3U8ZA

Human merlin ferm domain
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
293
structure length
260
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Merlin
publication title Unfurling of the band 4.1, ezrin, radixin, moesin (FERM) domain of the merlin tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 260
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3u8zA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3u8zA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3u8zA01
3P6AA 2Z59B 5DPTA 1R4NI 3I3TB 4MM3A 4A20A 2MW5A 2W2XD 3L17A 3AU5A 2Y5BB 3QQ8B 5FI0A 4W9FA 1SHCA 3ML4A 4P7IA 2OOBB 3ECIA 2KD0A 4M8NA 1TBEA 3NZSA 2E2XA 2CAYA 2KQSA 2DX1A 1WJ6A 3B08A 1TJ6A 2J0JA 2RD0A 2JF5A 2FAZA 5E6OA 3V62A 2P0DA 2Y8FA 3FLVA 5LOPB 2JUOA 1I2HA 3IG3A 4KV2A 3ENEA 1FAOA 2IO1B 2R09A 2KDEB 3PT2B 1V5UA 1I42A 1RLFA 5DPWA 2JP2A 2KMAA 1MPHA 4WAAA 3ULBA 2AWTA 2BCJA 2RGNB 1FGZA 3AULA 1XODA 3PGEA 2RLOA 2HJ8A 3UQAA 5J2RA 4MJSB 4WVFB 1WGDA 2C5LC 5AZFA 1K8RB 3V61A 2RSUA 2YS3A 2RR9A 3RZWC 1OGWA 3CIKA 2EKEC 2DLWA 1UBQA 2UYZB 2D3GA 1OEYJ 4NJ6A 5CLLB 3NS8A 1TXDA 2NMBA 3ZTDA 2LASA 3ZNGC 4KHAA 2C7HA 5TR5A 1PMSA 3MJWA 1DDWA 2RGFA 2DENB 2KFJA 2HD5B 1V89A 4DWFA 3K9PB 4AJYB 2JRHA 4EEWA 4HAZB 4EOYA 2BWFA 1YJ1A 3M1IB 4IOYX 5CLQB 2N7DA 1GC6A 3MHSD 5HKHA 2MQJA 4HAXB 4CHMA 1TTNA 1A5RA 4FN2A 1WZ3A 2CR5A 4HAWB 5C5BB 2A4ZA 3PRMB 3ALBA 4B6HA 1Z87A 3ONSA 3RYTA 1U2BA 4KSKC 5KQ4A 3K9OB 2D9XA 1WXVA 4HAVB 4KSLC 3BJIA 1E90A 3DVGX 4BKTA 4K7WA 3ZKJC 3BINA 2LJ5A 2DZJA 2YRYA 4E74A 2KVRA 4FBJB 2AL6A 2MA9B 2EJ8A 2K2JA 4KIKB 3UF8A 4JIOU 2N9EB 3VVWB 2CHXA 3RCZA 1GJZA 2DHIA 3TJPA 4A6FB 2L0TA 2JXXA 2LXCA 5L95C 2V76A 2KK8A 5FI1A 2YS1A 2DAFA 2Z0OA 1V5MA 3W1SC 4A5KA 2D9ZA 1TGZB 1NI2A 2I5CA 2IO3B 2L1CA 4K2OA 2I5FA 4PS7A 2R0DA 1WXSA 4BOSC 1WFYA 4FLHA 2LZ6A 4NAWB 3WANA 2J59M 4PNKA 4LCDE 1UPRA 4L6EA 4WJPA 2COFA 2KFKB 2M17A 2KO3A 3KUDB 2MSED 2K6QA 3B0AA 3U8ZA 2NR2A 2P8VA 2DYQA 2VRRB 4A3OA 2DHZA 3GYPA 4G0NB 2OQBA 2ASQA 1Y8RC 2N9PC 2FNJB 2YS5A 1WH3A 1ZC3B 2FUHB 3PVUA 2LKOA 3DXCA 1LM8B 3GYOA 4OVVA 5DPRA 3QHTA 1WE6A 1V61A 5D27A 4NNJB 3A9KA 1V80A 1ISNA 1EO6A 2I1JA 2BPSA 2JY6A 3N3KB 1HB6A 2FJ9A 2DKPA 4A3PA 2JT4B 1WGYA 3TBLD 1X86A 2NVUI 1ZC4B 2G35A 2ZZPB 2GJYA 4WQOB 3JSVB 3EC8A 1AARA 1U29A 4K7UA 5KHQA 2DYMA 4BKGA 4W9HA 2P0FA 1NVLA 3DOWA 3JW0X 2CS4A 2JZZA 2PEAA 1WGQA 5LLIA 1EUVB 5JH5C 3EPYA 2MWSB 2DA0A 3DVNU 3NHEB 5C23A 1Q1OA 5D3VA 1J8CA 4DDID 1K5DB 4BFRA 5DHFB 2ZEQA 5D3WA 2JPHA 4EZLA 1FHXA 2D9WA 2AEHA 1WM2A 5GMVA 1UBIA 1UPQA 1ZW7A 4IM0A 4KDLB 2GCJA 3ZO5B 5EDSA 2KC2A 3U7DA 5HE1A 3V60A 5J3QA 2BYEA 1E8ZA 2KNBA 4HPLB 4HATB 2L3ZA 4GZUA 2N1VA 2FCSA 2J0MA 2YF0A 4K7SA 4GDKA 5DH9B 4F7UP 3TL5A 4BKSD 3ZDTA 3M3JA 1XQQA 1C3TA 1P1AA 5DHAB 1E7VA 5C1ZA 3EECA 4DHZE 3A8QA 4HXDA 1MKEA 3TMPB 4HPMB 1KJTA 4PYZA 2CHZA 5G2NA 3VTUA 2LYDA 2LI5A 4WJQA 5E6PA 4BOZB 2CRFA 4IW0A 2LGDA 4IWOA 5J3TA 4HLEA 4FHKA 3KYCD 4DXAB 4IG7B 2JRIB 2MKRA 1V5TA 1NU2A 3OJ4B 2KLGA 2UZRA 3CSTA 1WZ0A 2XBBC 4HDOA 2GCLA 4B6WA 2YT0A 3WA0A 1BAKA 2RNRB 3QWMA 5CHWA 2EMTA 3VUWA 2GBNA 4C0AA 1UNRA 3T8MA 1UH6A 2WDTB 2YSZA 1S3SG 3VTVA 2DKQA 1WR6E 1Z2MA 1KI1B 3V6EB 5CHVC 3ZW3A 3KZ1A 2IBIB 2K39A 1RRBA 2CKHB 1QQGA 5JHBA 3VHTC 1SGHA 1H4RA 4ZRIA 4Y94A 2B3AA 3PS6A 2K6DB 2KCJA 3VUXA 3TVVA 3PHXB 4ANWA 3L16A 2LRUA 4MELA 3ML8A 1WM3A 1YIWA 3HM3A 1LB1A 5HE3A 3DBHI 2XEWA 1WMHA 2HTHA 4G3XB 3SDLC 3H9DA 2HE7A 2ROVA 2DAJA 5BO4B 2Q13A 2KLCA 2PPHA 4BVUC 4ASWC 2LG1A 2JWZA 3SD5A 3FEHA 3ZUNA 1GUAB 4FHJA 3RD2A 1WE7A 1NDDA 5C79A 3VH4B 1Y19B 2KDBA 3N7CA 2ADZA 4W9JA 4F1SA 3VFKA 4IM2A 2NCNA 3ZRFA 4BBNF 4DBGA 3B1LX 1K5GB 2C7MB 2BYVE 4GPTB 1UEFA 4G11A 3O65B 2ZVNA 2PZ1A 3RUIB 1E8XA 2RQ1A 4KVGB 3IBEA 4PQ0A 3PLUA 2DHKA 4XC2A 3MDBC 2JZ3B 4BBNC 1YX5B 2W2XC 2O2VA 2LBBA 2ZCCA 2L05A 3KSYA 4BBKA 3L10B 1WXAA 2BKFA 3ULCA 1PFJA 2WX1A 4DHZB 2X18A 4ZYNA 2IYBA 2Z0EB 3SYXA 1XX0A 1WX9A 3KY9A 2KOXA 3A33B 3SHQA 1P6SA 2GMIC 3DVNV 4HB2B 3X23A 5DIFB 2QHOA 3T06A 3PZDA 4IAPA 3D8EA 4ANUA 2IZVB 2NS5A 5D3YA 2LRWA 2AYOB 1P9DU 4GDKB 2KMCA 4TQ0A 2K8HA 2COCA 4D0NB 1GNUA 3PRPB 4PYUA 3QJZA 1J0GA 3D8DA 5J3YA 2ZNVC 4E71A 3M62B 3PSEB 3HIZA 2K1FA 2L00B 4FADA 2CU1A 3WAMA 3FP5A 3P2BA 2K8BA 4HCNB 3PG7A 2KDIA 5DI9B 1R4MI 2W9NA 4IFSA 1HB8A 2BYFA 3QC8B 2AL3A 5J18A 3PVWA 2M0XA 1Y5OA 1DYNA 2FJLA 2PE9A 3EHVA 1U5DA 2IO2B 4TUUA 2KX0A 3ZLZA 3BY4B 1BTNA 2MDXA 3VIAA 3H6NA 2LVPA 1BTKA 4TQ1A 1WI0A 4MGKE 3Q3JA 2W2WA 2GBJA 4HDQA 4EKUA 1WGRA 2WWZA 1MG8A 2ZNVB 5LXIB 1S1QB 2DYBA 2IY0B 2XK5A 4NPNA 4MDKE 3MPXA 2IYDB 2KANA 1DROA 4K2PA 2BGFA 2GS0A 1WGGA 2OJRA 1P0RA 5JZEB 4W9GA 2KTRA 1GC7A 1EAZA 2KTFA 1IPGA 3QK0A 1LW3A 4I6NB 1EF1A 3CF6E 3PEGA 1BWNA 3QA8A 3SNHA 4YL8A 2V3SA 3L54A 2NPTA 3LDZE 1OMWA 2MLBA 3C0RB 1OQYA 1QZEA 1ZGUB 4ZRKA 3QX1A 3HM6X 1YQBA 3A1QA 5DPSA 4WWPA 2WX0A 1L7YA 4RM8A 3F5RA 1NBFC 3F0WA 3DQVA 2KJHB 1ZVRA 1BT0A 1Q5WB 1U4AA 3NSUA 2LOXA 2G3QB 2KWCA 1VCBA 3DBLI 4E3CA 3PRZA 1KM7A 4HAYB 3L0WB 2FDQA 4KHBB 5KQ1A 1GG3A 2UVMA 2G45B 4DK5A 1L2NA 4HB3B 2KQ7A 4F7ZA 1WGUA 2M4NA 5CHFA 2Z0PA 3UINB 4WJOA 1V6EA 2Y7BA 4KHOA 4B95A 5C16A 4X57B 1LQBA 4DHJD 3R7RA 1AQCA 2MBQA 4CHJA 2ZPNA 2KWVB 2L0FA 5JHAA 5D6JB 1NTVA 2D10A 3QCAA 2MFQA 2CY4A 2KUPA 2R2OA 2HRJA 2L2IA 2L7RA 4CYEA 4GMXB 4IM3A 1DDMA 4IWQA 5C6RA 1EVHA 1J19A 4K17A 4II2B 2LVQA 4GU2A 4XX5A 2LOZA 4EZKA 1WG7A 1MK9B 3JYUA 4W9CA 1E8WA 4ANVA 1I7AA 2K25A 4II3B 3V5WA 2KXJA 1WJNA 2D11A 3P7ZA 4IC7B 2Y8GA 2GBKA 2KDFB 2ABDA 2Z0QA 1X1MA 5HE2A 3DXEA 1AWEA 5DCNA 4W9LA 1Q67A 4FJYA 1P3QU 2XQNM 5CTRC 3AU4A 2PJHA 3R3MA 2KKCA 1OQNA 5KCVA 1W1GA 1WJUA 1X11A 3QWZB 5JHGA 1M94A 1U5EA 2MWNB 2EC1A 1F9JA 1XT9B 3DXDA 4AWJA 3WIMA 3PSCA 3QBVB 2FCMA 1WR1A 4KZ0A 1OEYA 2NBVB 4GXBA 1MIZB 2ZVOA 1SIFA 3RCPA 4IUMB 3WYFB 1EF5A 4A6FA 1WJ1A 2V4LA 3R7QA 3HHMA 3PVLA 1WIAA 3VDZA 1FHOA 3SU8X 1XD3B 2KC1A 3SV1A 1RRPB 4CO7A 2N7EA 4HCPB 3RZFA 4FJVB 2DTCA 2KHWB 4KDIC 4RMAA 2H7DA 5D2MB 4MGYE 1FHWA 4GOCA 4DHJB 1FOEA 2N4FA 1QC6A 1UZXB 1WJ4A 4EMOA 1IYFA 4HAUB 1V88A 4EUTA 1YX6B 1ZKHA 1N3HA 3RULA 4MK0A 2C9WB 3CSFA 2C7NB 4WJ7A 2KTRB 2L8JA 1OTRB 3ZNZB 2PE6B 4B9KA 4GDLA 2YT1A 1RAXA 1H10A 2LWPA 3UIOB 3W1SA 3H7PA 2NPTB 1LXDA 1KLVA 3VH3B 3D32A 3VXWA 3KRXA 4XWXA 3A1QB 3KUCB 2M38A 3A9KB 5J17A 1WXMA 2D9YA 2DX5A 4FJZA 3OAWA 4ICVA 3U30A 4I6PA 2COPA 3WALA 4LDTD 2CODA 2M14A 2RSGA 3SO6A 2ZCBA 4YONA 4JQWC 4M0WB 2ROZB 3Q3FA 2YVCA 3FSSA 1DBHA 3IFWB 4DDGD 2KWUB 1WX7A 2O6VA 3JSVA 1X05A 3QAQA 4MGZE 4URKA 1PLSA 2FIFA 3JVZX 1W1HA 2D07B 3QIJA 5GOWB 5JLJB 1UGMA 2L76A 3L08A 3APDA 1WF9A 4W9IA 2RVBB 2YLMA 1IRSA 4W9DA 4ZRJA 5LXHA 1XR0B 3PPAA 3ZIMA 2MBBB 3VQIA 3W1YA 1P5TA 3TO1A 1CMXB 1MK7B 1D3ZA 5D3XA 5JHHA 1T0YA 2M8SA 1M7EA 2MCNB 3LJ3A 3PV1A 2KJ6A 1X1FA 3TIXA 2UZSA 1V5PA 3AXCA 3N32A 4KAXB 4A6HA 4GMVA 4HB4B 3A4SC 4MEMA 2COAA 4A6KA 2GBRA 2GBMA 2A5UA 3ZRCA 1UNPA 4NQLB 1V9JA 4AUQC 4ZDVA 4EJNA 2MBHA 1WJMA 4ANXA 3WAPA 1Z5SB 1KOTA 2IO0B 1V2YA 1PQSA 3M95A 3T9LA 3VTWA 3G9WA 1V5OA 2K2UA 4HJKA 5D7GA 3NZUA 2KJRA 4H8SA 3IVFA 4GB9A 2UWQA 2IFSA 3V6CB 4AJWA 2CHWA 2ZJDA 1X1GA 2VRWB 2O6VD 1ZSQA 4LJOB 4HK2A 4LDTB 4FA6A 3PLVA 5KHOA 1SE9A 1E8YA 3ZVVA 1ACAA 4MY6A 2FIDA 4TKNA 2JVCA 2MRPA 1WVHA 4IWPA 2D4QA 3VUYA 3ML9A 1FXTB 3KUZA 1B55A 2VSZA 2BKRB 2DN6A 4GN1A 4RM9A 3HW2B 1U5FA 4XZ4A 4HB0B 1ZM0A 4W9EA 1P98A 3VOQA 4EFOA 3UGBB 1UELA 1V86A 1VD2A 2ELBA 4GSWA 3UIPB 1JRUA 5L83A 3A9JA 1V81A 3N30A 4TYZA 3OJ3A 2MP2A 2IY1B 3KH0A 1HE8A 2BF8B 2V1YA 1J0WA 4JLCA 1WGHA 4DBBA 1E7UA 1MIXA 2H7EA 2G4DB 1HBKA 1KZGA 1NTIA 4LJPB 4GDLB 3ODWA 4WJNA 4GIVA 3CXBB 3CMMB 5IA7A 3APFA 1RJ2A 1WMHB 1U27A 2HTHB 3ZVRA 2MBOA 2CY5A 3H7PB 4M8MA 5E6NA 1P3RA 2FCNA 3NOBA 3IHPC 1WX8A 3DBRI 1C1YB 3FM8C 4BKSA 2VKIA 3S2AA 2DX5B 4PS3A 3L13A 3LJUX 2NBUA 1WRDB 2WH5A 2KX3A 2ZPYA 5CX3A 2J7QB 5JP4A 1UNQA 3PP2A 3ODOA 2FCQA 1I35A 2OTXA 1IP9A 3UQBA 1XKEA 1LFDA 2BWES 2EMSA 3EFUA 3PHWB 4AOFA 4HWIB 2O6VB 2KZRA 2LXAA 3M63B 4G50A 4MJSA 1E5WA 3KVFB 3D8FA 1OY2A 2NZ8B 4F8CB 2LGXA 1FB8A 2ELAA 3NY5A 3ZNHB 3ZNID 3ODXA 1V49A 4CHKA 3TCAA 2O2VB 4EZJA 5AZHA 2KN5A 5EFXA 1YD8U 4MGIE 5HE0A 2I1KA 3AJ4A 3KRWA 2QKMA 5LONB 3H7SA 2DZMA 2LD9A 1H8CA 3APCA 5G55A 5AEKB 5L81A 1M7RA 3MTNB 2RUKB 3GOEA 1FGYA 4J6IA 4DX8A 1MAIA 4WSFA 3PTFC 4HVBA 2LVOA 3DCGA 5AZGA 4I6LB 2RPQA 2CQUA 3PREA 1W1DA 2Z0DB 3R66C 2CB8A 3OANA 2K8CA 2D2QA 1WYWB 4OVUA 2KGXB 5IAAC 5C5BA 3O96A 1XD4A 2LGYA 1XCGA 2G4SA 1DDVA 4MSMB 3X0WA 1WI1A 2N23A 2D9VA 4Z2NA 3RT3B 3TFMA 1WY8A 1TZ1A 3KYDD 1RFAA 4KZCA 4K1RB 4MSQB 4NQKE 3ZDMC 2LULA 5D94A 4NSWA 4F7HA 3OLMD 3A98B 2J0KA 4TV3A 4ICUA 4PS8A 5FR6A 2C60A 2DZKA 4KIKA 3DDCB 4F7GA 2DYNA 3KW5B 1TQZA 1NTYA 2MX2A 4MH0E 3DBSA 2N9XA 3A4RA 4WWOA 2REXA 4NY0A 4GGQA 3A8PA 2DYOA 2DFKA 4FULA 1ST7A 2LUEA 1G6JA 3DVGY 2N1WA 3GZNI 2NBWB 3QARA 2XK5B 4HHVA 1KZ7A 2P0HA 4MT7A 2DZIA 4NAWA 1EGXA 2GOWA 4WWNA 4NJ7A 3VAWA 2QKLA 3H1UA 4K81A 2DHJA 4N9F4 3TW1A 5IJMA 2R2QA 1U5GA 2MBEA 2KFKA 4JGHB 3WAOA 3SUZA 3HQCA 3UZTA 2WYQA 3HK0A 3A9JB 3DPDA 1Q0WB 4JL9A 4AP4C 4Z2MB 2M1MA 4W9KA 4DX90 3AI5A 3ZTCA 1UD7A 2MP2B 2N0YA 2K00A
chains in the Genus database with same CATH superfamily
3P6AA 2Z59B 5DPTA 1FM0D 1R4NI 3I3TB 4MM3A 4A20A 1FMAD 2K8EA 3OWEB 2MW5A 2W2XD 3L17A 3AU5A 2Y5BB 3W9CB 4KKIA 2Z8LA 1MI1A 3QQ8B 5FI0A 4W9FA 1SHCA 3ML4A 5IP4D 4P7IA 1V1PA 2OOBB 3RNAC 3ECIA 2KD0A 4M8NA 2IDYA 1TBEA 3NZSA 2E2XA 3DHIC 1DOXA 2CAYA 2KQSA 2DX1A 1ZXHA 1WJ6A 2GLSA 3B08A 1TJ6A 1ROEA 2J0JA 2RD0A 2JF5A 2FAZA 4DXFA 5E6OA 3Q3OC 4JKHA 3V62A 2P0DA 1Y56A 4ARCA 1MHXA 2Y8FA 3FLVA 5LOPB 1JRPA 2JUOA 1I2HA 3IG3A 4KV2A 3ENEA 4C7YA 2PVGC 1FAOA 1TY2A 2R09A 2IO1B 2KDEB 3DWGC 3PT2B 5IRSA 1V5UA 1I42A 3NUHB 1RLFA 5I2MA 4HJGE 5HHDG 1N5WA 5DPWA 2JP2A 3ABVB 2KMAA 2GRIA 1MPHA 4WAAA 3ULBA 2AWTA 2WXFA 2BCJA 2RGNB 1QLBB 1FGZA 2WXLA 3AULA 1XODA 3PGEA 2RLOA 2HJ8A 4FXCA 1MPEA 3UQAA 5J2RA 4MJSB 4WVFB 1WGDA 1WXQA 2C5LC 2JX5A 5AZFA 2WXQA 3L4PA 1K8RB 2RSUA 3V61A 2YS3A 2RR9A 2WXRA 3RZWC 1OQRA 1OGWA 1SEBD 5HI1A 3CIKA 2EKEC 4GOUA 2DLWA 1UBQA 2UYZB 5BMGA 2D3GA 1OEYJ 1VLBA 2WDRB 4NJ6A 5CLLB 3NS8A 4KX6B 3EGRA 1TXDA 2QC8A 2NMBA 1JWMD 4C4VA 4HSIA 3ZTDA 2LASA 3ZNGC 3P42A 4KHAA 4RH6A 4ZHPA 2C7HA 5TR5A 1PMSA 4LTUA 3MJWA 2PVOD 1DDWA 1UWXA 1FO4A 2VH2A 2KUQA 2RGFA 2DENB 2KFJA 2KAJA 2HD5B 2ON8A 1V89A 3KLSX 2AQ3B 4DWFA 3K9PB 4AJYB 2JRHA 4EEWA 4HAZB 3VR8B 3OHMB 4EOYA 2BWFA 1YJ1A 3M1IB 4IOYX 5CLQB 2KACA 2N7DA 2QILA 1T5XD 2LJIA 1GC6A 4YWGG 4YXDB 3MHSD 5HKHA 1C4AA 2MQJA 1CZPA 3AEBB 4HAXB 4CHMA 2JYEA 3NWFA 1TTNA 1A5RA 1ZDXA 1L0XB 4FN2A 1WZ3A 3AE9B 2CR5A 4HAWB 5C5BB 3H8HA 1WWTA 2A4ZA 1FEHA 3PRMB 3ALBA 4B6HA 1Z87A 3ONSA 3RYTA 1U2BA 4KSKC 5KQ4A 3K9OB 1YN5A 3RNFC 2D9XA 1TKGA 4YTMB 4US9A 1WXVA 4HAVB 2V0GA 4KSLC 4NZLB 2Z4DA 3BJIA 5G5HA 1E90A 3DVGX 1JWUD 5BYSA 4BKTA 4K7WA 3ZKJC 3BINA 2LJ5A 2DZJA 1KF6B 3FILB 2YRYA 3ZJVA 4E74A 2GI9A 2KVRA 4FBJB 2BB6A 2AL6A 2MA9B 2EJ8A 2K2JA 4KIKB 3UF8A 3AEEB 4JIOU 4DIXA 2N9EB 1SE2A 3VVWB 2RDHA 3DHHC 4M01A 4ZRPA 2CHXA 3RCZA 1GJZA 2DHIA 3TJPA 4A6FB 1IUEA 4MH8A 4QJ5B 1MVKA 2L0TA 2JXXA 2LXCA 5L95C 2V76A 2KK8A 5FI1A 2YS1A 2DAFA 4N58A 2Z0OA 1V5MA 3W1SC 4A5KA 2D9ZA 1TGZB 1NI2A 3N20C 2I5CA 2IO3B 4B0MA 2L1CA 4K2OA 2QDFA 2I5FA 4JK7A 4PS7A 2BVCA 4QAYA 2R0DA 1WXSA 1MFWA 5T8IA 4H2AA 3AECB 2INNE 4BOSC 2X8XX 4RF1A 1WFYA 4FLHA 2LZ6A 4NAWB 2WLBA 3WANA 3GE3C 1HA5A 5IN7A 2J4XA 2LHDA 4IDIA 2J59M 4PNKA 4LCDE 1JALA 2LEKA 1UPRA 4L6EA 3RNBC 4WJPA 2MJ3A 3GZNB 2COFA 2KFKB 2M17A 2KO3A 3U7ZA 1ENFA 3KUDB 1ZE3D 2MSED 2K6QA 3B0AA 3U8ZA 1FPYA 2NR2A 2P8VA 2DYQA 3E9OA 2VRRB 2I2YA 4A3OA 2DHZA 3GYPA 1FXAA 4G0NB 2OQBA 2ASQA 1Y8RC 2N9PC 2FNJB 2YS5A 2YEPF 1VDVA 3BZDB 1WH3A 4MM3B 1ZC3B 2FUHB 3PVUA 5I4DA 2LKOA 1TJEA 2LMCA 1AN8A 3DXCA 2WXIA 1LM8B 2YT2A 3GYOA 4OVVA 5DPRA 2X0SA 2JZPA 1WE6A 3QHTA 1I4RA 1V1PB 3AE2B 3NVVA 5HG2A 1V61A 5D27A 4NNJB 3A9KA 4L23A 3E9LA 1R4NB 1V80A 1ISNA 3BVMA 3GE8C 1N5XA 1EO6A 5GXGB 3I5JC 2Y5PA 2E3TA 4HROA 3T3OA 4UDUC 5FR3A 2I1JA 2BPSA 2JY6A 3AE5B 3N3KB 5E6JA 1GGOA 1HB6A 3DBHB 4OT1A 2FJ9A 2DKPA 4A3PA 2OHFA 2JT4B 1TYGB 4JX1C 4ILJA 1WGYA 3TBLD 1X86A 2NVUI 2J42A 1FNWA 1ZC4B 2G35A 2ZZPB 2GJYA 4M00A 3JSVB 3EC8A 1AARA 4WQOB 1U29A 4K7UA 1D5MC 3UI3A 5KHQA 2DYMA 4BKGA 4W9HA 2P0FA 1P7FA 2WHIA 4HPPA 1NVLA 3DOWA 3ZGZA 3JW0X 2CS4A 2JZZA 2QEJC 1YQ3B 1IBXA 2PEAA 1WGQA 2D3BA 5LLIA 3TUOA 1EUVB 1MI0A 5D3DA 3Q8BA 5JH5C 1T0QC 3EPYA 2MWSB 2DA0A 3I63C 3DVNU 1B9RA 4R3DA 3NHEB 5C23A 1Q1OA 4JWSC 2KYWA 5D3VA 1J8CA 1DOYA 4DDID 1K5DB 1WGKA 2YEPB 4BFRA 5DHFB 2ZEQA 5D3WA 2JPHA 4EZLA 3Q8AA 1FHXA 1JCKB 4PK1A 2D9WA 2N7JA 2AEHA 1WM2A 2R61A 5GMVA 3ZYYX 1UBIA 3NWAA 1UPQA 1ZW7A 1PDXA 4IM0A 1D4BA 1AYFA 2QCZA 1PGXA 3EFCA 4KDLB 1N63A 2GCJA 4C4VB 3ZO5B 5EDSA 2BS4B 2KC2A 4O1NA 3SFDB 3U7DA 3MP9A 1XF5L 5HE1A 3E9PA 3V60A 2KMMA 2W3SA 5J3QA 1FXIA 2BYEA 1E8ZA 4WIPA 2KNBA 4HATB 4HPLB 2L3ZA 4GZUA 2N1VA 2FCSA 2J0MA 2QSDA 1PFDA 2YF0A 2L52A 4K7SA 4JPSA 1K52A 4GDKA 5C2TB 2MH7A 2V3NA 5DH9B 4F7UP 1Q10A 3TL5A 3ZDTA 3MC0B 3M3JA 1XQQA 1F77A 2I38A 1C3TA 1VR9A 1SF0A 3B2FA 1SJED 1P1AA 5DHAB 2BT6A 1E7VA 1K51A 4NJCA 3EECA 4DHZE 5C1ZA 3A8QA 4HXDA 1MKEA 3TMPB 4HPMB 1KJTA 1PUTA 2AQ2B 4PYZA 3HVZA 2CHZA 5G2NA 3NW8A 3VTUA 2LYDA 4ZHOA 2LI5A 4XYCA 4WJQA 1BMLC 5E6PA 1UGJA 2CRFA 4BOZB 4IW0A 2LGDA 1FRRA 2IGGA 4HRSA 1PYWD 3HSAA 4IWOA 5J3TA 2LHEA 4HLEA 4LNKA 4FHKA 1QKZA 4XE0A 4WAFA 1SSNA 3KYCD 4DXAB 4IG7B 5IKCM 2ZKMX 2X38A 2JRIB 2WXJA 2D5GA 3BK1A 2MKRA 1QOGA 1QOFA 2G9HD 1V5TA 1NU2A 3OJ4B 1KLGD 2UZRA 2KLGA 3CSTA 4A90A 1WZ0A 2XBBC 4HDOA 2GCLA 1V1OA 4B6WA 1BUIC 2YT0A 3WA0A 4XGAB 1BAKA 2RNRB 4L1BA 3P4PB 3QWMA 5JXVA 2FJUB 2LGIA 2WU2B 3BWUD 1V8CA 5CHWA 2EMTA 1YQ4B 3VUWA 4RFBA 2GBNA 4C0AA 1ESFA 1UNRA 3T8MA 1UH6A 2WDTB 1EU4A 2YSZA 1S3SG 4K3BA 4ZOHC 1XCQL 2HJ1A 1MHHE 4ITKA 1L4ZB 3IAM1 3VTVA 2DKQA 1WR6E 1Z2MA 1YJIA 3RN9C 1KI1B 1LGRA 3V6EB 4S17A 5CHVC 3ZW3A 3KZ1A 4JKEA 2IBIB 4OZAA 2K39A 1RRBA 2CKHB 1XLPA 1C76A 1QQGA 2V3PA 5JHBA 3VHTC 1JROA 1SGHA 3U52E 1D5ZC 2DIKA 2RDGA 1H4RA 4ZRIA 4Y94A 2B3AA 3PS6A 2K6DB 1CQVA 4P16A 2KCJA 1OQQA 3Q14C 3VUXA 3TVVA 3PHXB 4ANWA 3L16A 1NYQA 2OEDA 2LRUA 4MELA 2L1AA 1NENB 3ML8A 1WM3A 1J7AA 1TS2A 1J7BA 1YIWA 3HM3A 5JVLA 4XDDA 1LB1A 5HE3A 3DBHI 3PO0A 2XEWA 1WMHA 2HTHA 4G3XB 1VBHA 2V4IB 3SDLC 3H9DA 2HE7A 2ROVA 5IO9A 2DAJA 2KN4A 3TEWA 5BO4B 2Q13A 2KLCA 2PPHA 3MC8A 4BVUC 4ASWC 2KT7A 2DLBA 2LUMA 2CU3A 2LG1A 2JWZA 3SD5A 3AE7B 1IGCA 4AS1A 3FEHA 3ZUNA 1GUAB 2WXHA 4FHJA 3RD2A 1WE7A 1NDDA 1T0RC 4P6VF 5C79A 3SBTA 3VH4B 4A9AA 3E9SA 1Y19B 2KDBA 4KHBA 3N7CA 2ADZA 3HUIA 4W9JA 4F1SA 3W2DA 3C8YA 3VFKA 4IM2A 2NCNA 5BYQA 4NAMA 3ZRFA 2GUMA 3P4RB 4BBNF 4DBGA 3B1LX 1K5GB 2C7MB 2BYVE 4LNOA 5FK9C 4GPTB 1F1HA 1UEFA 4G11A 3U2SC 1E6EB 3O65B 2ZVNA 2PZ1A 3IT6B 1TIFA 1WSPA 3RUIB 1E8XA 5TSSA 3TEYA 1AW7A 1BXTA 2RQ1A 4KVGB 1T77A 1F2RI 3IBEA 4PQ0A 4JKGA 3PLUA 3DBLB 2DHKA 1HQRD 3MDBC 4XC2A 1JQ4A 2JZ3B 2PKOA 5BMHA 4BBNC 3I57A 1ZYIA 1YX5B 1QOAA 2W2XC 2O2VA 1C78A 2LBBA 2ZCCA 1JDEA 2L05A 2FBWB 2B76B 3KSYA 4BBKA 3L10B 3RFZB 1WXAA 1WRIA 2BKFA 3TEXA 3ULCA 1PFJA 2WX1A 4DHZB 2X18A 3Q6BA 4ZYNA 2IYBA 2Z0EB 3SYXA 1XX0A 3E66A 1WX9A 5AUKA 3KY9A 2KOXA 3A33B 3SHQA 1P6SA 2GMIC 3Q8EA 3DVNV 1UWMA 4HB2B 2RMMA 1PGAA 2D3AA 3X23A 2J52A 5DIFB 2QHOA 3T06A 3PZDA 4IAPA 3D8EA 2K0PA 4ANUA 3ETRA 2IZVB 4BZAA 5BMIA 2NS5A 1RWSA 1XEEA 2HDEA 1E0ZA 5D3YA 2LRWA 2AYOB 1L5PA 4CQNA 1FIQA 1P9DU 4GDKB 2KMCA 3AE8B 2W55A 4TQ0A 2K8HA 2Z14A 2COCA 4D0NB 1GNUA 3PRPB 4REZA 4PYUA 3QJZA 1J0GA 3WCQA 1K53A 4JK9A 3D8DA 2W54A 1JMLA 1SE4A 5J3YA 2ZNVC 4E71A 4DXGA 1C9FA 3M62B 3AEAB 3PSEB 3HIZA 2K1FA 2N0SB 3LYYA 2L00B 4MACA 4FADA 2CU1A 3WAMA 3FP5A 3TSSA 3P2BA 2K8BA 4HCNB 3PG7A 2KDIA 5DI9B 1R4MI 1XLQA 2W9NA 2NBVA 4IFSA 1HB8A 2BYFA 3QC8B 2AL3A 5J18A 3PVWA 2M0XA 1Y5OA 1DYNA 2FJLA 2PE9A 1L6VA 3EHVA 2R2YA 1U5DA 2IO2B 4TUUA 4HKQA 2KX0A 3ZLZA 3BY4B 2EELA 2R82A 1BTNA 2MDXA 3R2TA 3VIAA 3H6NA 2LVPA 1BTKA 1XO3A 4TQ1A 1WI0A 4KGRA 3Q3JA 1J7CA 1ZXIA 4MGKE 1ZP0B 2W2WA 2GBJA 4OZBA 3RNGC 2KDMA 4HDQA 4EKUA 1WGRA 2WWZA 1MG8A 2ZNVB 5LXIB 1S1QB 2DYBA 2KIEA 2IY0B 2XK5A 4NPNA 4MDKE 1L6UA 1TS4A 2K9XA 3RNEC 3AM9A 3MPXA 2IYDB 1KFYB 2KANA 1YOVB 1DROA 5HFYA 3RPFC 4K2PA 2BGFA 2N9KA 4BKSD 2GS0A 1WGGA 2OJRA 3Q3NC 1P0RA 5JZEB 4XDCA 4W9GA 2QIEB 3MJ5A 3NRZA 2KTRA 1KBLA 1GC7A 1EAZA 2KTFA 1N61A 1IPGA 2BS2B 4JK8A 1LW3A 3QK0A 4I6NB 1EF1A 3CF6E 4C00A 1F52A 3PEGA 1BWNA 3QA8A 3SNHA 2JQRB 2Z59A 4YL8A 5EE3A 2V3SA 3L54A 2NPTA 3LDZE 1OMWA 2MLBA 2W82A 3C0RB 1OQYA 1QZEA 1ZGUB 3SFEB 1UNSA 4ZRKA 3AMZA 1TZOA 3QX1A 3HM6X 1YQBA 2K22A 3A1QA 2BBCA 2H88B 3B2GA 5DPSA 2MJEA 4WWPA 2WX0A 2TSSA 1L7YA 5H92C 4RM8A 3FC4A 5MPOA 2INPE 3F5RA 1NBFC 2ZW1A 2K49A 3F0WA 1CK1A 3DQVA 1TS5A 2KJHB 2PIAA 1ZVRA 1BT0A 1EWCA 1Q5WB 1U4AA 3NSUA 4M0WA 3HVDA 2LOXA 2G3QB 2JU6X 2KWCA 1VCBA 4IOIE 3N1YC 3DBLI 4E3CA 2VH1A 3PRZA 2V9HA 1KM7A 4HAYB 3L0WB 2FDQA 4KHBB 5KQ1A 3V05A 1GG3A 2UVMA 2VZKD 4EE2A 2G45B 4DK5A 1L2NA 3W5UB 2ICIA 1DIKA 1C79A 4HB3B 4GNKB 2NTTA 1VRAB 3P63A 3I9V1 2KQ7A 4F7ZA 1WGUA 4WURA 2M4NA 5CHFA 3PZ8A 2Z0PA 1TKYA 3UINB 4WJOA 1V6EA 2Y7BA 4RGTA 4KHOA 1D5XC 4RGOS 4B95A 5C16A 4JKGB 4X57B 2MHJA 1LQBA 4DHJD 3R7RA 1AQCA 4WWMA 2MBQA 5G5GA 3CWIA 5BYRA 4CHJA 1NYRA 2LGSA 2JSVX 2KVZA 2ZPNA 2KWVB 2L0FA 4Q2JA 2NMQA 5JHAA 3BVZA 3N1ZC 5D6JB 1NTVA 2D10A 3QCAA 2MFQA 3HRDD 4M02A 2CJOA 2CY4A 2KUPA 2R2OA 3VR9B 2HRJA 2L2IA 2L7RA 2PMVA 4CYEA 4GMXB 1GAQB 4IM3A 1A70A 1DDMA 4BAXA 4IWQA 4QJ4B 5C6RA 4QXAB 2MJDA 1EVHA 1J19A 4K17A 4II2B 3MC9A 1I4GA 2LVQA 4GU2A 3GB1A 2BTEA 3NVZA 4XX5A 2LOZA 4EZKA 1CJEA 1WG7A 1MK9B 4JKFA 3JYUA 4ILHA 4W9CA 1E8WA 4ANVA 1I7AA 2K25A 4L1RA 4II3B 3V5WA 2KXJA 2H89B 3V3XA 1WJNA 2D11A 3P7ZA 3ZJTA 4IC7B 2Y8GA 2GBKA 3VRBB 2RRFA 2KDFB 2ABDA 2ONQA 2Z0QA 1X1MA 5HE2A 3SEBA 3DXEA 1AWEA 5DCNA 4W9LA 1Q67A 4FJYA 1P3QU 4RCOA 3AEFB 1YN4A 4CSQA 3ZJUA 2XQNM 5CTRC 1GOZA 3AU4A 2JWUA 2PJHA 4YTNB 1VJKA 1T6BX 4RGMA 3R3MA 2KKCA 4GLSC 1OQNA 5KCVA 4ACFA 1W1GA 1WJUA 1X11A 3QWZB 2WDQB 5JHGA 2INCC 2K5PA 1M94A 1U5EA 2MWNB 4LNNA 2EC1A 1F9JA 1XT9B 3DXDA 4AWJA 3WIMA 3PSCA 1ET6A 1YJJA 3QBVB 2LFIA 2UU7A 2FCMA 2ZW0A 2L83A 1WR1A 4KZ0A 1YMHE 4P1BC 4US8A 1OEYA 1C4PA 2KWDA 2OJWA 2WGSA 2NBVB 5AUIA 4D6WA 4GXBA 3Q8FA 3C19A 3P4QB 1MIZB 1LO5D 2ZVOA 2FE8A 1SIFA 3RCPA 4IUMB 4LNFA 3WYFB 1JWAD 1EF5A 2VZKB 1VZ7A 4A55A 4A6FA 1ZUD2 1WJ1A 4ZRQA 4N59A 2V4LA 2KIGA 4ZYSA 2DNFA 3R7QA 3HHMA 1VBGA 3PVLA 1R4MB 1FCLA 1WIAA 3VDZA 1VZ8A 1FHOA 3SU8X 3AH7A 4YSYB 1XD3B 3NJTA 2KC1A 2IGHA 1HZ5A 3SV1A 1RRPB 1FRDA 4CO7A 2Y3AA 1YNTE 2N7EA 4HCPB 3RZFA 2JYTA 1SB3C 4FJVB 2DTCA 1FCCC 1KLUD 2KHWB 4KDIC 4RMAA 2H7DA 5D2MB 4MGYE 1FHWA 1HTOA 4GOCA 3EUB2 2JXTA 4DHJB 1FOEA 2N4FA 1QC6A 1UZXB 1WJ4A 1XLOA 4WQMA 4ARIA 4EMOA 1IYFA 2WXGA 4HAUB 2Z13A 1V88A 4EUTA 1UUPA 1YX6B 1ZKHA 4A8XC 1N3HA 3RULA 4MK0A 2C9WB 3CSFA 2C7NB 4N6EB 4WJ7A 2KTRB 4C80A 2L8JA 2KQ4X 1F0ZA 1OTRB 1FNUA 1KH0A 3ZNZB 2WDVB 2PE6B 4B9KA 4GDLA 3U4EG 2YT1A 1RAXA 1H10A 1HEZE 3NVWA 2LWPA 2DBYA 3UIOB 3W1SA 3H7PA 2NPTB 1LXDA 1KLVA 4LLGM 3VH3B 3D32A 3VXWA 3KRXA 4XWXA 3A1QB 3KUCB 1N62A 2M38A 3A9KB 5J17A 1WXMA 4S0RA 2D9YA 1GB1A 2DX5A 4FJZA 3OAWA 3R8BA 4ICVA 3U30A 4I6PA 2COPA 3NVYA 3WALA 3DCXA 4LDTD 2CODA 1EM7A 2M14A 2RSGA 3OG5A 4RF0A 3SO6A 2ZCBA 4YONA 4JQWC 4M0WB 2ROZB 3Q3FA 5I2SA 2YVCA 3FAHA 3FVCA 3FSSA 1DBHA 3IFWB 5FKAC 4DDGD 2FUG1 2KWUB 3DBRB 1WX7A 3O13A 2O6VA 3JSVA 1X05A 3QAQA 2XNAC 4MGZE 1PLSA 4URKA 4JKDA 2FIFA 3JVZX 2BS3B 1W1HA 2BW2A 1IBXB 2D07B 3QIJA 5GOWB 5JLJB 1UGMA 4YSXB 2L76A 3L08A 4JWUC 3APDA 1WF9A 4W9IA 5LG4B 2RVBB 5M4YB 2YLMA 1IRSA 2KR0A 4W9DA 1I4QA 1HTQA 3ZXVA 5D3IB 3P4SB 4ZRJA 2CJNA 3LXFA 5LXHA 1DYQA 1XR0B 3PPAA 3ZIMA 4B0EA 2MBBB 3RNCC 3CIRB 4KKJA 3VQIA 1P5TA 3TO1A 3W1YA 1CMXB 1MK7B 1D3ZA 3AEGB 3BYTB 5EE1A 5D3XA 5JHHA 1T0YA 2M8SA 1M7EA 2MCNB 1FFVA 3LJ3A 3PV1A 2KJ6A 2INDC 3DHGC 1X1FA 1I7HA 3TIXA 2UZSA 1V5PA 3AXCA 3N32A 3FKYA 4KAXB 4A6HA 4RNAA 4GMVA 4HB4B 3A4SC 4MEMA 2WXOA 2PW9A 4QJ3B 2COAA 4A6KA 2GBRA 2IJ0A 1SXTA 2GBMA 2A5UA 3IXSA 3ZRCA 1UNPA 4NQLB 1V9JA 1STEA 4AUQC 4ZDVA 2WXPA 3W5VB 4EJNA 2MBHA 3ZXRA 1WJMA 4ANXA 3WAPA 1Z5SB 2WU5B 2XN9C 1B1ZA 3URYA 1KOTA 2IO0B 1V2YA 4P1CC 1PQSA 3M95A 2ACZB 3T9LA 3VTWA 4JKAA 2GB1A 3IAS1 3G9WA 1V5OA 2K2UA 1SJHD 3Q3MC 5H8YE 3AB5A 2IGDA 1TT5B 2QJLA 3HIEA 4XWTA 4HJKA 5D7GA 3J9CA 1QT9A 3NZUA 2KJRA 4H8SA 3PZ7A 4C56C 3BK2A 1QF6A 1NEKB 1GPXA 3IVFA 1MJDA 4GB9A 2UWQA 2IFSA 2WXNA 3Q8CA 3V6CB 1ZPSA 4AJWA 4MT5A 2CHWA 2ZJDA 3N1XC 1X1GA 2VRWB 3RI7C 2O6VD 1ZSQA 2NTSA 4LJOB 4HK2A 2W3RA 4LDTB 4FA6A 3PLVA 5KHOA 1SE9A 1E8YA 4RGNA 3ZVVA 2MEKA 1ACAA 4MY6A 3Q2AC 4KGSA 2FIDA 4TKNA 2JVCA 2MRPA 1SIJA 1WVHA 4IWPA 2D4QA 4JKCA 3VUYA 3ML9A 1JWBD 1FXTB 3KUZA 3A58A 1B55A 2VSZA 2BKRB 3SBGA 2DN6A 4GN1A 4RM9A 3ZQ4A 4WH4A 3HW2B 3AEDB 1TY0A 1U5FA 2AX5A 2WP9B 4XZ4A 4HB0B 2IPKD 5C3JB 1ZM0A 4W9EA 1XCTL 1P98A 2SEBD 3VOQA 4OVZA 4K3CA 4EFOA 3UGBB 1QQRA 1QILA 2M0AA 1UELA 1V86A 3BVGA 5LNK1 2WXMA 4HKZE 2PLPA 4OZCA 1GB4A 1VD2A 2ELBA 4GSWA 3UIPB 1JRUA 5L83A 4XWWA 1UF0A 3NWDA 3AE1B 4TSSA 3A9JA 1V81A 3N30A 1OFFA 1XLNA 1RYJA 2G1EA 4TYZA 3OJ3A 2MP2A 2IY1B 3KH0A 1HE8A 4DQOC 2BF8B 2V1YA 1J0WA 1C4CA 4JLCA 1WGHA 3IT4B 4DBBA 1E7UA 1MIXA 3AV8A 4J3OD 2H7EA 2G4DB 1HBKA 1KZGA 1NTIA 2N9LA 4LK0M 4LJPB 1ACCA 3U12A 3B77A 1L4DB 4GDLB 3ODWA 4L2YA 4WJNA 4GIVA 3CXBB 3CMMB 5IA7A 1E7PB 3APFA 1RJ2A 1WMHB 1U27A 2HTHB 3ZVRA 2MBOA 2CY5A 3H7PB 1VZ6A 3TEZA 3GP7A 4M8MA 1NI3A 1L0VB 4JKBA 1K50A 5E6NA 1P3RA 2FCNA 3NOBA 2SAKA 3IHPC 1WX8A 3DBRI 1IGDA 2EKIA 1C1YB 3FM8C 1FD6A 4BKSA 1NVID 3KQ4A 1TKEA 2VKIA 3S2AA 1D6EC 2DX5B 2J53A 4PS3A 1KRHA 3L13A 2WQYB 3LJUX 1MG4A 2RPVA 2NBUA 1ZOYB 1F2RC 1HZ6A 1WRDB 2PTLA 3AN1A 2WH5A 2RDBC 2KX3A 2ZPYA 4JE3B 5CX3A 2J7QB 4YT0B 5JP4A 1UNQA 3PP2A 3ODOA 2FCQA 1I35A 2OTXA 1IP9A 1E9MA 1SE3A 3UQBA 3ENBA 1XKEA 1LFDA 1V97A 2BWES 2EMSA 3AE3B 2BB5A 3EFUA 4OHJA 3PHWB 2BQQA 4AOFA 4HWIB 2O6VB 2KZRA 1QOBA 2LXAA 3M63B 4G50A 4MJSA 2E6XA 3T3NA 1E5WA 2WXKA 3KVFB 1EWYC 3D8FA 2BYTA 1OY2A 3KWVA 2NZ8B 3NS1A 3Q69A 4F8CB 2LGXA 4OW0A 1FB8A 2Y5CA 2ELAA 3NY5A 3ZNHB 3ZNID 4YTPB 3ODXA 1V49A 1PGBA 3EA6A 4CHKA 1T3QA 1E10A 1ZDVA 3DWMA 3TCAA 2O2VB 2WS3B 4EZJA 5AZHA 2KN5A 5EFXA 3MHZA 1YD8U 4MGIE 3RMKC 5HE0A 5EE9A 2I1KA 3AJ4A 3KRWA 3BYYB 2QKMA 5LONB 2M19A 3H7SA 2DZMA 2LD9A 1H8CA 3APCA 5G55A 5AEKB 4LNIA 4PT5A 5L81A 1M7RA 4A6QA 3MTNB 1T0SC 2RUKB 3GOEA 1FGYA 1SBBB 3GS2A 4J6IA 4DX8A 1MAIA 4WSFA 3PTFC 1RM6C 4HVBA 1HXYD 2LVOA 3DCGA 1DOIA 5AZGA 4I6LB 2QMTA 3NZ3A 2RPQA 2CQUA 3NG0A 3PREA 3N9YC 1W1DA 1I4HA 2Z0DB 1I4XA 3R66C 2CB8A 3OANA 2K8CA 1FFUA 2D2QA 1WYWB 4OVUA 2KGXB 2M56B 3LB8C 5IAAC 5C5BA 3O96A 1XD4A 1RFKA 4IKGA 2LGYA 1XCGA 4D2KA 2G4SA 1DDVA 4MSMB 1L0YB 3X0WA 1WI1A 2N23A 2D9VA 4Z2NA 4HEA1 1XXGA 3KWLA 1ET9A 3RT3B 3TFMA 1WY8A 2WNMA 1TZ1A 3KYDD 1RFAA 2HTME 4KZCA 4K1RB 4MSQB 4NQKE 3ZDMC 2LULA 5D94A 4NSWA 3FILA 4F7HA 3OLMD 5IOIA 3SR6A 3A98B 2J0KA 3MFGA 4TV3A 4C7ZA 4ICUA 3B9JA 1I4PA 4PS8A 5FR6A 2C60A 3P1MA 2DZKA 4KIKA 3DDCB 3VRAB 4F7GA 2DYNA 5EE0A 2Q5WD 3KW5B 1TQZA 1R7SA 1NTYA 1JW9D 2MX2A 1P7EA 1C77A 4MH0E 3DBSA 1M4VA 2AQ1B 2N9XA 3A4RA 4WWOA 1JWSD 2REXA 4NY0A 1N6ZA 3E56A 3A8PA 4GGQA 2DYOA 2DWQA 4AQ7A 3AE6B 1KC7A 3R2IA 2DFKA 1KTKA 4FULA 1WYGA 1ST7A 1AWDA 2LUEA 4USAA 1G6JA 3DVGY 2N1WA 3GZNI 4OSNA 2NBWB 3QARA 2XK5B 1DGJA 4HHVA 1KZ7A 2P0HA 4MT7A 2DZIA 4NAWA 1EGXA 2GOWA 1N60A 4TMAB 4WWNA 2D3CA 4NJ7A 3VAWA 2QKLA 3H1UA 3AE4B 4K81A 2DHJA 4N9F4 3TW1A 5IJMA 2K3UA 2R2QA 4YSZB 1U5GA 2MBEA 2KFKA 4JGHB 3WAOA 3SUZA 3HQCA 3UZTA 2WYQA 4ILGB 3HK0A 3A9JB 3DPDA 1Q0WB 4JL9A 4AP4C 4Z2MB 2M1MA 4W9KA 4DX90 1TS3A 3AI5A 1FNVA 3ZTCA 1EU3A 1UD7A 2MP2B 2N0YA 4KGTA 1YN3A 3BIID 2K00A 2L32A
chains in the Genus database with same CATH topology
3P6AA 2Z59B 5DPTA 1R4NI 3I3TB 4MM3A 4A20A 2MW5A 2W2XD 3L17A 3AU5A 2Y5BB 3QQ8B 5FI0A 4W9FA 1SHCA 3ML4A 4P7IA 2OOBB 3ECIA 2KD0A 4M8NA 1TBEA 3NZSA 2E2XA 2CAYA 2KQSA 2DX1A 1WJ6A 3B08A 1TJ6A 2J0JA 2RD0A 2JF5A 2FAZA 5E6OA 4JKHA 3V62A 2P0DA 2Y8FA 3FLVA 5LOPB 2JUOA 1I2HA 3IG3A 4KV2A 3ENEA 1FAOA 2IO1B 2R09A 2KDEB 3PT2B 1V5UA 1I42A 1RLFA 5DPWA 2JP2A 2KMAA 1MPHA 4WAAA 3ULBA 2AWTA 2BCJA 2RGNB 1FGZA 3AULA 1XODA 3PGEA 2RLOA 2HJ8A 3UQAA 5J2RA 4MJSB 4WVFB 1WGDA 2C5LC 5AZFA 1K8RB 3V61A 2RSUA 2YS3A 2RR9A 3RZWC 1OGWA 3CIKA 2EKEC 2DLWA 1UBQA 2UYZB 2D3GA 1OEYJ 4NJ6A 5CLLB 3NS8A 1TXDA 2NMBA 3ZTDA 2LASA 3ZNGC 4KHAA 2C7HA 5TR5A 1PMSA 3MJWA 1DDWA 2RGFA 2DENB 2KFJA 2HD5B 1V89A 4DWFA 3K9PB 4AJYB 2JRHA 4EEWA 4HAZB 4EOYA 2BWFA 1YJ1A 3M1IB 4IOYX 5CLQB 2N7DA 1GC6A 3MHSD 5HKHA 2MQJA 4HAXB 4CHMA 1TTNA 1A5RA 4FN2A 1WZ3A 2CR5A 4HAWB 5C5BB 2A4ZA 3PRMB 3ALBA 4B6HA 1Z87A 3ONSA 3RYTA 1U2BA 4KSKC 5KQ4A 3K9OB 2D9XA 1WXVA 4HAVB 4KSLC 3BJIA 1E90A 3DVGX 4BKTA 4K7WA 3ZKJC 3BINA 2LJ5A 2DZJA 2YRYA 4E74A 2KVRA 4FBJB 2AL6A 2MA9B 2EJ8A 2K2JA 4KIKB 3UF8A 4JIOU 2N9EB 3VVWB 2CHXA 3RCZA 1GJZA 2DHIA 3TJPA 4A6FB 2L0TA 2JXXA 2LXCA 5L95C 2V76A 2KK8A 5FI1A 2YS1A 2DAFA 2Z0OA 1V5MA 3W1SC 4A5KA 2D9ZA 1TGZB 1NI2A 2I5CA 2IO3B 2L1CA 4K2OA 2I5FA 4JK7A 4PS7A 2R0DA 1WXSA 4BOSC 1WFYA 4FLHA 2LZ6A 4NAWB 3WANA 2J59M 4PNKA 4LCDE 1UPRA 4L6EA 4WJPA 2COFA 2KFKB 2M17A 2KO3A 3KUDB 2MSED 2K6QA 3B0AA 3U8ZA 2NR2A 2P8VA 2DYQA 3E9OA 2VRRB 4A3OA 2DHZA 3GYPA 4G0NB 2OQBA 2ASQA 1Y8RC 2N9PC 2FNJB 2YS5A 1WH3A 1ZC3B 2FUHB 3PVUA 2LKOA 3DXCA 1LM8B 3GYOA 4OVVA 5DPRA 2X0SA 3QHTA 1WE6A 1V61A 5D27A 4NNJB 3A9KA 3E9LA 1V80A 1ISNA 1EO6A 2I1JA 2BPSA 2JY6A 3N3KB 1GGOA 1HB6A 2FJ9A 2DKPA 4A3PA 2JT4B 4ILJA 1WGYA 3TBLD 1X86A 2NVUI 1ZC4B 2G35A 2ZZPB 2GJYA 4WQOB 3JSVB 3EC8A 1AARA 1U29A 4K7UA 5KHQA 2DYMA 4BKGA 4W9HA 2P0FA 1NVLA 3DOWA 3JW0X 2CS4A 2JZZA 2PEAA 1WGQA 5LLIA 1EUVB 5JH5C 3EPYA 2MWSB 2DA0A 3DVNU 3NHEB 5C23A 1Q1OA 5D3VA 1J8CA 4DDID 1K5DB 4BFRA 5DHFB 2ZEQA 5D3WA 2JPHA 4EZLA 1FHXA 2D9WA 2AEHA 1WM2A 5GMVA 1UBIA 1UPQA 1ZW7A 4IM0A 4KDLB 2GCJA 3ZO5B 5EDSA 2KC2A 3U7DA 5HE1A 3E9PA 3V60A 5J3QA 2BYEA 1E8ZA 2KNBA 4HPLB 4HATB 2L3ZA 4GZUA 2N1VA 2FCSA 2J0MA 2YF0A 4K7SA 4GDKA 5DH9B 4F7UP 3TL5A 4BKSD 3ZDTA 3M3JA 1XQQA 1C3TA 1P1AA 5DHAB 1E7VA 5C1ZA 3EECA 4DHZE 3A8QA 4HXDA 1MKEA 3TMPB 4HPMB 1KJTA 4PYZA 2CHZA 5G2NA 3VTUA 2LYDA 2LI5A 4WJQA 5E6PA 4BOZB 2CRFA 4IW0A 2LGDA 4IWOA 5J3TA 4HLEA 4FHKA 3KYCD 4DXAB 4IG7B 2JRIB 2MKRA 1V5TA 1NU2A 3OJ4B 2KLGA 2UZRA 3CSTA 1WZ0A 2XBBC 4HDOA 2GCLA 4B6WA 2YT0A 3WA0A 1BAKA 2RNRB 3QWMA 5CHWA 2EMTA 3VUWA 2GBNA 4C0AA 1UNRA 3T8MA 1UH6A 2WDTB 2YSZA 1S3SG 3VTVA 2DKQA 1WR6E 1Z2MA 1KI1B 3V6EB 5CHVC 3ZW3A 3KZ1A 4JKEA 2IBIB 2K39A 1RRBA 2CKHB 1QQGA 5JHBA 3VHTC 1SGHA 2DIKA 1H4RA 4ZRIA 4Y94A 2B3AA 3PS6A 2K6DB 2KCJA 3VUXA 3TVVA 3PHXB 4ANWA 3L16A 2LRUA 4MELA 3ML8A 1WM3A 1YIWA 3HM3A 5JVLA 1LB1A 5HE3A 3DBHI 2XEWA 1WMHA 2HTHA 4G3XB 1VBHA 3SDLC 3H9DA 2HE7A 2ROVA 2DAJA 5BO4B 2Q13A 2KLCA 2PPHA 4BVUC 4ASWC 2LG1A 2JWZA 3SD5A 3FEHA 3ZUNA 1GUAB 4FHJA 3RD2A 1WE7A 1NDDA 5C79A 3SBTA 3VH4B 1Y19B 2KDBA 3N7CA 2ADZA 4W9JA 4F1SA 3VFKA 4IM2A 2NCNA 3ZRFA 4BBNF 4DBGA 3B1LX 1K5GB 2C7MB 2BYVE 4GPTB 1UEFA 4G11A 3O65B 2ZVNA 2PZ1A 3RUIB 1E8XA 2RQ1A 4KVGB 3IBEA 4PQ0A 4JKGA 3PLUA 2DHKA 4XC2A 3MDBC 2JZ3B 4BBNC 1YX5B 2W2XC 2O2VA 2LBBA 2ZCCA 1JDEA 2L05A 3KSYA 4BBKA 3L10B 1WXAA 2BKFA 3ULCA 1PFJA 2WX1A 4DHZB 2X18A 4ZYNA 2IYBA 2Z0EB 3SYXA 1XX0A 3E66A 1WX9A 3KY9A 2KOXA 3A33B 3SHQA 1P6SA 2GMIC 3DVNV 4HB2B 3X23A 5DIFB 2QHOA 3T06A 3PZDA 4IAPA 3D8EA 4ANUA 2IZVB 2NS5A 5D3YA 2LRWA 2AYOB 1P9DU 4GDKB 2KMCA 4TQ0A 2K8HA 2COCA 4D0NB 1GNUA 3PRPB 4PYUA 3QJZA 1J0GA 4JK9A 3D8DA 5J3YA 2ZNVC 4E71A 3M62B 3PSEB 3HIZA 2K1FA 2L00B 4FADA 2CU1A 3WAMA 3FP5A 3P2BA 4HCNB 2K8BA 3PG7A 2KDIA 5DI9B 1R4MI 2W9NA 4IFSA 1HB8A 2BYFA 3QC8B 2AL3A 5J18A 3PVWA 2M0XA 1Y5OA 1DYNA 2FJLA 2PE9A 3EHVA 1U5DA 2IO2B 4TUUA 2KX0A 3ZLZA 3BY4B 2R82A 1BTNA 2MDXA 3VIAA 3H6NA 2LVPA 1BTKA 4TQ1A 1WI0A 4MGKE 3Q3JA 2W2WA 2GBJA 4HDQA 4EKUA 1WGRA 2WWZA 1MG8A 2ZNVB 5LXIB 1S1QB 2DYBA 2IY0B 2XK5A 4NPNA 4MDKE 3MPXA 2IYDB 2KANA 1DROA 4K2PA 2BGFA 2GS0A 1WGGA 2OJRA 1P0RA 5JZEB 4W9GA 2KTRA 1KBLA 1GC7A 1EAZA 2KTFA 1IPGA 4JK8A 3QK0A 1LW3A 4I6NB 1EF1A 3CF6E 3PEGA 1BWNA 3QA8A 3SNHA 4YL8A 2V3SA 3L54A 2NPTA 3LDZE 1OMWA 2MLBA 3C0RB 1OQYA 1QZEA 1ZGUB 4ZRKA 3QX1A 3HM6X 1YQBA 3A1QA 5DPSA 4WWPA 2WX0A 1L7YA 4RM8A 3F5RA 1NBFC 3F0WA 3DQVA 2KJHB 1ZVRA 1BT0A 1Q5WB 1U4AA 3NSUA 2LOXA 2G3QB 2KWCA 1VCBA 3DBLI 4E3CA 3PRZA 1KM7A 4HAYB 3L0WB 2FDQA 4KHBB 5KQ1A 1GG3A 2UVMA 2G45B 4DK5A 1L2NA 1DIKA 4HB3B 2KQ7A 4F7ZA 1WGUA 2M4NA 5CHFA 2Z0PA 3UINB 4WJOA 1V6EA 2Y7BA 4KHOA 4B95A 5C16A 4JKGB 4X57B 1LQBA 4DHJD 3R7RA 1AQCA 2MBQA 4CHJA 2ZPNA 2KWVB 2L0FA 5JHAA 5D6JB 1NTVA 2D10A 3QCAA 2MFQA 2CY4A 2KUPA 2R2OA 2HRJA 2L2IA 2L7RA 4CYEA 4GMXB 4IM3A 1DDMA 4IWQA 5C6RA 1EVHA 1J19A 4K17A 4II2B 2LVQA 4GU2A 4XX5A 2LOZA 4EZKA 1WG7A 1MK9B 4JKFA 3JYUA 4ILHA 4W9CA 1E8WA 4ANVA 1I7AA 2K25A 4II3B 3V5WA 2KXJA 1WJNA 2D11A 3P7ZA 4IC7B 2Y8GA 2GBKA 2KDFB 2ABDA 2Z0QA 1X1MA 5HE2A 3DXEA 1AWEA 5DCNA 4W9LA 1Q67A 4FJYA 1P3QU 2XQNM 5CTRC 3AU4A 2PJHA 3R3MA 2KKCA 1OQNA 5KCVA 1W1GA 1WJUA 1X11A 3QWZB 5JHGA 1M94A 1U5EA 2MWNB 2EC1A 1F9JA 1XT9B 3DXDA 4AWJA 3WIMA 3PSCA 3QBVB 2FCMA 1WR1A 4KZ0A 1OEYA 2NBVB 4GXBA 1MIZB 2ZVOA 1SIFA 3RCPA 4IUMB 3WYFB 1EF5A 4A6FA 1WJ1A 2V4LA 3R7QA 3HHMA 1VBGA 3PVLA 1WIAA 3VDZA 1FHOA 3SU8X 1XD3B 2KC1A 3SV1A 1RRPB 4CO7A 2N7EA 4HCPB 3RZFA 4FJVB 2DTCA 2KHWB 4KDIC 4RMAA 2H7DA 5D2MB 4MGYE 1FHWA 4GOCA 4DHJB 1FOEA 2N4FA 1QC6A 1UZXB 1WJ4A 4EMOA 1IYFA 4HAUB 1V88A 4EUTA 1YX6B 1ZKHA 1N3HA 3RULA 4MK0A 2C9WB 3CSFA 2C7NB 4WJ7A 2KTRB 2L8JA 1OTRB 3ZNZB 2PE6B 4B9KA 4GDLA 2YT1A 1RAXA 1H10A 2LWPA 3UIOB 3W1SA 3H7PA 2NPTB 1LXDA 1KLVA 3VH3B 3D32A 3VXWA 3KRXA 4XWXA 3A1QB 3KUCB 2M38A 3A9KB 5J17A 1WXMA 2D9YA 2DX5A 4FJZA 3OAWA 4ICVA 3U30A 4I6PA 2COPA 3WALA 4LDTD 2CODA 2M14A 2RSGA 3SO6A 2ZCBA 4YONA 4JQWC 4M0WB 2ROZB 3Q3FA 2YVCA 3FSSA 1DBHA 3IFWB 4DDGD 2KWUB 1WX7A 2O6VA 3JSVA 1X05A 3QAQA 4MGZE 4URKA 1PLSA 4JKDA 2FIFA 3JVZX 1W1HA 2D07B 3QIJA 5GOWB 5JLJB 1UGMA 2L76A 3L08A 3APDA 1WF9A 4W9IA 2RVBB 2YLMA 1IRSA 4W9DA 4ZRJA 5LXHA 1XR0B 3PPAA 3ZIMA 2MBBB 3VQIA 1P5TA 3TO1A 3W1YA 1CMXB 1MK7B 1D3ZA 5D3XA 5JHHA 1T0YA 2M8SA 1M7EA 2MCNB 3LJ3A 3PV1A 2KJ6A 1X1FA 3TIXA 2UZSA 1V5PA 3AXCA 3N32A 4KAXB 4A6HA 4GMVA 4HB4B 3A4SC 4MEMA 2COAA 4A6KA 2GBRA 2GBMA 2A5UA 3ZRCA 1UNPA 4NQLB 1V9JA 4AUQC 4ZDVA 4EJNA 2MBHA 1WJMA 4ANXA 3WAPA 1Z5SB 1KOTA 2IO0B 1V2YA 1PQSA 3M95A 3T9LA 3VTWA 4JKAA 3G9WA 1V5OA 2K2UA 4HJKA 5D7GA 3NZUA 2KJRA 4H8SA 3IVFA 4GB9A 2UWQA 2IFSA 3V6CB 4AJWA 2CHWA 2ZJDA 1X1GA 2VRWB 2O6VD 1ZSQA 4LJOB 4HK2A 4LDTB 4FA6A 3PLVA 5KHOA 1SE9A 1E8YA 3ZVVA 1ACAA 4MY6A 2FIDA 4TKNA 2JVCA 2MRPA 1WVHA 4IWPA 2D4QA 4JKCA 3VUYA 3ML9A 1FXTB 3KUZA 1B55A 2VSZA 2BKRB 3SBGA 2DN6A 4GN1A 4RM9A 3HW2B 1U5FA 4XZ4A 4HB0B 1ZM0A 4W9EA 1P98A 3VOQA 4EFOA 3UGBB 1UELA 1V86A 1VD2A 2ELBA 4GSWA 3UIPB 1JRUA 5L83A 3A9JA 1V81A 3N30A 4TYZA 3OJ3A 2MP2A 2IY1B 3KH0A 1HE8A 2BF8B 2V1YA 1J0WA 4JLCA 1WGHA 4DBBA 1E7UA 1MIXA 2H7EA 2G4DB 1HBKA 1KZGA 1NTIA 4LJPB 4GDLB 3ODWA 4WJNA 4GIVA 3CXBB 3CMMB 5IA7A 3APFA 1RJ2A 1WMHB 1U27A 2HTHB 3ZVRA 2MBOA 2CY5A 3H7PB 4M8MA 4JKBA 5E6NA 1P3RA 2FCNA 3NOBA 3IHPC 1WX8A 3DBRI 1C1YB 3FM8C 4BKSA 2VKIA 3S2AA 2DX5B 4PS3A 3L13A 3LJUX 2NBUA 1WRDB 2WH5A 2KX3A 2ZPYA 5CX3A 2J7QB 5JP4A 1UNQA 3PP2A 3ODOA 2FCQA 1I35A 2OTXA 1IP9A 3UQBA 3ENBA 1XKEA 1LFDA 2BWES 2EMSA 3EFUA 3PHWB 4AOFA 4HWIB 2O6VB 2KZRA 2LXAA 3M63B 4G50A 4MJSA 1E5WA 3KVFB 3D8FA 1OY2A 2NZ8B 4F8CB 2LGXA 1FB8A 2ELAA 3NY5A 3ZNHB 3ZNID 3ODXA 1V49A 4CHKA 3TCAA 2O2VB 4EZJA 5AZHA 2KN5A 5EFXA 1YD8U 4MGIE 5HE0A 2I1KA 3AJ4A 3KRWA 2QKMA 5LONB 3H7SA 2DZMA 2LD9A 1H8CA 3APCA 5G55A 5AEKB 5L81A 1M7RA 3MTNB 2RUKB 3GOEA 1FGYA 4J6IA 4DX8A 1MAIA 4WSFA 3PTFC 4HVBA 2LVOA 3DCGA 5AZGA 4I6LB 2RPQA 2CQUA 3PREA 1W1DA 2Z0DB 3R66C 2CB8A 3OANA 2K8CA 2D2QA 1WYWB 4OVUA 2KGXB 5IAAC 5C5BA 3O96A 1XD4A 2LGYA 1XCGA 2G4SA 1DDVA 4MSMB 3X0WA 1WI1A 2N23A 2D9VA 4Z2NA 3RT3B 3TFMA 1WY8A 1TZ1A 3KYDD 1RFAA 4KZCA 4K1RB 4MSQB 4NQKE 3ZDMC 2LULA 5D94A 4NSWA 4F7HA 3OLMD 3A98B 2J0KA 4TV3A 4ICUA 4PS8A 5FR6A 2C60A 2DZKA 4KIKA 3DDCB 4F7GA 2DYNA 3KW5B 1TQZA 1NTYA 2MX2A 4MH0E 3DBSA 2N9XA 3A4RA 4WWOA 2REXA 4NY0A 4GGQA 3A8PA 2DYOA 1KC7A 2DFKA 4FULA 1ST7A 2LUEA 1G6JA 3DVGY 2N1WA 3GZNI 2NBWB 3QARA 2XK5B 4HHVA 1KZ7A 2P0HA 4MT7A 2DZIA 4NAWA 1EGXA 2GOWA 4WWNA 4NJ7A 3VAWA 2QKLA 3H1UA 4K81A 2DHJA 4N9F4 3TW1A 5IJMA 2R2QA 1U5GA 2MBEA 2KFKA 4JGHB 3WAOA 3SUZA 3HQCA 3UZTA 2WYQA 4ILGB 3HK0A 3A9JB 3DPDA 1Q0WB 4JL9A 4AP4C 4Z2MB 2M1MA 4W9KA 4DX90 3AI5A 3ZTCA 1UD7A 2MP2B 2N0YA 2K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6A A;  2Z59 B;  5DPT A;  1R4N I;  3I3T B;  4MM3 A;  4A20 A;  2MW5 A;  2W2X D;  3L17 A;  3AU5 A;  2Y5B B;  3QQ8 B;  5FI0 A;  4W9F A;  1SHC A;  3ML4 A;  4P7I A;  2OOB B;  3ECI A;  2KD0 A;  4M8N A;  1TBE A;  3NZS A;  2E2X A;  2CAY A;  2KQS A;  2DX1 A;  1WJ6 A;  3B08 A;  1TJ6 A;  2J0J A;  2RD0 A;  2JF5 A;  2FAZ A;  5E6O A;  3V62 A;  2P0D A;  2Y8F A;  3FLV A;  5LOP B;  2JUO A;  1I2H A;  3IG3 A;  4KV2 A;  3ENE A;  1FAO A;  2IO1 B;  2R09 A;  2KDE B;  3PT2 B;  1V5U A;  1I42 A;  1RLF A;  5DPW A;  2JP2 A;  2KMA A;  1MPH A;  4WAA A;  3ULB A;  2AWT A;  2BCJ A;  2RGN B;  1FGZ A;  3AUL A;  1XOD A;  3PGE A;  2RLO A;  2HJ8 A;  3UQA A;  5J2R A;  4MJS B;  4WVF B;  1WGD A;  2C5L C;  5AZF A;  1K8R B;  3V61 A;  2RSU A;  2YS3 A;  2RR9 A;  3RZW C;  1OGW A;  3CIK A;  2EKE C;  2DLW A;  1UBQ A;  2UYZ B;  2D3G A;  1OEY J;  4NJ6 A;  5CLL B;  3NS8 A;  1TXD A;  2NMB A;  3ZTD A;  2LAS A;  3ZNG C;  4KHA A;  2C7H A;  5TR5 A;  1PMS A;  3MJW A;  1DDW A;  2RGF A;  2DEN B;  2KFJ A;  2HD5 B;  1V89 A;  4DWF A;  3K9P B;  4AJY B;  2JRH A;  4EEW A;  4HAZ B;  4EOY A;  2BWF A;  1YJ1 A;  3M1I B;  4IOY X;  5CLQ B;  2N7D A;  1GC6 A;  3MHS D;  5HKH A;  2MQJ A;  4HAX B;  4CHM A;  1TTN A;  1A5R A;  4FN2 A;  1WZ3 A;  2CR5 A;  4HAW B;  5C5B B;  2A4Z A;  3PRM B;  3ALB A;  4B6H A;  1Z87 A;  3ONS A;  3RYT A;  1U2B A;  4KSK C;  5KQ4 A;  3K9O B;  2D9X A;  1WXV A;  4HAV B;  4KSL C;  3BJI A;  1E90 A;  3DVG X;  4BKT A;  4K7W A;  3ZKJ C;  3BIN A;  2LJ5 A;  2DZJ A;  2YRY A;  4E74 A;  2KVR A;  4FBJ B;  2AL6 A;  2MA9 B;  2EJ8 A;  2K2J A;  4KIK B;  3UF8 A;  4JIO U;  2N9E B;  3VVW B;  2CHX A;  3RCZ A;  1GJZ A;  2DHI A;  3TJP A;  4A6F B;  2L0T A;  2JXX A;  2LXC A;  5L95 C;  2V76 A;  2KK8 A;  5FI1 A;  2YS1 A;  2DAF A;  2Z0O A;  1V5M A;  3W1S C;  4A5K A;  2D9Z A;  1TGZ B;  1NI2 A;  2I5C A;  2IO3 B;  2L1C A;  4K2O A;  2I5F A;  4PS7 A;  2R0D A;  1WXS A;  4BOS C;  1WFY A;  4FLH A;  2LZ6 A;  4NAW B;  3WAN A;  2J59 M;  4PNK A;  4LCD E;  1UPR A;  4L6E A;  4WJP A;  2COF A;  2KFK B;  2M17 A;  2KO3 A;  3KUD B;  2MSE D;  2K6Q A;  3B0A A;  3U8Z A;  2NR2 A;  2P8V A;  2DYQ A;  2VRR B;  4A3O A;  2DHZ A;  3GYP A;  4G0N B;  2OQB A;  2ASQ A;  1Y8R C;  2N9P C;  2FNJ B;  2YS5 A;  1WH3 A;  1ZC3 B;  2FUH B;  3PVU A;  2LKO A;  3DXC A;  1LM8 B;  3GYO A;  4OVV A;  5DPR A;  3QHT A;  1WE6 A;  1V61 A;  5D27 A;  4NNJ B;  3A9K A;  1V80 A;  1ISN A;  1EO6 A;  2I1J A;  2BPS A;  2JY6 A;  3N3K B;  1HB6 A;  2FJ9 A;  2DKP A;  4A3P A;  2JT4 B;  1WGY A;  3TBL D;  1X86 A;  2NVU I;  1ZC4 B;  2G35 A;  2ZZP B;  2GJY A;  4WQO B;  3JSV B;  3EC8 A;  1AAR A;  1U29 A;  4K7U A;  5KHQ A;  2DYM A;  4BKG A;  4W9H A;  2P0F A;  1NVL A;  3DOW A;  3JW0 X;  2CS4 A;  2JZZ A;  2PEA A;  1WGQ A;  5LLI A;  1EUV B;  5JH5 C;  3EPY A;  2MWS B;  2DA0 A;  3DVN U;  3NHE B;  5C23 A;  1Q1O A;  5D3V A;  1J8C A;  4DDI D;  1K5D B;  4BFR A;  5DHF B;  2ZEQ A;  5D3W A;  2JPH A;  4EZL A;  1FHX A;  2D9W A;  2AEH A;  1WM2 A;  5GMV A;  1UBI A;  1UPQ A;  1ZW7 A;  4IM0 A;  4KDL B;  2GCJ A;  3ZO5 B;  5EDS A;  2KC2 A;  3U7D A;  5HE1 A;  3V60 A;  5J3Q A;  2BYE A;  1E8Z A;  2KNB A;  4HPL B;  4HAT B;  2L3Z A;  4GZU A;  2N1V A;  2FCS A;  2J0M A;  2YF0 A;  4K7S A;  4GDK A;  5DH9 B;  4F7U P;  3TL5 A;  4BKS D;  3ZDT A;  3M3J A;  1XQQ A;  1C3T A;  1P1A A;  5DHA B;  1E7V A;  5C1Z A;  3EEC A;  4DHZ E;  3A8Q A;  4HXD A;  1MKE A;  3TMP B;  4HPM B;  1KJT A;  4PYZ A;  2CHZ A;  5G2N A;  3VTU A;  2LYD A;  2LI5 A;  4WJQ A;  5E6P A;  4BOZ B;  2CRF A;  4IW0 A;  2LGD A;  4IWO A;  5J3T A;  4HLE A;  4FHK A;  3KYC D;  4DXA B;  4IG7 B;  2JRI B;  2MKR A;  1V5T A;  1NU2 A;  3OJ4 B;  2KLG A;  2UZR A;  3CST A;  1WZ0 A;  2XBB C;  4HDO A;  2GCL A;  4B6W A;  2YT0 A;  3WA0 A;  1BAK A;  2RNR B;  3QWM A;  5CHW A;  2EMT A;  3VUW A;  2GBN A;  4C0A A;  1UNR A;  3T8M A;  1UH6 A;  2WDT B;  2YSZ A;  1S3S G;  3VTV A;  2DKQ A;  1WR6 E;  1Z2M A;  1KI1 B;  3V6E B;  5CHV C;  3ZW3 A;  3KZ1 A;  2IBI B;  2K39 A;  1RRB A;  2CKH B;  1QQG A;  5JHB A;  3VHT C;  1SGH A;  1H4R A;  4ZRI A;  4Y94 A;  2B3A A;  3PS6 A;  2K6D B;  2KCJ A;  3VUX A;  3TVV A;  3PHX B;  4ANW A;  3L16 A;  2LRU A;  4MEL A;  3ML8 A;  1WM3 A;  1YIW A;  3HM3 A;  1LB1 A;  5HE3 A;  3DBH I;  2XEW A;  1WMH A;  2HTH A;  4G3X B;  3SDL C;  3H9D A;  2HE7 A;  2ROV A;  2DAJ A;  5BO4 B;  2Q13 A;  2KLC A;  2PPH A;  4BVU C;  4ASW C;  2LG1 A;  2JWZ A;  3SD5 A;  3FEH A;  3ZUN A;  1GUA B;  4FHJ A;  3RD2 A;  1WE7 A;  1NDD A;  5C79 A;  3VH4 B;  1Y19 B;  2KDB A;  3N7C A;  2ADZ A;  4W9J A;  4F1S A;  3VFK A;  4IM2 A;  2NCN A;  3ZRF A;  4BBN F;  4DBG A;  3B1L X;  1K5G B;  2C7M B;  2BYV E;  4GPT B;  1UEF A;  4G11 A;  3O65 B;  2ZVN A;  2PZ1 A;  3RUI B;  1E8X A;  2RQ1 A;  4KVG B;  3IBE A;  4PQ0 A;  3PLU A;  2DHK A;  4XC2 A;  3MDB C;  2JZ3 B;  4BBN C;  1YX5 B;  2W2X C;  2O2V A;  2LBB A;  2ZCC A;  2L05 A;  3KSY A;  4BBK A;  3L10 B;  1WXA A;  2BKF A;  3ULC A;  1PFJ A;  2WX1 A;  4DHZ B;  2X18 A;  4ZYN A;  2IYB A;  2Z0E B;  3SYX A;  1XX0 A;  1WX9 A;  3KY9 A;  2KOX A;  3A33 B;  3SHQ A;  1P6S A;  2GMI C;  3DVN V;  4HB2 B;  3X23 A;  5DIF B;  2QHO A;  3T06 A;  3PZD A;  4IAP A;  3D8E A;  4ANU A;  2IZV B;  2NS5 A;  5D3Y A;  2LRW A;  2AYO B;  1P9D U;  4GDK B;  2KMC A;  4TQ0 A;  2K8H A;  2COC A;  4D0N B;  1GNU A;  3PRP B;  4PYU A;  3QJZ A;  1J0G A;  3D8D A;  5J3Y A;  2ZNV C;  4E71 A;  3M62 B;  3PSE B;  3HIZ A;  2K1F A;  2L00 B;  4FAD A;  2CU1 A;  3WAM A;  3FP5 A;  3P2B A;  2K8B A;  4HCN B;  3PG7 A;  2KDI A;  5DI9 B;  1R4M I;  2W9N A;  4IFS A;  1HB8 A;  2BYF A;  3QC8 B;  2AL3 A;  5J18 A;  3PVW A;  2M0X A;  1Y5O A;  1DYN A;  2FJL A;  2PE9 A;  3EHV A;  1U5D A;  2IO2 B;  4TUU A;  2KX0 A;  3ZLZ A;  3BY4 B;  1BTN A;  2MDX A;  3VIA A;  3H6N A;  2LVP A;  1BTK A;  4TQ1 A;  1WI0 A;  4MGK E;  3Q3J A;  2W2W A;  2GBJ A;  4HDQ A;  4EKU A;  1WGR A;  2WWZ A;  1MG8 A;  2ZNV B;  5LXI B;  1S1Q B;  2DYB A;  2IY0 B;  2XK5 A;  4NPN A;  4MDK E;  3MPX A;  2IYD B;  2KAN A;  1DRO A;  4K2P A;  2BGF A;  2GS0 A;  1WGG A;  2OJR A;  1P0R A;  5JZE B;  4W9G A;  2KTR A;  1GC7 A;  1EAZ A;  2KTF A;  1IPG A;  3QK0 A;  1LW3 A;  4I6N B;  1EF1 A;  3CF6 E;  3PEG A;  1BWN A;  3QA8 A;  3SNH A;  4YL8 A;  2V3S A;  3L54 A;  2NPT A;  3LDZ E;  1OMW A;  2MLB A;  3C0R B;  1OQY A;  1QZE A;  1ZGU B;  4ZRK A;  3QX1 A;  3HM6 X;  1YQB A;  3A1Q A;  5DPS A;  4WWP A;  2WX0 A;  1L7Y A;  4RM8 A;  3F5R A;  1NBF C;  3F0W A;  3DQV A;  2KJH B;  1ZVR A;  1BT0 A;  1Q5W B;  1U4A A;  3NSU A;  2LOX A;  2G3Q B;  2KWC A;  1VCB A;  3DBL I;  4E3C A;  3PRZ A;  1KM7 A;  4HAY B;  3L0W B;  2FDQ A;  4KHB B;  5KQ1 A;  1GG3 A;  2UVM A;  2G45 B;  4DK5 A;  1L2N A;  4HB3 B;  2KQ7 A;  4F7Z A;  1WGU A;  2M4N A;  5CHF A;  2Z0P A;  3UIN B;  4WJO A;  1V6E A;  2Y7B A;  4KHO A;  4B95 A;  5C16 A;  4X57 B;  1LQB A;  4DHJ D;  3R7R A;  1AQC A;  2MBQ A;  4CHJ A;  2ZPN A;  2KWV B;  2L0F A;  5JHA A;  5D6J B;  1NTV A;  2D10 A;  3QCA A;  2MFQ A;  2CY4 A;  2KUP A;  2R2O A;  2HRJ A;  2L2I A;  2L7R A;  4CYE A;  4GMX B;  4IM3 A;  1DDM A;  4IWQ A;  5C6R A;  1EVH A;  1J19 A;  4K17 A;  4II2 B;  2LVQ A;  4GU2 A;  4XX5 A;  2LOZ A;  4EZK A;  1WG7 A;  1MK9 B;  3JYU A;  4W9C A;  1E8W A;  4ANV A;  1I7A A;  2K25 A;  4II3 B;  3V5W A;  2KXJ A;  1WJN A;  2D11 A;  3P7Z A;  4IC7 B;  2Y8G A;  2GBK A;  2KDF B;  2ABD A;  2Z0Q A;  1X1M A;  5HE2 A;  3DXE A;  1AWE A;  5DCN A;  4W9L A;  1Q67 A;  4FJY A;  1P3Q U;  2XQN M;  5CTR C;  3AU4 A;  2PJH A;  3R3M A;  2KKC A;  1OQN A;  5KCV A;  1W1G A;  1WJU A;  1X11 A;  3QWZ B;  5JHG A;  1M94 A;  1U5E A;  2MWN B;  2EC1 A;  1F9J A;  1XT9 B;  3DXD A;  4AWJ A;  3WIM A;  3PSC A;  3QBV B;  2FCM A;  1WR1 A;  4KZ0 A;  1OEY A;  2NBV B;  4GXB A;  1MIZ B;  2ZVO A;  1SIF A;  3RCP A;  4IUM B;  3WYF B;  1EF5 A;  4A6F A;  1WJ1 A;  2V4L A;  3R7Q A;  3HHM A;  3PVL A;  1WIA A;  3VDZ A;  1FHO A;  3SU8 X;  1XD3 B;  2KC1 A;  3SV1 A;  1RRP B;  4CO7 A;  2N7E A;  4HCP B;  3RZF A;  4FJV B;  2DTC A;  2KHW B;  4KDI C;  4RMA A;  2H7D A;  5D2M B;  4MGY E;  1FHW A;  4GOC A;  4DHJ B;  1FOE A;  2N4F A;  1QC6 A;  1UZX B;  1WJ4 A;  4EMO A;  1IYF A;  4HAU B;  1V88 A;  4EUT A;  1YX6 B;  1ZKH A;  1N3H A;  3RUL A;  4MK0 A;  2C9W B;  3CSF A;  2C7N B;  4WJ7 A;  2KTR B;  2L8J A;  1OTR B;  3ZNZ B;  2PE6 B;  4B9K A;  4GDL A;  2YT1 A;  1RAX A;  1H10 A;  2LWP A;  3UIO B;  3W1S A;  3H7P A;  2NPT B;  1LXD A;  1KLV A;  3VH3 B;  3D32 A;  3VXW A;  3KRX A;  4XWX A;  3A1Q B;  3KUC B;  2M38 A;  3A9K B;  5J17 A;  1WXM A;  2D9Y A;  2DX5 A;  4FJZ A;  3OAW A;  4ICV A;  3U30 A;  4I6P A;  2COP A;  3WAL A;  4LDT D;  2COD A;  2M14 A;  2RSG A;  3SO6 A;  2ZCB A;  4YON A;  4JQW C;  4M0W B;  2ROZ B;  3Q3F A;  2YVC A;  3FSS A;  1DBH A;  3IFW B;  4DDG D;  2KWU B;  1WX7 A;  2O6V A;  3JSV A;  1X05 A;  3QAQ A;  4MGZ E;  4URK A;  1PLS A;  2FIF A;  3JVZ X;  1W1H A;  2D07 B;  3QIJ A;  5GOW B;  5JLJ B;  1UGM A;  2L76 A;  3L08 A;  3APD A;  1WF9 A;  4W9I A;  2RVB B;  2YLM A;  1IRS A;  4W9D A;  4ZRJ A;  5LXH A;  1XR0 B;  3PPA A;  3ZIM A;  2MBB B;  3VQI A;  3W1Y A;  1P5T A;  3TO1 A;  1CMX B;  1MK7 B;  1D3Z A;  5D3X A;  5JHH A;  1T0Y A;  2M8S A;  1M7E A;  2MCN B;  3LJ3 A;  3PV1 A;  2KJ6 A;  1X1F A;  3TIX A;  2UZS A;  1V5P A;  3AXC A;  3N32 A;  4KAX B;  4A6H A;  4GMV A;  4HB4 B;  3A4S C;  4MEM A;  2COA A;  4A6K A;  2GBR A;  2GBM A;  2A5U A;  3ZRC A;  1UNP A;  4NQL B;  1V9J A;  4AUQ C;  4ZDV A;  4EJN A;  2MBH A;  1WJM A;  4ANX A;  3WAP A;  1Z5S B;  1KOT A;  2IO0 B;  1V2Y A;  1PQS A;  3M95 A;  3T9L A;  3VTW A;  3G9W A;  1V5O A;  2K2U A;  4HJK A;  5D7G A;  3NZU A;  2KJR A;  4H8S A;  3IVF A;  4GB9 A;  2UWQ A;  2IFS A;  3V6C B;  4AJW A;  2CHW A;  2ZJD A;  1X1G A;  2VRW B;  2O6V D;  1ZSQ A;  4LJO B;  4HK2 A;  4LDT B;  4FA6 A;  3PLV A;  5KHO A;  1SE9 A;  1E8Y A;  3ZVV A;  1ACA A;  4MY6 A;  2FID A;  4TKN A;  2JVC A;  2MRP A;  1WVH A;  4IWP A;  2D4Q A;  3VUY A;  3ML9 A;  1FXT B;  3KUZ A;  1B55 A;  2VSZ A;  2BKR B;  2DN6 A;  4GN1 A;  4RM9 A;  3HW2 B;  1U5F A;  4XZ4 A;  4HB0 B;  1ZM0 A;  4W9E A;  1P98 A;  3VOQ A;  4EFO A;  3UGB B;  1UEL A;  1V86 A;  1VD2 A;  2ELB A;  4GSW A;  3UIP B;  1JRU A;  5L83 A;  3A9J A;  1V81 A;  3N30 A;  4TYZ A;  3OJ3 A;  2MP2 A;  2IY1 B;  3KH0 A;  1HE8 A;  2BF8 B;  2V1Y A;  1J0W A;  4JLC A;  1WGH A;  4DBB A;  1E7U A;  1MIX A;  2H7E A;  2G4D B;  1HBK A;  1KZG A;  1NTI A;  4LJP B;  4GDL B;  3ODW A;  4WJN A;  4GIV A;  3CXB B;  3CMM B;  5IA7 A;  3APF A;  1RJ2 A;  1WMH B;  1U27 A;  2HTH B;  3ZVR A;  2MBO A;  2CY5 A;  3H7P B;  4M8M A;  5E6N A;  1P3R A;  2FCN A;  3NOB A;  3IHP C;  1WX8 A;  3DBR I;  1C1Y B;  3FM8 C;  4BKS A;  2VKI A;  3S2A A;  2DX5 B;  4PS3 A;  3L13 A;  3LJU X;  2NBU A;  1WRD B;  2WH5 A;  2KX3 A;  2ZPY A;  5CX3 A;  2J7Q B;  5JP4 A;  1UNQ A;  3PP2 A;  3ODO A;  2FCQ A;  1I35 A;  2OTX A;  1IP9 A;  3UQB A;  1XKE A;  1LFD A;  2BWE S;  2EMS A;  3EFU A;  3PHW B;  4AOF A;  4HWI B;  2O6V B;  2KZR A;  2LXA A;  3M63 B;  4G50 A;  4MJS A;  1E5W A;  3KVF B;  3D8F A;  1OY2 A;  2NZ8 B;  4F8C B;  2LGX A;  1FB8 A;  2ELA A;  3NY5 A;  3ZNH B;  3ZNI D;  3ODX A;  1V49 A;  4CHK A;  3TCA A;  2O2V B;  4EZJ A;  5AZH A;  2KN5 A;  5EFX A;  1YD8 U;  4MGI E;  5HE0 A;  2I1K A;  3AJ4 A;  3KRW A;  2QKM A;  5LON B;  3H7S A;  2DZM A;  2LD9 A;  1H8C A;  3APC A;  5G55 A;  5AEK B;  5L81 A;  1M7R A;  3MTN B;  2RUK B;  3GOE A;  1FGY A;  4J6I A;  4DX8 A;  1MAI A;  4WSF A;  3PTF C;  4HVB A;  2LVO A;  3DCG A;  5AZG A;  4I6L B;  2RPQ A;  2CQU A;  3PRE A;  1W1D A;  2Z0D B;  3R66 C;  2CB8 A;  3OAN A;  2K8C A;  2D2Q A;  1WYW B;  4OVU A;  2KGX B;  5IAA C;  5C5B A;  3O96 A;  1XD4 A;  2LGY A;  1XCG A;  2G4S A;  1DDV A;  4MSM B;  3X0W A;  1WI1 A;  2N23 A;  2D9V A;  4Z2N A;  3RT3 B;  3TFM A;  1WY8 A;  1TZ1 A;  3KYD D;  1RFA A;  4KZC A;  4K1R B;  4MSQ B;  4NQK E;  3ZDM C;  2LUL A;  5D94 A;  4NSW A;  4F7H A;  3OLM D;  3A98 B;  2J0K A;  4TV3 A;  4ICU A;  4PS8 A;  5FR6 A;  2C60 A;  2DZK A;  4KIK A;  3DDC B;  4F7G A;  2DYN A;  3KW5 B;  1TQZ A;  1NTY A;  2MX2 A;  4MH0 E;  3DBS A;  2N9X A;  3A4R A;  4WWO A;  2REX A;  4NY0 A;  4GGQ A;  3A8P A;  2DYO A;  2DFK A;  4FUL A;  1ST7 A;  2LUE A;  1G6J A;  3DVG Y;  2N1W A;  3GZN I;  2NBW B;  3QAR A;  2XK5 B;  4HHV A;  1KZ7 A;  2P0H A;  4MT7 A;  2DZI A;  4NAW A;  1EGX A;  2GOW A;  4WWN A;  4NJ7 A;  3VAW A;  2QKL A;  3H1U A;  4K81 A;  2DHJ A;  4N9F 4;  3TW1 A;  5IJM A;  2R2Q A;  1U5G A;  2MBE A;  2KFK A;  4JGH B;  3WAO A;  3SUZ A;  3HQC A;  3UZT A;  2WYQ A;  3HK0 A;  3A9J B;  3DPD A;  1Q0W B;  4JL9 A;  4AP4 C;  4Z2M B;  2M1M A;  4W9K A;  4DX9 0;  3AI5 A;  3ZTC A;  1UD7 A;  2MP2 B;  2N0Y A;  2K00 A; 
#chains in the Genus database with same CATH topology
 3P6A A;  2Z59 B;  5DPT A;  1FM0 D;  1R4N I;  3I3T B;  4MM3 A;  4A20 A;  1FMA D;  2K8E A;  3OWE B;  2MW5 A;  2W2X D;  3L17 A;  3AU5 A;  2Y5B B;  3W9C B;  4KKI A;  2Z8L A;  1MI1 A;  3QQ8 B;  5FI0 A;  4W9F A;  1SHC A;  3ML4 A;  5IP4 D;  4P7I A;  1V1P A;  2OOB B;  3RNA C;  3ECI A;  2KD0 A;  4M8N A;  2IDY A;  1TBE A;  3NZS A;  2E2X A;  3DHI C;  1DOX A;  2CAY A;  2KQS A;  2DX1 A;  1ZXH A;  1WJ6 A;  2GLS A;  3B08 A;  1TJ6 A;  1ROE A;  2J0J A;  2RD0 A;  2JF5 A;  2FAZ A;  4DXF A;  5E6O A;  3Q3O C;  4JKH A;  3V62 A;  2P0D A;  1Y56 A;  4ARC A;  1MHX A;  2Y8F A;  3FLV A;  5LOP B;  1JRP A;  2JUO A;  1I2H A;  3IG3 A;  4KV2 A;  3ENE A;  4C7Y A;  2PVG C;  1FAO A;  1TY2 A;  2R09 A;  2IO1 B;  2KDE B;  3DWG C;  3PT2 B;  5IRS A;  1V5U A;  1I42 A;  3NUH B;  1RLF A;  5I2M A;  4HJG E;  5HHD G;  1N5W A;  5DPW A;  2JP2 A;  3ABV B;  2KMA A;  2GRI A;  1MPH A;  4WAA A;  3ULB A;  2AWT A;  2WXF A;  2BCJ A;  2RGN B;  1QLB B;  1FGZ A;  2WXL A;  3AUL A;  1XOD A;  3PGE A;  2RLO A;  2HJ8 A;  4FXC A;  1MPE A;  3UQA A;  5J2R A;  4MJS B;  4WVF B;  1WGD A;  1WXQ A;  2C5L C;  2JX5 A;  5AZF A;  2WXQ A;  3L4P A;  1K8R B;  2RSU A;  3V61 A;  2YS3 A;  2RR9 A;  2WXR A;  3RZW C;  1OQR A;  1OGW A;  1SEB D;  5HI1 A;  3CIK A;  2EKE C;  4GOU A;  2DLW A;  1UBQ A;  2UYZ B;  5BMG A;  2D3G A;  1OEY J;  1VLB A;  2WDR B;  4NJ6 A;  5CLL B;  3NS8 A;  4KX6 B;  3EGR A;  1TXD A;  2QC8 A;  2NMB A;  1JWM D;  4C4V A;  4HSI A;  3ZTD A;  2LAS A;  3ZNG C;  3P42 A;  4KHA A;  4RH6 A;  4ZHP A;  2C7H A;  5TR5 A;  1PMS A;  4LTU A;  3MJW A;  2PVO D;  1DDW A;  1UWX A;  1FO4 A;  2VH2 A;  2KUQ A;  2RGF A;  2DEN B;  2KFJ A;  2KAJ A;  2HD5 B;  2ON8 A;  1V89 A;  3KLS X;  2AQ3 B;  4DWF A;  3K9P B;  4AJY B;  2JRH A;  4EEW A;  4HAZ B;  3VR8 B;  3OHM B;  4EOY A;  2BWF A;  1YJ1 A;  3M1I B;  4IOY X;  5CLQ B;  2KAC A;  2N7D A;  2QIL A;  1T5X D;  2LJI A;  1GC6 A;  4YWG G;  4YXD B;  3MHS D;  5HKH A;  1C4A A;  2MQJ A;  1CZP A;  3AEB B;  4HAX B;  4CHM A;  2JYE A;  3NWF A;  1TTN A;  1A5R A;  1ZDX A;  1L0X B;  4FN2 A;  1WZ3 A;  3AE9 B;  2CR5 A;  4HAW B;  5C5B B;  3H8H A;  1WWT A;  2A4Z A;  1FEH A;  3PRM B;  3ALB A;  4B6H A;  1Z87 A;  3ONS A;  3RYT A;  1U2B A;  4KSK C;  5KQ4 A;  3K9O B;  1YN5 A;  3RNF C;  2D9X A;  1TKG A;  4YTM B;  4US9 A;  1WXV A;  4HAV B;  2V0G A;  4KSL C;  4NZL B;  2Z4D A;  3BJI A;  5G5H A;  1E90 A;  3DVG X;  1JWU D;  5BYS A;  4BKT A;  4K7W A;  3ZKJ C;  3BIN A;  2LJ5 A;  2DZJ A;  1KF6 B;  3FIL B;  2YRY A;  3ZJV A;  4E74 A;  2GI9 A;  2KVR A;  4FBJ B;  2BB6 A;  2AL6 A;  2MA9 B;  2EJ8 A;  2K2J A;  4KIK B;  3UF8 A;  3AEE B;  4JIO U;  4DIX A;  2N9E B;  1SE2 A;  3VVW B;  2RDH A;  3DHH C;  4M01 A;  4ZRP A;  2CHX A;  3RCZ A;  1GJZ A;  2DHI A;  3TJP A;  4A6F B;  1IUE A;  4MH8 A;  4QJ5 B;  1MVK A;  2L0T A;  2JXX A;  2LXC A;  5L95 C;  2V76 A;  2KK8 A;  5FI1 A;  2YS1 A;  2DAF A;  4N58 A;  2Z0O A;  1V5M A;  3W1S C;  4A5K A;  2D9Z A;  1TGZ B;  1NI2 A;  3N20 C;  2I5C A;  2IO3 B;  4B0M A;  2L1C A;  4K2O A;  2QDF A;  2I5F A;  4JK7 A;  4PS7 A;  2BVC A;  4QAY A;  2R0D A;  1WXS A;  1MFW A;  5T8I A;  4H2A A;  3AEC B;  2INN E;  4BOS C;  2X8X X;  4RF1 A;  1WFY A;  4FLH A;  2LZ6 A;  4NAW B;  2WLB A;  3WAN A;  3GE3 C;  1HA5 A;  5IN7 A;  2J4X A;  2LHD A;  4IDI A;  2J59 M;  4PNK A;  4LCD E;  1JAL A;  2LEK A;  1UPR A;  4L6E A;  3RNB C;  4WJP A;  2MJ3 A;  3GZN B;  2COF A;  2KFK B;  2M17 A;  2KO3 A;  3U7Z A;  1ENF A;  3KUD B;  1ZE3 D;  2MSE D;  2K6Q A;  3B0A A;  3U8Z A;  1FPY A;  2NR2 A;  2P8V A;  2DYQ A;  3E9O A;  2VRR B;  2I2Y A;  4A3O A;  2DHZ A;  3GYP A;  1FXA A;  4G0N B;  2OQB A;  2ASQ A;  1Y8R C;  2N9P C;  2FNJ B;  2YS5 A;  2YEP F;  1VDV A;  3BZD B;  1WH3 A;  4MM3 B;  1ZC3 B;  2FUH B;  3PVU A;  5I4D A;  2LKO A;  1TJE A;  2LMC A;  1AN8 A;  3DXC A;  2WXI A;  1LM8 B;  2YT2 A;  3GYO A;  4OVV A;  5DPR A;  2X0S A;  2JZP A;  1WE6 A;  3QHT A;  1I4R A;  1V1P B;  3AE2 B;  3NVV A;  5HG2 A;  1V61 A;  5D27 A;  4NNJ B;  3A9K A;  4L23 A;  3E9L A;  1R4N B;  1V80 A;  1ISN A;  3BVM A;  3GE8 C;  1N5X A;  1EO6 A;  5GXG B;  3I5J C;  2Y5P A;  2E3T A;  4HRO A;  3T3O A;  4UDU C;  5FR3 A;  2I1J A;  2BPS A;  2JY6 A;  3AE5 B;  3N3K B;  5E6J A;  1GGO A;  1HB6 A;  3DBH B;  4OT1 A;  2FJ9 A;  2DKP A;  4A3P A;  2OHF A;  2JT4 B;  1TYG B;  4JX1 C;  4ILJ A;  1WGY A;  3TBL D;  1X86 A;  2NVU I;  2J42 A;  1FNW A;  1ZC4 B;  2G35 A;  2ZZP B;  2GJY A;  4M00 A;  3JSV B;  3EC8 A;  1AAR A;  4WQO B;  1U29 A;  4K7U A;  1D5M C;  3UI3 A;  5KHQ A;  2DYM A;  4BKG A;  4W9H A;  2P0F A;  1P7F A;  2WHI A;  4HPP A;  1NVL A;  3DOW A;  3ZGZ A;  3JW0 X;  2CS4 A;  2JZZ A;  2QEJ C;  1YQ3 B;  1IBX A;  2PEA A;  1WGQ A;  2D3B A;  5LLI A;  3TUO A;  1EUV B;  1MI0 A;  5D3D A;  3Q8B A;  5JH5 C;  1T0Q C;  3EPY A;  2MWS B;  2DA0 A;  3I63 C;  3DVN U;  1B9R A;  4R3D A;  3NHE B;  5C23 A;  1Q1O A;  4JWS C;  2KYW A;  5D3V A;  1J8C A;  1DOY A;  4DDI D;  1K5D B;  1WGK A;  2YEP B;  4BFR A;  5DHF B;  2ZEQ A;  5D3W A;  2JPH A;  4EZL A;  3Q8A A;  1FHX A;  1JCK B;  4PK1 A;  2D9W A;  2N7J A;  2AEH A;  1WM2 A;  2R61 A;  5GMV A;  3ZYY X;  1UBI A;  3NWA A;  1UPQ A;  1ZW7 A;  1PDX A;  4IM0 A;  1D4B A;  1AYF A;  2QCZ A;  1PGX A;  3EFC A;  4KDL B;  1N63 A;  2GCJ A;  4C4V B;  3ZO5 B;  5EDS A;  2BS4 B;  2KC2 A;  4O1N A;  3SFD B;  3U7D A;  3MP9 A;  1XF5 L;  5HE1 A;  3E9P A;  3V60 A;  2KMM A;  2W3S A;  5J3Q A;  1FXI A;  2BYE A;  1E8Z A;  4WIP A;  2KNB A;  4HAT B;  4HPL B;  2L3Z A;  4GZU A;  2N1V A;  2FCS A;  2J0M A;  2QSD A;  1PFD A;  2YF0 A;  2L52 A;  4K7S A;  4JPS A;  1K52 A;  4GDK A;  5C2T B;  2MH7 A;  2V3N A;  5DH9 B;  4F7U P;  1Q10 A;  3TL5 A;  3ZDT A;  3MC0 B;  3M3J A;  1XQQ A;  1F77 A;  2I38 A;  1C3T A;  1VR9 A;  1SF0 A;  3B2F A;  1SJE D;  1P1A A;  5DHA B;  2BT6 A;  1E7V A;  1K51 A;  4NJC A;  3EEC A;  4DHZ E;  5C1Z A;  3A8Q A;  4HXD A;  1MKE A;  3TMP B;  4HPM B;  1KJT A;  1PUT A;  2AQ2 B;  4PYZ A;  3HVZ A;  2CHZ A;  5G2N A;  3NW8 A;  3VTU A;  2LYD A;  4ZHO A;  2LI5 A;  4XYC A;  4WJQ A;  1BML C;  5E6P A;  1UGJ A;  2CRF A;  4BOZ B;  4IW0 A;  2LGD A;  1FRR A;  2IGG A;  4HRS A;  1PYW D;  3HSA A;  4IWO A;  5J3T A;  2LHE A;  4HLE A;  4LNK A;  4FHK A;  1QKZ A;  4XE0 A;  4WAF A;  1SSN A;  3KYC D;  4DXA B;  4IG7 B;  5IKC M;  2ZKM X;  2X38 A;  2JRI B;  2WXJ A;  2D5G A;  3BK1 A;  2MKR A;  1QOG A;  1QOF A;  2G9H D;  1V5T A;  1NU2 A;  3OJ4 B;  1KLG D;  2UZR A;  2KLG A;  3CST A;  4A90 A;  1WZ0 A;  2XBB C;  4HDO A;  2GCL A;  1V1O A;  4B6W A;  1BUI C;  2YT0 A;  3WA0 A;  4XGA B;  1BAK A;  2RNR B;  4L1B A;  3P4P B;  3QWM A;  5JXV A;  2FJU B;  2LGI A;  2WU2 B;  3BWU D;  1V8C A;  5CHW A;  2EMT A;  1YQ4 B;  3VUW A;  4RFB A;  2GBN A;  4C0A A;  1ESF A;  1UNR A;  3T8M A;  1UH6 A;  2WDT B;  1EU4 A;  2YSZ A;  1S3S G;  4K3B A;  4ZOH C;  1XCQ L;  2HJ1 A;  1MHH E;  4ITK A;  1L4Z B;  3IAM 1;  3VTV A;  2DKQ A;  1WR6 E;  1Z2M A;  1YJI A;  3RN9 C;  1KI1 B;  1LGR A;  3V6E B;  4S17 A;  5CHV C;  3ZW3 A;  3KZ1 A;  4JKE A;  2IBI B;  4OZA A;  2K39 A;  1RRB A;  2CKH B;  1XLP A;  1C76 A;  1QQG A;  2V3P A;  5JHB A;  3VHT C;  1JRO A;  1SGH A;  3U52 E;  1D5Z C;  2DIK A;  2RDG A;  1H4R A;  4ZRI A;  4Y94 A;  2B3A A;  3PS6 A;  2K6D B;  1CQV A;  4P16 A;  2KCJ A;  1OQQ A;  3Q14 C;  3VUX A;  3TVV A;  3PHX B;  4ANW A;  3L16 A;  1NYQ A;  2OED A;  2LRU A;  4MEL A;  2L1A A;  1NEN B;  3ML8 A;  1WM3 A;  1J7A A;  1TS2 A;  1J7B A;  1YIW A;  3HM3 A;  5JVL A;  4XDD A;  1LB1 A;  5HE3 A;  3DBH I;  3PO0 A;  2XEW A;  1WMH A;  2HTH A;  4G3X B;  1VBH A;  2V4I B;  3SDL C;  3H9D A;  2HE7 A;  2ROV A;  5IO9 A;  2DAJ A;  2KN4 A;  3TEW A;  5BO4 B;  2Q13 A;  2KLC A;  2PPH A;  3MC8 A;  4BVU C;  4ASW C;  2KT7 A;  2DLB A;  2LUM A;  2CU3 A;  2LG1 A;  2JWZ A;  3SD5 A;  3AE7 B;  1IGC A;  4AS1 A;  3FEH A;  3ZUN A;  1GUA B;  2WXH A;  4FHJ A;  3RD2 A;  1WE7 A;  1NDD A;  1T0R C;  4P6V F;  5C79 A;  3SBT A;  3VH4 B;  4A9A A;  3E9S A;  1Y19 B;  2KDB A;  4KHB A;  3N7C A;  2ADZ A;  3HUI A;  4W9J A;  4F1S A;  3W2D A;  3C8Y A;  3VFK A;  4IM2 A;  2NCN A;  5BYQ A;  4NAM A;  3ZRF A;  2GUM A;  3P4R B;  4BBN F;  4DBG A;  3B1L X;  1K5G B;  2C7M B;  2BYV E;  4LNO A;  5FK9 C;  4GPT B;  1F1H A;  1UEF A;  4G11 A;  3U2S C;  1E6E B;  3O65 B;  2ZVN A;  2PZ1 A;  3IT6 B;  1TIF A;  1WSP A;  3RUI B;  1E8X A;  5TSS A;  3TEY A;  1AW7 A;  1BXT A;  2RQ1 A;  4KVG B;  1T77 A;  1F2R I;  3IBE A;  4PQ0 A;  4JKG A;  3PLU A;  3DBL B;  2DHK A;  1HQR D;  3MDB C;  4XC2 A;  1JQ4 A;  2JZ3 B;  2PKO A;  5BMH A;  4BBN C;  3I57 A;  1ZYI A;  1YX5 B;  1QOA A;  2W2X C;  2O2V A;  1C78 A;  2LBB A;  2ZCC A;  1JDE A;  2L05 A;  2FBW B;  2B76 B;  3KSY A;  4BBK A;  3L10 B;  3RFZ B;  1WXA A;  1WRI A;  2BKF A;  3TEX A;  3ULC A;  1PFJ A;  2WX1 A;  4DHZ B;  2X18 A;  3Q6B A;  4ZYN A;  2IYB A;  2Z0E B;  3SYX A;  1XX0 A;  3E66 A;  1WX9 A;  5AUK A;  3KY9 A;  2KOX A;  3A33 B;  3SHQ A;  1P6S A;  2GMI C;  3Q8E A;  3DVN V;  1UWM A;  4HB2 B;  2RMM A;  1PGA A;  2D3A A;  3X23 A;  2J52 A;  5DIF B;  2QHO A;  3T06 A;  3PZD A;  4IAP A;  3D8E A;  2K0P A;  4ANU A;  3ETR A;  2IZV B;  4BZA A;  5BMI A;  2NS5 A;  1RWS A;  1XEE A;  2HDE A;  1E0Z A;  5D3Y A;  2LRW A;  2AYO B;  1L5P A;  4CQN A;  1FIQ A;  1P9D U;  4GDK B;  2KMC A;  3AE8 B;  2W55 A;  4TQ0 A;  2K8H A;  2Z14 A;  2COC A;  4D0N B;  1GNU A;  3PRP B;  4REZ A;  4PYU A;  3QJZ A;  1J0G A;  3WCQ A;  1K53 A;  4JK9 A;  3D8D A;  2W54 A;  1JML A;  1SE4 A;  5J3Y A;  2ZNV C;  4E71 A;  4DXG A;  1C9F A;  3M62 B;  3AEA B;  3PSE B;  3HIZ A;  2K1F A;  2N0S B;  3LYY A;  2L00 B;  4MAC A;  4FAD A;  2CU1 A;  3WAM A;  3FP5 A;  3TSS A;  3P2B A;  2K8B A;  4HCN B;  3PG7 A;  2KDI A;  5DI9 B;  1R4M I;  1XLQ A;  2W9N A;  2NBV A;  4IFS A;  1HB8 A;  2BYF A;  3QC8 B;  2AL3 A;  5J18 A;  3PVW A;  2M0X A;  1Y5O A;  1DYN A;  2FJL A;  2PE9 A;  1L6V A;  3EHV A;  2R2Y A;  1U5D A;  2IO2 B;  4TUU A;  4HKQ A;  2KX0 A;  3ZLZ A;  3BY4 B;  2EEL A;  2R82 A;  1BTN A;  2MDX A;  3R2T A;  3VIA A;  3H6N A;  2LVP A;  1BTK A;  1XO3 A;  4TQ1 A;  1WI0 A;  4KGR A;  3Q3J A;  1J7C A;  1ZXI A;  4MGK E;  1ZP0 B;  2W2W A;  2GBJ A;  4OZB A;  3RNG C;  2KDM A;  4HDQ A;  4EKU A;  1WGR A;  2WWZ A;  1MG8 A;  2ZNV B;  5LXI B;  1S1Q B;  2DYB A;  2KIE A;  2IY0 B;  2XK5 A;  4NPN A;  4MDK E;  1L6U A;  1TS4 A;  2K9X A;  3RNE C;  3AM9 A;  3MPX A;  2IYD B;  1KFY B;  2KAN A;  1YOV B;  1DRO A;  5HFY A;  3RPF C;  4K2P A;  2BGF A;  2N9K A;  4BKS D;  2GS0 A;  1WGG A;  2OJR A;  3Q3N C;  1P0R A;  5JZE B;  4XDC A;  4W9G A;  2QIE B;  3MJ5 A;  3NRZ A;  2KTR A;  1KBL A;  1GC7 A;  1EAZ A;  2KTF A;  1N61 A;  1IPG A;  2BS2 B;  4JK8 A;  1LW3 A;  3QK0 A;  4I6N B;  1EF1 A;  3CF6 E;  4C00 A;  1F52 A;  3PEG A;  1BWN A;  3QA8 A;  3SNH A;  2JQR B;  2Z59 A;  4YL8 A;  5EE3 A;  2V3S A;  3L54 A;  2NPT A;  3LDZ E;  1OMW A;  2MLB A;  2W82 A;  3C0R B;  1OQY A;  1QZE A;  1ZGU B;  3SFE B;  1UNS A;  4ZRK A;  3AMZ A;  1TZO A;  3QX1 A;  3HM6 X;  1YQB A;  2K22 A;  3A1Q A;  2BBC A;  2H88 B;  3B2G A;  5DPS A;  2MJE A;  4WWP A;  2WX0 A;  2TSS A;  1L7Y A;  5H92 C;  4RM8 A;  3FC4 A;  5MPO A;  2INP E;  3F5R A;  1NBF C;  2ZW1 A;  2K49 A;  3F0W A;  1CK1 A;  3DQV A;  1TS5 A;  2KJH B;  2PIA A;  1ZVR A;  1BT0 A;  1EWC A;  1Q5W B;  1U4A A;  3NSU A;  4M0W A;  3HVD A;  2LOX A;  2G3Q B;  2JU6 X;  2KWC A;  1VCB A;  4IOI E;  3N1Y C;  3DBL I;  4E3C A;  2VH1 A;  3PRZ A;  2V9H A;  1KM7 A;  4HAY B;  3L0W B;  2FDQ A;  4KHB B;  5KQ1 A;  3V05 A;  1GG3 A;  2UVM A;  2VZK D;  4EE2 A;  2G45 B;  4DK5 A;  1L2N A;  3W5U B;  2ICI A;  1DIK A;  1C79 A;  4HB3 B;  4GNK B;  2NTT A;  1VRA B;  3P63 A;  3I9V 1;  2KQ7 A;  4F7Z A;  1WGU A;  4WUR A;  2M4N A;  5CHF A;  3PZ8 A;  2Z0P A;  1TKY A;  3UIN B;  4WJO A;  1V6E A;  2Y7B A;  4RGT A;  4KHO A;  1D5X C;  4RGO S;  4B95 A;  5C16 A;  4JKG B;  4X57 B;  2MHJ A;  1LQB A;  4DHJ D;  3R7R A;  1AQC A;  4WWM A;  2MBQ A;  5G5G A;  3CWI A;  5BYR A;  4CHJ A;  1NYR A;  2LGS A;  2JSV X;  2KVZ A;  2ZPN A;  2KWV B;  2L0F A;  4Q2J A;  2NMQ A;  5JHA A;  3BVZ A;  3N1Z C;  5D6J B;  1NTV A;  2D10 A;  3QCA A;  2MFQ A;  3HRD D;  4M02 A;  2CJO A;  2CY4 A;  2KUP A;  2R2O A;  3VR9 B;  2HRJ A;  2L2I A;  2L7R A;  2PMV A;  4CYE A;  4GMX B;  1GAQ B;  4IM3 A;  1A70 A;  1DDM A;  4BAX A;  4IWQ A;  4QJ4 B;  5C6R A;  4QXA B;  2MJD A;  1EVH A;  1J19 A;  4K17 A;  4II2 B;  3MC9 A;  1I4G A;  2LVQ A;  4GU2 A;  3GB1 A;  2BTE A;  3NVZ A;  4XX5 A;  2LOZ A;  4EZK A;  1CJE A;  1WG7 A;  1MK9 B;  4JKF A;  3JYU A;  4ILH A;  4W9C A;  1E8W A;  4ANV A;  1I7A A;  2K25 A;  4L1R A;  4II3 B;  3V5W A;  2KXJ A;  2H89 B;  3V3X A;  1WJN A;  2D11 A;  3P7Z A;  3ZJT A;  4IC7 B;  2Y8G A;  2GBK A;  3VRB B;  2RRF A;  2KDF B;  2ABD A;  2ONQ A;  2Z0Q A;  1X1M A;  5HE2 A;  3SEB A;  3DXE A;  1AWE A;  5DCN A;  4W9L A;  1Q67 A;  4FJY A;  1P3Q U;  4RCO A;  3AEF B;  1YN4 A;  4CSQ A;  3ZJU A;  2XQN M;  5CTR C;  1GOZ A;  3AU4 A;  2JWU A;  2PJH A;  4YTN B;  1VJK A;  1T6B X;  4RGM A;  3R3M A;  2KKC A;  4GLS C;  1OQN A;  5KCV A;  4ACF A;  1W1G A;  1WJU A;  1X11 A;  3QWZ B;  2WDQ B;  5JHG A;  2INC C;  2K5P A;  1M94 A;  1U5E A;  2MWN B;  4LNN A;  2EC1 A;  1F9J A;  1XT9 B;  3DXD A;  4AWJ A;  3WIM A;  3PSC A;  1ET6 A;  1YJJ A;  3QBV B;  2LFI A;  2UU7 A;  2FCM A;  2ZW0 A;  2L83 A;  1WR1 A;  4KZ0 A;  1YMH E;  4P1B C;  4US8 A;  1OEY A;  1C4P A;  2KWD A;  2OJW A;  2WGS A;  2NBV B;  5AUI A;  4D6W A;  4GXB A;  3Q8F A;  3C19 A;  3P4Q B;  1MIZ B;  1LO5 D;  2ZVO A;  2FE8 A;  1SIF A;  3RCP A;  4IUM B;  4LNF A;  3WYF B;  1JWA D;  1EF5 A;  2VZK B;  1VZ7 A;  4A55 A;  4A6F A;  1ZUD 2;  1WJ1 A;  4ZRQ A;  4N59 A;  2V4L A;  2KIG A;  4ZYS A;  2DNF A;  3R7Q A;  3HHM A;  1VBG A;  3PVL A;  1R4M B;  1FCL A;  1WIA A;  3VDZ A;  1VZ8 A;  1FHO A;  3SU8 X;  3AH7 A;  4YSY B;  1XD3 B;  3NJT A;  2KC1 A;  2IGH A;  1HZ5 A;  3SV1 A;  1RRP B;  1FRD A;  4CO7 A;  2Y3A A;  1YNT E;  2N7E A;  4HCP B;  3RZF A;  2JYT A;  1SB3 C;  4FJV B;  2DTC A;  1FCC C;  1KLU D;  2KHW B;  4KDI C;  4RMA A;  2H7D A;  5D2M B;  4MGY E;  1FHW A;  1HTO A;  4GOC A;  3EUB 2;  2JXT A;  4DHJ B;  1FOE A;  2N4F A;  1QC6 A;  1UZX B;  1WJ4 A;  1XLO A;  4WQM A;  4ARI A;  4EMO A;  1IYF A;  2WXG A;  4HAU B;  2Z13 A;  1V88 A;  4EUT A;  1UUP A;  1YX6 B;  1ZKH A;  4A8X C;  1N3H A;  3RUL A;  4MK0 A;  2C9W B;  3CSF A;  2C7N B;  4N6E B;  4WJ7 A;  2KTR B;  4C80 A;  2L8J A;  2KQ4 X;  1F0Z A;  1OTR B;  1FNU A;  1KH0 A;  3ZNZ B;  2WDV B;  2PE6 B;  4B9K A;  4GDL A;  3U4E G;  2YT1 A;  1RAX A;  1H10 A;  1HEZ E;  3NVW A;  2LWP A;  2DBY A;  3UIO B;  3W1S A;  3H7P A;  2NPT B;  1LXD A;  1KLV A;  4LLG M;  3VH3 B;  3D32 A;  3VXW A;  3KRX A;  4XWX A;  3A1Q B;  3KUC B;  1N62 A;  2M38 A;  3A9K B;  5J17 A;  1WXM A;  4S0R A;  2D9Y A;  1GB1 A;  2DX5 A;  4FJZ A;  3OAW A;  3R8B A;  4ICV A;  3U30 A;  4I6P A;  2COP A;  3NVY A;  3WAL A;  3DCX A;  4LDT D;  2COD A;  1EM7 A;  2M14 A;  2RSG A;  3OG5 A;  4RF0 A;  3SO6 A;  2ZCB A;  4YON A;  4JQW C;  4M0W B;  2ROZ B;  3Q3F A;  5I2S A;  2YVC A;  3FAH A;  3FVC A;  3FSS A;  1DBH A;  3IFW B;  5FKA C;  4DDG D;  2FUG 1;  2KWU B;  3DBR B;  1WX7 A;  3O13 A;  2O6V A;  3JSV A;  1X05 A;  3QAQ A;  2XNA C;  4MGZ E;  1PLS A;  4URK A;  4JKD A;  2FIF A;  3JVZ X;  2BS3 B;  1W1H A;  2BW2 A;  1IBX B;  2D07 B;  3QIJ A;  5GOW B;  5JLJ B;  1UGM A;  4YSX B;  2L76 A;  3L08 A;  4JWU C;  3APD A;  1WF9 A;  4W9I A;  5LG4 B;  2RVB B;  5M4Y B;  2YLM A;  1IRS A;  2KR0 A;  4W9D A;  1I4Q A;  1HTQ A;  3ZXV A;  5D3I B;  3P4S B;  4ZRJ A;  2CJN A;  3LXF A;  5LXH A;  1DYQ A;  1XR0 B;  3PPA A;  3ZIM A;  4B0E A;  2MBB B;  3RNC C;  3CIR B;  4KKJ A;  3VQI A;  1P5T A;  3TO1 A;  3W1Y A;  1CMX B;  1MK7 B;  1D3Z A;  3AEG B;  3BYT B;  5EE1 A;  5D3X A;  5JHH A;  1T0Y A;  2M8S A;  1M7E A;  2MCN B;  1FFV A;  3LJ3 A;  3PV1 A;  2KJ6 A;  2IND C;  3DHG C;  1X1F A;  1I7H A;  3TIX A;  2UZS A;  1V5P A;  3AXC A;  3N32 A;  3FKY A;  4KAX B;  4A6H A;  4RNA A;  4GMV A;  4HB4 B;  3A4S C;  4MEM A;  2WXO A;  2PW9 A;  4QJ3 B;  2COA A;  4A6K A;  2GBR A;  2IJ0 A;  1SXT A;  2GBM A;  2A5U A;  3IXS A;  3ZRC A;  1UNP A;  4NQL B;  1V9J A;  1STE A;  4AUQ C;  4ZDV A;  2WXP A;  3W5V B;  4EJN A;  2MBH A;  3ZXR A;  1WJM A;  4ANX A;  3WAP A;  1Z5S B;  2WU5 B;  2XN9 C;  1B1Z A;  3URY A;  1KOT A;  2IO0 B;  1V2Y A;  4P1C C;  1PQS A;  3M95 A;  2ACZ B;  3T9L A;  3VTW A;  4JKA A;  2GB1 A;  3IAS 1;  3G9W A;  1V5O A;  2K2U A;  1SJH D;  3Q3M C;  5H8Y E;  3AB5 A;  2IGD A;  1TT5 B;  2QJL A;  3HIE A;  4XWT A;  4HJK A;  5D7G A;  3J9C A;  1QT9 A;  3NZU A;  2KJR A;  4H8S A;  3PZ7 A;  4C56 C;  3BK2 A;  1QF6 A;  1NEK B;  1GPX A;  3IVF A;  1MJD A;  4GB9 A;  2UWQ A;  2IFS A;  2WXN A;  3Q8C A;  3V6C B;  1ZPS A;  4AJW A;  4MT5 A;  2CHW A;  2ZJD A;  3N1X C;  1X1G A;  2VRW B;  3RI7 C;  2O6V D;  1ZSQ A;  2NTS A;  4LJO B;  4HK2 A;  2W3R A;  4LDT B;  4FA6 A;  3PLV A;  5KHO A;  1SE9 A;  1E8Y A;  4RGN A;  3ZVV A;  2MEK A;  1ACA A;  4MY6 A;  3Q2A C;  4KGS A;  2FID A;  4TKN A;  2JVC A;  2MRP A;  1SIJ A;  1WVH A;  4IWP A;  2D4Q A;  4JKC A;  3VUY A;  3ML9 A;  1JWB D;  1FXT B;  3KUZ A;  3A58 A;  1B55 A;  2VSZ A;  2BKR B;  3SBG A;  2DN6 A;  4GN1 A;  4RM9 A;  3ZQ4 A;  4WH4 A;  3HW2 B;  3AED B;  1TY0 A;  1U5F A;  2AX5 A;  2WP9 B;  4XZ4 A;  4HB0 B;  2IPK D;  5C3J B;  1ZM0 A;  4W9E A;  1XCT L;  1P98 A;  2SEB D;  3VOQ A;  4OVZ A;  4K3C A;  4EFO A;  3UGB B;  1QQR A;  1QIL A;  2M0A A;  1UEL A;  1V86 A;  3BVG A;  5LNK 1;  2WXM A;  4HKZ E;  2PLP A;  4OZC A;  1GB4 A;  1VD2 A;  2ELB A;  4GSW A;  3UIP B;  1JRU A;  5L83 A;  4XWW A;  1UF0 A;  3NWD A;  3AE1 B;  4TSS A;  3A9J A;  1V81 A;  3N30 A;  1OFF A;  1XLN A;  1RYJ A;  2G1E A;  4TYZ A;  3OJ3 A;  2MP2 A;  2IY1 B;  3KH0 A;  1HE8 A;  4DQO C;  2BF8 B;  2V1Y A;  1J0W A;  1C4C A;  4JLC A;  1WGH A;  3IT4 B;  4DBB A;  1E7U A;  1MIX A;  3AV8 A;  4J3O D;  2H7E A;  2G4D B;  1HBK A;  1KZG A;  1NTI A;  2N9L A;  4LK0 M;  4LJP B;  1ACC A;  3U12 A;  3B77 A;  1L4D B;  4GDL B;  3ODW A;  4L2Y A;  4WJN A;  4GIV A;  3CXB B;  3CMM B;  5IA7 A;  1E7P B;  3APF A;  1RJ2 A;  1WMH B;  1U27 A;  2HTH B;  3ZVR A;  2MBO A;  2CY5 A;  3H7P B;  1VZ6 A;  3TEZ A;  3GP7 A;  4M8M A;  1NI3 A;  1L0V B;  4JKB A;  1K50 A;  5E6N A;  1P3R A;  2FCN A;  3NOB A;  2SAK A;  3IHP C;  1WX8 A;  3DBR I;  1IGD A;  2EKI A;  1C1Y B;  3FM8 C;  1FD6 A;  4BKS A;  1NVI D;  3KQ4 A;  1TKE A;  2VKI A;  3S2A A;  1D6E C;  2DX5 B;  2J53 A;  4PS3 A;  1KRH A;  3L13 A;  2WQY B;  3LJU X;  1MG4 A;  2RPV A;  2NBU A;  1ZOY B;  1F2R C;  1HZ6 A;  1WRD B;  2PTL A;  3AN1 A;  2WH5 A;  2RDB C;  2KX3 A;  2ZPY A;  4JE3 B;  5CX3 A;  2J7Q B;  4YT0 B;  5JP4 A;  1UNQ A;  3PP2 A;  3ODO A;  2FCQ A;  1I35 A;  2OTX A;  1IP9 A;  1E9M A;  1SE3 A;  3UQB A;  3ENB A;  1XKE A;  1LFD A;  1V97 A;  2BWE S;  2EMS A;  3AE3 B;  2BB5 A;  3EFU A;  4OHJ A;  3PHW B;  2BQQ A;  4AOF A;  4HWI B;  2O6V B;  2KZR A;  1QOB A;  2LXA A;  3M63 B;  4G50 A;  4MJS A;  2E6X A;  3T3N A;  1E5W A;  2WXK A;  3KVF B;  1EWY C;  3D8F A;  2BYT A;  1OY2 A;  3KWV A;  2NZ8 B;  3NS1 A;  3Q69 A;  4F8C B;  2LGX A;  4OW0 A;  1FB8 A;  2Y5C A;  2ELA A;  3NY5 A;  3ZNH B;  3ZNI D;  4YTP B;  3ODX A;  1V49 A;  1PGB A;  3EA6 A;  4CHK A;  1T3Q A;  1E10 A;  1ZDV A;  3DWM A;  3TCA A;  2O2V B;  2WS3 B;  4EZJ A;  5AZH A;  2KN5 A;  5EFX A;  3MHZ A;  1YD8 U;  4MGI E;  3RMK C;  5HE0 A;  5EE9 A;  2I1K A;  3AJ4 A;  3KRW A;  3BYY B;  2QKM A;  5LON B;  2M19 A;  3H7S A;  2DZM A;  2LD9 A;  1H8C A;  3APC A;  5G55 A;  5AEK B;  4LNI A;  4PT5 A;  5L81 A;  1M7R A;  4A6Q A;  3MTN B;  1T0S C;  2RUK B;  3GOE A;  1FGY A;  1SBB B;  3GS2 A;  4J6I A;  4DX8 A;  1MAI A;  4WSF A;  3PTF C;  1RM6 C;  4HVB A;  1HXY D;  2LVO A;  3DCG A;  1DOI A;  5AZG A;  4I6L B;  2QMT A;  3NZ3 A;  2RPQ A;  2CQU A;  3NG0 A;  3PRE A;  3N9Y C;  1W1D A;  1I4H A;  2Z0D B;  1I4X A;  3R66 C;  2CB8 A;  3OAN A;  2K8C A;  1FFU A;  2D2Q A;  1WYW B;  4OVU A;  2KGX B;  2M56 B;  3LB8 C;  5IAA C;  5C5B A;  3O96 A;  1XD4 A;  1RFK A;  4IKG A;  2LGY A;  1XCG A;  4D2K A;  2G4S A;  1DDV A;  4MSM B;  1L0Y B;  3X0W A;  1WI1 A;  2N23 A;  2D9V A;  4Z2N A;  4HEA 1;  1XXG A;  3KWL A;  1ET9 A;  3RT3 B;  3TFM A;  1WY8 A;  2WNM A;  1TZ1 A;  3KYD D;  1RFA A;  2HTM E;  4KZC A;  4K1R B;  4MSQ B;  4NQK E;  3ZDM C;  2LUL A;  5D94 A;  4NSW A;  3FIL A;  4F7H A;  3OLM D;  5IOI A;  3SR6 A;  3A98 B;  2J0K A;  3MFG A;  4TV3 A;  4C7Z A;  4ICU A;  3B9J A;  1I4P A;  4PS8 A;  5FR6 A;  2C60 A;  3P1M A;  2DZK A;  4KIK A;  3DDC B;  3VRA B;  4F7G A;  2DYN A;  5EE0 A;  2Q5W D;  3KW5 B;  1TQZ A;  1R7S A;  1NTY A;  1JW9 D;  2MX2 A;  1P7E A;  1C77 A;  4MH0 E;  3DBS A;  1M4V A;  2AQ1 B;  2N9X A;  3A4R A;  4WWO A;  1JWS D;  2REX A;  4NY0 A;  1N6Z A;  3E56 A;  3A8P A;  4GGQ A;  2DYO A;  2DWQ A;  4AQ7 A;  3AE6 B;  1KC7 A;  3R2I A;  2DFK A;  1KTK A;  4FUL A;  1WYG A;  1ST7 A;  1AWD A;  2LUE A;  4USA A;  1G6J A;  3DVG Y;  2N1W A;  3GZN I;  4OSN A;  2NBW B;  3QAR A;  2XK5 B;  1DGJ A;  4HHV A;  1KZ7 A;  2P0H A;  4MT7 A;  2DZI A;  4NAW A;  1EGX A;  2GOW A;  1N60 A;  4TMA B;  4WWN A;  2D3C A;  4NJ7 A;  3VAW A;  2QKL A;  3H1U A;  3AE4 B;  4K81 A;  2DHJ A;  4N9F 4;  3TW1 A;  5IJM A;  2K3U A;  2R2Q A;  4YSZ B;  1U5G A;  2MBE A;  2KFK A;  4JGH B;  3WAO A;  3SUZ A;  3HQC A;  3UZT A;  2WYQ A;  4ILG B;  3HK0 A;  3A9J B;  3DPD A;  1Q0W B;  4JL9 A;  4AP4 C;  4Z2M B;  2M1M A;  4W9K A;  4DX9 0;  1TS3 A;  3AI5 A;  1FNV A;  3ZTC A;  1EU3 A;  1UD7 A;  2MP2 B;  2N0Y A;  4KGT A;  1YN3 A;  3BII D;  2K00 A;  2L32 A; 
#chains in the Genus database with same CATH homology
 3P6A A;  2Z59 B;  5DPT A;  1R4N I;  3I3T B;  4MM3 A;  4A20 A;  2MW5 A;  2W2X D;  3L17 A;  3AU5 A;  2Y5B B;  3QQ8 B;  5FI0 A;  4W9F A;  1SHC A;  3ML4 A;  4P7I A;  2OOB B;  3ECI A;  2KD0 A;  4M8N A;  1TBE A;  3NZS A;  2E2X A;  2CAY A;  2KQS A;  2DX1 A;  1WJ6 A;  3B08 A;  1TJ6 A;  2J0J A;  2RD0 A;  2JF5 A;  2FAZ A;  5E6O A;  4JKH A;  3V62 A;  2P0D A;  2Y8F A;  3FLV A;  5LOP B;  2JUO A;  1I2H A;  3IG3 A;  4KV2 A;  3ENE A;  1FAO A;  2IO1 B;  2R09 A;  2KDE B;  3PT2 B;  1V5U A;  1I42 A;  1RLF A;  5DPW A;  2JP2 A;  2KMA A;  1MPH A;  4WAA A;  3ULB A;  2AWT A;  2BCJ A;  2RGN B;  1FGZ A;  3AUL A;  1XOD A;  3PGE A;  2RLO A;  2HJ8 A;  3UQA A;  5J2R A;  4MJS B;  4WVF B;  1WGD A;  2C5L C;  5AZF A;  1K8R B;  3V61 A;  2RSU A;  2YS3 A;  2RR9 A;  3RZW C;  1OGW A;  3CIK A;  2EKE C;  2DLW A;  1UBQ A;  2UYZ B;  2D3G A;  1OEY J;  4NJ6 A;  5CLL B;  3NS8 A;  1TXD A;  2NMB A;  3ZTD A;  2LAS A;  3ZNG C;  4KHA A;  2C7H A;  5TR5 A;  1PMS A;  3MJW A;  1DDW A;  2RGF A;  2DEN B;  2KFJ A;  2HD5 B;  1V89 A;  4DWF A;  3K9P B;  4AJY B;  2JRH A;  4EEW A;  4HAZ B;  4EOY A;  2BWF A;  1YJ1 A;  3M1I B;  4IOY X;  5CLQ B;  2N7D A;  1GC6 A;  3MHS D;  5HKH A;  2MQJ A;  4HAX B;  4CHM A;  1TTN A;  1A5R A;  4FN2 A;  1WZ3 A;  2CR5 A;  4HAW B;  5C5B B;  2A4Z A;  3PRM B;  3ALB A;  4B6H A;  1Z87 A;  3ONS A;  3RYT A;  1U2B A;  4KSK C;  5KQ4 A;  3K9O B;  2D9X A;  1WXV A;  4HAV B;  4KSL C;  3BJI A;  1E90 A;  3DVG X;  4BKT A;  4K7W A;  3ZKJ C;  3BIN A;  2LJ5 A;  2DZJ A;  2YRY A;  4E74 A;  2KVR A;  4FBJ B;  2AL6 A;  2MA9 B;  2EJ8 A;  2K2J A;  4KIK B;  3UF8 A;  4JIO U;  2N9E B;  3VVW B;  2CHX A;  3RCZ A;  1GJZ A;  2DHI A;  3TJP A;  4A6F B;  2L0T A;  2JXX A;  2LXC A;  5L95 C;  2V76 A;  2KK8 A;  5FI1 A;  2YS1 A;  2DAF A;  2Z0O A;  1V5M A;  3W1S C;  4A5K A;  2D9Z A;  1TGZ B;  1NI2 A;  2I5C A;  2IO3 B;  2L1C A;  4K2O A;  2I5F A;  4JK7 A;  4PS7 A;  2R0D A;  1WXS A;  4BOS C;  1WFY A;  4FLH A;  2LZ6 A;  4NAW B;  3WAN A;  2J59 M;  4PNK A;  4LCD E;  1UPR A;  4L6E A;  4WJP A;  2COF A;  2KFK B;  2M17 A;  2KO3 A;  3KUD B;  2MSE D;  2K6Q A;  3B0A A;  3U8Z A;  2NR2 A;  2P8V A;  2DYQ A;  3E9O A;  2VRR B;  4A3O A;  2DHZ A;  3GYP A;  4G0N B;  2OQB A;  2ASQ A;  1Y8R C;  2N9P C;  2FNJ B;  2YS5 A;  1WH3 A;  1ZC3 B;  2FUH B;  3PVU A;  2LKO A;  3DXC A;  1LM8 B;  3GYO A;  4OVV A;  5DPR A;  2X0S A;  3QHT A;  1WE6 A;  1V61 A;  5D27 A;  4NNJ B;  3A9K A;  3E9L A;  1V80 A;  1ISN A;  1EO6 A;  2I1J A;  2BPS A;  2JY6 A;  3N3K B;  1GGO A;  1HB6 A;  2FJ9 A;  2DKP A;  4A3P A;  2JT4 B;  4ILJ A;  1WGY A;  3TBL D;  1X86 A;  2NVU I;  1ZC4 B;  2G35 A;  2ZZP B;  2GJY A;  4WQO B;  3JSV B;  3EC8 A;  1AAR A;  1U29 A;  4K7U A;  5KHQ A;  2DYM A;  4BKG A;  4W9H A;  2P0F A;  1NVL A;  3DOW A;  3JW0 X;  2CS4 A;  2JZZ A;  2PEA A;  1WGQ A;  5LLI A;  1EUV B;  5JH5 C;  3EPY A;  2MWS B;  2DA0 A;  3DVN U;  3NHE B;  5C23 A;  1Q1O A;  5D3V A;  1J8C A;  4DDI D;  1K5D B;  4BFR A;  5DHF B;  2ZEQ A;  5D3W A;  2JPH A;  4EZL A;  1FHX A;  2D9W A;  2AEH A;  1WM2 A;  5GMV A;  1UBI A;  1UPQ A;  1ZW7 A;  4IM0 A;  4KDL B;  2GCJ A;  3ZO5 B;  5EDS A;  2KC2 A;  3U7D A;  5HE1 A;  3E9P A;  3V60 A;  5J3Q A;  2BYE A;  1E8Z A;  2KNB A;  4HPL B;  4HAT B;  2L3Z A;  4GZU A;  2N1V A;  2FCS A;  2J0M A;  2YF0 A;  4K7S A;  4GDK A;  5DH9 B;  4F7U P;  3TL5 A;  4BKS D;  3ZDT A;  3M3J A;  1XQQ A;  1C3T A;  1P1A A;  5DHA B;  1E7V A;  5C1Z A;  3EEC A;  4DHZ E;  3A8Q A;  4HXD A;  1MKE A;  3TMP B;  4HPM B;  1KJT A;  4PYZ A;  2CHZ A;  5G2N A;  3VTU A;  2LYD A;  2LI5 A;  4WJQ A;  5E6P A;  4BOZ B;  2CRF A;  4IW0 A;  2LGD A;  4IWO A;  5J3T A;  4HLE A;  4FHK A;  3KYC D;  4DXA B;  4IG7 B;  2JRI B;  2MKR A;  1V5T A;  1NU2 A;  3OJ4 B;  2KLG A;  2UZR A;  3CST A;  1WZ0 A;  2XBB C;  4HDO A;  2GCL A;  4B6W A;  2YT0 A;  3WA0 A;  1BAK A;  2RNR B;  3QWM A;  5CHW A;  2EMT A;  3VUW A;  2GBN A;  4C0A A;  1UNR A;  3T8M A;  1UH6 A;  2WDT B;  2YSZ A;  1S3S G;  3VTV A;  2DKQ A;  1WR6 E;  1Z2M A;  1KI1 B;  3V6E B;  5CHV C;  3ZW3 A;  3KZ1 A;  4JKE A;  2IBI B;  2K39 A;  1RRB A;  2CKH B;  1QQG A;  5JHB A;  3VHT C;  1SGH A;  2DIK A;  1H4R A;  4ZRI A;  4Y94 A;  2B3A A;  3PS6 A;  2K6D B;  2KCJ A;  3VUX A;  3TVV A;  3PHX B;  4ANW A;  3L16 A;  2LRU A;  4MEL A;  3ML8 A;  1WM3 A;  1YIW A;  3HM3 A;  5JVL A;  1LB1 A;  5HE3 A;  3DBH I;  2XEW A;  1WMH A;  2HTH A;  4G3X B;  1VBH A;  3SDL C;  3H9D A;  2HE7 A;  2ROV A;  2DAJ A;  5BO4 B;  2Q13 A;  2KLC A;  2PPH A;  4BVU C;  4ASW C;  2LG1 A;  2JWZ A;  3SD5 A;  3FEH A;  3ZUN A;  1GUA B;  4FHJ A;  3RD2 A;  1WE7 A;  1NDD A;  5C79 A;  3SBT A;  3VH4 B;  1Y19 B;  2KDB A;  3N7C A;  2ADZ A;  4W9J A;  4F1S A;  3VFK A;  4IM2 A;  2NCN A;  3ZRF A;  4BBN F;  4DBG A;  3B1L X;  1K5G B;  2C7M B;  2BYV E;  4GPT B;  1UEF A;  4G11 A;  3O65 B;  2ZVN A;  2PZ1 A;  3RUI B;  1E8X A;  2RQ1 A;  4KVG B;  3IBE A;  4PQ0 A;  4JKG A;  3PLU A;  2DHK A;  4XC2 A;  3MDB C;  2JZ3 B;  4BBN C;  1YX5 B;  2W2X C;  2O2V A;  2LBB A;  2ZCC A;  1JDE A;  2L05 A;  3KSY A;  4BBK A;  3L10 B;  1WXA A;  2BKF A;  3ULC A;  1PFJ A;  2WX1 A;  4DHZ B;  2X18 A;  4ZYN A;  2IYB A;  2Z0E B;  3SYX A;  1XX0 A;  3E66 A;  1WX9 A;  3KY9 A;  2KOX A;  3A33 B;  3SHQ A;  1P6S A;  2GMI C;  3DVN V;  4HB2 B;  3X23 A;  5DIF B;  2QHO A;  3T06 A;  3PZD A;  4IAP A;  3D8E A;  4ANU A;  2IZV B;  2NS5 A;  5D3Y A;  2LRW A;  2AYO B;  1P9D U;  4GDK B;  2KMC A;  4TQ0 A;  2K8H A;  2COC A;  4D0N B;  1GNU A;  3PRP B;  4PYU A;  3QJZ A;  1J0G A;  4JK9 A;  3D8D A;  5J3Y A;  2ZNV C;  4E71 A;  3M62 B;  3PSE B;  3HIZ A;  2K1F A;  2L00 B;  4FAD A;  2CU1 A;  3WAM A;  3FP5 A;  3P2B A;  4HCN B;  2K8B A;  3PG7 A;  2KDI A;  5DI9 B;  1R4M I;  2W9N A;  4IFS A;  1HB8 A;  2BYF A;  3QC8 B;  2AL3 A;  5J18 A;  3PVW A;  2M0X A;  1Y5O A;  1DYN A;  2FJL A;  2PE9 A;  3EHV A;  1U5D A;  2IO2 B;  4TUU A;  2KX0 A;  3ZLZ A;  3BY4 B;  2R82 A;  1BTN A;  2MDX A;  3VIA A;  3H6N A;  2LVP A;  1BTK A;  4TQ1 A;  1WI0 A;  4MGK E;  3Q3J A;  2W2W A;  2GBJ A;  4HDQ A;  4EKU A;  1WGR A;  2WWZ A;  1MG8 A;  2ZNV B;  5LXI B;  1S1Q B;  2DYB A;  2IY0 B;  2XK5 A;  4NPN A;  4MDK E;  3MPX A;  2IYD B;  2KAN A;  1DRO A;  4K2P A;  2BGF A;  2GS0 A;  1WGG A;  2OJR A;  1P0R A;  5JZE B;  4W9G A;  2KTR A;  1KBL A;  1GC7 A;  1EAZ A;  2KTF A;  1IPG A;  4JK8 A;  3QK0 A;  1LW3 A;  4I6N B;  1EF1 A;  3CF6 E;  3PEG A;  1BWN A;  3QA8 A;  3SNH A;  4YL8 A;  2V3S A;  3L54 A;  2NPT A;  3LDZ E;  1OMW A;  2MLB A;  3C0R B;  1OQY A;  1QZE A;  1ZGU B;  4ZRK A;  3QX1 A;  3HM6 X;  1YQB A;  3A1Q A;  5DPS A;  4WWP A;  2WX0 A;  1L7Y A;  4RM8 A;  3F5R A;  1NBF C;  3F0W A;  3DQV A;  2KJH B;  1ZVR A;  1BT0 A;  1Q5W B;  1U4A A;  3NSU A;  2LOX A;  2G3Q B;  2KWC A;  1VCB A;  3DBL I;  4E3C A;  3PRZ A;  1KM7 A;  4HAY B;  3L0W B;  2FDQ A;  4KHB B;  5KQ1 A;  1GG3 A;  2UVM A;  2G45 B;  4DK5 A;  1L2N A;  1DIK A;  4HB3 B;  2KQ7 A;  4F7Z A;  1WGU A;  2M4N A;  5CHF A;  2Z0P A;  3UIN B;  4WJO A;  1V6E A;  2Y7B A;  4KHO A;  4B95 A;  5C16 A;  4JKG B;  4X57 B;  1LQB A;  4DHJ D;  3R7R A;  1AQC A;  2MBQ A;  4CHJ A;  2ZPN A;  2KWV B;  2L0F A;  5JHA A;  5D6J B;  1NTV A;  2D10 A;  3QCA A;  2MFQ A;  2CY4 A;  2KUP A;  2R2O A;  2HRJ A;  2L2I A;  2L7R A;  4CYE A;  4GMX B;  4IM3 A;  1DDM A;  4IWQ A;  5C6R A;  1EVH A;  1J19 A;  4K17 A;  4II2 B;  2LVQ A;  4GU2 A;  4XX5 A;  2LOZ A;  4EZK A;  1WG7 A;  1MK9 B;  4JKF A;  3JYU A;  4ILH A;  4W9C A;  1E8W A;  4ANV A;  1I7A A;  2K25 A;  4II3 B;  3V5W A;  2KXJ A;  1WJN A;  2D11 A;  3P7Z A;  4IC7 B;  2Y8G A;  2GBK A;  2KDF B;  2ABD A;  2Z0Q A;  1X1M A;  5HE2 A;  3DXE A;  1AWE A;  5DCN A;  4W9L A;  1Q67 A;  4FJY A;  1P3Q U;  2XQN M;  5CTR C;  3AU4 A;  2PJH A;  3R3M A;  2KKC A;  1OQN A;  5KCV A;  1W1G A;  1WJU A;  1X11 A;  3QWZ B;  5JHG A;  1M94 A;  1U5E A;  2MWN B;  2EC1 A;  1F9J A;  1XT9 B;  3DXD A;  4AWJ A;  3WIM A;  3PSC A;  3QBV B;  2FCM A;  1WR1 A;  4KZ0 A;  1OEY A;  2NBV B;  4GXB A;  1MIZ B;  2ZVO A;  1SIF A;  3RCP A;  4IUM B;  3WYF B;  1EF5 A;  4A6F A;  1WJ1 A;  2V4L A;  3R7Q A;  3HHM A;  1VBG A;  3PVL A;  1WIA A;  3VDZ A;  1FHO A;  3SU8 X;  1XD3 B;  2KC1 A;  3SV1 A;  1RRP B;  4CO7 A;  2N7E A;  4HCP B;  3RZF A;  4FJV B;  2DTC A;  2KHW B;  4KDI C;  4RMA A;  2H7D A;  5D2M B;  4MGY E;  1FHW A;  4GOC A;  4DHJ B;  1FOE A;  2N4F A;  1QC6 A;  1UZX B;  1WJ4 A;  4EMO A;  1IYF A;  4HAU B;  1V88 A;  4EUT A;  1YX6 B;  1ZKH A;  1N3H A;  3RUL A;  4MK0 A;  2C9W B;  3CSF A;  2C7N B;  4WJ7 A;  2KTR B;  2L8J A;  1OTR B;  3ZNZ B;  2PE6 B;  4B9K A;  4GDL A;  2YT1 A;  1RAX A;  1H10 A;  2LWP A;  3UIO B;  3W1S A;  3H7P A;  2NPT B;  1LXD A;  1KLV A;  3VH3 B;  3D32 A;  3VXW A;  3KRX A;  4XWX A;  3A1Q B;  3KUC B;  2M38 A;  3A9K B;  5J17 A;  1WXM A;  2D9Y A;  2DX5 A;  4FJZ A;  3OAW A;  4ICV A;  3U30 A;  4I6P A;  2COP A;  3WAL A;  4LDT D;  2COD A;  2M14 A;  2RSG A;  3SO6 A;  2ZCB A;  4YON A;  4JQW C;  4M0W B;  2ROZ B;  3Q3F A;  2YVC A;  3FSS A;  1DBH A;  3IFW B;  4DDG D;  2KWU B;  1WX7 A;  2O6V A;  3JSV A;  1X05 A;  3QAQ A;  4MGZ E;  4URK A;  1PLS A;  4JKD A;  2FIF A;  3JVZ X;  1W1H A;  2D07 B;  3QIJ A;  5GOW B;  5JLJ B;  1UGM A;  2L76 A;  3L08 A;  3APD A;  1WF9 A;  4W9I A;  2RVB B;  2YLM A;  1IRS A;  4W9D A;  4ZRJ A;  5LXH A;  1XR0 B;  3PPA A;  3ZIM A;  2MBB B;  3VQI A;  1P5T A;  3TO1 A;  3W1Y A;  1CMX B;  1MK7 B;  1D3Z A;  5D3X A;  5JHH A;  1T0Y A;  2M8S A;  1M7E A;  2MCN B;  3LJ3 A;  3PV1 A;  2KJ6 A;  1X1F A;  3TIX A;  2UZS A;  1V5P A;  3AXC A;  3N32 A;  4KAX B;  4A6H A;  4GMV A;  4HB4 B;  3A4S C;  4MEM A;  2COA A;  4A6K A;  2GBR A;  2GBM A;  2A5U A;  3ZRC A;  1UNP A;  4NQL B;  1V9J A;  4AUQ C;  4ZDV A;  4EJN A;  2MBH A;  1WJM A;  4ANX A;  3WAP A;  1Z5S B;  1KOT A;  2IO0 B;  1V2Y A;  1PQS A;  3M95 A;  3T9L A;  3VTW A;  4JKA A;  3G9W A;  1V5O A;  2K2U A;  4HJK A;  5D7G A;  3NZU A;  2KJR A;  4H8S A;  3IVF A;  4GB9 A;  2UWQ A;  2IFS A;  3V6C B;  4AJW A;  2CHW A;  2ZJD A;  1X1G A;  2VRW B;  2O6V D;  1ZSQ A;  4LJO B;  4HK2 A;  4LDT B;  4FA6 A;  3PLV A;  5KHO A;  1SE9 A;  1E8Y A;  3ZVV A;  1ACA A;  4MY6 A;  2FID A;  4TKN A;  2JVC A;  2MRP A;  1WVH A;  4IWP A;  2D4Q A;  4JKC A;  3VUY A;  3ML9 A;  1FXT B;  3KUZ A;  1B55 A;  2VSZ A;  2BKR B;  3SBG A;  2DN6 A;  4GN1 A;  4RM9 A;  3HW2 B;  1U5F A;  4XZ4 A;  4HB0 B;  1ZM0 A;  4W9E A;  1P98 A;  3VOQ A;  4EFO A;  3UGB B;  1UEL A;  1V86 A;  1VD2 A;  2ELB A;  4GSW A;  3UIP B;  1JRU A;  5L83 A;  3A9J A;  1V81 A;  3N30 A;  4TYZ A;  3OJ3 A;  2MP2 A;  2IY1 B;  3KH0 A;  1HE8 A;  2BF8 B;  2V1Y A;  1J0W A;  4JLC A;  1WGH A;  4DBB A;  1E7U A;  1MIX A;  2H7E A;  2G4D B;  1HBK A;  1KZG A;  1NTI A;  4LJP B;  4GDL B;  3ODW A;  4WJN A;  4GIV A;  3CXB B;  3CMM B;  5IA7 A;  3APF A;  1RJ2 A;  1WMH B;  1U27 A;  2HTH B;  3ZVR A;  2MBO A;  2CY5 A;  3H7P B;  4M8M A;  4JKB A;  5E6N A;  1P3R A;  2FCN A;  3NOB A;  3IHP C;  1WX8 A;  3DBR I;  1C1Y B;  3FM8 C;  4BKS A;  2VKI A;  3S2A A;  2DX5 B;  4PS3 A;  3L13 A;  3LJU X;  2NBU A;  1WRD B;  2WH5 A;  2KX3 A;  2ZPY A;  5CX3 A;  2J7Q B;  5JP4 A;  1UNQ A;  3PP2 A;  3ODO A;  2FCQ A;  1I35 A;  2OTX A;  1IP9 A;  3UQB A;  3ENB A;  1XKE A;  1LFD A;  2BWE S;  2EMS A;  3EFU A;  3PHW B;  4AOF A;  4HWI B;  2O6V B;  2KZR A;  2LXA A;  3M63 B;  4G50 A;  4MJS A;  1E5W A;  3KVF B;  3D8F A;  1OY2 A;  2NZ8 B;  4F8C B;  2LGX A;  1FB8 A;  2ELA A;  3NY5 A;  3ZNH B;  3ZNI D;  3ODX A;  1V49 A;  4CHK A;  3TCA A;  2O2V B;  4EZJ A;  5AZH A;  2KN5 A;  5EFX A;  1YD8 U;  4MGI E;  5HE0 A;  2I1K A;  3AJ4 A;  3KRW A;  2QKM A;  5LON B;  3H7S A;  2DZM A;  2LD9 A;  1H8C A;  3APC A;  5G55 A;  5AEK B;  5L81 A;  1M7R A;  3MTN B;  2RUK B;  3GOE A;  1FGY A;  4J6I A;  4DX8 A;  1MAI A;  4WSF A;  3PTF C;  4HVB A;  2LVO A;  3DCG A;  5AZG A;  4I6L B;  2RPQ A;  2CQU A;  3PRE A;  1W1D A;  2Z0D B;  3R66 C;  2CB8 A;  3OAN A;  2K8C A;  2D2Q A;  1WYW B;  4OVU A;  2KGX B;  5IAA C;  5C5B A;  3O96 A;  1XD4 A;  2LGY A;  1XCG A;  2G4S A;  1DDV A;  4MSM B;  3X0W A;  1WI1 A;  2N23 A;  2D9V A;  4Z2N A;  3RT3 B;  3TFM A;  1WY8 A;  1TZ1 A;  3KYD D;  1RFA A;  4KZC A;  4K1R B;  4MSQ B;  4NQK E;  3ZDM C;  2LUL A;  5D94 A;  4NSW A;  4F7H A;  3OLM D;  3A98 B;  2J0K A;  4TV3 A;  4ICU A;  4PS8 A;  5FR6 A;  2C60 A;  2DZK A;  4KIK A;  3DDC B;  4F7G A;  2DYN A;  3KW5 B;  1TQZ A;  1NTY A;  2MX2 A;  4MH0 E;  3DBS A;  2N9X A;  3A4R A;  4WWO A;  2REX A;  4NY0 A;  4GGQ A;  3A8P A;  2DYO A;  1KC7 A;  2DFK A;  4FUL A;  1ST7 A;  2LUE A;  1G6J A;  3DVG Y;  2N1W A;  3GZN I;  2NBW B;  3QAR A;  2XK5 B;  4HHV A;  1KZ7 A;  2P0H A;  4MT7 A;  2DZI A;  4NAW A;  1EGX A;  2GOW A;  4WWN A;  4NJ7 A;  3VAW A;  2QKL A;  3H1U A;  4K81 A;  2DHJ A;  4N9F 4;  3TW1 A;  5IJM A;  2R2Q A;  1U5G A;  2MBE A;  2KFK A;  4JGH B;  3WAO A;  3SUZ A;  3HQC A;  3UZT A;  2WYQ A;  4ILG B;  3HK0 A;  3A9J B;  3DPD A;  1Q0W B;  4JL9 A;  4AP4 C;  4Z2M B;  2M1M A;  4W9K A;  4DX9 0;  3AI5 A;  3ZTC A;  1UD7 A;  2MP2 B;  2N0Y A;  2K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...