A;  2KZR A;  3EHV A;  4PS3 A;  1IYF A;  2MFQ A;  4LCD E;  4XZ4 A;  1VCB A;  4EOY A;  2N9E B;  2KNB A;  3TVV A;  3UIN B;  3QC8 B;  2G4S A;  4GZU A;  3QAR A;  1KZ7 A;  1K5D B;  1ACA A;  1X11 A;  2NR2 A;  3UIP B;  4MK0 A;  1Z5S B;  1I2H A;  4FN2 A;  4W9I A;  1BWN A;  2LXA A;  4K7W A;  4ZRJ A;  1BTN A;  2DX1 A;  2KK8 A;  2NCN A;  3JSV A;  2CU1 A;  3ODX A;  3SUZ A;  3IVF A;  3VXW A;  3QAQ A;  4TYZ A;  1YD8 U;  4IOY X;  1G6J A;  2DZK A;  3JW0 X;  2CKH B;  2M0X A;  5DI9 B;  2XEW A;  1H10 A;  1BAK A;  3KRX A;  1GNU A;  4E74 A;  1F9J A;  1DYN A;  5JHG A;  3A8Q A;  1EGX A;  1Q1O A;  4ICU A;  4LDT D;  2RPQ A;  2Y8G A;  2J59 M;  4HAV B;  1EF5 A;  1V2Y A;  2IYD B;  2KD0 A;  3D32 A;  3EC8 A;  3DPD A;  4IM3 A;  4ANW A;  4BKS A;  2H7E A;  2CY5 A;  3APF A;  3AU5 A;  4HAT B;  3U7D A;  1WG7 A;  1FGY A;  4A5K A;  5C79 A;  3RCZ A;  1GC6 A;  1WJM A;  2NBU A;  4G0N B;  3VUY A;  1MIZ B;  2DHZ A;  3L0W B;  1WR1 A;  2JVC A;  4EZL A;  3ODW A;  1WXV A;  5D7G A;  3WAL A;  1OTR B;  4BBK A;  5L95 C;  2KCJ A;  2O2V A;  4WJN A;  4DHZ B;  2KVR A;  2K2J A;  4MY6 A;  1K8R B;  2KN5 A;  1A5R A;  3BJI A;  1UPR A;  1KJT A;  3MHS D;  4TUU A;  5LON B;  5C5B B;  3ONS A;  4ZRI A;  1HB8 A;  1UNR A;  4KVG B;  2BYV E;  3GZN I;  4I6N B;  1E90 A;  5D94 A;  4DDI D;  4TQ1 A;  4B6W A;  3ZUN A;  4F7G A;  3FP5 A;  4WJP A;  2XK5 A;  2LKO A;  3DXC A;  2N1W A;  4GSW A;  4MM3 A;  1I35 A;  2HE7 A;  1W1D A;  2YS5 A;  2N7D A;  1RRB A;  4HLE A;  2R09 A;  2LI5 A;  2IO1 B;  4CO7 A;  3H7P A;  4KHB B;  4GGQ A;  3VAW A;  3RYT A;  5JZE B;  2CY4 A;  3SO6 A;  3LDZ E;  4KSK C;  2MW5 A;  2MLB A;  3BIN A;  2YRY A;  1Q67 A;  1LM8 B;  3VUW A;  3A33 B;  4M8N A;  1QC6 A;  2DLW A;  5C16 A;  3ODO A;  2K8H A;  3KZ1 A;  4PYU A;  1ST7 A;  5J2R A;  2LVP A;  4FLH A;  3N7C A;  1DRO A;  2GMI C;  2PJH A;  2UZS A;  1XT9 B;  2DYB A;  2OTX A;  3PTF C;  3OJ4 B;  3ZRF A;  4BKS D;  2L1C A;  1X1F A;  1XOD A;  2AYO B;  1IP9 A;  2KX3 A;  1UH6 A;  3B0A A;  5EDS A;  2HD5 B;  3R3M A;  4MGI E;  1LB1 A;  2FNJ B;  1WGD A;  2IO3 B;  2MBO A;  1P6S A;  1PQS A;  5DH9 B;  2C7H A;  5D3Y A;  4NSW A;  2CQU A;  4HB3 B;  2L76 A;  2OOB B;  4NQK E;  1P3Q U;  3PRM B;  2N4F A;  3DVG X;  1WXS A;  4GIV A;  3TW1 A;  5GMV A;  2M38 A;  4IUM B;  3R66 C;  1OY2 A;  2MKR A;  5J17 A;  3MDB C;  1UZX B;  4IWO A;  2P0F A;  1WI0 A;  1HBK A;  3ZTD A;  4KIK A;  4HAU B;  2CB8 A;  1WE7 A;  2KX0 A;  1V5P A;  2KUP A;  2DZJ A;  2V4L A;  3QQ8 B;  5G55 A;  4BBN F;  1Z87 A;  2W2X C;  2JY6 A;  3MJW A;  3ZTC A;  4NQL B;  1OQY A;  4HB0 B;  4BBN C;  1WM3 A;  2ZEQ A;  5FI0 A;  1LFD A;  2NPT A;  4AP4 C;  2LWP A;  1V86 A;  3CSF A;  1V5U A;  2DHI A;  2DKP A;  2Q13 A;  2Z0Q A;  4WVF B;  1GUA B;  1Y8R C;  4MJS A;  3UF8 A;  1TBE A;  2JRH A;  1MAI A;  1N3H A;  1WXM A;  2N9X A;  3A1Q A;  2K8B A;  2W2X D;  3HHM A;  1WGY A;  2JWZ A;  3A4R A;  4RM8 A;  3TIX A;  1C3T A;  4BKT A;  2M14 A;  3VTU A;  2K00 A;  4W9J A;  2C9W B;  5JHH A;  3IHP C;  3PG7 A;  5DIF B;  2GCJ A;  1WMH B;  3FSS A;  4KDI C;  3L13 A;  1W1G A;  2YF0 A;  4F7U P;  2A5U A;  2RUK B;  3A8P A;  2PEA A;  1X1G A;  4F7H A;  2K6Q A;  1ZSQ A;  4K2P A;  3KUC B;  4DK5 A;  1D3Z A;  2MP2 B;  2BCJ A;  5CHV C;  2CR5 A;  1WGQ A;  3M95 A;  2BYE A;  1PLS A;  5IAA C;  1XCG A;  2D9X A;  1P5T A;  2C60 A;  1CMX B;  1FHW A;  3TCA A;  5G2N A;  3ML9 A;  3HIZ A;  2EKE C;  3H1U A;  4G11 A;  5J3T A;  2KTF A;  1Y5O A;  1V61 A;  2LGX A;  3KYD D;  3D8E A;  4JGH B;  1EF1 A;  3ML4 A;  3PP2 A;  1RFA A;  1WZ0 A;  5BO4 B;  3HW2 B;  2MSE D;  4JL9 A;  1QZE A;  3KW5 B;  4AWJ A;  5D6J B;  1YIW A;  2J0J A;  1U5E A;  2LGY A;  2MBB B;  2L0F A;  4KV2 A;  3K9O B;  4W9K A;  4PS8 A;  1E7U A;  2P8V A;  3SU8 X;  4DHJ B;  2O6V B;  4WWO A;  3JVZ X;  2BPS A;  4YON A;  1MKE A;  3V61 A;  2DX5 A;  4MGK E;  1V5O A;  1T0Y A;  4NAW B;  3VDZ A;  5AZG A;  5L83 A;  4IWP A;  2JRI B;  1J0W A;  3KYC D;  5DPS A;  1NTY A;  4FAD A;  1TTN A;  2DAJ A;  2MWS B;  3A9K A;  1E5W A;  2HTH A;  5JP4 A;  4EZK A;  4K17 A;  4CHM A;  3ZIM A;  4TV3 A;  4CHK A;  3C0R B;  2KJR A;  2G35 A;  2W9N A;  5GOW B;  2J0K A;  2KDF B;  1NDD A;  1NI2 A;  1RAX A;  4IM2 A;  1UBQ A;  4KHO A;  2LOX A;  2D9Y A;  3W1Y A;  1KOT A;  3NY5 A;  5TR5 A;  3V62 A;  2CHW A;  4F8C B;  3PRZ A;  1ZW7 A;  3CMM B;  3SYX A;  1WX8 A;  2HJ8 A;  2LYD A;  2G4D B;  2BYF A;  3B08 A;  3HM6 X;  4OVU A;  2DX5 B;  1LQB A;  3PEG A;  2Z0D B;  1WMH A;  5HE2 A;  2WX0 A;  5AZH A;  5KQ4 A;  1P1A A;  1U4A A;  1H8C A;  2O6V A;  3AI5 A;  2J7Q B;  2XQN M;  2BGF A;  3PSE B;  4LDT B;  3TL5 A;  3ZRC A;  1S1Q B;  3A9K B;  1TJ6 A;  2QKL A;  2BWE S;  4Z2N A;  3EEC A;  2ZNV C;  2ELA A;  1KI1 B;  5JHA A;  1U5G A;  1WFY A;  4ICV A;  3CXB B;  1EUV B;  2KXJ A;  2CHX A;  3MTN B;  5HKH A;  3QK0 A;  1KLV A;  2DN6 A;  1ISN A;  3DVN U;  2ZCC A;  4TQ0 A;  2DTC A;  5L81 A;  2NMB A;  3Q3F A;  1RJ2 A;  4KAX B;  2UZR A;  4DHZ E;  3RD2 A;  5E6N A;  2D07 B;  3PPA A;  1U5D A;  3HQC A;  4CHJ A;  5AZF A;  1FOE A;  5J3Q A;  1FHX A;  3JSV B;  2RSU A;  3X23 A;  4Y94 A;  2M8S A;  1MK7 B;  1GJZ A;  2NBV B;  5FI1 A;  1XX0 A;  1Q5W B;  1C1Y B;  3ECI A;  3W1S C;  3F0W A;  2KWV B;  2ELB A;  2L00 B;  2REX A;  3QA8 A;  4FJY A;  3DXE A;  4RMA A;  5AEK B;  1FGZ A;  4TKN A;  5IA7 A;  2EMT A;  3T06 A;  2IBI B;  1M7R A;  2JZZ A;  5HE1 A;  1OEY J;  2K39 A;  2KDE B;  2KLC A;  1WJ4 A;  4KDL B;  3ENE A;  3M1I B;  1UNP A;  2BKF A;  2NZ8 B;  4W9G A;  5DCN A;  3AU4 A;  2JT4 B;  1DDW A;  2KGX B;  2QHO A;  1WJN A;  2KKC A;  1LXD A;  3ML8 A;  4WAA A;  4PNK A;  3RUI B;  1TQZ A;  2KMA A;  3ULB A;  3VVW B;  3LJ3 A;  3GYO A;  3TMP B;  4FA6 A;  5CLQ B;  4F1S A;  4X57 B;  4BOS C;  2KC1 A;  1WH3 A;  2Y8F A;  1HB6 A;  1YQB A;  2BF8 B;  2GBJ A;  2RD0 A;  4BFR A;  3UQA A;  1MG8 A;  1LW3 A;  2LUE A;  2UWQ A;  4A6F B;  2DYM A;  5EFX A;  3PVU A;  1WGR A;  4A20 A;  3ZVV A;  2RGF A;  2JXX A;  2FCM A;  4HXD A;  4DX8 A;  4XWX A;  2KC2 A;  3RZW C;  2IY1 B;  4LJP B;  1YJ1 A;  1EO6 A;  4HWI B;  2KAN A;  3KY9 A;  2ASQ A;  1NU2 A;  1RLF A;  4KZ0 A;  3U30 A;  4C0A A;  3FEH A;  1I42 A;  3OLM D;  5LOP B;  4GPT B;  4G3X B;  1WGG A;  3W1S A;  2UYZ B;  1P9D U;  3SD5 A;  4A6K A;  3QWM A;  1B55 A;  1MK9 B;  3OAN A;  2DKQ A;  2FCS A;  3L08 A;  2M4N A;  3GYP A;  3KVF B;  3NZS A;  2KWC A;  3H9D A;  3X0W A;  1H4R A;  1XR0 B;  3CF6 E;  2CAY A;  1FXT B;  4MSQ B;  3AXC A;  4MGY E;  3S2A A;  3EPY A;  4EJN A;  1WYW B;  2IO0 B;  2L05 A;  2FUH B;  3KUD B;  4WSF A;  4HCP B;  4IAP A;  3VIA A;  5JLJ B;  3V60 A;  3ALB A;  4AJW A;  1UD7 A;  1W1H A;  2DEN B;  1V80 A;  1WX7 A;  2Y5B B;  1FB8 A;  2COC A;  4ANV A;  5CHW A;  3UGB B;  1ZKH A;  3ZO5 B;  2COA A;  1NTI A;  2K1F A;  3HM3 A;  2PE6 B;  3IG3 A;  1TXD A;  2KJ6 A;  5DPW A;  2MCN B;  1DDM A;  2IY0 B;  3N3K B;  4HK2 A;  3ZNZ B;  1IRS A;  5JHB A;  2N0Y A;  5C5B A;  5J18 A;  1KZG A;  2YT1 A;  3V6E B;  1UGM A;  3PT2 B;  3RUL A;  2N23 A;  2D9V A;  2KTR A;  2GJY A;  3NS8 A;  4F7Z A;  2ADZ A;  4MH0 E;  3NSU A;  3DXD A;  2LZ6 A;  3VUX A;  3WAP A;  1P3R A;  2DA0 A;  4DX9 0;  2FIF A;  2K6D B;  4I6L B;  2AL6 A;  3DDC B;  1OEY A;  2VSZ A;  4J6I A;  4NJ6 A;  1FAO A;  1YX5 B;  4FJV B;  3IBE A;  3SDL C;  3UZT A;  3R7Q A;  2I5F A;  2WH5 A;  2LXC A;  2NS5 A;  3VTV A;  4EMO A;  4MEL A;  4ASW C;  1U5F A;  1JRU A;  2BKR B;  2D9W A;  3A9J B;  1NTV A;  2CRF A;  3M63 B;  1L2N A;  1X86 A;  2LRU A;  3AJ4 A;  2YS3 A;  1WJU A;  2KOX A;  3VH4 B;  2LJ5 A;  3OAW A;  3ZDM C;  2DHK A;  2L8J A;  3WYF B;  2WYQ A;  3F5R A;  1WE6 A;  3FM8 C;  2LGD A;  2P0H A;  4W9C A;  2PE9 A;  2R2Q A;  5FR6 A;  4A3O A;  4HVB A;  3TO1 A;  1V81 A;  2W2W A;  4W9D A;  4N9F 4;  3TBL D;  4WJQ A;  3DBR I;  2VRW B;  5D27 A;  1V5T A;  3A4S C;  4A6F A;  4JQW C;  4K7U A;  5HE0 A;  4LJO B;  2UVM A;  1BTK A;  3O65 B;  2JP2 A;  1UBI A;  4KSL C;  3WAO A;  2H7D A;  1NBF C;  2VRR B;  2MQJ A;  4MDK E;  2A4Z A;  2V1Y A;  4KHA A;  2YLM A;  4MSM B;  2OQB A;  5LLI A;  3ZW3 A;  4P7I A;  3NOB A;  2G45 B;  2LBB A;  4KIK B;  4H8S A;  2R2O A;  1J8C A;  2I1K A;  4HPM B;  3DVG Y;  4RM9 A;  1SIF A;  4GMV A;  2B3A A;  5LXI B;  1YX6 B;  2DZI A;  4GDL B;  4NNJ B;  2COD A;  1PMS A;  2GBK A;  2P0D A;  2ZPN A;  1E8W A;  2LD9 A;  4MGZ E;  2M17 A;  4ANX A; 
#chains in the Genus database with same CATH topology
 2KQ7 A;  4B9K A;  2D10 A;  1V8C A;  2D3B A;  3AE5 B;  1RWS A;  3QX1 A;  2VZK B;  3A98 B;  2RR9 A;  1TZ1 A;  4FHJ A;  4ANU A;  2WWZ A;  2FDQ A;  2CS4 A;  3BK2 A;  2INC C;  2VKI A;  5CHF A;  1VD2 A;  5CTR C;  5C1Z A;  3PZD A;  1SGH A;  1R4M I;  1XEE A;  2GBM A;  3DHI C;  3DBL I;  3SFD B;  2B76 B;  4ARC A;  3B9J A;  4PT5 A;  4AJY B;  3D8D A;  3AMZ A;  2DNF A;  2RNR B;  2CJO A;  3ZNH B;  1FO4 A;  4MJS B;  1F0Z A;  2ZNV B;  3VOQ A;  3NWD A;  1NI3 A;  3NVV A;  4HDO A;  1E8Y A;  2Y7B A;  1GOZ A;  2Z0E B;  2FJ9 A;  4NY0 A;  2N1V A;  3Q2A C;  3WAN A;  3GOE A;  1OQN A;  3Q8E A;  2MDX A;  1HTQ A;  2BVC A;  4M01 A;  3NHE B;  2FBW B;  4GU2 A;  3AED B;  1AQC A;  1XD3 B;  1DDV A;  3A1Q B;  1ZC4 B;  1PUT A;  4NPN A;  1KM7 A;  2BYT A;  2WXM A;  1ZC3 B;  5HE3 A;  4Z2M B;  4E3C A;  2KO3 A;  3U8Z A;  2K25 A;  1J19 A;  3P6A A;  4GDK B;  2K2U A;  4LNO A;  2WU5 B;  3ZDT A;  4W9F A;  3V6C B;  3WA0 A;  1BT0 A;  4JKG B;  2AEH A;  5DHF B;  1QOB A;  2YSZ A;  1R4N I;  4N6E B;  4IWQ A;  1QLB B;  4BKG A;  3ULC A;  2KWU B;  1Y19 B;  4XX5 A;  1PGX A;  2QJL A;  2KT7 A;  3NRZ A;  3L16 A;  4A9A A;  4XWW A;  4D2K A;  2GS0 A;  2LAS A;  4LLG M;  3BY4 B;  2PKO A;  1J7B A;  1FNW A;  2BTE A;  2AL3 A;  2IPK D;  1C79 A;  2KHW B;  1JRO A;  2KJH B;  4DWF A;  3R2T A;  3LYY A;  2X38 A;  1WXA A;  1WF9 A;  5C3J B;  3U4E G;  1V89 A;  1K51 A;  2ZVO A;  3NUH B;  3QWZ B;  2L3Z A;  3P7Z A;  1UWX A;  2MX2 A;  2SAK A;  1D5M C;  3KSY A;  2KTR B;  2V3S A;  2IZV B;  2JZ3 B;  2L2I A;  4FUL A;  4LK0 M;  4WJ7 A;  4BAX A;  5KQ1 A;  3OJ3 A;  3PHX B;  3DQV A;  1X1M A;  1FD6 A;  4AUQ C;  1OQQ A;  2ZPY A;  5KCV A;  2KR0 A;  4ZRK A;  3KH0 A;  2K5P A;  2VZK D;  4MT7 A;  1D4B A;  3PVW A;  3MC8 A;  1UWM A;  2V4I B;  4GB9 A;  5D2M B;  1L7Y A;  3HIE A;  3EHV A;  4XZ4 A;  1JWA D;  3UIN B;  3TVV A;  5EE3 A;  3QC8 B;  3QAR A;  1KZ7 A;  2NR2 A;  1F77 A;  1T3Q A;  4C4V B;  2QIL A;  4ZRJ A;  3JSV A;  2NCN A;  4HEA 1;  4TYZ A;  3JW0 X;  2M0X A;  3OHM B;  1C78 A;  1F9J A;  2RPQ A;  4HAV B;  1EF5 A;  1V2Y A;  2BS2 B;  2IYD B;  4IM3 A;  1AN8 A;  4ZRQ A;  2H7E A;  3NW8 A;  2EKI A;  3APF A;  1FGY A;  4A5K A;  1WJM A;  4EZL A;  2JVC A;  2NTS A;  1WXV A;  1QT9 A;  2XN9 C;  2KCJ A;  4JKF A;  1XLO A;  2BBC A;  4WJN A;  1K8R B;  4C7Y A;  5C5B B;  1HB8 A;  1R4N B;  2GI9 A;  3FP5 A;  1W1D A;  4N58 A;  2R09 A;  3AV8 A;  5JZE B;  2K22 A;  3RYT A;  3NWF A;  2CY4 A;  3LDZ E;  2MW5 A;  4US9 A;  4OHJ A;  2AQ3 B;  1Q67 A;  2M56 B;  2V3N A;  2JXT A;  3A33 B;  1QC6 A;  5C16 A;  1IBX B;  1DRO A;  3IT4 B;  4WH4 A;  1EU4 A;  4JPS A;  1XOD A;  2AYO B;  3O13 A;  1UH6 A;  1JCK B;  1I4H A;  2MBO A;  1P6S A;  1PQS A;  3Q8C A;  1P7F A;  1YJI A;  2JX5 A;  2L76 A;  1P3Q U;  3CIR B;  3Q8F A;  1I4Q A;  3ABV B;  4OZB A;  2INP E;  4L2Y A;  4IDI A;  4IWO A;  3ZJV A;  2P0F A;  2CB8 A;  2V4L A;  2KUP A;  2Q5W D;  1OQY A;  4HB0 B;  2NPT A;  4AP4 C;  1V5U A;  2DHI A;  4WVF B;  1TBE A;  2JRH A;  1MAI A;  1N3H A;  2N9X A;  4K3C A;  4RFB A;  4RM8 A;  3TIX A;  1WGY A;  2JWZ A;  4BKT A;  4NZL B;  2C9W B;  5JHH A;  3IHP C;  3PG7 A;  2GCJ A;  2KQ4 X;  4KDI C;  2RUK B;  2PEA A;  1D3Z A;  1X1G A;  2JWU A;  2MP2 B;  2X0S A;  1PLS A;  5IAA C;  1XCG A;  2I38 A;  2C60 A;  1I4X A;  1FHW A;  3NVZ A;  1TS4 A;  5G2N A;  2WU2 B;  3HIZ A;  3ML9 A;  5G5H A;  5J3T A;  4KGS A;  1EF1 A;  3IT6 B;  5FR3 A;  1BXT A;  4JL9 A;  1QZE A;  1YIW A;  2BS3 B;  2LGY A;  4KV2 A;  2MJD A;  2O6V B;  4YON A;  1MKE A;  2BB5 A;  3V61 A;  1CK1 A;  2DX5 A;  4S0R A;  2ACZ B;  5L83 A;  2JRI B;  4FAD A;  1GB1 A;  1TTN A;  2DAJ A;  2KMM A;  4QAY A;  2SEB D;  2HTH A;  4RGN A;  2IJ0 A;  4OZC A;  2KDF B;  3GP7 A;  1UBQ A;  2D9Y A;  1ET6 A;  3V62 A;  3PRZ A;  3CMM B;  2LMC A;  2LYD A;  1LQB A;  5AZH A;  5HE2 A;  1N5X A;  1OQR A;  2O6V A;  3PSE B;  1TS5 A;  1S1Q B;  1BUI C;  2YEP B;  2QKL A;  4MT5 A;  2KVZ A;  1UGJ A;  1U5G A;  1EUV B;  2X8X X;  2KXJ A;  1HZ5 A;  3QK0 A;  2DN6 A;  2NMB A;  2UZR A;  3E9S A;  3RD2 A;  5E6N A;  4BZA A;  1IGD A;  4OT1 A;  1V97 A;  3ENB A;  2M8S A;  2IGH A;  1Q5W B;  1C1Y B;  1Q10 A;  4R3D A;  2KWV B;  1XF5 L;  2REX A;  1NVI D;  5AEK B;  5IA7 A;  2K39 A;  1WJ4 A;  1YQ4 B;  3M1I B;  2BKF A;  1ZUD 2;  2QHO A;  3ML8 A;  1T77 A;  3RUI B;  1ZPS A;  3GYO A;  3LJ3 A;  4BOS C;  2KC1 A;  1WH3 A;  2Y8F A;  2RD0 A;  2BF8 B;  4Q2J A;  3W5V B;  4BFR A;  4ILJ A;  1TKE A;  3NVY A;  3ZVV A;  3PVU A;  4A20 A;  4C4V A;  2K9X A;  3ZGZ A;  4XWX A;  1UF0 A;  4LJP B;  1YJ1 A;  4KZ0 A;  3FEH A;  1I42 A;  4ILG B;  4G3X B;  4JKE A;  1P9D U;  2J53 A;  3QWM A;  1EU3 A;  3OAN A;  2LJI A;  2M4N A;  3GYP A;  3NZS A;  3ZQ4 A;  3KWL A;  1H4R A;  3X0W A;  4C00 A;  2H89 B;  2L05 A;  2FUH B;  4IAP A;  3V60 A;  5EE0 A;  1UD7 A;  1W1H A;  1WX7 A;  1FB8 A;  2COC A;  2JZP A;  3UGB B;  3ZO5 B;  3IG3 A;  1MHX A;  5JHB A;  2N0Y A;  5C5B A;  3PZ7 A;  1KZG A;  3DBH B;  2D9V A;  2GJY A;  4MH0 E;  3WAP A;  4LNN A;  4DX9 0;  2K6D B;  1OEY A;  1YX5 B;  3R7Q A;  2I5F A;  3VTV A;  2MJE A;  5I4D A;  3A9J B;  4C56 C;  3M63 B;  2LRU A;  3AJ4 A;  1WJU A;  3VH4 B;  3P4R B;  3ZJT A;  3ZDM C;  5LG4 B;  3F5R A;  4A3O A;  2P0H A;  4HPP A;  3MP9 A;  3TO1 A;  4N9F 4;  1NEK B;  4WJQ A;  3DBR I;  4RF0 A;  1V5T A;  2D3C A;  2IND C;  4KSL C;  4OSN A;  1B1Z A;  3WAO A;  2H7D A;  2VRR B;  3VRB B;  4MDK E;  2A4Z A;  2V1Y A;  3HSA A;  4MSM B;  5BYR A;  4H8S A;  3DVG Y;  4RM9 A;  1SIF A;  2ONQ A;  2M17 A;  3B1L X;  3N3K B;  2I5C A;  2LVO A;  1V49 A;  2HTH B;  4E71 A;  4PS7 A;  4M0W B;  3DCG A;  2Z0P A;  1WX9 A;  5E6O A;  2K8C A;  4K1R B;  1L0V B;  4A3P A;  4EKU A;  2D2Q A;  1E8X A;  2K49 A;  1ZP0 B;  4JLC A;  4DBB A;  1V9J A;  2MHJ A;  5CX3 A;  1GPX A;  4OVZ A;  4GNK B;  2WXG A;  3A9J A;  2C7N B;  1J0G A;  3MPX A;  3VHT C;  3HVZ A;  1VZ8 A;  4HDQ A;  1XQQ A;  1KLG D;  4LTU A;  1SE4 A;  2ICI A;  4EUT A;  2L7R A;  1OMW A;  4K81 A;  3DBL B;  2D4Q A;  1YNT E;  2G1E A;  3L4P A;  3PRE A;  4ACF A;  3PS6 A;  5LXH A;  4L23 A;  4RCO A;  2WXP A;  3N1X C;  4GMX B;  4NJ7 A;  1R7S A;  2EMS A;  2DFK A;  3H8H A;  2R61 A;  3P4S B;  3P4Q B;  3BZD B;  3TEY A;  1QOA A;  2C5L C;  2UU7 A;  1LO5 D;  2WHI A;  5FK9 C;  5KHQ A;  2D3G A;  2EEL A;  2WDT B;  3Q8A A;  1N6Z A;  3OWE B;  1HA5 A;  4N59 A;  4DXA B;  5DPR A;  4EZJ A;  1DOY A;  1XKE A;  3NG0 A;  5JH5 C;  3PLV A;  2LHE A;  2DHJ A;  3CWI A;  3DBH I;  2KFJ A;  5IKC M;  2MBQ A;  2DAF A;  1WR6 E;  3I3T B;  4HCN B;  1V88 A;  4C7Z A;  1C4P A;  1WGH A;  3DCX A;  2XBB C;  3ETR A;  4IG7 B;  5AUK A;  4OW0 A;  1T5X D;  2ZW1 A;  5DHA B;  3N20 C;  3TJP A;  2NBW B;  4OVV A;  3VH3 B;  2LOZ A;  2WXI A;  3W9C B;  3QBV B;  2DYO A;  1MPH A;  4K2O A;  5IJM A;  2FJL A;  1QKZ A;  2W82 A;  2ROZ B;  4WWN A;  3R8B A;  4JWU C;  4HAX B;  2YT0 A;  1ZVR A;  4B6H A;  5H92 C;  1JDE A;  4EFO A;  1FEH A;  2YT2 A;  3AUL A;  3PLU A;  4WQM A;  4MAC A;  4YSZ B;  3SHQ A;  1X05 A;  2NPT B;  1ROE A;  1NYR A;  1UNQ A;  1F2R C;  1UEL A;  1TGZ B;  4FHK A;  4KZC A;  2OHF A;  3ZNI D;  2PPH A;  1V5M A;  2QCZ A;  3AE3 B;  5E6P A;  1C3T A;  1E7P B;  1E8Z A;  3FLV A;  4GXB A;  3RNE C;  1NEN B;  2HTM E;  5D3W A;  1VRA B;  2DYN A;  3ZVR A;  4GDK A;  4JIO U;  2WP9 B;  1FPY A;  2Z59 B;  1SE9 A;  5C6R A;  4IC7 B;  1XLN A;  1U2B A;  2ROV A;  3RZF A;  4PQ0 A;  1UPQ A;  2KZR A;  1IYF A;  1K53 A;  2MFQ A;  4LCD E;  1VCB A;  4RGM A;  3AE1 B;  4M0W A;  3MC0 B;  1ACA A;  1Z5S B;  4YTM B;  4B0M A;  4P1B C;  3SUZ A;  3QAQ A;  4A90 A;  1XXG A;  4QJ3 B;  2I2Y A;  1GNU A;  5JHG A;  3N1Y C;  3EC8 A;  3D32 A;  1PYW D;  4BKS A;  3BVZ A;  4HAT B;  1GC6 A;  4G0N B;  1WR1 A;  2CU3 A;  1TS2 A;  5D7G A;  4ZHP A;  3R2I A;  4BBK A;  2KVR A;  2QEJ C;  4MY6 A;  2KIG A;  2KN5 A;  3MHS D;  1UPR A;  1KJT A;  3ONS A;  1UNR A;  2BYV E;  4KVG B;  4DQO C;  2H88 B;  5D94 A;  4WAF A;  4TQ1 A;  3ZUN A;  4WJP A;  3W2D A;  2LKO A;  3P63 A;  4MM3 A;  2N7D A;  4HLE A;  2LI5 A;  4CO7 A;  3H7P A;  4GGQ A;  2Z4D A;  2FJU B;  2BS4 B;  4KSK C;  3BIN A;  2DLW A;  2K8H A;  2UZS A;  1XT9 B;  2OTX A;  3PTF C;  4O1N A;  5IN7 A;  1QQR A;  2HD5 B;  1IUE A;  2FNJ B;  2IO3 B;  2WDR B;  5DH9 B;  1KFY B;  2C7H A;  2OOB B;  4NSW A;  4HB3 B;  4NQK E;  3PRM B;  2N4F A;  3IAM 1;  1SF0 A;  2M38 A;  2MKR A;  3W5U B;  3AE4 B;  3SR6 A;  1HBK A;  3ZTD A;  2RDH A;  4KIK A;  4JKB A;  1WE7 A;  3QQ8 B;  1V5P A;  4NJC A;  3RNF C;  1L2N A;  4BBN C;  1KBL A;  1V86 A;  2D5G A;  3CSF A;  2Q13 A;  1ZDX A;  3T3N A;  1TJE A;  2M19 A;  2ZW0 A;  3BVG A;  3A4R A;  2L83 A;  4RNA A;  3HUI A;  5DIF B;  1FCC C;  3L13 A;  1W1G A;  2YF0 A;  3SFE B;  3AEC B;  2A5U A;  3A8P A;  4F7H A;  2K6Q A;  1WGK A;  1F52 A;  2BCJ A;  1EWY C;  5CHV C;  2CR5 A;  1WGQ A;  1I4R A;  3EUB 2;  2RRF A;  1P5T A;  1CMX B;  3TCA A;  2EKE C;  2BT6 A;  3H1U A;  4G11 A;  1V61 A;  2LGX A;  3KYD D;  1RFA A;  1FIQ A;  2MSE D;  2KN4 A;  2RDG A;  3ZXV A;  4JX1 C;  3K9O B;  1E7U A;  4YSY B;  2P8V A;  1C77 A;  4WWO A;  3OG5 A;  3KWV A;  3T3O A;  4JK8 A;  5H8Y E;  1C4C A;  4EZK A;  4CHM A;  4HJG E;  4IM2 A;  1NDD A;  3Q6B A;  1QF6 A;  2KAJ A;  2LOX A;  3W1Y A;  5TR5 A;  4F8C B;  1ZW7 A;  2L52 A;  3SYX A;  1ET9 A;  1WX8 A;  2G4D B;  2HJ8 A;  3B08 A;  4OVU A;  2K0P A;  2WX0 A;  1U4A A;  2XQN M;  2BGF A;  3ZRC A;  1WYG A;  2LGI A;  3A9K B;  3EEC A;  2ZNV C;  2GB1 A;  1WFY A;  3CXB B;  3E9L A;  3BVM A;  2CHX A;  3AEG B;  4XYC A;  1KLV A;  3V3X A;  4TQ0 A;  3U2S C;  4L1R A;  4M02 A;  2D07 B;  4YXD B;  4CHJ A;  4AQ7 A;  1DIK A;  3X23 A;  2W54 A;  4Y94 A;  1MK7 B;  1GJZ A;  1TKY A;  1XX0 A;  3W1S C;  1XLQ A;  2L00 B;  2WS3 B;  3FIL A;  5LNK 1;  1EM7 A;  1M7R A;  2JZZ A;  2Z59 A;  2KLC A;  2KDE B;  1HXY D;  4KDL B;  4W9G A;  3AU4 A;  1DDW A;  1I4P A;  1JWM D;  4FA6 A;  3NZ3 A;  2GLS A;  1T0R C;  1HB6 A;  3Q14 C;  5I2M A;  3SEB A;  1KF6 B;  2JSV X;  4HXD A;  4HKQ A;  1N63 A;  1L6V A;  2KC2 A;  1K52 A;  2IDY A;  3RZW C;  2IY1 B;  1EO6 A;  2KAN A;  4YSX B;  4DXF A;  3U30 A;  4C0A A;  1KC7 A;  4QJ5 B;  2UYZ B;  4A6K A;  3GE3 C;  2FCS A;  3H9D A;  1XR0 B;  3CF6 E;  1B9R A;  2MEK A;  3S2A A;  5DPS A;  4LNK A;  4WSF A;  4AJW A;  3VIA A;  2GUM A;  3ZJU A;  5GXG B;  4ANV A;  2WDQ B;  1ZKH A;  2PE6 B;  1TXD A;  2MCN B;  1L0Y B;  4HK2 A;  4JWS C;  3RNA C;  2WXR A;  2KTR A;  4F7Z A;  1P3R A;  2DA0 A;  2FIF A;  4I6L B;  4J6I A;  3SDL C;  4FJV B;  3DWG C;  4ASW C;  2WH5 A;  2Z8L A;  4EMO A;  1U5F A;  1V1P B;  2CRF A;  2N9K A;  1X86 A;  1JAL A;  1L6U A;  2YS3 A;  2DHK A;  3WYF B;  1WE6 A;  2R2Q A;  5FR6 A;  4W9D A;  3TBL D;  3SBT A;  5D27 A;  5HE0 A;  3O65 B;  4TSS A;  3KLS X;  4ZRP A;  3AEF B;  2MQJ A;  5BMI A;  1ZXI A;  3ZW3 A;  3NOB A;  2LBB A;  3NVW A;  2R2Y A;  1SB3 C;  2R2O A;  1J8C A;  2I1K A;  1YX6 B;  2COD A;  2LD9 A;  3CIK A;  4PK1 A;  3EA6 A;  3AB5 A;  3JYU A;  4XGA B;  4URK A;  2HRJ A;  2ZVN A;  1AWE A;  4HB2 B;  1PFJ A;  4MEM A;  4M8M A;  2RVB B;  1M7E A;  4KKJ A;  1IBX A;  2WX1 A;  4ZDV A;  2RDB C;  2G3Q B;  4EE2 A;  2KAC A;  5EE9 A;  2E2X A;  2D3A A;  2ZKM X;  2LVQ A;  4GOC A;  2ABD A;  2RQ1 A;  4DDG D;  2V76 A;  2COF A;  2TSS A;  3I5J C;  3PSC A;  3N30 A;  5D3X A;  1FXA A;  1T0Q C;  3CST A;  1U29 A;  1EVH A;  4HAY B;  1V1P A;  2MBE A;  2PZ1 A;  1YJJ A;  2RLO A;  2MRP A;  3NJT A;  4W9L A;  3IFW B;  4WUR A;  1RRP B;  1E10 A;  4K7S A;  3LB8 C;  1WXQ A;  3WAM A;  3O96 A;  3KUZ A;  5J3Y A;  2ZZP B;  3ZKJ C;  2GRI A;  2BB6 A;  3T8M A;  3L17 A;  2KDB A;  4G50 A;  3N1Z C;  2YVC A;  2JYT A;  2NVU I;  3PV1 A;  1N61 A;  4A8X C;  3G9W A;  2WGS A;  2XK5 B;  4XDC A;  2WXH A;  3WCQ A;  2LHD A;  2AQ2 B;  2LGS A;  1NYQ A;  2LUL A;  2JPH A;  3V5W A;  4CYE A;  1WJ1 A;  3EFU A;  4MH8 A;  2LRW A;  4W9H A;  5E6J A;  4XC2 A;  2DZM A;  2KFK A;  2PVG C;  3GZN B;  4IM0 A;  3QIJ A;  4BOZ B;  2RSG A;  2YEP F;  2WDV B;  2CHZ A;  4MM3 B;  2KLG A;  1FHO A;  4HSI A;  2L0T A;  3DVN V;  4I6P A;  1SE2 A;  4FJZ A;  1OFF A;  3AE7 B;  4WWP A;  1PDX A;  3DBS A;  2N7E A;  1P0R A;  3FVC A;  1ZE3 D;  3PVL A;  3Q3J A;  3MC9 A;  1VR9 A;  4WQO B;  3RCP A;  1WM2 A;  3QHT A;  3PGE A;  1YMH E;  2DYQ A;  2WXK A;  5CLL B;  3TEZ A;  1V6E A;  1WJ6 A;  2C7M B;  4II2 B;  3L10 B;  1L4D B;  3H7P B;  2D9Z A;  2V0G A;  1E7V A;  3APD A;  4QJ4 B;  1SBB B;  4L6E A;  1A70 A;  3HVD A;  2GBN A;  3Q3O C;  1QQG A;  1ZM0 A;  2MBH A;  1ZGU B;  2WXL A;  1WVH A;  3VR9 B;  4JE3 B;  4NAW A;  3ZLZ A;  1MIX A;  4A6H A;  2EC1 A;  1WI1 A;  5D3D A;  1C4A A;  2N9P C;  3KRW A;  3P2B A;  3HK0 A;  1D5X C;  3RNB C;  1UNS A;  1GGO A;  1QOG A;  4DHJ D;  1I7A A;  4GN1 A;  1L4Z B;  2FUG 1;  4REZ A;  1MPE A;  3AEE B;  3ZNG C;  3NZU A;  1J7C A;  1M94 A;  2QSD A;  3MHZ A;  2AQ1 B;  4PS3 A;  2X18 A;  4J3O D;  3FC4 A;  2KNB A;  2LEK A;  1K5D B;  4MK0 A;  1YN5 A;  2LXA A;  2DX1 A;  2KK8 A;  2QIE B;  3PO0 A;  3VXW A;  3E66 A;  2INN E;  5FKA C;  1G6J A;  4IKG A;  3P1M A;  4JK9 A;  1CJE A;  4ICU A;  1DYN A;  1EGX A;  4LDT D;  2Y8G A;  4ANW A;  3DPD A;  1HTO A;  3RCZ A;  2NBU A;  1XO3 A;  3ODW A;  3WAL A;  1V1O A;  5L95 C;  3RFZ B;  3B2F A;  2K2J A;  1JW9 D;  1M4V A;  1A5R A;  3DWM A;  4TUU A;  5LON B;  4ZRI A;  4DDI D;  1JWB D;  4I6N B;  1JRP A;  3MJ5 A;  4B6W A;  2XK5 A;  2DIK A;  3DXC A;  4GSW A;  1I35 A;  2CJN A;  1RRB A;  3AEB B;  1L0X B;  1IGC A;  3AE9 B;  3NS1 A;  4DXG A;  2MLB A;  2YRY A;  5IP4 D;  3VUW A;  4M8N A;  4M00 A;  3ODO A;  5J2R A;  2LVP A;  4FLH A;  3N7C A;  4HRS A;  4ZYS A;  2DYB A;  4BKS D;  4AS1 A;  1FRR A;  3U12 A;  3R3M A;  5EDS A;  1LB1 A;  1WWT A;  1QIL A;  2CQU A;  2NTT A;  5C2T B;  3DVG X;  1WXS A;  4GIV A;  1SXT A;  1SEB D;  1OY2 A;  5J17 A;  1UZX B;  4IOI E;  1WI0 A;  4BBN F;  1Z87 A;  2W2X C;  1N62 A;  3MJW A;  1TZO A;  1WM3 A;  2ZEQ A;  1FCL A;  1XLP A;  2LWP A;  1JQ4 A;  2DKP A;  2Z0Q A;  4MJS A;  4P16 A;  2V9H A;  4FXC A;  3C8Y A;  1T6B X;  2M14 A;  4K3B A;  3Q3M C;  3FSS A;  3KUC B;  1ZSQ A;  4K2P A;  4GOU A;  2BYE A;  3M95 A;  2N0S B;  3V05 A;  4CQN A;  2KTF A;  1Y5O A;  1VDV A;  1JML A;  3ML4 A;  3PP2 A;  5BO4 B;  3GB1 A;  3HW2 B;  4AWJ A;  1FRD A;  3KW5 B;  5D6J B;  2J0J A;  1U5E A;  1I4G A;  4W9K A;  4YT0 B;  1V5O A;  3VDZ A;  5AZG A;  1T0S C;  4KGR A;  5IO9 A;  4RGT A;  2W3S A;  5JP4 A;  5HI1 A;  4TV3 A;  4CHK A;  3C0R B;  2OJW A;  5GOW B;  2W9N A;  3GE8 C;  1RAX A;  2Y3A A;  2PLP A;  4H2A A;  1KOT A;  2Y5P A;  3PZ8 A;  3NY5 A;  2DWQ A;  1RM6 C;  3FAH A;  1VJK A;  4WIP A;  2DX5 B;  2N9L A;  5KQ4 A;  1FNV A;  3TL5 A;  2J7Q B;  5AUI A;  1TJ6 A;  4LNI A;  5IOI A;  2ELA A;  4RH6 A;  5JHA A;  3BII D;  4ICV A;  3MTN B;  5HKH A;  3I57 A;  1ISN A;  3DVN U;  5L81 A;  2JYE A;  4DHZ E;  5AZF A;  1U5D A;  3HQC A;  1FOE A;  1FHX A;  3JSV B;  2RSU A;  3ECI A;  3QA8 A;  2ELB A;  4HRO A;  3BYT B;  4FJY A;  3DXE A;  4RMA A;  3RMK C;  4ARI A;  4TKN A;  1FGZ A;  2G9H D;  2EMT A;  3T06 A;  3SBG A;  4L1B A;  5HE1 A;  1OEY J;  2LFI A;  2NZ8 B;  1SIJ A;  2NBV A;  2JT4 B;  4JK7 A;  1WJN A;  2KKC A;  1LXD A;  2QMT A;  1VLB A;  4WAA A;  4PNK A;  1TQZ A;  3ULB A;  3B2G A;  3VVW B;  3TMP B;  4ZOH C;  5CLQ B;  4F1S A;  3AN1 A;  2LUE A;  2UWQ A;  4A6F B;  1ACC A;  2W55 A;  3VRA B;  1WGR A;  5MPO A;  1FFU A;  4DX8 A;  2KDM A;  4JKC A;  3KY9 A;  1NU2 A;  1RLF A;  3OLM D;  2K8E A;  1WGG A;  3W1S A;  5BYQ A;  3RPF C;  1MK9 B;  3KVF B;  2KWC A;  2CAY A;  1MVK A;  3KUD B;  1WYW B;  2PTL A;  1PGA A;  5JLJ B;  2LUM A;  3ALB A;  2DEN B;  2Y5B B;  2V3P A;  1YOV B;  3HM3 A;  1NTI A;  2K1F A;  2QDF A;  2KJ6 A;  5DPW A;  1DDM A;  2IY0 B;  5J18 A;  1ZOY B;  4JKH A;  1UGM A;  3PT2 B;  3RUL A;  2N23 A;  2ADZ A;  1ESF A;  3NSU A;  2LZ6 A;  3VUX A;  4QXA B;  2XNA C;  2DLB A;  3URY A;  2AL6 A;  3DDC B;  3Q69 A;  3U7Z A;  1I7H A;  3IBE A;  2NS5 A;  2J4X A;  1J7A A;  1JRU A;  2BKR B;  5IRS A;  2KOX A;  3OAW A;  2WYQ A;  3FM8 C;  2QC8 A;  2HDE A;  3RN9 C;  1V81 A;  2VH2 A;  2VRW B;  3A4S C;  2W3R A;  2JP2 A;  1UBI A;  1NBF C;  2OQB A;  5JXV A;  4P7I A;  2G45 B;  3P4P B;  4HPM B;  1L5P A;  5LXI B;  4GDL B;  4JKA A;  1E8W A;  3A1Q A;  4W9C A;  1VZ7 A;  1U27 A;  2COP A;  2ZJD A;  2WXJ A;  3VQI A;  2GBR A;  4YL8 A;  3H7S A;  3TEX A;  2L1A A;  4JKG A;  4DBG A;  3IXS A;  4B95 A;  2BWF A;  2K3U A;  1P7E A;  1OGW A;  3UIO B;  3H6N A;  2MWN B;  3SNH A;  4LNF A;  1WIA A;  3E9P A;  2KUQ A;  2IYB A;  1IPG A;  2KQS A;  3I9V 1;  1AW7 A;  2M1M A;  3M62 B;  4PYZ A;  5EE1 A;  1YQ3 B;  1RFK A;  4OZA A;  4ILH A;  1VBH A;  3MFG A;  5BMG A;  3VTW A;  1EWC A;  2QKM A;  4RGO S;  3AH7 A;  2RPV A;  3VFK A;  4XDD A;  1VZ6 A;  2O2V B;  1R4M B;  2E3T A;  1HEZ E;  2WNM A;  4TMA B;  4D6W A;  4YTN B;  4ZHO A;  1SHC A;  5BYS A;  4HHV A;  1MHH E;  1WGU A;  4HPL B;  3E56 A;  2KDI A;  1Q0W B;  3DOW A;  3D8F A;  3R7R A;  2FID A;  2GOW A;  3UQB A;  4XWT A;  4IFS A;  3IAS 1;  5TSS A;  2R0D A;  2OJR A;  2IFS A;  4HAZ B;  3VR8 B;  2WXQ A;  1FFV A;  1GG3 A;  4BVU C;  2I1J A;  5C23 A;  1D6E C;  1ZYI A;  2Z0O A;  3ZXR A;  3BYY B;  5D3V A;  1K5G B;  4II3 B;  4XE0 A;  2BW2 A;  1E9M A;  2O6V D;  3APC A;  3AM9 A;  1NVL A;  1DOX A;  1YN4 A;  3AE6 B;  1WSP A;  2D11 A;  3RNG C;  3QCA A;  4AOF A;  3EGR A;  4A55 A;  3PRP B;  5G5G A;  1FM0 D;  1AWD A;  1EAZ A;  1MI1 A;  2MA9 B;  1Z2M A;  2AWT A;  3M3J A;  1CZP A;  3L54 A;  3T9L A;  3C19 A;  1SJH D;  3LJU X;  3WIM A;  3BK1 A;  3AE8 B;  3TFM A;  3RI7 C;  4GDL A;  2JQR B;  1S3S G;  3K9P B;  4WJO A;  1GC7 A;  1C76 A;  5KHO A;  4P6V F;  4DIX A;  4HB4 B;  1WY8 A;  3RNC C;  2J0M A;  1VBG A;  1LGR A;  2IGD A;  1P98 A;  2LG1 A;  4HAW B;  2EJ8 A;  2JF5 A;  2OED A;  4W9E A;  4IW0 A;  1AYF A;  1AAR A;  1HE8 A;  2JUO A;  1DBH A;  2R82 A;  5D3I B;  1SE3 A;  4ZYN A;  1WZ3 A;  2FAZ A;  3N9Y C;  2RGN B;  2FCQ A;  1XCQ L;  4EEW A;  4FBJ B;  1MG4 A;  1XD4 A;  1TY0 A;  2KFK B;  2PW9 A;  3QJZ A;  4D0N B;  2ZCB A;  2YS1 A;  3SV1 A;  2GCL A;  1K50 A;  1JWU D;  3FIL B;  4KGT A;  1WRD B;  2KMC A;  3PHW B;  2ON8 A;  4HJK A;  2IO2 B;  3RT3 B;  2MP2 A;  3N32 A;  2FCN A;  1UEF A;  1DYQ A;  2N9E B;  2KWD A;  3EFC A;  5HFY A;  2G4S A;  4GZU A;  1X11 A;  3UIP B;  1GAQ B;  3FKY A;  1I2H A;  3P42 A;  4FN2 A;  4W9I A;  1BWN A;  4K7W A;  1BTN A;  2CU1 A;  3ODX A;  3IVF A;  1C9F A;  1YD8 U;  4IOY X;  2DZK A;  2HJ1 A;  1F2R I;  2CKH B;  5DI9 B;  2XEW A;  3Q8B A;  1H10 A;  1BAK A;  3KRX A;  1FMA D;  4E74 A;  1Q1O A;  3A8Q A;  2J59 M;  2KD0 A;  1PGB A;  4KKI A;  2CY5 A;  3AU5 A;  3U7D A;  1WG7 A;  5C79 A;  4P1C C;  3B77 A;  1MIZ B;  2DHZ A;  3L0W B;  3VUY A;  1ZXH A;  1KH0 A;  1OTR B;  2O2V A;  3BWU D;  4DHZ B;  2J42 A;  3BJI A;  3GZN I;  1E90 A;  1D5Z C;  4F7G A;  4CSQ A;  2N1W A;  2HE7 A;  2YS5 A;  2IO1 B;  2IGG A;  4KHB B;  1YN3 A;  3VAW A;  2KYW A;  3SO6 A;  1LM8 B;  1SSN A;  3KZ1 A;  4PYU A;  1ST7 A;  2PJH A;  2GMI C;  3ZRF A;  1BML C;  3OJ4 B;  2L1C A;  1X1F A;  1IP9 A;  2KX3 A;  3B0A A;  4MGI E;  1WGD A;  4HKZ E;  5D3Y A;  3NWA A;  1PFD A;  2PMV A;  5HG2 A;  3TW1 A;  5GMV A;  4IUM B;  3R66 C;  3MDB C;  1ZDV A;  4DK5 A;  4HAU B;  2KX0 A;  5G55 A;  2DZJ A;  3Q3N C;  2KIE A;  2JY6 A;  2PVO D;  3ZTC A;  4NQL B;  5FI0 A;  1LFD A;  3DHH C;  4C80 A;  1GUA B;  4YWG G;  2NMQ A;  1Y8R C;  3UF8 A;  3HHM A;  1WXM A;  4EOY A;  2K8B A;  2W2X D;  3AEA B;  3VTU A;  2PIA A;  2K00 A;  4W9J A;  1TY2 A;  1WMH B;  4F7U P;  1HZ6 A;  2D9X A;  1N60 A;  4NAM A;  2DBY A;  5M4Y B;  3TSS A;  3D8E A;  1MJD A;  4JGH B;  1WZ0 A;  1HQR D;  3UI3 A;  2AX5 A;  1XCT L;  2MBB B;  2L32 A;  2L0F A;  1GB4 A;  1TKG A;  4PS8 A;  3SU8 X;  4DHJ B;  3JVZ X;  2BPS A;  1MFW A;  2M0A A;  4MGK E;  4NAW B;  1T0Y A;  4IWP A;  1J0W A;  1FNU A;  3KYC D;  1NTY A;  2MWS B;  3A9K A;  1E5W A;  3TEW A;  4K17 A;  3ZIM A;  2KJR A;  2G35 A;  2J0K A;  5BMH A;  1NI2 A;  4KHO A;  4B0E A;  2JU6 X;  2WQY B;  2CHW A;  2WXO A;  2BYF A;  3HM6 X;  1KLU D;  3PEG A;  2Z0D B;  1WMH A;  1H8C A;  1P1A A;  3AI5 A;  2N7J A;  3TUO A;  4LDT B;  4YTP B;  2BWE S;  4Z2N A;  2Z13 A;  1KI1 B;  1N5W A;  2WLB A;  2MJ3 A;  2ZCC A;  2DTC A;  4JKD A;  3Q3F A;  1RJ2 A;  4KAX B;  3DBR B;  4UDU C;  3PPA A;  5J3Q A;  4RF1 A;  5HHD G;  1F1H A;  4KX6 B;  2NBV B;  5FI1 A;  4S17 A;  2E6X A;  3F0W A;  2J52 A;  3ZYY X;  1MI0 A;  3I63 C;  2IBI B;  5DPT A;  2WXN A;  4MGZ E;  2BQQ A;  1TT5 B;  3ENE A;  1UNP A;  5DCN A;  3HRD D;  1WRI A;  2KGX B;  1UUP A;  1Y56 A;  2KMA A;  1E0Z A;  4X57 B;  2GBJ A;  1YQB A;  3U52 E;  3LXF A;  2MH7 A;  4GLS C;  3UQA A;  1MG8 A;  1LW3 A;  1TYG B;  2FE8 A;  2DYM A;  3GS2 A;  4A6Q A;  5EFX A;  2RGF A;  2JXX A;  2FCM A;  1KRH A;  4ITK A;  4HWI B;  1KTK A;  2ASQ A;  4WWM A;  5LOP B;  4GPT B;  1FXI A;  3SD5 A;  1B55 A;  3L08 A;  2DKQ A;  1RYJ A;  4MGY E;  1FXT B;  4MSQ B;  3AXC A;  3EPY A;  4EJN A;  2IO0 B;  4HCP B;  5T8I A;  3AE2 B;  1QOF A;  1V80 A;  5CHW A;  2COA A;  4US8 A;  3E9O A;  3ZNZ B;  1IRS A;  2YT1 A;  3V6E B;  3NS8 A;  1ENF A;  1TS3 A;  1DOI A;  2RMM A;  1E6E B;  3DXD A;  2VH1 A;  3DHG C;  1JWS D;  2VSZ A;  4NJ6 A;  1FAO A;  4KHB A;  3UZT A;  2LXC A;  5I2S A;  4MEL A;  1DGJ A;  2D9W A;  1NTV A;  2WXF A;  2LJ5 A;  5JVL A;  2L8J A;  2LGD A;  4HVB A;  1TIF A;  2PE9 A;  2W2W A;  3KQ4 A;  4JQW C;  4K7U A;  4A6F A;  4LJO B;  2UVM A;  1BTK A;  1CQV A;  2Y5C A;  4KHA A;  2YLM A;  1SJE D;  5LLI A;  4KIK B;  4USA A;  3J9C A;  4GMV A;  2B3A A;  2DZI A;  4NNJ B;  1PMS A;  2GBK A;  2P0D A;  1STE A;  2ZPN A;  2Z14 A;  3A58 A;  4ANX A; 
#chains in the Genus database with same CATH homology
 2KQ7 A;  4B9K A;  2D10 A;  3QX1 A;  3A98 B;  2RR9 A;  1TZ1 A;  4FHJ A;  4ANU A;  2WWZ A;  2FDQ A;  2CS4 A;  2VKI A;  5CHF A;  1VD2 A;  5CTR C;  5C1Z A;  3PZD A;  1SGH A;  1R4M I;  2GBM A;  3DBL I;  4AJY B;  3D8D A;  2RNR B;  3ZNH B;  4MJS B;  2ZNV B;  3VOQ A;  4HDO A;  1E8Y A;  2Y7B A;  2Z0E B;  2FJ9 A;  4NY0 A;  2N1V A;  3WAN A;  3GOE A;  1OQN A;  2MDX A;  3NHE B;  4GU2 A;  1AQC A;  1XD3 B;  1DDV A;  3A1Q B;  1ZC4 B;  4NPN A;  1KM7 A;  1ZC3 B;  5HE3 A;  4Z2M B;  4E3C A;  2KO3 A;  3U8Z A;  2K25 A;  1J19 A;  3P6A A;  4GDK B;  2K2U A;  3ZDT A;  4W9F A;  3V6C B;  3WA0 A;  1BT0 A;  4JKG B;  2AEH A;  5DHF B;  2YSZ A;  1R4N I;  4IWQ A;  4BKG A;  3ULC A;  2KWU B;  1Y19 B;  4XX5 A;  3L16 A;  2GS0 A;  2LAS A;  3BY4 B;  2AL3 A;  2KHW B;  2KJH B;  4DWF A;  1WXA A;  1WF9 A;  1V89 A;  2ZVO A;  3QWZ B;  2L3Z A;  3P7Z A;  2MX2 A;  3KSY A;  2KTR B;  2V3S A;  2IZV B;  2JZ3 B;  2L2I A;  4FUL A;  4WJ7 A;  5KQ1 A;  3OJ3 A;  3PHX B;  3DQV A;  1X1M A;  4AUQ C;  2ZPY A;  5KCV A;  4ZRK A;  3KH0 A;  4MT7 A;  3PVW A;  4GB9 A;  5D2M B;  1L7Y A;  3EHV A;  4XZ4 A;  3UIN B;  3TVV A;  3QC8 B;  3QAR A;  1KZ7 A;  2NR2 A;  4ZRJ A;  3JSV A;  2NCN A;  4TYZ A;  3JW0 X;  2M0X A;  1F9J A;  2RPQ A;  4HAV B;  1EF5 A;  1V2Y A;  2IYD B;  4IM3 A;  2H7E A;  3APF A;  1FGY A;  4A5K A;  1WJM A;  4EZL A;  2JVC A;  1WXV A;  2KCJ A;  4JKF A;  4WJN A;  1K8R B;  5C5B B;  1HB8 A;  3FP5 A;  1W1D A;  2R09 A;  5JZE B;  3RYT A;  2CY4 A;  3LDZ E;  2MW5 A;  1Q67 A;  3A33 B;  1QC6 A;  5C16 A;  1DRO A;  1XOD A;  2AYO B;  1UH6 A;  2MBO A;  1P6S A;  1PQS A;  2L76 A;  1P3Q U;  4IWO A;  2P0F A;  2CB8 A;  2V4L A;  2KUP A;  1OQY A;  4HB0 B;  2NPT A;  4AP4 C;  1V5U A;  2DHI A;  4WVF B;  1TBE A;  2JRH A;  1MAI A;  1N3H A;  2N9X A;  4RM8 A;  3TIX A;  1WGY A;  2JWZ A;  4BKT A;  2C9W B;  5JHH A;  3IHP C;  3PG7 A;  2GCJ A;  4KDI C;  2RUK B;  2PEA A;  1D3Z A;  1X1G A;  2MP2 B;  2X0S A;  1PLS A;  5IAA C;  1XCG A;  2C60 A;  1FHW A;  5G2N A;  3ML9 A;  3HIZ A;  5J3T A;  1EF1 A;  4JL9 A;  1QZE A;  1YIW A;  2LGY A;  4KV2 A;  2O6V B;  4YON A;  1MKE A;  3V61 A;  2DX5 A;  5L83 A;  2JRI B;  4FAD A;  1TTN A;  2DAJ A;  2HTH A;  2KDF B;  1UBQ A;  2D9Y A;  3V62 A;  3PRZ A;  3CMM B;  2LYD A;  1LQB A;  5AZH A;  5HE2 A;  2O6V A;  3PSE B;  1S1Q B;  2QKL A;  1U5G A;  1EUV B;  2KXJ A;  3QK0 A;  2DN6 A;  2NMB A;  2UZR A;  3RD2 A;  5E6N A;  2M8S A;  3ENB A;  1Q5W B;  1C1Y B;  2KWV B;  2REX A;  5AEK B;  5IA7 A;  2K39 A;  1WJ4 A;  3M1I B;  2BKF A;  2QHO A;  3ML8 A;  3RUI B;  3LJ3 A;  3GYO A;  4BOS C;  2KC1 A;  1WH3 A;  2Y8F A;  2RD0 A;  2BF8 B;  4BFR A;  4ILJ A;  3ZVV A;  3PVU A;  4A20 A;  4XWX A;  4LJP B;  1YJ1 A;  4KZ0 A;  3FEH A;  1I42 A;  4ILG B;  4G3X B;  4JKE A;  1P9D U;  3QWM A;  3OAN A;  2M4N A;  3GYP A;  3NZS A;  3X0W A;  1H4R A;  2L05 A;  2FUH B;  4IAP A;  3V60 A;  1UD7 A;  1W1H A;  1WX7 A;  1FB8 A;  2COC A;  3UGB B;  3ZO5 B;  3IG3 A;  5JHB A;  2N0Y A;  5C5B A;  1KZG A;  2D9V A;  2GJY A;  4MH0 E;  3WAP A;  4DX9 0;  2K6D B;  1OEY A;  1YX5 B;  3R7Q A;  2I5F A;  3VTV A;  3A9J B;  3M63 B;  2LRU A;  3AJ4 A;  1WJU A;  3VH4 B;  3ZDM C;  3F5R A;  4A3O A;  2P0H A;  3TO1 A;  4N9F 4;  4WJQ A;  3DBR I;  1V5T A;  4KSL C;  3WAO A;  2H7D A;  2VRR B;  4MDK E;  2A4Z A;  2V1Y A;  4MSM B;  4H8S A;  3DVG Y;  4RM9 A;  1SIF A;  3B1L X;  3N3K B;  2M17 A;  2I5C A;  2LVO A;  1V49 A;  2HTH B;  4E71 A;  4PS7 A;  4M0W B;  3DCG A;  2Z0P A;  1WX9 A;  5E6O A;  2K8C A;  4K1R B;  4A3P A;  4EKU A;  2D2Q A;  1E8X A;  4JLC A;  4DBB A;  1V9J A;  5CX3 A;  3A9J A;  2C7N B;  1J0G A;  3MPX A;  3VHT C;  4HDQ A;  1XQQ A;  4EUT A;  2L7R A;  1OMW A;  4K81 A;  2D4Q A;  3PRE A;  3PS6 A;  5LXH A;  4GMX B;  4NJ7 A;  2EMS A;  2DFK A;  2C5L C;  5KHQ A;  2D3G A;  2WDT B;  4DXA B;  5DPR A;  4EZJ A;  1XKE A;  5JH5 C;  3PLV A;  2DHJ A;  3DBH I;  2KFJ A;  2MBQ A;  2DAF A;  1WR6 E;  3I3T B;  4HCN B;  1V88 A;  1WGH A;  2XBB C;  4IG7 B;  5DHA B;  3TJP A;  2NBW B;  4OVV A;  3VH3 B;  2LOZ A;  3QBV B;  2DYO A;  1MPH A;  4K2O A;  5IJM A;  2FJL A;  2ROZ B;  4WWN A;  4HAX B;  2YT0 A;  1ZVR A;  4B6H A;  1JDE A;  4EFO A;  3AUL A;  3PLU A;  3SHQ A;  1X05 A;  2NPT B;  1UNQ A;  1UEL A;  1TGZ B;  4FHK A;  4KZC A;  3ZNI D;  2PPH A;  1V5M A;  5E6P A;  1C3T A;  1E8Z A;  3FLV A;  4GXB A;  5D3W A;  2DYN A;  3ZVR A;  4GDK A;  4JIO U;  2Z59 B;  1SE9 A;  5C6R A;  4IC7 B;  1U2B A;  2ROV A;  3RZF A;  4PQ0 A;  1UPQ A;  2KZR A;  1IYF A;  2MFQ A;  1VCB A;  1ACA A;  1Z5S B;  3SUZ A;  3QAQ A;  1GNU A;  5JHG A;  3EC8 A;  3D32 A;  4BKS A;  4HAT B;  1GC6 A;  4G0N B;  1WR1 A;  5D7G A;  4BBK A;  2KVR A;  4MY6 A;  2KN5 A;  3MHS D;  1UPR A;  1KJT A;  3ONS A;  1UNR A;  2BYV E;  4KVG B;  5D94 A;  4TQ1 A;  3ZUN A;  4WJP A;  2LKO A;  4MM3 A;  2N7D A;  4HLE A;  2LI5 A;  4CO7 A;  3H7P A;  4GGQ A;  4KSK C;  3BIN A;  2DLW A;  2K8H A;  2UZS A;  1XT9 B;  2OTX A;  3PTF C;  2HD5 B;  2FNJ B;  2IO3 B;  5DH9 B;  2C7H A;  4NSW A;  4HB3 B;  2OOB B;  4NQK E;  3PRM B;  2N4F A;  2M38 A;  2MKR A;  1HBK A;  3ZTD A;  4KIK A;  4JKB A;  1WE7 A;  3QQ8 B;  1V5P A;  1L2N A;  4BBN C;  1KBL A;  1V86 A;  3CSF A;  2Q13 A;  3A4R A;  5DIF B;  3L13 A;  1W1G A;  2YF0 A;  2A5U A;  3A8P A;  4F7H A;  2K6Q A;  2BCJ A;  5CHV C;  2CR5 A;  1WGQ A;  1P5T A;  1CMX B;  3TCA A;  2EKE C;  3H1U A;  4G11 A;  1V61 A;  2LGX A;  3KYD D;  1RFA A;  2MSE D;  3K9O B;  1E7U A;  2P8V A;  4WWO A;  4JK8 A;  4EZK A;  4CHM A;  4IM2 A;  1NDD A;  2LOX A;  3W1Y A;  5TR5 A;  4F8C B;  1ZW7 A;  3SYX A;  1WX8 A;  2HJ8 A;  2G4D B;  3B08 A;  4OVU A;  2WX0 A;  1U4A A;  2XQN M;  2BGF A;  3ZRC A;  3A9K B;  3EEC A;  2ZNV C;  1WFY A;  3CXB B;  3E9L A;  2CHX A;  1KLV A;  4TQ0 A;  2D07 B;  4CHJ A;  1DIK A;  3X23 A;  4Y94 A;  1MK7 B;  1GJZ A;  1XX0 A;  3W1S C;  2L00 B;  1M7R A;  2JZZ A;  4KDL B;  2KDE B;  2KLC A;  4W9G A;  3AU4 A;  1DDW A;  4FA6 A;  1HB6 A;  4HXD A;  3RZW C;  2KC2 A;  2IY1 B;  1EO6 A;  2KAN A;  3U30 A;  4C0A A;  1KC7 A;  2UYZ B;  4A6K A;  2FCS A;  3H9D A;  1XR0 B;  3CF6 E;  3S2A A;  5DPS A;  4WSF A;  4AJW A;  3VIA A;  4ANV A;  1ZKH A;  2PE6 B;  1TXD A;  2MCN B;  4HK2 A;  2KTR A;  4F7Z A;  1P3R A;  2DA0 A;  2FIF A;  4I6L B;  4J6I A;  3SDL C;  4FJV B;  4ASW C;  2WH5 A;  4EMO A;  1U5F A;  2CRF A;  1X86 A;  2YS3 A;  2DHK A;  3WYF B;  1WE6 A;  2R2Q A;  5FR6 A;  4W9D A;  3TBL D;  3SBT A;  5D27 A;  5HE0 A;  3O65 B;  2MQJ A;  3ZW3 A;  3NOB A;  2LBB A;  2R2O A;  1J8C A;  2I1K A;  1YX6 B;  2COD A;  2LD9 A;  3CIK A;  3JYU A;  4URK A;  2HRJ A;  2ZVN A;  1AWE A;  4HB2 B;  1PFJ A;  4MEM A;  4M8M A;  2RVB B;  1M7E A;  2WX1 A;  4ZDV A;  2G3Q B;  2E2X A;  2LVQ A;  4GOC A;  2ABD A;  2RQ1 A;  4DDG D;  2V76 A;  2COF A;  3PSC A;  3N30 A;  5D3X A;  3CST A;  1U29 A;  1EVH A;  4HAY B;  2MBE A;  2PZ1 A;  2RLO A;  2MRP A;  4W9L A;  3IFW B;  1RRP B;  4K7S A;  3WAM A;  3O96 A;  3KUZ A;  5J3Y A;  2ZZP B;  3ZKJ C;  3T8M A;  3L17 A;  2KDB A;  4G50 A;  2YVC A;  2NVU I;  3PV1 A;  3G9W A;  2XK5 B;  2LUL A;  2JPH A;  3V5W A;  4CYE A;  1WJ1 A;  3EFU A;  2LRW A;  4W9H A;  4XC2 A;  2DZM A;  2KFK A;  4IM0 A;  3QIJ A;  4BOZ B;  2RSG A;  2CHZ A;  2KLG A;  1FHO A;  2L0T A;  3DVN V;  4I6P A;  4FJZ A;  4WWP A;  3DBS A;  2N7E A;  1P0R A;  3Q3J A;  3PVL A;  4WQO B;  3RCP A;  1WM2 A;  3QHT A;  3PGE A;  2DYQ A;  5CLL B;  1V6E A;  1WJ6 A;  2C7M B;  4II2 B;  3L10 B;  3H7P B;  2D9Z A;  1E7V A;  3APD A;  4L6E A;  2GBN A;  1QQG A;  1ZM0 A;  2MBH A;  1ZGU B;  1WVH A;  4NAW A;  3ZLZ A;  1MIX A;  4A6H A;  2EC1 A;  1WI1 A;  2N9P C;  3KRW A;  3P2B A;  3HK0 A;  1GGO A;  4DHJ D;  1I7A A;  4GN1 A;  3ZNG C;  3NZU A;  1M94 A;  4PS3 A;  2X18 A;  2KNB A;  1K5D B;  4MK0 A;  2LXA A;  2DX1 A;  2KK8 A;  3VXW A;  3E66 A;  1G6J A;  4JK9 A;  4ICU A;  1DYN A;  1EGX A;  4LDT D;  2Y8G A;  4ANW A;  3DPD A;  3RCZ A;  2NBU A;  3ODW A;  3WAL A;  5L95 C;  2K2J A;  1A5R A;  4TUU A;  5LON B;  4ZRI A;  4DDI D;  4I6N B;  4B6W A;  2XK5 A;  2DIK A;  3DXC A;  4GSW A;  1I35 A;  1RRB A;  2MLB A;  2YRY A;  3VUW A;  4M8N A;  3ODO A;  5J2R A;  2LVP A;  4FLH A;  3N7C A;  2DYB A;  4BKS D;  5EDS A;  3R3M A;  1LB1 A;  2CQU A;  3DVG X;  1WXS A;  4GIV A;  5J17 A;  1OY2 A;  1UZX B;  1WI0 A;  4BBN F;  1Z87 A;  2W2X C;  3MJW A;  1WM3 A;  2ZEQ A;  2LWP A;  2DKP A;  2Z0Q A;  4MJS A;  2M14 A;  3FSS A;  3KUC B;  1ZSQ A;  4K2P A;  3M95 A;  2BYE A;  2KTF A;  1Y5O A;  3ML4 A;  3PP2 A;  5BO4 B;  3HW2 B;  4AWJ A;  3KW5 B;  5D6J B;  2J0J A;  1U5E A;  4W9K A;  1V5O A;  3VDZ A;  5AZG A;  5JP4 A;  4TV3 A;  4CHK A;  3C0R B;  2W9N A;  5GOW B;  1RAX A;  1KOT A;  3NY5 A;  2DX5 B;  5KQ4 A;  3TL5 A;  2J7Q B;  1TJ6 A;  2ELA A;  5JHA A;  4ICV A;  3MTN B;  5HKH A;  1ISN A;  3DVN U;  5L81 A;  4DHZ E;  5AZF A;  1U5D A;  3HQC A;  1FOE A;  1FHX A;  3JSV B;  2RSU A;  3ECI A;  3QA8 A;  2ELB A;  4FJY A;  3DXE A;  4RMA A;  4TKN A;  1FGZ A;  2EMT A;  3T06 A;  3SBG A;  5HE1 A;  1OEY J;  2NZ8 B;  2JT4 B;  4JK7 A;  1WJN A;  2KKC A;  1LXD A;  4WAA A;  4PNK A;  1TQZ A;  3ULB A;  3VVW B;  3TMP B;  5CLQ B;  4F1S A;  2LUE A;  2UWQ A;  4A6F B;  1WGR A;  4DX8 A;  4JKC A;  3KY9 A;  1NU2 A;  1RLF A;  3OLM D;  1WGG A;  3W1S A;  1MK9 B;  3KVF B;  2KWC A;  2CAY A;  3KUD B;  1WYW B;  5JLJ B;  3ALB A;  2DEN B;  2Y5B B;  3HM3 A;  1NTI A;  2K1F A;  2KJ6 A;  5DPW A;  1DDM A;  2IY0 B;  5J18 A;  4JKH A;  1UGM A;  3PT2 B;  3RUL A;  2N23 A;  2ADZ A;  3NSU A;  2LZ6 A;  3VUX A;  2AL6 A;  3DDC B;  3IBE A;  2NS5 A;  1JRU A;  2BKR B;  2KOX A;  3OAW A;  2WYQ A;  3FM8 C;  1V81 A;  2VRW B;  3A4S C;  2JP2 A;  1UBI A;  1NBF C;  2OQB A;  4P7I A;  2G45 B;  4HPM B;  5LXI B;  4GDL B;  4JKA A;  3A1Q A;  4W9C A;  1E8W A;  1U27 A;  2COP A;  2ZJD A;  3VQI A;  2GBR A;  4YL8 A;  3H7S A;  4JKG A;  4DBG A;  4B95 A;  2BWF A;  1OGW A;  3UIO B;  3H6N A;  2MWN B;  3SNH A;  1WIA A;  3E9P A;  2IYB A;  1IPG A;  2KQS A;  2M1M A;  3M62 B;  4PYZ A;  4ILH A;  1VBH A;  3VTW A;  2QKM A;  3VFK A;  2O2V B;  1SHC A;  4HHV A;  1WGU A;  4HPL B;  2KDI A;  1Q0W B;  3DOW A;  3D8F A;  3R7R A;  2FID A;  2GOW A;  3UQB A;  4IFS A;  2R0D A;  2OJR A;  2IFS A;  4HAZ B;  4BVU C;  1GG3 A;  2I1J A;  5C23 A;  2Z0O A;  5D3V A;  1K5G B;  4II3 B;  2O6V D;  3APC A;  1NVL A;  2D11 A;  3QCA A;  4AOF A;  3PRP B;  1EAZ A;  2MA9 B;  1Z2M A;  2AWT A;  3M3J A;  3L54 A;  3T9L A;  3LJU X;  3WIM A;  3TFM A;  4GDL A;  1S3S G;  3K9P B;  4WJO A;  1GC7 A;  5KHO A;  4HB4 B;  1WY8 A;  2J0M A;  1VBG A;  1P98 A;  2LG1 A;  4HAW B;  2EJ8 A;  2JF5 A;  4W9E A;  4IW0 A;  1HE8 A;  1AAR A;  2JUO A;  1DBH A;  2R82 A;  4ZYN A;  1WZ3 A;  2FAZ A;  2RGN B;  2FCQ A;  4EEW A;  4FBJ B;  1XD4 A;  2KFK B;  3QJZ A;  4D0N B;  2ZCB A;  2YS1 A;  3SV1 A;  2GCL A;  1WRD B;  2KMC A;  3PHW B;  4HJK A;  2IO2 B;  3RT3 B;  2MP2 A;  3N32 A;  2FCN A;  1UEF A;  2N9E B;  2G4S A;  4GZU A;  1X11 A;  3UIP B;  1I2H A;  4FN2 A;  4W9I A;  1BWN A;  4K7W A;  1BTN A;  2CU1 A;  3ODX A;  3IVF A;  1YD8 U;  4IOY X;  2DZK A;  2CKH B;  5DI9 B;  2XEW A;  1H10 A;  1BAK A;  3KRX A;  4E74 A;  1Q1O A;  3A8Q A;  2J59 M;  2KD0 A;  2CY5 A;  3AU5 A;  3U7D A;  1WG7 A;  5C79 A;  3VUY A;  1MIZ B;  2DHZ A;  3L0W B;  1OTR B;  2O2V A;  4DHZ B;  3BJI A;  3GZN I;  1E90 A;  4F7G A;  2N1W A;  2HE7 A;  2YS5 A;  2IO1 B;  4KHB B;  3VAW A;  3SO6 A;  1LM8 B;  3KZ1 A;  4PYU A;  1ST7 A;  2PJH A;  2GMI C;  3ZRF A;  3OJ4 B;  2L1C A;  1X1F A;  1IP9 A;  2KX3 A;  3B0A A;  4MGI E;  1WGD A;  5D3Y A;  3TW1 A;  5GMV A;  4IUM B;  3R66 C;  3MDB C;  4DK5 A;  4HAU B;  2KX0 A;  5G55 A;  2DZJ A;  2JY6 A;  3ZTC A;  4NQL B;  5FI0 A;  1LFD A;  1GUA B;  3UF8 A;  1Y8R C;  3HHM A;  1WXM A;  4EOY A;  2K8B A;  2W2X D;  3VTU A;  2K00 A;  4W9J A;  1WMH B;  4F7U P;  2D9X A;  3D8E A;  4JGH B;  1WZ0 A;  2MBB B;  2L0F A;  4PS8 A;  3SU8 X;  4DHJ B;  3JVZ X;  2BPS A;  4MGK E;  4NAW B;  1T0Y A;  4IWP A;  1J0W A;  3KYC D;  1NTY A;  2MWS B;  3A9K A;  1E5W A;  4K17 A;  3ZIM A;  2KJR A;  2G35 A;  2J0K A;  1NI2 A;  4KHO A;  2CHW A;  2BYF A;  3HM6 X;  3PEG A;  2Z0D B;  1WMH A;  1H8C A;  1P1A A;  3AI5 A;  4LDT B;  2BWE S;  4Z2N A;  1KI1 B;  2ZCC A;  2DTC A;  4JKD A;  3Q3F A;  1RJ2 A;  4KAX B;  3PPA A;  5J3Q A;  2NBV B;  5FI1 A;  3F0W A;  5DPT A;  2IBI B;  4MGZ E;  3ENE A;  1UNP A;  5DCN A;  2KGX B;  2KMA A;  4X57 B;  2GBJ A;  1YQB A;  3UQA A;  1MG8 A;  1LW3 A;  2DYM A;  5EFX A;  2RGF A;  2JXX A;  2FCM A;  4HWI B;  2ASQ A;  5LOP B;  4GPT B;  3SD5 A;  1B55 A;  3L08 A;  2DKQ A;  4MGY E;  1FXT B;  4MSQ B;  3AXC A;  3EPY A;  4EJN A;  2IO0 B;  4HCP B;  1V80 A;  5CHW A;  2COA A;  3E9O A;  3ZNZ B;  1IRS A;  2YT1 A;  3V6E B;  3NS8 A;  3DXD A;  2VSZ A;  4NJ6 A;  1FAO A;  3UZT A;  2LXC A;  4MEL A;  2D9W A;  1NTV A;  2LJ5 A;  5JVL A;  2L8J A;  2LGD A;  4HVB A;  2PE9 A;  2W2W A;  4JQW C;  4K7U A;  4LJO B;  4A6F A;  2UVM A;  1BTK A;  4KHA A;  2YLM A;  5LLI A;  4KIK B;  4GMV A;  2B3A A;  2DZI A;  4NNJ B;  1PMS A;  2GBK A;  2P0D A;  2ZPN A;  4LCD E;  4ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...