4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
4ILJA 4JKBA 4JKEA 3E9LA 4JK8A 4JKCA 4JKAA 4JKGB 4JKGA 3SBTA 3E66A 4JK9A 3E9PA 4ILGB 4JKFA 4JK7A 4JKHA 3E9OA 3ENBA 4JKDA 4ILHA 3SBGA
chains in the Genus database with same CATH superfamily
1EXQA 3DLHA 1NK7A 3VQPA 2HBMA 3JAMO 2QK9A 1ZBIA 3IS9A 4MLEA 3FZMA 5KRTA 3B8AX 1E4GT 2KW4A 3VGKA 3QMLA 3HRGA 4CIGA 2KKZA 2HVIA 3ZEUB 3T1HK 4FSVA 3LM2A 1KVAA 2QKKA 4IJNA 5AQJA 3LM9A 5GAHP 2XY8A 4HDOA 1VSMA 4DTXA 1NJZA 1NGEA 3ALYA 4JKCA 3WNHA 2RE2A 2NRRA 4CJWA 4IFVA 5M1OA 3C7NA 4FO0A 3GOIA 4J2AA 3O9RA 3AVGA 3WUHA 2E2NA 4BRLA 3CCSN 2G8HA 2IS3A 3VESA 2WFBA 3O3GA 1ATRA 2FBXA 5FPEA 4M3YA 3SQ4A 3A5MC 1HKGA 4DS4A 4CW7B 4I6MB 1JL1A 1Q8IA 4OKJA 4OLBA 3V4IA 4DF8A 4KRFA 1N36K 4CJEA 5HRPA 3AA5X 2Z1GA 1K8AO 4Q5VA 4F2SA 2AJQA 1HX1A 3AO4A 3DMJA 4CBXA 1HJRA 3G4SN 1TV6A 1KBLA 1NGGA 1JCFA 3NF7A 4AM7A 3Q7BA 3RMBA 4FJKA 1FKOA 4DV2K 3KIOA 1P90A 3OYMA 5BN9A 2CB8A 3QNNA 3SBTA 2YI1A 2DTUA 3E66A 1WSEA 4H0PA 1N5YA 1Q81O 3T3FA 2B5JA 4BVPA 1X9JA 4CF9A 4OLAA 3HZ6A 3QESA 3TSQA 1X1PA 4JI5K 3PIPL 4YDUA 4CEDA 2GBZA 5CZ2A 1X9SA 3SPZA 3DM2A 1GC6A 4BC2A 5HL7L 3PX6A 1EX4A 4WE1A 4F8RA 4OKEA 2FF6A 4CFBA 4Z4HA 4JKAA 1VQLN 3ZSQA 3O08A 1MWMA 3DRPA 1TAQA 1J53A 2V7ZA 1NLVA 1CZ9A 4HCBA 3T69A 3DLEA 4LF7K 4CHNA 3HM9A 4DV1K 5E84A 3ZX0A 4CGGA 5KI6A 1XC9A 3SQ0A 4A57A 1LWFA 3QFUA 2BE2A 4C8NA 4BR7A 3HBTA 2RKIA 4GKKK 4JHDA 4FJJA 3G71N 1NK9A 3OYAA 1SUQA 3MMVA 3MEGA 2P9PB 2HMPA 4K0KK 3WNEA 5LY3A 1U4BA 3LZIA 1Q9YA 2FJ9A 2ATQA 5IWAK 1GGOA 3O6WA 3DWLA 3LPUA 4ID5A 2YCHA 2X0SA 3TSPA 3IMXA 4LF9K 4KAZA 5AQUA 3M8SA 1QS4A 2FBVA 2E1ZA 2G8FA 4Z4IA 2CH6A 4B9LA 3I55N 4JN4A 2QEXN 2ZJQL 2B4JA 1T3VA 1KC7A 4JI6K 5HP1A 3VEZA 2QM1A 1K6YA 5DM6L 3E9PA 4CJ5A 3RTVA 3SMPA 3QBWA 2ASOA 2R82A 3BGRA 2QWRA 3C7NB 2ITGA 3DRSA 4C8LA 3S9HA 2P9UA 1ITGA 4CF8A 4KPYA 3DXKB 4BDYA 4BRHA 3NF6A 4KH5A 3P1GA 3PUFA 3SZ2A 2Y1JA 4JRPA 3ATUA 3CC2N 4M42A 2W40A 2ZGZA 3O9TA 2I1JA 4DCHA 3RMAA 2YNHA 2HHXA 5AR0A 3U7DA 3AAPA 4B9NA 1TKTA 1T8EA 4FJNA 4CHQA 1D9DA 2HMIA 2QWNA 4IFYA 3WT0A 3DOLA 4FK2A 5FRNA 4BDZA 4OGEA 1KRPA 5E26A 4BRAA 4YOVA 3L4IA 3O9UA 4BRIA 1GOCA 4Y1DA 1SL1A 3WXKA 4YY3K 4O44A 4QS8A 1DTTA 3CJ7A 4B1VA 3O3HA 1ILYA 4F3OA 1RBVA 4ILGB 5AQTA 2NRXA 2OPQA 4PHTX 1WSIA 4KTWA 2Q2RA 3G25A 5JLFA 3NDKA 4L8RB 4C1NK 4A61A 1S9GA 4KI4A 1VSLA 4LH4A 3DXMB 4DTJA 3F9MA 4ELUA 3CJ9A 4IEIA 2P9SB 1Z26A 3I56N 4FK0A 5E41A 4JKGB 1BI4A 2ASMA 3M8RA 5AQGA 3GDQA 3TAFA 4RW4A 2AL6A 2HSTA 4FLZA 1YJWN 4ZRJA 1G15A 1XC3A 4DFJA 2D2QA 2ZJRL 4CHYA 4JD2A 3OYCA 3ULEA 4W5NA 3KTQA 4JI0K 4JS4A 5CZ1A 4E7HA 4MFBA 3AU4A 4ISFA 1X9WA 4DTMA 2KTQA 1LV5A 4HUGA 4FLYA 1TL3A 4CJ7A 3SAFA 1S6PA 2ZQBA 4HHTA 1C1CA 1IO2A 5AQSA 3HOSA 3JSMA 3TARA 3MXMA 4OPHA 1U45A 3HVTA 3KLGA 3BZCA 3PSFA 1VQKN 1KC8O 2HNDA 4DV7K 4LFAK 1EO1A 1VQMN 1RTJA 1RBSA 3VQDA 1U2VB 2O8EB 3DLBA 4DQRA 3AO2A 4BQLA 3NGIA 1QTMA 4BY9C 1OH7A 4PKHA 2GX9A 1RILA 3K5NA 1ESVA 4LSLA 4FLUA 4DTUA 4DSLA 4CBWA 4LFCK 1JLBA 2WC9A 3H3NO 4YOTA 3CPWM 3KVGA 1NOZA 1RTIA 1C0MA 4CFDA 3O8MA 1J9AA 2CGLA 2F9WA 5CR4A 1NJXA 2UXCK 3OYEA 3VQ7A 3P4IA 3UE5A 4FZYA 5GAEP 3A0IX 3L3VA 4I2PA 4B3OA 4DFMA 4BE1A 3CM5A 1MIXA 3KD1E 3QERA 1WBDA 1HLUA 4O55A 3BDPA 3LP2A 2VGNA 1JLGA 3FLVA 3HPOA 1R59O 1FW6A 1KFSA 3SQ2A 4FM0A 1EKEA 3R1XA 5DM7L 3OTOK 1T6DA 3MWPA 4IG3A 4EHTA 4RW9A 4BROA 1HMVA 4X64K 4Z94A 1GLEG 1JL2A 1S1XA 5C10A 5BN8A 4EFHA 5C42A 4FVUA 4H8KA 3WA0A 1YIJN 1Q9XA 3VEOA 1NJIO 3NVMA 3OYKA 3CMAN 3L2UA 1LW2A 3TR8A 1TGOA 4EP4A 3SJJA 1KD1O 2BTFA 2KFZA 4CEEA 2ASPA 3FLCO 4WQ4A 1DGKN 1TYQA 3I0SA 1SKRA 4H0XB 4WF9L 4HCCA 2FDQA 1VSKA 2DFHA 4HWIA 4B1UB 3J81O 4B3SK 4CFAA 4FLTA 5BPMA 1FJGK 3V9UA 2FLOA 1CXQA 4YL8A 3BEXA 3EE8A 2HHSA 3MCAB 5C2DA 1NMNA 3L2RA 4CGJA 2O8FB 3VQQA 3VQ4A 4Z4CA 1M90O 4CJKA 3DYAA 4Z0UA 3L2VA 3GL1A 4BR5A 3THYA 3K5OA 4LSNA 1T03A 4CEAA 1BQMA 2A42A 4DSIA 1RT6A 2ABDA 3NE6A 3HVRA 4CJPA 1QVGM 1EP4A 1WUAA 4PL7A 3I8DA 2RN2A 3FZKA 4M3UA 5CYMA 4E19A 2HHUA 1LWEA 3ID6A 3D2FA 3WXLA 3CXCM 1O13A 5M1FA 4KHYA 2F8SA 3ASMA 4O8UA 3HL8A 4W5RA 1I39A 4CGHA 1NK6A 4DV0K 1S1TA 3I0RA 5AQHA 1D5AA 2HHTA 3HO1A 1ASUA 3EKSA 5HRNA 1B9DA 4H0TB 3ZEUA 5C12A 4FJLA 1C0UA 4YOXA 1NVLA 1BUPA 1HQEA 3RSEA 1N32K 4KBOA 2QA4N 3P5JA 2O4GA 3TTCA 5ADXH 1MIZB 3OYJA 2Q31A 4FPAA 3D2EB 3KLEA 4YHHK 2JGUA 3H1QA 2OZSA 1ZBFA 3KK3A 1WSGA 1J54A 4AHVA 4C23A 4CD3A 4CIEA 3CQYA 4CIFA 3MECA 1Z25A 4OX9K 5AQFA 4X62K 1RBTA 3CQXA 4DS5A 4K8XA 2CGJA 4PKIA 3VPZA 3SJHA 2UUAK 5HRSA 3NMUA 4DFPA 4QAGA 2WBNA 4EZ9A 5M1PA 1RT7A 1WSFA 3I33A 2P9PA 4FJ9A 3U4LA 3LDNA 2PBDA 4XH5A 4BWMA 3CJCA 5BRHA 1EQYA 4JI4K 2YJEA 4CI6A 2D0CA 4RW8A 2XO7A 1ZBUA 3LP3A 3QB0A 3ZCMA 4H0VB 5DMRA 4O0IA 4ELTA 1BA0A 5KGWA 2O8CA 1IV0A 1JDEA 3G10A 4ELVA 4DQPA 3V1OA 3E9LA 2JLEA 5AQVA 3KK2A 3RRGA 4J2DA 4FCYA 4KHWA 5JS1A 1HPMA 4PL8A 1YI2N 3CCQN 1YVUA 5AQLA 1WOQA 4NLBA 2F4VK 1GLLO 4AHCA 1JLQA 3LDOA 4CZHA 3U3YA 5LMUK 3NGYA 1L3VA 1VQNN 4OO1J 4GVMA 4N76A 2QI2A 4H5VA 4BRGA 3RR8A 4FLVA 1C1AA 1XHXA 5AZJB 5C24A 1Z05A 2KFNA 3VTHA 3BUZB 3U8ZA 1TUUA 3UKUB 4BR2A 2VGMA 1YJNN 3ZETA 4JI7K 1QHAA 4HDQA 3CCLN 4CEFA 2IGIA 2GELA 3E01A 4PA1A 1XMOK 4M3TA 4U7BA 3KLIA 2BANA 2WOMA 3ULEB 4A2AA 3HSCA 3V9XA 4ID1A 3U8XA 1B92A 3A5OC 1ST7A 3DJCA 2W6LA 1J5OA 2PFUA 3TTFA 4DR1K 2P9KA 3ZSOA 3EO3A 4CK1A 2A1RA 1SKSA 2V51B 4N5SA 1I94K 1ASVA 2X74A 4ICLA 1BO5O 3OA9A 4HUEA 1V4TA 1SGHA 2NUBA 5FRMA 4KREA 1NK0A 2W41A 3BP8A 1JCEA 5AZIB 1ACAA 4EIAA 3ZT4A 1HB6A 2NNWA 1BDGA 3UKUA 1EWQA 4CJRA 1NTIA 4CESA 3FZLA 3SAHA 5JLHA 2X6SA 3CCEN 1HKBA 1E3MA 4DR2K 4AM6A 3AVFA 2OANA 3OBWA 4E1NA 3KJVA 5SWMA 4LY7A 4I9LA 1XHZA 1BQNA 3VF6A 1OH5A 2DY4A 2ZJPL 3WQTA 2FXUA 3W3DA 4K42A 1HRHA 1GOBA 2VYPA 1HQUA 4CZGA 1J5EK 1NGDA 1HYSA 5M1KA 3KWIA 2G8KA 2O8DB 3K5LA 1NK5A 3VQ9A 1EWRA 2PZSA 4ZRIA 2X6NA 4DR3K 3LANA 4GKJK 2Q0UA 3CC7N 3PVLA 2I7NA 4FJXA 1SZ2A 4C8KA 3WEEB 4K25A 3H08A 3LL3A 5FLXO 2A1SA 3JXUA 4CHOA 4CEQA 3UB5A 3AGRA 2WH5A 4JKHA 4A59A 3ENBA 3QEPA 4RWTA 2Q1NA 3HXMA 2IC3A 3LDLA 2IAJA 1VHXA 1NGHA 3L0QA 1TKZA 3IFRA 4FLXA 3UIQA 2GUPA 2BUPA 3ZSXA 4IG0A 4YDUC 3VEYA 5HROA 3MEEA 4DXAB 3TPQA 3QEXA 2WUSA 3C94A 3F73A 4FZXC 1WSHA 4DTNA 4X66K 4CZLA 5B8HA 2J4RA 4NO7A 5IJMA 1X3MA 4WQ5A 3GBTA 3T1AA 3PO5A 3MN7A 2E4LA 4JKEA 2IVOA 2P9IB 3ZSVA 5I42A 5JS2A 4FM1A 1SQKA 3HI0A 1D9FA 4FJ8A 3TU5A 4CF2A 4OVLA 1WAJA 3C6UA 4RCHA 4AQYK 1YXQA 4PKGA 4BRDA 3AVJA 1A5WA 4A5AA 4M3RA 2A6AA 4MLHA 5JICA 3THXA 3ENOA 1VBGA 5K14A 4UQGA 4JRQA 2OA8A 1IG9A 3THYB 1HNVA 3A2FA 4DQIA 1IKWA 1SV5A 1XWLA 2DIKA 3FGUA 4KKOA 2NRVA 3K59A 3OYLA 4LF5K 2PY5A 4O5FA 1EETA 3V1QA 3RMDA 2G8IA 1VRTA 4MDAA 4XEIA 3E9OA 4IXCA 4DTSA 3H46O 4DMNA 3F5TA 2VG7A 4JHDB 4EP5A 3LDPA 3WXIA 4I9QA 3WEEA 2P9NB 3OVNA 1NGIA 1A5XA 2J0KA 4XH1A 2AEHA 4OPKA 3O9QA 5C0YA 5LMNK 1N6QA 3L6QA 3LZJA 4K43A 1VAZA 5AQWA 2QWMA 3DXMA 1NGAA 5F1XA 5AQXA 1LAVA 2O8CB 2ZPYA 1VQ7N 1VQ9N 4DHYA 4ILJA 2EMTA 3FFIA 1BCOA 3OYNA 4KH4A 1XUPO 5KPTA 1ZC6A 3J7YP 1KXPA 1RT1A 4B3TK 1IKXA 2F7TA 4B1YB 3PZDA 5SZTA 3LWMA 2EX3A 4P7IA 3CF5L 3RRHA 3ZDTA 3KKSA 1ZBHA 4M3WA 3TAMA 1QVFM 3C6TA 1EF1A 5AZIA 3EPYA 1FK9A 3WNGA 3VEVA 1ISNA 3VOVA 3HSTB 4H5NA 4BWJA 3BZKA 3O3FA 1NU0A 3CG7A 2RPIA 3CC4N 5KRSA 1BIZA 3OYHA 1CLQA 4BRKA 3O4WA 2VQEK 2YKNA 3DAWA 4CFCA 1NKEA 2YHYA 1VQ4N 2QWPA 1BU6O 4XIUA 1S22A 4FLWA 4AHTA 1W7AA 2YHXA 4CJTA 3KHYA 4OPAA 3DLLL 2YJFA 1RDUA 2ZM6K 3SPYA 3NGZA 4GMJB 3MWTA 3ATVA 5GADP 2FBYA 1KVBA 3V9WA 3NH2A 1VSHA 3A8YA 4KHSA 4O4GA 4JI2K 4CJLA 3V9ZA 2OZMA 4FM2A 1JKHA 3ISNC 1WLJA 3CERA 2P9SA 4W5OA 4CGDA 4JLHA 1Y19B 3AARA 3CFPA 1HR0K 4BGAA 2O8BA 1ASWA 3H6EA 4H5RA 1KFDA 2YHBA 2UUCK 5AQPA 4E7IA 4Z4FA 2G8UA 3GG4A 4O0JA 3BF3A 2FSJA 4M7YA 4M3ZA 3J8AA 3THWA 4IOAL 4IFEA 5AQOA 4FVMA 2D0PA 4LH5A 4IBNA 1E4FT 3M6GA 4DFKA 4C8MA 1RDAA 1LAWA 3HJFA 1IH7A 3QDKA 1RTHA 5CE3A 2YVCA 3P38A 1TUYA 5JVLA 4FL9A 2NZTA 5BPLA 3SQ1A 5J2QA 3IVFA 4CEOA 4KH6A 1CXUA 1LWCA 3QFPA 4H0OA 4CEBA 4JS5A 5J2NA 1KAXA 2ZF5O 1I3AA 3IG1A 4BRMA 4AH9A 1C1BA 2UYTA 3CCVN 5LL6Z 3HM8A 2Y1IA 3AVCA 3QIPA 3SCXA 4W5TA 1W97L 3X23A 1Q82O 3PLAA 2AP1A 1NKCA 2CQUA 3OS2A 4HUFA 1B9FA 4DR7K 4JKBA 2P51A 3I8BA 1T05A 3D45A 1S1WA 3CD6N 2GTDA 3MX5A 4KTQA 4JV5K 1RDWX 4JK8A 4DQSA 4E7LA 3S3OA 2QWLA 4O8KA 2VWBA 3O1BA 4K8ZA 4GV9A 1NOYA 4QOZB 1DEJA 3D2EA 4ZHRA 3TAGA 4FOEA 3VEXA 3KK1A 4FWNA 3JYTA 3CFOA 3ZX3A 2HF4A 2PYJA 2E6LA 4FWKA 3UKRB 4FWPA 3RR7A 2D0AA 3ZT1A 4K41A 4BC3A 4L3QA 1DIKA 2UU9K 3V1RA 3VQBA 5BREA 4JI1K 2QXFA 4DQ8A 2D0BA 5M1QA 1E5WA 1VQPN 3CFRA 5EVZA 4H03B 1J19A 1S6QA 2O8BB 4BRQA 2P9KB 4CZMA 3A5LC 2JWKA 2D10A 4IDHA 5BR9A 2XHBA 1LW0A 3ZT3A 1NG9A 4DTOA 4PWDA 1HNWK 4LFBK 2RF2A 4BGBA 3CMEN 2E2OA 3NAEA 2EMSA 4CJUA 5LJVA 4E0DA 5FPNA 4C8OA 1X3NA 4R5PA 3L2WA 3EN9A 3FR0A 4DR5K 1NJYA 1NK4A 3RSEB 4TSXA 4BQZA 1NGFA 2E2QA 1VBHA 2HHWA 3MAQA 4BACA 4YOUA 4CZJA 3ZSZA 4FW1A 2G8WA 3SNNA 2NRWA 1C0GA 5KPZA 2VWKA 3N4PA 4IWVA 3MXIA 1QQMA 4IOXA 3ZYYX 3FE1A 3DRRA 4HTUA 1QSLA 3THXB 4WFNL 4FJHA 1DTQA 5HLFA 3AGKA 3QIOA 2JWLA 2QWQA 4BDPA 1FXXA 3VQEA 3K9JA 1QHTA 3PV8A 1NNEA 3AO3A 4JI3K 1KLNA 5KTQA 2IOCA 4JEPA 2Z1HA 4G9ZA 3MX2A 3WNFA 3LP0A 3VQ8A 1VQ6N 4AHRA 2HBJA 5GAGP 5JVHL 3QNOA 3OYBA 3OYIA 1NGCA 3HP9A 3N4QA 3OJUA 1U04A 3LAKA 4AILC 4RW7A 3CM6A 4A2BA 3QO9A 4CECA 4MO5A 4B9UA 4WQ4C 1W0HA 3HOTA 3LWLA 3H1VX 3OS0A 3NH0A 4LF8K 3FFKB 2YV0X 4CJ4A 3ZSWA 4B8CA 1LCUA 1YAGA 3QLHA 3HPGA 3MN5A 3EEQA 4YORA 4BC4A 2RHKA 3LALA 4DTRA 4CZFA 1DT9A 4ZRKA 4I6MA 1TKDA 3IAYA 4GW6A 4LC9B 2HE7A 3SUPA 1D4XA 1GLDG 3VGLA 3O4QA 1HYZA 4PUOA 3ZT0A 4BR4A 2HVHA 5AQNA 1QQCA 3OW2M 1SAZA 1N34K 1RDBA 3IDHA 3T1YK 5FROA 4DB3A 4DQQA 3ZLJA 3K58A 4H4MA 4KB1A 4FOIA 3V9SA 3VEWA 1RT4A 1NGJA 4LD0A 1GG3A 3CCMN 3U9DA 2F96A 4EAHD 5KQ8A 4E1JA 1QSYA 3VQCA 3ID8A 1REVA 3CHWA 4M41A 2HNYA 1HNZK 1MU2A 4H4OA 3TWHA 3NF9A 2J0MA 3EE9A 1OVQA 2D1KA 4DTPA 3QEVA 3ZSRA 2XY7A 2UXDK 3R3LA 4FJIA 4NLCA 1MA9B 4DV3K 3CIPA 1L5UA 4H5TA 3B6PA 1M1KO 4OJRA 1L3TA 3K0SA 3H3OB 3VMFB 4B9QA 3NH1A 1C6VA 1JLEA 3AVBA 4JNEA 1UOCA 1KAYA 3KD5E 4JI8K 1ATSA 3DXKA 2H3GX 4BG9A 2FSNA 3DI6A 2QW9A 1JXBA 3BF1A 3VQ6A 1RFQA 4ILHA 3H45C 1K8KA 3QEIA 3VA3A 2F8TA 2ITMA 5ADXA 3TAPA 1KVCA 4H5WA 1TYQB 3S3NA 5BR8K 4JYAK 2VWJA 4B3RK 2A40A 1KLMA 1NMDA 3F9KA 3R8EA 4DSKA 2PAVA 1VQ5N 1G99A 1P8ZA 2P9LA 2KZMA 1HJOA 5FPDA 5KGXA 1RDDA 2HW3A 2AA4A 4O5BA 4HVJA 4UY8O 3DLRA 3M8QA 1OVYA 1CZAN 2DFEA 2OTJN 5AQMA 4KB0A 4MDBA 1W9HA 1XNQK 3LDSA 3ZSYA 4JK9A 3M1FA 3J7ZO 1K8KB 3DLGA 2QXLA 4CGIA 4NCBA 2DPNA 1BCMA 3CCRN 3CPEA 3CCUN 3ZX2A 2QKBA 4IJAA 3IRXA 4NXMK 2CGKA 1ZBLA 2HRJA 1IJJA 3D0PA 1U6ZA 3KWGA 2CH5A 2IIRA 5C25A 3A5NC 1Z6RA 4Q0BA 5BRFA 2COPA 1RCHA 2E8AA 5JMVA 3U3GA 1C0FA 3C95A 5CYQA 3J80O 1RBUA 3C0BA 3O9SA 4J2BA 3SAGA 5GINA 4B8AB 5AQIA 4Y1CA 4DF4A 1JCGA 4ZTJA 1IKVA 3QBXA 2GUIA 2IVPA 2V52B 3AY9A 3Q7CA 3VF4A 5KQDA 4EZ6A 1S72N 4AHUA 5BRDA 4CERA 4KHPK 5F0XA 4LF4K 4FWRA 3MDQA 3AVKA 4CYEA 5ELZA 5AFUA 3E1YA 1OKJA 4J8FA 4DG1A 1U2VA 2O8EA 4WYBA 1SL2A 4CF0A 4CCHA 2KQ2A 1A5VA 1XNRK 3AVAA 4BE0A 3L4QA 3OJSA 4FJ5A 1RT3A 4RW6A 1YITN 4CJSA 3G0ZA 4G1QA 4U67L 2Q36A 1HBKA 4KO0A 4OKKA 2BH1A 4FJGA 1FKPA 5AZJA 2YKMA 4AF1A 3WXJA 3AO5A 1IG8A 4YOYA 1WAFA 3D7EO 3K9KA 4E3SA 3TAQA 3OYGA 4GVEA 4TKNA 1RBRA 3OHRA 4V19S 2P5OA 1XI1A 4H0YB 3MEDA 2P1JA 3SV3A 3CJBA 3DLKA 4JD2B 3V81A 3TI0A 3HYFA 1UWBA 2ZGYA 4FJ7A 1Q18A 1YVNA 1DKGD 1NGBA 4EKUA 1VQ8N 4FWQA 3VN5A 5J2MA 1Y97A 5J2PA 1QQNA 2FSKA 2QTDA 4Z4GA 4GXBA 2QWOA 4B08A 3AVIA 4I7FA 4B3MK 4M45A 1YTUA 3AA4A 1QQOA 3M8PA 3CJAA 4Y0WA 4HTLA 3PY8A 2HB5A 1WB9A 3B6OA 4IKFA 3R9PA 3IUCA 1BA1A 1VSIA 4GNIA 4DU3A 3AO1A 4CEZA 5GIOA 3SUOA 2E6MA 4IO8A 1N8RO 4IZ9A 3OY9A 4NYNA 3WQUA 4DV5K 2EHGA 4JAXA 4DV4K 4DR4K 3HPHA 1YHQN 3P31A 4CD1A 1QZ6A 2I5JA 3LPTA 4CJQA 3AA2A 4A5BA 2E1YA 2A3ZA 1H4RA 3MN6A 1J6ZA 4DLEA 4GV6A 1TK0A 3MCPA 2NRHA 4KHUA 3EL2A 2YNFA 4OGCA 1RT5A 2OTLN 1WNSA 3C6AA 1RT2A 1F21A 2BDPA 4FPBA 5LJWA 2OPSA 3LDQA 5C2FA 1YF5L 1RDCA 3T7ZA 4EHUA 4B1XB 1GOAA 2I1KA 2NRZA 2F9TA 2HNZA 4BRNA 3NF8A 1HKCA 2YHAA 4DSFA 5C15A 5AQKA 1Q7YO 2FC0A 2O8DA 2E2PA 3U6FA 2BGGA 2NRTA 2ZE2A 5TKYA 5F2RA 2YNGA 3D2FB 1GLFO 2HHHK 3ULDA 1VRUA 3K57A 4BRPA 3O4NA 1KQSM 2VCPA 3VENA 1QE1A 3O80A 4FWMA 1U49A 2D11A 4DKWA 1X9MA 4WFAL 1OH6A 4FXDA 3AVLA 3PSIA 1GLAG 1NBWA 4KHNA 2HHQA 1WBBA 1RGIA 3SUQA 3W0LA 2EWSA 3EZ5A 4DLGA 2A41A 2V7YA 2XY5A 3V6DA 1GLCG 2KLAA 3LP1A 1Q86O 3IKMA 4DUZK 5H1SQ 4CZKA 1BGXT 1ZBSA 3THWB 3SUNA 1T7PA 4CGFA 4FWSA 3S3MA 1R0AA 1NM1A 2GWKA 2OPPA 3EKUA 4B9MA 1U47A 1TVRA 2OCEA 3RVCA 3VQ5A 4DU4A 3D6RA 3KK7A 4F9OA 2E5LK 3K5MA 5AQRA 3PX0A 1WN7A 2ZWHA 5EU7A 4CF1A 4KV8A 2G8VA 1MK9B 4ISEA 2I7PA 4E7JA 2KZZA 5FPMA 2HBKA 1XQSC 1NJWA 2GWJA 1BIUA 3AA3A 5A2QO 1BL3A 2YX6A 4FWLA 3P39A 1VSDA 3S41A 4N41A 1YT3A 3HT3A 2UXBK 4X65K 3ENHA 4I2QA 3QICA 2VG5A 5AQQA 3RWUA 1TL1A 1YUWA 2Q3SA 4E89A 4KTZA 2E20A 1TKXA 5EOYA 4GY2B 3BINA 1L3UA 3M3ZA 1KTQA 3R6MA 3AU5A 1DLOA 3CJ1A 2XRIA 4KHQA 5AJ3K 3RMCA 1IBLK 2R7YA 4N56A 3KLFA 1VSFA 4FW2A 1L3SA 4YOWA 3NHGA 1BISA 4YFUA 2HF3A 4JKDA 1UA1A 4CJVA 2Q0RA 1UA0A 3CI5A 3NBPA 5J1EA 1VSJA 2X78A 2GV9A 4FJMA 2D4WA 4CK2A 2DFFA 1NK8A 3L3UA 4M63C 3O5BA 2YHWA 3NFAA 5HOOA 4WCEL 3NVKA 3HP6A 4CE9A 1O1WA 4MO4A 4BREA 2NLXA 2UUBK 4B1WB 5DK5A 5BPNA 2HBLA 1S1VA 3J7AP 3TANA 1SKWA 4IEEA 2Z1IA 3QEWA 3FZFA 1ZYQA 3K2PA 3VTIA 3FZHA 1JLFA 1HNXK 5AQYA 1YTAA 4JK7A 5FDLA 4NCAA 1JLAA 4NXNK 1NI2A 3SLCA 2HOEA 4QS7A 2Q97A 3TAEA 4F3TA 3OS1A 4CK3A 4NB4A 4BE2A 4YNQA 1JXEA 3OBYA 1KCFA 1LOTB 3SMSA 2J0JA 5GIPA 4OPJA 1S5JA 2IDOA 4M7XA 1S3XA 2KHOA 2Z1JA 3SV4A 5AFUH 3KLHA 4FK4A 1BWFO 4DSEA 1OH8A 4J2EA 3P83D 4WQ5C 3VF2A 4B9SA 5CHIA 1K73O 2P9UB 2YNIA 1TAUA 3VA0A 3PX4A 3THVA 1TK8A 1H1VA 3CETA 2VG6A 4DU1A 1MK7B 4FZZA 2O4IA 2OPRA 4CZIA 4DSJA 3FP5A 2FBTA 2RQ1A 3OYDA 4B9TA 1MDUB 4DUYK 4NY0A 5I9EB 2ETJA 1GC7A 1HUXA 2OYQA 5HRRA 1IBMK 1U48A 4M3XA 5D3GA 3C65A 3MK6A 4FYDA 4CJ3A 4LF6K 2LSNA 3WXMB 3HTVA 4MQ3A 3EY1A 3EZWA 1NKBA 1HB8A 1T44A 5T7BA 3L8BA 3VETA 3CQ8A 4N47A 4E7KA 1W2BM 1RNHA 1VK0A 3JS6A 3AV9A 1ATNA 5JVGL 4B9VA 3ZETB 3TTDA 3GE1A 2P9NA 1S1UA 1SL0A 4CJFA 3QINA 5MLCQ 2WTUA 4IDKA 1JLCA 2O8FA 2GEMA 4QCLA 3LAMA 5AQZA 1YJ9N 4CVNE 4GV3A 1KAZA 3C6HA 4ZTFA 4PY5A 1V4SA 3CYMA 4WFBL 1K9MO 4BG8A 1GLBG 4FWOA 3TSUA 3AVNA 3AVHA 3MN9A 4C1NI 2A5XA 3AAQA 1RTDA 2ZD1A 3KZBA 3OYFA 5I3UA 3M5RA 5EY4A 5IT9O 2HHVA 2P9LB 4BR9A 3MXJA 3VQAA 1XMQK 2LBBA 4BC5A 3SYZA 2P9IA 3VGMA 4BRFA 4CHZA 4F7GA 1T6CA 4DWIA 4BVOA 4E1MA 1TK5A 4RG8A 4F4KA 4A62A 1NWKA 5M1NA 1MWKA 2WONA 3ZT2A 3L2QA 5CY4A 3PO4A 3UKRA 3U9ZA 4F2RA 1HYVA 1QZ5A 1BHLA 1S9EA 1ZXOA 3AVMA 3BY5A 3NCIA 4NCGA 4AHSA 5KPRA 3SI6A 4BRCA 3VERA 1C0TA 5TKWA 3F2KA 2W6KA 3G9WA 1SS6A 2B6AA 3QIJA 4W5QA 2XY6A 1WSJA 4KFBA 4RTFD 4Z4EA 1QSSA 2E88A 3DOKA 2P5GA 3CCJN 4IOCL 2D5RA 1IBKK 3EYZA 1GLJO 2W42A 1VQON 3PIOL 4BR0A 4CBUA 1D8YA 1BG3A 3QETA 3KKRA 5EXWA 3SK3A 4XH4A 4B1ZA 5EX5A 4IO9L 2IVNA 2D0OA 4DV6K 3SBGA 1Y64A 4R79A 1CZBA 4QS9A 3TABA 4KI6A 4DR6K 1HPZA 4CZEA 4JKGA 1BI4B 5HBMA 3O1WA 2PYLA 1UAXA 2FF3B 2VQFK 1KSPA 1N33K 3ITHA 1JJ2M 3HK2A 4JKFA 1VSEA 1IKYA 4PQUA 4CHPA 4NYFA 1HNIA 4ISGA 3G6EN 3T19A 1BOTO
chains in the Genus database with same CATH topology
4H0YB 3CJBA 4JD2B 1QVGM 5AQPA 1WUAA 3GG4A 2HBMA 2ZGYA 4PL7A 3FZKA 3BF3A 2FSJA 4M7YA 1Q18A 3J8AA 1YVNA 1DKGD 4MLEA 3FZMA 4IOAL 1NGBA 4IFEA 4EKUA 3B8AX 1E4GT 1VQ8N 4FWQA 3ID6A 5AQOA 3D2FA 2D0PA 3WXLA 1E4FT 3VGKA 3M6GA 1QQNA 1O13A 2FSKA 2QTDA 3QMLA 3CXCM 3HRGA 5M1FA 4GXBA 2KKZA 2QWOA 4O8UA 3ZEUB 3QDKA 4FSVA 3LM2A 5AQHA 1QQOA 5CE3A 2YVCA 3CJAA 3P38A 4IJNA 4Y0WA 1TUYA 3LM9A 4HTLA 5AQJA 5GAHP 5JVLA 3EKSA 4FL9A 4HDOA 2NZTA 5BPLA 1NGEA 3IVFA 3R9PA 4JKCA 3IUCA 1BA1A 4H0TB 3ZEUA 4GNIA 4KH6A 2RE2A 3QFPA 4H0OA 5C12A 2NRRA 5GIOA 1NVLA 5M1OA 4YOXA 1BUPA 1KAXA 2ZF5O 3C7NA 4IO8A 4FO0A 3RSEA 4IZ9A 4KBOA 2QA4N 1N8RO 3GOIA 4BRMA 3TTCA 3WQUA 5ADXH 1MIZB 2Q31A 3O9RA 4FPAA 4JAXA 2E2NA 3WUHA 3D2EB 2UYTA 4BRLA 3CCVN 3P31A 1YHQN 3HM8A 3CCSN 3H1QA 4CD1A 1QZ6A 3VESA 4C23A 1W97L 4CD3A 3X23A 2WFBA 1Q82O 1ATRA 4A5BA 3CQYA 5FPEA 3PLAA 2E1YA 2A3ZA 1H4RA 3MN6A 1J6ZA 2AP1A 1HKGA 2CQUA 3A5MC 3MCPA 5AQFA 4GV6A 2NRHA 3CQXA 4JKBA 2CGJA 3I8BA 4PKIA 3SJHA 3VPZA 3CD6N 3EL2A 3NMUA 2GTDA 3MX5A 4I6MB 2WBNA 1RDWX 5M1PA 4JK8A 3C6AA 2OTLN 3I33A 2P9PA 4FPBA 3U4LA 5LJWA 2QWLA 4O8KA 3LDNA 3LDQA 2PBDA 2VWBA 4XH5A 5C2FA 3O1BA 4GV9A 3CJCA 1YF5L 5BRHA 1DEJA 3T7ZA 4EHUA 4B1XB 1EQYA 2I1KA 2NRZA 3D2EA 1K8AO 2YJEA 2F9TA 4BRNA 4FOEA 4CI6A 1HX1A 3VEXA 1HKCA 4CBXA 5C15A 5AQKA 3G4SN 1Q7YO 3QB0A 4FWNA 2E2PA 2NRTA 4H0VB 1KBLA 5TKYA 1NGGA 1JCFA 5F2RA 1BA0A 1JDEA 3D2FB 3Q7BA 4AM7A 3ZX3A 2HF4A 1P90A 1GLFO 4FWKA 3E9LA 5BN9A 5AQVA 2CB8A 4BRPA 3UKRB 1KQSM 4FWPA 2VCPA 3VENA 3SBTA 2YI1A 3E66A 3O80A 4FWMA 4H0PA 1Q81O 4K41A 4BC3A 2D11A 4L3QA 4DKWA 1HPMA 4BVPA 1DIKA 4PL8A 4WFAL 1YI2N 3CCQN 5AQLA 1X9JA 1WOQA 4NLBA 1GLLO 3HZ6A 3TSQA 5BREA 1GLAG 1NBWA 3LDOA 4CZHA 4DQ8A 5M1QA 3PIPL 1E5WA 4YDUA 1RGIA 1VQPN 3W0LA 2EWSA 5EVZA 1VQNN 4H03B 2A41A 2V7YA 1J19A 4OO1J 1GLCG 2KLAA 4BRQA 1Q86O 1GC6A 3IKMA 4BC2A 2P9KB 2QI2A 4H5VA 4CZMA 5HL7L 4BRGA 3A5LC 5H1SQ 2FF6A 4CZKA 4JKAA 1ZBSA 2JWKA 5AZJB 1VQLN 3O08A 2D10A 4IDHA 1MWMA 5BR9A 1Z05A 4FWSA 2V7ZA 1NLVA 1NM1A 2GWKA 3EKUA 3T69A 3VTHA 3BUZB 3U8ZA 1TUUA 3RVCA 3UKUB 3D6RA 3KK7A 4BR2A 2VGMA 4F9OA 1YJNN 5E84A 3ZETA 1QHAA 4HDQA 3ZX0A 3CCLN 5AQRA 4BGBA 2GELA 3CMEN 4A57A 4BR7A 3QFUA 2E2OA 2ZWHA 3HBTA 2EMSA 4JHDA 1MK9B 5LJVA 4U7BA 4ISEA 2I7PA 5FPMA 5FPNA 3G71N 2HBKA 3ULEB 4A2AA 1X3NA 1XQSC 3MMVA 3HSCA 2P9PB 2GWJA 2HMPA 3EN9A 3FR0A 3U8XA 3A5OC 3RSEB 5LY3A 2YX6A 4FWLA 1ST7A 2FJ9A 4BQZA 1NGFA 2E2QA 3DJCA 3P39A 1VBHA 3S41A 1GGOA 2PFUA 3TTFA 3O6WA 3DWLA 2P9KA 3EO3A 4YOUA 4CZJA 2YCHA 2X0SA 3ENHA 3TSPA 2V51B 3IMXA 3QICA 5AQQA 2NRWA 1C0GA 1YUWA 5AQUA 5KPZA 2E20A 5EOYA 4GY2B 1BO5O 3OA9A 3BINA 2E1ZA 1V4TA 1SGHA 3N4PA 4IWVA 3M3ZA 1QQMA 4IOXA 3ZYYX 3R6MA 2CH6A 3AU5A 3FE1A 3CJ1A 3I55N 4JN4A 2QEXN 2ZJQL 4WFNL 1T3VA 1KC7A 2W41A 3BP8A 1JCEA 5AZIB 1ACAA 4EIAA 3AGKA 3VEZA 2JWLA 2QWQA 2QM1A 5DM6L 3E9PA 1HB6A 2NNWA 1BDGA 3K9JA 3UKUA 3SMPA 3QBWA 4YOWA 2ASOA 1NTIA 2R82A 3FZLA 4JEPA 4G9ZA 2QWRA 3MX2A 3C7NB 2HF3A 4JKDA 1VQ6N 2HBJA 2Q0RA 5GAGP 3SAHA 5JVHL 5JLHA 3CCEN 3CI5A 1HKBA 2P9UA 3DXKB 4BRHA 4AM6A 1NGCA 3N4QA 4KH5A 2D4WA 2OANA 3ATUA 3OBWA 3CC2N 2W40A 2ZGZA 3O9TA 4M63C 3O5BA 2I1JA 4A2BA 4DCHA 4MO5A 2YHWA 5AR0A 4WQ4C 3VF6A 3U7DA 3HOTA 3AAPA 4WCEL 5HOOA 2ZJPL 3H1VX 3WQTA 2FXUA 3NVKA 3FFKB 3W3DA 4K42A 2VYPA 2QWNA 4CZGA 1NGDA 5M1KA 4MO4A 3WT0A 1LCUA 1YAGA 2NLXA 3KWIA 4B1WB 4BREA 4ZRIA 5BPNA 3MN5A 2Q0UA 4YORA 2HBLA 4BC4A 2RHKA 5E26A 4BRAA 4YOVA 3L4IA 3O9UA 4BRIA 4CZFA 3CC7N 3PVLA 2I7NA 4IEEA 1DT9A 3WXKA 4ZRKA 4I6MA 4QS8A 1SZ2A 3FZFA 3WEEB 3CJ7A 4LC9B 3VTIA 2HE7A 4B1VA 1D4XA 3FZHA 1ILYA 1GLDG 4K25A 3VGLA 4BR4A 3LL3A 5AQYA 3JXUA 4ILGB 5AQNA 2NRXA 5AQTA 3UB5A 4PHTX 1SAZA 3AGRA 4JK7A 3OW2M 2WH5A 4JKHA 2Q2RA 3G25A 3IDHA 5JLFA 4C1NK 4A59A 1NI2A 3SLCA 4A61A 4DB3A 3ENBA 2HOEA 4QS7A 2Q97A 2Q1NA 3DXMB 4RWTA 3F9MA 3LDLA 4NB4A 1NGHA 3CJ9A 3L0QA 2P9SB 4FOIA 4IEIA 3VEWA 3IFRA 1NGJA 3OBYA 1GG3A 2GUPA 3I56N 1LOTB 2BUPA 2J0JA 3SMSA 4YDUC 3U9DA 4JKGB 3VEYA 2ASMA 4EAHD 5GIPA 3CCMN 5AQGA 5KQ8A 3GDQA 1S3XA 4M7XA 4DXAB 2KHOA 3TPQA 4E1JA 2WUSA 3ID8A 2AL6A 2HSTA 3CHWA 5AFUH 4ZRJA 1YJWN 1XC3A 2D2QA 2ZJRL 4JD2A 1BWFO 3ULEA 4CZLA 2J0MA 3EE9A 2D1KA 5B8HA 2J4RA 4WQ5C 4NO7A 5IJMA 3VF2A 1X3MA 5CHIA 3R3LA 3GBTA 4WQ5A 4NLCA 1MA9B 1K73O 2P9UB 3CIPA 3AU4A 2IVOA 4JKEA 2P9IB 3MN7A 4H5TA 1M1KO 4ISFA 1H1VA 3CETA 3H3OB 3VMFB 1MK7B 4B9QA 4CZIA 1SQKA 3FP5A 2RQ1A 3HI0A 3TU5A 4JNEA 1KAYA 4CJ7A 3SAFA 4RCHA 1MDUB 1ATSA 1YXQA 3DXKA 2H3GX 4NY0A 4PKGA 4BG9A 5AQSA 1GC7A 4BRDA 5I9EB 3HOSA 1HUXA 4A5AA 2FSNA 2A6AA 4MLHA 4OPHA 5JICA 2QW9A 3C65A 3MK6A 3ENOA 3BF1A 1VBGA 3HTVA 3WXMB 3EZWA 1HB8A 1T44A 1RFQA 4ILHA 3H45C 3VETA 1W2BM 1K8KA 1VQKN 1KC8O 3JS6A 1ATNA 5JVGL 2ITMA 3ZETB 3TTDA 5ADXA 1EO1A 1VQMN 3GE1A 2P9NA 4H5WA 2DIKA 5MLCQ 3FGUA 1TYQB 1U2VB 2NRVA 2GEMA 5AQZA 4BQLA 1YJ9N 4GV3A 4O5FA 4BY9C 2A40A 1KAZA 1NMDA 3C6HA 4PKHA 2GX9A 3R8EA 1V4SA 2PAVA 4WFBL 1K9MO 4BG8A 4MDAA 1VQ5N 1ESVA 1GLBG 3E9OA 4XEIA 1G99A 1P8ZA 4FWOA 2P9LA 4IXCA 3TSUA 4CBWA 1HJOA 3H46O 5FPDA 2WC9A 3H3NO 3MN9A 2AA4A 3F5TA 4JHDB 4YOTA 3CPWM 4C1NI 2A5XA 3KVGA 3LDPA 3WXIA 4UY8O 3AAQA 1OVYA 1CZAN 3KZBA 3O8MA 3WEEA 2CGLA 2F9WA 2P9NB 3M5RA 5CR4A 1NGIA 5EY4A 2OTJN 5AQMA 2J0KA 2P9LB 3P4IA 4XH1A 3UE5A 2AEHA 4BR9A 3O9QA 4MDBA 5C0YA 2LBBA 4JK9A 3M1FA 5GAEP 1K8KB 3A0IX 4BC5A 3J7ZO 3L6QA 2QXLA 2DPNA 3CCRN 2P9IA 4K43A 3CPEA 3VGMA 3CCUN 4BRFA 1MIXA 1VAZA 5AQWA 2QWMA 4F7GA 3DXMA 1T6CA 3ZX2A 1NGAA 5F1XA 1HLUA 5AQXA 2VGNA 4IJAA 4BVOA 3FLVA 2ZPYA 2CGKA 4A62A 1NWKA 1R59O 2HRJA 5M1NA 1VQ7N 1IJJA 1MWKA 4DHYA 4ILJA 1VQ9N 1U6ZA 2EMTA 3KWGA 2CH5A 2IIRA 3A5NC 1Z6RA 4KH4A 1XUPO 5KPTA 5BRFA 3UKRA 2COPA 3R1XA 1ZC6A 3U9ZA 5DM7L 1KXPA 2E8AA 5JMVA 1T6DA 2F7TA 1C0FA 3MWPA 3PZDA 4B1YB 4EHTA 1QZ5A 1ZXOA 4BROA 4P7IA 4Z94A 5KPRA 1GLEG 3ZDTA 3C0BA 3O9SA 3CF5L 4BRCA 3VERA 5C10A 3SAGA 5GINA 5TKWA 5AQIA 3F2KA 1QVFM 1JCGA 1EF1A 3G9WA 5BN8A 1SS6A 4EFHA 3QBXA 5AZIA 2IVPA 4FVUA 1YIJN 3WA0A 3EPYA 2V52B 3AY9A 3VEOA 3Q7CA 1ISNA 3VEVA 3VF4A 3VOVA 3QIJA 5KQDA 4H5NA 1NJIO 1S72N 3NVMA 5BRDA 3CMAN 5F0XA 4FWRA 3MDQA 4RTFD 3CC4N 1KD1O 4CYEA 2BTFA 5ELZA 5AFUA 3E1YA 1OKJA 2ASPA 2E88A 4J8FA 3FLCO 4WQ4A 3CCJN 1DGKN 1TYQA 1U2VA 4WYBA 4BRKA 4IOCL 3O4WA 4H0XB 4WF9L 1GLJO 3DAWA 2FDQA 1VQ4N 2YHYA 2QWPA 1BU6O 1VQON 1S22A 4HWIA 4B1UB 4BR0A 4CBUA 3PIOL 1BG3A 3L4QA 5BPMA 2YHXA 5EXWA 3KHYA 3SK3A 2FLOA 4OPAA 4XH4A 2YJFA 1RDUA 4YL8A 3DLLL 1YITN 3BEXA 4B1ZA 5EX5A 4IO9L 2IVNA 4U67L 2D0OA 2Q36A 1HBKA 3SBGA 1Y64A 4R79A 2BH1A 3EE8A 3MCAB 3MWTA 3ATVA 4QS9A 5C2DA 5GADP 4CZEA 5AZJA 4AF1A 3WXJA 4JKGA 3A8YA 1IG8A 3O1WA 4YOYA 1M90O 2FF3B 3D7EO 3CERA 3GL1A 2P9SA 3K9KA 1JJ2M 4JKFA 4BR5A 4GVEA 1Y19B 2A42A 4ISGA 3AARA 3G6EN 1BOTO 4TKNA 4BGAA 3OHRA 3H6EA 4H5RA 2ABDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILJ A;  4JKB A;  4JKE A;  3E9L A;  4JK8 A;  4JKC A;  4JKA A;  4JKG B;  4JKG A;  3SBT A;  3E66 A;  4JK9 A;  3E9P A;  4ILG B;  4JKF A;  4JK7 A;  4JKH A;  3E9O A;  3ENB A;  4JKD A;  4ILH A;  3SBG A; 
#chains in the Genus database with same CATH topology
 1EXQ A;  3DLH A;  1NK7 A;  3VQP A;  2HBM A;  3JAM O;  2QK9 A;  1ZBI A;  3IS9 A;  4MLE A;  3FZM A;  5KRT A;  3B8A X;  1E4G T;  2KW4 A;  3VGK A;  3QML A;  3HRG A;  4CIG A;  2KKZ A;  2HVI A;  3ZEU B;  3T1H K;  4FSV A;  3LM2 A;  1KVA A;  2QKK A;  4IJN A;  5AQJ A;  3LM9 A;  5GAH P;  2XY8 A;  4HDO A;  1VSM A;  4DTX A;  1NJZ A;  1NGE A;  3ALY A;  4JKC A;  3WNH A;  2RE2 A;  2NRR A;  4CJW A;  4IFV A;  5M1O A;  3C7N A;  4FO0 A;  3GOI A;  4J2A A;  3O9R A;  3AVG A;  3WUH A;  2E2N A;  4BRL A;  3CCS N;  2G8H A;  2IS3 A;  3VES A;  2WFB A;  3O3G A;  1ATR A;  2FBX A;  5FPE A;  4M3Y A;  3SQ4 A;  3A5M C;  1HKG A;  4DS4 A;  4CW7 B;  4I6M B;  1JL1 A;  1Q8I A;  4OKJ A;  4OLB A;  3V4I A;  4DF8 A;  4KRF A;  1N36 K;  4CJE A;  5HRP A;  3AA5 X;  2Z1G A;  1K8A O;  4Q5V A;  4F2S A;  2AJQ A;  1HX1 A;  3AO4 A;  3DMJ A;  4CBX A;  1HJR A;  3G4S N;  1TV6 A;  1KBL A;  1NGG A;  1JCF A;  3NF7 A;  4AM7 A;  3Q7B A;  3RMB A;  4FJK A;  1FKO A;  4DV2 K;  3KIO A;  1P90 A;  3OYM A;  5BN9 A;  2CB8 A;  3QNN A;  3SBT A;  2YI1 A;  2DTU A;  3E66 A;  1WSE A;  4H0P A;  1N5Y A;  1Q81 O;  3T3F A;  2B5J A;  4BVP A;  1X9J A;  4CF9 A;  4OLA A;  3HZ6 A;  3QES A;  3TSQ A;  1X1P A;  4JI5 K;  3PIP L;  4YDU A;  4CED A;  2GBZ A;  5CZ2 A;  1X9S A;  3SPZ A;  3DM2 A;  1GC6 A;  4BC2 A;  5HL7 L;  3PX6 A;  1EX4 A;  4WE1 A;  4F8R A;  4OKE A;  2FF6 A;  4CFB A;  4Z4H A;  4JKA A;  1VQL N;  3ZSQ A;  3O08 A;  1MWM A;  3DRP A;  1TAQ A;  1J53 A;  2V7Z A;  1NLV A;  1CZ9 A;  4HCB A;  3T69 A;  3DLE A;  4LF7 K;  4CHN A;  3HM9 A;  4DV1 K;  5E84 A;  3ZX0 A;  4CGG A;  5KI6 A;  1XC9 A;  3SQ0 A;  4A57 A;  1LWF A;  3QFU A;  2BE2 A;  4C8N A;  4BR7 A;  3HBT A;  2RKI A;  4GKK K;  4JHD A;  4FJJ A;  3G71 N;  1NK9 A;  3OYA A;  1SUQ A;  3MMV A;  3MEG A;  2P9P B;  2HMP A;  4K0K K;  3WNE A;  5LY3 A;  1U4B A;  3LZI A;  1Q9Y A;  2FJ9 A;  2ATQ A;  5IWA K;  1GGO A;  3O6W A;  3DWL A;  3LPU A;  4ID5 A;  2YCH A;  2X0S A;  3TSP A;  3IMX A;  4LF9 K;  4KAZ A;  5AQU A;  3M8S A;  1QS4 A;  2FBV A;  2E1Z A;  2G8F A;  4Z4I A;  2CH6 A;  4B9L A;  3I55 N;  4JN4 A;  2QEX N;  2ZJQ L;  2B4J A;  1T3V A;  1KC7 A;  4JI6 K;  5HP1 A;  3VEZ A;  2QM1 A;  1K6Y A;  5DM6 L;  3E9P A;  4CJ5 A;  3RTV A;  3SMP A;  3QBW A;  2ASO A;  2R82 A;  3BGR A;  2QWR A;  3C7N B;  2ITG A;  3DRS A;  4C8L A;  3S9H A;  2P9U A;  1ITG A;  4CF8 A;  4KPY A;  3DXK B;  4BDY A;  4BRH A;  3NF6 A;  4KH5 A;  3P1G A;  3PUF A;  3SZ2 A;  2Y1J A;  4JRP A;  3ATU A;  3CC2 N;  4M42 A;  2W40 A;  2ZGZ A;  3O9T A;  2I1J A;  4DCH A;  3RMA A;  2YNH A;  2HHX A;  5AR0 A;  3U7D A;  3AAP A;  4B9N A;  1TKT A;  1T8E A;  4FJN A;  4CHQ A;  1D9D A;  2HMI A;  2QWN A;  4IFY A;  3WT0 A;  3DOL A;  4FK2 A;  5FRN A;  4BDZ A;  4OGE A;  1KRP A;  5E26 A;  4BRA A;  4YOV A;  3L4I A;  3O9U A;  4BRI A;  1GOC A;  4Y1D A;  1SL1 A;  3WXK A;  4YY3 K;  4O44 A;  4QS8 A;  1DTT A;  3CJ7 A;  4B1V A;  3O3H A;  1ILY A;  4F3O A;  1RBV A;  4ILG B;  5AQT A;  2NRX A;  2OPQ A;  4PHT X;  1WSI A;  4KTW A;  2Q2R A;  3G25 A;  5JLF A;  3NDK A;  4L8R B;  4C1N K;  4A61 A;  1S9G A;  4KI4 A;  1VSL A;  4LH4 A;  3DXM B;  4DTJ A;  3F9M A;  4ELU A;  3CJ9 A;  4IEI A;  2P9S B;  1Z26 A;  3I56 N;  4FK0 A;  5E41 A;  4JKG B;  1BI4 A;  2ASM A;  3M8R A;  5AQG A;  3GDQ A;  3TAF A;  4RW4 A;  2AL6 A;  2HST A;  4FLZ A;  1YJW N;  4ZRJ A;  1G15 A;  1XC3 A;  4DFJ A;  2D2Q A;  2ZJR L;  4CHY A;  4JD2 A;  3OYC A;  3ULE A;  4W5N A;  3KTQ A;  4JI0 K;  4JS4 A;  5CZ1 A;  4E7H A;  4MFB A;  3AU4 A;  4ISF A;  1X9W A;  4DTM A;  2KTQ A;  1LV5 A;  4HUG A;  4FLY A;  1TL3 A;  4CJ7 A;  3SAF A;  1S6P A;  2ZQB A;  4HHT A;  1C1C A;  1IO2 A;  5AQS A;  3HOS A;  3JSM A;  3TAR A;  3MXM A;  4OPH A;  1U45 A;  3HVT A;  3KLG A;  3BZC A;  3PSF A;  1VQK N;  1KC8 O;  2HND A;  4DV7 K;  4LFA K;  1EO1 A;  1VQM N;  1RTJ A;  1RBS A;  3VQD A;  1U2V B;  2O8E B;  3DLB A;  4DQR A;  3AO2 A;  4BQL A;  3NGI A;  1QTM A;  4BY9 C;  1OH7 A;  4PKH A;  2GX9 A;  1RIL A;  3K5N A;  1ESV A;  4LSL A;  4FLU A;  4DTU A;  4DSL A;  4CBW A;  4LFC K;  1JLB A;  2WC9 A;  3H3N O;  4YOT A;  3CPW M;  3KVG A;  1NOZ A;  1RTI A;  1C0M A;  4CFD A;  3O8M A;  1J9A A;  2CGL A;  2F9W A;  5CR4 A;  1NJX A;  2UXC K;  3OYE A;  3VQ7 A;  3P4I A;  3UE5 A;  4FZY A;  5GAE P;  3A0I X;  3L3V A;  4I2P A;  4B3O A;  4DFM A;  4BE1 A;  3CM5 A;  1MIX A;  3KD1 E;  3QER A;  1WBD A;  1HLU A;  4O55 A;  3BDP A;  3LP2 A;  2VGN A;  1JLG A;  3FLV A;  3HPO A;  1R59 O;  1FW6 A;  1KFS A;  3SQ2 A;  4FM0 A;  1EKE A;  3R1X A;  5DM7 L;  3OTO K;  1T6D A;  3MWP A;  4IG3 A;  4EHT A;  4RW9 A;  4BRO A;  1HMV A;  4X64 K;  4Z94 A;  1GLE G;  1JL2 A;  1S1X A;  5C10 A;  5BN8 A;  4EFH A;  5C42 A;  4FVU A;  4H8K A;  3WA0 A;  1YIJ N;  1Q9X A;  3VEO A;  1NJI O;  3NVM A;  3OYK A;  3CMA N;  3L2U A;  1LW2 A;  3TR8 A;  1TGO A;  4EP4 A;  3SJJ A;  1KD1 O;  2BTF A;  2KFZ A;  4CEE A;  2ASP A;  3FLC O;  4WQ4 A;  1DGK N;  1TYQ A;  3I0S A;  1SKR A;  4H0X B;  4WF9 L;  4HCC A;  2FDQ A;  1VSK A;  2DFH A;  4HWI A;  4B1U B;  3J81 O;  4B3S K;  4CFA A;  4FLT A;  5BPM A;  1FJG K;  3V9U A;  2FLO A;  1CXQ A;  4YL8 A;  3BEX A;  3EE8 A;  2HHS A;  3MCA B;  5C2D A;  1NMN A;  3L2R A;  4CGJ A;  2O8F B;  3VQQ A;  3VQ4 A;  4Z4C A;  1M90 O;  4CJK A;  3DYA A;  4Z0U A;  3L2V A;  3GL1 A;  4BR5 A;  3THY A;  3K5O A;  4LSN A;  1T03 A;  4CEA A;  1BQM A;  2A42 A;  4DSI A;  1RT6 A;  2ABD A;  3NE6 A;  3HVR A;  4CJP A;  1QVG M;  1EP4 A;  1WUA A;  4PL7 A;  3I8D A;  2RN2 A;  3FZK A;  4M3U A;  5CYM A;  4E19 A;  2HHU A;  1LWE A;  3ID6 A;  3D2F A;  3WXL A;  3CXC M;  1O13 A;  5M1F A;  4KHY A;  2F8S A;  3ASM A;  4O8U A;  3HL8 A;  4W5R A;  1I39 A;  4CGH A;  1NK6 A;  4DV0 K;  1S1T A;  3I0R A;  5AQH A;  1D5A A;  2HHT A;  3HO1 A;  1ASU A;  3EKS A;  5HRN A;  1B9D A;  4H0T B;  3ZEU A;  5C12 A;  4FJL A;  1C0U A;  4YOX A;  1NVL A;  1BUP A;  1HQE A;  3RSE A;  1N32 K;  4KBO A;  2QA4 N;  3P5J A;  2O4G A;  3TTC A;  5ADX H;  1MIZ B;  3OYJ A;  2Q31 A;  4FPA A;  3D2E B;  3KLE A;  4YHH K;  2JGU A;  3H1Q A;  2OZS A;  1ZBF A;  3KK3 A;  1WSG A;  1J54 A;  4AHV A;  4C23 A;  4CD3 A;  4CIE A;  3CQY A;  4CIF A;  3MEC A;  1Z25 A;  4OX9 K;  5AQF A;  4X62 K;  1RBT A;  3CQX A;  4DS5 A;  4K8X A;  2CGJ A;  4PKI A;  3VPZ A;  3SJH A;  2UUA K;  5HRS A;  3NMU A;  4DFP A;  4QAG A;  2WBN A;  4EZ9 A;  5M1P A;  1RT7 A;  1WSF A;  3I33 A;  2P9P A;  4FJ9 A;  3U4L A;  3LDN A;  2PBD A;  4XH5 A;  4BWM A;  3CJC A;  5BRH A;  1EQY A;  4JI4 K;  2YJE A;  4CI6 A;  2D0C A;  4RW8 A;  2XO7 A;  1ZBU A;  3LP3 A;  3QB0 A;  3ZCM A;  4H0V B;  5DMR A;  4O0I A;  4ELT A;  1BA0 A;  5KGW A;  2O8C A;  1IV0 A;  1JDE A;  3G10 A;  4ELV A;  4DQP A;  3V1O A;  3E9L A;  2JLE A;  5AQV A;  3KK2 A;  3RRG A;  4J2D A;  4FCY A;  4KHW A;  5JS1 A;  1HPM A;  4PL8 A;  1YI2 N;  3CCQ N;  1YVU A;  5AQL A;  1WOQ A;  4NLB A;  2F4V K;  1GLL O;  4AHC A;  1JLQ A;  3LDO A;  4CZH A;  3U3Y A;  5LMU K;  3NGY A;  1L3V A;  1VQN N;  4OO1 J;  4GVM A;  4N76 A;  2QI2 A;  4H5V A;  4BRG A;  3RR8 A;  4FLV A;  1C1A A;  1XHX A;  5AZJ B;  5C24 A;  1Z05 A;  2KFN A;  3VTH A;  3BUZ B;  3U8Z A;  1TUU A;  3UKU B;  4BR2 A;  2VGM A;  1YJN N;  3ZET A;  4JI7 K;  1QHA A;  4HDQ A;  3CCL N;  4CEF A;  2IGI A;  2GEL A;  3E01 A;  4PA1 A;  1XMO K;  4M3T A;  4U7B A;  3KLI A;  2BAN A;  2WOM A;  3ULE B;  4A2A A;  3HSC A;  3V9X A;  4ID1 A;  3U8X A;  1B92 A;  3A5O C;  1ST7 A;  3DJC A;  2W6L A;  1J5O A;  2PFU A;  3TTF A;  4DR1 K;  2P9K A;  3ZSO A;  3EO3 A;  4CK1 A;  2A1R A;  1SKS A;  2V51 B;  4N5S A;  1I94 K;  1ASV A;  2X74 A;  4ICL A;  1BO5 O;  3OA9 A;  4HUE A;  1V4T A;  1SGH A;  2NUB A;  5FRM A;  4KRE A;  1NK0 A;  2W41 A;  3BP8 A;  1JCE A;  5AZI B;  1ACA A;  4EIA A;  3ZT4 A;  1HB6 A;  2NNW A;  1BDG A;  3UKU A;  1EWQ A;  4CJR A;  1NTI A;  4CES A;  3FZL A;  3SAH A;  5JLH A;  2X6S A;  3CCE N;  1HKB A;  1E3M A;  4DR2 K;  4AM6 A;  3AVF A;  2OAN A;  3OBW A;  4E1N A;  3KJV A;  5SWM A;  4LY7 A;  4I9L A;  1XHZ A;  1BQN A;  3VF6 A;  1OH5 A;  2DY4 A;  2ZJP L;  3WQT A;  2FXU A;  3W3D A;  4K42 A;  1HRH A;  1GOB A;  2VYP A;  1HQU A;  4CZG A;  1J5E K;  1NGD A;  1HYS A;  5M1K A;  3KWI A;  2G8K A;  2O8D B;  3K5L A;  1NK5 A;  3VQ9 A;  1EWR A;  2PZS A;  4ZRI A;  2X6N A;  4DR3 K;  3LAN A;  4GKJ K;  2Q0U A;  3CC7 N;  3PVL A;  2I7N A;  4FJX A;  1SZ2 A;  4C8K A;  3WEE B;  4K25 A;  3H08 A;  3LL3 A;  5FLX O;  2A1S A;  3JXU A;  4CHO A;  4CEQ A;  3UB5 A;  3AGR A;  2WH5 A;  4JKH A;  4A59 A;  3ENB A;  3QEP A;  4RWT A;  2Q1N A;  3HXM A;  2IC3 A;  3LDL A;  2IAJ A;  1VHX A;  1NGH A;  3L0Q A;  1TKZ A;  3IFR A;  4FLX A;  3UIQ A;  2GUP A;  2BUP A;  3ZSX A;  4IG0 A;  4YDU C;  3VEY A;  5HRO A;  3MEE A;  4DXA B;  3TPQ A;  3QEX A;  2WUS A;  3C94 A;  3F73 A;  4FZX C;  1WSH A;  4DTN A;  4X66 K;  4CZL A;  5B8H A;  2J4R A;  4NO7 A;  5IJM A;  1X3M A;  4WQ5 A;  3GBT A;  3T1A A;  3PO5 A;  3MN7 A;  2E4L A;  4JKE A;  2IVO A;  2P9I B;  3ZSV A;  5I42 A;  5JS2 A;  4FM1 A;  1SQK A;  3HI0 A;  1D9F A;  4FJ8 A;  3TU5 A;  4CF2 A;  4OVL A;  1WAJ A;  3C6U A;  4RCH A;  4AQY K;  1YXQ A;  4PKG A;  4BRD A;  3AVJ A;  1A5W A;  4A5A A;  4M3R A;  2A6A A;  4MLH A;  5JIC A;  3THX A;  3ENO A;  1VBG A;  5K14 A;  4UQG A;  4JRQ A;  2OA8 A;  1IG9 A;  3THY B;  1HNV A;  3A2F A;  4DQI A;  1IKW A;  1SV5 A;  1XWL A;  2DIK A;  3FGU A;  4KKO A;  2NRV A;  3K59 A;  3OYL A;  4LF5 K;  2PY5 A;  4O5F A;  1EET A;  3V1Q A;  3RMD A;  2G8I A;  1VRT A;  4MDA A;  4XEI A;  3E9O A;  4IXC A;  4DTS A;  3H46 O;  4DMN A;  3F5T A;  2VG7 A;  4JHD B;  4EP5 A;  3LDP A;  3WXI A;  4I9Q A;  3WEE A;  2P9N B;  3OVN A;  1NGI A;  1A5X A;  2J0K A;  4XH1 A;  2AEH A;  4OPK A;  3O9Q A;  5C0Y A;  5LMN K;  1N6Q A;  3L6Q A;  3LZJ A;  4K43 A;  1VAZ A;  5AQW A;  2QWM A;  3DXM A;  1NGA A;  5F1X A;  5AQX A;  1LAV A;  2O8C B;  2ZPY A;  1VQ7 N;  1VQ9 N;  4DHY A;  4ILJ A;  2EMT A;  3FFI A;  1BCO A;  3OYN A;  4KH4 A;  1XUP O;  5KPT A;  1ZC6 A;  3J7Y P;  1KXP A;  1RT1 A;  4B3T K;  1IKX A;  2F7T A;  4B1Y B;  3PZD A;  5SZT A;  3LWM A;  2EX3 A;  4P7I A;  3CF5 L;  3RRH A;  3ZDT A;  3KKS A;  1ZBH A;  4M3W A;  3TAM A;  1QVF M;  3C6T A;  1EF1 A;  5AZI A;  3EPY A;  1FK9 A;  3WNG A;  3VEV A;  1ISN A;  3VOV A;  3HST B;  4H5N A;  4BWJ A;  3BZK A;  3O3F A;  1NU0 A;  3CG7 A;  2RPI A;  3CC4 N;  5KRS A;  1BIZ A;  3OYH A;  1CLQ A;  4BRK A;  3O4W A;  2VQE K;  2YKN A;  3DAW A;  4CFC A;  1NKE A;  2YHY A;  1VQ4 N;  2QWP A;  1BU6 O;  4XIU A;  1S22 A;  4FLW A;  4AHT A;  1W7A A;  2YHX A;  4CJT A;  3KHY A;  4OPA A;  3DLL L;  2YJF A;  1RDU A;  2ZM6 K;  3SPY A;  3NGZ A;  4GMJ B;  3MWT A;  3ATV A;  5GAD P;  2FBY A;  1KVB A;  3V9W A;  3NH2 A;  1VSH A;  3A8Y A;  4KHS A;  4O4G A;  4JI2 K;  4CJL A;  3V9Z A;  2OZM A;  4FM2 A;  1JKH A;  3ISN C;  1WLJ A;  3CER A;  2P9S A;  4W5O A;  4CGD A;  4JLH A;  1Y19 B;  3AAR A;  3CFP A;  1HR0 K;  4BGA A;  2O8B A;  1ASW A;  3H6E A;  4H5R A;  1KFD A;  2YHB A;  2UUC K;  5AQP A;  4E7I A;  4Z4F A;  2G8U A;  3GG4 A;  4O0J A;  3BF3 A;  2FSJ A;  4M7Y A;  4M3Z A;  3J8A A;  3THW A;  4IOA L;  4IFE A;  5AQO A;  4FVM A;  2D0P A;  4LH5 A;  4IBN A;  1E4F T;  3M6G A;  4DFK A;  4C8M A;  1RDA A;  1LAW A;  3HJF A;  1IH7 A;  3QDK A;  1RTH A;  5CE3 A;  2YVC A;  3P38 A;  1TUY A;  5JVL A;  4FL9 A;  2NZT A;  5BPL A;  3SQ1 A;  5J2Q A;  3IVF A;  4CEO A;  4KH6 A;  1CXU A;  1LWC A;  3QFP A;  4H0O A;  4CEB A;  4JS5 A;  5J2N A;  1KAX A;  2ZF5 O;  1I3A A;  3IG1 A;  4BRM A;  4AH9 A;  1C1B A;  2UYT A;  3CCV N;  5LL6 Z;  3HM8 A;  2Y1I A;  3AVC A;  3QIP A;  3SCX A;  4W5T A;  1W97 L;  3X23 A;  1Q82 O;  3PLA A;  2AP1 A;  1NKC A;  2CQU A;  3OS2 A;  4HUF A;  1B9F A;  4DR7 K;  4JKB A;  2P51 A;  3I8B A;  1T05 A;  3D45 A;  1S1W A;  3CD6 N;  2GTD A;  3MX5 A;  4KTQ A;  4JV5 K;  1RDW X;  4JK8 A;  4DQS A;  4E7L A;  3S3O A;  2QWL A;  4O8K A;  2VWB A;  3O1B A;  4K8Z A;  4GV9 A;  1NOY A;  4QOZ B;  1DEJ A;  3D2E A;  4ZHR A;  3TAG A;  4FOE A;  3VEX A;  3KK1 A;  4FWN A;  3JYT A;  3CFO A;  3ZX3 A;  2HF4 A;  2PYJ A;  2E6L A;  4FWK A;  3UKR B;  4FWP A;  3RR7 A;  2D0A A;  3ZT1 A;  4K41 A;  4BC3 A;  4L3Q A;  1DIK A;  2UU9 K;  3V1R A;  3VQB A;  5BRE A;  4JI1 K;  2QXF A;  4DQ8 A;  2D0B A;  5M1Q A;  1E5W A;  1VQP N;  3CFR A;  5EVZ A;  4H03 B;  1J19 A;  1S6Q A;  2O8B B;  4BRQ A;  2P9K B;  4CZM A;  3A5L C;  2JWK A;  2D10 A;  4IDH A;  5BR9 A;  2XHB A;  1LW0 A;  3ZT3 A;  1NG9 A;  4DTO A;  4PWD A;  1HNW K;  4LFB K;  2RF2 A;  4BGB A;  3CME N;  2E2O A;  3NAE A;  2EMS A;  4CJU A;  5LJV A;  4E0D A;  5FPN A;  4C8O A;  1X3N A;  4R5P A;  3L2W A;  3EN9 A;  3FR0 A;  4DR5 K;  1NJY A;  1NK4 A;  3RSE B;  4TSX A;  4BQZ A;  1NGF A;  2E2Q A;  1VBH A;  2HHW A;  3MAQ A;  4BAC A;  4YOU A;  4CZJ A;  3ZSZ A;  4FW1 A;  2G8W A;  3SNN A;  2NRW A;  1C0G A;  5KPZ A;  2VWK A;  3N4P A;  4IWV A;  3MXI A;  1QQM A;  4IOX A;  3ZYY X;  3FE1 A;  3DRR A;  4HTU A;  1QSL A;  3THX B;  4WFN L;  4FJH A;  1DTQ A;  5HLF A;  3AGK A;  3QIO A;  2JWL A;  2QWQ A;  4BDP A;  1FXX A;  3VQE A;  3K9J A;  1QHT A;  3PV8 A;  1NNE A;  3AO3 A;  4JI3 K;  1KLN A;  5KTQ A;  2IOC A;  4JEP A;  2Z1H A;  4G9Z A;  3MX2 A;  3WNF A;  3LP0 A;  3VQ8 A;  1VQ6 N;  4AHR A;  2HBJ A;  5GAG P;  5JVH L;  3QNO A;  3OYB A;  3OYI A;  1NGC A;  3HP9 A;  3N4Q A;  3OJU A;  1U04 A;  3LAK A;  4AIL C;  4RW7 A;  3CM6 A;  4A2B A;  3QO9 A;  4CEC A;  4MO5 A;  4B9U A;  4WQ4 C;  1W0H A;  3HOT A;  3LWL A;  3H1V X;  3OS0 A;  3NH0 A;  4LF8 K;  3FFK B;  2YV0 X;  4CJ4 A;  3ZSW A;  4B8C A;  1LCU A;  1YAG A;  3QLH A;  3HPG A;  3MN5 A;  3EEQ A;  4YOR A;  4BC4 A;  2RHK A;  3LAL A;  4DTR A;  4CZF A;  1DT9 A;  4ZRK A;  4I6M A;  1TKD A;  3IAY A;  4GW6 A;  4LC9 B;  2HE7 A;  3SUP A;  1D4X A;  1GLD G;  3VGL A;  3O4Q A;  1HYZ A;  4PUO A;  3ZT0 A;  4BR4 A;  2HVH A;  5AQN A;  1QQC A;  3OW2 M;  1SAZ A;  1N34 K;  1RDB A;  3IDH A;  3T1Y K;  5FRO A;  4DB3 A;  4DQQ A;  3ZLJ A;  3K58 A;  4H4M A;  4KB1 A;  4FOI A;  3V9S A;  3VEW A;  1RT4 A;  1NGJ A;  4LD0 A;  1GG3 A;  3CCM N;  3U9D A;  2F96 A;  4EAH D;  5KQ8 A;  4E1J A;  1QSY A;  3VQC A;  3ID8 A;  1REV A;  3CHW A;  4M41 A;  2HNY A;  1HNZ K;  1MU2 A;  4H4O A;  3TWH A;  3NF9 A;  2J0M A;  3EE9 A;  1OVQ A;  2D1K A;  4DTP A;  3QEV A;  3ZSR A;  2XY7 A;  2UXD K;  3R3L A;  4FJI A;  4NLC A;  1MA9 B;  4DV3 K;  3CIP A;  1L5U A;  4H5T A;  3B6P A;  1M1K O;  4OJR A;  1L3T A;  3K0S A;  3H3O B;  3VMF B;  4B9Q A;  3NH1 A;  1C6V A;  1JLE A;  3AVB A;  4JNE A;  1UOC A;  1KAY A;  3KD5 E;  4JI8 K;  1ATS A;  3DXK A;  2H3G X;  4BG9 A;  2FSN A;  3DI6 A;  2QW9 A;  1JXB A;  3BF1 A;  3VQ6 A;  1RFQ A;  4ILH A;  3H45 C;  1K8K A;  3QEI A;  3VA3 A;  2F8T A;  2ITM A;  5ADX A;  3TAP A;  1KVC A;  4H5W A;  1TYQ B;  3S3N A;  5BR8 K;  4JYA K;  2VWJ A;  4B3R K;  2A40 A;  1KLM A;  1NMD A;  3F9K A;  3R8E A;  4DSK A;  2PAV A;  1VQ5 N;  1G99 A;  1P8Z A;  2P9L A;  2KZM A;  1HJO A;  5FPD A;  5KGX A;  1RDD A;  2HW3 A;  2AA4 A;  4O5B A;  4HVJ A;  4UY8 O;  3DLR A;  3M8Q A;  1OVY A;  1CZA N;  2DFE A;  2OTJ N;  5AQM A;  4KB0 A;  4MDB A;  1W9H A;  1XNQ K;  3LDS A;  3ZSY A;  4JK9 A;  3M1F A;  3J7Z O;  1K8K B;  3DLG A;  2QXL A;  4CGI A;  4NCB A;  2DPN A;  1BCM A;  3CCR N;  3CPE A;  3CCU N;  3ZX2 A;  2QKB A;  4IJA A;  3IRX A;  4NXM K;  2CGK A;  1ZBL A;  2HRJ A;  1IJJ A;  3D0P A;  1U6Z A;  3KWG A;  2CH5 A;  2IIR A;  5C25 A;  3A5N C;  1Z6R A;  4Q0B A;  5BRF A;  2COP A;  1RCH A;  2E8A A;  5JMV A;  3U3G A;  1C0F A;  3C95 A;  5CYQ A;  3J80 O;  1RBU A;  3C0B A;  3O9S A;  4J2B A;  3SAG A;  5GIN A;  4B8A B;  5AQI A;  4Y1C A;  4DF4 A;  1JCG A;  4ZTJ A;  1IKV A;  3QBX A;  2GUI A;  2IVP A;  2V52 B;  3AY9 A;  3Q7C A;  3VF4 A;  5KQD A;  4EZ6 A;  1S72 N;  4AHU A;  5BRD A;  4CER A;  4KHP K;  5F0X A;  4LF4 K;  4FWR A;  3MDQ A;  3AVK A;  4CYE A;  5ELZ A;  5AFU A;  3E1Y A;  1OKJ A;  4J8F A;  4DG1 A;  1U2V A;  2O8E A;  4WYB A;  1SL2 A;  4CF0 A;  4CCH A;  2KQ2 A;  1A5V A;  1XNR K;  3AVA A;  4BE0 A;  3L4Q A;  3OJS A;  4FJ5 A;  1RT3 A;  4RW6 A;  1YIT N;  4CJS A;  3G0Z A;  4G1Q A;  4U67 L;  2Q36 A;  1HBK A;  4KO0 A;  4OKK A;  2BH1 A;  4FJG A;  1FKP A;  5AZJ A;  2YKM A;  4AF1 A;  3WXJ A;  3AO5 A;  1IG8 A;  4YOY A;  1WAF A;  3D7E O;  3K9K A;  4E3S A;  3TAQ A;  3OYG A;  4GVE A;  4TKN A;  1RBR A;  3OHR A;  4V19 S;  2P5O A;  1XI1 A;  4H0Y B;  3MED A;  2P1J A;  3SV3 A;  3CJB A;  3DLK A;  4JD2 B;  3V81 A;  3TI0 A;  3HYF A;  1UWB A;  2ZGY A;  4FJ7 A;  1Q18 A;  1YVN A;  1DKG D;  1NGB A;  4EKU A;  1VQ8 N;  4FWQ A;  3VN5 A;  5J2M A;  1Y97 A;  5J2P A;  1QQN A;  2FSK A;  2QTD A;  4Z4G A;  4GXB A;  2QWO A;  4B08 A;  3AVI A;  4I7F A;  4B3M K;  4M45 A;  1YTU A;  3AA4 A;  1QQO A;  3M8P A;  3CJA A;  4Y0W A;  4HTL A;  3PY8 A;  2HB5 A;  1WB9 A;  3B6O A;  4IKF A;  3R9P A;  3IUC A;  1BA1 A;  1VSI A;  4GNI A;  4DU3 A;  3AO1 A;  4CEZ A;  5GIO A;  3SUO A;  2E6M A;  4IO8 A;  1N8R O;  4IZ9 A;  3OY9 A;  4NYN A;  3WQU A;  4DV5 K;  2EHG A;  4JAX A;  4DV4 K;  4DR4 K;  3HPH A;  1YHQ N;  3P31 A;  4CD1 A;  1QZ6 A;  2I5J A;  3LPT A;  4CJQ A;  3AA2 A;  4A5B A;  2E1Y A;  2A3Z A;  1H4R A;  3MN6 A;  1J6Z A;  4DLE A;  4GV6 A;  1TK0 A;  3MCP A;  2NRH A;  4KHU A;  3EL2 A;  2YNF A;  4OGC A;  1RT5 A;  2OTL N;  1WNS A;  3C6A A;  1RT2 A;  1F21 A;  2BDP A;  4FPB A;  5LJW A;  2OPS A;  3LDQ A;  5C2F A;  1YF5 L;  1RDC A;  3T7Z A;  4EHU A;  4B1X B;  1GOA A;  2I1K A;  2NRZ A;  2F9T A;  2HNZ A;  4BRN A;  3NF8 A;  1HKC A;  2YHA A;  4DSF A;  5C15 A;  5AQK A;  1Q7Y O;  2FC0 A;  2O8D A;  2E2P A;  3U6F A;  2BGG A;  2NRT A;  2ZE2 A;  5TKY A;  5F2R A;  2YNG A;  3D2F B;  1GLF O;  2HHH K;  3ULD A;  1VRU A;  3K57 A;  4BRP A;  3O4N A;  1KQS M;  2VCP A;  3VEN A;  1QE1 A;  3O80 A;  4FWM A;  1U49 A;  2D11 A;  4DKW A;  1X9M A;  4WFA L;  1OH6 A;  4FXD A;  3AVL A;  3PSI A;  1GLA G;  1NBW A;  4KHN A;  2HHQ A;  1WBB A;  1RGI A;  3SUQ A;  3W0L A;  2EWS A;  3EZ5 A;  4DLG A;  2A41 A;  2V7Y A;  2XY5 A;  3V6D A;  1GLC G;  2KLA A;  3LP1 A;  1Q86 O;  3IKM A;  4DUZ K;  5H1S Q;  4CZK A;  1BGX T;  1ZBS A;  3THW B;  3SUN A;  1T7P A;  4CGF A;  4FWS A;  3S3M A;  1R0A A;  1NM1 A;  2GWK A;  2OPP A;  3EKU A;  4B9M A;  1U47 A;  1TVR A;  2OCE A;  3RVC A;  3VQ5 A;  4DU4 A;  3D6R A;  3KK7 A;  4F9O A;  2E5L K;  3K5M A;  5AQR A;  3PX0 A;  1WN7 A;  2ZWH A;  5EU7 A;  4CF1 A;  4KV8 A;  2G8V A;  1MK9 B;  4ISE A;  2I7P A;  4E7J A;  2KZZ A;  5FPM A;  2HBK A;  1XQS C;  1NJW A;  2GWJ A;  1BIU A;  3AA3 A;  5A2Q O;  1BL3 A;  2YX6 A;  4FWL A;  3P39 A;  1VSD A;  3S41 A;  4N41 A;  1YT3 A;  3HT3 A;  2UXB K;  4X65 K;  3ENH A;  4I2Q A;  3QIC A;  2VG5 A;  5AQQ A;  3RWU A;  1TL1 A;  1YUW A;  2Q3S A;  4E89 A;  4KTZ A;  2E20 A;  1TKX A;  5EOY A;  4GY2 B;  3BIN A;  1L3U A;  3M3Z A;  1KTQ A;  3R6M A;  3AU5 A;  1DLO A;  3CJ1 A;  2XRI A;  4KHQ A;  5AJ3 K;  3RMC A;  1IBL K;  2R7Y A;  4N56 A;  3KLF A;  1VSF A;  4FW2 A;  1L3S A;  4YOW A;  3NHG A;  1BIS A;  4YFU A;  2HF3 A;  4JKD A;  1UA1 A;  4CJV A;  2Q0R A;  1UA0 A;  3CI5 A;  3NBP A;  5J1E A;  1VSJ A;  2X78 A;  2GV9 A;  4FJM A;  2D4W A;  4CK2 A;  2DFF A;  1NK8 A;  3L3U A;  4M63 C;  3O5B A;  2YHW A;  3NFA A;  5HOO A;  4WCE L;  3NVK A;  3HP6 A;  4CE9 A;  1O1W A;  4MO4 A;  4BRE A;  2NLX A;  2UUB K;  4B1W B;  5DK5 A;  5BPN A;  2HBL A;  1S1V A;  3J7A P;  3TAN A;  1SKW A;  4IEE A;  2Z1I A;  3QEW A;  3FZF A;  1ZYQ A;  3K2P A;  3VTI A;  3FZH A;  1JLF A;  1HNX K;  5AQY A;  1YTA A;  4JK7 A;  5FDL A;  4NCA A;  1JLA A;  4NXN K;  1NI2 A;  3SLC A;  2HOE A;  4QS7 A;  2Q97 A;  3TAE A;  4F3T A;  3OS1 A;  4CK3 A;  4NB4 A;  4BE2 A;  4YNQ A;  1JXE A;  3OBY A;  1KCF A;  1LOT B;  3SMS A;  2J0J A;  5GIP A;  4OPJ A;  1S5J A;  2IDO A;  4M7X A;  1S3X A;  2KHO A;  2Z1J A;  3SV4 A;  5AFU H;  3KLH A;  4FK4 A;  1BWF O;  4DSE A;  1OH8 A;  4J2E A;  3P83 D;  4WQ5 C;  3VF2 A;  4B9S A;  5CHI A;  1K73 O;  2P9U B;  2YNI A;  1TAU A;  3VA0 A;  3PX4 A;  3THV A;  1TK8 A;  1H1V A;  3CET A;  2VG6 A;  4DU1 A;  1MK7 B;  4FZZ A;  2O4I A;  2OPR A;  4CZI A;  4DSJ A;  3FP5 A;  2FBT A;  2RQ1 A;  3OYD A;  4B9T A;  1MDU B;  4DUY K;  4NY0 A;  5I9E B;  2ETJ A;  1GC7 A;  1HUX A;  2OYQ A;  5HRR A;  1IBM K;  1U48 A;  4M3X A;  5D3G A;  3C65 A;  3MK6 A;  4FYD A;  4CJ3 A;  4LF6 K;  2LSN A;  3WXM B;  3HTV A;  4MQ3 A;  3EY1 A;  3EZW A;  1NKB A;  1HB8 A;  1T44 A;  5T7B A;  3L8B A;  3VET A;  3CQ8 A;  4N47 A;  4E7K A;  1W2B M;  1RNH A;  1VK0 A;  3JS6 A;  3AV9 A;  1ATN A;  5JVG L;  4B9V A;  3ZET B;  3TTD A;  3GE1 A;  2P9N A;  1S1U A;  1SL0 A;  4CJF A;  3QIN A;  5MLC Q;  2WTU A;  4IDK A;  1JLC A;  2O8F A;  2GEM A;  4QCL A;  3LAM A;  5AQZ A;  1YJ9 N;  4CVN E;  4GV3 A;  1KAZ A;  3C6H A;  4ZTF A;  4PY5 A;  1V4S A;  3CYM A;  4WFB L;  1K9M O;  4BG8 A;  1GLB G;  4FWO A;  3TSU A;  3AVN A;  3AVH A;  3MN9 A;  4C1N I;  2A5X A;  3AAQ A;  1RTD A;  2ZD1 A;  3KZB A;  3OYF A;  5I3U A;  3M5R A;  5EY4 A;  5IT9 O;  2HHV A;  2P9L B;  4BR9 A;  3MXJ A;  3VQA A;  1XMQ K;  2LBB A;  4BC5 A;  3SYZ A;  2P9I A;  3VGM A;  4BRF A;  4CHZ A;  4F7G A;  1T6C A;  4DWI A;  4BVO A;  4E1M A;  1TK5 A;  4RG8 A;  4F4K A;  4A62 A;  1NWK A;  5M1N A;  1MWK A;  2WON A;  3ZT2 A;  3L2Q A;  5CY4 A;  3PO4 A;  3UKR A;  3U9Z A;  4F2R A;  1HYV A;  1QZ5 A;  1BHL A;  1S9E A;  1ZXO A;  3AVM A;  3BY5 A;  3NCI A;  4NCG A;  4AHS A;  5KPR A;  3SI6 A;  4BRC A;  3VER A;  1C0T A;  5TKW A;  3F2K A;  2W6K A;  3G9W A;  1SS6 A;  2B6A A;  3QIJ A;  4W5Q A;  2XY6 A;  1WSJ A;  4KFB A;  4RTF D;  4Z4E A;  1QSS A;  2E88 A;  3DOK A;  2P5G A;  3CCJ N;  4IOC L;  2D5R A;  1IBK K;  3EYZ A;  1GLJ O;  2W42 A;  1VQO N;  3PIO L;  4BR0 A;  4CBU A;  1D8Y A;  1BG3 A;  3QET A;  3KKR A;  5EXW A;  3SK3 A;  4XH4 A;  4B1Z A;  5EX5 A;  4IO9 L;  2IVN A;  2D0O A;  4DV6 K;  3SBG A;  1Y64 A;  4R79 A;  1CZB A;  4QS9 A;  3TAB A;  4KI6 A;  4DR6 K;  1HPZ A;  4CZE A;  4JKG A;  1BI4 B;  5HBM A;  3O1W A;  2PYL A;  1UAX A;  2FF3 B;  2VQF K;  1KSP A;  1N33 K;  3ITH A;  1JJ2 M;  3HK2 A;  4JKF A;  1VSE A;  1IKY A;  4PQU A;  4CHP A;  4NYF A;  1HNI A;  4ISG A;  3G6E N;  3T19 A;  1BOT O; 
#chains in the Genus database with same CATH homology
 4H0Y B;  3CJB A;  4JD2 B;  1QVG M;  5AQP A;  1WUA A;  3GG4 A;  2HBM A;  2ZGY A;  4PL7 A;  3FZK A;  3BF3 A;  2FSJ A;  4M7Y A;  1Q18 A;  3J8A A;  1YVN A;  1DKG D;  4MLE A;  3FZM A;  4IOA L;  1NGB A;  4IFE A;  4EKU A;  3B8A X;  1E4G T;  1VQ8 N;  4FWQ A;  3ID6 A;  5AQO A;  3D2F A;  2D0P A;  3WXL A;  1E4F T;  3VGK A;  3M6G A;  1QQN A;  1O13 A;  2FSK A;  2QTD A;  3QML A;  3CXC M;  3HRG A;  5M1F A;  4GXB A;  2KKZ A;  2QWO A;  4O8U A;  3ZEU B;  3QDK A;  4FSV A;  3LM2 A;  5AQH A;  1QQO A;  5CE3 A;  2YVC A;  3CJA A;  3P38 A;  4IJN A;  4Y0W A;  1TUY A;  3LM9 A;  4HTL A;  5AQJ A;  5GAH P;  5JVL A;  3EKS A;  4FL9 A;  4HDO A;  2NZT A;  5BPL A;  1NGE A;  3IVF A;  3R9P A;  4JKC A;  3IUC A;  1BA1 A;  4H0T B;  3ZEU A;  4GNI A;  4KH6 A;  2RE2 A;  3QFP A;  4H0O A;  5C12 A;  2NRR A;  5GIO A;  1NVL A;  5M1O A;  4YOX A;  1BUP A;  1KAX A;  2ZF5 O;  3C7N A;  4IO8 A;  4FO0 A;  3RSE A;  4IZ9 A;  4KBO A;  2QA4 N;  1N8R O;  3GOI A;  4BRM A;  3TTC A;  3WQU A;  5ADX H;  1MIZ B;  2Q31 A;  3O9R A;  4FPA A;  4JAX A;  2E2N A;  3WUH A;  3D2E B;  2UYT A;  4BRL A;  3CCV N;  3P31 A;  1YHQ N;  3HM8 A;  3CCS N;  3H1Q A;  4CD1 A;  1QZ6 A;  3VES A;  4C23 A;  1W97 L;  4CD3 A;  3X23 A;  2WFB A;  1Q82 O;  1ATR A;  4A5B A;  3CQY A;  5FPE A;  3PLA A;  2E1Y A;  2A3Z A;  1H4R A;  3MN6 A;  1J6Z A;  2AP1 A;  1HKG A;  2CQU A;  3A5M C;  3MCP A;  5AQF A;  4GV6 A;  2NRH A;  3CQX A;  4JKB A;  2CGJ A;  3I8B A;  4PKI A;  3SJH A;  3VPZ A;  3CD6 N;  3EL2 A;  3NMU A;  2GTD A;  3MX5 A;  4I6M B;  2WBN A;  1RDW X;  5M1P A;  4JK8 A;  3C6A A;  2OTL N;  3I33 A;  2P9P A;  4FPB A;  3U4L A;  5LJW A;  2QWL A;  4O8K A;  3LDN A;  3LDQ A;  2PBD A;  2VWB A;  4XH5 A;  5C2F A;  3O1B A;  4GV9 A;  3CJC A;  1YF5 L;  5BRH A;  1DEJ A;  3T7Z A;  4EHU A;  4B1X B;  1EQY A;  2I1K A;  2NRZ A;  3D2E A;  1K8A O;  2YJE A;  2F9T A;  4BRN A;  4FOE A;  4CI6 A;  1HX1 A;  3VEX A;  1HKC A;  4CBX A;  5C15 A;  5AQK A;  3G4S N;  1Q7Y O;  3QB0 A;  4FWN A;  2E2P A;  2NRT A;  4H0V B;  1KBL A;  5TKY A;  1NGG A;  1JCF A;  5F2R A;  1BA0 A;  1JDE A;  3D2F B;  3Q7B A;  4AM7 A;  3ZX3 A;  2HF4 A;  1P90 A;  1GLF O;  4FWK A;  3E9L A;  5BN9 A;  5AQV A;  2CB8 A;  4BRP A;  3UKR B;  1KQS M;  4FWP A;  2VCP A;  3VEN A;  3SBT A;  2YI1 A;  3E66 A;  3O80 A;  4FWM A;  4H0P A;  1Q81 O;  4K41 A;  4BC3 A;  2D11 A;  4L3Q A;  4DKW A;  1HPM A;  4BVP A;  1DIK A;  4PL8 A;  4WFA L;  1YI2 N;  3CCQ N;  5AQL A;  1X9J A;  1WOQ A;  4NLB A;  1GLL O;  3HZ6 A;  3TSQ A;  5BRE A;  1GLA G;  1NBW A;  3LDO A;  4CZH A;  4DQ8 A;  5M1Q A;  3PIP L;  1E5W A;  4YDU A;  1RGI A;  1VQP N;  3W0L A;  2EWS A;  5EVZ A;  1VQN N;  4H03 B;  2A41 A;  2V7Y A;  1J19 A;  4OO1 J;  1GLC G;  2KLA A;  4BRQ A;  1Q86 O;  1GC6 A;  3IKM A;  4BC2 A;  2P9K B;  2QI2 A;  4H5V A;  4CZM A;  5HL7 L;  4BRG A;  3A5L C;  5H1S Q;  2FF6 A;  4CZK A;  4JKA A;  1ZBS A;  2JWK A;  5AZJ B;  1VQL N;  3O08 A;  2D10 A;  4IDH A;  1MWM A;  5BR9 A;  1Z05 A;  4FWS A;  2V7Z A;  1NLV A;  1NM1 A;  2GWK A;  3EKU A;  3T69 A;  3VTH A;  3BUZ B;  3U8Z A;  1TUU A;  3RVC A;  3UKU B;  3D6R A;  3KK7 A;  4BR2 A;  2VGM A;  4F9O A;  1YJN N;  5E84 A;  3ZET A;  1QHA A;  4HDQ A;  3ZX0 A;  3CCL N;  5AQR A;  4BGB A;  2GEL A;  3CME N;  4A57 A;  4BR7 A;  3QFU A;  2E2O A;  2ZWH A;  3HBT A;  2EMS A;  4JHD A;  1MK9 B;  5LJV A;  4U7B A;  4ISE A;  2I7P A;  5FPM A;  5FPN A;  3G71 N;  2HBK A;  3ULE B;  4A2A A;  1X3N A;  1XQS C;  3MMV A;  3HSC A;  2P9P B;  2GWJ A;  2HMP A;  3EN9 A;  3FR0 A;  3U8X A;  3A5O C;  3RSE B;  5LY3 A;  2YX6 A;  4FWL A;  1ST7 A;  2FJ9 A;  4BQZ A;  1NGF A;  2E2Q A;  3DJC A;  3P39 A;  1VBH A;  3S41 A;  1GGO A;  2PFU A;  3TTF A;  3O6W A;  3DWL A;  2P9K A;  3EO3 A;  4YOU A;  4CZJ A;  2YCH A;  2X0S A;  3ENH A;  3TSP A;  2V51 B;  3IMX A;  3QIC A;  5AQQ A;  2NRW A;  1C0G A;  1YUW A;  5AQU A;  5KPZ A;  2E20 A;  5EOY A;  4GY2 B;  1BO5 O;  3OA9 A;  3BIN A;  2E1Z A;  1V4T A;  1SGH A;  3N4P A;  4IWV A;  3M3Z A;  1QQM A;  4IOX A;  3ZYY X;  3R6M A;  2CH6 A;  3AU5 A;  3FE1 A;  3CJ1 A;  3I55 N;  4JN4 A;  2QEX N;  2ZJQ L;  4WFN L;  1T3V A;  1KC7 A;  2W41 A;  3BP8 A;  1JCE A;  5AZI B;  1ACA A;  4EIA A;  3AGK A;  3VEZ A;  2JWL A;  2QWQ A;  2QM1 A;  5DM6 L;  3E9P A;  1HB6 A;  2NNW A;  1BDG A;  3K9J A;  3UKU A;  3SMP A;  3QBW A;  4YOW A;  2ASO A;  1NTI A;  2R82 A;  3FZL A;  4JEP A;  4G9Z A;  2QWR A;  3MX2 A;  3C7N B;  2HF3 A;  4JKD A;  1VQ6 N;  2HBJ A;  2Q0R A;  5GAG P;  3SAH A;  5JVH L;  5JLH A;  3CCE N;  3CI5 A;  1HKB A;  2P9U A;  3DXK B;  4BRH A;  4AM6 A;  1NGC A;  3N4Q A;  4KH5 A;  2D4W A;  2OAN A;  3ATU A;  3OBW A;  3CC2 N;  2W40 A;  2ZGZ A;  3O9T A;  4M63 C;  3O5B A;  2I1J A;  4A2B A;  4DCH A;  4MO5 A;  2YHW A;  5AR0 A;  4WQ4 C;  3VF6 A;  3U7D A;  3HOT A;  3AAP A;  4WCE L;  5HOO A;  2ZJP L;  3H1V X;  3WQT A;  2FXU A;  3NVK A;  3FFK B;  3W3D A;  4K42 A;  2VYP A;  2QWN A;  4CZG A;  1NGD A;  5M1K A;  4MO4 A;  3WT0 A;  1LCU A;  1YAG A;  2NLX A;  3KWI A;  4B1W B;  4BRE A;  4ZRI A;  5BPN A;  3MN5 A;  2Q0U A;  4YOR A;  2HBL A;  4BC4 A;  2RHK A;  5E26 A;  4BRA A;  4YOV A;  3L4I A;  3O9U A;  4BRI A;  4CZF A;  3CC7 N;  3PVL A;  2I7N A;  4IEE A;  1DT9 A;  3WXK A;  4ZRK A;  4I6M A;  4QS8 A;  1SZ2 A;  3FZF A;  3WEE B;  3CJ7 A;  4LC9 B;  3VTI A;  2HE7 A;  4B1V A;  1D4X A;  3FZH A;  1ILY A;  1GLD G;  4K25 A;  3VGL A;  4BR4 A;  3LL3 A;  5AQY A;  3JXU A;  4ILG B;  5AQN A;  2NRX A;  5AQT A;  3UB5 A;  4PHT X;  1SAZ A;  3AGR A;  4JK7 A;  3OW2 M;  2WH5 A;  4JKH A;  2Q2R A;  3G25 A;  3IDH A;  5JLF A;  4C1N K;  4A59 A;  1NI2 A;  3SLC A;  4A61 A;  4DB3 A;  3ENB A;  2HOE A;  4QS7 A;  2Q97 A;  2Q1N A;  3DXM B;  4RWT A;  3F9M A;  3LDL A;  4NB4 A;  1NGH A;  3CJ9 A;  3L0Q A;  2P9S B;  4FOI A;  4IEI A;  3VEW A;  3IFR A;  1NGJ A;  3OBY A;  1GG3 A;  2GUP A;  3I56 N;  1LOT B;  2BUP A;  2J0J A;  3SMS A;  4YDU C;  3U9D A;  4JKG B;  3VEY A;  2ASM A;  4EAH D;  5GIP A;  3CCM N;  5AQG A;  5KQ8 A;  3GDQ A;  1S3X A;  4M7X A;  4DXA B;  2KHO A;  3TPQ A;  4E1J A;  2WUS A;  3ID8 A;  2AL6 A;  2HST A;  3CHW A;  5AFU H;  4ZRJ A;  1YJW N;  1XC3 A;  2D2Q A;  2ZJR L;  4JD2 A;  1BWF O;  3ULE A;  4CZL A;  2J0M A;  3EE9 A;  2D1K A;  5B8H A;  2J4R A;  4WQ5 C;  4NO7 A;  5IJM A;  3VF2 A;  1X3M A;  5CHI A;  3R3L A;  3GBT A;  4WQ5 A;  4NLC A;  1MA9 B;  1K73 O;  2P9U B;  3CIP A;  3AU4 A;  2IVO A;  4JKE A;  2P9I B;  3MN7 A;  4H5T A;  1M1K O;  4ISF A;  1H1V A;  3CET A;  3H3O B;  3VMF B;  1MK7 B;  4B9Q A;  4CZI A;  1SQK A;  3FP5 A;  2RQ1 A;  3HI0 A;  3TU5 A;  4JNE A;  1KAY A;  4CJ7 A;  3SAF A;  4RCH A;  1MDU B;  1ATS A;  1YXQ A;  3DXK A;  2H3G X;  4NY0 A;  4PKG A;  4BG9 A;  5AQS A;  1GC7 A;  4BRD A;  5I9E B;  3HOS A;  1HUX A;  4A5A A;  2FSN A;  2A6A A;  4MLH A;  4OPH A;  5JIC A;  2QW9 A;  3C65 A;  3MK6 A;  3ENO A;  3BF1 A;  1VBG A;  3HTV A;  3WXM B;  3EZW A;  1HB8 A;  1T44 A;  1RFQ A;  4ILH A;  3H45 C;  3VET A;  1W2B M;  1K8K A;  1VQK N;  1KC8 O;  3JS6 A;  1ATN A;  5JVG L;  2ITM A;  3ZET B;  3TTD A;  5ADX A;  1EO1 A;  1VQM N;  3GE1 A;  2P9N A;  4H5W A;  2DIK A;  5MLC Q;  3FGU A;  1TYQ B;  1U2V B;  2NRV A;  2GEM A;  5AQZ A;  4BQL A;  1YJ9 N;  4GV3 A;  4O5F A;  4BY9 C;  2A40 A;  1KAZ A;  1NMD A;  3C6H A;  4PKH A;  2GX9 A;  3R8E A;  1V4S A;  2PAV A;  4WFB L;  1K9M O;  4BG8 A;  4MDA A;  1VQ5 N;  1ESV A;  1GLB G;  3E9O A;  4XEI A;  1G99 A;  1P8Z A;  4FWO A;  2P9L A;  4IXC A;  3TSU A;  4CBW A;  1HJO A;  3H46 O;  5FPD A;  2WC9 A;  3H3N O;  3MN9 A;  2AA4 A;  3F5T A;  4JHD B;  4YOT A;  3CPW M;  4C1N I;  2A5X A;  3KVG A;  3LDP A;  3WXI A;  4UY8 O;  3AAQ A;  1OVY A;  1CZA N;  3KZB A;  3O8M A;  3WEE A;  2CGL A;  2F9W A;  2P9N B;  3M5R A;  5CR4 A;  1NGI A;  5EY4 A;  2OTJ N;  5AQM A;  2J0K A;  2P9L B;  3P4I A;  4XH1 A;  3UE5 A;  2AEH A;  4BR9 A;  3O9Q A;  4MDB A;  5C0Y A;  2LBB A;  4JK9 A;  3M1F A;  5GAE P;  1K8K B;  3A0I X;  4BC5 A;  3J7Z O;  3L6Q A;  2QXL A;  2DPN A;  3CCR N;  2P9I A;  4K43 A;  3CPE A;  3VGM A;  3CCU N;  4BRF A;  1MIX A;  1VAZ A;  5AQW A;  2QWM A;  4F7G A;  3DXM A;  1T6C A;  3ZX2 A;  1NGA A;  5F1X A;  1HLU A;  5AQX A;  2VGN A;  4IJA A;  4BVO A;  3FLV A;  2ZPY A;  2CGK A;  4A62 A;  1NWK A;  1R59 O;  2HRJ A;  5M1N A;  1VQ7 N;  1IJJ A;  1MWK A;  4DHY A;  4ILJ A;  1VQ9 N;  1U6Z A;  2EMT A;  3KWG A;  2CH5 A;  2IIR A;  3A5N C;  1Z6R A;  4KH4 A;  1XUP O;  5KPT A;  5BRF A;  3UKR A;  2COP A;  3R1X A;  1ZC6 A;  3U9Z A;  5DM7 L;  1KXP A;  2E8A A;  5JMV A;  1T6D A;  2F7T A;  1C0F A;  3MWP A;  3PZD A;  4B1Y B;  4EHT A;  1QZ5 A;  1ZXO A;  4BRO A;  4P7I A;  4Z94 A;  5KPR A;  1GLE G;  3ZDT A;  3C0B A;  3O9S A;  3CF5 L;  4BRC A;  3VER A;  5C10 A;  3SAG A;  5GIN A;  5TKW A;  5AQI A;  3F2K A;  1QVF M;  1JCG A;  1EF1 A;  3G9W A;  5BN8 A;  1SS6 A;  4EFH A;  3QBX A;  5AZI A;  2IVP A;  4FVU A;  1YIJ N;  3WA0 A;  3EPY A;  2V52 B;  3AY9 A;  3VEO A;  3Q7C A;  1ISN A;  3VEV A;  3VF4 A;  3VOV A;  3QIJ A;  5KQD A;  4H5N A;  1NJI O;  1S72 N;  3NVM A;  5BRD A;  3CMA N;  5F0X A;  4FWR A;  3MDQ A;  4RTF D;  3CC4 N;  1KD1 O;  4CYE A;  2BTF A;  5ELZ A;  5AFU A;  3E1Y A;  1OKJ A;  2ASP A;  2E88 A;  4J8F A;  3FLC O;  4WQ4 A;  3CCJ N;  1DGK N;  1TYQ A;  1U2V A;  4WYB A;  4BRK A;  4IOC L;  3O4W A;  4H0X B;  4WF9 L;  1GLJ O;  3DAW A;  2FDQ A;  1VQ4 N;  2YHY A;  2QWP A;  1BU6 O;  1VQO N;  1S22 A;  4HWI A;  4B1U B;  4BR0 A;  4CBU A;  3PIO L;  1BG3 A;  3L4Q A;  5BPM A;  2YHX A;  5EXW A;  3KHY A;  3SK3 A;  2FLO A;  4OPA A;  4XH4 A;  2YJF A;  1RDU A;  4YL8 A;  3DLL L;  1YIT N;  3BEX A;  4B1Z A;  5EX5 A;  4IO9 L;  2IVN A;  4U67 L;  2D0O A;  2Q36 A;  1HBK A;  3SBG A;  1Y64 A;  4R79 A;  2BH1 A;  3EE8 A;  3MCA B;  3MWT A;  3ATV A;  4QS9 A;  5C2D A;  5GAD P;  4CZE A;  5AZJ A;  4AF1 A;  3WXJ A;  4JKG A;  3A8Y A;  1IG8 A;  3O1W A;  4YOY A;  1M90 O;  2FF3 B;  3D7E O;  3CER A;  3GL1 A;  2P9S A;  3K9K A;  1JJ2 M;  4JKF A;  4BR5 A;  4GVE A;  1Y19 B;  2A42 A;  4ISG A;  3AAR A;  3G6E N;  1BOT O;  4TKN A;  4BGA A;  3OHR A;  3H6E A;  4H5R A;  2ABD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...