4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
3E9OA 3E66A 4JKFA 4JK9A 4JKAA 3SBTA 4JK7A 4ILGB 4JKGA 4JKCA 4JKHA 4JKEA 3E9LA 4JKDA 3SBGA 4JK8A 3ENBA 4JKGB 4JKBA 3E9PA 4ILHA 4ILJA
chains in the Genus database with same CATH superfamily
4E7KA 5BN9A 3IAYA 1RDUA 4F2RA 2WTUA 4DR4K 2VG6A 3FLVA 4G1QA 4G9ZA 4ZHRA 3SMSA 2E5LK 3RVCA 4KV8A 3KIOA 3G25A 3VGLA 1SKSA 1RT3A 1QSSA 2JLEA 4KHPK 4N47A 2IOCA 4NB4A 4RG8A 4GY2B 4LFCK 2NRTA 2KFZA 3SJJA 4DV4K 3DLHA 2WC9A 4YOUA 5J2PA 2HB5A 2HNDA 2XHBA 1RT4A 4OPAA 3OYEA 4O44A 2G8IA 4FWOA 4DV6K 2X78A 2Z1JA 3H3NO 4JKFA 3LP1A 3PO5A 4BRGA 1BA0A 4BE2A 3K5MA 2KTQA 4NY0A 3DXMB 4M7XA 3L0QA 4J2AA 1S3XA 3E9LA 3NVMA 5LJWA 3NE6A 2KHOA 3W0LA 3CCJN 4EFHA 1WOQA 4WFBL 3OYIA 3AA3A 3L2RA 3HOTA 3OY9A 3QINA 5BR8K 4RTFD 1C0UA 1VSKA 1GC7A 4O5FA 3E66A 2YNGA 2OANA 4KH6A 3KK1A 3C6TA 1TAQA 1JLAA 4CZEA 3HRGA 1EKEA 3N4PA 3AVGA 3AAPA 4DTNA 1NVLA 3B6OA 3K2PA 1DGKN 4Z4FA 4CFDA 4IFVA 1EQYA 2B5JA 2UUAK 3CMEN 5AQJA 3HBTA 3HVRA 3NDKA 3AVHA 3ITHA 4BR4A 1NNEA 3AVFA 4FJ5A 3V1RA 2HW3A 4ICLA 1WBDA 4FZYA 2V7ZA 4AHSA 3SBTA 3ZSYA 4CJ7A 3P83D 4U7BA 3SPYA 1LWFA 5KGWA 4J2EA 2ASMA 4H0XB 3V4IA 4UQGA 4FLZA 4FLTA 4NLCA 2VCPA 4Z4GA 1HNWK 5SWMA 3RWUA 4W5RA 3CJBA 5M1FA 4CEEA 1TUYA 2FSKA 4DSLA 2D2QA 4PL7A 3FZMA 1BHLA 2HMPA 4YFUA 1GOCA 1MA9B 2Q31A 1HYZA 4KH4A 2QK9A 2FC0A 3VA3A 4A59A 1U4BA 4KB0A 2E2QA 2OTLN 2F7TA 4LSNA 4DUYK 3R3LA 3DOKA 3O6WA 2D0CA 3NGIA 2YCHA 4JI6K 4FM0A 3QEWA 3U3YA 4FJIA 1JLCA 3VQEA 2O8EB 3VEYA 4DLEA 3EZ5A 2BE2A 3CFOA 1RT2A 2DY4A 2R82A 5AQGA 4CJVA 5EX5A 4DV2K 3KTQA 1I94K 3FGUA 4AHRA 3L3VA 2X6NA 1K6YA 2O8BB 1BISA 3NH2A 4DTMA 4CEFA 2ZJQL 3O3FA 4IFYA 2P9NB 1NGCA 3E9PA 1JDEA 2KW4A 1IBKK 3H08A 3L2QA 1VQ4N 1IJJA 4CESA 3ZX0A 2Q2RA 2GUPA 4PKIA 3SZ2A 3FP5A 4AHVA 5T7BA 1NGJA 1FW6A 3BINA 4M45A 3TTDA 1TKZA 5DMRA 3ZSXA 1J5OA 2G8WA 4A5BA 2WBNA 2Z1GA 5LMNK 5LY3A 5I3UA 1Y64A 4C23A 4CGJA 2UYTA 4L3QA 3MK6A 2GBZA 2KZMA 3U6FA 1FXXA 3HP6A 4BC4A 2KQ2A 3TAEA 3UE5A 4F3TA 1SL2A 4W5OA 3SLCA 2ATQA 1ZBIA 1VAZA 4CF2A 2P1JA 3HL8A 3S9HA 2AEHA 1T3VA 3OW2M 2E20A 2HSTA 5C24A 2XY7A 4CJQA 3CCRN 5F0XA 3TANA 3VQ5A 4CZFA 3TI0A 3CFRA 1RT7A 1VQ5N 4B08A 1BOTO 3BGRA 4CJSA 4C8OA 5H1SQ 4CJUA 4GKKK 4MFBA 3DYAA 4I2PA 4KTQA 2ASPA 4CZMA 4DSKA 3ZETB 1VRTA 4QS7A 4FW2A 3QEVA 1NKBA 3IS9A 4H0YB 2X6SA 4CERA 3CCSN 1RBVA 4AH9A 2ETJA 2QI2A 4E7HA 4DV0K 4DQSA 3U9DA 1J54A 3JAMO 2HHUA 5AQXA 2QA4N 3OS0A 1DEJA 1NLVA 5BRHA 2UUCK 4B8AB 4AILC 2X74A 3THXB 4IO9L 1NK5A 1C6VA 5AQYA 5E41A 1TL1A 1X3NA 2Q1NA 1DTTA 3OJSA 3OYNA 2VYPA 3OA9A 1NGGA 1S1XA 1UWBA 4EHUA 1YJ9N 4JI1K 3PIOL 4B9VA 4B3TK 4ILGB 4DSFA 3EKUA 1NGIA 3CCEN 1SQKA 3O4NA 4E0DA 3I0SA 2YI1A 3D2FB 1GLDG 1RTDA 4M3WA 3O4QA 1HJOA 3AVAA 4BE0A 4BRLA 2ASOA 3CCQN 2KZZA 2V51B 3L2VA 4CECA 3V81A 4CGHA 3E01A 3MMVA 1U49A 1HNXK 3MAQA 2HHTA 3VQ7A 3J81O 4BG9A 1VQNN 3RMCA 3A5NC 3ULEA 3HK2A 5EVZA 4DCHA 4IDKA 3VQAA 4Y1CA 3VQBA 5J2QA 5SZTA 2I7PA 1U2VB 1QHAA 3RR7A 5LJVA 1GLLO 3THWB 2G8FA 3MXJA 4QS9A 2CB8A 3U8XA 4DS5A 1ATNA 3KVGA 4DFJA 5KGXA 1SKWA 4JKAA 4N76A 3O8MA 3AVCA 4CIFA 1IV0A 5C42A 4JKGA 4HCCA 4C8MA 3HM8A 3NF7A 3KK3A 4LFBK 3AO1A 1O1WA 1U47A 3F9MA 1IBMK 4O0JA 4KKOA 1IG9A 4JI5K 3MDQA 1T8EA 1WSEA 3PX4A 3SV3A 1U6ZA 4CK3A 4JKBA 3CC4N 2PZSA 4F4KA 5GAEP 2UU9K 2P9UB 4XEIA 3GDQA 5AQQA 2JWLA 2Q97A 4BWJA 4CK2A 4QCLA 4FWPA 2EHGA 1OVYA 4CJ4A 1BU6O 1GLAG 5GAHP 3UKUB 4RWTA 1OH8A 1Q18A 3AU4A 3HTVA 2YHXA 1QHTA 2IDOA 3ATVA 2DPNA 2XRIA 3ZSRA 1BL3A 1R59O 5CY4A 4CZKA 4FZXC 5C10A 4K25A 3SCXA 1EWQA 3SUNA 2VG7A 3LDOA 4M3XA 4CVNE 4A57A 3MEDA 2QM1A 1QQOA 3VN5A 2XO7A 3OBYA 1T6CA 4CZGA 4BRPA 1L3SA 2FSNA 1VQLN 1U48A 4FVMA 3P1GA 5GIPA 2YKNA 5CZ2A 3O9UA 3ZX2A 3T3FA 3GE1A 4U67L 1RBTA 2ZF5O 2O8CB 4Z4IA 3SUOA 3TAGA 3AAQA 2A1RA 4H0PA 4BGAA 4PKGA 4B9SA 1BCMA 1E4GT 3QB0A 2RKIA 3LWLA 4JYAK 1T44A 2EWSA 4BVPA 3OVNA 4GV3A 2D10A 1HPZA 4FWSA 5FROA 4CIEA 1CLQA 1W97L 4IWVA 3S3OA 4DR5K 4K8ZA 1Z25A 4MLEA 3AO2A 1KVAA 4KBOA 1ZBHA 1VQPN 4CGIA 1MIXA 3HT3A 5M1QA 3RMBA 3SUPA 1E3MA 4FK0A 4BRHA 3B8AX 4CGGA 1TV6A 3C7NB 4MDBA 3CCUN 4K8XA 1HBKA 2O4IA 1HMVA 4YDUA 1G15A 1XUPO 4H5VA 3Q7CA 3QNOA 1TUUA 2AA4A 4IBNA 2AP1A 4V19S 3O4WA 5AZIB 2ZQBA 3DRPA 3CJCA 4BR2A 3PO4A 1XQSC 2QXLA 2HVHA 3CIPA 3THYB 3BEXA 1RCHA 1NI2A 3BUZB 3MN9A 3FZLA 1QQNA 3CERA 5KPRA 3NMUA 1NGFA 1OVQA 1SV5A 5BRDA 4ELUA 1A5XA 3QERA 2HHWA 1JCFA 1IG8A 2A42A 4DU4A 3BF3A 3H1QA 1VSMA 4A62A 2FDQA 5AZJB 4YORA 3OYBA 3OYAA 4KHYA 4BC3A 2WUSA 4BDYA 1YUWA 4BR7A 1NGBA 4DR6K 4O8UA 4J2BA 1LAVA 1ZYQA 1QE1A 4JRPA 4JEPA 3OHRA 3LL3A 1Q7YO 3AVNA 4YOYA 5FLXO 3SI6A 1TVRA 1X9SA 4FJJA 2A1SA 1S1WA 3OYMA 4P7IA 5JICA 1TAUA 1XHZA 2HNZA 3VA0A 4WQ5A 2VG5A 3OYLA 1W9HA 2NRVA 1QZ5A 1RTIA 1BA1A 2IGIA 4EP4A 2KFNA 3E1YA 4I6MA 3T7ZA 4BRCA 4R5PA 2ZGZA 2JWKA 4Q5VA 4DTOA 3KKSA 2YV0X 3DMJA 4F9OA 1WSGA 3EE9A 2DTUA 4AQYK 3DLEA 3AGRA 2O8DB 3M5RA 4OPKA 1EXQA 3J7AP 5ADXH 4DWIA 1YF5L 3F9KA 3P39A 4FJXA 1N5YA 1W2BM 3PZDA 4QS8A 4CFAA 4H0VB 4HTLA 3K9JA 4CHPA 4JS4A 1TKTA 1OH7A 3OS2A 4NYNA 4MQ3A 2QWPA 3MX2A 4FZZA 3KWIA 4FJLA 1C0MA 4YDUC 1KD1O 2VQEK 1GLBG 4LD0A 3J8AA 1E4FT 4E1MA 4BREA 3RTVA 1T05A 1X9JA 1HYSA 4WFAL 3K0SA 3SYZA 3ZT2A 3CYMA 4K42A 4YY3K 4O4GA 1RDWX 3AO4A 3ZSVA 4CJKA 3CD6N 1K8KA 1TK8A 3K9KA 1FK9A 4FK2A 2QXFA 4DSIA 2P9KA 3C94A 2HRJA 1S9GA 3V9UA 4OJRA 3CJ1A 1WLJA 3LPTA 4DFKA 5FPEA 5CYQA 4CE9A 3SJHA 4CEOA 3CJAA 1IKXA 1KRPA 1NK6A 3V9WA 2WONA 4LC9B 4AHCA 1WSHA 3C6AA 1BIUA 1A5VA 3HO1A 3NHGA 2YNFA 4BQZA 3SQ0A 4AHTA 3VGMA 3DLRA 1LW2A 4CYEA 2DFFA 2UXBK 3ENOA 1D9DA 3VF6A 4MO4A 3VF4A 5E26A 1NGDA 1YITN 4IXCA 1VQKN 5HL7L 1C0TA 3M3ZA 5CZ1A 1XMQK 2FBXA 1YTUA 4FK4A 1ZXOA 4FSVA 4EKUA 4X62K 3BF1A 2VWBA 2OTJN 4H5NA 3O9QA 1YVUA 2NZTA 3AY9A 4OPJA 4FPBA 4BWMA 5HLFA 4OGCA 5TKYA 1JL2A 1SGHA 2QWMA 3D2EA 1EF1A 3CM6A 3WUHA 1VBHA 3OYGA 1JLBA 2D5RA 1NJXA 4FJ9A 4ZRKA 1OH6A 5C12A 4KREA 1H1VA 1V4SA 4H0TB 1YI2N 1D5AA 1ITGA 2P9IB 3P5JA 4FWRA 3S3MA 1RBRA 3X23A 3A8YA 3WEEB 5KPZA 4KRFA 1N34K 3V6DA 1C1AA 5AQZA 4ZTJA 5AQSA 4DFPA 4BC2A 3VOVA 1HB6A 3QIJA 3O1BA 3HSCA 4FJGA 4OO1J 4C8KA 3AO3A 4EAHD 1MK7B 3WT0A 3DWLA 4DU3A 3VTHA 1R0AA 3ZEUB 2GWKA 3O9SA 1JLEA 2P9PA 4KTWA 3VENA 1BG3A 4N56A 4JRQA 4Z4CA 2E1ZA 5DM6L 1QVGM 4CZHA 2YHYA 2GELA 3KJVA 1MIZB 4GVMA 3DXKA 3J7YP 1U04A 3G6EN 4WE1A 1TK0A 4RW9A 3FE1A 4I2QA 3OBWA 4DKWA 4IOCL 3LP2A 3VQDA 4GKJK 1GLEG 1ZBUA 1N32K 3S41A 4FJHA 3QETA 1XNQK 3U4LA 3WQTA 4OKEA 1KAXA 4OLAA 4BRIA 1NMNA 1MU2A 5F2RA 4FW1A 3SUQA 2ITGA 4B1UB 3K5LA 2VWJA 3HXMA 5BRFA 3I0RA 1HYVA 2F4VK 5AJ3K 1IKYA 1LCUA 3SPZA 2ZM6K 3KLFA 2ZGYA 4H0OA 4BRFA 4NCGA 1YJWN 4IOXA 1TYQB 3ZT0A 3RSEB 3R9PA 5HOOA 3HOSA 1S9EA 4AM7A 3QNNA 1FKPA 4JLHA 1J53A 4KO0A 2BTFA 3UIQA 2R7YA 3CQXA 1WAJA 4RW8A 1IKVA 5HRPA 4ELVA 2YX6A 4A2BA 2OPRA 1S72N 4DHYA 4ID1A 3SQ1A 3ENBA 1XNRK 2F8TA 4Z94A 2A41A 4CF1A 3PIPL 1NJYA 1K8AO 3CC2N 4CK1A 4KPYA 4FO0A 3TR8A 2GX9A 2O8FB 4A61A 1ZBFA 1NGAA 2I1KA 3LWMA 1NOYA 3A5LC 3DXMA 4NCAA 5JS2A 4CBUA 3IFRA 1WSJA 4XH4A 1HB8A 2IAJA 4OX9K 1XC3A 5C2FA 3M8RA 2RN2A 2RQ1A 3MEGA 3CPEA 3W3DA 4B1WB 4WCEL 3DLLL 1LOTB 5BN8A 1Q86O 1EP4A 4H4OA 3OYFA 4XH1A 2A3ZA 4ISEA 1J19A 1GLJO 3FR0A 4CCHA 4OPHA 2NRZA 3NF9A 4J8FA 5EU7A 1B9DA 1YXQA 2H3GX 3TAPA 3I8DA 1JLQA 3THVA 3AVMA 3ULDA 5KPTA 3TSUA 1NK9A 1VK0A 2AL6A 4CEZA 2A6AA 2Y1JA 4CBXA 2YNHA 1GG3A 4IG3A 4X66K 4DSJA 2CH5A 1HKCA 3G10A 4JI0K 1ZBLA 1SZ2A 3P4IA 3DAWA 3KK7A 4FLVA 4BROA 3UKRB 4KAZA 3G4SN 4ZRIA 1CXQA 4E3SA 5GAGP 5M1OA 2W40A 2LBBA 5KTQA 1JKHA 2HF4A 3TARA 4OGEA 4IKFA 2XY8A 1DLOA 1EETA 2ZE2A 4LF7K 1VSHA 2OPSA 3MWPA 3G0ZA 2QWOA 4KI6A 3L3UA 3KKRA 1LWCA 2HBJA 4BR0A 2IVNA 1MK9B 4FOEA 1GC6A 2QWRA 4C8NA 3GBTA 3QEXA 3QIPA 1I3AA 3RRGA 3FFKB 4DSEA 4CW7B 5I42A 5BR9A 2O8EA 1WNSA 3WNFA 4CHQA 4QOZB 5B8HA 1N33K 1HLUA 4CJ5A 2QKBA 3PLAA 3MEEA 4DLGA 4CFBA 4DR3K 2E2PA 2O8BA 4E1NA 3PSIA 2ZJRL 4YOWA 3IVFA 1NK0A 2P9NA 3LM2A 3KLGA 3QO9A 1BQNA 2PYJA 1FKOA 4IO8A 4ZRJA 1KSPA 4RW6A 5AQKA 3V9ZA 4B1ZA 4FWLA 4E7JA 1JLFA 2OZMA 2F8SA 1UA1A 2YKMA 4B9MA 2PAVA 2FSJA 3FZKA 3ENHA 1BI4B 1YHQN 4IEIA 1XHXA 4WYBA 5HRNA 3V9XA 4TKNA 3C0BA 3OTOK 3LZJA 3ZLJA 3CFPA 3AARA 2EMSA 3JXUA 2F9TA 3EYZA 1T7PA 3M1FA 1N36K 1RT1A 3AU5A 1MDUB 2Z1HA 1UAXA 3ISNC 2ZD1A 3DM2A 4CHOA 4CI6A 4O5BA 4JK7A 1BCOA 3I33A 3D7EO 2ABDA 3DOLA 3JS6A 3K5OA 3L8BA 3T1HK 4LY7A 2J0KA 5EOYA 5EY4A 4JV5K 3AGKA 3TPQA 1QVFM 3AA4A 2D0PA 5J2MA 2P9LB 3E9OA 3SAGA 1WSFA 1N8RO 1VQ9N 4JK9A 1DT9A 4WQ4A 3LDNA 4YHHK 2KKZA 1S1UA 1IO2A 1ISNA 4CJLA 1JCEA 3TTCA 3ZETA 1LAWA 1QSYA 4RW4A 2P9SB 2FBVA 1RDDA 1JL1A 1WUAA 1O13A 4KI4A 1G99A 1HUXA 4EIAA 1YAGA 2FF3B 3AV9A 3CQYA 2V52B 1DKGD 3THXA 1EO1A 4GXBA 3MXMA 1ASWA 2QWQA 3BY5A 3BZCA 4CIGA 4DR2K 2QEXN 3AA2A 4JD2B 3PY8A 1RTJA 2BUPA 4BACA 4GMJB 3RMDA 4BY9C 3AVJA 1SL1A 3DLGA 1D4XA 3ZT3A 4IFEA 4JHDB 1RILA 4DTPA 4KTZA 2YJFA 3NF6A 4FJMA 4ISFA 2NUBA 4B8CA 3AVKA 3D2FA 3T19A 1VSLA 3O9RA 2VGNA 1S6PA 5AQHA 4Y0WA 1HX1A 3QFUA 4M7YA 4EHTA 2YHBA 2OPPA 1SS6A 3GOIA 3L2UA 4DV1K 1VQON 5GINA 1RBUA 5JLFA 4B3SK 2Q3SA 3SNNA 3K57A 3H45C 4NO7A 3TTFA 3QIOA 1F21A 5AQFA 4BC5A 4DTSA 4EZ9A 3ASMA 2PYLA 2W6LA 3D45A 2D0OA 5FPDA 4F7GA 3V9SA 3OS1A 1U2VA 4HDQA 5JVLA 4BG8A 4DV3K 1JCGA 1K9MO 1TKXA 4JNEA 5CHIA 3IUCA 4Z0UA 4BRAA 4GNIA 1NK4A 5HRSA 3HVTA 3HPGA 4B1VA 3WXMB 1TK5A 2HHVA 1VQMN 1RTHA 4WQ4C 1NJZA 4UY8O 4DF8A 4JAXA 4B1YB 2E2OA 5AQRA 1GOAA 1ACAA 5C2DA 2A40A 3FZFA 3J7ZO 1TGOA 4BE1A 5AQNA 3TAFA 1NMDA 2GEMA 3VERA 4FJ8A 1OKJA 4W5TA 1SAZA 3ZX3A 1GLFO 2OYQA 2P9UA 4YL8A 3DRRA 3KLIA 4MO5A 1UA0A 3WA0A 3VQPA 3RMAA 1S22A 5C0YA 1VSJA 4ILJA 4FWNA 3UKUA 4LF9K 1VSEA 3OYHA 1RDAA 2CQUA 4A5AA 4BVOA 1YVNA 1X9MA 3LP0A 2AJQA 1KVBA 3NGYA 4OVLA 4CEQA 2HBKA 1QTMA 2YJEA 1ZC6A 3WNEA 1C0FA 2Q36A 3KZBA 1BWFO 4BRQA 5HROA 3TWHA 5C15A 5FPMA 4A2AA 1QZ6A 1YIJN 2O8CA 1S5JA 3R6MA 1NOZA 3BZKA 3WXIA 4OLBA 1HQUA 3D6RA 4KH5A 3CPWM 2CGKA 1B92A 4J2DA 1VSDA 4BR5A 3EE8A 2Q0UA 2D0BA 2NRRA 3KK2A 4YOXA 2QTDA 1WN7A 3WXKA 1RFQA 2E1YA 4O8KA 1Y97A 3V1QA 4KHSA 3KLHA 1GLCG 4B3RK 1L3UA 3C65A 5DK5A 1VQ7N 3NFAA 2D0AA 4XH5A 1HKBA 2BDPA 4JKEA 3VQQA 3G9WA 5KI6A 1GGOA 4CF9A 4DUZK 4JI8K 4IOAL 3C7NA 4FM1A 5E84A 5AR0A 1ATRA 2NNWA 4CEBA 3HP9A 3CM5A 4Q0BA 5AZIA 4WQ5C 4CHYA 3R8EA 1TKDA 2G8KA 3T1AA 1NKCA 4F3OA 3O80A 2CH6A 4CEAA 4KHQA 2HBLA 3THYA 3A5OC 5JVGL 1CZ9A 3HYFA 3M6GA 2IS3A 1M90O 4IEEA 2PFUA 4AM6A 4JKCA 3LP3A 3QEIA 4FLXA 1V4TA 3HSTB 4JK8A 5AZJA 5AQWA 5A2QO 3ALYA 4DXAB 4BQLA 4CJPA 3O1WA 4RCHA 3OYJA 3JYTA 1Q81O 4OKKA 1YJNN 4NXNK 2IC3A 2VWKA 1RDBA 1KTQA 3O5BA 3JSMA 1KVCA 1NGEA 4DTRA 1SKRA 3ZSQA 2HVIA 2DFEA 4M3TA 5I9EB 4KHUA 2DFHA 3WXLA 1RGIA 2W41A 3PX6A 3H1VX 4CHNA 5GIOA 3WNHA 1H4RA 3OJUA 2HMIA 2DIKA 3EKSA 1A5WA 1KC7A 5JVHL 3MX5A 3DI6A 3MXIA 3I8BA 4KB1A 4QAGA 5BPLA 1KAYA 3SQ4A 3H46O 4FJNA 2D1KA 3VF2A 3LZIA 4PY5A 3IDHA 5AQUA 4H5RA 3CF5L 3TAQA 4YOVA 1ILYA 4HCBA 4FWQA 1RDCA 3CCLN 1Q8IA 5ELZA 3FLCO 4E89A 1Q9XA 3N4QA 2GTDA 4Z4HA 4H8KA 4B9UA 1BO5O 4CZJA 2O8DA 3KLEA 3OYCA 4GW6A 5IT9O 5CR4A 1T6DA 4BRNA 4DMNA 2EMTA 3U7DA 5CE3A 4I9QA 1KXPA 3PUFA 1IH7A 3IG1A 4BDZA 3DJCA 1HPMA 4JKDA 1Z6RA 4WF9L 3VEZA 2HBMA 3CMAN 2Q0RA 3ZYYX 5KQDA 2B4JA 1B9FA 4Z4EA 3C6UA 5HRRA 5M1KA 2NRXA 3A2FA 1JLGA 5JMVA 5JLHA 1WSIA 2HOEA 1NJWA 3VESA 3ZSWA 4FXDA 3T69A 2YHAA 1QSLA 3L6QA 1D8YA 5J1EA 3LAMA 4CJRA 3QESA 3M8SA 4DV7K 1JXEA 4PQUA 2V7YA 3CJ7A 4B3MK 4IJNA 4ILHA 1EWRA 2Z1IA 4M41A 4O55A 1IBLK 2FBTA 2ZPYA 4IDHA 3SAHA 3S3NA 3AVLA 1LWEA 3AO5A 4B9LA 3RRHA 5ADXA 3SV4A 3ZCMA 1NG9A 1K73O 1D9FA 2HHXA 3LDSA 1Z05A 4FCYA 3HZ6A 4FM2A 1P90A 1IKWA 4H5WA 4X65K 4CJFA 2P5GA 5M1PA 4CBWA 3TABA 3ULEB 3AVBA 5IJMA 3TSPA 3KWGA 4JI3K 3MECA 1HJRA 1KCFA 3ZSZA 2NRHA 4DQQA 4TSXA 1JXBA 4CFCA 4PUOA 4DTXA 2RHKA 3AVIA 1BQMA 3EEQA 1TL3A 4PHTX 3U8ZA 1XWLA 4ID5A 4B1XB 4K41A 3L2WA 4JKGB 2JGUA 4CGDA 1LW0A 1NTIA 2UXCK 4ELTA 5AFUH 1KAZA 1Z26A 3MCPA 4AF1A 2W42A 1N6QA 1KQSM 4DS4A 1SL0A 1X9WA 4FLWA 2FJ9A 3EY1A 1DIKA 3QDKA 3EN9A 3C95A 1KFSA 1QQCA 2P9IA 3VPZA 5GADP 3AA5X 2QW9A 4DQIA 2E6MA 5KRTA 3MN6A 3H3OB 3WEEA 4L8RB 3O3HA 2HNYA 1NJIO 3C6HA 3NBPA 1L5UA 1J6ZA 4X64K 3VEOA 3HPHA 3F5TA 1NU0A 1UOCA 4K0KK 2FXUA 4EZ6A 2NLXA 4M3YA 1BGXT 3EZWA 1RBSA 4CD1A 4DB3A 3ZEUA 3SBGA 4PWDA 4GV6A 2Y1IA 1P8ZA 4FVUA 3CCVN 4KHNA 1RT5A 2QWLA 2OPQA 4Y1DA 1U45A 3ATUA 4E7IA 2VGMA 4JI4K 2CGJA 3L4IA 4YOTA 3QBXA 4KHWA 4FL9A 1HKGA 2I7NA 1REVA 1ESVA 4IZ9A 4HHTA 1NWKA 3UB5A 2HHHK 4NLBA 4JN4A 1VSIA 1NGHA 3HM9A 4HTUA 2G8VA 3A0IX 1S6QA 2QWNA 5TKWA 3LDPA 2RPIA 3WNGA 5J2NA 4MDAA 3EL2A 3IMXA 4FLUA 2ITMA 5FDLA 1WBBA 2CGLA 2I5JA 1X1PA 1NKEA 3OYDA 5AQLA 4N5SA 3D0PA 3WQUA 5K14A 4XIUA 3T1YK 4FLYA 1NK7A 1CZBA 4CZLA 5AQVA 3BP8A 2UXDK 2HE7A 1TYQA 4H03B 4BRDA 1WAFA 4IJAA 1MWMA 3RSEA 1W0HA 3VTIA 3A5MC 1L3VA 1ZBSA 4GVEA 2YNIA 4C1NK 4CZIA 2E8AA 2FLOA 4DFMA 3PSFA 3U9ZA 3IKMA 1E5WA 1Y19B 2P51A 5FPNA 4HUFA 2PY5A 1J9AA 1HNVA 1NK8A 1VSFA 3CCMN 1XMOK 2O8FA 4C1NI 4HUEA 4M63C 4CJTA 4W5QA 1KFDA 3L4QA 5D3GA 2HF3A 5AQIA 3F73A 1XI1A 3OYKA 4H5TA 1C1BA 3NH1A 2P5OA 3O3GA 5AQPA 2RE2A 4PA1A 3DLBA 3R1XA 3DLKA 1ASVA 4DR1K 2GV9A 2IVOA 4FJ7A 2D11A 2I1JA 4M42A 4OKJA 3NF8A 5M1NA 1HNIA 2B6AA 2YVCA 1L3TA 3WXJA 4CJ3A 5KRSA 4LH4A 1S1VA 5IWAK 3P38A 3ZDTA 4I6MB 4MLHA 4DG1A 3ZT4A 3Q7BA 1LV5A 1C1CA 4N41A 4HVJA 2EX3A 5AQOA 3MN7A 3ID6A 4BR9A 3LDQA 1RNHA 2W6KA 4JKHA 4O0IA 2J0MA 3LANA 4RW7A 4CF8A 3CXCM 2WH5A 4DQRA 4M3ZA 3I55N 3UKRA 3NH0A 3FZHA 3B6PA 1VRUA 4CJEA 3SQ2A 4DR7K 2F9WA 2D4WA 3CJ9A 3NGZA 4NXMK 1J5EK 2G8UA 4LH5A 3I56N 5CYMA 1FJGK 4B3OA 4E7LA 4JS5A 3P31A 3U3GA 2PBDA 2ZJPL 3VETA 2UUBK 3QMLA 1CZAN 1KLNA 3M8PA 4NYFA 2LSNA 3LM9A 4LSLA 4YNQA 5EXWA 3J80O 5AFUA 1QQMA 1HRHA 1BDGA 1X3MA 3V1OA 2HHSA 1ASUA 1VHXA 3CI5A 3O08A 2XY5A 2E88A 3QLHA 2O4GA 3HI0A 4CGFA 4CF0A 4DQ8A 4E19A 1WB9A 2RF2A 3QBWA 1K8KB 4LFAK 4PKHA 4WFNL 4DTUA 2WOMA 2YHWA 1NBWA 4PL8A 5AQTA 5BPNA 3SMPA 2P9KB 4W5NA 4ZTFA 4IG0A 3DRSA 3LALA 1HQEA 4EP5A 1YT3A 4I7FA 3VQCA 1C0GA 2QKKA 2A5XA 3VQ8A 3VEVA 1T03A 2IVPA 4KFBA 5FRMA 1I39A 1YTAA 1RT6A 3CC7N 2X0SA 1VQ8N 4BDPA 4C8LA 4LF4K 5DM7L 4DQPA 4ISGA 4BRMA 3PX0A 1HNZK 3THWA 3MN5A 1DTQA 3K59A 2J4RA 3MCAB 3KHYA 1VQ6N 2J0JA 3EPYA 3VEXA 3CETA 5MLCQ 4FOIA 5HP1A 3TU5A 1M1KO 1BI4A 1EX4A 3SAFA 3NCIA 3GG4A 3VEWA 3VGKA 2WFBA 4LF5K 4FWMA 3HPOA 4DF4A 1Q82O 3HJFA 1ATSA 3KD5E 2ZWHA 2GUIA 4H4MA 4CEDA 2G8HA 2E2NA 5FRNA 3LAKA 3GL1A 2NRWA 3D2EB 4HUGA 5KQ8A 3CG7A 1OH5A 2OZSA 1KC8O 3PVLA 3PV8A 1S1TA 4DTJA 3ZT1A 1VBGA 2E6LA 2FF6A 1HR0K 4BGBA 4K43A 3O9TA 3TAMA 3M8QA 4HWIA 3LDLA 4CJWA 3NAEA 5C25A 5BPMA 3KD1E 4F8RA 4JI2K 4LF8K 2P9LA 3IRXA 4R79A 3QICA 4HDOA 3ZSOA 2BGGA 4CHZA 4F2SA 4E1JA 2IIRA 2OA8A 2COPA 1BIZA 5F1XA 1KLMA 3TSQA 3CHWA 2HHQA 4DU1A 2E4LA 5AQMA 2P9SA 2P9PB 4AHUA 4M3UA 2BANA 1MWKA 3G71N 2BH1A 4FJKA 1ST7A 3H6EA 2VQFK 1QS4A 3SK3A 3DXKB 5BREA 2XY6A 3VQ9A 3VMFB 1XC9A 1KBLA 2F96A 3K5NA 3RR8A 4JI7K 4B9QA 3QEPA 3F2KA 2KLAA 3FFIA 4DV5K 3EO3A 3ID8A 1CXUA 4JD2A 5LL6Z 1GOBA 3K58A 4GV9A 4FWKA 3CQ8A 3NVKA 4M3RA 4BRKA 4NCBA 3LPUA 5HBMA 2OCEA 1Q9YA 4FPAA 4CD3A 4B9TA 3VQ6A 1SUQA 4JHDA 3QFPA 3VQ4A 2FBYA 5LMUK 3MWTA 1NM1A 5JS1A 4I9LA 4B9NA 1W7AA 3BDPA 1JJ2M 4LF6K 4FYDA 2GWJA 1BUPA
chains in the Genus database with same CATH topology
4BRHA 3B8AX 5BN9A 1RDUA 3C7NB 4MDBA 3CCUN 3FLVA 1HBKA 2ZPYA 4IDHA 4G9ZA 3SMSA 3SAHA 4YDUA 2E2PA 3RVCA 4H5VA 1XUPO 3G25A 3Q7CA 1TUUA 2AA4A 3VGLA 2AP1A 3O4WA 5ADXA 2ZJRL 5AZIB 4YOWA 3IVFA 4NB4A 3CJCA 4GY2B 2P9NA 4BR2A 1XQSC 2QXLA 3LM2A 1K73O 2NRTA 1Z05A 3CIPA 4IO8A 3BEXA 3BUZB 1NI2A 4ZRJA 2WC9A 3HZ6A 3FZLA 1P90A 1QQNA 3MN9A 4H5WA 3CERA 4YOUA 5KPRA 5AQKA 5M1PA 4CBWA 3ULEB 3NMUA 1NGFA 4B1ZA 4OPAA 5IJMA 3TSPA 3KWGA 5BRDA 4FWLA 1JCFA 1IG8A 2A42A 4FWOA 3BF3A 3H1QA 4A62A 2FDQA 3H3NO 5AZJB 4JKFA 2NRHA 4YORA 4BRGA 4BC3A 2WUSA 2PAVA 1BA0A 2FSJA 1YUWA 4BR7A 1NGBA 2RHKA 3FZKA 4O8UA 3ENHA 1YHQN 4NY0A 3DXMB 4IEIA 3L0QA 4M7XA 1S3XA 4PHTX 3E9LA 4WYBA 3U8ZA 4TKNA 4JEPA 3C0BA 3NVMA 3OHRA 4K41A 4B1XB 5LJWA 3LL3A 1Q7YO 2KHOA 3W0LA 4JKGB 3CCJN 4EFHA 1WOQA 4YOYA 3AARA 2EMSA 4WFBL 3HOTA 3JXUA 2F9TA 3G4SN 1NTIA 3M1FA 5AFUH 1KAZA 3AU5A 3MCPA 4AF1A 1KQSM 1MDUB 4RTFD 4P7IA 5JICA 1GC7A 4O5FA 3E66A 2FJ9A 4WQ5A 4CI6A 4JK7A 1DIKA 2NRVA 2OANA 3I33A 1QZ5A 2ABDA 3D7EO 3QDKA 4KH6A 4CZEA 3HRGA 3N4PA 3EN9A 3JS6A 3AAPA 1NVLA 2P9IA 1BA1A 1DGKN 3VPZA 5GADP 3E1YA 2QW9A 4I6MA 3T7ZA 4BRCA 1EQYA 3CMEN 2ZGZA 2J0KA 3HBTA 5AQJA 5EOYA 3MN6A 2JWKA 3H3OB 3WEEA 5EY4A 4BR4A 3AGKA 3TPQA 1QVFM 2D0PA 1NJIO 3C6HA 1J6ZA 2P9LB 3E9OA 3SAGA 1N8RO 3VEOA 1VQ9N 4F9OA 4JK9A 3EE9A 2V7ZA 1DT9A 4WQ4A 3F5TA 3LDNA 3SBTA 2KKZA 4CJ7A 3AGRA 4U7BA 1ISNA 3M5RA 1JCEA 2FXUA 3TTCA 5ADXH 1YF5L 2NLXA 3ZETA 3EZWA 3P39A 1W2BM 4CD1A 2ASMA 3ZEUA 4H0XB 3PZDA 4QS8A 3SBGA 4H0VB 4DB3A 2P9SB 4GV6A 4NLCA 4HTLA 1P8ZA 3K9JA 4FVUA 2VCPA 1WUAA 1O13A 3CCVN 2QWLA 2QWPA 3MX2A 1G99A 1HUXA 3KWIA 3ATUA 1YAGA 3CJBA 4EIAA 2FF3B 1TUYA 5M1FA 2FSKA 2VGMA 3CQYA 2V52B 1DKGD 2D2QA 4PL7A 4YDUC 1EO1A 3FZMA 4GXBA 1KD1O 2CGJA 3L4IA 2HMPA 1GLBG 2QWQA 4YOTA 1MA9B 3QBXA 2Q31A 3J8AA 1E4FT 4FL9A 4BREA 4KH4A 1HKGA 2QEXN 2I7NA 1ESVA 1X9JA 4IZ9A 4WFAL 4JD2B 4A59A 1NWKA 2E2QA 3UB5A 2BUPA 4NLBA 2OTLN 2F7TA 4JN4A 1NGHA 4K42A 4BY9C 3A0IX 2QWNA 5TKWA 3LDPA 3R3LA 1RDWX 1D4XA 3O6WA 4MDAA 3EL2A 4IFEA 4JHDB 2YCHA 3IMXA 2YJFA 3CD6N 1K8KA 3K9KA 2ITMA 4ISFA 2CGLA 3D2FA 4B1UB 3VEYA 2P9KA 3O9RA 2VGNA 5AQHA 2HRJA 4Y0WA 5AQLA 1HX1A 2R82A 3QFUA 3CJ1A 4M7YA 5AQGA 5EX5A 4EHTA 3WQUA 3FGUA 5FPEA 4CZLA 1SS6A 3SJHA 3GOIA 3CJAA 5AQVA 3BP8A 1VQON 2HE7A 1TYQA 4H03B 4BRDA 4LC9B 5GINA 3C6AA 1MWMA 4IJAA 3RSEA 5JLFA 2ZJQL 3VTIA 3A5MC 2P9NB 1NGCA 3H45C 4BQZA 4NO7A 1ZBSA 4GVEA 5AQFA 3E9PA 3TTFA 4BC5A 1JDEA 4C1NK 4CZIA 2E8AA 2FLOA 3VGMA 2D0OA 3U9ZA 3IKMA 5FPDA 4CYEA 1E5WA 1Y19B 4F7GA 1IJJA 5FPNA 1VQ4N 3ZX0A 3ENOA 2Q2RA 2GUPA 1U2VA 4HDQA 5JVLA 4PKIA 3VF6A 4BG8A 1JCGA 1K9MO 3FP5A 4MO4A 1NGJA 3VF4A 3CCMN 3BINA 5E26A 1NGDA 1YITN 3TTDA 4C1NI 4JNEA 4IXCA 4M63C 5CHIA 3IUCA 4BRAA 4GNIA 1VQKN 5HL7L 4A5BA 3M3ZA 3L4QA 2HF3A 2WBNA 5AQIA 4B1VA 3WXMB 1VQMN 1ZXOA 5LY3A 4FSVA 4EKUA 4H5TA 1Y64A 3BF1A 2VWBA 4WQ4C 4C23A 2OTJN 4H5NA 2UYTA 4UY8O 4L3QA 3MK6A 5AQPA 3O9QA 2RE2A 4JAXA 4B1YB 2NZTA 2E2OA 5AQRA 3AY9A 4FPBA 1ACAA 3R1XA 5TKYA 4BC4A 5C2DA 1SGHA 2QWMA 3D2EA 2A40A 1EF1A 3WUHA 1VBHA 3FZFA 3J7ZO 3UE5A 5AQNA 1NMDA 2IVOA 2D11A 2I1JA 2GEMA 3VERA 1OKJA 3SLCA 5M1NA 4ZRKA 1VAZA 1SAZA 3ZX3A 1GLFO 5C12A 2YVCA 3WXJA 2P9UA 4YL8A 1H1VA 2AEHA 1T3VA 1V4SA 4H0TB 3OW2M 1YI2N 2P9IB 3P38A 4MO5A 2E20A 3WA0A 3ZDTA 2HSTA 1S22A 4FWRA 4I6MB 4MLHA 4ILJA 5C0YA 4FWNA 3UKUA 3X23A 3A8YA 3WEEB 3Q7BA 2CQUA 3CCRN 5F0XA 4A5AA 5KPZA 4BVOA 4CZFA 1YVNA 5AQOA 3MN7A 5AQZA 3ID6A 1VQ5N 4BR9A 5AQSA 3LDQA 1BOTO 4BC2A 5H1SQ 3VOVA 1HB6A 4JKHA 3QIJA 2HBKA 2J0MA 3O1BA 2YJEA 1ZC6A 3CXCM 2WH5A 1C0FA 3HSCA 4OO1J 3I55N 2ASPA 4EAHD 3UKRA 1MK7B 3WT0A 2Q36A 3DWLA 3KZBA 3ZETB 1BWFO 4CZMA 4QS7A 3FZHA 3VTHA 4BRQA 4H0YB 3ZEUB 2F9WA 3CCSN 2GWKA 3O9SA 2P9PA 2D4WA 3CJ9A 2QI2A 1BG3A 3VENA 5C15A 5FPMA 2E1ZA 5DM6L 4A2AA 1QVGM 1QZ6A 3I56N 1YIJN 4CZHA 2YHYA 3U9DA 2GELA 5AQXA 2QA4N 1MIZB 3R6MA 3P31A 1DEJA 1NLVA 2PBDA 3DXKA 5BRHA 3WXIA 2ZJPL 3VETA 3QMLA 4IO9L 3CC2N 3G6EN 3D6RA 4KH5A 3CPWM 1CZAN 2CGKA 5AQYA 1X3NA 2Q1NA 3LM9A 3FE1A 3OBWA 4DKWA 4BR5A 4IOCL 5EXWA 3EE8A 1QQMA 2Q0UA 2NRRA 2VYPA 5AFUA 4YOXA 1BDGA 3OA9A 1GLEG 1NGGA 2QTDA 1X3MA 3S41A 3CI5A 3O08A 4EHUA 3WXKA 1RFQA 2E88A 5BPNA 1YJ9N 3U4LA 3PIOL 2E1YA 4O8KA 3HI0A 3WQTA 4ILGB 1KAXA 4DQ8A 4BRIA 3EKUA 3QBWA 1NGIA 1K8KB 3CCEN 1SQKA 1GLCG 3C65A 4PKHA 4WFNL 2YI1A 5F2RA 2YHWA 1VQ7N 1NBWA 3D2FB 1GLDG 4PL8A 1HKBA 4XH5A 5AQTA 4JKEA 2P9KB 3G9WA 3SMPA 5BRFA 1GGOA 4IOAL 1LCUA 1HJOA 3C7NA 4BRLA 5E84A 2ASOA 5AR0A 1ATRA 1C0GA 2NNWA 2ZGYA 2A5XA 4H0OA 4BRFA 3CCQN 3VEVA 2V51B 2IVPA 1YJWN 4IOXA 1TYQB 3RSEB 5AZIA 3R9PA 5HOOA 4WQ5C 3HOSA 3R8EA 3MMVA 4AM7A 3O80A 2CH6A 3CC7N 2BTFA 2HBLA 2X0SA 3A5OC 1VQ8N 5JVGL 4BG9A 1VQNN 3M6GA 3CQXA 5DM7L 1M90O 4IEEA 4ISGA 2PFUA 3A5NC 4AM6A 4JKCA 4BRMA 3ULEA 3MN5A 2YX6A 4A2BA 1V4TA 5EVZA 4DCHA 1S72N 4DHYA 2J4RA 3MCAB 4JK8A 3ENBA 3KHYA 1VQ6N 2I7PA 1K8AO 2J0JA 1U2VB 5AZJA 1QHAA 3EPYA 2A41A 5AQWA 4Z94A 5LJVA 1GLLO 3VEXA 3PIPL 4FO0A 4DXAB 4BQLA 3CETA 3O1WA 2GX9A 4RCHA 1Q81O 5MLCQ 4FOIA 4A61A 4QS9A 2CB8A 3U8XA 1YJNN 1NGAA 3TU5A 2I1KA 1ATNA 1M1KO 3KVGA 3A5LC 3DXMA 4JKAA 4CBUA 3SAFA 3O5BA 3GG4A 3VEWA 3IFRA 3O8MA 1NGEA 1HB8A 4XH4A 3VGKA 2WFBA 4FWMA 4JKGA 1XC3A 5C2FA 2RQ1A 1Q82O 3CPEA 3HM8A 1ATSA 3W3DA 4B1WB 2ZWHA 4WCEL 1LOTB 5I9EB 3DLLL 5BN8A 1Q86O 2E2NA 3GL1A 3WXLA 1RGIA 2NRWA 2W41A 3D2EB 3F9MA 4XH1A 2A3ZA 4ISEA 1J19A 3H1VX 1GLJO 3MDQA 3FR0A 5KQ8A 5GIOA 1KC8O 1H4RA 3PVLA 2DIKA 1U6ZA 4JKBA 1KC7A 2NRZA 3EKSA 3MX5A 4J8FA 4OPHA 3I8BA 1VBGA 3CC4N 5JVHL 5GAEP 5BPLA 1YXQA 1KAYA 2FF6A 2H3GX 2P9UB 4XEIA 4BGBA 3GDQA 4K43A 2JWLA 2Q97A 3H46O 5AQQA 4FWPA 5KPTA 3O9TA 1OVYA 2D1KA 3TSUA 3VF2A 1BU6O 1GLAG 5GAHP 3IDHA 2AL6A 3LDLA 4HWIA 5AQUA 3UKUB 1Q18A 4RWTA 4H5RA 3CF5L 3AU4A 2A6AA 5BPMA 3HTVA 4YOVA 2YHXA 1ILYA 4FWQA 3CCLN 4CBXA 5ELZA 3FLCO 3ATVA 2DPNA 2P9LA 1GG3A 4R79A 3QICA 4HDOA 3N4QA 2GTDA 2CH5A 1HKCA 4E1JA 1R59O 2IIRA 4CZKA 1BO5O 4CZJA 1SZ2A 3P4IA 5C10A 3DAWA 3KK7A 4K25A 3LDOA 4BROA 3UKRB 2COPA 4A57A 5F1XA 3TSQA 2QM1A 1QQOA 3CHWA 5CR4A 1T6DA 4BRNA 5CE3A 2EMTA 4ZRIA 3U7DA 1T6CA 3OBYA 1KXPA 5AQMA 2FSNA 2P9SA 4BRPA 4CZGA 5GAGP 5M1OA 1VQLN 2P9PB 5GIPA 1MWKA 3G71N 2BH1A 2W40A 3O9UA 3ZX2A 2LBBA 1ST7A 3GE1A 3DJCA 3H6EA 4U67L 1HPMA 4JKDA 1Z6RA 2ZF5O 4WF9L 3VEZA 2HF4A 3SK3A 3AAQA 3DXKB 2HBMA 5BREA 3CMAN 3VMFB 2Q0RA 4H0PA 4PKGA 3ZYYX 4BGAA 5KQDA 1KBLA 1E4GT 4B9QA 3MWPA 2QWOA 2KLAA 3F2KA 3QB0A 3EO3A 3ID8A 5M1KA 2NRXA 1T44A 4JD2A 2HBJA 5JMVA 4GV9A 2EWSA 4FWKA 5JLHA 3NVKA 4BVPA 2HOEA 2IVNA 1MK9B 4FOEA 3VESA 4BRKA 4BR0A 2D10A 1GC6A 2QWRA 3T69A 4FWSA 4GV3A 3GBTA 4FPAA 1W97L 3FFKB 3L6QA 4IWVA 4CD3A 4JHDA 3QFPA 4MLEA 4KBOA 1VQPN 3MWTA 1MIXA 1NM1A 5BR9A 5M1QA 5B8HA 1HLUA 2V7YA 3CJ7A 1JJ2M 2GWJA 3PLAA 4IJNA 1BUPA 4ILHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9O A;  3E66 A;  4JKF A;  4JK9 A;  4JKA A;  3SBT A;  4JK7 A;  4ILG B;  4JKG A;  4JKC A;  4JKH A;  4JKE A;  3E9L A;  4JKD A;  3SBG A;  4JK8 A;  3ENB A;  4JKG B;  4JKB A;  3E9P A;  4ILH A;  4ILJ A; 
#chains in the Genus database with same CATH topology
 4E7K A;  5BN9 A;  3IAY A;  1RDU A;  4F2R A;  2WTU A;  4DR4 K;  2VG6 A;  3FLV A;  4G1Q A;  4G9Z A;  4ZHR A;  3SMS A;  2E5L K;  3RVC A;  4KV8 A;  3KIO A;  3G25 A;  3VGL A;  1SKS A;  1RT3 A;  1QSS A;  2JLE A;  4KHP K;  4N47 A;  2IOC A;  4NB4 A;  4RG8 A;  4GY2 B;  4LFC K;  2NRT A;  2KFZ A;  3SJJ A;  4DV4 K;  3DLH A;  2WC9 A;  4YOU A;  5J2P A;  2HB5 A;  2HND A;  2XHB A;  1RT4 A;  4OPA A;  3OYE A;  4O44 A;  2G8I A;  4FWO A;  4DV6 K;  2X78 A;  2Z1J A;  3H3N O;  4JKF A;  3LP1 A;  3PO5 A;  4BRG A;  1BA0 A;  4BE2 A;  3K5M A;  2KTQ A;  4NY0 A;  3DXM B;  4M7X A;  3L0Q A;  4J2A A;  1S3X A;  3E9L A;  3NVM A;  5LJW A;  3NE6 A;  2KHO A;  3W0L A;  3CCJ N;  4EFH A;  1WOQ A;  4WFB L;  3OYI A;  3AA3 A;  3L2R A;  3HOT A;  3OY9 A;  3QIN A;  5BR8 K;  4RTF D;  1C0U A;  1VSK A;  1GC7 A;  4O5F A;  3E66 A;  2YNG A;  2OAN A;  4KH6 A;  3KK1 A;  3C6T A;  1TAQ A;  1JLA A;  4CZE A;  3HRG A;  1EKE A;  3N4P A;  3AVG A;  3AAP A;  4DTN A;  1NVL A;  3B6O A;  3K2P A;  1DGK N;  4Z4F A;  4CFD A;  4IFV A;  1EQY A;  2B5J A;  2UUA K;  3CME N;  5AQJ A;  3HBT A;  3HVR A;  3NDK A;  3AVH A;  3ITH A;  4BR4 A;  1NNE A;  3AVF A;  4FJ5 A;  3V1R A;  2HW3 A;  4ICL A;  1WBD A;  4FZY A;  2V7Z A;  4AHS A;  3SBT A;  3ZSY A;  4CJ7 A;  3P83 D;  4U7B A;  3SPY A;  1LWF A;  5KGW A;  4J2E A;  2ASM A;  4H0X B;  3V4I A;  4UQG A;  4FLZ A;  4FLT A;  4NLC A;  2VCP A;  4Z4G A;  1HNW K;  5SWM A;  3RWU A;  4W5R A;  3CJB A;  5M1F A;  4CEE A;  1TUY A;  2FSK A;  4DSL A;  2D2Q A;  4PL7 A;  3FZM A;  1BHL A;  2HMP A;  4YFU A;  1GOC A;  1MA9 B;  2Q31 A;  1HYZ A;  4KH4 A;  2QK9 A;  2FC0 A;  3VA3 A;  4A59 A;  1U4B A;  4KB0 A;  2E2Q A;  2OTL N;  2F7T A;  4LSN A;  4DUY K;  3R3L A;  3DOK A;  3O6W A;  2D0C A;  3NGI A;  2YCH A;  4JI6 K;  4FM0 A;  3QEW A;  3U3Y A;  4FJI A;  1JLC A;  3VQE A;  2O8E B;  3VEY A;  4DLE A;  3EZ5 A;  2BE2 A;  3CFO A;  1RT2 A;  2DY4 A;  2R82 A;  5AQG A;  4CJV A;  5EX5 A;  4DV2 K;  3KTQ A;  1I94 K;  3FGU A;  4AHR A;  3L3V A;  2X6N A;  1K6Y A;  2O8B B;  1BIS A;  3NH2 A;  4DTM A;  4CEF A;  2ZJQ L;  3O3F A;  4IFY A;  2P9N B;  1NGC A;  3E9P A;  1JDE A;  2KW4 A;  1IBK K;  3H08 A;  3L2Q A;  1VQ4 N;  1IJJ A;  4CES A;  3ZX0 A;  2Q2R A;  2GUP A;  4PKI A;  3SZ2 A;  3FP5 A;  4AHV A;  5T7B A;  1NGJ A;  1FW6 A;  3BIN A;  4M45 A;  3TTD A;  1TKZ A;  5DMR A;  3ZSX A;  1J5O A;  2G8W A;  4A5B A;  2WBN A;  2Z1G A;  5LMN K;  5LY3 A;  5I3U A;  1Y64 A;  4C23 A;  4CGJ A;  2UYT A;  4L3Q A;  3MK6 A;  2GBZ A;  2KZM A;  3U6F A;  1FXX A;  3HP6 A;  4BC4 A;  2KQ2 A;  3TAE A;  3UE5 A;  4F3T A;  1SL2 A;  4W5O A;  3SLC A;  2ATQ A;  1ZBI A;  1VAZ A;  4CF2 A;  2P1J A;  3HL8 A;  3S9H A;  2AEH A;  1T3V A;  3OW2 M;  2E20 A;  2HST A;  5C24 A;  2XY7 A;  4CJQ A;  3CCR N;  5F0X A;  3TAN A;  3VQ5 A;  4CZF A;  3TI0 A;  3CFR A;  1RT7 A;  1VQ5 N;  4B08 A;  1BOT O;  3BGR A;  4CJS A;  4C8O A;  5H1S Q;  4CJU A;  4GKK K;  4MFB A;  3DYA A;  4I2P A;  4KTQ A;  2ASP A;  4CZM A;  4DSK A;  3ZET B;  1VRT A;  4QS7 A;  4FW2 A;  3QEV A;  1NKB A;  3IS9 A;  4H0Y B;  2X6S A;  4CER A;  3CCS N;  1RBV A;  4AH9 A;  2ETJ A;  2QI2 A;  4E7H A;  4DV0 K;  4DQS A;  3U9D A;  1J54 A;  3JAM O;  2HHU A;  5AQX A;  2QA4 N;  3OS0 A;  1DEJ A;  1NLV A;  5BRH A;  2UUC K;  4B8A B;  4AIL C;  2X74 A;  3THX B;  4IO9 L;  1NK5 A;  1C6V A;  5AQY A;  5E41 A;  1TL1 A;  1X3N A;  2Q1N A;  1DTT A;  3OJS A;  3OYN A;  2VYP A;  3OA9 A;  1NGG A;  1S1X A;  1UWB A;  4EHU A;  1YJ9 N;  4JI1 K;  3PIO L;  4B9V A;  4B3T K;  4ILG B;  4DSF A;  3EKU A;  1NGI A;  3CCE N;  1SQK A;  3O4N A;  4E0D A;  3I0S A;  2YI1 A;  3D2F B;  1GLD G;  1RTD A;  4M3W A;  3O4Q A;  1HJO A;  3AVA A;  4BE0 A;  4BRL A;  2ASO A;  3CCQ N;  2KZZ A;  2V51 B;  3L2V A;  4CEC A;  3V81 A;  4CGH A;  3E01 A;  3MMV A;  1U49 A;  1HNX K;  3MAQ A;  2HHT A;  3VQ7 A;  3J81 O;  4BG9 A;  1VQN N;  3RMC A;  3A5N C;  3ULE A;  3HK2 A;  5EVZ A;  4DCH A;  4IDK A;  3VQA A;  4Y1C A;  3VQB A;  5J2Q A;  5SZT A;  2I7P A;  1U2V B;  1QHA A;  3RR7 A;  5LJV A;  1GLL O;  3THW B;  2G8F A;  3MXJ A;  4QS9 A;  2CB8 A;  3U8X A;  4DS5 A;  1ATN A;  3KVG A;  4DFJ A;  5KGX A;  1SKW A;  4JKA A;  4N76 A;  3O8M A;  3AVC A;  4CIF A;  1IV0 A;  5C42 A;  4JKG A;  4HCC A;  4C8M A;  3HM8 A;  3NF7 A;  3KK3 A;  4LFB K;  3AO1 A;  1O1W A;  1U47 A;  3F9M A;  1IBM K;  4O0J A;  4KKO A;  1IG9 A;  4JI5 K;  3MDQ A;  1T8E A;  1WSE A;  3PX4 A;  3SV3 A;  1U6Z A;  4CK3 A;  4JKB A;  3CC4 N;  2PZS A;  4F4K A;  5GAE P;  2UU9 K;  2P9U B;  4XEI A;  3GDQ A;  5AQQ A;  2JWL A;  2Q97 A;  4BWJ A;  4CK2 A;  4QCL A;  4FWP A;  2EHG A;  1OVY A;  4CJ4 A;  1BU6 O;  1GLA G;  5GAH P;  3UKU B;  4RWT A;  1OH8 A;  1Q18 A;  3AU4 A;  3HTV A;  2YHX A;  1QHT A;  2IDO A;  3ATV A;  2DPN A;  2XRI A;  3ZSR A;  1BL3 A;  1R59 O;  5CY4 A;  4CZK A;  4FZX C;  5C10 A;  4K25 A;  3SCX A;  1EWQ A;  3SUN A;  2VG7 A;  3LDO A;  4M3X A;  4CVN E;  4A57 A;  3MED A;  2QM1 A;  1QQO A;  3VN5 A;  2XO7 A;  3OBY A;  1T6C A;  4CZG A;  4BRP A;  1L3S A;  2FSN A;  1VQL N;  1U48 A;  4FVM A;  3P1G A;  5GIP A;  2YKN A;  5CZ2 A;  3O9U A;  3ZX2 A;  3T3F A;  3GE1 A;  4U67 L;  1RBT A;  2ZF5 O;  2O8C B;  4Z4I A;  3SUO A;  3TAG A;  3AAQ A;  2A1R A;  4H0P A;  4BGA A;  4PKG A;  4B9S A;  1BCM A;  1E4G T;  3QB0 A;  2RKI A;  3LWL A;  4JYA K;  1T44 A;  2EWS A;  4BVP A;  3OVN A;  4GV3 A;  2D10 A;  1HPZ A;  4FWS A;  5FRO A;  4CIE A;  1CLQ A;  1W97 L;  4IWV A;  3S3O A;  4DR5 K;  4K8Z A;  1Z25 A;  4MLE A;  3AO2 A;  1KVA A;  4KBO A;  1ZBH A;  1VQP N;  4CGI A;  1MIX A;  3HT3 A;  5M1Q A;  3RMB A;  3SUP A;  1E3M A;  4FK0 A;  4BRH A;  3B8A X;  4CGG A;  1TV6 A;  3C7N B;  4MDB A;  3CCU N;  4K8X A;  1HBK A;  2O4I A;  1HMV A;  4YDU A;  1G15 A;  1XUP O;  4H5V A;  3Q7C A;  3QNO A;  1TUU A;  2AA4 A;  4IBN A;  2AP1 A;  4V19 S;  3O4W A;  5AZI B;  2ZQB A;  3DRP A;  3CJC A;  4BR2 A;  3PO4 A;  1XQS C;  2QXL A;  2HVH A;  3CIP A;  3THY B;  3BEX A;  1RCH A;  1NI2 A;  3BUZ B;  3MN9 A;  3FZL A;  1QQN A;  3CER A;  5KPR A;  3NMU A;  1NGF A;  1OVQ A;  1SV5 A;  5BRD A;  4ELU A;  1A5X A;  3QER A;  2HHW A;  1JCF A;  1IG8 A;  2A42 A;  4DU4 A;  3BF3 A;  3H1Q A;  1VSM A;  4A62 A;  2FDQ A;  5AZJ B;  4YOR A;  3OYB A;  3OYA A;  4KHY A;  4BC3 A;  2WUS A;  4BDY A;  1YUW A;  4BR7 A;  1NGB A;  4DR6 K;  4O8U A;  4J2B A;  1LAV A;  1ZYQ A;  1QE1 A;  4JRP A;  4JEP A;  3OHR A;  3LL3 A;  1Q7Y O;  3AVN A;  4YOY A;  5FLX O;  3SI6 A;  1TVR A;  1X9S A;  4FJJ A;  2A1S A;  1S1W A;  3OYM A;  4P7I A;  5JIC A;  1TAU A;  1XHZ A;  2HNZ A;  3VA0 A;  4WQ5 A;  2VG5 A;  3OYL A;  1W9H A;  2NRV A;  1QZ5 A;  1RTI A;  1BA1 A;  2IGI A;  4EP4 A;  2KFN A;  3E1Y A;  4I6M A;  3T7Z A;  4BRC A;  4R5P A;  2ZGZ A;  2JWK A;  4Q5V A;  4DTO A;  3KKS A;  2YV0 X;  3DMJ A;  4F9O A;  1WSG A;  3EE9 A;  2DTU A;  4AQY K;  3DLE A;  3AGR A;  2O8D B;  3M5R A;  4OPK A;  1EXQ A;  3J7A P;  5ADX H;  4DWI A;  1YF5 L;  3F9K A;  3P39 A;  4FJX A;  1N5Y A;  1W2B M;  3PZD A;  4QS8 A;  4CFA A;  4H0V B;  4HTL A;  3K9J A;  4CHP A;  4JS4 A;  1TKT A;  1OH7 A;  3OS2 A;  4NYN A;  4MQ3 A;  2QWP A;  3MX2 A;  4FZZ A;  3KWI A;  4FJL A;  1C0M A;  4YDU C;  1KD1 O;  2VQE K;  1GLB G;  4LD0 A;  3J8A A;  1E4F T;  4E1M A;  4BRE A;  3RTV A;  1T05 A;  1X9J A;  1HYS A;  4WFA L;  3K0S A;  3SYZ A;  3ZT2 A;  3CYM A;  4K42 A;  4YY3 K;  4O4G A;  1RDW X;  3AO4 A;  3ZSV A;  4CJK A;  3CD6 N;  1K8K A;  1TK8 A;  3K9K A;  1FK9 A;  4FK2 A;  2QXF A;  4DSI A;  2P9K A;  3C94 A;  2HRJ A;  1S9G A;  3V9U A;  4OJR A;  3CJ1 A;  1WLJ A;  3LPT A;  4DFK A;  5FPE A;  5CYQ A;  4CE9 A;  3SJH A;  4CEO A;  3CJA A;  1IKX A;  1KRP A;  1NK6 A;  3V9W A;  2WON A;  4LC9 B;  4AHC A;  1WSH A;  3C6A A;  1BIU A;  1A5V A;  3HO1 A;  3NHG A;  2YNF A;  4BQZ A;  3SQ0 A;  4AHT A;  3VGM A;  3DLR A;  1LW2 A;  4CYE A;  2DFF A;  2UXB K;  3ENO A;  1D9D A;  3VF6 A;  4MO4 A;  3VF4 A;  5E26 A;  1NGD A;  1YIT N;  4IXC A;  1VQK N;  5HL7 L;  1C0T A;  3M3Z A;  5CZ1 A;  1XMQ K;  2FBX A;  1YTU A;  4FK4 A;  1ZXO A;  4FSV A;  4EKU A;  4X62 K;  3BF1 A;  2VWB A;  2OTJ N;  4H5N A;  3O9Q A;  1YVU A;  2NZT A;  3AY9 A;  4OPJ A;  4FPB A;  4BWM A;  5HLF A;  4OGC A;  5TKY A;  1JL2 A;  1SGH A;  2QWM A;  3D2E A;  1EF1 A;  3CM6 A;  3WUH A;  1VBH A;  3OYG A;  1JLB A;  2D5R A;  1NJX A;  4FJ9 A;  4ZRK A;  1OH6 A;  5C12 A;  4KRE A;  1H1V A;  1V4S A;  4H0T B;  1YI2 N;  1D5A A;  1ITG A;  2P9I B;  3P5J A;  4FWR A;  3S3M A;  1RBR A;  3X23 A;  3A8Y A;  3WEE B;  5KPZ A;  4KRF A;  1N34 K;  3V6D A;  1C1A A;  5AQZ A;  4ZTJ A;  5AQS A;  4DFP A;  4BC2 A;  3VOV A;  1HB6 A;  3QIJ A;  3O1B A;  3HSC A;  4FJG A;  4OO1 J;  4C8K A;  3AO3 A;  4EAH D;  1MK7 B;  3WT0 A;  3DWL A;  4DU3 A;  3VTH A;  1R0A A;  3ZEU B;  2GWK A;  3O9S A;  1JLE A;  2P9P A;  4KTW A;  3VEN A;  1BG3 A;  4N56 A;  4JRQ A;  4Z4C A;  2E1Z A;  5DM6 L;  1QVG M;  4CZH A;  2YHY A;  2GEL A;  3KJV A;  1MIZ B;  4GVM A;  3DXK A;  3J7Y P;  1U04 A;  3G6E N;  4WE1 A;  1TK0 A;  4RW9 A;  3FE1 A;  4I2Q A;  3OBW A;  4DKW A;  4IOC L;  3LP2 A;  3VQD A;  4GKJ K;  1GLE G;  1ZBU A;  1N32 K;  3S41 A;  4FJH A;  3QET A;  1XNQ K;  3U4L A;  3WQT A;  4OKE A;  1KAX A;  4OLA A;  4BRI A;  1NMN A;  1MU2 A;  5F2R A;  4FW1 A;  3SUQ A;  2ITG A;  4B1U B;  3K5L A;  2VWJ A;  3HXM A;  5BRF A;  3I0R A;  1HYV A;  2F4V K;  5AJ3 K;  1IKY A;  1LCU A;  3SPZ A;  2ZM6 K;  3KLF A;  2ZGY A;  4H0O A;  4BRF A;  4NCG A;  1YJW N;  4IOX A;  1TYQ B;  3ZT0 A;  3RSE B;  3R9P A;  5HOO A;  3HOS A;  1S9E A;  4AM7 A;  3QNN A;  1FKP A;  4JLH A;  1J53 A;  4KO0 A;  2BTF A;  3UIQ A;  2R7Y A;  3CQX A;  1WAJ A;  4RW8 A;  1IKV A;  5HRP A;  4ELV A;  2YX6 A;  4A2B A;  2OPR A;  1S72 N;  4DHY A;  4ID1 A;  3SQ1 A;  3ENB A;  1XNR K;  2F8T A;  4Z94 A;  2A41 A;  4CF1 A;  3PIP L;  1NJY A;  1K8A O;  3CC2 N;  4CK1 A;  4KPY A;  4FO0 A;  3TR8 A;  2GX9 A;  2O8F B;  4A61 A;  1ZBF A;  1NGA A;  2I1K A;  3LWM A;  1NOY A;  3A5L C;  3DXM A;  4NCA A;  5JS2 A;  4CBU A;  3IFR A;  1WSJ A;  4XH4 A;  1HB8 A;  2IAJ A;  4OX9 K;  1XC3 A;  5C2F A;  3M8R A;  2RN2 A;  2RQ1 A;  3MEG A;  3CPE A;  3W3D A;  4B1W B;  4WCE L;  3DLL L;  1LOT B;  5BN8 A;  1Q86 O;  1EP4 A;  4H4O A;  3OYF A;  4XH1 A;  2A3Z A;  4ISE A;  1J19 A;  1GLJ O;  3FR0 A;  4CCH A;  4OPH A;  2NRZ A;  3NF9 A;  4J8F A;  5EU7 A;  1B9D A;  1YXQ A;  2H3G X;  3TAP A;  3I8D A;  1JLQ A;  3THV A;  3AVM A;  3ULD A;  5KPT A;  3TSU A;  1NK9 A;  1VK0 A;  2AL6 A;  4CEZ A;  2A6A A;  2Y1J A;  4CBX A;  2YNH A;  1GG3 A;  4IG3 A;  4X66 K;  4DSJ A;  2CH5 A;  1HKC A;  3G10 A;  4JI0 K;  1ZBL A;  1SZ2 A;  3P4I A;  3DAW A;  3KK7 A;  4FLV A;  4BRO A;  3UKR B;  4KAZ A;  3G4S N;  4ZRI A;  1CXQ A;  4E3S A;  5GAG P;  5M1O A;  2W40 A;  2LBB A;  5KTQ A;  1JKH A;  2HF4 A;  3TAR A;  4OGE A;  4IKF A;  2XY8 A;  1DLO A;  1EET A;  2ZE2 A;  4LF7 K;  1VSH A;  2OPS A;  3MWP A;  3G0Z A;  2QWO A;  4KI6 A;  3L3U A;  3KKR A;  1LWC A;  2HBJ A;  4BR0 A;  2IVN A;  1MK9 B;  4FOE A;  1GC6 A;  2QWR A;  4C8N A;  3GBT A;  3QEX A;  3QIP A;  1I3A A;  3RRG A;  3FFK B;  4DSE A;  4CW7 B;  5I42 A;  5BR9 A;  2O8E A;  1WNS A;  3WNF A;  4CHQ A;  4QOZ B;  5B8H A;  1N33 K;  1HLU A;  4CJ5 A;  2QKB A;  3PLA A;  3MEE A;  4DLG A;  4CFB A;  4DR3 K;  2E2P A;  2O8B A;  4E1N A;  3PSI A;  2ZJR L;  4YOW A;  3IVF A;  1NK0 A;  2P9N A;  3LM2 A;  3KLG A;  3QO9 A;  1BQN A;  2PYJ A;  1FKO A;  4IO8 A;  4ZRJ A;  1KSP A;  4RW6 A;  5AQK A;  3V9Z A;  4B1Z A;  4FWL A;  4E7J A;  1JLF A;  2OZM A;  2F8S A;  1UA1 A;  2YKM A;  4B9M A;  2PAV A;  2FSJ A;  3FZK A;  3ENH A;  1BI4 B;  1YHQ N;  4IEI A;  1XHX A;  4WYB A;  5HRN A;  3V9X A;  4TKN A;  3C0B A;  3OTO K;  3LZJ A;  3ZLJ A;  3CFP A;  3AAR A;  2EMS A;  3JXU A;  2F9T A;  3EYZ A;  1T7P A;  3M1F A;  1N36 K;  1RT1 A;  3AU5 A;  1MDU B;  2Z1H A;  1UAX A;  3ISN C;  2ZD1 A;  3DM2 A;  4CHO A;  4CI6 A;  4O5B A;  4JK7 A;  1BCO A;  3I33 A;  3D7E O;  2ABD A;  3DOL A;  3JS6 A;  3K5O A;  3L8B A;  3T1H K;  4LY7 A;  2J0K A;  5EOY A;  5EY4 A;  4JV5 K;  3AGK A;  3TPQ A;  1QVF M;  3AA4 A;  2D0P A;  5J2M A;  2P9L B;  3E9O A;  3SAG A;  1WSF A;  1N8R O;  1VQ9 N;  4JK9 A;  1DT9 A;  4WQ4 A;  3LDN A;  4YHH K;  2KKZ A;  1S1U A;  1IO2 A;  1ISN A;  4CJL A;  1JCE A;  3TTC A;  3ZET A;  1LAW A;  1QSY A;  4RW4 A;  2P9S B;  2FBV A;  1RDD A;  1JL1 A;  1WUA A;  1O13 A;  4KI4 A;  1G99 A;  1HUX A;  4EIA A;  1YAG A;  2FF3 B;  3AV9 A;  3CQY A;  2V52 B;  1DKG D;  3THX A;  1EO1 A;  4GXB A;  3MXM A;  1ASW A;  2QWQ A;  3BY5 A;  3BZC A;  4CIG A;  4DR2 K;  2QEX N;  3AA2 A;  4JD2 B;  3PY8 A;  1RTJ A;  2BUP A;  4BAC A;  4GMJ B;  3RMD A;  4BY9 C;  3AVJ A;  1SL1 A;  3DLG A;  1D4X A;  3ZT3 A;  4IFE A;  4JHD B;  1RIL A;  4DTP A;  4KTZ A;  2YJF A;  3NF6 A;  4FJM A;  4ISF A;  2NUB A;  4B8C A;  3AVK A;  3D2F A;  3T19 A;  1VSL A;  3O9R A;  2VGN A;  1S6P A;  5AQH A;  4Y0W A;  1HX1 A;  3QFU A;  4M7Y A;  4EHT A;  2YHB A;  2OPP A;  1SS6 A;  3GOI A;  3L2U A;  4DV1 K;  1VQO N;  5GIN A;  1RBU A;  5JLF A;  4B3S K;  2Q3S A;  3SNN A;  3K57 A;  3H45 C;  4NO7 A;  3TTF A;  3QIO A;  1F21 A;  5AQF A;  4BC5 A;  4DTS A;  4EZ9 A;  3ASM A;  2PYL A;  2W6L A;  3D45 A;  2D0O A;  5FPD A;  4F7G A;  3V9S A;  3OS1 A;  1U2V A;  4HDQ A;  5JVL A;  4BG8 A;  4DV3 K;  1JCG A;  1K9M O;  1TKX A;  4JNE A;  5CHI A;  3IUC A;  4Z0U A;  4BRA A;  4GNI A;  1NK4 A;  5HRS A;  3HVT A;  3HPG A;  4B1V A;  3WXM B;  1TK5 A;  2HHV A;  1VQM N;  1RTH A;  4WQ4 C;  1NJZ A;  4UY8 O;  4DF8 A;  4JAX A;  4B1Y B;  2E2O A;  5AQR A;  1GOA A;  1ACA A;  5C2D A;  2A40 A;  3FZF A;  3J7Z O;  1TGO A;  4BE1 A;  5AQN A;  3TAF A;  1NMD A;  2GEM A;  3VER A;  4FJ8 A;  1OKJ A;  4W5T A;  1SAZ A;  3ZX3 A;  1GLF O;  2OYQ A;  2P9U A;  4YL8 A;  3DRR A;  3KLI A;  4MO5 A;  1UA0 A;  3WA0 A;  3VQP A;  3RMA A;  1S22 A;  5C0Y A;  1VSJ A;  4ILJ A;  4FWN A;  3UKU A;  4LF9 K;  1VSE A;  3OYH A;  1RDA A;  2CQU A;  4A5A A;  4BVO A;  1YVN A;  1X9M A;  3LP0 A;  2AJQ A;  1KVB A;  3NGY A;  4OVL A;  4CEQ A;  2HBK A;  1QTM A;  2YJE A;  1ZC6 A;  3WNE A;  1C0F A;  2Q36 A;  3KZB A;  1BWF O;  4BRQ A;  5HRO A;  3TWH A;  5C15 A;  5FPM A;  4A2A A;  1QZ6 A;  1YIJ N;  2O8C A;  1S5J A;  3R6M A;  1NOZ A;  3BZK A;  3WXI A;  4OLB A;  1HQU A;  3D6R A;  4KH5 A;  3CPW M;  2CGK A;  1B92 A;  4J2D A;  1VSD A;  4BR5 A;  3EE8 A;  2Q0U A;  2D0B A;  2NRR A;  3KK2 A;  4YOX A;  2QTD A;  1WN7 A;  3WXK A;  1RFQ A;  2E1Y A;  4O8K A;  1Y97 A;  3V1Q A;  4KHS A;  3KLH A;  1GLC G;  4B3R K;  1L3U A;  3C65 A;  5DK5 A;  1VQ7 N;  3NFA A;  2D0A A;  4XH5 A;  1HKB A;  2BDP A;  4JKE A;  3VQQ A;  3G9W A;  5KI6 A;  1GGO A;  4CF9 A;  4DUZ K;  4JI8 K;  4IOA L;  3C7N A;  4FM1 A;  5E84 A;  5AR0 A;  1ATR A;  2NNW A;  4CEB A;  3HP9 A;  3CM5 A;  4Q0B A;  5AZI A;  4WQ5 C;  4CHY A;  3R8E A;  1TKD A;  2G8K A;  3T1A A;  1NKC A;  4F3O A;  3O80 A;  2CH6 A;  4CEA A;  4KHQ A;  2HBL A;  3THY A;  3A5O C;  5JVG L;  1CZ9 A;  3HYF A;  3M6G A;  2IS3 A;  1M90 O;  4IEE A;  2PFU A;  4AM6 A;  4JKC A;  3LP3 A;  3QEI A;  4FLX A;  1V4T A;  3HST B;  4JK8 A;  5AZJ A;  5AQW A;  5A2Q O;  3ALY A;  4DXA B;  4BQL A;  4CJP A;  3O1W A;  4RCH A;  3OYJ A;  3JYT A;  1Q81 O;  4OKK A;  1YJN N;  4NXN K;  2IC3 A;  2VWK A;  1RDB A;  1KTQ A;  3O5B A;  3JSM A;  1KVC A;  1NGE A;  4DTR A;  1SKR A;  3ZSQ A;  2HVI A;  2DFE A;  4M3T A;  5I9E B;  4KHU A;  2DFH A;  3WXL A;  1RGI A;  2W41 A;  3PX6 A;  3H1V X;  4CHN A;  5GIO A;  3WNH A;  1H4R A;  3OJU A;  2HMI A;  2DIK A;  3EKS A;  1A5W A;  1KC7 A;  5JVH L;  3MX5 A;  3DI6 A;  3MXI A;  3I8B A;  4KB1 A;  4QAG A;  5BPL A;  1KAY A;  3SQ4 A;  3H46 O;  4FJN A;  2D1K A;  3VF2 A;  3LZI A;  4PY5 A;  3IDH A;  5AQU A;  4H5R A;  3CF5 L;  3TAQ A;  4YOV A;  1ILY A;  4HCB A;  4FWQ A;  1RDC A;  3CCL N;  1Q8I A;  5ELZ A;  3FLC O;  4E89 A;  1Q9X A;  3N4Q A;  2GTD A;  4Z4H A;  4H8K A;  4B9U A;  1BO5 O;  4CZJ A;  2O8D A;  3KLE A;  3OYC A;  4GW6 A;  5IT9 O;  5CR4 A;  1T6D A;  4BRN A;  4DMN A;  2EMT A;  3U7D A;  5CE3 A;  4I9Q A;  1KXP A;  3PUF A;  1IH7 A;  3IG1 A;  4BDZ A;  3DJC A;  1HPM A;  4JKD A;  1Z6R A;  4WF9 L;  3VEZ A;  2HBM A;  3CMA N;  2Q0R A;  3ZYY X;  5KQD A;  2B4J A;  1B9F A;  4Z4E A;  3C6U A;  5HRR A;  5M1K A;  2NRX A;  3A2F A;  1JLG A;  5JMV A;  5JLH A;  1WSI A;  2HOE A;  1NJW A;  3VES A;  3ZSW A;  4FXD A;  3T69 A;  2YHA A;  1QSL A;  3L6Q A;  1D8Y A;  5J1E A;  3LAM A;  4CJR A;  3QES A;  3M8S A;  4DV7 K;  1JXE A;  4PQU A;  2V7Y A;  3CJ7 A;  4B3M K;  4IJN A;  4ILH A;  1EWR A;  2Z1I A;  4M41 A;  4O55 A;  1IBL K;  2FBT A;  2ZPY A;  4IDH A;  3SAH A;  3S3N A;  3AVL A;  1LWE A;  3AO5 A;  4B9L A;  3RRH A;  5ADX A;  3SV4 A;  3ZCM A;  1NG9 A;  1K73 O;  1D9F A;  2HHX A;  3LDS A;  1Z05 A;  4FCY A;  3HZ6 A;  4FM2 A;  1P90 A;  1IKW A;  4H5W A;  4X65 K;  4CJF A;  2P5G A;  5M1P A;  4CBW A;  3TAB A;  3ULE B;  3AVB A;  5IJM A;  3TSP A;  3KWG A;  4JI3 K;  3MEC A;  1HJR A;  1KCF A;  3ZSZ A;  2NRH A;  4DQQ A;  4TSX A;  1JXB A;  4CFC A;  4PUO A;  4DTX A;  2RHK A;  3AVI A;  1BQM A;  3EEQ A;  1TL3 A;  4PHT X;  3U8Z A;  1XWL A;  4ID5 A;  4B1X B;  4K41 A;  3L2W A;  4JKG B;  2JGU A;  4CGD A;  1LW0 A;  1NTI A;  2UXC K;  4ELT A;  5AFU H;  1KAZ A;  1Z26 A;  3MCP A;  4AF1 A;  2W42 A;  1N6Q A;  1KQS M;  4DS4 A;  1SL0 A;  1X9W A;  4FLW A;  2FJ9 A;  3EY1 A;  1DIK A;  3QDK A;  3EN9 A;  3C95 A;  1KFS A;  1QQC A;  2P9I A;  3VPZ A;  5GAD P;  3AA5 X;  2QW9 A;  4DQI A;  2E6M A;  5KRT A;  3MN6 A;  3H3O B;  3WEE A;  4L8R B;  3O3H A;  2HNY A;  1NJI O;  3C6H A;  3NBP A;  1L5U A;  1J6Z A;  4X64 K;  3VEO A;  3HPH A;  3F5T A;  1NU0 A;  1UOC A;  4K0K K;  2FXU A;  4EZ6 A;  2NLX A;  4M3Y A;  1BGX T;  3EZW A;  1RBS A;  4CD1 A;  4DB3 A;  3ZEU A;  3SBG A;  4PWD A;  4GV6 A;  2Y1I A;  1P8Z A;  4FVU A;  3CCV N;  4KHN A;  1RT5 A;  2QWL A;  2OPQ A;  4Y1D A;  1U45 A;  3ATU A;  4E7I A;  2VGM A;  4JI4 K;  2CGJ A;  3L4I A;  4YOT A;  3QBX A;  4KHW A;  4FL9 A;  1HKG A;  2I7N A;  1REV A;  1ESV A;  4IZ9 A;  4HHT A;  1NWK A;  3UB5 A;  2HHH K;  4NLB A;  4JN4 A;  1VSI A;  1NGH A;  3HM9 A;  4HTU A;  2G8V A;  3A0I X;  1S6Q A;  2QWN A;  5TKW A;  3LDP A;  2RPI A;  3WNG A;  5J2N A;  4MDA A;  3EL2 A;  3IMX A;  4FLU A;  2ITM A;  5FDL A;  1WBB A;  2CGL A;  2I5J A;  1X1P A;  1NKE A;  3OYD A;  5AQL A;  4N5S A;  3D0P A;  3WQU A;  5K14 A;  4XIU A;  3T1Y K;  4FLY A;  1NK7 A;  1CZB A;  4CZL A;  5AQV A;  3BP8 A;  2UXD K;  2HE7 A;  1TYQ A;  4H03 B;  4BRD A;  1WAF A;  4IJA A;  1MWM A;  3RSE A;  1W0H A;  3VTI A;  3A5M C;  1L3V A;  1ZBS A;  4GVE A;  2YNI A;  4C1N K;  4CZI A;  2E8A A;  2FLO A;  4DFM A;  3PSF A;  3U9Z A;  3IKM A;  1E5W A;  1Y19 B;  2P51 A;  5FPN A;  4HUF A;  2PY5 A;  1J9A A;  1HNV A;  1NK8 A;  1VSF A;  3CCM N;  1XMO K;  2O8F A;  4C1N I;  4HUE A;  4M63 C;  4CJT A;  4W5Q A;  1KFD A;  3L4Q A;  5D3G A;  2HF3 A;  5AQI A;  3F73 A;  1XI1 A;  3OYK A;  4H5T A;  1C1B A;  3NH1 A;  2P5O A;  3O3G A;  5AQP A;  2RE2 A;  4PA1 A;  3DLB A;  3R1X A;  3DLK A;  1ASV A;  4DR1 K;  2GV9 A;  2IVO A;  4FJ7 A;  2D11 A;  2I1J A;  4M42 A;  4OKJ A;  3NF8 A;  5M1N A;  1HNI A;  2B6A A;  2YVC A;  1L3T A;  3WXJ A;  4CJ3 A;  5KRS A;  4LH4 A;  1S1V A;  5IWA K;  3P38 A;  3ZDT A;  4I6M B;  4MLH A;  4DG1 A;  3ZT4 A;  3Q7B A;  1LV5 A;  1C1C A;  4N41 A;  4HVJ A;  2EX3 A;  5AQO A;  3MN7 A;  3ID6 A;  4BR9 A;  3LDQ A;  1RNH A;  2W6K A;  4JKH A;  4O0I A;  2J0M A;  3LAN A;  4RW7 A;  4CF8 A;  3CXC M;  2WH5 A;  4DQR A;  4M3Z A;  3I55 N;  3UKR A;  3NH0 A;  3FZH A;  3B6P A;  1VRU A;  4CJE A;  3SQ2 A;  4DR7 K;  2F9W A;  2D4W A;  3CJ9 A;  3NGZ A;  4NXM K;  1J5E K;  2G8U A;  4LH5 A;  3I56 N;  5CYM A;  1FJG K;  4B3O A;  4E7L A;  4JS5 A;  3P31 A;  3U3G A;  2PBD A;  2ZJP L;  3VET A;  2UUB K;  3QML A;  1CZA N;  1KLN A;  3M8P A;  4NYF A;  2LSN A;  3LM9 A;  4LSL A;  4YNQ A;  5EXW A;  3J80 O;  5AFU A;  1QQM A;  1HRH A;  1BDG A;  1X3M A;  3V1O A;  2HHS A;  1ASU A;  1VHX A;  3CI5 A;  3O08 A;  2XY5 A;  2E88 A;  3QLH A;  2O4G A;  3HI0 A;  4CGF A;  4CF0 A;  4DQ8 A;  4E19 A;  1WB9 A;  2RF2 A;  3QBW A;  1K8K B;  4LFA K;  4PKH A;  4WFN L;  4DTU A;  2WOM A;  2YHW A;  1NBW A;  4PL8 A;  5AQT A;  5BPN A;  3SMP A;  2P9K B;  4W5N A;  4ZTF A;  4IG0 A;  3DRS A;  3LAL A;  1HQE A;  4EP5 A;  1YT3 A;  4I7F A;  3VQC A;  1C0G A;  2QKK A;  2A5X A;  3VQ8 A;  3VEV A;  1T03 A;  2IVP A;  4KFB A;  5FRM A;  1I39 A;  1YTA A;  1RT6 A;  3CC7 N;  2X0S A;  1VQ8 N;  4BDP A;  4C8L A;  4LF4 K;  5DM7 L;  4DQP A;  4ISG A;  4BRM A;  3PX0 A;  1HNZ K;  3THW A;  3MN5 A;  1DTQ A;  3K59 A;  2J4R A;  3MCA B;  3KHY A;  1VQ6 N;  2J0J A;  3EPY A;  3VEX A;  3CET A;  5MLC Q;  4FOI A;  5HP1 A;  3TU5 A;  1M1K O;  1BI4 A;  1EX4 A;  3SAF A;  3NCI A;  3GG4 A;  3VEW A;  3VGK A;  2WFB A;  4LF5 K;  4FWM A;  3HPO A;  4DF4 A;  1Q82 O;  3HJF A;  1ATS A;  3KD5 E;  2ZWH A;  2GUI A;  4H4M A;  4CED A;  2G8H A;  2E2N A;  5FRN A;  3LAK A;  3GL1 A;  2NRW A;  3D2E B;  4HUG A;  5KQ8 A;  3CG7 A;  1OH5 A;  2OZS A;  1KC8 O;  3PVL A;  3PV8 A;  1S1T A;  4DTJ A;  3ZT1 A;  1VBG A;  2E6L A;  2FF6 A;  1HR0 K;  4BGB A;  4K43 A;  3O9T A;  3TAM A;  3M8Q A;  4HWI A;  3LDL A;  4CJW A;  3NAE A;  5C25 A;  5BPM A;  3KD1 E;  4F8R A;  4JI2 K;  4LF8 K;  2P9L A;  3IRX A;  4R79 A;  3QIC A;  4HDO A;  3ZSO A;  2BGG A;  4CHZ A;  4F2S A;  4E1J A;  2IIR A;  2OA8 A;  2COP A;  1BIZ A;  5F1X A;  1KLM A;  3TSQ A;  3CHW A;  2HHQ A;  4DU1 A;  2E4L A;  5AQM A;  2P9S A;  2P9P B;  4AHU A;  4M3U A;  2BAN A;  1MWK A;  3G71 N;  2BH1 A;  4FJK A;  1ST7 A;  3H6E A;  2VQF K;  1QS4 A;  3SK3 A;  3DXK B;  5BRE A;  2XY6 A;  3VQ9 A;  3VMF B;  1XC9 A;  1KBL A;  2F96 A;  3K5N A;  3RR8 A;  4JI7 K;  4B9Q A;  3QEP A;  3F2K A;  2KLA A;  3FFI A;  4DV5 K;  3EO3 A;  3ID8 A;  1CXU A;  4JD2 A;  5LL6 Z;  1GOB A;  3K58 A;  4GV9 A;  4FWK A;  3CQ8 A;  3NVK A;  4M3R A;  4BRK A;  4NCB A;  3LPU A;  5HBM A;  2OCE A;  1Q9Y A;  4FPA A;  4CD3 A;  4B9T A;  3VQ6 A;  1SUQ A;  4JHD A;  3QFP A;  3VQ4 A;  2FBY A;  5LMU K;  3MWT A;  1NM1 A;  5JS1 A;  4I9L A;  4B9N A;  1W7A A;  3BDP A;  1JJ2 M;  4LF6 K;  4FYD A;  2GWJ A;  1BUP A; 
#chains in the Genus database with same CATH homology
 4BRH A;  3B8A X;  5BN9 A;  1RDU A;  3C7N B;  4MDB A;  3CCU N;  3FLV A;  1HBK A;  2ZPY A;  4IDH A;  4G9Z A;  3SMS A;  3SAH A;  4YDU A;  2E2P A;  3RVC A;  4H5V A;  1XUP O;  3G25 A;  3Q7C A;  1TUU A;  2AA4 A;  3VGL A;  2AP1 A;  3O4W A;  5ADX A;  2ZJR L;  5AZI B;  4YOW A;  3IVF A;  4NB4 A;  3CJC A;  4GY2 B;  2P9N A;  4BR2 A;  1XQS C;  2QXL A;  3LM2 A;  1K73 O;  2NRT A;  1Z05 A;  3CIP A;  4IO8 A;  3BEX A;  3BUZ B;  1NI2 A;  4ZRJ A;  2WC9 A;  3HZ6 A;  3FZL A;  1P90 A;  1QQN A;  3MN9 A;  4H5W A;  3CER A;  4YOU A;  5KPR A;  5AQK A;  5M1P A;  4CBW A;  3ULE B;  3NMU A;  1NGF A;  4B1Z A;  4OPA A;  5IJM A;  3TSP A;  3KWG A;  5BRD A;  4FWL A;  1JCF A;  1IG8 A;  2A42 A;  4FWO A;  3BF3 A;  3H1Q A;  4A62 A;  2FDQ A;  3H3N O;  5AZJ B;  4JKF A;  2NRH A;  4YOR A;  4BRG A;  4BC3 A;  2WUS A;  2PAV A;  1BA0 A;  2FSJ A;  1YUW A;  4BR7 A;  1NGB A;  2RHK A;  3FZK A;  4O8U A;  3ENH A;  1YHQ N;  4NY0 A;  3DXM B;  4IEI A;  3L0Q A;  4M7X A;  1S3X A;  4PHT X;  3E9L A;  4WYB A;  3U8Z A;  4TKN A;  4JEP A;  3C0B A;  3NVM A;  3OHR A;  4K41 A;  4B1X B;  5LJW A;  3LL3 A;  1Q7Y O;  2KHO A;  3W0L A;  4JKG B;  3CCJ N;  4EFH A;  1WOQ A;  4YOY A;  3AAR A;  2EMS A;  4WFB L;  3HOT A;  3JXU A;  2F9T A;  3G4S N;  1NTI A;  3M1F A;  5AFU H;  1KAZ A;  3AU5 A;  3MCP A;  4AF1 A;  1KQS M;  1MDU B;  4RTF D;  4P7I A;  5JIC A;  1GC7 A;  4O5F A;  3E66 A;  2FJ9 A;  4WQ5 A;  4CI6 A;  4JK7 A;  1DIK A;  2NRV A;  2OAN A;  3I33 A;  1QZ5 A;  2ABD A;  3D7E O;  3QDK A;  4KH6 A;  4CZE A;  3HRG A;  3N4P A;  3EN9 A;  3JS6 A;  3AAP A;  1NVL A;  2P9I A;  1BA1 A;  1DGK N;  3VPZ A;  5GAD P;  3E1Y A;  2QW9 A;  4I6M A;  3T7Z A;  4BRC A;  1EQY A;  3CME N;  2ZGZ A;  2J0K A;  3HBT A;  5AQJ A;  5EOY A;  3MN6 A;  2JWK A;  3H3O B;  3WEE A;  5EY4 A;  4BR4 A;  3AGK A;  3TPQ A;  1QVF M;  2D0P A;  1NJI O;  3C6H A;  1J6Z A;  2P9L B;  3E9O A;  3SAG A;  1N8R O;  3VEO A;  1VQ9 N;  4F9O A;  4JK9 A;  3EE9 A;  2V7Z A;  1DT9 A;  4WQ4 A;  3F5T A;  3LDN A;  3SBT A;  2KKZ A;  4CJ7 A;  3AGR A;  4U7B A;  1ISN A;  3M5R A;  1JCE A;  2FXU A;  3TTC A;  5ADX H;  1YF5 L;  2NLX A;  3ZET A;  3EZW A;  3P39 A;  1W2B M;  4CD1 A;  2ASM A;  3ZEU A;  4H0X B;  3PZD A;  4QS8 A;  3SBG A;  4H0V B;  4DB3 A;  2P9S B;  4GV6 A;  4NLC A;  4HTL A;  1P8Z A;  3K9J A;  4FVU A;  2VCP A;  1WUA A;  1O13 A;  3CCV N;  2QWL A;  2QWP A;  3MX2 A;  1G99 A;  1HUX A;  3KWI A;  3ATU A;  1YAG A;  3CJB A;  4EIA A;  2FF3 B;  1TUY A;  5M1F A;  2FSK A;  2VGM A;  3CQY A;  2V52 B;  1DKG D;  2D2Q A;  4PL7 A;  4YDU C;  1EO1 A;  3FZM A;  4GXB A;  1KD1 O;  2CGJ A;  3L4I A;  2HMP A;  1GLB G;  2QWQ A;  4YOT A;  1MA9 B;  3QBX A;  2Q31 A;  3J8A A;  1E4F T;  4FL9 A;  4BRE A;  4KH4 A;  1HKG A;  2QEX N;  2I7N A;  1ESV A;  1X9J A;  4IZ9 A;  4WFA L;  4JD2 B;  4A59 A;  1NWK A;  2E2Q A;  3UB5 A;  2BUP A;  4NLB A;  2OTL N;  2F7T A;  4JN4 A;  1NGH A;  4K42 A;  4BY9 C;  3A0I X;  2QWN A;  5TKW A;  3LDP A;  3R3L A;  1RDW X;  1D4X A;  3O6W A;  4MDA A;  3EL2 A;  4IFE A;  4JHD B;  2YCH A;  3IMX A;  2YJF A;  3CD6 N;  1K8K A;  3K9K A;  2ITM A;  4ISF A;  2CGL A;  3D2F A;  4B1U B;  3VEY A;  2P9K A;  3O9R A;  2VGN A;  5AQH A;  2HRJ A;  4Y0W A;  5AQL A;  1HX1 A;  2R82 A;  3QFU A;  3CJ1 A;  4M7Y A;  5AQG A;  5EX5 A;  4EHT A;  3WQU A;  3FGU A;  5FPE A;  4CZL A;  1SS6 A;  3SJH A;  3GOI A;  3CJA A;  5AQV A;  3BP8 A;  1VQO N;  2HE7 A;  1TYQ A;  4H03 B;  4BRD A;  4LC9 B;  5GIN A;  3C6A A;  1MWM A;  4IJA A;  3RSE A;  5JLF A;  2ZJQ L;  3VTI A;  3A5M C;  2P9N B;  1NGC A;  3H45 C;  4BQZ A;  4NO7 A;  1ZBS A;  4GVE A;  5AQF A;  3E9P A;  3TTF A;  4BC5 A;  1JDE A;  4C1N K;  4CZI A;  2E8A A;  2FLO A;  3VGM A;  2D0O A;  3U9Z A;  3IKM A;  5FPD A;  4CYE A;  1E5W A;  1Y19 B;  4F7G A;  1IJJ A;  5FPN A;  1VQ4 N;  3ZX0 A;  3ENO A;  2Q2R A;  2GUP A;  1U2V A;  4HDQ A;  5JVL A;  4PKI A;  3VF6 A;  4BG8 A;  1JCG A;  1K9M O;  3FP5 A;  4MO4 A;  1NGJ A;  3VF4 A;  3CCM N;  3BIN A;  5E26 A;  1NGD A;  1YIT N;  3TTD A;  4C1N I;  4JNE A;  4IXC A;  4M63 C;  5CHI A;  3IUC A;  4BRA A;  4GNI A;  1VQK N;  5HL7 L;  4A5B A;  3M3Z A;  3L4Q A;  2HF3 A;  2WBN A;  5AQI A;  4B1V A;  3WXM B;  1VQM N;  1ZXO A;  5LY3 A;  4FSV A;  4EKU A;  4H5T A;  1Y64 A;  3BF1 A;  2VWB A;  4WQ4 C;  4C23 A;  2OTJ N;  4H5N A;  2UYT A;  4UY8 O;  4L3Q A;  3MK6 A;  5AQP A;  3O9Q A;  2RE2 A;  4JAX A;  4B1Y B;  2NZT A;  2E2O A;  5AQR A;  3AY9 A;  4FPB A;  1ACA A;  3R1X A;  5TKY A;  4BC4 A;  5C2D A;  1SGH A;  2QWM A;  3D2E A;  2A40 A;  1EF1 A;  3WUH A;  1VBH A;  3FZF A;  3J7Z O;  3UE5 A;  5AQN A;  1NMD A;  2IVO A;  2D11 A;  2I1J A;  2GEM A;  3VER A;  1OKJ A;  3SLC A;  5M1N A;  4ZRK A;  1VAZ A;  1SAZ A;  3ZX3 A;  1GLF O;  5C12 A;  2YVC A;  3WXJ A;  2P9U A;  4YL8 A;  1H1V A;  2AEH A;  1T3V A;  1V4S A;  4H0T B;  3OW2 M;  1YI2 N;  2P9I B;  3P38 A;  4MO5 A;  2E20 A;  3WA0 A;  3ZDT A;  2HST A;  1S22 A;  4FWR A;  4I6M B;  4MLH A;  4ILJ A;  5C0Y A;  4FWN A;  3UKU A;  3X23 A;  3A8Y A;  3WEE B;  3Q7B A;  2CQU A;  3CCR N;  5F0X A;  4A5A A;  5KPZ A;  4BVO A;  4CZF A;  1YVN A;  5AQO A;  3MN7 A;  5AQZ A;  3ID6 A;  1VQ5 N;  4BR9 A;  5AQS A;  3LDQ A;  1BOT O;  4BC2 A;  5H1S Q;  3VOV A;  1HB6 A;  4JKH A;  3QIJ A;  2HBK A;  2J0M A;  3O1B A;  2YJE A;  1ZC6 A;  3CXC M;  2WH5 A;  1C0F A;  3HSC A;  4OO1 J;  3I55 N;  2ASP A;  4EAH D;  3UKR A;  1MK7 B;  3WT0 A;  2Q36 A;  3DWL A;  3KZB A;  3ZET B;  1BWF O;  4CZM A;  4QS7 A;  3FZH A;  3VTH A;  4BRQ A;  4H0Y B;  3ZEU B;  2F9W A;  3CCS N;  2GWK A;  3O9S A;  2P9P A;  2D4W A;  3CJ9 A;  2QI2 A;  1BG3 A;  3VEN A;  5C15 A;  5FPM A;  2E1Z A;  5DM6 L;  4A2A A;  1QVG M;  1QZ6 A;  3I56 N;  1YIJ N;  4CZH A;  2YHY A;  3U9D A;  2GEL A;  5AQX A;  2QA4 N;  1MIZ B;  3R6M A;  3P31 A;  1DEJ A;  1NLV A;  2PBD A;  3DXK A;  5BRH A;  3WXI A;  2ZJP L;  3VET A;  3QML A;  4IO9 L;  3CC2 N;  3G6E N;  3D6R A;  4KH5 A;  3CPW M;  1CZA N;  2CGK A;  5AQY A;  1X3N A;  2Q1N A;  3LM9 A;  3FE1 A;  3OBW A;  4DKW A;  4BR5 A;  4IOC L;  5EXW A;  3EE8 A;  1QQM A;  2Q0U A;  2NRR A;  2VYP A;  5AFU A;  4YOX A;  1BDG A;  3OA9 A;  1GLE G;  1NGG A;  2QTD A;  1X3M A;  3S41 A;  3CI5 A;  3O08 A;  4EHU A;  3WXK A;  1RFQ A;  2E88 A;  5BPN A;  1YJ9 N;  3U4L A;  3PIO L;  2E1Y A;  4O8K A;  3HI0 A;  3WQT A;  4ILG B;  1KAX A;  4DQ8 A;  4BRI A;  3EKU A;  3QBW A;  1NGI A;  1K8K B;  3CCE N;  1SQK A;  1GLC G;  3C65 A;  4PKH A;  4WFN L;  2YI1 A;  5F2R A;  2YHW A;  1VQ7 N;  1NBW A;  3D2F B;  1GLD G;  4PL8 A;  1HKB A;  4XH5 A;  5AQT A;  4JKE A;  2P9K B;  3G9W A;  3SMP A;  5BRF A;  1GGO A;  4IOA L;  1LCU A;  1HJO A;  3C7N A;  4BRL A;  5E84 A;  2ASO A;  5AR0 A;  1ATR A;  1C0G A;  2NNW A;  2ZGY A;  2A5X A;  4H0O A;  4BRF A;  3CCQ N;  3VEV A;  2V51 B;  2IVP A;  1YJW N;  4IOX A;  1TYQ B;  3RSE B;  5AZI A;  3R9P A;  5HOO A;  4WQ5 C;  3HOS A;  3R8E A;  3MMV A;  4AM7 A;  3O80 A;  2CH6 A;  3CC7 N;  2BTF A;  2HBL A;  2X0S A;  3A5O C;  1VQ8 N;  5JVG L;  4BG9 A;  1VQN N;  3M6G A;  3CQX A;  5DM7 L;  1M90 O;  4IEE A;  4ISG A;  2PFU A;  3A5N C;  4AM6 A;  4JKC A;  4BRM A;  3ULE A;  3MN5 A;  2YX6 A;  4A2B A;  1V4T A;  5EVZ A;  4DCH A;  1S72 N;  4DHY A;  2J4R A;  3MCA B;  4JK8 A;  3ENB A;  3KHY A;  1VQ6 N;  2I7P A;  1K8A O;  2J0J A;  1U2V B;  5AZJ A;  1QHA A;  3EPY A;  2A41 A;  5AQW A;  4Z94 A;  5LJV A;  1GLL O;  3VEX A;  3PIP L;  4FO0 A;  4DXA B;  4BQL A;  3CET A;  3O1W A;  2GX9 A;  4RCH A;  1Q81 O;  5MLC Q;  4FOI A;  4A61 A;  4QS9 A;  2CB8 A;  3U8X A;  1YJN N;  1NGA A;  3TU5 A;  2I1K A;  1ATN A;  1M1K O;  3KVG A;  3A5L C;  3DXM A;  4JKA A;  4CBU A;  3SAF A;  3O5B A;  3GG4 A;  3VEW A;  3IFR A;  3O8M A;  1NGE A;  1HB8 A;  4XH4 A;  3VGK A;  2WFB A;  4FWM A;  4JKG A;  1XC3 A;  5C2F A;  2RQ1 A;  1Q82 O;  3CPE A;  3HM8 A;  1ATS A;  3W3D A;  4B1W B;  2ZWH A;  4WCE L;  1LOT B;  5I9E B;  3DLL L;  5BN8 A;  1Q86 O;  2E2N A;  3GL1 A;  3WXL A;  1RGI A;  2NRW A;  2W41 A;  3D2E B;  3F9M A;  4XH1 A;  2A3Z A;  4ISE A;  1J19 A;  3H1V X;  1GLJ O;  3MDQ A;  3FR0 A;  5KQ8 A;  5GIO A;  1KC8 O;  1H4R A;  3PVL A;  2DIK A;  1U6Z A;  4JKB A;  1KC7 A;  2NRZ A;  3EKS A;  3MX5 A;  4J8F A;  4OPH A;  3I8B A;  1VBG A;  3CC4 N;  5JVH L;  5GAE P;  5BPL A;  1YXQ A;  1KAY A;  2FF6 A;  2H3G X;  2P9U B;  4XEI A;  4BGB A;  3GDQ A;  4K43 A;  2JWL A;  2Q97 A;  3H46 O;  5AQQ A;  4FWP A;  5KPT A;  3O9T A;  1OVY A;  2D1K A;  3TSU A;  3VF2 A;  1BU6 O;  1GLA G;  5GAH P;  3IDH A;  2AL6 A;  3LDL A;  4HWI A;  5AQU A;  3UKU B;  1Q18 A;  4RWT A;  4H5R A;  3CF5 L;  3AU4 A;  2A6A A;  5BPM A;  3HTV A;  4YOV A;  2YHX A;  1ILY A;  4FWQ A;  3CCL N;  4CBX A;  5ELZ A;  3FLC O;  3ATV A;  2DPN A;  2P9L A;  1GG3 A;  4R79 A;  3QIC A;  4HDO A;  3N4Q A;  2GTD A;  2CH5 A;  1HKC A;  4E1J A;  1R59 O;  2IIR A;  4CZK A;  1BO5 O;  4CZJ A;  1SZ2 A;  3P4I A;  5C10 A;  3DAW A;  3KK7 A;  4K25 A;  3LDO A;  4BRO A;  3UKR B;  2COP A;  4A57 A;  5F1X A;  3TSQ A;  2QM1 A;  1QQO A;  3CHW A;  5CR4 A;  1T6D A;  4BRN A;  5CE3 A;  2EMT A;  4ZRI A;  3U7D A;  1T6C A;  3OBY A;  1KXP A;  5AQM A;  2FSN A;  2P9S A;  4BRP A;  4CZG A;  5GAG P;  5M1O A;  1VQL N;  2P9P B;  5GIP A;  1MWK A;  3G71 N;  2BH1 A;  2W40 A;  3O9U A;  3ZX2 A;  2LBB A;  1ST7 A;  3GE1 A;  3DJC A;  3H6E A;  4U67 L;  1HPM A;  4JKD A;  1Z6R A;  2ZF5 O;  4WF9 L;  3VEZ A;  2HF4 A;  3SK3 A;  3AAQ A;  3DXK B;  2HBM A;  5BRE A;  3CMA N;  3VMF B;  2Q0R A;  4H0P A;  4PKG A;  3ZYY X;  4BGA A;  5KQD A;  1KBL A;  1E4G T;  4B9Q A;  3MWP A;  2QWO A;  2KLA A;  3F2K A;  3QB0 A;  3EO3 A;  3ID8 A;  5M1K A;  2NRX A;  1T44 A;  4JD2 A;  2HBJ A;  5JMV A;  4GV9 A;  2EWS A;  4FWK A;  5JLH A;  3NVK A;  4BVP A;  2HOE A;  2IVN A;  1MK9 B;  4FOE A;  3VES A;  4BRK A;  4BR0 A;  2D10 A;  1GC6 A;  2QWR A;  3T69 A;  4FWS A;  4GV3 A;  3GBT A;  4FPA A;  1W97 L;  3FFK B;  3L6Q A;  4IWV A;  4CD3 A;  4JHD A;  3QFP A;  4MLE A;  4KBO A;  1VQP N;  3MWT A;  1MIX A;  1NM1 A;  5BR9 A;  5M1Q A;  5B8H A;  1HLU A;  2V7Y A;  3CJ7 A;  1JJ2 M;  2GWJ A;  3PLA A;  4IJN A;  1BUP A;  4ILH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...