4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
3E9PA 3E9LA 3SBTA 4JKBA 4JK9A 4JK7A 4JKEA 3E9OA 4JKDA 4JKFA 4ILJA 4JKHA 4JKGB 4JKAA 4ILGB 4JK8A 4JKCA 3E66A 4JKGA 3SBGA 4ILHA 3ENBA
chains in the Genus database with same CATH superfamily
3ID8A 2VGMA 4IG0A 3G4SN 3K59A 3GL1A 3TTDA 3WXKA 1ZBUA 3WQTA 4A2AA 3MX2A 1YJ9N 2D0PA 3DRPA 4LFBK 3KLFA 4J2AA 3ASMA 3WNEA 4CGDA 4FLUA 1VQNN 3ALYA 4W5NA 3ULEA 3E1YA 3QEPA 3NH1A 3DLEA 1EX4A 4DB3A 3KWGA 4JK8A 4U67L 4AHRA 3E66A 4HUFA 5BR8K 3KKRA 1FKPA 3TAEA 4CYEA 1KVBA 3NGYA 2PZSA 3C6UA 3JXUA 1OH5A 4LY7A 5E26A 1YI2N 4CE9A 4CHPA 4KI4A 1RTJA 1YJNN 1B9FA 2G8HA 1OKJA 4ID1A 4C1NK 3O9SA 5BN8A 4M41A 4LFAK 1REVA 4DR4K 4CJUA 3SBGA 1XHXA 3DWLA 4HCBA 4V19S 1M90O 3L3UA 2R7YA 3LDSA 3IDHA 3CCRN 1S6QA 2JLEA 3NHGA 2DTUA 1RT7A 1OH8A 4JHDA 4A2BA 3KLHA 2I7NA 5HRRA 4EP5A 4ISGA 1YUWA 1JL1A 2UUCK 3PVLA 4L8RB 2BANA 4LSLA 3MWPA 4KH4A 3HPHA 1IKWA 5CYMA 4Q5VA 3PIPL 1Z26A 3AGRA 3O1WA 1YF5L 3AVHA 4CJ5A 3ZSQA 1NKCA 3BGRA 1EKEA 1VSDA 1KAXA 1BOTO 1MWKA 1QHTA 2QWNA 4JD2A 3FZHA 2B6AA 4DS5A 4DUYK 1TKTA 2FSJA 1ESVA 4CHNA 1VRUA 3G9WA 3WNHA 3MEEA 5HL7L 1WSGA 1RBSA 5DMRA 2Q36A 1VAZA 1XQSC 2QXFA 4CZMA 1WLJA 4BRQA 3CD6N 1RILA 2VGNA 1RDAA 1L3TA 3AVFA 3MCPA 4B9VA 2W6LA 4YNQA 1YHQN 3LP3A 4LF6K 3S41A 1QQOA 3RVCA 3G10A 2HOEA 1ZBIA 4C8KA 5EVZA 2IGIA 3TANA 4X66K 3ZLJA 4KREA 1HKGA 3BEXA 4BVOA 4BGBA 3LDOA 1V4SA 4LH5A 4FOEA 4JI5K 2DFHA 3D2EB 4BRPA 2GBZA 3O6WA 3AV9A 3AY9A 4GVEA 5C24A 4YOWA 3DYAA 2YHBA 2BUPA 3KVGA 1CXQA 3BZKA 2P9SB 4I7FA 3MXJA 3AU4A 4Z4GA 1NGCA 4GMJB 1JLGA 1UWBA 1D9DA 4F2RA 4IKFA 5HP1A 1GLEG 1D4XA 4AF1A 1SL2A 3CF5L 1E4GT 1IH7A 3SUQA 4E7JA 3GG4A 4DFKA 2BH1A 2D0AA 4E3SA 1KVAA 2O8BB 5AQSA 4JLHA 4CECA 3RTVA 3PX4A 1JL2A 1RT5A 3BUZB 1SQKA 5HOOA 4NXNK 1A5WA 1LAWA 2P9LA 4JKHA 4H0TB 3BY5A 1SKWA 2VWBA 5BREA 3QEIA 1RBTA 3M8RA 3VEXA 1TV6A 4FJNA 5I9EB 3LZJA 5AQLA 5IJMA 1RTIA 1WOQA 4OKKA 4JI2K 3OS2A 1NU0A 1NGFA 1S1UA 3QB0A 1WNSA 5F2RA 4M7YA 5M1QA 4RG8A 2QWPA 2D0OA 1C1AA 4C8OA 4CJSA 3IAYA 1QVGM 5FPMA 4FVUA 4X64K 3VA3A 4EHUA 1J6ZA 4BRNA 1RT4A 3U7DA 3HVTA 3KTQA 2FBVA 4BR4A 5LL6Z 2WFBA 4DV4K 3KIOA 1HLUA 2QM1A 4CGHA 2RN2A 4NXMK 1C0MA 4FWPA 3SMSA 2ZD1A 3CG7A 3D2FA 3WXIA 2EMTA 5BR9A 5E41A 4JKCA 2AP1A 5LY3A 1N32K 2IVNA 3OBYA 4BRIA 4DR6K 5AQQA 1IG9A 1KLMA 5AQXA 3S3NA 2CH6A 2FC0A 4MO4A 5AZIB 4H0VB 4DR1K 4DQ8A 3D6RA 5LJVA 1U49A 1XC3A 5K14A 2DY4A 3LDNA 1DTQA 1SL0A 1XUPO 3HPOA 1HJOA 3BZCA 4BGAA 1TAQA 4FJ7A 3C94A 3DXMB 3V9UA 5KGWA 3OYHA 1X9WA 3TSUA 2P9UA 3O5BA 4FK4A 4IEIA 3TAGA 3G25A 2F9WA 5M1PA 2NRVA 4FJGA 1GG3A 4M3YA 1XMQK 3RR7A 2P9KA 4CJTA 4O44A 1RT2A 3ZETA 3OYGA 1DTTA 3SCXA 2FBTA 5EOYA 4GY2B 2OPSA 3C6AA 4CJ4A 4JI0K 3P31A 3TAMA 2AEHA 2UYTA 1RTHA 2OYQA 1BG3A 1H4RA 1D5AA 2JWKA 3C6TA 2XRIA 4JEPA 1VQ4N 2W6KA 4DU3A 4KB0A 3UKUB 1DLOA 3OYMA 5GIPA 1NNEA 3MEDA 4IWVA 3KHYA 4BROA 1A5VA 4C8LA 2V51B 5AQFA 4WF9L 3FR0A 3QLHA 3WNFA 4GXBA 3HK2A 3OYCA 2DFFA 4CZJA 3NF9A 3TABA 5CE3A 1EO1A 3OS0A 4CFCA 4BDZA 1LWEA 3DRRA 3BINA 4OLBA 1KC7A 3OYLA 3FZFA 3SYZA 3LM2A 1N6QA 1MIXA 1BHLA 4ELUA 3C65A 4CJVA 3NE6A 5BN9A 3EZWA 1WBDA 3MAQA 2Y1IA 3S3MA 1Y97A 3M6GA 1Z6RA 3SK3A 3T1YK 4KHUA 4KTZA 1S9GA 1CLQA 1BWFO 4DTNA 3DLGA 1QVFM 4N41A 3WXMB 4CFDA 4CCHA 2G8VA 4DV0K 3CC4N 4AM7A 4KPYA 4W5TA 4E7KA 1VSHA 3A5LC 1RCHA 2E4LA 1HBKA 1OVQA 3PO5A 4FPBA 3V81A 1ZBFA 5FRNA 2O8CA 4KHYA 4A5BA 1BI4B 4NY0A 4FXDA 3T1AA 3P39A 1SGHA 4BY9C 3VTHA 4OPKA 4IG3A 3KWIA 4DTOA 4B3TK 4FSVA 1HX1A 2GUPA 2E2PA 4ICLA 3VESA 1VQ7N 4J2DA 3HOSA 4CEFA 4GKKK 3LPUA 3P1GA 2O8EB 2YNHA 4KAZA 4CF1A 3MEGA 2RF2A 4OLAA 1EWRA 2WONA 2ETJA 4IFEA 2A1RA 1HQEA 4RW6A 2GX9A 2EHGA 3NAEA 1Q86O 1D9FA 3ZSYA 1N36K 3L2UA 1TK0A 2PYJA 4BG8A 1KAYA 1NG9A 1DGKN 4FWSA 4CVNE 3VQBA 5JVLA 1HUXA 5ELZA 4DSIA 4B1WB 1VRTA 3THYA 1CZAN 3VOVA 3HVRA 1OH7A 5AJ3K 4DFPA 2QWLA 4OPAA 5KRSA 4H5WA 4O55A 2E8AA 4FO0A 3THWA 3VQQA 4M3TA 4CJ7A 3HSCA 3V9SA 1BIZA 3EO3A 4DV7K 3AO2A 3K5MA 3U3YA 4A57A 3T3FA 2VWKA 2HHTA 3L6QA 4JI8K 2X6NA 1GLDG 4JNEA 4M42A 3ZX3A 3ULEB 1MIZB 4H4MA 4KB1A 4XIUA 4FK2A 3M5RA 1U2VA 3I8DA 4DQIA 3MK6A 3CCUN 1KLNA 3ZSRA 2QK9A 3CYMA 4ID5A 3MWTA 3UKRA 3O3GA 5CR4A 3I0SA 3CJAA 3QIOA 4B8AB 4JYAK 5AFUH 4JKFA 2XHBA 5AQTA 3HP9A 3VQEA 1NK4A 2YNGA 4BDYA 5C42A 5B8HA 1RDWX 3SJJA 2CGKA 2A5XA 2FBYA 3HPGA 2OCEA 2ZWHA 1QSYA 2W41A 3IMXA 4F3OA 4DQRA 4DG1A 3SNNA 3MCAB 3J7ZO 3F9MA 3VEVA 1BQMA 3RMCA 3S9HA 1TL3A 2E6MA 2GWKA 2VWJA 1TYQB 5FPNA 4JKDA 2Y1JA 1TKDA 1DT9A 2CGLA 3SUNA 5AZJA 4A59A 3SQ4A 4DQSA 4KBOA 4M3XA 1IBLK 2YKMA 4KRFA 3QO9A 3CFOA 2KHOA 3D45A 2QA4N 2HW3A 4CJKA 4AILC 3ITHA 4UQGA 1NK5A 1MA9B 3GOIA 4BC2A 4YOUA 3T1HK 3AGKA 3V6DA 1ILYA 3EEQA 3VETA 4B9SA 1VSKA 4DSLA 3CCVN 1Z25A 3H08A 3JS6A 3DRSA 3K5OA 3NVMA 2Z1IA 2GUIA 4JRQA 4H0YB 3U6FA 3AVIA 2PFUA 4XH5A 5HBMA 2D5RA 2WUSA 5ADXH 1TVRA 3LDPA 4G1QA 4JN4A 4GVMA 1HPMA 4M3WA 1KQSM 4DS4A 3SLCA 3LP0A 1IBMK 3RRGA 3DAWA 1NGIA 3JAMO 3QDKA 4FJ8A 1VQ9N 1NJYA 3BP8A 4BRHA 5C12A 3TTFA 3VF6A 2UU9K 2P9IA 5BRDA 3SZ2A 2ZPYA 3ZT2A 4JRPA 1KXPA 3KKSA 1P90A 4NB4A 1TAUA 1RDCA 3MMVA 3RSEA 1KTQA 3CQ8A 5AQYA 5C25A 3CHWA 2FF3B 4E7HA 3T19A 1Y19B 1Q7YO 4JS4A 5CY4A 3TR8A 3VQAA 4X62K 2VQFK 1QZ5A 3A8YA 1X3NA 3SAFA 1K73O 1VSEA 2YX6A 3HOTA 1IKYA 4YY3K 4MDAA 3ENOA 4GV3A 1GGOA 2EMSA 2P9NA 4HCCA 1G99A 2P9LB 1T8EA 3OYIA 4QCLA 2F96A 4RTFD 4N47A 4J8FA 1HB8A 2KTQA 3VQ4A 1NGGA 2QKKA 4FWKA 4ILGB 3VQDA 4H4OA 2W40A 5KRTA 5GIOA 4JKGA 5JVHL 1B92A 4YL8A 1BU6O 3KK2A 3VGKA 4DLEA 4KO0A 3QEWA 3SPYA 5AQVA 5KTQA 1EWQA 5AQMA 4ISFA 1HJRA 1RDBA 2CQUA 1XNQK 1TKZA 4DU4A 1IJJA 1VQMN 2G8WA 1WUAA 1KCFA 3PUFA 1BDGA 3LANA 1RDDA 2IAJA 2PY5A 4CHQA 2B4JA 1ATSA 3LP1A 2KLAA 2V52B 2O8FB 3CXCM 1ZYQA 4C1NI 2ZM6K 3J7YP 3VQPA 2YKNA 4FM1A 4CZEA 4DSJA 3V4IA 3SJHA 4IOXA 1QSSA 3Q7CA 2A40A 2KZMA 2ABDA 1ACAA 3CFPA 5KPTA 2PYLA 2ASOA 4AHCA 2I1JA 4NCBA 2WTUA 3HT3A 1S1TA 2XY6A 2Z1GA 4BG9A 2O4IA 3G0ZA 4A5AA 1HKCA 2D4WA 2P9PA 3OS1A 5J2NA 3HRGA 4WE1A 1NMDA 1VBGA 2W42A 1GOCA 4BACA 2HB5A 2IOCA 3VEOA 3F2KA 4IDHA 2YV0X 3U9DA 3T69A 1C0TA 1WSIA 1RBVA 1U47A 4WCEL 4CZHA 3EKSA 1EETA 2UXBK 4PA1A 1T6CA 4WFNL 1HNIA 3MECA 4KHPK 1TL1A 2QWOA 3NFAA 1RT3A 1WAJA 3T7ZA 5AQRA 4FJ5A 3FGUA 4PL7A 4B1VA 2P9UB 5JS1A 5C2DA 3LDQA 1T3VA 1XI1A 2ZQBA 4WQ5A 1FXXA 3UIQA 1J19A 1NGBA 4J2EA 3NMUA 4U7BA 3FFIA 3KJVA 3ATVA 2P9KB 1VQ5N 3L4QA 2H3GX 4ZTFA 3F9KA 4LH4A 3PIOL 3AVNA 3HZ6A 1V4TA 2FF6A 2WC9A 4CJQA 1YJWN 3OYBA 2Q2RA 3AA4A 3F5TA 1XC9A 3BF1A 2G8KA 1KRPA 2NRTA 4F4KA 4A62A 1EP4A 3JYTA 1OVYA 3VQ8A 4B3RK 1RNHA 4DFMA 1FW6A 2AJQA 3WEEB 2HVHA 4HTLA 4QS7A 1EF1A 4HVJA 3DLLL 1JCFA 1J53A 1JLFA 4H5VA 3EY1A 3VEZA 5BPNA 3O9RA 2QXLA 2X6SA 4FPAA 5JS2A 3MN6A 3O4WA 3EYZA 1SV5A 1GLJO 3DOKA 3CETA 2QTDA 1NK6A 2OANA 4FJXA 1YVUA 2ZJPL 3O4NA 4CBWA 4KHQA 4F8RA 3NF6A 3DXKB 3TTCA 1VBHA 1BA0A 2ITGA 3VQ6A 1E5WA 3LAMA 2J0JA 3VEYA 5EU7A 1HNVA 3JSMA 4DU1A 4CF8A 1FK9A 2RKIA 4FL9A 3W3DA 4BRAA 1NK7A 4BDPA 5C15A 2Q3SA 2D0BA 4LF9K 3HTVA 3SQ2A 4AHSA 4NYNA 4XH1A 4WQ5C 4JK9A 4DR5K 2O8CB 3AVMA 4O0JA 4PL8A 3M1FA 3QETA 3VA0A 1NGJA 3PSFA 4KFBA 3TAFA 3CQXA 3QEXA 1K8AO 1X9JA 2HRJA 2QWRA 4BWMA 4CD3A 1BIUA 4FVMA 2D10A 4CJEA 4MO5A 3THXB 3PX0A 3DM2A 4CZIA 4NCGA 1O1WA 2YNFA 3H3NO 5TKYA 4IJNA 3NH2A 3A0IX 1NOYA 4M7XA 3OW2M 4F2SA 4FOIA 1VSJA 4PWDA 2HNZA 2A6AA 1N33K 4DTSA 2QEXN 4H5TA 4WQ4A 4FLZA 4CJLA 5FDLA 3NGIA 4FYDA 3C6HA 3LZIA 4E7IA 3ZT1A 4LF4K 3LDLA 3QESA 4DKWA 4MQ3A 1WSFA 2F9TA 1S1VA 3H6EA 1UA0A 1SZ2A 4GNIA 3I55N 4I2PA 5EXWA 2GELA 1HNWK 3THYB 3RWUA 1ATNA 4KH6A 4I9LA 3ZSZA 3Q7BA 1KSPA 3I8BA 1X9MA 4AQYK 3FLVA 5I42A 4MLHA 4RW4A 1BCOA 2RHKA 3O80A 5AQPA 4HHTA 3QINA 3THWB 4Z4HA 4B9MA 5AQIA 4LD0A 1VQ8N 1NM1A 4YOYA 4XEIA 4I2QA 5GAHP 1QZ6A 1C6VA 2V7ZA 1HR0K 2RQ1A 2YCHA 1QQNA 5GINA 2FSNA 2OPQA 4OGEA 1DEJA 5M1NA 3D2EA 1NJIO 2NRHA 4DCHA 3SI6A 4K8XA 3HM8A 1Q82O 4ELTA 4ZHRA 1RGIA 4BR2A 3ZT3A 2P51A 4GKJK 4CGIA 1R0AA 5FROA 4B1XB 2E1YA 4DV2K 4BR9A 4PHTX 3MXIA 1JDEA 5TKWA 4G9ZA 1M1KO 4IZ9A 1Q18A 4CJRA 4O0IA 1HQUA 4TKNA 2E88A 4WQ4C 4BRKA 1Q81O 4KV8A 1RDUA 1ASVA 1HYZA 3AO5A 4BRCA 3CMAN 1P8ZA 4H03B 1RBRA 3QERA 1K8KB 4FWLA 2OZMA 2E2QA 2HHUA 5AZJB 4CZFA 4DTJA 1L3VA 5KGXA 4CGFA 3G6EN 1D8YA 3P83D 3LM9A 1RBUA 1T7PA 1FJGK 4JI6K 3J81O 3I56N 4DF8A 1VK0A 3DLBA 4OPJA 3SAHA 4AHUA 1LWCA 4B9QA 1HYVA 5FPDA 2E1ZA 4B9TA 4HTUA 1NJXA 1SAZA 3DJCA 1BQNA 4IFVA 3P38A 3CCEN 3PZDA 3QICA 4DV1K 4CEDA 2X74A 4YORA 4H5RA 4DTPA 1S1WA 3AVJA 1X1PA 3ID6A 3P5JA 3CERA 3A5OC 2CH5A 3M8QA 2BDPA 4CIGA 2HMPA 5F1XA 4DLGA 3CC2N 4N76A 2E2NA 5HRNA 3KLGA 3SQ0A 5AQKA 4LSNA 3O9QA 3PY8A 4DTRA 4ZRIA 4IOAL 1KVCA 1GLBG 3E9LA 4DV3K 1ST7A 4RCHA 3S3OA 1QHAA 4PQUA 3HSTB 4H5NA 5AZIA 3VF4A 1TUUA 3VMFB 4BE0A 1W9HA 5M1OA 4E7LA 3H46O 4BR7A 3VTIA 4E19A 3MX5A 3ZDTA 3B6PA 3IVFA 1BGXT 4KKOA 1NKEA 3HP6A 4C8NA 4WFBL 2NRXA 2HSTA 4BRGA 2O8DA 1U45A 2R82A 2Z1HA 3SBTA 4YFUA 3VEWA 1BUPA 3CCMN 5SWMA 2YVCA 2I1KA 4M3UA 2FXUA 1TK8A 2HHHK 3KD5E 2PAVA 3CQYA 2FDQA 1XNRK 1NWKA 4LFCK 5JLFA 1MK7B 4DF4A 2QI2A 4HUEA 2DPNA 5MLCQ 2XO7A 2UUAK 2AL6A 1I94K 4FJMA 4OO1J 4FM0A 5FRMA 4CHZA 3EZ5A 1TGOA 1IKVA 3SV3A 3MN5A 3BDPA 2EWSA 2YJEA 2E2OA 2P9NB 3R1XA 1QE1A 4FJJA 3J8AA 2Q0UA 3UKUA 3FP5A 3IFRA 1BCMA 3QFPA 3HO1A 3DLHA 3H1VX 4B3MK 4PKIA 2ATQA 4HWIA 3VQ9A 4FK0A 4W5QA 2HHWA 4Q0BA 1TK5A 4FWNA 1VQKN 1QSLA 1GLAG 4JKGB 1KBLA 1KD1O 2HF4A 1ASWA 3L2QA 4CHOA 4FWOA 3E9PA 1VQ6N 3AU5A 4JHDB 4EHTA 4I6MA 3U8XA 4UY8O 1UAXA 1SKSA 3OVNA 3NCIA 3NF7A 4DFJA 4N5SA 3SUPA 4K43A 4LF5K 3IRXA 4JI4K 1W7AA 1ZBHA 2B5JA 4H0XB 5KPZA 4CF0A 5E84A 3DOLA 3LL3A 1B9DA 1YVNA 3FLCO 3AVAA 3GDQA 2F8TA 4OKEA 4B3SK 3CIPA 1L3UA 2P5OA 3OBWA 5AQGA 5KQ8A 4B1ZA 3TSQA 5D3GA 2F7TA 4IJAA 2OA8A 3QMLA 4JD2B 1BO5O 4KHNA 3M3ZA 1VQPN 3I33A 1QTMA 5LMUK 3CI5A 3ZT4A 2P9PB 1VHXA 4CI6A 1SUQA 1T6DA 4GW6A 1JCEA 3RR8A 2DIKA 1TUYA 3ENBA 5GAEP 5AQZA 1IBKK 4EKUA 3VGMA 3VQ7A 4Z4EA 1YAGA 4R79A 1F21A 3PSIA 1MK9B 2NZTA 3WUHA 2HHSA 2O8EA 4ILJA 4FJ9A 5IT9O 2WBNA 4JS5A 1WSEA 3QIPA 3G71N 4FJKA 1XWLA 3R9PA 3WQUA 1RTDA 5T7BA 4F7GA 1LAVA 3KK3A 1W97L 2GV9A 2FBXA 3NF8A 4O5BA 3SMPA 3OYEA 4GV6A 1HMVA 2E5LK 2D0CA 1ASUA 3E9OA 2HMIA 3ZEUA 4KH5A 2CB8A 4FCYA 3TWHA 1NOZA 3RMAA 1ZXOA 3I0RA 1NK0A 4ZRKA 4FLWA 1KFDA 4FLVA 1S1XA 1J5EK 5AR0A 4QS9A 4RW7A 3ATUA 1NJWA 2GWJA 1UOCA 4FW1A 1X3MA 5DK5A 2G8IA 3M8PA 4CBUA 1YIJN 4QOZB 4O8UA 5I3UA 1GLCG 1Z05A 1L5UA 3ZSOA 5HLFA 1WSHA 2IDOA 3H3OB 2E6LA 4CEQA 3HXMA 3V1RA 2HBJA 1DKGD 4EIAA 4CIFA 2KZZA 5C2FA 1JKHA 3CFRA 1N5YA 4OPHA 1WAFA 3KK7A 3CPEA 3R6MA 3LWMA 3WNGA 3OJUA 4YDUA 2ZJRL 2ZF5O 3K5NA 5J2PA 1R59O 2RE2A 3V1OA 4WFAL 4YOTA 3SUOA 1NK9A 1G15A 5H1SQ 4BWJA 1BA1A 2LBBA 1IKXA 4DSFA 3CCLN 1T03A 4DHYA 2OPPA 4PUOA 3V9WA 4DQPA 4CGJA 4CK1A 4DTXA 4RWTA 2OTLN 4CJPA 1TYQA 3K57A 3MXMA 2YI1A 1ATRA 1GLLO 4ISEA 3D2FB 4KI6A 4CHYA 3CJ7A 2J4RA 4JI7K 4NCAA 4FJHA 2WOMA 4OX9K 1YTUA 4CEZA 3E01A 4DV5K 3DLKA 2HNDA 3FZKA 3ZYYX 5AQNA 5IWAK 5J2MA 1MU2A 1S9EA 3AAQA 3OYDA 4WYBA 3LALA 3HBTA 1HNZK 4Z4IA 4JI3K 2XY8A 1ZC6A 2ZJQL 4IO8A 2BGGA 3N4QA 5A2QO 2Q1NA 3F73A 4BC5A 3OYJA 4CIEA 2G8UA 4CESA 3WA0A 2A42A 1LCUA 2NUBA 4IO9L 1S22A 5CZ1A 3L8BA 3QNNA 3SPZA 4FZYA 3ZX0A 4E89A 3UE5A 3SV4A 3CM5A 4DQQA 3VF2A 2A3ZA 4BVPA 4BR0A 4FLXA 1IG8A 4DV6K 4AH9A 2KFZA 3AVGA 3AO4A 3C7NA 4FWRA 3ZETB 3L2RA 2NRZA 3UB5A 2QKBA 1VSMA 4YDUC 1XHZA 3ZSWA 3HI0A 1JLEA 1MWMA 2F8SA 3AO3A 1NBWA 4ELVA 4FWQA 4DSEA 2HNYA 1A5XA 3KZBA 4MFBA 4C8MA 3C95A 3V9XA 3P4IA 5J1EA 4KHWA 3C0BA 3A5NC 1IV0A 3AVKA 2IVOA 3HYFA 4EFHA 4FJLA 5JMVA 4NLCA 3MN7A 3U4LA 4CF2A 1LOTB 1MDUB 1HRHA 4XH4A 2HHQA 4BR5A 4IFYA 4MLEA 1S6PA 4DR7K 1YXQA 2J0MA 3RMBA 4BE1A 2IIRA 4HDOA 4LC9B 4FLYA 3CJ9A 4M45A 1FKOA 5CYQA 4JAXA 4HDQA 3B6OA 1WB9A 1U6ZA 5KQDA 3AA5X 1S72N 2Q31A 2VG7A 4CZKA 5DM7L 4Z4FA 2F4VK 3TAPA 5C0YA 3CPWM 1WN7A 2HBMA 2VG5A 1W0HA 4MDBA 3QBWA 4BRLA 1NGDA 3ENHA 1QS4A 3VENA 3B8AX 3EE9A 1Y64A 4IBNA 4K25A 1I39A 5AFUA 4H0OA 2EX3A 2YNIA 3J80O 3K5LA 4BQLA 3MN9A 1NGEA 1LW0A 5BRHA 3SAGA 2HVIA 4ZRJA 3VPZA 2GEMA 1JLBA 5GAGP 4X65K 3HM9A 3CCSN 2VYPA 4CJFA 1GOBA 3L3VA 3O3FA 2O8FA 4IXCA 5AQHA 4N56A 4FLTA 1K9MO 2HE7A 1ZBLA 1L3SA 3NBPA 4JK7A 3L2VA 2BTFA 4CFAA 1C1BA 3AVBA 5LMNK 4K0KK 4AM6A 4B3OA 2YHAA 3AARA 3AAPA 3U9ZA 3WT0A 3AVLA 2UXCK 3EN9A 1GC6A 4Z94A 4CEEA 3L4IA 2QWQA 3KLEA 2OZSA 3U8ZA 1Q9XA 1NI2A 4IOCL 3VERA 1JLCA 2CGJA 4B9NA 4ILHA 3QEVA 2HF3A 3RMDA 2P1JA 4M63C 3BF3A 4O8KA 2HBKA 3O8MA 4BREA 3AVCA 4CZGA 4LF8K 4EAHD 1LV5A 1BL3A 4P7IA 1NK8A 3CCQN 3GBTA 2KW4A 3ZSXA 2O8DB 3ISNC 3SQ1A 1W2BM 3IS9A 2QW9A 5ADXA 2X78A 4OKJA 3OYKA 1VSLA 2ASPA 3A2FA 2YHWA 4B9LA 4DSKA 2G8FA 1HKBA 2YJFA 4O5FA 3IG1A 3H45C 2J0KA 2D1KA 2KKZA 4CFBA 4DR2K 5HRPA 1U2VB 1H1VA 2X0SA 2NLXA 3LP2A 2JWLA 5KPRA 4CEOA 3L0QA 1X9SA 4B9UA 5EY4A 3UKRB 2WH5A 2P9SA 3CJCA 1T05A 3CM6A 4JKBA 4DTUA 4CGGA 1S5JA 1C0UA 2QWMA 3PO4A 1YITN 4I9QA 2PBDA 3K58A 1J54A 3CMEN 1J9AA 4FW2A 3RRHA 2HHXA 2O8BA 5GADP 3WEEA 3OYFA 4BC3A 3K9JA 3LAKA 4CEBA 3THVA 2ZE2A 3DI6A 4KTWA 5BPLA 1TKXA 2FSKA 5FLXO 4E1JA 3NGZA 4FZXC 1T44A 4F3TA 2XY7A 2IC3A 1E4FT 1NLVA 3NDKA 3R8EA 3IUCA 4QAGA 2XY5A 1RT6A 4AHVA 1DIKA 4I6MB 5HROA 3O1BA 4NO7A 2IVPA 4GV9A 3O08A 4R5PA 4RW8A 1RFQA 2KFNA 1CZ9A 3GE1A 2ZGZA 3DXKA 4BQZA 2COPA 2VCPA 4H8KA 4QS8A 1SKRA 3U3GA 3ZSVA 4NLBA 3H1QA 3KLIA 1EXQA 5AQJA 4J2BA 3MDQA 4CK2A 1ITGA 4DUZK 4CW7B 5C10A 1CXUA 4B1YB 1JCGA 4K42A 2I5JA 3DMJA 3K9KA 4DWIA 2YHXA 5FPEA 1GC7A 1C0GA 5JLHA 2OTJN 4PY5A 4KTQA 1ISNA 2ZGYA 1EQYA 4ZTJA 3FE1A 4B1UB 3X23A 4JI1K 5AQOA 4B8CA 1VSFA 1Q9YA 4W5OA 3EE8A 4K8ZA 5KI6A 3OJSA 1LW2A 3EL2A 4DR3K 3J7AP 1NVLA 1IO2A 2D2QA 4Y0WA 4E1NA 3QNOA 1N34K 3NVKA 3THXA 2YHYA 1JJ2M 3M8SA 2HBLA 3TSPA 2UXDK 3D7EO 1NMNA 4CBXA 3O9TA 2KQ2A 1KAZA 4IEEA 3OYAA 3FFKB 2A41A 1E3MA 4BC4A 3IKMA 4RW9A 1CZBA 3DXMA 3ZT0A 1S3XA 2P9IB 3ZEUB 3CJ1A 4KHSA 5F0XA 3AO1A 3RSEB 3O4QA 3WXJA 5M1FA 1KFSA 2NNWA 1XMOK 3V9ZA 1U04A 5JVGL 3O9UA 4M3ZA 3AA3A 3N4PA 1I3AA 3ULDA 1VQON 2ITMA 4CJ3A 2UUBK 3VQ5A 1NTIA 1QQCA 4JKEA 4EP4A 4CK3A 1OH6A 4Y1CA 2HHVA 4FZZA 2Z1JA 2AA4A 3LWLA 4A61A 2FJ9A 4B08A 2LSNA 3R3LA 4C23A 3K0SA 3HJFA 4E0DA 3TAQA 3ZCMA 3OHRA 1JLAA 4L3QA 3PLAA 4DMNA 5BPMA 4FJIA 3OA9A 3FZLA 1WBBA 3KK1A 1U4BA 1HNXK 5AQWA 4FM2A 1KC8O 3A5MC 1VSIA 3TPQA 1GOAA 2IS3A 2E20A 4CJWA 4LF7K 2A1SA 1NJZA 3KD1E 3V1QA 2VQEK 5JICA 1GLFO 3TARA 1QQMA 3LPTA 4M3RA 3PX6A 3OYNA 1JXEA 4CEAA 4CZLA 4HUGA 3PV8A 2OPRA 4Z4CA 4H0PA 1YT3A 4OJRA 5CZ2A 5DM6L 3VQCA 5SZTA 2I7PA 1YTAA 4JV5K 1LWFA 2VG6A 1K8KA 3QIJA 4EZ6A 3QFUA 4F9OA 1HB6A 4BRFA 1U48A 1BISA 4W5RA 1VQLN 2ASMA 3HL8A 4Y1DA 5M1KA 3L2WA 1BI4A 4CF9A 1HPZA 3CCJN 3OY9A 2BE2A 5BRFA 1HYSA 4O4GA 1K6YA 1O13A 3K2PA 1RT1A 3O3HA 3CJBA 4E1MA 2O4GA 3OTOK 2Q97A 4OGCA 3WXLA 2P5GA 4EZ9A 1SL1A 3DLRA 5HRSA 3TU5A 4Z0UA 4PKHA 3VGLA 1JLQA 4DTMA 1C0FA 4BRMA 3EPYA 2NRRA 1NGAA 4BE2A 4DXAB 2Q0RA 1UA1A 4IDKA 4YOVA 4CD1A 4JKAA 1NGHA 4PKGA 4FWMA 4NYFA 5AQUA 4YOXA 2D11A 5CHIA 5LJWA 2DFEA 2JGUA 3EKUA 1J5OA 4AHTA 1ZBSA 4TSXA 5J2QA 3TI0A 4BRDA 2RPIA 3VN5A 1SS6A 1N8RO 3C7NB 3QBXA 3W0LA 4YHHK 3D0PA 1C1CA 4K41A 3FZMA 3NH0A 2FLOA 5EX5A 4CERA 1WSJA 2GTDA 1JXBA 3CC7N 4OVLA 3AA2A 2V7YA 2NRWA 1NKBA 1Q8IA 3ZX2A
chains in the Genus database with same CATH topology
1QZ6A 3KZBA 3EO3A 3ID8A 2V7ZA 2VGMA 3P4IA 3G4SN 3C0BA 2RQ1A 3A5NC 3GL1A 3TTDA 3WXKA 4A57A 2IVOA 2YCHA 1QQNA 4EFHA 5GINA 2FSNA 3L6QA 3WQTA 1DEJA 4A2AA 3MX2A 4NLCA 1GLDG 2D0PA 3MN7A 4JNEA 3ZX3A 5JMVA 5M1NA 1YJ9N 3D2EA 3ULEB 3U4LA 1MIZB 2NRHA 4DCHA 1NJIO 1LOTB 1MDUB 1VQNN 3HM8A 3ULEA 3E1YA 3M5RA 4XH4A 1Q82O 1U2VA 4DB3A 4BR5A 3KWGA 3MK6A 3CCUN 4MLEA 4JK8A 1RGIA 4U67L 4BR2A 3E66A 1YXQA 3MWTA 2J0MA 3UKRA 2IIRA 4HDOA 4LC9B 4CYEA 5CR4A 3CJ9A 3CJAA 3JXUA 4B1XB 2E1YA 4JAXA 4HDQA 4BR9A 5E26A 1YI2N 4PHTX 5AFUH 1JDEA 5TKWA 4JKFA 5AQTA 1U6ZA 5KQDA 1S72N 4G9ZA 1M1KO 2Q31A 4IZ9A 1Q18A 4CZKA 1YJNN 5DM7L 4TKNA 2E88A 4WQ4C 4BRKA 5B8HA 1RDWX 1OKJA 1Q81O 2CGKA 5C0YA 2A5XA 3CPWM 4C1NK 1RDUA 3O9SA 2ZWHA 5BN8A 2W41A 2HBMA 3IMXA 4BRCA 3CMAN 4MDBA 1P8ZA 4H03B 3QBWA 4BRLA 3SBGA 1NGDA 3ENHA 3MCAB 3DWLA 3J7ZO 3VENA 3F9MA 1K8KB 3B8AX 3EE9A 4FWLA 3VEVA 1M90O 2E2QA 1Y64A 3IDHA 4K25A 3CCRN 5AZJB 5AFUA 2GWKA 4H0OA 4CZFA 1TYQB 5FPNA 4JKDA 4JHDA 4BQLA 1DT9A 2CGLA 3MN9A 4A2BA 1NGEA 5AZJA 5BRHA 2I7NA 4A59A 3LM9A 3SAGA 4ZRJA 3VPZA 4ISGA 1YUWA 2GEMA 4KBOA 3I56N 3PVLA 5GAGP 3SAHA 4B9QA 5FPDA 2E1ZA 3CCSN 2KHOA 3MWPA 2VYPA 4KH4A 2QA4N 1SAZA 3DJCA 3PIPL 3P38A 3CCEN 3PZDA 3QICA 3AGRA 4IXCA 3O1WA 5AQHA 4YORA 1K9MO 1YF5L 2HE7A 4H5RA 4JK7A 1MA9B 2BTFA 3GOIA 4BC2A 4YOUA 3AGKA 3ID6A 4AM6A 1ILYA 3CERA 3AARA 3A5OC 3AAPA 3U9ZA 3WT0A 2CH5A 3EN9A 1KAXA 1GC6A 3VETA 2HMPA 4Z94A 5F1XA 1BOTO 1MWKA 2QWNA 4JD2A 3CC2N 3CCVN 3L4IA 3FZHA 2QWQA 2E2NA 5AQKA 2FSJA 1ESVA 3JS6A 3NVMA 3U8ZA 3G9WA 3O9QA 1NI2A 4IOCL 3VERA 5HL7L 4ZRIA 2CGJA 2Q36A 4IOAL 4H0YB 4ILHA 2HF3A 1XQSC 1VAZA 4CZMA 1GLBG 3E9LA 2PFUA 1ST7A 4XH5A 4BRQA 3CD6N 4M63C 4RCHA 3BF3A 2VGNA 4O8KA 1QHAA 2HBKA 3O8MA 3MCPA 4BREA 2WUSA 4CZGA 5ADXH 4EAHD 1YHQN 3LDPA 4H5NA 5AZIA 3S41A 1TUUA 4JN4A 3VF4A 3VMFB 4P7IA 1HPMA 5M1OA 1QQOA 1KQSM 3H46O 4BR7A 3VTIA 3MX5A 3ZDTA 3RVCA 3CCQN 3IVFA 3SLCA 2HOEA 3GBTA 5EVZA 3DAWA 1NGIA 4WFBL 2NRXA 2HSTA 3QDKA 4BRGA 1VQ9N 3BP8A 4BRHA 1HKGA 3BEXA 5C12A 2R82A 3TTFA 1W2BM 4BVOA 3VF6A 3SBTA 4BGBA 3VEWA 3LDOA 1V4SA 2QW9A 1BUPA 5ADXA 3CCMN 2P9IA 2YVCA 2ASPA 2I1KA 2YHWA 5BRDA 2ZPYA 2FXUA 1HKBA 2YJFA 4FOEA 1KXPA 4O5FA 4NB4A 1P90A 2PAVA 3D2EB 4BRPA 3O6WA 3CQYA 2FDQA 3MMVA 3H45C 2J0KA 2D1KA 2KKZA 1NWKA 3AY9A 4GVEA 3RSEA 5JLFA 4YOWA 1MK7B 5AQYA 1U2VB 2BUPA 2QI2A 1H1VA 3CHWA 2X0SA 2FF3B 3KVGA 1Y19B 2DPNA 2NLXA 1Q7YO 2JWLA 5KPRA 5MLCQ 2AL6A 2P9SB 3L0QA 4OO1J 3AU4A 1NGCA 5EY4A 3UKRB 2WH5A 2P9SA 3CJCA 1QZ5A 3A8YA 1X3NA 3MN5A 3SAFA 2EWSA 1K73O 1GLEG 1D4XA 2YX6A 4AF1A 3HOTA 3CF5L 2YJEA 4JKBA 1E4GT 2E2OA 2P9NB 3R1XA 3J8AA 3GG4A 4MDAA 2Q0UA 3ENOA 3UKUA 3FP5A 2BH1A 1GGOA 3IFRA 2QWMA 4GV3A 2EMSA 2P9NA 1YITN 5AQSA 1G99A 3QFPA 2PBDA 3H1VX 3CMEN 2P9LB 4PKIA 3BUZB 1SQKA 5GADP 3WEEA 4HWIA 5HOOA 4BC3A 3K9JA 2P9LA 4JKHA 4RTFD 4H0TB 4J8FA 1HB8A 4FWNA 5BPLA 1VQKN 1GLAG 4JKGB 1KBLA 2FSKA 2VWBA 1NGGA 1T44A 4FWKA 4ILGB 2HF4A 4E1JA 5BREA 1KD1O 1E4FT 1NLVA 2W40A 5GIOA 4JKGA 3R8EA 3IUCA 5JVHL 4FWOA 4YL8A 3E9PA 1BU6O 3VEXA 1DIKA 3VGKA 5I9EB 4I6MB 5AQVA 1VQ6N 3AU5A 3O1BA 4NO7A 2IVPA 4JHDB 5AQMA 4EHTA 4ISFA 5IJMA 4I6MA 5AQLA 3U8XA 1WOQA 4UY8O 4GV9A 3O08A 1NGFA 2CQUA 1RFQA 3GE1A 2ZGZA 3DXKA 3QB0A 5F2RA 4BQZA 2COPA 4M7YA 1IJJA 2VCPA 5M1QA 4QS8A 1VQMN 2QWPA 1WUAA 4K43A 4NLBA 1BDGA 3H1QA 2D0OA 1ATSA 4H0XB 2KLAA 2V52B 5AQJA 5KPZA 5E84A 1QVGM 3MDQA 5FPMA 3CXCM 4FVUA 3LL3A 4C1NI 1YVNA 4B1YB 5C10A 1JCGA 3FLCO 4K42A 4EHUA 1J6ZA 3GDQA 4BRNA 3CIPA 3U7DA 3OBWA 4CZEA 3K9KA 5AQGA 5KQ8A 2YHXA 3SJHA 4B1ZA 5FPEA 3TSQA 1GC7A 1C0GA 4BR4A 4IOXA 5JLHA 2WFBA 2OTJN 2F7TA 3Q7CA 4IJAA 1ISNA 2A40A 3QMLA 2ABDA 1ACAA 4JD2B 2ZGYA 1HLUA 1BO5O 2QM1A 5KPTA 1EQYA 3M3ZA 2ASOA 2I1JA 1VQPN 3I33A 3FE1A 4FWPA 3CI5A 2P9PB 3SMSA 3D2FA 4B1UB 3X23A 4CI6A 4BG9A 1T6DA 5AQOA 3WXIA 2EMTA 5BR9A 4A5AA 1HKCA 4JKCA 2D4WA 2AP1A 2P9PA 1JCEA 3EE8A 5LY3A 3HRGA 1NMDA 2DIKA 3EL2A 1VBGA 1TUYA 3ENBA 5GAEP 1NVLA 3NVKA 2D2QA 2IVNA 3OBYA 4Y0WA 5AQZA 5AQQA 4BRIA 2YHYA 3VEOA 5AQXA 3F2KA 4EKUA 4IDHA 3VGMA 2CH6A 3U9DA 1YAGA 3T69A 4R79A 4MO4A 5AZIB 1JJ2M 1MK9B 2NZTA 2HBLA 3WUHA 3TSPA 4WCEL 4H0VB 3D7EO 4DQ8A 4CZHA 3EKSA 3D6RA 5LJVA 4CBXA 4ILJA 1XC3A 3O9TA 1T6CA 4WFNL 2WBNA 1KAZA 3LDNA 4IEEA 3G71N 3R9PA 1XUPO 3FFKB 2A41A 2QWOA 3WQUA 4BC4A 1HJOA 4BGAA 3DXMB 4F7GA 1W97L 3T7ZA 5AQRA 3IKMA 3FGUA 4PL7A 4B1VA 2P9UB 3DXMA 5C2DA 3LDQA 1S3XA 3TSUA 1T3VA 3SMPA 4GV6A 2P9IB 3ZEUB 3CJ1A 2P9UA 4WQ5A 3O5BA 3E9OA 1J19A 1NGBA 4IEIA 3NMUA 3ZEUA 4KH5A 4U7BA 3G25A 2F9WA 3ATVA 2CB8A 5M1PA 5F0XA 2P9KB 2NRVA 1VQ5N 3RSEB 1GG3A 3L4QA 2H3GX 3WXJA 1ZXOA 2P9KA 5M1FA 2NNWA 3PIOL 3ZETA 3HZ6A 5EOYA 1V4TA 4ZRKA 2FF6A 2WC9A 4GY2B 3O9UA 3C6AA 5JVGL 3P31A 2AEHA 2UYTA 1YJWN 5AR0A 3N4PA 1BG3A 4QS9A 1H4RA 2JWKA 2Q2RA 4JEPA 3F5TA 1VQ4N 3BF1A 1VQON 2NRTA 3ATUA 2ITMA 4A62A 2GWJA 3UKUB 5GIPA 1NTIA 4JKEA 4IWVA 1X3MA 3KHYA 1OVYA 4BROA 2V51B 5AQFA 4WF9L 3WEEB 2AA4A 3FR0A 4A61A 4GXBA 4HTLA 4CBUA 4QS7A 2FJ9A 3R3LA 4C23A 1EF1A 3DLLL 4CZJA 1JCFA 1YIJN 5CE3A 3OHRA 4H5VA 4O8UA 4L3QA 3PLAA 1EO1A 1GLCG 1Z05A 5BPMA 3OA9A 3FZLA 3VEZA 5BPNA 3O9RA 5AQWA 3BINA 2QXLA 1KC8O 1KC7A 3A5MC 3H3OB 4FPAA 3FZFA 3MN6A 3TPQA 2E20A 3O4WA 1GLJO 3CETA 2HBJA 2QTDA 2OANA 3LM2A 1MIXA 1DKGD 4EIAA 5JICA 5C2FA 2ZJPL 1GLFO 4CBWA 3C65A 3TTCA 3DXKB 1VBHA 4OPHA 5BN9A 1BA0A 1QQMA 3EZWA 1E5WA 3KK7A 3CPEA 2J0JA 3R6MA 3VEYA 3G6EN 3M6GA 1Z6RA 4YDUA 3SK3A 4CZLA 4FL9A 3W3DA 2ZJRL 2ZF5O 4BRAA 1R59O 4H0PA 5C15A 2RE2A 1BWFO 4WFAL 1QVFM 4YOTA 3WXMB 3HTVA 5H1SQ 5DM6L 1BA1A 2LBBA 2I7PA 3CC4N 4AM7A 3CCLN 4XH1A 4DHYA 1K8KA 4JK9A 3QIJA 3A5LC 4WQ5C 3QFUA 4F9OA 1HBKA 4PL8A 1HB6A 3M1FA 4BRFA 4FPBA 1NGJA 4RWTA 1VQLN 2OTLN 1TYQA 2ASMA 3CQXA 4A5BA 1K8AO 1X9JA 2HRJA 2YI1A 1ATRA 1GLLO 4ISEA 5M1KA 4NY0A 2QWRA 4CD3A 3P39A 1SGHA 3D2FB 4BY9C 3CCJN 3VTHA 3CJ7A 2J4RA 5BRFA 3KWIA 2D10A 1O13A 4MO5A 3CJBA 3FZKA 4FSVA 1HX1A 2Q97A 3ZYYX 2GUPA 5AQNA 3WXLA 4CZIA 2E2PA 3VESA 1VQ7N 3AAQA 3TU5A 3HOSA 4PKHA 4WYBA 3VGLA 3HBTA 1C0FA 3H3NO 5TKYA 4IJNA 4BRMA 1ZC6A 3A0IX 4IO8A 4M7XA 3N4QA 3EPYA 2Q1NA 4FOIA 2ZJQL 3OW2M 2A6AA 2NRRA 4BC5A 1NGAA 2QEXN 4H5TA 4WQ4A 3WA0A 2A42A 4IFEA 4DXAB 1LCUA 2GX9A 2Q0RA 1Q86O 4YOVA 4CD1A 4JKAA 1NGHA 3C6HA 4PKGA 4IO9L 1S22A 3LDLA 4FWMA 4DKWA 2F9TA 5AQUA 3H6EA 4BG8A 1KAYA 4YOXA 2D11A 3ZX0A 5CHIA 5LJWA 3UE5A 1SZ2A 3EKUA 1DGKN 3VF2A 4GNIA 3I55N 2A3ZA 1ZBSA 2GELA 4FWSA 5EXWA 4BVPA 4BR0A 5JVLA 1ATNA 1HUXA 4KH6A 4BRDA 3Q7BA 1SS6A 5ELZA 1N8RO 1IG8A 3I8BA 3C7NB 4B1WB 3QBXA 3W0LA 1CZAN 4K41A 3VOVA 3FLVA 4FWRA 3C7NA 3ZETB 3FZMA 4MLHA 2NRZA 2QWLA 2RHKA 3O80A 4H5WA 4OPAA 2FLOA 5AQPA 3UB5A 4YDUC 5EX5A 2GTDA 2E8AA 4FO0A 5AQIA 3HI0A 3CC7N 1MWMA 1VQ8N 1NM1A 1NBWA 2V7YA 2NRWA 4CJ7A 4YOYA 3HSCA 4FWQA 4XEIA 5GAHP 3ZX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9P A;  3E9L A;  3SBT A;  4JKB A;  4JK9 A;  4JK7 A;  4JKE A;  3E9O A;  4JKD A;  4JKF A;  4ILJ A;  4JKH A;  4JKG B;  4JKA A;  4ILG B;  4JK8 A;  4JKC A;  3E66 A;  4JKG A;  3SBG A;  4ILH A;  3ENB A; 
#chains in the Genus database with same CATH topology
 3ID8 A;  2VGM A;  4IG0 A;  3G4S N;  3K59 A;  3GL1 A;  3TTD A;  3WXK A;  1ZBU A;  3WQT A;  4A2A A;  3MX2 A;  1YJ9 N;  2D0P A;  3DRP A;  4LFB K;  3KLF A;  4J2A A;  3ASM A;  3WNE A;  4CGD A;  4FLU A;  1VQN N;  3ALY A;  4W5N A;  3ULE A;  3E1Y A;  3QEP A;  3NH1 A;  3DLE A;  1EX4 A;  4DB3 A;  3KWG A;  4JK8 A;  4U67 L;  4AHR A;  3E66 A;  4HUF A;  5BR8 K;  3KKR A;  1FKP A;  3TAE A;  4CYE A;  1KVB A;  3NGY A;  2PZS A;  3C6U A;  3JXU A;  1OH5 A;  4LY7 A;  5E26 A;  1YI2 N;  4CE9 A;  4CHP A;  4KI4 A;  1RTJ A;  1YJN N;  1B9F A;  2G8H A;  1OKJ A;  4ID1 A;  4C1N K;  3O9S A;  5BN8 A;  4M41 A;  4LFA K;  1REV A;  4DR4 K;  4CJU A;  3SBG A;  1XHX A;  3DWL A;  4HCB A;  4V19 S;  1M90 O;  3L3U A;  2R7Y A;  3LDS A;  3IDH A;  3CCR N;  1S6Q A;  2JLE A;  3NHG A;  2DTU A;  1RT7 A;  1OH8 A;  4JHD A;  4A2B A;  3KLH A;  2I7N A;  5HRR A;  4EP5 A;  4ISG A;  1YUW A;  1JL1 A;  2UUC K;  3PVL A;  4L8R B;  2BAN A;  4LSL A;  3MWP A;  4KH4 A;  3HPH A;  1IKW A;  5CYM A;  4Q5V A;  3PIP L;  1Z26 A;  3AGR A;  3O1W A;  1YF5 L;  3AVH A;  4CJ5 A;  3ZSQ A;  1NKC A;  3BGR A;  1EKE A;  1VSD A;  1KAX A;  1BOT O;  1MWK A;  1QHT A;  2QWN A;  4JD2 A;  3FZH A;  2B6A A;  4DS5 A;  4DUY K;  1TKT A;  2FSJ A;  1ESV A;  4CHN A;  1VRU A;  3G9W A;  3WNH A;  3MEE A;  5HL7 L;  1WSG A;  1RBS A;  5DMR A;  2Q36 A;  1VAZ A;  1XQS C;  2QXF A;  4CZM A;  1WLJ A;  4BRQ A;  3CD6 N;  1RIL A;  2VGN A;  1RDA A;  1L3T A;  3AVF A;  3MCP A;  4B9V A;  2W6L A;  4YNQ A;  1YHQ N;  3LP3 A;  4LF6 K;  3S41 A;  1QQO A;  3RVC A;  3G10 A;  2HOE A;  1ZBI A;  4C8K A;  5EVZ A;  2IGI A;  3TAN A;  4X66 K;  3ZLJ A;  4KRE A;  1HKG A;  3BEX A;  4BVO A;  4BGB A;  3LDO A;  1V4S A;  4LH5 A;  4FOE A;  4JI5 K;  2DFH A;  3D2E B;  4BRP A;  2GBZ A;  3O6W A;  3AV9 A;  3AY9 A;  4GVE A;  5C24 A;  4YOW A;  3DYA A;  2YHB A;  2BUP A;  3KVG A;  1CXQ A;  3BZK A;  2P9S B;  4I7F A;  3MXJ A;  3AU4 A;  4Z4G A;  1NGC A;  4GMJ B;  1JLG A;  1UWB A;  1D9D A;  4F2R A;  4IKF A;  5HP1 A;  1GLE G;  1D4X A;  4AF1 A;  1SL2 A;  3CF5 L;  1E4G T;  1IH7 A;  3SUQ A;  4E7J A;  3GG4 A;  4DFK A;  2BH1 A;  2D0A A;  4E3S A;  1KVA A;  2O8B B;  5AQS A;  4JLH A;  4CEC A;  3RTV A;  3PX4 A;  1JL2 A;  1RT5 A;  3BUZ B;  1SQK A;  5HOO A;  4NXN K;  1A5W A;  1LAW A;  2P9L A;  4JKH A;  4H0T B;  3BY5 A;  1SKW A;  2VWB A;  5BRE A;  3QEI A;  1RBT A;  3M8R A;  3VEX A;  1TV6 A;  4FJN A;  5I9E B;  3LZJ A;  5AQL A;  5IJM A;  1RTI A;  1WOQ A;  4OKK A;  4JI2 K;  3OS2 A;  1NU0 A;  1NGF A;  1S1U A;  3QB0 A;  1WNS A;  5F2R A;  4M7Y A;  5M1Q A;  4RG8 A;  2QWP A;  2D0O A;  1C1A A;  4C8O A;  4CJS A;  3IAY A;  1QVG M;  5FPM A;  4FVU A;  4X64 K;  3VA3 A;  4EHU A;  1J6Z A;  4BRN A;  1RT4 A;  3U7D A;  3HVT A;  3KTQ A;  2FBV A;  4BR4 A;  5LL6 Z;  2WFB A;  4DV4 K;  3KIO A;  1HLU A;  2QM1 A;  4CGH A;  2RN2 A;  4NXM K;  1C0M A;  4FWP A;  3SMS A;  2ZD1 A;  3CG7 A;  3D2F A;  3WXI A;  2EMT A;  5BR9 A;  5E41 A;  4JKC A;  2AP1 A;  5LY3 A;  1N32 K;  2IVN A;  3OBY A;  4BRI A;  4DR6 K;  5AQQ A;  1IG9 A;  1KLM A;  5AQX A;  3S3N A;  2CH6 A;  2FC0 A;  4MO4 A;  5AZI B;  4H0V B;  4DR1 K;  4DQ8 A;  3D6R A;  5LJV A;  1U49 A;  1XC3 A;  5K14 A;  2DY4 A;  3LDN A;  1DTQ A;  1SL0 A;  1XUP O;  3HPO A;  1HJO A;  3BZC A;  4BGA A;  1TAQ A;  4FJ7 A;  3C94 A;  3DXM B;  3V9U A;  5KGW A;  3OYH A;  1X9W A;  3TSU A;  2P9U A;  3O5B A;  4FK4 A;  4IEI A;  3TAG A;  3G25 A;  2F9W A;  5M1P A;  2NRV A;  4FJG A;  1GG3 A;  4M3Y A;  1XMQ K;  3RR7 A;  2P9K A;  4CJT A;  4O44 A;  1RT2 A;  3ZET A;  3OYG A;  1DTT A;  3SCX A;  2FBT A;  5EOY A;  4GY2 B;  2OPS A;  3C6A A;  4CJ4 A;  4JI0 K;  3P31 A;  3TAM A;  2AEH A;  2UYT A;  1RTH A;  2OYQ A;  1BG3 A;  1H4R A;  1D5A A;  2JWK A;  3C6T A;  2XRI A;  4JEP A;  1VQ4 N;  2W6K A;  4DU3 A;  4KB0 A;  3UKU B;  1DLO A;  3OYM A;  5GIP A;  1NNE A;  3MED A;  4IWV A;  3KHY A;  4BRO A;  1A5V A;  4C8L A;  2V51 B;  5AQF A;  4WF9 L;  3FR0 A;  3QLH A;  3WNF A;  4GXB A;  3HK2 A;  3OYC A;  2DFF A;  4CZJ A;  3NF9 A;  3TAB A;  5CE3 A;  1EO1 A;  3OS0 A;  4CFC A;  4BDZ A;  1LWE A;  3DRR A;  3BIN A;  4OLB A;  1KC7 A;  3OYL A;  3FZF A;  3SYZ A;  3LM2 A;  1N6Q A;  1MIX A;  1BHL A;  4ELU A;  3C65 A;  4CJV A;  3NE6 A;  5BN9 A;  3EZW A;  1WBD A;  3MAQ A;  2Y1I A;  3S3M A;  1Y97 A;  3M6G A;  1Z6R A;  3SK3 A;  3T1Y K;  4KHU A;  4KTZ A;  1S9G A;  1CLQ A;  1BWF O;  4DTN A;  3DLG A;  1QVF M;  4N41 A;  3WXM B;  4CFD A;  4CCH A;  2G8V A;  4DV0 K;  3CC4 N;  4AM7 A;  4KPY A;  4W5T A;  4E7K A;  1VSH A;  3A5L C;  1RCH A;  2E4L A;  1HBK A;  1OVQ A;  3PO5 A;  4FPB A;  3V81 A;  1ZBF A;  5FRN A;  2O8C A;  4KHY A;  4A5B A;  1BI4 B;  4NY0 A;  4FXD A;  3T1A A;  3P39 A;  1SGH A;  4BY9 C;  3VTH A;  4OPK A;  4IG3 A;  3KWI A;  4DTO A;  4B3T K;  4FSV A;  1HX1 A;  2GUP A;  2E2P A;  4ICL A;  3VES A;  1VQ7 N;  4J2D A;  3HOS A;  4CEF A;  4GKK K;  3LPU A;  3P1G A;  2O8E B;  2YNH A;  4KAZ A;  4CF1 A;  3MEG A;  2RF2 A;  4OLA A;  1EWR A;  2WON A;  2ETJ A;  4IFE A;  2A1R A;  1HQE A;  4RW6 A;  2GX9 A;  2EHG A;  3NAE A;  1Q86 O;  1D9F A;  3ZSY A;  1N36 K;  3L2U A;  1TK0 A;  2PYJ A;  4BG8 A;  1KAY A;  1NG9 A;  1DGK N;  4FWS A;  4CVN E;  3VQB A;  5JVL A;  1HUX A;  5ELZ A;  4DSI A;  4B1W B;  1VRT A;  3THY A;  1CZA N;  3VOV A;  3HVR A;  1OH7 A;  5AJ3 K;  4DFP A;  2QWL A;  4OPA A;  5KRS A;  4H5W A;  4O55 A;  2E8A A;  4FO0 A;  3THW A;  3VQQ A;  4M3T A;  4CJ7 A;  3HSC A;  3V9S A;  1BIZ A;  3EO3 A;  4DV7 K;  3AO2 A;  3K5M A;  3U3Y A;  4A57 A;  3T3F A;  2VWK A;  2HHT A;  3L6Q A;  4JI8 K;  2X6N A;  1GLD G;  4JNE A;  4M42 A;  3ZX3 A;  3ULE B;  1MIZ B;  4H4M A;  4KB1 A;  4XIU A;  4FK2 A;  3M5R A;  1U2V A;  3I8D A;  4DQI A;  3MK6 A;  3CCU N;  1KLN A;  3ZSR A;  2QK9 A;  3CYM A;  4ID5 A;  3MWT A;  3UKR A;  3O3G A;  5CR4 A;  3I0S A;  3CJA A;  3QIO A;  4B8A B;  4JYA K;  5AFU H;  4JKF A;  2XHB A;  5AQT A;  3HP9 A;  3VQE A;  1NK4 A;  2YNG A;  4BDY A;  5C42 A;  5B8H A;  1RDW X;  3SJJ A;  2CGK A;  2A5X A;  2FBY A;  3HPG A;  2OCE A;  2ZWH A;  1QSY A;  2W41 A;  3IMX A;  4F3O A;  4DQR A;  4DG1 A;  3SNN A;  3MCA B;  3J7Z O;  3F9M A;  3VEV A;  1BQM A;  3RMC A;  3S9H A;  1TL3 A;  2E6M A;  2GWK A;  2VWJ A;  1TYQ B;  5FPN A;  4JKD A;  2Y1J A;  1TKD A;  1DT9 A;  2CGL A;  3SUN A;  5AZJ A;  4A59 A;  3SQ4 A;  4DQS A;  4KBO A;  4M3X A;  1IBL K;  2YKM A;  4KRF A;  3QO9 A;  3CFO A;  2KHO A;  3D45 A;  2QA4 N;  2HW3 A;  4CJK A;  4AIL C;  3ITH A;  4UQG A;  1NK5 A;  1MA9 B;  3GOI A;  4BC2 A;  4YOU A;  3T1H K;  3AGK A;  3V6D A;  1ILY A;  3EEQ A;  3VET A;  4B9S A;  1VSK A;  4DSL A;  3CCV N;  1Z25 A;  3H08 A;  3JS6 A;  3DRS A;  3K5O A;  3NVM A;  2Z1I A;  2GUI A;  4JRQ A;  4H0Y B;  3U6F A;  3AVI A;  2PFU A;  4XH5 A;  5HBM A;  2D5R A;  2WUS A;  5ADX H;  1TVR A;  3LDP A;  4G1Q A;  4JN4 A;  4GVM A;  1HPM A;  4M3W A;  1KQS M;  4DS4 A;  3SLC A;  3LP0 A;  1IBM K;  3RRG A;  3DAW A;  1NGI A;  3JAM O;  3QDK A;  4FJ8 A;  1VQ9 N;  1NJY A;  3BP8 A;  4BRH A;  5C12 A;  3TTF A;  3VF6 A;  2UU9 K;  2P9I A;  5BRD A;  3SZ2 A;  2ZPY A;  3ZT2 A;  4JRP A;  1KXP A;  3KKS A;  1P90 A;  4NB4 A;  1TAU A;  1RDC A;  3MMV A;  3RSE A;  1KTQ A;  3CQ8 A;  5AQY A;  5C25 A;  3CHW A;  2FF3 B;  4E7H A;  3T19 A;  1Y19 B;  1Q7Y O;  4JS4 A;  5CY4 A;  3TR8 A;  3VQA A;  4X62 K;  2VQF K;  1QZ5 A;  3A8Y A;  1X3N A;  3SAF A;  1K73 O;  1VSE A;  2YX6 A;  3HOT A;  1IKY A;  4YY3 K;  4MDA A;  3ENO A;  4GV3 A;  1GGO A;  2EMS A;  2P9N A;  4HCC A;  1G99 A;  2P9L B;  1T8E A;  3OYI A;  4QCL A;  2F96 A;  4RTF D;  4N47 A;  4J8F A;  1HB8 A;  2KTQ A;  3VQ4 A;  1NGG A;  2QKK A;  4FWK A;  4ILG B;  3VQD A;  4H4O A;  2W40 A;  5KRT A;  5GIO A;  4JKG A;  5JVH L;  1B92 A;  4YL8 A;  1BU6 O;  3KK2 A;  3VGK A;  4DLE A;  4KO0 A;  3QEW A;  3SPY A;  5AQV A;  5KTQ A;  1EWQ A;  5AQM A;  4ISF A;  1HJR A;  1RDB A;  2CQU A;  1XNQ K;  1TKZ A;  4DU4 A;  1IJJ A;  1VQM N;  2G8W A;  1WUA A;  1KCF A;  3PUF A;  1BDG A;  3LAN A;  1RDD A;  2IAJ A;  2PY5 A;  4CHQ A;  2B4J A;  1ATS A;  3LP1 A;  2KLA A;  2V52 B;  2O8F B;  3CXC M;  1ZYQ A;  4C1N I;  2ZM6 K;  3J7Y P;  3VQP A;  2YKN A;  4FM1 A;  4CZE A;  4DSJ A;  3V4I A;  3SJH A;  4IOX A;  1QSS A;  3Q7C A;  2A40 A;  2KZM A;  2ABD A;  1ACA A;  3CFP A;  5KPT A;  2PYL A;  2ASO A;  4AHC A;  2I1J A;  4NCB A;  2WTU A;  3HT3 A;  1S1T A;  2XY6 A;  2Z1G A;  4BG9 A;  2O4I A;  3G0Z A;  4A5A A;  1HKC A;  2D4W A;  2P9P A;  3OS1 A;  5J2N A;  3HRG A;  4WE1 A;  1NMD A;  1VBG A;  2W42 A;  1GOC A;  4BAC A;  2HB5 A;  2IOC A;  3VEO A;  3F2K A;  4IDH A;  2YV0 X;  3U9D A;  3T69 A;  1C0T A;  1WSI A;  1RBV A;  1U47 A;  4WCE L;  4CZH A;  3EKS A;  1EET A;  2UXB K;  4PA1 A;  1T6C A;  4WFN L;  1HNI A;  3MEC A;  4KHP K;  1TL1 A;  2QWO A;  3NFA A;  1RT3 A;  1WAJ A;  3T7Z A;  5AQR A;  4FJ5 A;  3FGU A;  4PL7 A;  4B1V A;  2P9U B;  5JS1 A;  5C2D A;  3LDQ A;  1T3V A;  1XI1 A;  2ZQB A;  4WQ5 A;  1FXX A;  3UIQ A;  1J19 A;  1NGB A;  4J2E A;  3NMU A;  4U7B A;  3FFI A;  3KJV A;  3ATV A;  2P9K B;  1VQ5 N;  3L4Q A;  2H3G X;  4ZTF A;  3F9K A;  4LH4 A;  3PIO L;  3AVN A;  3HZ6 A;  1V4T A;  2FF6 A;  2WC9 A;  4CJQ A;  1YJW N;  3OYB A;  2Q2R A;  3AA4 A;  3F5T A;  1XC9 A;  3BF1 A;  2G8K A;  1KRP A;  2NRT A;  4F4K A;  4A62 A;  1EP4 A;  3JYT A;  1OVY A;  3VQ8 A;  4B3R K;  1RNH A;  4DFM A;  1FW6 A;  2AJQ A;  3WEE B;  2HVH A;  4HTL A;  4QS7 A;  1EF1 A;  4HVJ A;  3DLL L;  1JCF A;  1J53 A;  1JLF A;  4H5V A;  3EY1 A;  3VEZ A;  5BPN A;  3O9R A;  2QXL A;  2X6S A;  4FPA A;  5JS2 A;  3MN6 A;  3O4W A;  3EYZ A;  1SV5 A;  1GLJ O;  3DOK A;  3CET A;  2QTD A;  1NK6 A;  2OAN A;  4FJX A;  1YVU A;  2ZJP L;  3O4N A;  4CBW A;  4KHQ A;  4F8R A;  3NF6 A;  3DXK B;  3TTC A;  1VBH A;  1BA0 A;  2ITG A;  3VQ6 A;  1E5W A;  3LAM A;  2J0J A;  3VEY A;  5EU7 A;  1HNV A;  3JSM A;  4DU1 A;  4CF8 A;  1FK9 A;  2RKI A;  4FL9 A;  3W3D A;  4BRA A;  1NK7 A;  4BDP A;  5C15 A;  2Q3S A;  2D0B A;  4LF9 K;  3HTV A;  3SQ2 A;  4AHS A;  4NYN A;  4XH1 A;  4WQ5 C;  4JK9 A;  4DR5 K;  2O8C B;  3AVM A;  4O0J A;  4PL8 A;  3M1F A;  3QET A;  3VA0 A;  1NGJ A;  3PSF A;  4KFB A;  3TAF A;  3CQX A;  3QEX A;  1K8A O;  1X9J A;  2HRJ A;  2QWR A;  4BWM A;  4CD3 A;  1BIU A;  4FVM A;  2D10 A;  4CJE A;  4MO5 A;  3THX B;  3PX0 A;  3DM2 A;  4CZI A;  4NCG A;  1O1W A;  2YNF A;  3H3N O;  5TKY A;  4IJN A;  3NH2 A;  3A0I X;  1NOY A;  4M7X A;  3OW2 M;  4F2S A;  4FOI A;  1VSJ A;  4PWD A;  2HNZ A;  2A6A A;  1N33 K;  4DTS A;  2QEX N;  4H5T A;  4WQ4 A;  4FLZ A;  4CJL A;  5FDL A;  3NGI A;  4FYD A;  3C6H A;  3LZI A;  4E7I A;  3ZT1 A;  4LF4 K;  3LDL A;  3QES A;  4DKW A;  4MQ3 A;  1WSF A;  2F9T A;  1S1V A;  3H6E A;  1UA0 A;  1SZ2 A;  4GNI A;  3I55 N;  4I2P A;  5EXW A;  2GEL A;  1HNW K;  3THY B;  3RWU A;  1ATN A;  4KH6 A;  4I9L A;  3ZSZ A;  3Q7B A;  1KSP A;  3I8B A;  1X9M A;  4AQY K;  3FLV A;  5I42 A;  4MLH A;  4RW4 A;  1BCO A;  2RHK A;  3O80 A;  5AQP A;  4HHT A;  3QIN A;  3THW B;  4Z4H A;  4B9M A;  5AQI A;  4LD0 A;  1VQ8 N;  1NM1 A;  4YOY A;  4XEI A;  4I2Q A;  5GAH P;  1QZ6 A;  1C6V A;  2V7Z A;  1HR0 K;  2RQ1 A;  2YCH A;  1QQN A;  5GIN A;  2FSN A;  2OPQ A;  4OGE A;  1DEJ A;  5M1N A;  3D2E A;  1NJI O;  2NRH A;  4DCH A;  3SI6 A;  4K8X A;  3HM8 A;  1Q82 O;  4ELT A;  4ZHR A;  1RGI A;  4BR2 A;  3ZT3 A;  2P51 A;  4GKJ K;  4CGI A;  1R0A A;  5FRO A;  4B1X B;  2E1Y A;  4DV2 K;  4BR9 A;  4PHT X;  3MXI A;  1JDE A;  5TKW A;  4G9Z A;  1M1K O;  4IZ9 A;  1Q18 A;  4CJR A;  4O0I A;  1HQU A;  4TKN A;  2E88 A;  4WQ4 C;  4BRK A;  1Q81 O;  4KV8 A;  1RDU A;  1ASV A;  1HYZ A;  3AO5 A;  4BRC A;  3CMA N;  1P8Z A;  4H03 B;  1RBR A;  3QER A;  1K8K B;  4FWL A;  2OZM A;  2E2Q A;  2HHU A;  5AZJ B;  4CZF A;  4DTJ A;  1L3V A;  5KGX A;  4CGF A;  3G6E N;  1D8Y A;  3P83 D;  3LM9 A;  1RBU A;  1T7P A;  1FJG K;  4JI6 K;  3J81 O;  3I56 N;  4DF8 A;  1VK0 A;  3DLB A;  4OPJ A;  3SAH A;  4AHU A;  1LWC A;  4B9Q A;  1HYV A;  5FPD A;  2E1Z A;  4B9T A;  4HTU A;  1NJX A;  1SAZ A;  3DJC A;  1BQN A;  4IFV A;  3P38 A;  3CCE N;  3PZD A;  3QIC A;  4DV1 K;  4CED A;  2X74 A;  4YOR A;  4H5R A;  4DTP A;  1S1W A;  3AVJ A;  1X1P A;  3ID6 A;  3P5J A;  3CER A;  3A5O C;  2CH5 A;  3M8Q A;  2BDP A;  4CIG A;  2HMP A;  5F1X A;  4DLG A;  3CC2 N;  4N76 A;  2E2N A;  5HRN A;  3KLG A;  3SQ0 A;  5AQK A;  4LSN A;  3O9Q A;  3PY8 A;  4DTR A;  4ZRI A;  4IOA L;  1KVC A;  1GLB G;  3E9L A;  4DV3 K;  1ST7 A;  4RCH A;  3S3O A;  1QHA A;  4PQU A;  3HST B;  4H5N A;  5AZI A;  3VF4 A;  1TUU A;  3VMF B;  4BE0 A;  1W9H A;  5M1O A;  4E7L A;  3H46 O;  4BR7 A;  3VTI A;  4E19 A;  3MX5 A;  3ZDT A;  3B6P A;  3IVF A;  1BGX T;  4KKO A;  1NKE A;  3HP6 A;  4C8N A;  4WFB L;  2NRX A;  2HST A;  4BRG A;  2O8D A;  1U45 A;  2R82 A;  2Z1H A;  3SBT A;  4YFU A;  3VEW A;  1BUP A;  3CCM N;  5SWM A;  2YVC A;  2I1K A;  4M3U A;  2FXU A;  1TK8 A;  2HHH K;  3KD5 E;  2PAV A;  3CQY A;  2FDQ A;  1XNR K;  1NWK A;  4LFC K;  5JLF A;  1MK7 B;  4DF4 A;  2QI2 A;  4HUE A;  2DPN A;  5MLC Q;  2XO7 A;  2UUA K;  2AL6 A;  1I94 K;  4FJM A;  4OO1 J;  4FM0 A;  5FRM A;  4CHZ A;  3EZ5 A;  1TGO A;  1IKV A;  3SV3 A;  3MN5 A;  3BDP A;  2EWS A;  2YJE A;  2E2O A;  2P9N B;  3R1X A;  1QE1 A;  4FJJ A;  3J8A A;  2Q0U A;  3UKU A;  3FP5 A;  3IFR A;  1BCM A;  3QFP A;  3HO1 A;  3DLH A;  3H1V X;  4B3M K;  4PKI A;  2ATQ A;  4HWI A;  3VQ9 A;  4FK0 A;  4W5Q A;  2HHW A;  4Q0B A;  1TK5 A;  4FWN A;  1VQK N;  1QSL A;  1GLA G;  4JKG B;  1KBL A;  1KD1 O;  2HF4 A;  1ASW A;  3L2Q A;  4CHO A;  4FWO A;  3E9P A;  1VQ6 N;  3AU5 A;  4JHD B;  4EHT A;  4I6M A;  3U8X A;  4UY8 O;  1UAX A;  1SKS A;  3OVN A;  3NCI A;  3NF7 A;  4DFJ A;  4N5S A;  3SUP A;  4K43 A;  4LF5 K;  3IRX A;  4JI4 K;  1W7A A;  1ZBH A;  2B5J A;  4H0X B;  5KPZ A;  4CF0 A;  5E84 A;  3DOL A;  3LL3 A;  1B9D A;  1YVN A;  3FLC O;  3AVA A;  3GDQ A;  2F8T A;  4OKE A;  4B3S K;  3CIP A;  1L3U A;  2P5O A;  3OBW A;  5AQG A;  5KQ8 A;  4B1Z A;  3TSQ A;  5D3G A;  2F7T A;  4IJA A;  2OA8 A;  3QML A;  4JD2 B;  1BO5 O;  4KHN A;  3M3Z A;  1VQP N;  3I33 A;  1QTM A;  5LMU K;  3CI5 A;  3ZT4 A;  2P9P B;  1VHX A;  4CI6 A;  1SUQ A;  1T6D A;  4GW6 A;  1JCE A;  3RR8 A;  2DIK A;  1TUY A;  3ENB A;  5GAE P;  5AQZ A;  1IBK K;  4EKU A;  3VGM A;  3VQ7 A;  4Z4E A;  1YAG A;  4R79 A;  1F21 A;  3PSI A;  1MK9 B;  2NZT A;  3WUH A;  2HHS A;  2O8E A;  4ILJ A;  4FJ9 A;  5IT9 O;  2WBN A;  4JS5 A;  1WSE A;  3QIP A;  3G71 N;  4FJK A;  1XWL A;  3R9P A;  3WQU A;  1RTD A;  5T7B A;  4F7G A;  1LAV A;  3KK3 A;  1W97 L;  2GV9 A;  2FBX A;  3NF8 A;  4O5B A;  3SMP A;  3OYE A;  4GV6 A;  1HMV A;  2E5L K;  2D0C A;  1ASU A;  3E9O A;  2HMI A;  3ZEU A;  4KH5 A;  2CB8 A;  4FCY A;  3TWH A;  1NOZ A;  3RMA A;  1ZXO A;  3I0R A;  1NK0 A;  4ZRK A;  4FLW A;  1KFD A;  4FLV A;  1S1X A;  1J5E K;  5AR0 A;  4QS9 A;  4RW7 A;  3ATU A;  1NJW A;  2GWJ A;  1UOC A;  4FW1 A;  1X3M A;  5DK5 A;  2G8I A;  3M8P A;  4CBU A;  1YIJ N;  4QOZ B;  4O8U A;  5I3U A;  1GLC G;  1Z05 A;  1L5U A;  3ZSO A;  5HLF A;  1WSH A;  2IDO A;  3H3O B;  2E6L A;  4CEQ A;  3HXM A;  3V1R A;  2HBJ A;  1DKG D;  4EIA A;  4CIF A;  2KZZ A;  5C2F A;  1JKH A;  3CFR A;  1N5Y A;  4OPH A;  1WAF A;  3KK7 A;  3CPE A;  3R6M A;  3LWM A;  3WNG A;  3OJU A;  4YDU A;  2ZJR L;  2ZF5 O;  3K5N A;  5J2P A;  1R59 O;  2RE2 A;  3V1O A;  4WFA L;  4YOT A;  3SUO A;  1NK9 A;  1G15 A;  5H1S Q;  4BWJ A;  1BA1 A;  2LBB A;  1IKX A;  4DSF A;  3CCL N;  1T03 A;  4DHY A;  2OPP A;  4PUO A;  3V9W A;  4DQP A;  4CGJ A;  4CK1 A;  4DTX A;  4RWT A;  2OTL N;  4CJP A;  1TYQ A;  3K57 A;  3MXM A;  2YI1 A;  1ATR A;  1GLL O;  4ISE A;  3D2F B;  4KI6 A;  4CHY A;  3CJ7 A;  2J4R A;  4JI7 K;  4NCA A;  4FJH A;  2WOM A;  4OX9 K;  1YTU A;  4CEZ A;  3E01 A;  4DV5 K;  3DLK A;  2HND A;  3FZK A;  3ZYY X;  5AQN A;  5IWA K;  5J2M A;  1MU2 A;  1S9E A;  3AAQ A;  3OYD A;  4WYB A;  3LAL A;  3HBT A;  1HNZ K;  4Z4I A;  4JI3 K;  2XY8 A;  1ZC6 A;  2ZJQ L;  4IO8 A;  2BGG A;  3N4Q A;  5A2Q O;  2Q1N A;  3F73 A;  4BC5 A;  3OYJ A;  4CIE A;  2G8U A;  4CES A;  3WA0 A;  2A42 A;  1LCU A;  2NUB A;  4IO9 L;  1S22 A;  5CZ1 A;  3L8B A;  3QNN A;  3SPZ A;  4FZY A;  3ZX0 A;  4E89 A;  3UE5 A;  3SV4 A;  3CM5 A;  4DQQ A;  3VF2 A;  2A3Z A;  4BVP A;  4BR0 A;  4FLX A;  1IG8 A;  4DV6 K;  4AH9 A;  2KFZ A;  3AVG A;  3AO4 A;  3C7N A;  4FWR A;  3ZET B;  3L2R A;  2NRZ A;  3UB5 A;  2QKB A;  1VSM A;  4YDU C;  1XHZ A;  3ZSW A;  3HI0 A;  1JLE A;  1MWM A;  2F8S A;  3AO3 A;  1NBW A;  4ELV A;  4FWQ A;  4DSE A;  2HNY A;  1A5X A;  3KZB A;  4MFB A;  4C8M A;  3C95 A;  3V9X A;  3P4I A;  5J1E A;  4KHW A;  3C0B A;  3A5N C;  1IV0 A;  3AVK A;  2IVO A;  3HYF A;  4EFH A;  4FJL A;  5JMV A;  4NLC A;  3MN7 A;  3U4L A;  4CF2 A;  1LOT B;  1MDU B;  1HRH A;  4XH4 A;  2HHQ A;  4BR5 A;  4IFY A;  4MLE A;  1S6P A;  4DR7 K;  1YXQ A;  2J0M A;  3RMB A;  4BE1 A;  2IIR A;  4HDO A;  4LC9 B;  4FLY A;  3CJ9 A;  4M45 A;  1FKO A;  5CYQ A;  4JAX A;  4HDQ A;  3B6O A;  1WB9 A;  1U6Z A;  5KQD A;  3AA5 X;  1S72 N;  2Q31 A;  2VG7 A;  4CZK A;  5DM7 L;  4Z4F A;  2F4V K;  3TAP A;  5C0Y A;  3CPW M;  1WN7 A;  2HBM A;  2VG5 A;  1W0H A;  4MDB A;  3QBW A;  4BRL A;  1NGD A;  3ENH A;  1QS4 A;  3VEN A;  3B8A X;  3EE9 A;  1Y64 A;  4IBN A;  4K25 A;  1I39 A;  5AFU A;  4H0O A;  2EX3 A;  2YNI A;  3J80 O;  3K5L A;  4BQL A;  3MN9 A;  1NGE A;  1LW0 A;  5BRH A;  3SAG A;  2HVI A;  4ZRJ A;  3VPZ A;  2GEM A;  1JLB A;  5GAG P;  4X65 K;  3HM9 A;  3CCS N;  2VYP A;  4CJF A;  1GOB A;  3L3V A;  3O3F A;  2O8F A;  4IXC A;  5AQH A;  4N56 A;  4FLT A;  1K9M O;  2HE7 A;  1ZBL A;  1L3S A;  3NBP A;  4JK7 A;  3L2V A;  2BTF A;  4CFA A;  1C1B A;  3AVB A;  5LMN K;  4K0K K;  4AM6 A;  4B3O A;  2YHA A;  3AAR A;  3AAP A;  3U9Z A;  3WT0 A;  3AVL A;  2UXC K;  3EN9 A;  1GC6 A;  4Z94 A;  4CEE A;  3L4I A;  2QWQ A;  3KLE A;  2OZS A;  3U8Z A;  1Q9X A;  1NI2 A;  4IOC L;  3VER A;  1JLC A;  2CGJ A;  4B9N A;  4ILH A;  3QEV A;  2HF3 A;  3RMD A;  2P1J A;  4M63 C;  3BF3 A;  4O8K A;  2HBK A;  3O8M A;  4BRE A;  3AVC A;  4CZG A;  4LF8 K;  4EAH D;  1LV5 A;  1BL3 A;  4P7I A;  1NK8 A;  3CCQ N;  3GBT A;  2KW4 A;  3ZSX A;  2O8D B;  3ISN C;  3SQ1 A;  1W2B M;  3IS9 A;  2QW9 A;  5ADX A;  2X78 A;  4OKJ A;  3OYK A;  1VSL A;  2ASP A;  3A2F A;  2YHW A;  4B9L A;  4DSK A;  2G8F A;  1HKB A;  2YJF A;  4O5F A;  3IG1 A;  3H45 C;  2J0K A;  2D1K A;  2KKZ A;  4CFB A;  4DR2 K;  5HRP A;  1U2V B;  1H1V A;  2X0S A;  2NLX A;  3LP2 A;  2JWL A;  5KPR A;  4CEO A;  3L0Q A;  1X9S A;  4B9U A;  5EY4 A;  3UKR B;  2WH5 A;  2P9S A;  3CJC A;  1T05 A;  3CM6 A;  4JKB A;  4DTU A;  4CGG A;  1S5J A;  1C0U A;  2QWM A;  3PO4 A;  1YIT N;  4I9Q A;  2PBD A;  3K58 A;  1J54 A;  3CME N;  1J9A A;  4FW2 A;  3RRH A;  2HHX A;  2O8B A;  5GAD P;  3WEE A;  3OYF A;  4BC3 A;  3K9J A;  3LAK A;  4CEB A;  3THV A;  2ZE2 A;  3DI6 A;  4KTW A;  5BPL A;  1TKX A;  2FSK A;  5FLX O;  4E1J A;  3NGZ A;  4FZX C;  1T44 A;  4F3T A;  2XY7 A;  2IC3 A;  1E4F T;  1NLV A;  3NDK A;  3R8E A;  3IUC A;  4QAG A;  2XY5 A;  1RT6 A;  4AHV A;  1DIK A;  4I6M B;  5HRO A;  3O1B A;  4NO7 A;  2IVP A;  4GV9 A;  3O08 A;  4R5P A;  4RW8 A;  1RFQ A;  2KFN A;  1CZ9 A;  3GE1 A;  2ZGZ A;  3DXK A;  4BQZ A;  2COP A;  2VCP A;  4H8K A;  4QS8 A;  1SKR A;  3U3G A;  3ZSV A;  4NLB A;  3H1Q A;  3KLI A;  1EXQ A;  5AQJ A;  4J2B A;  3MDQ A;  4CK2 A;  1ITG A;  4DUZ K;  4CW7 B;  5C10 A;  1CXU A;  4B1Y B;  1JCG A;  4K42 A;  2I5J A;  3DMJ A;  3K9K A;  4DWI A;  2YHX A;  5FPE A;  1GC7 A;  1C0G A;  5JLH A;  2OTJ N;  4PY5 A;  4KTQ A;  1ISN A;  2ZGY A;  1EQY A;  4ZTJ A;  3FE1 A;  4B1U B;  3X23 A;  4JI1 K;  5AQO A;  4B8C A;  1VSF A;  1Q9Y A;  4W5O A;  3EE8 A;  4K8Z A;  5KI6 A;  3OJS A;  1LW2 A;  3EL2 A;  4DR3 K;  3J7A P;  1NVL A;  1IO2 A;  2D2Q A;  4Y0W A;  4E1N A;  3QNO A;  1N34 K;  3NVK A;  3THX A;  2YHY A;  1JJ2 M;  3M8S A;  2HBL A;  3TSP A;  2UXD K;  3D7E O;  1NMN A;  4CBX A;  3O9T A;  2KQ2 A;  1KAZ A;  4IEE A;  3OYA A;  3FFK B;  2A41 A;  1E3M A;  4BC4 A;  3IKM A;  4RW9 A;  1CZB A;  3DXM A;  3ZT0 A;  1S3X A;  2P9I B;  3ZEU B;  3CJ1 A;  4KHS A;  5F0X A;  3AO1 A;  3RSE B;  3O4Q A;  3WXJ A;  5M1F A;  1KFS A;  2NNW A;  1XMO K;  3V9Z A;  1U04 A;  5JVG L;  3O9U A;  4M3Z A;  3AA3 A;  3N4P A;  1I3A A;  3ULD A;  1VQO N;  2ITM A;  4CJ3 A;  2UUB K;  3VQ5 A;  1NTI A;  1QQC A;  4JKE A;  4EP4 A;  4CK3 A;  1OH6 A;  4Y1C A;  2HHV A;  4FZZ A;  2Z1J A;  2AA4 A;  3LWL A;  4A61 A;  2FJ9 A;  4B08 A;  2LSN A;  3R3L A;  4C23 A;  3K0S A;  3HJF A;  4E0D A;  3TAQ A;  3ZCM A;  3OHR A;  1JLA A;  4L3Q A;  3PLA A;  4DMN A;  5BPM A;  4FJI A;  3OA9 A;  3FZL A;  1WBB A;  3KK1 A;  1U4B A;  1HNX K;  5AQW A;  4FM2 A;  1KC8 O;  3A5M C;  1VSI A;  3TPQ A;  1GOA A;  2IS3 A;  2E20 A;  4CJW A;  4LF7 K;  2A1S A;  1NJZ A;  3KD1 E;  3V1Q A;  2VQE K;  5JIC A;  1GLF O;  3TAR A;  1QQM A;  3LPT A;  4M3R A;  3PX6 A;  3OYN A;  1JXE A;  4CEA A;  4CZL A;  4HUG A;  3PV8 A;  2OPR A;  4Z4C A;  4H0P A;  1YT3 A;  4OJR A;  5CZ2 A;  5DM6 L;  3VQC A;  5SZT A;  2I7P A;  1YTA A;  4JV5 K;  1LWF A;  2VG6 A;  1K8K A;  3QIJ A;  4EZ6 A;  3QFU A;  4F9O A;  1HB6 A;  4BRF A;  1U48 A;  1BIS A;  4W5R A;  1VQL N;  2ASM A;  3HL8 A;  4Y1D A;  5M1K A;  3L2W A;  1BI4 A;  4CF9 A;  1HPZ A;  3CCJ N;  3OY9 A;  2BE2 A;  5BRF A;  1HYS A;  4O4G A;  1K6Y A;  1O13 A;  3K2P A;  1RT1 A;  3O3H A;  3CJB A;  4E1M A;  2O4G A;  3OTO K;  2Q97 A;  4OGC A;  3WXL A;  2P5G A;  4EZ9 A;  1SL1 A;  3DLR A;  5HRS A;  3TU5 A;  4Z0U A;  4PKH A;  3VGL A;  1JLQ A;  4DTM A;  1C0F A;  4BRM A;  3EPY A;  2NRR A;  1NGA A;  4BE2 A;  4DXA B;  2Q0R A;  1UA1 A;  4IDK A;  4YOV A;  4CD1 A;  4JKA A;  1NGH A;  4PKG A;  4FWM A;  4NYF A;  5AQU A;  4YOX A;  2D11 A;  5CHI A;  5LJW A;  2DFE A;  2JGU A;  3EKU A;  1J5O A;  4AHT A;  1ZBS A;  4TSX A;  5J2Q A;  3TI0 A;  4BRD A;  2RPI A;  3VN5 A;  1SS6 A;  1N8R O;  3C7N B;  3QBX A;  3W0L A;  4YHH K;  3D0P A;  1C1C A;  4K41 A;  3FZM A;  3NH0 A;  2FLO A;  5EX5 A;  4CER A;  1WSJ A;  2GTD A;  1JXB A;  3CC7 N;  4OVL A;  3AA2 A;  2V7Y A;  2NRW A;  1NKB A;  1Q8I A;  3ZX2 A; 
#chains in the Genus database with same CATH homology
 1QZ6 A;  3KZB A;  3EO3 A;  3ID8 A;  2V7Z A;  2VGM A;  3P4I A;  3G4S N;  3C0B A;  2RQ1 A;  3A5N C;  3GL1 A;  3TTD A;  3WXK A;  4A57 A;  2IVO A;  2YCH A;  1QQN A;  4EFH A;  5GIN A;  2FSN A;  3L6Q A;  3WQT A;  1DEJ A;  4A2A A;  3MX2 A;  4NLC A;  1GLD G;  2D0P A;  3MN7 A;  4JNE A;  3ZX3 A;  5JMV A;  5M1N A;  1YJ9 N;  3D2E A;  3ULE B;  3U4L A;  1MIZ B;  2NRH A;  4DCH A;  1NJI O;  1LOT B;  1MDU B;  1VQN N;  3HM8 A;  3ULE A;  3E1Y A;  3M5R A;  4XH4 A;  1Q82 O;  1U2V A;  4DB3 A;  4BR5 A;  3KWG A;  3MK6 A;  3CCU N;  4MLE A;  4JK8 A;  1RGI A;  4U67 L;  4BR2 A;  3E66 A;  1YXQ A;  3MWT A;  2J0M A;  3UKR A;  2IIR A;  4HDO A;  4LC9 B;  4CYE A;  5CR4 A;  3CJ9 A;  3CJA A;  3JXU A;  4B1X B;  2E1Y A;  4JAX A;  4HDQ A;  4BR9 A;  5E26 A;  1YI2 N;  4PHT X;  5AFU H;  1JDE A;  5TKW A;  4JKF A;  5AQT A;  1U6Z A;  5KQD A;  1S72 N;  4G9Z A;  1M1K O;  2Q31 A;  4IZ9 A;  1Q18 A;  4CZK A;  1YJN N;  5DM7 L;  4TKN A;  2E88 A;  4WQ4 C;  4BRK A;  5B8H A;  1RDW X;  1OKJ A;  1Q81 O;  2CGK A;  5C0Y A;  2A5X A;  3CPW M;  4C1N K;  1RDU A;  3O9S A;  2ZWH A;  5BN8 A;  2W41 A;  2HBM A;  3IMX A;  4BRC A;  3CMA N;  4MDB A;  1P8Z A;  4H03 B;  3QBW A;  4BRL A;  3SBG A;  1NGD A;  3ENH A;  3MCA B;  3DWL A;  3J7Z O;  3VEN A;  3F9M A;  1K8K B;  3B8A X;  3EE9 A;  4FWL A;  3VEV A;  1M90 O;  2E2Q A;  1Y64 A;  3IDH A;  4K25 A;  3CCR N;  5AZJ B;  5AFU A;  2GWK A;  4H0O A;  4CZF A;  1TYQ B;  5FPN A;  4JKD A;  4JHD A;  4BQL A;  1DT9 A;  2CGL A;  3MN9 A;  4A2B A;  1NGE A;  5AZJ A;  5BRH A;  2I7N A;  4A59 A;  3LM9 A;  3SAG A;  4ZRJ A;  3VPZ A;  4ISG A;  1YUW A;  2GEM A;  4KBO A;  3I56 N;  3PVL A;  5GAG P;  3SAH A;  4B9Q A;  5FPD A;  2E1Z A;  3CCS N;  2KHO A;  3MWP A;  2VYP A;  4KH4 A;  2QA4 N;  1SAZ A;  3DJC A;  3PIP L;  3P38 A;  3CCE N;  3PZD A;  3QIC A;  3AGR A;  4IXC A;  3O1W A;  5AQH A;  4YOR A;  1K9M O;  1YF5 L;  2HE7 A;  4H5R A;  4JK7 A;  1MA9 B;  2BTF A;  3GOI A;  4BC2 A;  4YOU A;  3AGK A;  3ID6 A;  4AM6 A;  1ILY A;  3CER A;  3AAR A;  3A5O C;  3AAP A;  3U9Z A;  3WT0 A;  2CH5 A;  3EN9 A;  1KAX A;  1GC6 A;  3VET A;  2HMP A;  4Z94 A;  5F1X A;  1BOT O;  1MWK A;  2QWN A;  4JD2 A;  3CC2 N;  3CCV N;  3L4I A;  3FZH A;  2QWQ A;  2E2N A;  5AQK A;  2FSJ A;  1ESV A;  3JS6 A;  3NVM A;  3U8Z A;  3G9W A;  3O9Q A;  1NI2 A;  4IOC L;  3VER A;  5HL7 L;  4ZRI A;  2CGJ A;  2Q36 A;  4IOA L;  4H0Y B;  4ILH A;  2HF3 A;  1XQS C;  1VAZ A;  4CZM A;  1GLB G;  3E9L A;  2PFU A;  1ST7 A;  4XH5 A;  4BRQ A;  3CD6 N;  4M63 C;  4RCH A;  3BF3 A;  2VGN A;  4O8K A;  1QHA A;  2HBK A;  3O8M A;  3MCP A;  4BRE A;  2WUS A;  4CZG A;  5ADX H;  4EAH D;  1YHQ N;  3LDP A;  4H5N A;  5AZI A;  3S41 A;  1TUU A;  4JN4 A;  3VF4 A;  3VMF B;  4P7I A;  1HPM A;  5M1O A;  1QQO A;  1KQS M;  3H46 O;  4BR7 A;  3VTI A;  3MX5 A;  3ZDT A;  3RVC A;  3CCQ N;  3IVF A;  3SLC A;  2HOE A;  3GBT A;  5EVZ A;  3DAW A;  1NGI A;  4WFB L;  2NRX A;  2HST A;  3QDK A;  4BRG A;  1VQ9 N;  3BP8 A;  4BRH A;  1HKG A;  3BEX A;  5C12 A;  2R82 A;  3TTF A;  1W2B M;  4BVO A;  3VF6 A;  3SBT A;  4BGB A;  3VEW A;  3LDO A;  1V4S A;  2QW9 A;  1BUP A;  5ADX A;  3CCM N;  2P9I A;  2YVC A;  2ASP A;  2I1K A;  2YHW A;  5BRD A;  2ZPY A;  2FXU A;  1HKB A;  2YJF A;  4FOE A;  1KXP A;  4O5F A;  4NB4 A;  1P90 A;  2PAV A;  3D2E B;  4BRP A;  3O6W A;  3CQY A;  2FDQ A;  3MMV A;  3H45 C;  2J0K A;  2D1K A;  2KKZ A;  1NWK A;  3AY9 A;  4GVE A;  3RSE A;  5JLF A;  4YOW A;  1MK7 B;  5AQY A;  1U2V B;  2BUP A;  2QI2 A;  1H1V A;  3CHW A;  2X0S A;  2FF3 B;  3KVG A;  1Y19 B;  2DPN A;  2NLX A;  1Q7Y O;  2JWL A;  5KPR A;  5MLC Q;  2AL6 A;  2P9S B;  3L0Q A;  4OO1 J;  3AU4 A;  1NGC A;  5EY4 A;  3UKR B;  2WH5 A;  2P9S A;  3CJC A;  1QZ5 A;  3A8Y A;  1X3N A;  3MN5 A;  3SAF A;  2EWS A;  1K73 O;  1GLE G;  1D4X A;  2YX6 A;  4AF1 A;  3HOT A;  3CF5 L;  2YJE A;  4JKB A;  1E4G T;  2E2O A;  2P9N B;  3R1X A;  3J8A A;  3GG4 A;  4MDA A;  2Q0U A;  3ENO A;  3UKU A;  3FP5 A;  2BH1 A;  1GGO A;  3IFR A;  2QWM A;  4GV3 A;  2EMS A;  2P9N A;  1YIT N;  5AQS A;  1G99 A;  3QFP A;  2PBD A;  3H1V X;  3CME N;  2P9L B;  4PKI A;  3BUZ B;  1SQK A;  5GAD P;  3WEE A;  4HWI A;  5HOO A;  4BC3 A;  3K9J A;  2P9L A;  4JKH A;  4RTF D;  4H0T B;  4J8F A;  1HB8 A;  4FWN A;  5BPL A;  1VQK N;  1GLA G;  4JKG B;  1KBL A;  2FSK A;  2VWB A;  1NGG A;  1T44 A;  4FWK A;  4ILG B;  2HF4 A;  4E1J A;  5BRE A;  1KD1 O;  1E4F T;  1NLV A;  2W40 A;  5GIO A;  4JKG A;  3R8E A;  3IUC A;  5JVH L;  4FWO A;  4YL8 A;  3E9P A;  1BU6 O;  3VEX A;  1DIK A;  3VGK A;  5I9E B;  4I6M B;  5AQV A;  1VQ6 N;  3AU5 A;  3O1B A;  4NO7 A;  2IVP A;  4JHD B;  5AQM A;  4EHT A;  4ISF A;  5IJM A;  4I6M A;  5AQL A;  3U8X A;  1WOQ A;  4UY8 O;  4GV9 A;  3O08 A;  1NGF A;  2CQU A;  1RFQ A;  3GE1 A;  2ZGZ A;  3DXK A;  3QB0 A;  5F2R A;  4BQZ A;  2COP A;  4M7Y A;  1IJJ A;  2VCP A;  5M1Q A;  4QS8 A;  1VQM N;  2QWP A;  1WUA A;  4K43 A;  4NLB A;  1BDG A;  3H1Q A;  2D0O A;  1ATS A;  4H0X B;  2KLA A;  2V52 B;  5AQJ A;  5KPZ A;  5E84 A;  1QVG M;  3MDQ A;  5FPM A;  3CXC M;  4FVU A;  3LL3 A;  4C1N I;  1YVN A;  4B1Y B;  5C10 A;  1JCG A;  3FLC O;  4K42 A;  4EHU A;  1J6Z A;  3GDQ A;  4BRN A;  3CIP A;  3U7D A;  3OBW A;  4CZE A;  3K9K A;  5AQG A;  5KQ8 A;  2YHX A;  3SJH A;  4B1Z A;  5FPE A;  3TSQ A;  1GC7 A;  1C0G A;  4BR4 A;  4IOX A;  5JLH A;  2WFB A;  2OTJ N;  2F7T A;  3Q7C A;  4IJA A;  1ISN A;  2A40 A;  3QML A;  2ABD A;  1ACA A;  4JD2 B;  2ZGY A;  1HLU A;  1BO5 O;  2QM1 A;  5KPT A;  1EQY A;  3M3Z A;  2ASO A;  2I1J A;  1VQP N;  3I33 A;  3FE1 A;  4FWP A;  3CI5 A;  2P9P B;  3SMS A;  3D2F A;  4B1U B;  3X23 A;  4CI6 A;  4BG9 A;  1T6D A;  5AQO A;  3WXI A;  2EMT A;  5BR9 A;  4A5A A;  1HKC A;  4JKC A;  2D4W A;  2AP1 A;  2P9P A;  1JCE A;  3EE8 A;  5LY3 A;  3HRG A;  1NMD A;  2DIK A;  3EL2 A;  1VBG A;  1TUY A;  3ENB A;  5GAE P;  1NVL A;  3NVK A;  2D2Q A;  2IVN A;  3OBY A;  4Y0W A;  5AQZ A;  5AQQ A;  4BRI A;  2YHY A;  3VEO A;  5AQX A;  3F2K A;  4EKU A;  4IDH A;  3VGM A;  2CH6 A;  3U9D A;  1YAG A;  3T69 A;  4R79 A;  4MO4 A;  5AZI B;  1JJ2 M;  1MK9 B;  2NZT A;  2HBL A;  3WUH A;  3TSP A;  4WCE L;  4H0V B;  3D7E O;  4DQ8 A;  4CZH A;  3EKS A;  3D6R A;  5LJV A;  4CBX A;  4ILJ A;  1XC3 A;  3O9T A;  1T6C A;  4WFN L;  2WBN A;  1KAZ A;  3LDN A;  4IEE A;  3G71 N;  3R9P A;  1XUP O;  3FFK B;  2A41 A;  2QWO A;  3WQU A;  4BC4 A;  1HJO A;  4BGA A;  3DXM B;  4F7G A;  1W97 L;  3T7Z A;  5AQR A;  3IKM A;  3FGU A;  4PL7 A;  4B1V A;  2P9U B;  3DXM A;  5C2D A;  3LDQ A;  1S3X A;  3TSU A;  1T3V A;  3SMP A;  4GV6 A;  2P9I B;  3ZEU B;  3CJ1 A;  2P9U A;  4WQ5 A;  3O5B A;  3E9O A;  1J19 A;  1NGB A;  4IEI A;  3NMU A;  3ZEU A;  4KH5 A;  4U7B A;  3G25 A;  2F9W A;  3ATV A;  2CB8 A;  5M1P A;  5F0X A;  2P9K B;  2NRV A;  1VQ5 N;  3RSE B;  1GG3 A;  3L4Q A;  2H3G X;  3WXJ A;  1ZXO A;  2P9K A;  5M1F A;  2NNW A;  3PIO L;  3ZET A;  3HZ6 A;  5EOY A;  1V4T A;  4ZRK A;  2FF6 A;  2WC9 A;  4GY2 B;  3O9U A;  3C6A A;  5JVG L;  3P31 A;  2AEH A;  2UYT A;  1YJW N;  5AR0 A;  3N4P A;  1BG3 A;  4QS9 A;  1H4R A;  2JWK A;  2Q2R A;  4JEP A;  3F5T A;  1VQ4 N;  3BF1 A;  1VQO N;  2NRT A;  3ATU A;  2ITM A;  4A62 A;  2GWJ A;  3UKU B;  5GIP A;  1NTI A;  4JKE A;  4IWV A;  1X3M A;  3KHY A;  1OVY A;  4BRO A;  2V51 B;  5AQF A;  4WF9 L;  3WEE B;  2AA4 A;  3FR0 A;  4A61 A;  4GXB A;  4HTL A;  4CBU A;  4QS7 A;  2FJ9 A;  3R3L A;  4C23 A;  1EF1 A;  3DLL L;  4CZJ A;  1JCF A;  1YIJ N;  5CE3 A;  3OHR A;  4H5V A;  4O8U A;  4L3Q A;  3PLA A;  1EO1 A;  1GLC G;  1Z05 A;  5BPM A;  3OA9 A;  3FZL A;  3VEZ A;  5BPN A;  3O9R A;  5AQW A;  3BIN A;  2QXL A;  1KC8 O;  1KC7 A;  3A5M C;  3H3O B;  4FPA A;  3FZF A;  3MN6 A;  3TPQ A;  2E20 A;  3O4W A;  1GLJ O;  3CET A;  2HBJ A;  2QTD A;  2OAN A;  3LM2 A;  1MIX A;  1DKG D;  4EIA A;  5JIC A;  5C2F A;  2ZJP L;  1GLF O;  4CBW A;  3C65 A;  3TTC A;  3DXK B;  1VBH A;  4OPH A;  5BN9 A;  1BA0 A;  1QQM A;  3EZW A;  1E5W A;  3KK7 A;  3CPE A;  2J0J A;  3R6M A;  3VEY A;  3G6E N;  3M6G A;  1Z6R A;  4YDU A;  3SK3 A;  4CZL A;  4FL9 A;  3W3D A;  2ZJR L;  2ZF5 O;  4BRA A;  1R59 O;  4H0P A;  5C15 A;  2RE2 A;  1BWF O;  4WFA L;  1QVF M;  4YOT A;  3WXM B;  3HTV A;  5H1S Q;  5DM6 L;  1BA1 A;  2LBB A;  2I7P A;  3CC4 N;  4AM7 A;  3CCL N;  4XH1 A;  4DHY A;  1K8K A;  4JK9 A;  3QIJ A;  3A5L C;  4WQ5 C;  3QFU A;  4F9O A;  1HBK A;  4PL8 A;  1HB6 A;  3M1F A;  4BRF A;  4FPB A;  1NGJ A;  4RWT A;  1VQL N;  2OTL N;  1TYQ A;  2ASM A;  3CQX A;  4A5B A;  1K8A O;  1X9J A;  2HRJ A;  2YI1 A;  1ATR A;  1GLL O;  4ISE A;  5M1K A;  4NY0 A;  2QWR A;  4CD3 A;  3P39 A;  1SGH A;  3D2F B;  4BY9 C;  3CCJ N;  3VTH A;  3CJ7 A;  2J4R A;  5BRF A;  3KWI A;  2D10 A;  1O13 A;  4MO5 A;  3CJB A;  3FZK A;  4FSV A;  1HX1 A;  2Q97 A;  3ZYY X;  2GUP A;  5AQN A;  3WXL A;  4CZI A;  2E2P A;  3VES A;  1VQ7 N;  3AAQ A;  3TU5 A;  3HOS A;  4PKH A;  4WYB A;  3VGL A;  3HBT A;  1C0F A;  3H3N O;  5TKY A;  4IJN A;  4BRM A;  1ZC6 A;  3A0I X;  4IO8 A;  4M7X A;  3N4Q A;  3EPY A;  2Q1N A;  4FOI A;  2ZJQ L;  3OW2 M;  2A6A A;  2NRR A;  4BC5 A;  1NGA A;  2QEX N;  4H5T A;  4WQ4 A;  3WA0 A;  2A42 A;  4IFE A;  4DXA B;  1LCU A;  2GX9 A;  2Q0R A;  1Q86 O;  4YOV A;  4CD1 A;  4JKA A;  1NGH A;  3C6H A;  4PKG A;  4IO9 L;  1S22 A;  3LDL A;  4FWM A;  4DKW A;  2F9T A;  5AQU A;  3H6E A;  4BG8 A;  1KAY A;  4YOX A;  2D11 A;  3ZX0 A;  5CHI A;  5LJW A;  3UE5 A;  1SZ2 A;  3EKU A;  1DGK N;  3VF2 A;  4GNI A;  3I55 N;  2A3Z A;  1ZBS A;  2GEL A;  4FWS A;  5EXW A;  4BVP A;  4BR0 A;  5JVL A;  1ATN A;  1HUX A;  4KH6 A;  4BRD A;  3Q7B A;  1SS6 A;  5ELZ A;  1N8R O;  1IG8 A;  3I8B A;  3C7N B;  4B1W B;  3QBX A;  3W0L A;  1CZA N;  4K41 A;  3VOV A;  3FLV A;  4FWR A;  3C7N A;  3ZET B;  3FZM A;  4MLH A;  2NRZ A;  2QWL A;  2RHK A;  3O80 A;  4H5W A;  4OPA A;  2FLO A;  5AQP A;  3UB5 A;  4YDU C;  5EX5 A;  2GTD A;  2E8A A;  4FO0 A;  5AQI A;  3HI0 A;  3CC7 N;  1MWM A;  1VQ8 N;  1NM1 A;  1NBW A;  2V7Y A;  2NRW A;  4CJ7 A;  4YOY A;  3HSC A;  4FWQ A;  4XEI A;  5GAH P;  3ZX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...