4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
b'ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
4JKCA 3E9OA 3SBTA 4JK9A 3ENBA 4JKBA 4ILGB 3SBGA 4JKGB 4JKAA 4JKHA 4JKFA 3E9PA 4JKEA 3E9LA 4JKGA 4JKDA 4JK8A 4ILHA 4ILJA 4JK7A 3E66A
chains in the Genus database with same CATH superfamily
3FP5A 1TVRA 3CJ1A 4FM2A 4DG1A 1HB6A 1CXQA 4FK0A 3EYZA 1NG9A 4M3ZA 4LC9B 4FM0A 4A2AA 2GX9A 3ATVA 3PIOL 3F73A 3SQ0A 3LAKA 5J2NA 2W41A 1C0GA 4DTXA 2WOMA 1HYVA 4KREA 3SMPA 4A2BA 1REVA 4CJEA 1U2VA 3RMCA 4BREA 1VQNN 4BRLA 5FRMA 3AO5A 3IMXA 5JVHL 3K57A 4FJJA 3OYGA 4BRAA 3CJBA 4BC2A 4ZTJA 4AM7A 4DF8A 1NGCA 3DM2A 1XNQK 3A5LC 1S5JA 4JS5A 3THWB 1JCEA 1QHAA 1T44A 1VSKA 2A42A 1Y97A 4B3MK 1M1KO 4LF4K 5AZIA 4DTMA 3LDNA 3HOSA 4HUEA 4H4OA 2CQUA 3CJAA 3O9SA 2KQ2A 3FR0A 1C1BA 4JNEA 1F21A 5HRRA 4HCCA 1M90O 3UIQA 4WF9L 5DM6L 2P9LB 4NYFA 3KLFA 3WXIA 1QSYA 4DMNA 3P83D 1T7PA 4W5OA 1MK9B 3QETA 4L3QA 1JCFA 1GLDG 2UUCK 3ZSRA 1TL3A 2A5XA 1NTIA 3OS2A 4OKEA 3DLKA 2I7PA 3JS6A 4CF0A 1HUXA 4A62A 4W5RA 4E7LA 1J54A 3Q7CA 4HHTA 3HI0A 5FROA 4JKHA 3O3FA 1NOYA 3AVMA 4IFEA 4Z4HA 5JVGL 2YKNA 1S1VA 1NNEA 1JKHA 2O8DA 2WBNA 4DTUA 2D1KA 3FGUA 3A5NC 5JS2A 2DTUA 4CJQA 4CI6A 2Z1HA 4FXDA 4PQUA 1JLGA 4BG9A 4OPKA 2AJQA 2H3GX 2BDPA 4KBOA 4PL7A 4BC3A 2NUBA 5KRTA 1X3MA 3K5MA 4BRGA 1Z05A 2GEMA 1NJWA 2D0AA 2P9IA 5CR4A 3LPUA 3O4WA 1ASWA 4DSJA 1BQNA 1GLJO 5KQ8A 4QS7A 3O9UA 1EP4A 2HMPA 4FWOA 1OVYA 4MDBA 1HB8A 3VQEA 2IVPA 5HOOA 3CI5A 2E88A 2X74A 2HHQA 1NU0A 5DM7L 1X3NA 1DTTA 3TPQA 1KRPA 4M7XA 1QHTA 2RKIA 4DU1A 3PUFA 4E7JA 2JGUA 3AAQA 3JXUA 3TTFA 3V81A 3SUOA 4W5NA 4AH9A 3MK6A 3KK3A 4C8LA 3D6RA 4ZTFA 5F0XA 3LANA 4JKCA 5AZJA 2P9PA 3J80O 1NK8A 5C42A 1J5OA 4WE1A 2G8VA 4RG8A 3O9RA 2Z1IA 3HPGA 1YXQA 1YJWN 2YHYA 4CCHA 5HBMA 3L2VA 1HKGA 4O44A 3SYZA 2AA4A 1FKOA 2PYJA 1S6PA 3C6AA 3ASMA 3QINA 3T1HK 5M1PA 3ZX3A 4Z4EA 3TAEA 1LWEA 1TL1A 4IO8A 4FK2A 5C10A 1VSJA 2O8FB 1SKWA 1MA9B 4PKGA 3SAHA 2PFUA 3ZETB 1KXPA 1Y19B 4BRIA 3LALA 2UU9K 4ZRIA 2O8BA 4DLEA 1S22A 4W5QA 3U3YA 3J8AA 1KFSA 4BR7A 3X23A 4CF9A 4YORA 1YVUA 5EOYA 4IFVA 3ZSOA 1IBKK 5FRNA 3AVLA 1C0MA 4KH5A 2HHWA 4O0IA 4DSIA 3O4NA 2YNGA 4EIAA 1FW6A 1C0UA 4CZEA 4HUGA 4CZLA 5C2FA 1SGHA 4FO0A 5AFUH 3SPZA 2WFBA 4N41A 3WUHA 2W6KA 4BGBA 4CJFA 1HRHA 3OYEA 4YL8A 3MCPA 3BY5A 1NGHA 2KLAA 3A5MC 1U47A 1E5WA 2HNZA 2XY8A 2XY6A 3EY1A 2HHUA 5AQGA 1J53A 3CC7N 1BISA 5M1NA 4BRHA 3V4IA 1WAFA 2G8UA 3PIPL 2FJ9A 1RTDA 4OKJA 3UKRA 2RF2A 4B1WB 3VQDA 3ZT0A 3HP6A 4FWNA 1Q9XA 4BWMA 4CEAA 3TANA 4F3TA 4KHUA 4CGHA 2JWLA 3DYAA 4BDZA 1ATNA 1TK8A 3F9KA 5GINA 3S3NA 1KVAA 3WNHA 1VRUA 2PBDA 1VK0A 5CZ2A 4CHNA 4DQIA 4JD2B 4EZ9A 3VF6A 2D4WA 4F9OA 1B9DA 1VQ9N 1ASUA 1YJNN 1L3VA 4RTFD 4EHUA 2OANA 1S1TA 1NMDA 4KB1A 1BI4A 3CCUN 2QKKA 3DOKA 2IOCA 2X0SA 3PSFA 4OPAA 4DQ8A 4DU4A 1K8KB 1C1AA 4C8MA 2XY7A 3AO2A 4KO0A 2F4VK 4CGJA 3CETA 2FDQA 5FLXO 4CJPA 2A3ZA 1JDEA 2O4GA 2WC9A 3A5OC 3VQQA 3K9JA 4FLTA 3QERA 4FWMA 1ZBHA 2YJEA 4TKNA 2HHTA 3IKMA 3RMDA 4PA1A 3WNEA 1WSIA 1KC7A 3WEEB 1T6DA 4X65K 5EXWA 1J6ZA 2QEXN 2ASMA 3TU5A 1XWLA 4FWPA 5AQJA 4FSVA 1TAQA 3OBWA 5AQPA 3OYMA 2NRHA 4ISEA 3A8YA 4FWRA 3VQAA 3RVCA 4A5BA 2W40A 3SUPA 4TSXA 3U9ZA 3LDQA 3H45C 4F3OA 3CC4N 4I2QA 1W7AA 1JLBA 4NXMK 2FF3B 4OGCA 5C15A 2BANA 1MWKA 4DSEA 3HK2A 4GV9A 4DV3K 3SNNA 2FBVA 3K59A 1P8ZA 5M1FA 1L3UA 4WQ4A 3KKRA 1TKTA 3THXA 3M6GA 4FPAA 4FLYA 1NKCA 1VQ6N 4FPBA 1R0AA 1IH7A 1N34K 5AQUA 4W5TA 3DLRA 3PX4A 4ID1A 2WH5A 2VQFK 3HPHA 4I9LA 2QKBA 3CQXA 1KLNA 2PY5A 5LY3A 4QOZB 2OA8A 4ID5A 5J2PA 4O8KA 4FJ8A 2E20A 3AU5A 4LSNA 4Z4FA 2EHGA 3OA9A 3HYFA 3SUNA 4BRCA 3P31A 2B4JA 2QWLA 4FJIA 3SV3A 1A5WA 3DLEA 1GOCA 3IDHA 4CESA 2HB5A 4H0XB 1SV5A 4DTOA 4DR2K 3EE9A 5ADXA 4DR7K 4R5PA 2XY5A 4NCBA 2D0OA 2CH5A 1HLUA 3MCAB 3D2FB 2R82A 4X64K 4XH4A 1B9FA 4DR4K 1HX1A 2HBMA 4GVEA 1NI2A 1Z25A 3ZEUB 2I5JA 1QTMA 3TAPA 2E2PA 4FJGA 4B1VA 4KTZA 3KJVA 4Z0UA 1K73O 4RW8A 4K0KK 4YOTA 3M8RA 4BWJA 2W42A 1EO1A 5CZ1A 3VQ5A 2I1KA 4IJAA 3T19A 3IG1A 3TSUA 1NGJA 4JKFA 3E9PA 2B6AA 1O1WA 1H4RA 1NLVA 1KSPA 2F7TA 2EMTA 1WBBA 5FPNA 3AVNA 1DIKA 4G9ZA 3CMEN 3SK3A 1RTJA 2VWJA 2O8EA 4BROA 3SV4A 2UYTA 5HRNA 3OTOK 4I7FA 2AL6A 3QBXA 1XHXA 3H3NO 3ZT2A 1U49A 3O1WA 4DSKA 2DFEA 1R59O 1A5XA 3D2EA 1ACAA 3AO3A 5M1QA 2F9WA 4O4GA 2VGNA 4JKGA 4NLBA 5CHIA 4IOAL 3RRGA 2QTDA 3MN9A 3QBWA 3DLGA 3H1QA 3CJ9A 3WNGA 4E7KA 2IVOA 3ZDTA 4DR3K 4LY7A 4MO5A 1C6VA 4IG3A 1WSGA 4H5RA 5EVZA 1IO2A 2ZJQL 5I9EB 1Q7YO 2LBBA 2ITGA 1X1PA 3CQ8A 4QCLA 3VEZA 3NFAA 3ITHA 4Q5VA 5LMUK 1UOCA 4DV7K 2ASOA 3THYB 4XEIA 3WXJA 2X6SA 4BQZA 3TTCA 3OJUA 2O8BB 2A1SA 4CVNE 1GLFO 1DLOA 2OZMA 4IJNA 3G6EN 3N4QA 2G8FA 4NYNA 3PVLA 3A0IX 3NAEA 2HBKA 2D0CA 3LZIA 3RSEB 1LCUA 1NMNA 1KCFA 1VQMN 4FZZA 4CF1A 1UAXA 1XUPO 3ZX2A 3AAPA 3BF3A 3DMJA 4KH6A 4ISFA 1JLCA 4MDAA 1X9WA 3SAGA 5J1EA 4V19S 2ZD1A 3PV8A 2KFZA 4CHQA 2NRVA 5HP1A 2E1ZA 2CGKA 1G99A 4ELTA 4IDKA 2O8CB 4J2DA 3UKUA 4R79A 2HHSA 4KHYA 5SZTA 1MIZB 5EY4A 4DKWA 1VSIA 3HL8A 3UE5A 4CFCA 5LJWA 4JV5K 1RT3A 1Y64A 2I1JA 1RILA 2G8IA 1QS4A 1Q18A 1T05A 5C12A 2BGGA 3VESA 1BGXT 4CK1A 4CJ7A 2KFNA 4NO7A 2NRWA 4F2RA 4M3XA 4FW2A 3T1YK 4FK4A 3CG7A 5C2DA 1NGEA 4C8KA 1L3TA 1XMQK 3ULEA 4FZXC 4DLGA 1NK0A 2QWNA 4YOYA 3GBTA 1IBLK 2D0BA 3K9KA 2P9NB 3NVKA 2HOEA 4P7IA 1W0HA 1HNZK 2P9UA 3VA0A 1NM1A 2ABDA 2DFFA 3HM9A 1NGIA 2E8AA 1JL2A 3LP3A 2IDOA 2ITMA 2HE7A 1ZBLA 4CEQA 1YITN 1IKXA 4AF1A 5LMNK 1RDWX 4B3SK 1X9SA 3OS1A 4DB3A 1VSDA 3O5BA 4WFAL 2KZZA 2YX6A 4WQ5A 2HVIA 4CJSA 2GTDA 5AQFA 3CFPA 1Q8IA 4KB0A 1EX4A 4I6MA 5JLFA 4JI0K 4LFCK 2GV9A 3WXKA 5C24A 4CE9A 5AQHA 3AARA 4WQ4C 3NH1A 4L8RB 3K0SA 3LDSA 1IKVA 4BE1A 3KLEA 5HROA 2OTJN 2BTFA 3TAGA 1K8AO 4BRKA 2Y1JA 3THXB 3MEDA 4E1MA 3KK1A 4LSLA 5KPTA 2QXLA 3L4QA 2EMSA 3TAQA 1BIZA 5AFUA 3E1YA 1TGOA 4CEZA 5F1XA 3VTIA 2O4IA 3AVIA 3IUCA 5AQZA 2RHKA 3I55N 1LWCA 4Z4GA 1HBKA 4F7GA 2P9SB 4C23A 1GOAA 3K58A 3EO3A 2UUAK 3CCQN 3ENBA 1TKDA 4N5SA 2KHOA 1LAWA 3PSIA 1I3AA 4RW6A 2ETJA 5H1SQ 4YOXA 2E2QA 1KFDA 4JI4K 5JICA 2QK9A 2CB8A 4BGAA 3AA5X 3ZCMA 4PKIA 5AQNA 3SJJA 3CCLN 4X62K 1HJOA 3WT0A 4X66K 4BR5A 4HCBA 4DFMA 3G10A 4OPJA 2FBTA 3SBGA 1BCOA 4MQ3A 1RBRA 4LH5A 3HT3A 5BPLA 4LFAK 4CEEA 4FLZA 4B9MA 3DXKA 3THVA 1Z6RA 4CK2A 3U8XA 3TABA 2X78A 1UA1A 4OGEA 1HNVA 1VSFA 3DXMB 4BRPA 3S3MA 2HVHA 4H4MA 4FL9A 1SAZA 2UXBK 3ZSQA 5FPDA 4O8UA 1YVNA 3IFRA 4JI2K 3RR8A 1C0FA 1HNIA 4ZRJA 3AVFA 5KTQA 4KI6A 3PY8A 3HVTA 3QFPA 4B9NA 4YOVA 1FK9A 3IRXA 2DFHA 3OW2M 4IKFA 3L6QA 3L2QA 3CMAN 4FLWA 4BR9A 3MECA 1VSHA 4Y1CA 2FSNA 3CHWA 1EWQA 1LW0A 5I3UA 4FJHA 4JI3K 1WB9A 3OYKA 4HTUA 4JKGB 3QO9A 4BG8A 3V9WA 4BDPA 2RE2A 3MWPA 4H5VA 2J0KA 4DTRA 3ZSWA 2RQ1A 4MO4A 2P9KA 3TR8A 1NGBA 1S1WA 4FM1A 3I8BA 1NGDA 2CGLA 4DFJA 1TAUA 1VQPN 3SAFA 1G15A 3V9ZA 3M5RA 4Y1DA 4IEEA 2NRZA 4AHTA 4YOUA 3AU4A 1HQUA 3LZJA 3U9DA 3WXMB 1CLQA 4DF4A 1BHLA 4CJTA 1NK4A 2UUBK 1VAZA 1BWFO 4B3OA 1EXQA 1XMOK 3C6TA 4ILJA 4IFYA 3DLBA 1E3MA 3I8DA 2QM1A 1CZ9A 2OPRA 3F5TA 3GOIA 5GAGP 4C1NI 3C7NB 4DHYA 4PL8A 5KGWA 4RCHA 4GKKK 2I7NA 3VGLA 2Z1GA 3NMUA 3KLHA 3LL3A 4WYBA 1ASVA 1VQKN 1VSMA 4DFPA 2V51B 3QIPA 3MXIA 2P51A 3RMBA 5AQSA 2ZJRL 2OPPA 3NH0A 3HPOA 4BRFA 2W6LA 3DRRA 4FLXA 1XQSC 2EX3A 4LD0A 3DWLA 1WLJA 3CCJN 4BRMA 3FLVA 3CFOA 1RGIA 4B1XB 2IGIA 3WQUA 4M45A 3NF8A 1J9AA 2YV0X 5KPZA 3MAQA 2P5OA 3ZYYX 1NKBA 1HR0K 3VEVA 2Z1JA 3G4SN 3T1AA 1MDUB 4PKHA 3NGIA 3S9HA 4BR0A 3NVMA 4KAZA 4B8CA 3OYBA 4C8NA 3OYDA 2ZJPL 2FLOA 3O4QA 4AHVA 1C1CA 1KQSM 2OTLN 3OYLA 1VBGA 3PLAA 4DS5A 2B5JA 4FJKA 2QWPA 4HWIA 3KWIA 3QICA 2A41A 4CGDA 4H0TB 1WBDA 1VHXA 3VEXA 2WUSA 4CJ4A 3R9PA 1KVBA 3P38A 4JK9A 3KTQA 4YNQA 1QSLA 4NXNK 4PY5A 2AEHA 4PHTX 1ZBUA 4FVMA 3SJHA 1OH8A 4JKEA 1TUYA 3OBYA 1S3XA 1YJ9N 5HLFA 1NK7A 3GE1A 1U2VB 1HYZA 4WQ5C 4GW6A 4AHRA 1QSSA 3CQYA 2E2OA 3ISNC 4MLEA 3O1BA 4CZIA 3C0BA 3QEPA 4E19A 4EFHA 1JLQA 3MEEA 4DV5K 3SPYA 2FBYA 3LM9A 2E6MA 1OH5A 4GV6A 4FWLA 3L2UA 1CXUA 4KFBA 4NLCA 4U7BA 3V9UA 3AGRA 2VWBA 5AZIB 3QIOA 2HBJA 5BR9A 4GY2B 5HRPA 1W97L 1WSHA 2Q1NA 1GC6A 4U67L 3CM5A 4DV4K 1N32K 3EKUA 3LDLA 4F8RA 2IAJA 2HSTA 3C6HA 4BR4A 2QA4N 5CE3A 4J2AA 4WCEL 3O3HA 4J2BA 2HHXA 1YAGA 3R3LA 4CJUA 4FZYA 4OJRA 4FCYA 3U6FA 2YCHA 5GAHP 4DTJA 3M1FA 3OHRA 1C0TA 1D5AA 3FFKB 2P9LA 3CF5L 3LDPA 1JJ2M 1K6YA 4CERA 2DIKA 2O8DB 2HNYA 4H03B 3A2FA 1FXXA 3S41A 2E6LA 4CZKA 1I94K 3I56N 2ZE2A 4JK8A 1E4GT 3V1QA 4FLUA 2YNIA 4CK3A 4JK7A 5FPMA 4RW4A 5ELZA 3VGMA 3U3GA 4JHDA 4A5AA 2P9IB 3AA2A 1O13A 5AQTA 3VEYA 4IEIA 3L3VA 2D10A 3LWMA 3SZ2A 1HPMA 3ALYA 4CFBA 3LP2A 2HNDA 1LW2A 4O5FA 3QEIA 1YHQN 1SKSA 3LP0A 1DGKN 3HVRA 1NJXA 2QI2A 4CJ3A 1RT7A 4Z4IA 1YIJN 5AQVA 5AQQA 4MLHA 5JVLA 1IJJA 4BRNA 1CZBA 4E1NA 2XHBA 4CBXA 1RT1A 2AP1A 3R1XA 3OYJA 2VCPA 1CZAN 3EKSA 4BR2A 1TUUA 1KAXA 1RDCA 1KC8O 3O80A 4H5TA 2OPQA 4K43A 1KAZA 2E5LK 1WOQA 3F2KA 3WXLA 4GVMA 4KTWA 5DK5A 2Q2RA 5AZJB 2P9PB 4KHPK 3Q7BA 2A40A 1RBVA 2KKZA 2D2QA 3OYHA 4JI6K 4ISGA 3QIJA 2F96A 2ZWHA 3FLCO 3RR7A 1QQMA 4H0OA 3J7AP 1GOBA 1KLMA 2Q31A 4JS4A 3TAFA 4N56A 1RDUA 2P9KB 3MMVA 2ASPA 2BE2A 5TKYA 3R8EA 2UXDK 4WFNL 2J4RA 3ZLJA 4Z4CA 3BGRA 4O5BA 4JEPA 2DPNA 5AQRA 2HHHK 2IS3A 3AY9A 2YKMA 3MN6A 2HF3A 4KV8A 5KPRA 1IBMK 1OKJA 1NVLA 5AQMA 5GADP 4LF9K 1X9JA 1KBLA 1NWKA 4H0VB 1KVCA 2O8FA 4DTPA 3NCIA 4CFAA 3OYNA 3ZETA 1VRTA 1RBTA 1TKXA 5AQYA 2V7YA 4CJ5A 1ATSA 4A61A 2GUPA 1JL1A 3ZT1A 3ZX0A 1D8YA 4DCHA 2FSKA 5HL7L 5D3GA 4JYAK 3VQ9A 2HBLA 3P4IA 3HSTB 5FDLA 4OVLA 1NJYA 4CJVA 3HXMA 3ID8A 3OVNA 4K8ZA 3VQPA 4CZHA 4CW7B 4QS8A 3H6EA 3NF9A 4GNIA 1VQ8N 1QQNA 1L5UA 5GAEP 5CYMA 1VSEA 3ATUA 3K5OA 4FWQA 3AVCA 4M3TA 4RWTA 1RDBA 4OX9K 4IDHA 1KTQA 3UKRB 3GG4A 3AO4A 4PWDA 1GLEG 2BUPA 5AQOA 4FLVA 3HTVA 3E66A 1RT2A 5AJ3K 1SL0A 1L3SA 1RBUA 1JXEA 1ESVA 4CJRA 1OH6A 1ATRA 5EU7A 3TTDA 4M42A 2VG7A 1NK6A 4KPYA 4M7YA 1HKCA 1HPZA 5M1KA 3DJCA 2ATQA 1TYQA 4DWIA 3CIPA 4DR6K 4JD2A 1RT5A 1BI4B 3B6OA 1W9HA 3PO4A 4CEOA 3KWGA 4HDOA 1HNXK 3V6DA 3H46O 1BU6O 3I33A 4CBUA 2VGMA 2GBZA 4LF6K 1BO5O 2VWKA 1YF5L 3D45A 5M1OA 4CZFA 2KZMA 3U8ZA 1K8KA 3GL1A 3VPZA 4JRPA 4FJNA 5C0YA 3PO5A 1TV6A 3V9XA 5HRSA 4CGIA 1XC9A 4BDYA 4JKBA 3ZSXA 2HRJA 1V4SA 4PUOA 4A59A 3M8QA 1N6QA 4CZMA 1KAYA 1MU2A 2BH1A 4YHHK 3WEEA 3BZCA 4AHUA 3FZMA 1RTIA 3VQBA 2UXCK 4CF8A 1ILYA 3SMSA 3QNNA 2OYQA 3B6PA 3B8AX 2IVNA 3FZFA 4FW1A 3EPYA 5AQIA 1RBSA 3MX2A 4B1UB 4IXCA 1QQOA 3KHYA 4CEBA 4Y0WA 1Z26A 1ZBFA 5KGXA 3H08A 1P90A 4JRQA 1BDGA 3QEVA 1Q86O 1NOZA 2D0PA 1Q82O 1NGFA 4KHSA 3G9WA 4G1QA 3AA3A 1SL2A 1SQKA 5C25A 1SKRA 3UB5A 4FJ5A 2G8HA 3VEWA 3QFUA 1WNSA 1XC3A 4B9UA 4CGGA 1RFQA 3VQ6A 4CGFA 4JAXA 4CIEA 4HDQA 3P5JA 3MN5A 4JLHA 1QVFM 4J2EA 4N76A 4QAGA 4B08A 5AQKA 3ZSYA 3V1OA 4B9QA 2JLEA 3VQCA 2Q3SA 3I0SA 1XHZA 1NK5A 2A6AA 3PZDA 4BRDA 3IVFA 1GC7A 3CYMA 1RTHA 1V4TA 4OKKA 3EEQA 4B8AB 4E0DA 3QMLA 1Q9YA 1UA0A 1TK0A 3CCEN 4M3UA 3H3OB 1WSEA 4FJ7A 3NDKA 3O9TA 4DTSA 2HW3A 3CC2N 3NE6A 3FZLA 2D5RA 3OS0A 4JHDB 3D2FA 3GDQA 1NJIO 4CHZA 1JLEA 4K41A 1A5VA 1WN7A 4IO9L 2J0JA 4GKJK 4KI4A 3ZEUA 2ZF5O 1GLAG 2WONA 3K5LA 4F4KA 1GLLO 1YTUA 1ZBIA 4CBWA 1NGGA 4BQLA 4H5WA 2GUIA 3OYIA 1ZBSA 2EWSA 3L2RA 3MEGA 3LDOA 4EP4A 3AO1A 3AVBA 2O8EB 1SS6A 3CPEA 3C94A 5LJVA 1RT4A 3O08A 3VGKA 5A2QO 2ZPYA 3U4LA 1XNRK 4K8XA 4EP5A 1JXBA 4H5NA 3D2EB 4OLAA 1BA1A 3C95A 5E26A 3AVGA 4C1NK 3CCVN 4I2PA 2F8SA 4FJXA 3RRHA 2Q36A 5IJMA 1BCMA 2V7ZA 1QVGM 2LSNA 1DKGD 3FZHA 4LF8K 3HP9A 2QWMA 3SCXA 3M3ZA 2A1RA 3BF1A 4HTLA 4J8FA 3L8BA 4DQSA 4DUYK 1T03A 1YT3A 1WUAA 5T7BA 1LAVA 4F2SA 3D0PA 3S3OA 3KD1E 4IOCL 3U7DA 4AILC 3SQ4A 4RW9A 5JS1A 3AGKA 4GXBA 4YDUA 3MXMA 5KQDA 3P1GA 3G71N 3KIOA 2ZGYA 3K5NA 1LWFA 3VOVA 3CM6A 1ST7A 3AVHA 4ELUA 2G8KA 3O8MA 3THYA 5BN9A 1S6QA 1BOTO 2E2NA 4KH4A 4ILGB 4FWKA 5BR8K 3DLHA 1TKZA 4ICLA 4DV2K 4B9TA 3JSMA 4CZGA 3VQ4A 1VQON 2VQEK 1D9DA 4DQQA 4KRFA 3RWUA 1RDDA 1TK5A 1SUQA 4B3RK 1WSFA 3VENA 5DMRA 4CEDA 1VQLN 2YVCA 5F2RA 3RSEA 3G25A 1DT9A 3ULDA 1RT6A 4BACA 2IIRA 3OJSA 2YHWA 3QLHA 3SI6A 1QZ5A 2CGJA 3HO1A 4DSFA 3HRGA 3VEOA 4AHCA 1VQ4N 2VYPA 3UKUB 1FKPA 3JYTA 3J7YP 2KW4A 5J2QA 4AM6A 3VTHA 1BL3A 4ZHRA 2RN2A 1IKWA 3H1VX 4LF5K 4NB4A 2HHVA 2O8CA 2Q97A 4XH1A 1JLFA 3ZSZA 3CERA 2FBXA 1MIXA 3TARA 3KD5E 4H8KA 3RMAA 1QE1A 3SLCA 3AVAA 4DQRA 4O0JA 4CZJA 3QESA 4AQYK 1MK7B 4K42A 3DI6A 2KTQA 1TYQB 4DV1K 3O9QA 4LFBK 4E7HA 1HQEA 4GMJB 3ULEB 4FJMA 1U6ZA 1U4BA 4WFBL 3ENOA 3E9OA 3TSPA 4BE0A 4OLBA 1VBHA 1K9MO 3DOLA 2P9UB 4KHQA 1ZC6A 4FVUA 1FJGK 2QW9A 2NRRA 4FJLA 4GV3A 5IT9O 1NBWA 5JLHA 3NHGA 3SQ1A 4BC5A 3AA4A 3CD6N 2PYLA 2P9NA 5EX5A 4H0PA 1IKYA 1D9FA 3M8PA 1HNWK 5BREA 4YOWA 2E4LA 5B8HA 4CD3A 4JI8K 4IBNA 3WQTA 5GIPA 4AHSA 5AQLA 1W2BM 1GGOA 2JWKA 4CHOA 4EHTA 2Y1IA 3NF6A 4H0YB 1S72N 4DTNA 4EZ6A 3HSCA 1E4FT 4LF7K 3G0ZA 3CFRA 2ZGZA 2NZTA 4OPHA 4XH5A 4DR5K 3L4IA 1SZ2A 4CHPA 3AVJA 4I6MB 2VG6A 3EZ5A 1S9EA 5E84A 2QWRA 2NLXA 3CCMN 3MDQA 3OYFA 4ILHA 4A57A 5BRFA 1GLCG 4FYDA 1JLAA 2YNHA 3CCSN 2NRTA 3N4PA 3VQ8A 3KVGA 2FC0A 4K25A 4CJKA 3WA0A 3THWA 3TWHA 3C6UA 4NY0A 2F8TA 4FJ9A 4M3WA 1QQCA 3CJ7A 2CH6A 5I42A 4BY9C 3TI0A 3OYAA 4KKOA 3VQ7A 3DAWA 4KHWA 4CF2A 1N8RO 5BRHA 2P5GA 3T69A 3P39A 3EE8A 3MXJA 2NNWA 4OO1J 3C65A 4UY8O 4XIUA 1OH7A 2R7YA 3L3UA 5BRDA 4DV6K 3E01A 4E1JA 4B9SA 3OYCA 2E1YA 1S9GA 4I9QA 2Q0RA 4E89A 4KTQA 2P9SA 3JAMO 4M63C 2ZQBA 3LAMA 1BG3A 3KK2A 4IWVA 3BUZB 4E7IA 3I0RA 3NH2A 3QDKA 4IZ9A 5BPMA 3HBTA 1XI1A 4B3TK 4DSLA 3V1RA 4N47A 4DV0K 4CIGA 3KLIA 4MFBA 4B1ZA 5KI6A 2YNFA 1BA0A 5FPEA 4FOEA 4CD1A 1X9MA 3VA3A 3LPTA 3CXCM 2PZSA 3DXKB 1ZYQA 3KLGA 1VQ5N 3VF4A 2GWKA 1D4XA 5BPNA 1DTQA 2GELA 3EL2A 2V52B 1U04A 1N5YA 3E9LA 1S1XA 1JCGA 2P1JA 3ZSVA 4CECA 3QEWA 4EKUA 1N36K 4C8OA 2XRIA 2VG5A 4RW7A 2QXFA 1IV0A 4O55A 1HYSA 1IG8A 3O6WA 3PX6A 5AQWA 5LL6Z 3DXMA 1LV5A 3SBTA 1B92A 1T6CA 1GLBG 4E3SA 3KK7A 1EF1A 4BRQA 5GIOA 4JI7K 1J5EK 3QB0A 4BC4A 2J0MA 5KRSA 1YTAA 1NGAA 4CYEA 3BINA 1EETA 2NRXA 1T8EA 3VERA 4EAHD 2FXUA 3QEXA 2YI1A 2RPIA 4IOXA 3DRSA 3NBPA 4UQGA 1BUPA 2FF6A 1HKBA 1EKEA 1Q81O 3SUQA 4YFUA 2YJFA 1N33K 3NF7A 1ZXOA 3BP8A 4Q0BA 3LP1A 4CJLA 2IC3A 4BVOA 3AVKA 4JKDA 5K14A 4DUZK 4LH4A 2YHBA 2COPA 1GG3A 3NGYA 2WTUA 1EWRA 3L0QA 5SWMA 1NK9A 3AV9A 1VQ7N 4BVPA 1SL1A 3R6MA 3J7ZO 3BDPA 3HZ6A 3VN5A 4FWSA 4YDUC 2GWJA 5AR0A 3PX0A 1RDAA 4M41A 2F9TA 3MX5A 3SQ2A 4FOIA 5J2MA 1BQMA 1HJRA 3BZKA 3VF2A 3ZT4A 3VETA 1T3VA 3KZBA 3J81O 3EN9A 3IAYA 4DU3A 2HMIA 1NKEA 1J19A 5E41A 5MLCQ 4QS9A 3MWTA 3EZWA 1MWMA 4HUFA 3FFIA 3OY9A 4HVJA 1WAJA 5AQXA 3TAMA 4B9LA 2G8WA 2ZM6K 4JI5K 4DXAB 3FE1A 4NCGA 4JI1K 3HOTA 4CIFA 1LOTB 3TSQA 3C7NA 2PAVA 4CJWA 3NGZA 1U45A 3T7ZA 3FZKA 3LM2A 5CYQA 3W0LA 3HM8A 3L2WA 2FSJA 2QWQA 3BEXA 4IG0A 4DR1K 1H1VA 1NJZA 1I39A 3D7EO 5TKWA 3CJCA 5CY4A 3DRPA 4YY3K 2YHAA 3LWLA 1WSJA 4ZRKA 1KD1O 4JN4A 4BE2A 1YI2N 4JKAA 2QWOA 3IS9A 4Z94A 3KKSA 1QZ6A 3ENHA 3CPWM 4DFKA 4DS4A 1ISNA 3ZT3A 3O3GA 5JMVA 1EQYA 2D11A 3V9SA 5ADXH 2OPSA 3CCRN 3VMFB 3RTVA 4M3YA 3MN7A 1YUWA 4CFDA 2HF4A 1BIUA 3F9MA 4M3RA 4B9VA 2OCEA 4DQPA 1ITGA 2X6NA 3W3DA 2Q0UA 1OVQA 3DLLL 2OZSA 4CHYA 5IWAK 3T3FA 3QNOA 4NCAA 1U48A 1VSLA 3HJFA 4B1YB 1HMVA 1IG9A 4CEFA 2DY4A 1DEJA 2XO7A 2YHXA 3K2PA 5BN8A 3WNFA 3M8SA 4ELVA 1RCHA 1S1UA 4KHNA 1RNHA 1UWBA 3ID6A
chains in the Genus database with same CATH topology
3FP5A 2WUSA 3CJ1A 2AL6A 4H5NA 3QBXA 3D2EB 3R9PA 3P38A 3H3NO 4JK9A 1BA1A 3O1WA 5E26A 1HB6A 4C1NK 2AEHA 4PHTX 3CCVN 1R59O 3D2EA 2Q36A 4LC9B 3SJHA 1ACAA 4A2AA 5IJMA 2GX9A 4JKEA 5M1QA 1TUYA 2F9WA 3ATVA 2VGNA 1S3XA 3OBYA 4JKGA 4NLBA 5CHIA 3PIOL 1YJ9N 4IOAL 3GE1A 2QTDA 3MN9A 3QBWA 1U2VB 2V7ZA 2W41A 1C0GA 4WQ5C 1QVGM 3H1QA 1DKGD 3CQYA 3FZHA 2E2OA 2QWMA 3CJ9A 3SMPA 4A2BA 1U2VA 3M3ZA 3BF1A 4HTLA 4BREA 4J8FA 4MLEA 3O1BA 4CZIA 2IVOA 3C0BA 1VQNN 3ZDTA 4EFHA 4BRLA 1WUAA 3IMXA 5JVHL 4MO5A 4H5RA 5EVZA 4BRAA 3U7DA 3CJBA 4BC2A 2ZJQL 5I9EB 4IOCL 4AM7A 1Q7YO 3LM9A 2LBBA 1NGCA 4GV6A 4FWLA 3A5LC 3AGKA 3VEZA 4GXBA 2ASOA 4NLCA 4YDUA 1JCEA 1QHAA 1T44A 5KQDA 4U7BA 4XEIA 3G71N 3AGRA 2VWBA 5AZIB 2A42A 2ZGYA 3WXJA 2HBJA 4BQZA 4GY2B 3TTCA 1W97L 5BR9A 2Q1NA 3VOVA 1GC6A 1ST7A 1M1KO 4U67L 3O8MA 3EKUA 3LDLA 5AZIA 5BN9A 1BOTO 1GLFO 2HSTA 3LDNA 2E2NA 4IJNA 3C6HA 4ILGB 4KH4A 4FWKA 4BR4A 3HOSA 3G6EN 2QA4N 5CE3A 2CQUA 3CJAA 3N4QA 3O9SA 4WCEL 3FR0A 3PVLA 3A0IX 1YAGA 4CZGA 2HBKA 4JNEA 3R3LA 1VQON 3RSEB 1LCUA 1M90O 4WF9L 1VQMN 5DM6L 1XUPO 3VENA 3ZX2A 2P9LB 3WXIA 1VQLN 2YCHA 2YVCA 3AAPA 3BF3A 5F2RA 3RSEA 4KH6A 5GAHP 3G25A 1MK9B 1DT9A 3M1FA 1JCFA 1GLDG 3OHRA 4ISFA 4L3QA 2A5XA 4MDAA 3FFKB 1NTIA 2P9LA 3SAGA 2I7PA 3JS6A 2IIRA 3CF5L 3LDPA 2YHWA 1HUXA 1JJ2M 4A62A 2DIKA 1QZ5A 2CGJA 3Q7CA 4H03B 3HRGA 3HI0A 3VEOA 4JKHA 2NRVA 1VQ4N 2VYPA 4IFEA 3UKUB 5JVGL 3S41A 2E1ZA 2CGKA 1G99A 2WBNA 4CZKA 2D1KA 3I56N 3FGUA 4JK8A 3A5NC 4AM6A 3VTHA 3UKUA 1E4GT 3H1VX 4CI6A 4R79A 4NB4A 4BG9A 4JK7A 5FPMA 3CPWM 3CD6N 2Q97A 4XH1A 2H3GX 5ELZA 3VGMA 4KBOA 4PL7A 4JHDA 4A5AA 4BC3A 2P9IB 1MIZB 1X3MA 1O13A 3CERA 5EY4A 5AQTA 3UE5A 3VEYA 1Z05A 4BRGA 4DKWA 5LJWA 4IEIA 2D10A 1MIXA 2GEMA 1Y64A 1HPMA 2I1JA 2P9IA 3SLCA 5CR4A 3O4WA 1Q18A 4O5FA 4CZJA 5C12A 1MK7B 4K42A 1GLJO 5KQ8A 4QS7A 1TYQB 1YHQN 3O9UA 2HMPA 4FWOA 3VESA 1DGKN 1OVYA 4MDBA 4CJ7A 1HB8A 4NO7A 2IVPA 3O9QA 5HOOA 2NRWA 2QI2A 2E88A 3CI5A 3ULEB 1YIJN 5AQVA 5C2DA 1U6ZA 5AQQA 1NGEA 5DM7L 1X3NA 4MLHA 4WFBL 3ENOA 5JVLA 1IJJA 3E9OA 3TSPA 3ULEA 4BRNA 3TPQA 2QWNA 4CBXA 1VBHA 3GBTA 4YOYA 1K9MO 2AP1A 3R1XA 4M7XA 2VCPA 1CZAN 3EKSA 4BR2A 1TUUA 2P9UB 1KAXA 1KC8O 3O80A 1ZC6A 3K9KA 2P9NB 4H5TA 4FVUA 3NVKA 3AAQA 3JXUA 4K43A 3TTFA 1KAZA 2HOEA 4P7IA 2QW9A 1WOQA 2NRRA 4GV3A 1NBWA 2P9UA 3F2KA 1NM1A 2ABDA 3WXLA 4BC5A 5JLHA 2P9NA 3MK6A 4H0PA 5EX5A 2Q2RA 5AZJB 2P9PB 5BREA 3Q7BA 1NGIA 2A40A 3D6RA 4YOWA 2KKZA 2D2QA 5B8HA 2E8AA 4ISGA 3QIJA 4CD3A 2ITMA 2ZWHA 3FLCO 3WQTA 2HE7A 1QQMA 5F0XA 5GIPA 1YITN 4JKCA 5AZJA 2P9PA 5AQLA 1W2BM 1GGOA 4H0OA 4AF1A 1RDWX 2JWKA 4DB3A 4EHTA 2Q31A 3O9RA 1RDUA 2P9KB 3MMVA 3O5BA 1YXQA 4H0YB 2YX6A 2ASPA 4WFAL 4WQ5A 2YHYA 1YJWN 1S72N 3HSCA 1E4FT 1HKGA 5TKYA 3R8EA 2AA4A 2GTDA 5AQFA 4WFNL 2ZGZA 2NZTA 4OPHA 2J4RA 3C6AA 4XH5A 3L4IA 1SZ2A 4I6MB 5E84A 5M1PA 4JEPA 2DPNA 5AQRA 3ZX3A 2QWRA 2NLXA 3AY9A 3MDQA 3MN6A 3CCMN 4ILHA 4A57A 2HF3A 1GLCG 5BRFA 4IO8A 5KPRA 4I6MA 5JLFA 3CCSN 5C10A 1OKJA 2NRTA 1NVLA 3N4PA 5AQMA 3WXKA 5GADP 3KVGA 1MA9B 1X9JA 4K25A 3AARA 4WQ4C 5AQHA 3VEXA 1KBLA 3WA0A 1NWKA 4H0VB 2PFUA 4PKGA 3ZETB 3SAHA 4NY0A 1KXPA 1Y19B 2OTJN 4BRIA 2BTFA 3CJ7A 2CH6A 1K8AO 4ZRIA 4BRKA 3ZETA 1S22A 4BY9C 3J8AA 5AQYA 2V7YA 4BR7A 1ATSA 3X23A 4YORA 4A61A 2GUPA 2QXLA 3L4QA 5KPTA 3DAWA 2EMSA 3ZX0A 5EOYA 5AFUA 3E1YA 4DCHA 2FSKA 5BRHA 3T69A 3P39A 5HL7L 1N8RO 4KH5A 3EE8A 5F1XA 3VTIA 2NNWA 4OO1J 3C65A 4UY8O 3IUCA 5AQZA 2HBLA 2RHKA 4EIAA 3I55N 3P4IA 1HBKA 4F7GA 4CZEA 5BRDA 4E1JA 4CZLA 5C2FA 2P9SB 1SGHA 4FO0A 5AFUH 4C23A 3ID8A 3EO3A 2WFBA 2E1YA 4CZHA 3CCQN 3ENBA 2Q0RA 4QS8A 3H6EA 2P9SA 4GNIA 3WUHA 4BGBA 1VQ8N 1QQNA 4M63C 4YL8A 2KHOA 3MCPA 1BG3A 4IWVA 1NGHA 3BUZB 5GAEP 3ATUA 2KLAA 4FWQA 3A5MC 5H1SQ 1E5WA 4YOXA 4RWTA 3QDKA 2E2QA 4IZ9A 5AQGA 5BPMA 3CC7N 3HBTA 4IDHA 5JICA 3UKRB 3GG4A 2CB8A 5M1NA 4BGAA 4BRHA 4PKIA 5AQNA 1GLEG 3CCLN 2BUPA 1HJOA 5AQOA 3PIPL 3HTVA 3E66A 3WT0A 2FJ9A 3UKRA 4B1WB 4B1ZA 4BR5A 1ESVA 4FWNA 1BA0A 1ATRA 5FPEA 4FOEA 4CD1A 3TTDA 3SBGA 2JWLA 1ATNA 3CXCM 3DXKB 5GINA 1VQ5N 3VF4A 2GWKA 1D4XA 4M7YA 5BPNA 2GELA 5BPLA 3EL2A 2PBDA 2V52B 3DXKA 1HKCA 3E9LA 1Z6RA 1JCGA 5M1KA 3U8XA 3DJCA 4JD2B 4EKUA 3VF6A 4BRPA 1TYQA 3DXMB 3CIPA 2D4WA 4F9OA 4JD2A 1VQ9N 1IG8A 3O6WA 1YJNN 5AQWA 3DXMA 4FL9A 3SBTA 1SAZA 1T6CA 1GLBG 2OANA 3KK7A 1EF1A 4RTFD 1NMDA 4BRQA 4EHUA 5FPDA 3KWGA 4O8UA 1YVNA 4HDOA 3IFRA 3CCUN 5GIOA 1C0FA 4ZRJA 3H46O 1BU6O 2X0SA 3I33A 4OPAA 4CBUA 4DQ8A 2VGMA 1K8KB 3QB0A 3QFPA 4YOVA 4BC4A 1BO5O 1YF5L 5M1OA 3CETA 2FDQA 2J0MA 4CZFA 3OW2M 3U8ZA 1NGAA 3L6QA 4CYEA 2A3ZA 1K8KA 3CMAN 1JDEA 3BINA 2NRXA 2WC9A 3A5OC 3GL1A 3VPZA 3VERA 4BR9A 2FXUA 4EAHD 2YI1A 2FSNA 3CHWA 4IOXA 3K9JA 5C0YA 4FWMA 2YJEA 4TKNA 1BUPA 2FF6A 1HKBA 3IKMA 1Q81O 4JKBA 2HRJA 4JKGB 1KC7A 1V4SA 4BG8A 4A59A 3WEEB 1T6DA 2YJFA 4CZMA 2RE2A 5EXWA 3MWPA 4H5VA 2J0KA 1KAYA 1ZXOA 3BP8A 1J6ZA 2RQ1A 2BH1A 2QEXN 4MO4A 2P9KA 4BVOA 2ASMA 1NGBA 4JKDA 3TU5A 3WEEA 4FWPA 3FZMA 3I8BA 1NGDA 5AQJA 2COPA 1GG3A 2CGLA 4FSVA 1VQPN 3L0QA 3OBWA 5AQPA 3SAFA 3M5RA 2NRHA 1VQ7N 4IEEA 4ISEA 3A8YA 3R6MA 4FWRA 4BVPA 3RVCA 3SMSA 4A5BA 3J7ZO 2W40A 1ILYA 3HZ6A 2NRZA 3U9ZA 3LDQA 4YOUA 3AU4A 3B8AX 3H45C 4FWSA 4YDUC 2GWJA 2IVNA 3FZFA 5AR0A 2FF3B 3CC4N 5C15A 3U9DA 3WXMB 2F9TA 1MWKA 3MX5A 4FOIA 3EPYA 5AQIA 4B1UB 3MX2A 4IXCA 4GV9A 1QQOA 3VF2A 3KHYA 1P8ZA 4Y0WA 5M1FA 4WQ4A 3VETA 1P90A 1T3VA 3KZBA 1BDGA 1VAZA 3EN9A 1BWFO 1J19A 3M6GA 4FPAA 1Q86O 1VQ6N 4FPBA 5MLCQ 4ILJA 4QS9A 2D0PA 5AQUA 1Q82O 1NGFA 3MWTA 3EZWA 1MWMA 3G9WA 2WH5A 2QM1A 5AQXA 3F5TA 1SQKA 3CQXA 3GOIA 5GAGP 5LY3A 4C1NI 3C7NB 4DHYA 4PL8A 3UB5A 4DXAB 3FE1A 3VEWA 3QFUA 4RCHA 1XC3A 3HOTA 2I7NA 1LOTB 4O8KA 3TSQA 3C7NA 2PAVA 1RFQA 3AU5A 2E20A 3T7ZA 3FZKA 3OA9A 3LM2A 3VGLA 4JAXA 3NMUA 4BRCA 3P31A 4HDQA 3W0LA 3MN5A 3LL3A 2QWLA 4WYBA 3HM8A 1VQKN 1QVFM 2V51B 5AQKA 4B9QA 2FSJA 2QWQA 3BEXA 5AQSA 1H1VA 3IDHA 3D7EO 5TKWA 3CJCA 4H0XB 2ZJRL 2A6AA 3PZDA 4BRDA 3IVFA 1GC7A 4BRFA 4ZRKA 3EE9A 1KD1O 1V4TA 4JN4A 5ADXA 1XQSC 1YI2N 3QMLA 4JKAA 3DWLA 2QWOA 4Z94A 3CCJN 3CCEN 3H3OB 1QZ6A 3FLVA 2D0OA 2CH5A 3ENHA 4BRMA 1ISNA 1HLUA 3D2FB 2R82A 3MCAB 3O9TA 1RGIA 4B1XB 5JMVA 1EQYA 2D11A 3CC2N 5ADXH 4XH4A 3VMFB 3WQUA 3CCRN 1HX1A 3FZLA 2HBMA 1NI2A 3MN7A 1YUWA 3D2FA 2HF4A 4GVEA 4JHDB 3ZEUB 3GDQA 5KPZA 1NJIO 2E2PA 3F9MA 4K41A 3ZYYX 4B1VA 4IO9L 2J0JA 3VEVA 3ZEUA 3W3DA 3G4SN 2Q0UA 2ZF5O 1K73O 1GLAG 1MDUB 3DLLL 4PKHA 4YOTA 4BR0A 1GLLO 1EO1A 3NVMA 1NGGA 4CBWA 4BQLA 4H5WA 2I1KA 4IJAA 1ZBSA 2ZJPL 3TSUA 1NGJA 4JKFA 2EWSA 3E9PA 2FLOA 4B1YB 3LDOA 1H4RA 1NLVA 1KQSM 1DEJA 2OTLN 1SS6A 2F7TA 2EMTA 2YHXA 1VBGA 3CPEA 3O08A 5BN8A 5LJVA 3PLAA 5FPNA 3VGKA 1DIKA 2QWPA 4G9ZA 3CMEN 4HWIA 3KWIA 2ZPYA 3U4LA 3QICA 3SK3A 2A41A 4H0TB 4BROA 2UYTA 3ID6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKC A;  3E9O A;  3SBT A;  4JK9 A;  3ENB A;  4JKB A;  4ILG B;  3SBG A;  4JKG B;  4JKA A;  4JKH A;  4JKF A;  3E9P A;  4JKE A;  3E9L A;  4JKG A;  4JKD A;  4JK8 A;  4ILH A;  4ILJ A;  4JK7 A;  3E66 A; 
#chains in the Genus database with same CATH topology
 3FP5 A;  1TVR A;  3CJ1 A;  4FM2 A;  4DG1 A;  1HB6 A;  1CXQ A;  4FK0 A;  3EYZ A;  1NG9 A;  4M3Z A;  4LC9 B;  4FM0 A;  4A2A A;  2GX9 A;  3ATV A;  3PIO L;  3F73 A;  3SQ0 A;  3LAK A;  5J2N A;  2W41 A;  1C0G A;  4DTX A;  2WOM A;  1HYV A;  4KRE A;  3SMP A;  4A2B A;  1REV A;  4CJE A;  1U2V A;  3RMC A;  4BRE A;  1VQN N;  4BRL A;  5FRM A;  3AO5 A;  3IMX A;  5JVH L;  3K57 A;  4FJJ A;  3OYG A;  4BRA A;  3CJB A;  4BC2 A;  4ZTJ A;  4AM7 A;  4DF8 A;  1NGC A;  3DM2 A;  1XNQ K;  3A5L C;  1S5J A;  4JS5 A;  3THW B;  1JCE A;  1QHA A;  1T44 A;  1VSK A;  2A42 A;  1Y97 A;  4B3M K;  1M1K O;  4LF4 K;  5AZI A;  4DTM A;  3LDN A;  3HOS A;  4HUE A;  4H4O A;  2CQU A;  3CJA A;  3O9S A;  2KQ2 A;  3FR0 A;  1C1B A;  4JNE A;  1F21 A;  5HRR A;  4HCC A;  1M90 O;  3UIQ A;  4WF9 L;  5DM6 L;  2P9L B;  4NYF A;  3KLF A;  3WXI A;  1QSY A;  4DMN A;  3P83 D;  1T7P A;  4W5O A;  1MK9 B;  3QET A;  4L3Q A;  1JCF A;  1GLD G;  2UUC K;  3ZSR A;  1TL3 A;  2A5X A;  1NTI A;  3OS2 A;  4OKE A;  3DLK A;  2I7P A;  3JS6 A;  4CF0 A;  1HUX A;  4A62 A;  4W5R A;  4E7L A;  1J54 A;  3Q7C A;  4HHT A;  3HI0 A;  5FRO A;  4JKH A;  3O3F A;  1NOY A;  3AVM A;  4IFE A;  4Z4H A;  5JVG L;  2YKN A;  1S1V A;  1NNE A;  1JKH A;  2O8D A;  2WBN A;  4DTU A;  2D1K A;  3FGU A;  3A5N C;  5JS2 A;  2DTU A;  4CJQ A;  4CI6 A;  2Z1H A;  4FXD A;  4PQU A;  1JLG A;  4BG9 A;  4OPK A;  2AJQ A;  2H3G X;  2BDP A;  4KBO A;  4PL7 A;  4BC3 A;  2NUB A;  5KRT A;  1X3M A;  3K5M A;  4BRG A;  1Z05 A;  2GEM A;  1NJW A;  2D0A A;  2P9I A;  5CR4 A;  3LPU A;  3O4W A;  1ASW A;  4DSJ A;  1BQN A;  1GLJ O;  5KQ8 A;  4QS7 A;  3O9U A;  1EP4 A;  2HMP A;  4FWO A;  1OVY A;  4MDB A;  1HB8 A;  3VQE A;  2IVP A;  5HOO A;  3CI5 A;  2E88 A;  2X74 A;  2HHQ A;  1NU0 A;  5DM7 L;  1X3N A;  1DTT A;  3TPQ A;  1KRP A;  4M7X A;  1QHT A;  2RKI A;  4DU1 A;  3PUF A;  4E7J A;  2JGU A;  3AAQ A;  3JXU A;  3TTF A;  3V81 A;  3SUO A;  4W5N A;  4AH9 A;  3MK6 A;  3KK3 A;  4C8L A;  3D6R A;  4ZTF A;  5F0X A;  3LAN A;  4JKC A;  5AZJ A;  2P9P A;  3J80 O;  1NK8 A;  5C42 A;  1J5O A;  4WE1 A;  2G8V A;  4RG8 A;  3O9R A;  2Z1I A;  3HPG A;  1YXQ A;  1YJW N;  2YHY A;  4CCH A;  5HBM A;  3L2V A;  1HKG A;  4O44 A;  3SYZ A;  2AA4 A;  1FKO A;  2PYJ A;  1S6P A;  3C6A A;  3ASM A;  3QIN A;  3T1H K;  5M1P A;  3ZX3 A;  4Z4E A;  3TAE A;  1LWE A;  1TL1 A;  4IO8 A;  4FK2 A;  5C10 A;  1VSJ A;  2O8F B;  1SKW A;  1MA9 B;  4PKG A;  3SAH A;  2PFU A;  3ZET B;  1KXP A;  1Y19 B;  4BRI A;  3LAL A;  2UU9 K;  4ZRI A;  2O8B A;  4DLE A;  1S22 A;  4W5Q A;  3U3Y A;  3J8A A;  1KFS A;  4BR7 A;  3X23 A;  4CF9 A;  4YOR A;  1YVU A;  5EOY A;  4IFV A;  3ZSO A;  1IBK K;  5FRN A;  3AVL A;  1C0M A;  4KH5 A;  2HHW A;  4O0I A;  4DSI A;  3O4N A;  2YNG A;  4EIA A;  1FW6 A;  1C0U A;  4CZE A;  4HUG A;  4CZL A;  5C2F A;  1SGH A;  4FO0 A;  5AFU H;  3SPZ A;  2WFB A;  4N41 A;  3WUH A;  2W6K A;  4BGB A;  4CJF A;  1HRH A;  3OYE A;  4YL8 A;  3MCP A;  3BY5 A;  1NGH A;  2KLA A;  3A5M C;  1U47 A;  1E5W A;  2HNZ A;  2XY8 A;  2XY6 A;  3EY1 A;  2HHU A;  5AQG A;  1J53 A;  3CC7 N;  1BIS A;  5M1N A;  4BRH A;  3V4I A;  1WAF A;  2G8U A;  3PIP L;  2FJ9 A;  1RTD A;  4OKJ A;  3UKR A;  2RF2 A;  4B1W B;  3VQD A;  3ZT0 A;  3HP6 A;  4FWN A;  1Q9X A;  4BWM A;  4CEA A;  3TAN A;  4F3T A;  4KHU A;  4CGH A;  2JWL A;  3DYA A;  4BDZ A;  1ATN A;  1TK8 A;  3F9K A;  5GIN A;  3S3N A;  1KVA A;  3WNH A;  1VRU A;  2PBD A;  1VK0 A;  5CZ2 A;  4CHN A;  4DQI A;  4JD2 B;  4EZ9 A;  3VF6 A;  2D4W A;  4F9O A;  1B9D A;  1VQ9 N;  1ASU A;  1YJN N;  1L3V A;  4RTF D;  4EHU A;  2OAN A;  1S1T A;  1NMD A;  4KB1 A;  1BI4 A;  3CCU N;  2QKK A;  3DOK A;  2IOC A;  2X0S A;  3PSF A;  4OPA A;  4DQ8 A;  4DU4 A;  1K8K B;  1C1A A;  4C8M A;  2XY7 A;  3AO2 A;  4KO0 A;  2F4V K;  4CGJ A;  3CET A;  2FDQ A;  5FLX O;  4CJP A;  2A3Z A;  1JDE A;  2O4G A;  2WC9 A;  3A5O C;  3VQQ A;  3K9J A;  4FLT A;  3QER A;  4FWM A;  1ZBH A;  2YJE A;  4TKN A;  2HHT A;  3IKM A;  3RMD A;  4PA1 A;  3WNE A;  1WSI A;  1KC7 A;  3WEE B;  1T6D A;  4X65 K;  5EXW A;  1J6Z A;  2QEX N;  2ASM A;  3TU5 A;  1XWL A;  4FWP A;  5AQJ A;  4FSV A;  1TAQ A;  3OBW A;  5AQP A;  3OYM A;  2NRH A;  4ISE A;  3A8Y A;  4FWR A;  3VQA A;  3RVC A;  4A5B A;  2W40 A;  3SUP A;  4TSX A;  3U9Z A;  3LDQ A;  3H45 C;  4F3O A;  3CC4 N;  4I2Q A;  1W7A A;  1JLB A;  4NXM K;  2FF3 B;  4OGC A;  5C15 A;  2BAN A;  1MWK A;  4DSE A;  3HK2 A;  4GV9 A;  4DV3 K;  3SNN A;  2FBV A;  3K59 A;  1P8Z A;  5M1F A;  1L3U A;  4WQ4 A;  3KKR A;  1TKT A;  3THX A;  3M6G A;  4FPA A;  4FLY A;  1NKC A;  1VQ6 N;  4FPB A;  1R0A A;  1IH7 A;  1N34 K;  5AQU A;  4W5T A;  3DLR A;  3PX4 A;  4ID1 A;  2WH5 A;  2VQF K;  3HPH A;  4I9L A;  2QKB A;  3CQX A;  1KLN A;  2PY5 A;  5LY3 A;  4QOZ B;  2OA8 A;  4ID5 A;  5J2P A;  4O8K A;  4FJ8 A;  2E20 A;  3AU5 A;  4LSN A;  4Z4F A;  2EHG A;  3OA9 A;  3HYF A;  3SUN A;  4BRC A;  3P31 A;  2B4J A;  2QWL A;  4FJI A;  3SV3 A;  1A5W A;  3DLE A;  1GOC A;  3IDH A;  4CES A;  2HB5 A;  4H0X B;  1SV5 A;  4DTO A;  4DR2 K;  3EE9 A;  5ADX A;  4DR7 K;  4R5P A;  2XY5 A;  4NCB A;  2D0O A;  2CH5 A;  1HLU A;  3MCA B;  3D2F B;  2R82 A;  4X64 K;  4XH4 A;  1B9F A;  4DR4 K;  1HX1 A;  2HBM A;  4GVE A;  1NI2 A;  1Z25 A;  3ZEU B;  2I5J A;  1QTM A;  3TAP A;  2E2P A;  4FJG A;  4B1V A;  4KTZ A;  3KJV A;  4Z0U A;  1K73 O;  4RW8 A;  4K0K K;  4YOT A;  3M8R A;  4BWJ A;  2W42 A;  1EO1 A;  5CZ1 A;  3VQ5 A;  2I1K A;  4IJA A;  3T19 A;  3IG1 A;  3TSU A;  1NGJ A;  4JKF A;  3E9P A;  2B6A A;  1O1W A;  1H4R A;  1NLV A;  1KSP A;  2F7T A;  2EMT A;  1WBB A;  5FPN A;  3AVN A;  1DIK A;  4G9Z A;  3CME N;  3SK3 A;  1RTJ A;  2VWJ A;  2O8E A;  4BRO A;  3SV4 A;  2UYT A;  5HRN A;  3OTO K;  4I7F A;  2AL6 A;  3QBX A;  1XHX A;  3H3N O;  3ZT2 A;  1U49 A;  3O1W A;  4DSK A;  2DFE A;  1R59 O;  1A5X A;  3D2E A;  1ACA A;  3AO3 A;  5M1Q A;  2F9W A;  4O4G A;  2VGN A;  4JKG A;  4NLB A;  5CHI A;  4IOA L;  3RRG A;  2QTD A;  3MN9 A;  3QBW A;  3DLG A;  3H1Q A;  3CJ9 A;  3WNG A;  4E7K A;  2IVO A;  3ZDT A;  4DR3 K;  4LY7 A;  4MO5 A;  1C6V A;  4IG3 A;  1WSG A;  4H5R A;  5EVZ A;  1IO2 A;  2ZJQ L;  5I9E B;  1Q7Y O;  2LBB A;  2ITG A;  1X1P A;  3CQ8 A;  4QCL A;  3VEZ A;  3NFA A;  3ITH A;  4Q5V A;  5LMU K;  1UOC A;  4DV7 K;  2ASO A;  3THY B;  4XEI A;  3WXJ A;  2X6S A;  4BQZ A;  3TTC A;  3OJU A;  2O8B B;  2A1S A;  4CVN E;  1GLF O;  1DLO A;  2OZM A;  4IJN A;  3G6E N;  3N4Q A;  2G8F A;  4NYN A;  3PVL A;  3A0I X;  3NAE A;  2HBK A;  2D0C A;  3LZI A;  3RSE B;  1LCU A;  1NMN A;  1KCF A;  1VQM N;  4FZZ A;  4CF1 A;  1UAX A;  1XUP O;  3ZX2 A;  3AAP A;  3BF3 A;  3DMJ A;  4KH6 A;  4ISF A;  1JLC A;  4MDA A;  1X9W A;  3SAG A;  5J1E A;  4V19 S;  2ZD1 A;  3PV8 A;  2KFZ A;  4CHQ A;  2NRV A;  5HP1 A;  2E1Z A;  2CGK A;  1G99 A;  4ELT A;  4IDK A;  2O8C B;  4J2D A;  3UKU A;  4R79 A;  2HHS A;  4KHY A;  5SZT A;  1MIZ B;  5EY4 A;  4DKW A;  1VSI A;  3HL8 A;  3UE5 A;  4CFC A;  5LJW A;  4JV5 K;  1RT3 A;  1Y64 A;  2I1J A;  1RIL A;  2G8I A;  1QS4 A;  1Q18 A;  1T05 A;  5C12 A;  2BGG A;  3VES A;  1BGX T;  4CK1 A;  4CJ7 A;  2KFN A;  4NO7 A;  2NRW A;  4F2R A;  4M3X A;  4FW2 A;  3T1Y K;  4FK4 A;  3CG7 A;  5C2D A;  1NGE A;  4C8K A;  1L3T A;  1XMQ K;  3ULE A;  4FZX C;  4DLG A;  1NK0 A;  2QWN A;  4YOY A;  3GBT A;  1IBL K;  2D0B A;  3K9K A;  2P9N B;  3NVK A;  2HOE A;  4P7I A;  1W0H A;  1HNZ K;  2P9U A;  3VA0 A;  1NM1 A;  2ABD A;  2DFF A;  3HM9 A;  1NGI A;  2E8A A;  1JL2 A;  3LP3 A;  2IDO A;  2ITM A;  2HE7 A;  1ZBL A;  4CEQ A;  1YIT N;  1IKX A;  4AF1 A;  5LMN K;  1RDW X;  4B3S K;  1X9S A;  3OS1 A;  4DB3 A;  1VSD A;  3O5B A;  4WFA L;  2KZZ A;  2YX6 A;  4WQ5 A;  2HVI A;  4CJS A;  2GTD A;  5AQF A;  3CFP A;  1Q8I A;  4KB0 A;  1EX4 A;  4I6M A;  5JLF A;  4JI0 K;  4LFC K;  2GV9 A;  3WXK A;  5C24 A;  4CE9 A;  5AQH A;  3AAR A;  4WQ4 C;  3NH1 A;  4L8R B;  3K0S A;  3LDS A;  1IKV A;  4BE1 A;  3KLE A;  5HRO A;  2OTJ N;  2BTF A;  3TAG A;  1K8A O;  4BRK A;  2Y1J A;  3THX B;  3MED A;  4E1M A;  3KK1 A;  4LSL A;  5KPT A;  2QXL A;  3L4Q A;  2EMS A;  3TAQ A;  1BIZ A;  5AFU A;  3E1Y A;  1TGO A;  4CEZ A;  5F1X A;  3VTI A;  2O4I A;  3AVI A;  3IUC A;  5AQZ A;  2RHK A;  3I55 N;  1LWC A;  4Z4G A;  1HBK A;  4F7G A;  2P9S B;  4C23 A;  1GOA A;  3K58 A;  3EO3 A;  2UUA K;  3CCQ N;  3ENB A;  1TKD A;  4N5S A;  2KHO A;  1LAW A;  3PSI A;  1I3A A;  4RW6 A;  2ETJ A;  5H1S Q;  4YOX A;  2E2Q A;  1KFD A;  4JI4 K;  5JIC A;  2QK9 A;  2CB8 A;  4BGA A;  3AA5 X;  3ZCM A;  4PKI A;  5AQN A;  3SJJ A;  3CCL N;  4X62 K;  1HJO A;  3WT0 A;  4X66 K;  4BR5 A;  4HCB A;  4DFM A;  3G10 A;  4OPJ A;  2FBT A;  3SBG A;  1BCO A;  4MQ3 A;  1RBR A;  4LH5 A;  3HT3 A;  5BPL A;  4LFA K;  4CEE A;  4FLZ A;  4B9M A;  3DXK A;  3THV A;  1Z6R A;  4CK2 A;  3U8X A;  3TAB A;  2X78 A;  1UA1 A;  4OGE A;  1HNV A;  1VSF A;  3DXM B;  4BRP A;  3S3M A;  2HVH A;  4H4M A;  4FL9 A;  1SAZ A;  2UXB K;  3ZSQ A;  5FPD A;  4O8U A;  1YVN A;  3IFR A;  4JI2 K;  3RR8 A;  1C0F A;  1HNI A;  4ZRJ A;  3AVF A;  5KTQ A;  4KI6 A;  3PY8 A;  3HVT A;  3QFP A;  4B9N A;  4YOV A;  1FK9 A;  3IRX A;  2DFH A;  3OW2 M;  4IKF A;  3L6Q A;  3L2Q A;  3CMA N;  4FLW A;  4BR9 A;  3MEC A;  1VSH A;  4Y1C A;  2FSN A;  3CHW A;  1EWQ A;  1LW0 A;  5I3U A;  4FJH A;  4JI3 K;  1WB9 A;  3OYK A;  4HTU A;  4JKG B;  3QO9 A;  4BG8 A;  3V9W A;  4BDP A;  2RE2 A;  3MWP A;  4H5V A;  2J0K A;  4DTR A;  3ZSW A;  2RQ1 A;  4MO4 A;  2P9K A;  3TR8 A;  1NGB A;  1S1W A;  4FM1 A;  3I8B A;  1NGD A;  2CGL A;  4DFJ A;  1TAU A;  1VQP N;  3SAF A;  1G15 A;  3V9Z A;  3M5R A;  4Y1D A;  4IEE A;  2NRZ A;  4AHT A;  4YOU A;  3AU4 A;  1HQU A;  3LZJ A;  3U9D A;  3WXM B;  1CLQ A;  4DF4 A;  1BHL A;  4CJT A;  1NK4 A;  2UUB K;  1VAZ A;  1BWF O;  4B3O A;  1EXQ A;  1XMO K;  3C6T A;  4ILJ A;  4IFY A;  3DLB A;  1E3M A;  3I8D A;  2QM1 A;  1CZ9 A;  2OPR A;  3F5T A;  3GOI A;  5GAG P;  4C1N I;  3C7N B;  4DHY A;  4PL8 A;  5KGW A;  4RCH A;  4GKK K;  2I7N A;  3VGL A;  2Z1G A;  3NMU A;  3KLH A;  3LL3 A;  4WYB A;  1ASV A;  1VQK N;  1VSM A;  4DFP A;  2V51 B;  3QIP A;  3MXI A;  2P51 A;  3RMB A;  5AQS A;  2ZJR L;  2OPP A;  3NH0 A;  3HPO A;  4BRF A;  2W6L A;  3DRR A;  4FLX A;  1XQS C;  2EX3 A;  4LD0 A;  3DWL A;  1WLJ A;  3CCJ N;  4BRM A;  3FLV A;  3CFO A;  1RGI A;  4B1X B;  2IGI A;  3WQU A;  4M45 A;  3NF8 A;  1J9A A;  2YV0 X;  5KPZ A;  3MAQ A;  2P5O A;  3ZYY X;  1NKB A;  1HR0 K;  3VEV A;  2Z1J A;  3G4S N;  3T1A A;  1MDU B;  4PKH A;  3NGI A;  3S9H A;  4BR0 A;  3NVM A;  4KAZ A;  4B8C A;  3OYB A;  4C8N A;  3OYD A;  2ZJP L;  2FLO A;  3O4Q A;  4AHV A;  1C1C A;  1KQS M;  2OTL N;  3OYL A;  1VBG A;  3PLA A;  4DS5 A;  2B5J A;  4FJK A;  2QWP A;  4HWI A;  3KWI A;  3QIC A;  2A41 A;  4CGD A;  4H0T B;  1WBD A;  1VHX A;  3VEX A;  2WUS A;  4CJ4 A;  3R9P A;  1KVB A;  3P38 A;  4JK9 A;  3KTQ A;  4YNQ A;  1QSL A;  4NXN K;  4PY5 A;  2AEH A;  4PHT X;  1ZBU A;  4FVM A;  3SJH A;  1OH8 A;  4JKE A;  1TUY A;  3OBY A;  1S3X A;  1YJ9 N;  5HLF A;  1NK7 A;  3GE1 A;  1U2V B;  1HYZ A;  4WQ5 C;  4GW6 A;  4AHR A;  1QSS A;  3CQY A;  2E2O A;  3ISN C;  4MLE A;  3O1B A;  4CZI A;  3C0B A;  3QEP A;  4E19 A;  4EFH A;  1JLQ A;  3MEE A;  4DV5 K;  3SPY A;  2FBY A;  3LM9 A;  2E6M A;  1OH5 A;  4GV6 A;  4FWL A;  3L2U A;  1CXU A;  4KFB A;  4NLC A;  4U7B A;  3V9U A;  3AGR A;  2VWB A;  5AZI B;  3QIO A;  2HBJ A;  5BR9 A;  4GY2 B;  5HRP A;  1W97 L;  1WSH A;  2Q1N A;  1GC6 A;  4U67 L;  3CM5 A;  4DV4 K;  1N32 K;  3EKU A;  3LDL A;  4F8R A;  2IAJ A;  2HST A;  3C6H A;  4BR4 A;  2QA4 N;  5CE3 A;  4J2A A;  4WCE L;  3O3H A;  4J2B A;  2HHX A;  1YAG A;  3R3L A;  4CJU A;  4FZY A;  4OJR A;  4FCY A;  3U6F A;  2YCH A;  5GAH P;  4DTJ A;  3M1F A;  3OHR A;  1C0T A;  1D5A A;  3FFK B;  2P9L A;  3CF5 L;  3LDP A;  1JJ2 M;  1K6Y A;  4CER A;  2DIK A;  2O8D B;  2HNY A;  4H03 B;  3A2F A;  1FXX A;  3S41 A;  2E6L A;  4CZK A;  1I94 K;  3I56 N;  2ZE2 A;  4JK8 A;  1E4G T;  3V1Q A;  4FLU A;  2YNI A;  4CK3 A;  4JK7 A;  5FPM A;  4RW4 A;  5ELZ A;  3VGM A;  3U3G A;  4JHD A;  4A5A A;  2P9I B;  3AA2 A;  1O13 A;  5AQT A;  3VEY A;  4IEI A;  3L3V A;  2D10 A;  3LWM A;  3SZ2 A;  1HPM A;  3ALY A;  4CFB A;  3LP2 A;  2HND A;  1LW2 A;  4O5F A;  3QEI A;  1YHQ N;  1SKS A;  3LP0 A;  1DGK N;  3HVR A;  1NJX A;  2QI2 A;  4CJ3 A;  1RT7 A;  4Z4I A;  1YIJ N;  5AQV A;  5AQQ A;  4MLH A;  5JVL A;  1IJJ A;  4BRN A;  1CZB A;  4E1N A;  2XHB A;  4CBX A;  1RT1 A;  2AP1 A;  3R1X A;  3OYJ A;  2VCP A;  1CZA N;  3EKS A;  4BR2 A;  1TUU A;  1KAX A;  1RDC A;  1KC8 O;  3O80 A;  4H5T A;  2OPQ A;  4K43 A;  1KAZ A;  2E5L K;  1WOQ A;  3F2K A;  3WXL A;  4GVM A;  4KTW A;  5DK5 A;  2Q2R A;  5AZJ B;  2P9P B;  4KHP K;  3Q7B A;  2A40 A;  1RBV A;  2KKZ A;  2D2Q A;  3OYH A;  4JI6 K;  4ISG A;  3QIJ A;  2F96 A;  2ZWH A;  3FLC O;  3RR7 A;  1QQM A;  4H0O A;  3J7A P;  1GOB A;  1KLM A;  2Q31 A;  4JS4 A;  3TAF A;  4N56 A;  1RDU A;  2P9K B;  3MMV A;  2ASP A;  2BE2 A;  5TKY A;  3R8E A;  2UXD K;  4WFN L;  2J4R A;  3ZLJ A;  4Z4C A;  3BGR A;  4O5B A;  4JEP A;  2DPN A;  5AQR A;  2HHH K;  2IS3 A;  3AY9 A;  2YKM A;  3MN6 A;  2HF3 A;  4KV8 A;  5KPR A;  1IBM K;  1OKJ A;  1NVL A;  5AQM A;  5GAD P;  4LF9 K;  1X9J A;  1KBL A;  1NWK A;  4H0V B;  1KVC A;  2O8F A;  4DTP A;  3NCI A;  4CFA A;  3OYN A;  3ZET A;  1VRT A;  1RBT A;  1TKX A;  5AQY A;  2V7Y A;  4CJ5 A;  1ATS A;  4A61 A;  2GUP A;  1JL1 A;  3ZT1 A;  3ZX0 A;  1D8Y A;  4DCH A;  2FSK A;  5HL7 L;  5D3G A;  4JYA K;  3VQ9 A;  2HBL A;  3P4I A;  3HST B;  5FDL A;  4OVL A;  1NJY A;  4CJV A;  3HXM A;  3ID8 A;  3OVN A;  4K8Z A;  3VQP A;  4CZH A;  4CW7 B;  4QS8 A;  3H6E A;  3NF9 A;  4GNI A;  1VQ8 N;  1QQN A;  1L5U A;  5GAE P;  5CYM A;  1VSE A;  3ATU A;  3K5O A;  4FWQ A;  3AVC A;  4M3T A;  4RWT A;  1RDB A;  4OX9 K;  4IDH A;  1KTQ A;  3UKR B;  3GG4 A;  3AO4 A;  4PWD A;  1GLE G;  2BUP A;  5AQO A;  4FLV A;  3HTV A;  3E66 A;  1RT2 A;  5AJ3 K;  1SL0 A;  1L3S A;  1RBU A;  1JXE A;  1ESV A;  4CJR A;  1OH6 A;  1ATR A;  5EU7 A;  3TTD A;  4M42 A;  2VG7 A;  1NK6 A;  4KPY A;  4M7Y A;  1HKC A;  1HPZ A;  5M1K A;  3DJC A;  2ATQ A;  1TYQ A;  4DWI A;  3CIP A;  4DR6 K;  4JD2 A;  1RT5 A;  1BI4 B;  3B6O A;  1W9H A;  3PO4 A;  4CEO A;  3KWG A;  4HDO A;  1HNX K;  3V6D A;  3H46 O;  1BU6 O;  3I33 A;  4CBU A;  2VGM A;  2GBZ A;  4LF6 K;  1BO5 O;  2VWK A;  1YF5 L;  3D45 A;  5M1O A;  4CZF A;  2KZM A;  3U8Z A;  1K8K A;  3GL1 A;  3VPZ A;  4JRP A;  4FJN A;  5C0Y A;  3PO5 A;  1TV6 A;  3V9X A;  5HRS A;  4CGI A;  1XC9 A;  4BDY A;  4JKB A;  3ZSX A;  2HRJ A;  1V4S A;  4PUO A;  4A59 A;  3M8Q A;  1N6Q A;  4CZM A;  1KAY A;  1MU2 A;  2BH1 A;  4YHH K;  3WEE A;  3BZC A;  4AHU A;  3FZM A;  1RTI A;  3VQB A;  2UXC K;  4CF8 A;  1ILY A;  3SMS A;  3QNN A;  2OYQ A;  3B6P A;  3B8A X;  2IVN A;  3FZF A;  4FW1 A;  3EPY A;  5AQI A;  1RBS A;  3MX2 A;  4B1U B;  4IXC A;  1QQO A;  3KHY A;  4CEB A;  4Y0W A;  1Z26 A;  1ZBF A;  5KGX A;  3H08 A;  1P90 A;  4JRQ A;  1BDG A;  3QEV A;  1Q86 O;  1NOZ A;  2D0P A;  1Q82 O;  1NGF A;  4KHS A;  3G9W A;  4G1Q A;  3AA3 A;  1SL2 A;  1SQK A;  5C25 A;  1SKR A;  3UB5 A;  4FJ5 A;  2G8H A;  3VEW A;  3QFU A;  1WNS A;  1XC3 A;  4B9U A;  4CGG A;  1RFQ A;  3VQ6 A;  4CGF A;  4JAX A;  4CIE A;  4HDQ A;  3P5J A;  3MN5 A;  4JLH A;  1QVF M;  4J2E A;  4N76 A;  4QAG A;  4B08 A;  5AQK A;  3ZSY A;  3V1O A;  4B9Q A;  2JLE A;  3VQC A;  2Q3S A;  3I0S A;  1XHZ A;  1NK5 A;  2A6A A;  3PZD A;  4BRD A;  3IVF A;  1GC7 A;  3CYM A;  1RTH A;  1V4T A;  4OKK A;  3EEQ A;  4B8A B;  4E0D A;  3QML A;  1Q9Y A;  1UA0 A;  1TK0 A;  3CCE N;  4M3U A;  3H3O B;  1WSE A;  4FJ7 A;  3NDK A;  3O9T A;  4DTS A;  2HW3 A;  3CC2 N;  3NE6 A;  3FZL A;  2D5R A;  3OS0 A;  4JHD B;  3D2F A;  3GDQ A;  1NJI O;  4CHZ A;  1JLE A;  4K41 A;  1A5V A;  1WN7 A;  4IO9 L;  2J0J A;  4GKJ K;  4KI4 A;  3ZEU A;  2ZF5 O;  1GLA G;  2WON A;  3K5L A;  4F4K A;  1GLL O;  1YTU A;  1ZBI A;  4CBW A;  1NGG A;  4BQL A;  4H5W A;  2GUI A;  3OYI A;  1ZBS A;  2EWS A;  3L2R A;  3MEG A;  3LDO A;  4EP4 A;  3AO1 A;  3AVB A;  2O8E B;  1SS6 A;  3CPE A;  3C94 A;  5LJV A;  1RT4 A;  3O08 A;  3VGK A;  5A2Q O;  2ZPY A;  3U4L A;  1XNR K;  4K8X A;  4EP5 A;  1JXB A;  4H5N A;  3D2E B;  4OLA A;  1BA1 A;  3C95 A;  5E26 A;  3AVG A;  4C1N K;  3CCV N;  4I2P A;  2F8S A;  4FJX A;  3RRH A;  2Q36 A;  5IJM A;  1BCM A;  2V7Z A;  1QVG M;  2LSN A;  1DKG D;  3FZH A;  4LF8 K;  3HP9 A;  2QWM A;  3SCX A;  3M3Z A;  2A1R A;  3BF1 A;  4HTL A;  4J8F A;  3L8B A;  4DQS A;  4DUY K;  1T03 A;  1YT3 A;  1WUA A;  5T7B A;  1LAV A;  4F2S A;  3D0P A;  3S3O A;  3KD1 E;  4IOC L;  3U7D A;  4AIL C;  3SQ4 A;  4RW9 A;  5JS1 A;  3AGK A;  4GXB A;  4YDU A;  3MXM A;  5KQD A;  3P1G A;  3G71 N;  3KIO A;  2ZGY A;  3K5N A;  1LWF A;  3VOV A;  3CM6 A;  1ST7 A;  3AVH A;  4ELU A;  2G8K A;  3O8M A;  3THY A;  5BN9 A;  1S6Q A;  1BOT O;  2E2N A;  4KH4 A;  4ILG B;  4FWK A;  5BR8 K;  3DLH A;  1TKZ A;  4ICL A;  4DV2 K;  4B9T A;  3JSM A;  4CZG A;  3VQ4 A;  1VQO N;  2VQE K;  1D9D A;  4DQQ A;  4KRF A;  3RWU A;  1RDD A;  1TK5 A;  1SUQ A;  4B3R K;  1WSF A;  3VEN A;  5DMR A;  4CED A;  1VQL N;  2YVC A;  5F2R A;  3RSE A;  3G25 A;  1DT9 A;  3ULD A;  1RT6 A;  4BAC A;  2IIR A;  3OJS A;  2YHW A;  3QLH A;  3SI6 A;  1QZ5 A;  2CGJ A;  3HO1 A;  4DSF A;  3HRG A;  3VEO A;  4AHC A;  1VQ4 N;  2VYP A;  3UKU B;  1FKP A;  3JYT A;  3J7Y P;  2KW4 A;  5J2Q A;  4AM6 A;  3VTH A;  1BL3 A;  4ZHR A;  2RN2 A;  1IKW A;  3H1V X;  4LF5 K;  4NB4 A;  2HHV A;  2O8C A;  2Q97 A;  4XH1 A;  1JLF A;  3ZSZ A;  3CER A;  2FBX A;  1MIX A;  3TAR A;  3KD5 E;  4H8K A;  3RMA A;  1QE1 A;  3SLC A;  3AVA A;  4DQR A;  4O0J A;  4CZJ A;  3QES A;  4AQY K;  1MK7 B;  4K42 A;  3DI6 A;  2KTQ A;  1TYQ B;  4DV1 K;  3O9Q A;  4LFB K;  4E7H A;  1HQE A;  4GMJ B;  3ULE B;  4FJM A;  1U6Z A;  1U4B A;  4WFB L;  3ENO A;  3E9O A;  3TSP A;  4BE0 A;  4OLB A;  1VBH A;  1K9M O;  3DOL A;  2P9U B;  4KHQ A;  1ZC6 A;  4FVU A;  1FJG K;  2QW9 A;  2NRR A;  4FJL A;  4GV3 A;  5IT9 O;  1NBW A;  5JLH A;  3NHG A;  3SQ1 A;  4BC5 A;  3AA4 A;  3CD6 N;  2PYL A;  2P9N A;  5EX5 A;  4H0P A;  1IKY A;  1D9F A;  3M8P A;  1HNW K;  5BRE A;  4YOW A;  2E4L A;  5B8H A;  4CD3 A;  4JI8 K;  4IBN A;  3WQT A;  5GIP A;  4AHS A;  5AQL A;  1W2B M;  1GGO A;  2JWK A;  4CHO A;  4EHT A;  2Y1I A;  3NF6 A;  4H0Y B;  1S72 N;  4DTN A;  4EZ6 A;  3HSC A;  1E4F T;  4LF7 K;  3G0Z A;  3CFR A;  2ZGZ A;  2NZT A;  4OPH A;  4XH5 A;  4DR5 K;  3L4I A;  1SZ2 A;  4CHP A;  3AVJ A;  4I6M B;  2VG6 A;  3EZ5 A;  1S9E A;  5E84 A;  2QWR A;  2NLX A;  3CCM N;  3MDQ A;  3OYF A;  4ILH A;  4A57 A;  5BRF A;  1GLC G;  4FYD A;  1JLA A;  2YNH A;  3CCS N;  2NRT A;  3N4P A;  3VQ8 A;  3KVG A;  2FC0 A;  4K25 A;  4CJK A;  3WA0 A;  3THW A;  3TWH A;  3C6U A;  4NY0 A;  2F8T A;  4FJ9 A;  4M3W A;  1QQC A;  3CJ7 A;  2CH6 A;  5I42 A;  4BY9 C;  3TI0 A;  3OYA A;  4KKO A;  3VQ7 A;  3DAW A;  4KHW A;  4CF2 A;  1N8R O;  5BRH A;  2P5G A;  3T69 A;  3P39 A;  3EE8 A;  3MXJ A;  2NNW A;  4OO1 J;  3C65 A;  4UY8 O;  4XIU A;  1OH7 A;  2R7Y A;  3L3U A;  5BRD A;  4DV6 K;  3E01 A;  4E1J A;  4B9S A;  3OYC A;  2E1Y A;  1S9G A;  4I9Q A;  2Q0R A;  4E89 A;  4KTQ A;  2P9S A;  3JAM O;  4M63 C;  2ZQB A;  3LAM A;  1BG3 A;  3KK2 A;  4IWV A;  3BUZ B;  4E7I A;  3I0R A;  3NH2 A;  3QDK A;  4IZ9 A;  5BPM A;  3HBT A;  1XI1 A;  4B3T K;  4DSL A;  3V1R A;  4N47 A;  4DV0 K;  4CIG A;  3KLI A;  4MFB A;  4B1Z A;  5KI6 A;  2YNF A;  1BA0 A;  5FPE A;  4FOE A;  4CD1 A;  1X9M A;  3VA3 A;  3LPT A;  3CXC M;  2PZS A;  3DXK B;  1ZYQ A;  3KLG A;  1VQ5 N;  3VF4 A;  2GWK A;  1D4X A;  5BPN A;  1DTQ A;  2GEL A;  3EL2 A;  2V52 B;  1U04 A;  1N5Y A;  3E9L A;  1S1X A;  1JCG A;  2P1J A;  3ZSV A;  4CEC A;  3QEW A;  4EKU A;  1N36 K;  4C8O A;  2XRI A;  2VG5 A;  4RW7 A;  2QXF A;  1IV0 A;  4O55 A;  1HYS A;  1IG8 A;  3O6W A;  3PX6 A;  5AQW A;  5LL6 Z;  3DXM A;  1LV5 A;  3SBT A;  1B92 A;  1T6C A;  1GLB G;  4E3S A;  3KK7 A;  1EF1 A;  4BRQ A;  5GIO A;  4JI7 K;  1J5E K;  3QB0 A;  4BC4 A;  2J0M A;  5KRS A;  1YTA A;  1NGA A;  4CYE A;  3BIN A;  1EET A;  2NRX A;  1T8E A;  3VER A;  4EAH D;  2FXU A;  3QEX A;  2YI1 A;  2RPI A;  4IOX A;  3DRS A;  3NBP A;  4UQG A;  1BUP A;  2FF6 A;  1HKB A;  1EKE A;  1Q81 O;  3SUQ A;  4YFU A;  2YJF A;  1N33 K;  3NF7 A;  1ZXO A;  3BP8 A;  4Q0B A;  3LP1 A;  4CJL A;  2IC3 A;  4BVO A;  3AVK A;  4JKD A;  5K14 A;  4DUZ K;  4LH4 A;  2YHB A;  2COP A;  1GG3 A;  3NGY A;  2WTU A;  1EWR A;  3L0Q A;  5SWM A;  1NK9 A;  3AV9 A;  1VQ7 N;  4BVP A;  1SL1 A;  3R6M A;  3J7Z O;  3BDP A;  3HZ6 A;  3VN5 A;  4FWS A;  4YDU C;  2GWJ A;  5AR0 A;  3PX0 A;  1RDA A;  4M41 A;  2F9T A;  3MX5 A;  3SQ2 A;  4FOI A;  5J2M A;  1BQM A;  1HJR A;  3BZK A;  3VF2 A;  3ZT4 A;  3VET A;  1T3V A;  3KZB A;  3J81 O;  3EN9 A;  3IAY A;  4DU3 A;  2HMI A;  1NKE A;  1J19 A;  5E41 A;  5MLC Q;  4QS9 A;  3MWT A;  3EZW A;  1MWM A;  4HUF A;  3FFI A;  3OY9 A;  4HVJ A;  1WAJ A;  5AQX A;  3TAM A;  4B9L A;  2G8W A;  2ZM6 K;  4JI5 K;  4DXA B;  3FE1 A;  4NCG A;  4JI1 K;  3HOT A;  4CIF A;  1LOT B;  3TSQ A;  3C7N A;  2PAV A;  4CJW A;  3NGZ A;  1U45 A;  3T7Z A;  3FZK A;  3LM2 A;  5CYQ A;  3W0L A;  3HM8 A;  3L2W A;  2FSJ A;  2QWQ A;  3BEX A;  4IG0 A;  4DR1 K;  1H1V A;  1NJZ A;  1I39 A;  3D7E O;  5TKW A;  3CJC A;  5CY4 A;  3DRP A;  4YY3 K;  2YHA A;  3LWL A;  1WSJ A;  4ZRK A;  1KD1 O;  4JN4 A;  4BE2 A;  1YI2 N;  4JKA A;  2QWO A;  3IS9 A;  4Z94 A;  3KKS A;  1QZ6 A;  3ENH A;  3CPW M;  4DFK A;  4DS4 A;  1ISN A;  3ZT3 A;  3O3G A;  5JMV A;  1EQY A;  2D11 A;  3V9S A;  5ADX H;  2OPS A;  3CCR N;  3VMF B;  3RTV A;  4M3Y A;  3MN7 A;  1YUW A;  4CFD A;  2HF4 A;  1BIU A;  3F9M A;  4M3R A;  4B9V A;  2OCE A;  4DQP A;  1ITG A;  2X6N A;  3W3D A;  2Q0U A;  1OVQ A;  3DLL L;  2OZS A;  4CHY A;  5IWA K;  3T3F A;  3QNO A;  4NCA A;  1U48 A;  1VSL A;  3HJF A;  4B1Y B;  1HMV A;  1IG9 A;  4CEF A;  2DY4 A;  1DEJ A;  2XO7 A;  2YHX A;  3K2P A;  5BN8 A;  3WNF A;  3M8S A;  4ELV A;  1RCH A;  1S1U A;  4KHN A;  1RNH A;  1UWB A;  3ID6 A; 
#chains in the Genus database with same CATH homology
 3FP5 A;  2WUS A;  3CJ1 A;  2AL6 A;  4H5N A;  3QBX A;  3D2E B;  3R9P A;  3P38 A;  3H3N O;  4JK9 A;  1BA1 A;  3O1W A;  5E26 A;  1HB6 A;  4C1N K;  2AEH A;  4PHT X;  3CCV N;  1R59 O;  3D2E A;  2Q36 A;  4LC9 B;  3SJH A;  1ACA A;  4A2A A;  5IJM A;  2GX9 A;  4JKE A;  5M1Q A;  1TUY A;  2F9W A;  3ATV A;  2VGN A;  1S3X A;  3OBY A;  4JKG A;  4NLB A;  5CHI A;  3PIO L;  1YJ9 N;  4IOA L;  3GE1 A;  2QTD A;  3MN9 A;  3QBW A;  1U2V B;  2V7Z A;  2W41 A;  1C0G A;  4WQ5 C;  1QVG M;  3H1Q A;  1DKG D;  3CQY A;  3FZH A;  2E2O A;  2QWM A;  3CJ9 A;  3SMP A;  4A2B A;  1U2V A;  3M3Z A;  3BF1 A;  4HTL A;  4BRE A;  4J8F A;  4MLE A;  3O1B A;  4CZI A;  2IVO A;  3C0B A;  1VQN N;  3ZDT A;  4EFH A;  4BRL A;  1WUA A;  3IMX A;  5JVH L;  4MO5 A;  4H5R A;  5EVZ A;  4BRA A;  3U7D A;  3CJB A;  4BC2 A;  2ZJQ L;  5I9E B;  4IOC L;  4AM7 A;  1Q7Y O;  3LM9 A;  2LBB A;  1NGC A;  4GV6 A;  4FWL A;  3A5L C;  3AGK A;  3VEZ A;  4GXB A;  2ASO A;  4NLC A;  4YDU A;  1JCE A;  1QHA A;  1T44 A;  5KQD A;  4U7B A;  4XEI A;  3G71 N;  3AGR A;  2VWB A;  5AZI B;  2A42 A;  2ZGY A;  3WXJ A;  2HBJ A;  4BQZ A;  4GY2 B;  3TTC A;  1W97 L;  5BR9 A;  2Q1N A;  3VOV A;  1GC6 A;  1ST7 A;  1M1K O;  4U67 L;  3O8M A;  3EKU A;  3LDL A;  5AZI A;  5BN9 A;  1BOT O;  1GLF O;  2HST A;  3LDN A;  2E2N A;  4IJN A;  3C6H A;  4ILG B;  4KH4 A;  4FWK A;  4BR4 A;  3HOS A;  3G6E N;  2QA4 N;  5CE3 A;  2CQU A;  3CJA A;  3N4Q A;  3O9S A;  4WCE L;  3FR0 A;  3PVL A;  3A0I X;  1YAG A;  4CZG A;  2HBK A;  4JNE A;  3R3L A;  1VQO N;  3RSE B;  1LCU A;  1M90 O;  4WF9 L;  1VQM N;  5DM6 L;  1XUP O;  3VEN A;  3ZX2 A;  2P9L B;  3WXI A;  1VQL N;  2YCH A;  2YVC A;  3AAP A;  3BF3 A;  5F2R A;  3RSE A;  4KH6 A;  5GAH P;  3G25 A;  1MK9 B;  1DT9 A;  3M1F A;  1JCF A;  1GLD G;  3OHR A;  4ISF A;  4L3Q A;  2A5X A;  4MDA A;  3FFK B;  1NTI A;  2P9L A;  3SAG A;  2I7P A;  3JS6 A;  2IIR A;  3CF5 L;  3LDP A;  2YHW A;  1HUX A;  1JJ2 M;  4A62 A;  2DIK A;  1QZ5 A;  2CGJ A;  3Q7C A;  4H03 B;  3HRG A;  3HI0 A;  3VEO A;  4JKH A;  2NRV A;  1VQ4 N;  2VYP A;  4IFE A;  3UKU B;  5JVG L;  3S41 A;  2E1Z A;  2CGK A;  1G99 A;  2WBN A;  4CZK A;  2D1K A;  3I56 N;  3FGU A;  4JK8 A;  3A5N C;  4AM6 A;  3VTH A;  3UKU A;  1E4G T;  3H1V X;  4CI6 A;  4R79 A;  4NB4 A;  4BG9 A;  4JK7 A;  5FPM A;  3CPW M;  3CD6 N;  2Q97 A;  4XH1 A;  2H3G X;  5ELZ A;  3VGM A;  4KBO A;  4PL7 A;  4JHD A;  4A5A A;  4BC3 A;  2P9I B;  1MIZ B;  1X3M A;  1O13 A;  3CER A;  5EY4 A;  5AQT A;  3UE5 A;  3VEY A;  1Z05 A;  4BRG A;  4DKW A;  5LJW A;  4IEI A;  2D10 A;  1MIX A;  2GEM A;  1Y64 A;  1HPM A;  2I1J A;  2P9I A;  3SLC A;  5CR4 A;  3O4W A;  1Q18 A;  4O5F A;  4CZJ A;  5C12 A;  1MK7 B;  4K42 A;  1GLJ O;  5KQ8 A;  4QS7 A;  1TYQ B;  1YHQ N;  3O9U A;  2HMP A;  4FWO A;  3VES A;  1DGK N;  1OVY A;  4MDB A;  4CJ7 A;  1HB8 A;  4NO7 A;  2IVP A;  3O9Q A;  5HOO A;  2NRW A;  2QI2 A;  2E88 A;  3CI5 A;  3ULE B;  1YIJ N;  5AQV A;  5C2D A;  1U6Z A;  5AQQ A;  1NGE A;  5DM7 L;  1X3N A;  4MLH A;  4WFB L;  3ENO A;  5JVL A;  1IJJ A;  3E9O A;  3TSP A;  3ULE A;  4BRN A;  3TPQ A;  2QWN A;  4CBX A;  1VBH A;  3GBT A;  4YOY A;  1K9M O;  2AP1 A;  3R1X A;  4M7X A;  2VCP A;  1CZA N;  3EKS A;  4BR2 A;  1TUU A;  2P9U B;  1KAX A;  1KC8 O;  3O80 A;  1ZC6 A;  3K9K A;  2P9N B;  4H5T A;  4FVU A;  3NVK A;  3AAQ A;  3JXU A;  4K43 A;  3TTF A;  1KAZ A;  2HOE A;  4P7I A;  2QW9 A;  1WOQ A;  2NRR A;  4GV3 A;  1NBW A;  2P9U A;  3F2K A;  1NM1 A;  2ABD A;  3WXL A;  4BC5 A;  5JLH A;  2P9N A;  3MK6 A;  4H0P A;  5EX5 A;  2Q2R A;  5AZJ B;  2P9P B;  5BRE A;  3Q7B A;  1NGI A;  2A40 A;  3D6R A;  4YOW A;  2KKZ A;  2D2Q A;  5B8H A;  2E8A A;  4ISG A;  3QIJ A;  4CD3 A;  2ITM A;  2ZWH A;  3FLC O;  3WQT A;  2HE7 A;  1QQM A;  5F0X A;  5GIP A;  1YIT N;  4JKC A;  5AZJ A;  2P9P A;  5AQL A;  1W2B M;  1GGO A;  4H0O A;  4AF1 A;  1RDW X;  2JWK A;  4DB3 A;  4EHT A;  2Q31 A;  3O9R A;  1RDU A;  2P9K B;  3MMV A;  3O5B A;  1YXQ A;  4H0Y B;  2YX6 A;  2ASP A;  4WFA L;  4WQ5 A;  2YHY A;  1YJW N;  1S72 N;  3HSC A;  1E4F T;  1HKG A;  5TKY A;  3R8E A;  2AA4 A;  2GTD A;  5AQF A;  4WFN L;  2ZGZ A;  2NZT A;  4OPH A;  2J4R A;  3C6A A;  4XH5 A;  3L4I A;  1SZ2 A;  4I6M B;  5E84 A;  5M1P A;  4JEP A;  2DPN A;  5AQR A;  3ZX3 A;  2QWR A;  2NLX A;  3AY9 A;  3MDQ A;  3MN6 A;  3CCM N;  4ILH A;  4A57 A;  2HF3 A;  1GLC G;  5BRF A;  4IO8 A;  5KPR A;  4I6M A;  5JLF A;  3CCS N;  5C10 A;  1OKJ A;  2NRT A;  1NVL A;  3N4P A;  5AQM A;  3WXK A;  5GAD P;  3KVG A;  1MA9 B;  1X9J A;  4K25 A;  3AAR A;  4WQ4 C;  5AQH A;  3VEX A;  1KBL A;  3WA0 A;  1NWK A;  4H0V B;  2PFU A;  4PKG A;  3ZET B;  3SAH A;  4NY0 A;  1KXP A;  1Y19 B;  2OTJ N;  4BRI A;  2BTF A;  3CJ7 A;  2CH6 A;  1K8A O;  4ZRI A;  4BRK A;  3ZET A;  1S22 A;  4BY9 C;  3J8A A;  5AQY A;  2V7Y A;  4BR7 A;  1ATS A;  3X23 A;  4YOR A;  4A61 A;  2GUP A;  2QXL A;  3L4Q A;  5KPT A;  3DAW A;  2EMS A;  3ZX0 A;  5EOY A;  5AFU A;  3E1Y A;  4DCH A;  2FSK A;  5BRH A;  3T69 A;  3P39 A;  5HL7 L;  1N8R O;  4KH5 A;  3EE8 A;  5F1X A;  3VTI A;  2NNW A;  4OO1 J;  3C65 A;  4UY8 O;  3IUC A;  5AQZ A;  2HBL A;  2RHK A;  4EIA A;  3I55 N;  3P4I A;  1HBK A;  4F7G A;  4CZE A;  5BRD A;  4E1J A;  4CZL A;  5C2F A;  2P9S B;  1SGH A;  4FO0 A;  5AFU H;  4C23 A;  3ID8 A;  3EO3 A;  2WFB A;  2E1Y A;  4CZH A;  3CCQ N;  3ENB A;  2Q0R A;  4QS8 A;  3H6E A;  2P9S A;  4GNI A;  3WUH A;  4BGB A;  1VQ8 N;  1QQN A;  4M63 C;  4YL8 A;  2KHO A;  3MCP A;  1BG3 A;  4IWV A;  1NGH A;  3BUZ B;  5GAE P;  3ATU A;  2KLA A;  4FWQ A;  3A5M C;  5H1S Q;  1E5W A;  4YOX A;  4RWT A;  3QDK A;  2E2Q A;  4IZ9 A;  5AQG A;  5BPM A;  3CC7 N;  3HBT A;  4IDH A;  5JIC A;  3UKR B;  3GG4 A;  2CB8 A;  5M1N A;  4BGA A;  4BRH A;  4PKI A;  5AQN A;  1GLE G;  3CCL N;  2BUP A;  1HJO A;  5AQO A;  3PIP L;  3HTV A;  3E66 A;  3WT0 A;  2FJ9 A;  3UKR A;  4B1W B;  4B1Z A;  4BR5 A;  1ESV A;  4FWN A;  1BA0 A;  1ATR A;  5FPE A;  4FOE A;  4CD1 A;  3TTD A;  3SBG A;  2JWL A;  1ATN A;  3CXC M;  3DXK B;  5GIN A;  1VQ5 N;  3VF4 A;  2GWK A;  1D4X A;  4M7Y A;  5BPN A;  2GEL A;  5BPL A;  3EL2 A;  2PBD A;  2V52 B;  3DXK A;  1HKC A;  3E9L A;  1Z6R A;  1JCG A;  5M1K A;  3U8X A;  3DJC A;  4JD2 B;  4EKU A;  3VF6 A;  4BRP A;  1TYQ A;  3DXM B;  3CIP A;  2D4W A;  4F9O A;  4JD2 A;  1VQ9 N;  1IG8 A;  3O6W A;  1YJN N;  5AQW A;  3DXM A;  4FL9 A;  3SBT A;  1SAZ A;  1T6C A;  1GLB G;  2OAN A;  3KK7 A;  1EF1 A;  4RTF D;  1NMD A;  4BRQ A;  4EHU A;  5FPD A;  3KWG A;  4O8U A;  1YVN A;  4HDO A;  3IFR A;  3CCU N;  5GIO A;  1C0F A;  4ZRJ A;  3H46 O;  1BU6 O;  2X0S A;  3I33 A;  4OPA A;  4CBU A;  4DQ8 A;  2VGM A;  1K8K B;  3QB0 A;  3QFP A;  4YOV A;  4BC4 A;  1BO5 O;  1YF5 L;  5M1O A;  3CET A;  2FDQ A;  2J0M A;  4CZF A;  3OW2 M;  3U8Z A;  1NGA A;  3L6Q A;  4CYE A;  2A3Z A;  1K8K A;  3CMA N;  1JDE A;  3BIN A;  2NRX A;  2WC9 A;  3A5O C;  3GL1 A;  3VPZ A;  3VER A;  4BR9 A;  2FXU A;  4EAH D;  2YI1 A;  2FSN A;  3CHW A;  4IOX A;  3K9J A;  5C0Y A;  4FWM A;  2YJE A;  4TKN A;  1BUP A;  2FF6 A;  1HKB A;  3IKM A;  1Q81 O;  4JKB A;  2HRJ A;  4JKG B;  1KC7 A;  1V4S A;  4BG8 A;  4A59 A;  3WEE B;  1T6D A;  2YJF A;  4CZM A;  2RE2 A;  5EXW A;  3MWP A;  4H5V A;  2J0K A;  1KAY A;  1ZXO A;  3BP8 A;  1J6Z A;  2RQ1 A;  2BH1 A;  2QEX N;  4MO4 A;  2P9K A;  4BVO A;  2ASM A;  1NGB A;  4JKD A;  3TU5 A;  3WEE A;  4FWP A;  3FZM A;  3I8B A;  1NGD A;  5AQJ A;  2COP A;  1GG3 A;  2CGL A;  4FSV A;  1VQP N;  3L0Q A;  3OBW A;  5AQP A;  3SAF A;  3M5R A;  2NRH A;  1VQ7 N;  4IEE A;  4ISE A;  3A8Y A;  3R6M A;  4FWR A;  4BVP A;  3RVC A;  3SMS A;  4A5B A;  3J7Z O;  2W40 A;  1ILY A;  3HZ6 A;  2NRZ A;  3U9Z A;  3LDQ A;  4YOU A;  3AU4 A;  3B8A X;  3H45 C;  4FWS A;  4YDU C;  2GWJ A;  2IVN A;  3FZF A;  5AR0 A;  2FF3 B;  3CC4 N;  5C15 A;  3U9D A;  3WXM B;  2F9T A;  1MWK A;  3MX5 A;  4FOI A;  3EPY A;  5AQI A;  4B1U B;  3MX2 A;  4IXC A;  4GV9 A;  1QQO A;  3VF2 A;  3KHY A;  1P8Z A;  4Y0W A;  5M1F A;  4WQ4 A;  3VET A;  1P90 A;  1T3V A;  3KZB A;  1BDG A;  1VAZ A;  3EN9 A;  1BWF O;  1J19 A;  3M6G A;  4FPA A;  1Q86 O;  1VQ6 N;  4FPB A;  5MLC Q;  4ILJ A;  4QS9 A;  2D0P A;  5AQU A;  1Q82 O;  1NGF A;  3MWT A;  3EZW A;  1MWM A;  3G9W A;  2WH5 A;  2QM1 A;  5AQX A;  3F5T A;  1SQK A;  3CQX A;  3GOI A;  5GAG P;  5LY3 A;  4C1N I;  3C7N B;  4DHY A;  4PL8 A;  3UB5 A;  4DXA B;  3FE1 A;  3VEW A;  3QFU A;  4RCH A;  1XC3 A;  3HOT A;  2I7N A;  1LOT B;  4O8K A;  3TSQ A;  3C7N A;  2PAV A;  1RFQ A;  3AU5 A;  2E20 A;  3T7Z A;  3FZK A;  3OA9 A;  3LM2 A;  3VGL A;  4JAX A;  3NMU A;  4BRC A;  3P31 A;  4HDQ A;  3W0L A;  3MN5 A;  3LL3 A;  2QWL A;  4WYB A;  3HM8 A;  1VQK N;  1QVF M;  2V51 B;  5AQK A;  4B9Q A;  2FSJ A;  2QWQ A;  3BEX A;  5AQS A;  1H1V A;  3IDH A;  3D7E O;  5TKW A;  3CJC A;  4H0X B;  2ZJR L;  2A6A A;  3PZD A;  4BRD A;  3IVF A;  1GC7 A;  4BRF A;  4ZRK A;  3EE9 A;  1KD1 O;  1V4T A;  4JN4 A;  5ADX A;  1XQS C;  1YI2 N;  3QML A;  4JKA A;  3DWL A;  2QWO A;  4Z94 A;  3CCJ N;  3CCE N;  3H3O B;  1QZ6 A;  3FLV A;  2D0O A;  2CH5 A;  3ENH A;  4BRM A;  1ISN A;  1HLU A;  3D2F B;  2R82 A;  3MCA B;  3O9T A;  1RGI A;  4B1X B;  5JMV A;  1EQY A;  2D11 A;  3CC2 N;  5ADX H;  4XH4 A;  3VMF B;  3WQU A;  3CCR N;  1HX1 A;  3FZL A;  2HBM A;  1NI2 A;  3MN7 A;  1YUW A;  3D2F A;  2HF4 A;  4GVE A;  4JHD B;  3ZEU B;  3GDQ A;  5KPZ A;  1NJI O;  2E2P A;  3F9M A;  4K41 A;  3ZYY X;  4B1V A;  4IO9 L;  2J0J A;  3VEV A;  3ZEU A;  3W3D A;  3G4S N;  2Q0U A;  2ZF5 O;  1K73 O;  1GLA G;  1MDU B;  3DLL L;  4PKH A;  4YOT A;  4BR0 A;  1GLL O;  1EO1 A;  3NVM A;  1NGG A;  4CBW A;  4BQL A;  4H5W A;  2I1K A;  4IJA A;  1ZBS A;  2ZJP L;  3TSU A;  1NGJ A;  4JKF A;  2EWS A;  3E9P A;  2FLO A;  4B1Y B;  3LDO A;  1H4R A;  1NLV A;  1KQS M;  1DEJ A;  2OTL N;  1SS6 A;  2F7T A;  2EMT A;  2YHX A;  1VBG A;  3CPE A;  3O08 A;  5BN8 A;  5LJV A;  3PLA A;  5FPN A;  3VGK A;  1DIK A;  2QWP A;  4G9Z A;  3CME N;  4HWI A;  3KWI A;  2ZPY A;  3U4L A;  3QIC A;  3SK3 A;  2A41 A;  4H0T B;  4BRO A;  2UYT A;  3ID6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...