4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
4ILJA 4JKFA 4JK8A 3ENBA 3E66A 4ILGB 4JKDA 3SBGA 4JKGB 4JKEA 3E9PA 3SBTA 4JKHA 3E9LA 4ILHA 4JK9A 4JKAA 3E9OA 4JKGA 4JKCA 4JKBA 4JK7A
chains in the Genus database with same CATH superfamily
1EQYA 1JLAA 3T1HK 2W40A 3HM8A 1XHZA 2NRVA 3AO5A 3NE6A 3UKUB 2YKMA 1U4BA 4C1NI 5GAHP 3WNHA 3BDPA 3CF5L 4CERA 3JXUA 5KPZA 3DYAA 3AO1A 4M3TA 2E6MA 4PUOA 4JKGB 4JI5K 1BISA 2YVCA 2NNWA 1SL2A 2FDQA 1M90O 1GLAG 3IVFA 1NOZA 2P51A 4CEQA 4BE0A 4CJSA 3F9KA 1U45A 4CJKA 1TK5A 2F9WA 4DTPA 1ATRA 4E7HA 5FDLA 3VETA 3GE1A 1NK5A 2I5JA 4CD3A 2CH6A 4AQYK 4OKKA 3OY9A 1L3VA 1NLVA 1XMOK 3NH0A 4JI6K 4KI4A 1I39A 2W6KA 4YFUA 2FJ9A 1NTIA 4EP5A 4F2SA 1HQUA 4X62K 4BWJA 4FK0A 1HRHA 1RBRA 3HI0A 3VENA 3ZX3A 4FLXA 1T6CA 3NCIA 1U47A 4KPYA 3D2EA 3EEQA 1NGIA 3CC7N 1WNSA 1HNIA 5BRDA 3CFRA 4PKIA 4IOCL 1OKJA 4KHNA 3CCMN 1VQLN 1GLBG 3CCLN 2IVOA 1JDEA 4LC9B 4H8KA 1KQSM 2QWQA 2HHHK 1BOTO 2AEHA 3CYMA 4BVOA 4CJRA 3KKRA 2VGMA 3TPQA 4H0TB 3PVLA 4CJ7A 3OYCA 3KIOA 4K25A 3DI6A 4C1NK 1XI1A 3CD6N 1D9FA 1HBKA 2FXUA 1CLQA 3NBPA 4JHDA 3L4QA 3DXKB 4DR1K 5EX5A 1VSHA 3SQ2A 1EETA 3A5OC 1GG3A 1E4FT 4A5AA 2O4GA 3DXMA 2FF3B 4FJNA 2E8AA 3EL2A 3ZT1A 5JLFA 3J80O 2FSKA 1ISNA 1BWFO 2WFBA 1NMDA 1MIZB 3C6HA 2YCHA 2I7NA 1NJWA 3AA4A 3AGKA 1NK7A 1Z6RA 1N8RO 3P31A 3CC2N 3UKUA 3MEEA 2VWBA 5D3GA 2KZZA 3LZIA 3AVKA 5C2FA 2ITGA 1VAZA 3CJ9A 4GKJK 2G8WA 4JKGA 2RQ1A 2BUPA 2EMSA 2AL6A 3F2KA 4KO0A 3QLHA 4B3MK 1SGHA 2GBZA 2RE2A 1E4GT 4DF8A 4FJKA 4BROA 3V9ZA 1K8AO 4BGBA 5DM6L 2KTQA 4DR6K 4W5RA 2YKNA 3C0BA 4GW6A 4ELUA 5GAEP 3THYB 2ZQBA 3AO4A 2DIKA 4CJTA 3VA3A 4B1WB 2E88A 3ZX0A 5CZ1A 1EWRA 3BZCA 4B8CA 3ULEB 1LCUA 3LWLA 1GLFO 3MCPA 2E20A 1TK0A 4FW2A 1GLJO 1S22A 2OA8A 3LDSA 3I55N 4DV4K 3VMFB 3ZSVA 3S3MA 5AQRA 1QVFM 1D5AA 3FFKB 3TSQA 4CJ4A 1SAZA 5LMUK 1L3UA 4GVMA 1WB9A 2QWRA 2QM1A 3KK7A 1TKDA 4IJAA 2HB5A 3KLFA 2ZJRL 2WUSA 2FBYA 3LDOA 3AVGA 3D45A 3OYMA 3C7NA 4NLBA 4MDAA 4CHPA 4YOXA 3THXB 1JLQA 3THWA 4L8RB 4X65K 2ASMA 1JLFA 4F4KA 2PFUA 4B9MA 2P9UA 2D5RA 3C6UA 3C95A 3MXMA 4AHTA 2HHTA 4IEEA 1S1UA 2ETJA 1U04A 2FBTA 3LP3A 4I7FA 2HNZA 1BUPA 2JGUA 4CF1A 3V1QA 5HROA 2VGNA 5BR9A 2UYTA 1NGAA 4DFJA 1BCOA 3MECA 4FXDA 4LD0A 1RFQA 1U2VB 3TAQA 4LF7K 3PY8A 3WT0A 4BR0A 2GWJA 3GDQA 3J81O 4NYFA 3K0SA 2P9SA 4CFBA 3V6DA 3A5LC 5BPMA 4I6MB 1ZBLA 4DR7K 1I94K 1QQNA 3EKSA 2FSNA 5C42A 4R5PA 1CZBA 4CJPA 3KLGA 3IAYA 4FLZA 3UB5A 3CI5A 4AH9A 2O8CB 4DTRA 4CEAA 2F9TA 3NFAA 3THYA 1YT3A 4FK4A 3SMSA 4M3ZA 2HE7A 3QFPA 3AVBA 1I3AA 3C94A 3AA3A 3CHWA 4H5NA 5M1OA 3WXLA 4X64K 4BE2A 3L2VA 1T3VA 4CJ5A 5HBMA 2G8UA 3HVRA 1HR0K 4YDUA 3SMPA 4JI8K 4FM1A 4JI4K 4LH4A 2NRXA 3U9ZA 3K5MA 1VQON 3GBTA 2IVNA 3FP5A 4FJMA 3CM5A 2G8HA 4BRDA 3MEGA 4RW4A 3VEZA 1VSJA 2D0PA 3VEOA 4KB0A 3HRGA 3DM2A 4HUFA 4CGJA 1VQ7N 2HHVA 3ZT0A 5AQHA 3H3NO 4ZTFA 2NRWA 1EF1A 1TYQA 3OBWA 1S6PA 4FLWA 4A62A 2EX3A 3LAMA 1DTQA 2E2NA 3FGUA 2UUBK 1NM1A 4CK2A 4GV6A 2J0JA 1J5OA 3OYIA 3H6EA 3K9JA 3MEDA 1D8YA 1IV0A 4F3TA 5GINA 5I42A 3GOIA 3K59A 4RW7A 3VTHA 2H3GX 1HJOA 4CGDA 4WF9L 1BI4B 2VG7A 5GAGP 3L3UA 3TAEA 4JYAK 3CQYA 2UXDK 1WSIA 3QEPA 3ZSYA 3CQ8A 4RW8A 3JS6A 4FWNA 4MO4A 3S3NA 4O8UA 4IO9L 2JLEA 3B6PA 1R0AA 3DLKA 1KLMA 2I7PA 1LWEA 1Z26A 2JWKA 1S5JA 3MN6A 2D2QA 4KHUA 3WQTA 5AZIB 1E5WA 4IDHA 4CZEA 1U2VA 3RMBA 5CE3A 4E89A 4BRCA 3ATVA 3BEXA 4KHPK 2P9IB 4HWIA 2VWKA 4FJ9A 1YTUA 3T1YK 4JKDA 3A5NC 5J2MA 2HVIA 1KC7A 1K8KA 5HRSA 4ZRJA 4JN4A 4MO5A 3FLCO 4DSEA 1YXQA 3WEEB 2E5LK 2X6SA 1S1TA 3G9WA 1SKSA 4RW6A 3HO1A 5E26A 4CZGA 2P1JA 3EE8A 1WAFA 5J2PA 2YNHA 1IG9A 2LSNA 3O9TA 4M63C 3OW2M 4QS7A 5KRTA 1S6QA 3VEVA 1JL1A 4CJVA 3VQAA 1A5VA 3P39A 3TTFA 4CD1A 4M3UA 2KKZA 5KTQA 4CFDA 3HL8A 3E9PA 3HM9A 3IKMA 4BG9A 4DTUA 3MMVA 5AQPA 1X9MA 3T1AA 5M1QA 4JI7K 5BRHA 4YOUA 4QAGA 5C24A 3SV4A 3LDNA 4BRPA 3D2FB 4FSVA 4CZJA 1VQKN 1ACAA 1OH7A 3EO3A 5GADP 1BGXT 4BDZA 2RF2A 2DY4A 3W0LA 2ZGZA 1OH5A 3G25A 3VERA 4W5OA 5C10A 1K9MO 3BP8A 3T69A 3AVMA 3EE9A 3LL3A 3NGIA 1C1AA 1K73O 3OYBA 3F5TA 3HTVA 4FWPA 1KVAA 3ZX2A 3QIPA 4BRNA 1LOTB 1C6VA 1Q8IA 3W3DA 1ASWA 3VQ4A 4B08A 3R1XA 3WXKA 4Y1CA 1RDUA 3ZCMA 1P90A 1BI4A 4KBOA 1VQ6N 2CGJA 3TR8A 2OPQA 1HKCA 3K9KA 3AV9A 3TSUA 4DQSA 4K8ZA 4EP4A 2EMTA 1KTQA 1JLBA 1S9EA 4B3TK 1GC7A 3UIQA 5IJMA 2HSTA 4FJHA 1LAVA 3ZSQA 3M8PA 3CCQN 3V4IA 5F2RA 1G15A 3B8AX 4RTFD 2OPPA 5AZIA 2YHAA 3N4PA 1L3TA 3DLHA 3ISNC 3MDQA 5BRFA 2OPSA 4CF8A 3SQ1A 4DSJA 3Q7BA 4DQPA 1VBGA 3MN5A 3SI6A 3WNEA 3LDPA 4JKFA 3WEEA 4MLEA 5K14A 4MLHA 3SJJA 1Z05A 3ENBA 2XHBA 5JVHL 4JS4A 3FE1A 4RW9A 4O4GA 3QDKA 4M3YA 3ID6A 4BREA 3HP6A 2QTDA 3DJCA 4A5BA 3KK2A 4NY0A 4BVPA 1GC6A 4LSLA 5T7BA 3QBWA 2KLAA 3O4NA 3K58A 2ZM6K 4FM0A 2FF6A 4UY8O 1RT4A 3FFIA 4JS5A 2HBJA 1VQ4N 3WA0A 3V1RA 2OTLN 2O4IA 4DCHA 4CHYA 2QW9A 4K8XA 1XQSC 2XRIA 3U8ZA 4FVMA 4K42A 5FPDA 3L2QA 2WBNA 4FLYA 4CESA 3RMCA 4FWRA 2FSJA 1C1BA 3H1VX 5J2QA 4UQGA 4Z4IA 2ZF5O 2D10A 1T44A 3DAWA 4DQ8A 4F3OA 2Q3SA 2VQEK 2X6NA 3CXCM 4RCHA 3ZETB 4A59A 1IKXA 3OS0A 1UA0A 4KHYA 2ZPYA 4M3RA 1WLJA 4FJLA 3NH1A 4EAHD 3CFPA 4BRHA 4IEIA 3DRPA 4FLVA 4JK9A 1YITN 1MU2A 1SKRA 2XY5A 1YF5L 1TKZA 4LF5K 3L3VA 4PHTX 5HP1A 2WOMA 3TWHA 2Z1HA 1NK8A 4BQZA 3QO9A 2CGLA 5AQGA 3DOLA 2F8TA 3OS2A 4CEZA 2O8EB 1O13A 5EXWA 3OYHA 3HT3A 5JVGL 2QI2A 3WXMB 1BA0A 4QS8A 3PSIA 4OPHA 4EHUA 2OPRA 1M1KO 3RVCA 1W2BM 4BRKA 4OKJA 5EOYA 2R82A 1J6ZA 1YAGA 3IG1A 1JXBA 4B3OA 4FVUA 3AA2A 3QIOA 1C1CA 2CQUA 3VQ5A 5ELZA 3ZT4A 3H45C 1UA1A 4FOIA 4KH6A 3RMAA 4OLBA 5ADXA 3SUQA 1NU0A 3FZMA 4C8LA 3VQCA 3PSFA 4Z4EA 1LV5A 3V9SA 1HKGA 2KFNA 5AJ3K 2PYLA 3PO4A 1MWKA 2HNYA 4CHNA 1NGEA 4YOTA 2BTFA 4EHTA 4F2RA 4FJIA 5IT9O 1KD1O 2F8SA 4C23A 3CCEN 3ZSRA 5DMRA 1JCEA 1LWFA 2HHWA 1RCHA 4YY3K 3AU4A 5LMNK 1IO2A 3E9LA 3CJCA 3FZKA 3HYFA 5GIOA 1G99A 3H08A 2HMPA 4DS5A 3QB0A 3IFRA 1RGIA 4DLGA 3VESA 2W42A 4DV7K 5JLHA 3C6AA 3OYDA 3EN9A 4DF4A 3ENHA 1NKBA 4NCGA 1IKWA 4W5NA 3SUNA 1N33K 1BA1A 3AVLA 4EIAA 2P9NB 3WNFA 5M1FA 4IOXA 4H03B 3SBTA 1WSGA 4AHSA 5I9EB 4FM2A 4JKAA 2VYPA 3ZETA 2HMIA 2AA4A 3TSPA 2Y1JA 3A8YA 3KLIA 2ZD1A 3ZYYX 3VTIA 5AQOA 2FBVA 4BRLA 3CPEA 2JWLA 3AVCA 2OZSA 5JMVA 4MDBA 5BN9A 1BIUA 1D4XA 2Q1NA 1S3XA 5HOOA 1SS6A 4PY5A 4P7IA 1QHTA 1LAWA 3O1BA 4XIUA 4BWMA 1XMQK 1Q18A 2QK9A 4BR4A 5MLCQ 1GOAA 4E1JA 4OPAA 4DB3A 4FJXA 4H5RA 2F7TA 1T05A 1WSHA 4AHCA 1RTHA 4ELTA 2ZJPL 2A5XA 3AVHA 4DQQA 4B1UB 3P4IA 4YHHK 3RRHA 3ZSOA 4DU3A 3SK3A 3L2RA 5CYMA 4BY9C 1HMVA 2Q97A 1QSSA 4XH5A 2RKIA 1MK7B 2E6LA 2BE2A 1YVUA 2HNDA 2Q36A 4FO0A 4NXMK 1REVA 3UKRB 1GLDG 1WAJA 4CGIA 1JL2A 1Q7YO 3HK2A 4Q5VA 2P9PB 5FROA 1FK9A 3DWLA 3G71N 4KRFA 2BANA 3CG7A 1BL3A 3THVA 4OLAA 1RTJA 4E0DA 5KGXA 3ULDA 2NZTA 4BR9A 4I9LA 3AVFA 3RR7A 4WFNL 1TL1A 1B9FA 5A2QO 5E41A 2O8BB 3PV8A 1BIZA 5AQFA 4LY7A 4DV6K 4LH5A 1RILA 1WUAA 4DTMA 3U9DA 4E19A 3MCAB 3CM6A 2G8FA 4A61A 4CHQA 1D9DA 4KV8A 2O8FB 2ITMA 4B1VA 2Q0RA 4XEIA 1TGOA 4OO1J 4O5BA 4DR4K 3DXKA 4N56A 4H0PA 1C0TA 4ZTJA 1MK9B 1RBSA 3AY9A 1XHXA 2Z1IA 4DSFA 3CC4N 1YJ9N 3PUFA 1S1WA 3O9QA 1KFSA 3O4WA 4IFVA 4LF4K 3JSMA 3WQUA 3MWTA 1JCGA 4DHYA 4OKEA 5AQQA 4YL8A 1HPMA 1BU6O 5F0XA 1TAQA 5M1KA 2V7YA 5CY4A 1Q81O 4CJLA 3WXIA 2ABDA 1YHQN 2PAVA 4I2PA 4NCAA 3OYFA 1Z25A 5JS2A 1N32K 5HL7L 4IOAL 1NKEA 3CJAA 4FZYA 3KJVA 4KKOA 2WH5A 4LFCK 1BHLA 3OA9A 4NCBA 5AZJB 4TKNA 5M1PA 3V9WA 4F9OA 1QQMA 2BH1A 4Z0UA 2QWLA 1MWMA 5AQWA 1VQPN 1C0UA 1S1VA 1XC3A 2QA4N 3IUCA 1DGKN 1FKPA 4FJJA 2UXBK 2GEMA 3ULEA 2J0KA 2DTUA 1IBLK 2DFFA 4W5QA 1NWKA 4CJEA 2X78A 3VQEA 4IKFA 5FRNA 2Z1JA 3TABA 1U49A 4HTUA 3OYGA 4A57A 4AILC 1TUUA 4AM6A 5JVLA 4B3RK 3M3ZA 3KD5E 2P9PA 2A42A 3VQQA 4FPBA 4JI0K 3J7YP 2A41A 4DUZK 1TL3A 1YIJN 4Y0WA 4PKGA 3O5BA 1QQCA 1C0GA 3BGRA 1HX1A 3ALYA 4DFKA 1ATSA 3NF7A 4FJ5A 4YOWA 3THXA 4IXCA 2D0CA 3PX4A 1N36K 3NMUA 1FXXA 4DFMA 3ID8A 3P38A 4CK1A 3CCVN 1NG9A 2HW3A 5LJWA 4FJ8A 2O8FA 5AQIA 4KTZA 2W41A 1SV5A 4M45A 1B92A 3RMDA 3M8SA 3KZBA 2E4LA 4CIFA 3QNOA 5AQNA 1TAUA 3N4QA 1XUPO 4KREA 4DV5K 4J2AA 2QWPA 3TAPA 3M1FA 2CGKA 4BDPA 2W6LA 2QKBA 1VSMA 3K5LA 3DLRA 1X9SA 1Y64A 4WE1A 2V7ZA 2G8VA 4M42A 2QXLA 1L5UA 1HNXK 2E2OA 1VSIA 1MA9B 3SUPA 5E84A 1LWCA 1KVBA 4C8MA 4I6MA 2HBKA 5DK5A 3KWGA 5AQJA 1JLCA 3SNNA 4U7BA 2D4WA 4CGFA 4WCEL 3FZFA 3TI0A 3LPUA 1XNRK 4IWVA 3BUZB 3S9HA 2O8CA 3S3OA 2ZJQL 3MK6A 3OYKA 3LP0A 4WQ5A 3KD1E 2E2QA 2YHBA 3ENOA 1R59O 1CXQA 3NF8A 3OVNA 1Y19B 2YNGA 4DXAB 4FPAA 4EKUA 1IKYA 2V52B 4J2BA 5AR0A 1NJZA 1VQ8N 1TKXA 3CCUN 2GTDA 1YVNA 3SQ0A 5SWMA 4CZHA 4ZRIA 3KWIA 3I8DA 3EZ5A 4H0OA 3TAMA 4NO7A 5HRRA 3VF2A 3QEVA 1J9AA 3KKSA 4DTSA 3FR0A 3HVTA 3VGKA 5AQKA 3H46O 2FLOA 4CBUA 2VWJA 2YI1A 1ASUA 4FWQA 1RTDA 5AFUA 3OYJA 4B9LA 3O9UA 4CFCA 4M7XA 5AQZA 1W9HA 1W97L 3DLLL 4CF9A 2QEXN 5TKWA 4ELVA 3R6MA 3AVNA 4FZZA 4DWIA 3PX0A 3RWUA 1QQOA 4M7YA 1EP4A 4CJWA 4BC4A 1RBUA 4GVEA 4ICLA 3ZSZA 2VQFK 3U4LA 1ZXOA 4L3QA 2OYQA 4EZ9A 4DV2K 4DV0K 1X3NA 3U8XA 2J0MA 5BPNA 4WFAL 4DTOA 4FZXC 3IRXA 5LL6Z 3WNGA 2CH5A 1J53A 1YTAA 4A2BA 4ISGA 5BR8K 3I0SA 3SAGA 3SAHA 2HHSA 4DQRA 3S41A 5CYQA 5C12A 2E1YA 2P9IA 3R3LA 4E7JA 4FJ7A 3QERA 3U7DA 1NK0A 4RG8A 3C65A 1HUXA 4QOZB 1VK0A 1X9JA 1NJXA 3SBGA 3J7AP 4O5FA 3VN5A 5DM7L 4AHUA 4PKHA 4IBNA 3KK1A 4PL7A 1ZBIA 4CJFA 3SV3A 3SUOA 4O55A 3CMAN 4BG8A 4DS4A 2HVHA 2UXCK 4CBWA 3HJFA 3SQ4A 1CZAN 2NUBA 5BREA 4OJRA 2HHXA 4B8AB 4YOVA 4GV9A 3VA0A 3GG4A 3BINA 4DR2K 4JI3K 3LP1A 1OH6A 1MIXA 2AP1A 3QMLA 4PQUA 4HCCA 1NGCA 3BF3A 3NVMA 4KH4A 1SL0A 3O4QA 1VSFA 1ASVA 1BG3A 4GV3A 3L0QA 1IBKK 3D2FA 3ASMA 1SKWA 2AJQA 1ESVA 2YV0X 3VF4A 4B9NA 3ZLJA 5JICA 1JLEA 1WBBA 3VEXA 4BRAA 1DKGD 3O3GA 1TUYA 3A5MC 4C8OA 1SQKA 1NNEA 5ADXH 2V51B 4CYEA 1JXEA 3OHRA 1X9WA 4CZLA 4DUYK 3T3FA 3TAGA 4N41A 2GX9A 3QEIA 4DV1K 4DV3K 5BPLA 2KQ2A 3FLVA 5BN8A 2IS3A 3LALA 3Q7CA 4AHVA 4M3WA 3MX2A 4JHDB 1HB8A 4BR2A 3P1GA 2A1RA 4KI6A 2FBXA 4E7KA 1KSPA 1NI2A 1GOCA 4YDUC 3DXMB 4PL8A 4JKHA 3CCRN 4CVNE 1H1VA 4IZ9A 1NK9A 1U6ZA 3EPYA 4NB4A 3O8MA 4B9UA 4IDKA 2B6AA 4FLUA 4W5TA 4O44A 3L2UA 1VRTA 3QESA 1NMNA 2GUIA 1HJRA 4H0XB 3ZT3A 3SPYA 3ZSXA 3JYTA 1ZBSA 2R7YA 2A40A 3NVKA 4CECA 3QICA 3D7EO 3BZKA 1OVQA 4HDQA 2KW4A 3K5OA 3LANA 4M41A 4ISFA 1WOQA 4CGHA 3VPZA 4FWOA 1RDBA 4DLEA 3E66A 5KRSA 1V4TA 1RDDA 4DSLA 1RNHA 2D1KA 5SZTA 4M3XA 4BQLA 3O9SA 2XO7A 5KPRA 1NGBA 4FWLA 3CFOA 3D0PA 5I3UA 1T8EA 4CCHA 1A5XA 1KAXA 1IH7A 3H3OB 1S72N 5EU7A 3NDKA 1T6DA 1WSEA 4E1NA 4KB1A 5J1EA 4DR5K 4LF6K 2XY6A 1NGJA 5J2NA 3QINA 4QCLA 3IDHA 3HXMA 4KAZA 1QTMA 1NOYA 4WYBA 1YUWA 4NXNK 4H5TA 4BRIA 4OPKA 1T03A 3HPHA 4OGCA 2VCPA 4DKWA 3PLAA 2UU9K 1F21A 3B6OA 1IBMK 2Y1IA 4KTQA 2IAJA 3HZ6A 1JKHA 2Z1GA 1KBLA 3X23A 3PX6A 2HHQA 4GNIA 3TU5A 1XC9A 1LW2A 4FJGA 3JAMO 3C7NB 4ZHRA 2P5OA 2HBLA 2HHUA 3THWB 3ATUA 3CCJN 4JNEA 2GUPA 4J2EA 4JEPA 3WXJA 4B1XB 2YHWA 5KQ8A 1RDAA 4BACA 2P9UB 1RT6A 4I2QA 1T7PA 1VBHA 4K43A 4CEFA 4WQ5C 3HBTA 4IO8A 4C8NA 1KAYA 5FRMA 2OZMA 4LF8K 2O8EA 4O0JA 2A3ZA 5AQYA 3CIPA 4B9VA 3A0IX 3MN9A 3AAPA 1HYSA 4H4OA 4DR3K 3I8BA 4CGGA 4K41A 5AQMA 4V19S 1X3MA 3HSTB 2X0SA 3T7ZA 1A5WA 4FLTA 4CHOA 3DRSA 3MXJA 5TKYA 1NBWA 3VGLA 3OYEA 1OH8A 3O80A 4O0IA 4B9SA 3QEXA 3V81A 2IC3A 2P9SB 4H4MA 1NGFA 1ZBUA 3PIOL 2QWOA 3LDQA 4FWKA 4BC5A 1KRPA 2D0OA 3HOTA 2NRHA 4CZIA 2G8IA 1KAZA 1DIKA 5HLFA 4Z4GA 1JCFA 2QWNA 5AQXA 3RSEB 3EY1A 5AQUA 4ZRKA 2OTJN 4A2AA 4DMNA 2COPA 3CJBA 5C15A 1BQMA 3OBYA 4FYDA 1H4RA 1RT1A 2YNIA 3PIPL 5EVZA 2QWMA 4AHRA 3LDLA 1VQ5N 4IG3A 4WQ4A 3HP9A 4JK8A 3AO3A 3KLHA 3QEWA 1NJIO 1EXQA 2FC0A 2RPIA 3CERA 3OYLA 1FW6A 4GMJB 2D11A 4F8RA 1QZ6A 4ISEA 3TANA 1KCFA 1EX4A 2VG6A 4XH4A 1TYQB 1VRUA 1JJ2M 3KK3A 1GOBA 4O8KA 2P9NA 2GELA 4CJQA 4TSXA 1Q9XA 1VSDA 4FL9A 2ASOA 2BGGA 1KXPA 1ZYQA 2LBBA 1NGGA 1J54A 2F4VK 3LPTA 4Q0BA 3DMJA 4Z4CA 1BCMA 1IKVA 1WN7A 3RR8A 1ST7A 4C8KA 4E1MA 2QXFA 4GKKK 1VSLA 4AM7A 4BGAA 4DTNA 1W7AA 3M8QA 2NLXA 3NGYA 2IVPA 3QIJA 3O9RA 2Q31A 3M8RA 4JK7A 2KHOA 2OANA 3U3YA 4HVJA 1TK8A 2NRZA 4J8FA 4BR7A 2GV9A 3TTCA 1DLOA 5F1XA 2IGIA 4HTLA 2PZSA 4KHSA 3L8BA 3NHGA 1VQ9N 4BE1A 3AVIA 2GWKA 2P9KB 1EWQA 3K57A 4F7GA 5CZ2A 3C6TA 3VQ9A 4H5VA 1DTTA 4YORA 5EY4A 1X1PA 3AGRA 3V9XA 1K8KB 1N5YA 3R9PA 1RT7A 2EHGA 2Q2RA 3AAQA 3VQDA 3O3FA 1VHXA 1N34K 2DPNA 1NVLA 2O8DB 4KH5A 1KC8O 1J5EK 1ATNA 3DOKA 5C2DA 4E7IA 2IDOA 4CBXA 3E01A 1UWBA 1HPZA 3L2WA 1BQNA 1MDUB 3ZEUB 2Q0UA 2XY8A 3O1WA 4OGEA 3RSEA 1NK6A 2HOEA 3OS1A 1ITGA 3NF6A 1RTIA 5GIPA 4JKBA 4DSKA 3DLGA 3TARA 3QBXA 3QFUA 4RWTA 4MQ3A 2PY5A 4BRQA 4GXBA 1HQEA 5AQSA 3UKRA 2J4RA 4R79A 3EKUA 1HYVA 3MX5A 4CW7B 4LFBK 3K2PA 1TVRA 3NAEA 4HUEA 1GGOA 2YJFA 4FWSA 4DFPA 2KZMA 1HB6A 3VQ7A 3WUHA 4X66K 3J7ZO 2O8BA 4DTXA 4KTWA 3PZDA 1Y97A 4OVLA 3KLEA 1HNZK 1ZBHA 2YHXA 2P9LB 1OVYA 3T19A 4J2DA 2XY7A 4CIGA 3I33A 4CJUA 4JD2B 3SZ2A 4CFAA 3NH2A 1DEJA 2UUAK 5AQTA 2RHKA 3G6EN 1K6YA 4HUGA 2OCEA 3VQBA 5AQLA 3O6WA 4U67L 4CEOA 1HNVA 2PYJA 4CF2A 5HRPA 3SCXA 2ZGYA 1NJYA 3KTQA 1QZ5A 5KPTA 3CPWM 1QSLA 4NLCA 3U3GA 1CZ9A 3OJSA 5CHIA 1BO5O 4FOEA 3RTVA 1KFDA 3O08A 1V4SA 2HRJA 1QS4A 1RDCA 3G0ZA 1E3MA 4CIEA 1KLNA 3V1OA 2WTUA 1J19A 5AFUH 4HDOA 1RBVA 1B9DA 4LSNA 4B9QA 4JRPA 1HKBA 3MN7A 1Q86O 3TAFA 1Q82O 2HF3A 1EO1A 3TTDA 2P9KA 5FPMA 2HF4A 4IG0A 3AA5X 2HBMA 1P8ZA 4FWMA 5H1SQ 3HPOA 3D6RA 4CK3A 1S9GA 1S1XA 5AZJA 5IWAK 2E2PA 3VQ8A 1ILYA 3O3HA 3BF1A 2QKKA 2O8DA 3OJUA 3DLBA 4YNQA 2A6AA 4ILHA 4BRGA 4JI2K 2UUCK 2IIRA 5JS1A 3L6QA 4OX9K 1WSFA 1RBTA 4Y1DA 1RT5A 1U48A 1QE1A 1VSKA 1UAXA 1C0FA 3ZEUA 1HYZA 4DQIA 2B5JA 4I9QA 4CF0A 3OYAA 3ITHA 3MWPA 2ZE2A 4CEDA 5CR4A 4H5WA 3OYNA 1RT2A 4BR5A 3U6FA 3AVAA 3AARA 4N5SA 3UE5A 5LY3A 1ZC6A 4CEBA 2I1JA 3HSCA 5AQVA 1O1WA 2RN2A 4DG1A 4HHTA 3DLEA 4HCBA 3CJ7A 3K5NA 1YJNN 5FPEA 1BDGA 1NK4A 4B3SK 4N76A 1IG8A 2WC9A 4B1YB 5C0YA 2P9LA 4BC3A 3ZDTA 4CZKA 3VOVA 4FK2A 3KVGA 1QVGM 4JD2A 1FJGK 2D0AA 4CZMA 3E9OA 1TKTA 1LW0A 5KGWA 5HRNA 3SAFA 4ID5A 3SPZA 1VQNN 5KQDA 3R8EA 2ATQA 3NF9A 1XWLA 4G9ZA 5B8HA 4IFYA 4WFBL 3ZT2A 4KFBA 1SUQA 4ILGB 2YNFA 1JLGA 3DRRA 1L3SA 5M1NA 3CQXA 3M5RA 1YJWN 3HPGA 2KFZA 4IJNA 1IJJA 1DT9A 3F73A 4BDYA 3CETA 3FZHA 4BRMA 1RDWX 3AVJA 4PWDA 1GLCG 3VGMA 2YHYA 3GL1A 2I1KA 4JKCA 5C25A 2NRRA 3F9MA 4BRFA 4EFHA 3AU5A 1GLLO 2ZWHA 4FCYA 3LM9A 3VF6A 1SZ2A 4WQ4C 3OTOK 1QSYA 4LF9K 1VSEA 3ZSWA 2VG5A 3BY5A 1FKOA 4G1QA 2NRTA 1WSJA 2CB8A 3CMEN 4Z4FA 3VQ6A 3QNNA 4H0VB 4AF1A 2EWSA 2BDPA 4NYNA 2E1ZA 2YJEA 3KHYA 4CJ3A 4DU4A 4CZFA 4N47A 3G4SN 3H1QA 2X74A 4PA1A 4Z4HA 2B4JA 4K0KK 3IMXA 3EYZA 4OPJA 4MFBA 3I0RA 4IFEA 5FPNA 4H0YB 3E1YA 3M6GA 4EZ6A 3VQPA 1WBDA 3MAQA 3L4IA 3VEWA 3D2EB 1XNQK 4JKEA 4DSIA 2ASPA 3LAKA 3LZJA 4CEEA 1TV6A 1YI2N 1UOCA 2D0BA 4Z94A 4JAXA 1GLEG 4JI1K 3I56N 2DFHA 1CXUA 5LJVA 4CHZA 4CE9A 2A1SA 3RRGA 3FZLA 4QS9A 3V9UA 4ILJA 4ID1A 3EZWA 1NKCA 3A2FA 4DU1A 3SLCA 3SYZA 3CJ1A 3P83D 4FW1A 5KI6A 4B1ZA 3AO2A 1VQMN 4BC2A 3HOSA 3SJHA 3PO5A 4LFAK 2WONA 3IS9A 4JLHA 2DFEA 4JRQA 3P5JA 1NGDA 5FLXO 1HNWK 3CCSN 1QHAA 2IOCA 1KVCA 2YX6A 2G8KA 2P5GA 3QETA 2F96A 1C0MA 3NGZA 1ZBFA 1Q9YA 3LM2A 4KHQA 4KHWA 4B9TA 1HLUA 1EKEA 3J8AA 3LP2A 4DTJA 3VEYA 1W0HA 3LWMA 1NGHA 4E7LA 1RT3A 3G10A 1SL1A 1N6QA 4GY2B 4XH1A 4CI6A 4E3SA 4JV5K 3MXIA 4YOYA 2PBDA
chains in the Genus database with same CATH topology
2D0OA 3HOTA 1K73O 4AM6A 2NRHA 5JVLA 1EQYA 3F5TA 3HTVA 4CZIA 4FWPA 2W40A 3M3ZA 3HM8A 1KAZA 2NRVA 1DIKA 3UKUB 3ZX2A 4C1NI 5GAHP 2P9PA 3CF5L 2A42A 3JXUA 5KPZA 1JCFA 2QWNA 1LOTB 5AQXA 4BRNA 4FPBA 3W3DA 3RSEB 2A41A 4JKGB 5AQUA 4ZRKA 1YIJN 2OTJN 4Y0WA 3R1XA 4PKGA 4A2AA 3WXKA 1RDUA 3O5BA 2COPA 2YVCA 1C0GA 1HX1A 1P90A 2NNWA 3CJBA 2FDQA 4KBOA 1GLAG 3IVFA 2CGJA 5C15A 1M90O 1VQ6N 1ATSA 3OBYA 1HKCA 4YOWA 4IXCA 3K9KA 3NMUA 1H4RA 2F9WA 1ATRA 3TSUA 3ID8A 3PIPL 5EVZA 3P38A 3VETA 2EMTA 3GE1A 2QWMA 3LDLA 1VQ5N 3CCVN 4CD3A 1GC7A 2CH6A 5IJMA 5LJWA 4WQ4A 2HSTA 4JK8A 1NJIO 3CCQN 1NLVA 5AQIA 5F2RA 3CERA 3B8AX 2W41A 2FJ9A 4RTFD 5AZIA 2D11A 1NTIA 1QZ6A 4ISEA 3KZBA 3N4PA 3MDQA 5BRFA 3HI0A 3VENA 5AQNA 3ZX3A 3N4QA 1XUPO 4XH4A 1TYQB 1JJ2M 1T6CA 3Q7BA 2QWPA 3M1FA 4O8KA 2P9NA 2GELA 1VBGA 3D2EA 1NGIA 3MN5A 2CGKA 3CC7N 3LDPA 4JKFA 4FL9A 4MLEA 3WEEA 5BRDA 4MLHA 4PKIA 2ASOA 1OKJA 4IOCL 1Y64A 1Z05A 3CCMN 3ENBA 2V7ZA 1KXPA 5JVHL 1VQLN 1GLBG 3FE1A 3CCLN 2LBBA 2QXLA 3QDKA 2IVOA 3ID6A 1NGGA 2E2OA 4BREA 1JDEA 2QTDA 4LC9B 3DJCA 1MA9B 1KQSM 2QWQA 4A5BA 4NY0A 5E84A 4BVPA 1ST7A 1BOTO 1GC6A 2AEHA 3QBWA 2KLAA 4I6MA 4AM7A 4BGAA 4BVOA 2HBKA 2NLXA 3KWGA 5AQJA 2FF6A 2IVPA 2VGMA 3TPQA 4U7BA 3QIJA 4H0TB 2D4WA 3O9RA 4WCEL 2Q31A 3FZFA 4JK7A 2KHOA 3PVLA 4CJ7A 2OANA 2HBJA 1VQ4N 3WA0A 2OTLN 4K25A 2NRZA 4J8FA 4BR7A 4C1NK 4IWVA 3BUZB 4DCHA 3CD6N 2QW9A 3TTCA 2ZJQL 5F1XA 3MK6A 4WQ5A 1XQSC 2E2QA 3ENOA 1R59O 1HBKA 2FXUA 4HTLA 3U8ZA 4K42A 1Y19B 4JHDA 5FPDA 2WBNA 1VQ9N 4DXAB 3L4QA 4FPAA 4EKUA 2V52B 5AR0A 2GWKA 1VQ8N 2P9KB 3DXKB 5EX5A 4F7GA 2FSJA 2GTDA 4FWRA 3CCUN 4H5VA 1YVNA 4YORA 5EY4A 3H1VX 3A5OC 3AGRA 1GG3A 2ZF5O 1E4FT 4ZRIA 4CZHA 4A5AA 3KWIA 1K8KB 3DXMA 3R9PA 2FF3B 2D10A 1T44A 2E8AA 2Q2RA 3DAWA 3AAQA 3EL2A 4H0OA 4DQ8A 2DPNA 4NO7A 1NVLA 5JLFA 3VF2A 2FSKA 4KH5A 1ISNA 1BWFO 2WFBA 1KC8O 3CXCM 1NMDA 1ATNA 4RCHA 1MIZB 3C6HA 5C2DA 3ZETB 4A59A 2YCHA 4CBXA 2I7NA 3FR0A 3VGKA 5AQKA 3AGKA 3H46O 2FLOA 2ZPYA 1Z6RA 4CBUA 3P31A 1N8RO 3CC2N 2YI1A 3UKUA 2VWBA 4EAHD 4BRHA 1MDUB 3ZEUB 4IEIA 5C2FA 4FWQA 2Q0UA 4JK9A 1VAZA 3CJ9A 3O1WA 1YITN 3RSEA 2HOEA 4JKGA 2RQ1A 1YF5L 5AFUA 5GIPA 2BUPA 2EMSA 4JKBA 3O9UA 2AL6A 3QBXA 3F2KA 3QFUA 4PHTX 1SGHA 2RE2A 4M7XA 1E4GT 4BQZA 5AQZA 4BRQA 4RWTA 1W97L 4GXBA 2CGLA 5AQGA 5AQSA 2J4RA 3UKRA 4BROA 4R79A 2QEXN 5TKWA 3EKUA 1K8AO 4BGBA 1O13A 5EXWA 3MX5A 3R6MA 5DM6L 5JVGL 2QI2A 3WXMB 1BA0A 1QQOA 3C0BA 4QS8A 5GAEP 4M7YA 1GGOA 2YJFA 4FWSA 4OPHA 4BC4A 4GVEA 3DLLL 4EHUA 1M1KO 2DIKA 3RVCA 1HB6A 3WUHA 1W2BM 4BRKA 4B1WB 2E88A 5EOYA 3U4LA 1ZXOA 3J7ZO 2R82A 4L3QA 1J6ZA 3ZX0A 1YAGA 3PZDA 3ULEB 1LCUA 4FVUA 2YHXA 1GLFO 2P9LB 1OVYA 3MCPA 2E20A 1X3NA 2CQUA 3U8XA 2J0MA 5BPNA 4WFAL 1GLJO 5ELZA 1S22A 3H45C 3I33A 4JD2B 4FOIA 4KH6A 2CH5A 3I55N 1DEJA 3VMFB 5ADXA 5AQTA 4A2BA 2RHKA 3FZMA 4ISGA 3SAGA 3G6EN 3SAHA 5AQRA 3S41A 5C12A 1QVFM 2E1YA 2P9IA 3FFKB 3TSQA 1HKGA 5AQLA 1SAZA 3O6WA 4U67L 3R3LA 2QWRA 2QM1A 3KK7A 1MWKA 4IJAA 2ZJRL 3U7DA 2ZGYA 1NGEA 2WUSA 4YOTA 3C65A 1QZ5A 2BTFA 1HUXA 3LDOA 5KPTA 4EHTA 3CPWM 3C7NA 4NLCA 1X9JA 1KD1O 4NLBA 4MDAA 4C23A 3SBGA 4YOXA 3CCEN 1JCEA 5CHIA 1BO5O 4FOEA 4O5FA 3AU4A 2ASMA 5DM7L 3O08A 1V4SA 4PKHA 2HRJA 4PL7A 2PFUA 3E9LA 2P9UA 3CJCA 3FZKA 5GIOA 1G99A 3CMAN 4BG8A 1J19A 2HMPA 4HDOA 3QB0A 5AFUH 3IFRA 4IEEA 1RGIA 4B9QA 3VESA 4CBWA 5JLHA 3C6AA 1HKBA 3MN7A 1Q86O 1Q82O 1CZAN 2HF3A 1BUPA 3TTDA 2P9KA 5FPMA 3EN9A 2HF4A 1EO1A 3ENHA 5BREA 2VGNA 2HBMA 1P8ZA 4FWMA 5BR9A 5H1SQ 3D6RA 4YOVA 4GV9A 1BA1A 2UYTA 3GG4A 3BINA 4EIAA 5AZJA 2P9NB 2E2PA 1ILYA 1NGAA 5M1FA 4IOXA 4H03B 3BF1A 1MIXA 3SBTA 2AP1A 3QMLA 5I9EB 2A6AA 4ILHA 1NGCA 1RFQA 1U2VB 3BF3A 3NVMA 2IIRA 4KH4A 4BRGA 4JKAA 1BG3A 2VYPA 3L6QA 3L0QA 2GWJA 3WT0A 3ZETA 4BR0A 4GV3A 2AA4A 3D2FA 3TSPA 4UY8O 3GDQA 3A8YA 3ZYYX 1ESVA 3VTIA 3VF4A 5AQOA 1C0FA 3ZEUA 5JICA 4BRLA 2P9SA 3CPEA 3VEXA 3A5LC 5BPMA 4BRAA 1DKGD 4I6MB 2JWLA 3MWPA 1TUYA 3A5MC 4BR9A 1SQKA 5CR4A 5ADXH 4H5WA 5JMVA 1QQNA 4CYEA 2V51B 3EKSA 4MDBA 2FSNA 3OHRA 5BN9A 4BR5A 1D4XA 4CZLA 2GX9A 3AARA 3UB5A 2Q1NA 1S3XA 3CI5A 3UE5A 1ZC6A 1SS6A 5BPLA 5LY3A 5HOOA 3FLVA 2I1JA 2F9TA 3HSCA 3Q7CA 5AQVA 5BN8A 4P7IA 3O1BA 3MX2A 3SMSA 4JHDB 2HE7A 3QFPA 3CJ7A 5CE3A 1YJNN 3CHWA 3WXLA 1HB8A 4H5NA 5FPEA 5M1OA 1BDGA 4BR2A 1T3VA 1Q18A 4BR4A 1IG8A 2WC9A 5MLCQ 4B1YB 4E1JA 5C0YA 1NI2A 2P9LA 4BC3A 4OPAA 3ZDTA 4CZKA 4YDUA 4YDUC 3VOVA 3SMPA 3DXMB 4PL8A 4DB3A 4JKHA 4H5RA 3CCRN 2F7TA 2NRXA 3U9ZA 1H1VA 1VQON 3KVGA 1QVGM 4JD2A 4IZ9A 4CZMA 3GBTA 3E9OA 3FP5A 1U6ZA 2IVNA 3SAFA 4BRDA 2ZJPL 2A5XA 1VQNN 3EPYA 3VEZA 4NB4A 3O8MA 4B1UB 5KQDA 3R8EA 2D0PA 3P4IA 3VEOA 3HRGA 1VQ7N 4G9ZA 5AQHA 3H3NO 3SK3A 5B8HA 4WFBL 4BY9C 2NRWA 1EF1A 4ILGB 1TYQA 2Q97A 3OBWA 4H0XB 1ZBSA 4A62A 5M1NA 2A40A 3CQXA 4XH5A 3M5RA 2E2NA 3FGUA 1MK7B 1YJWN 1NM1A 3NVKA 1IJJA 3QICA 4IJNA 3D7EO 1DT9A 2Q36A 4FO0A 4GV6A 2J0JA 3CETA 3FZHA 3UKRB 1GLDG 4BRMA 1RDWX 1Q7YO 4HDQA 3H6EA 3K9JA 2P9PB 3G71N 3DWLA 4ISFA 1GLCG 1WOQA 2YHYA 3GL1A 2I1KA 4FWOA 4JKCA 3VGMA 3VPZA 2NRRA 3E66A 1V4TA 3F9MA 5GINA 4BRFA 4EFHA 3AU5A 1GLLO 2ZWHA 3GOIA 2NZTA 3LM9A 2D1KA 3VF6A 2H3GX 3VTHA 1SZ2A 1HJOA 3O9SA 4WQ4C 4BQLA 5KPRA 1NGBA 4WFNL 4WF9L 4FWLA 5GAGP 2NRTA 3CMEN 2CB8A 1KAXA 3CQYA 5AQFA 3H3OB 4H0VB 4AF1A 2EWSA 1S72N 1WUAA 1T6DA 3JS6A 4FWNA 4MO4A 3MCAB 3U9DA 2E1ZA 2YJEA 4O8UA 4IO9L 3KHYA 4A61A 4CZFA 3G4SN 3H1QA 2ITMA 2I7PA 2Q0RA 4XEIA 2JWKA 4B1VA 1NGJA 3MN6A 4OO1J 2D2QA 3IDHA 3IMXA 3WQTA 5AZIB 1E5WA 4IDHA 4CZEA 1U2VA 4IFEA 5FPNA 4H0YB 1YUWA 4WYBA 4H5TA 3E1YA 3M6GA 3ATVA 4BRIA 3BEXA 4BRCA 3DXKA 2P9IB 4HWIA 4DKWA 2VCPA 4H0PA 3PLAA 4JKDA 3A5NC 1MK9B 3AY9A 3HZ6A 1KC7A 1K8KA 4ZRJA 1KBLA 3L4IA 3VEWA 3X23A 3D2EB 4JKEA 4JN4A 4MO5A 3CC4N 3FLCO 2ASPA 1YXQA 1YJ9N 4GNIA 3O9QA 3O4WA 3WEEB 3TU5A 1YI2N 3WQUA 4Z94A 3MWTA 3C7NB 3G9WA 1JCGA 1GLEG 4JAXA 5AQQA 4DHYA 3I56N 4YL8A 5E26A 4CZGA 1HPMA 1BU6O 2HBLA 5LJVA 5F0XA 3ATUA 3EE8A 5M1KA 3CCJN 4JNEA 2GUPA 3FZLA 4JEPA 2V7YA 4QS9A 4ILJA 3EZWA 3WXJA 3O9TA 2YHWA 4B1XB 4M63C 5KQ8A 3SLCA 1Q81O 3CJ1A 3OW2M 4QS7A 2P9UB 3VEVA 1VBHA 4K43A 3WXIA 4B1ZA 4WQ5C 3P39A 4BC2A 3HOSA 3TTFA 4CD1A 1VQMN 3SJHA 2ABDA 1YHQN 3HBTA 2KKZA 2PAVA 4IO8A 1KAYA 3E9PA 5HL7L 3IKMA 4BG9A 1NGDA 3MMVA 4IOAL 5AQPA 3CJAA 2A3ZA 3CCSN 2WH5A 5AQYA 5M1QA 1QHAA 3CIPA 2YX6A 3OA9A 3A0IX 3MN9A 3AAPA 5AZJB 4TKNA 5BRHA 5M1PA 3I8BA 4K41A 3LM2A 5AQMA 1QQMA 1X3MA 2BH1A 2QWLA 1MWMA 4YOUA 4F9OA 1HLUA 5AQWA 2X0SA 3T7ZA 1VQPN 3LDNA 1XC3A 3J8AA 2QA4N 3VEYA 3IUCA 5TKYA 1DGKN 1NBWA 3VGLA 2GEMA 4BRPA 1NGHA 3D2FB 4FSVA 4CZJA 1ACAA 3O80A 2J0KA 3EO3A 3ULEA 1VQKN 1NWKA 5GADP 3W0LA 2ZGZA 3G25A 4GY2B 4XH1A 3VERA 4CI6A 2P9SB 5C10A 1K9MO 1NGFA 3BP8A 3PIOL 2QWOA 3LDQA 3T69A 3EE9A 4FWKA 3LL3A 4BC5A 4YOYA 4A57A 2PBDA 1TUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILJ A;  4JKF A;  4JK8 A;  3ENB A;  3E66 A;  4ILG B;  4JKD A;  3SBG A;  4JKG B;  4JKE A;  3E9P A;  3SBT A;  4JKH A;  3E9L A;  4ILH A;  4JK9 A;  4JKA A;  3E9O A;  4JKG A;  4JKC A;  4JKB A;  4JK7 A; 
#chains in the Genus database with same CATH topology
 1EQY A;  1JLA A;  3T1H K;  2W40 A;  3HM8 A;  1XHZ A;  2NRV A;  3AO5 A;  3NE6 A;  3UKU B;  2YKM A;  1U4B A;  4C1N I;  5GAH P;  3WNH A;  3BDP A;  3CF5 L;  4CER A;  3JXU A;  5KPZ A;  3DYA A;  3AO1 A;  4M3T A;  2E6M A;  4PUO A;  4JKG B;  4JI5 K;  1BIS A;  2YVC A;  2NNW A;  1SL2 A;  2FDQ A;  1M90 O;  1GLA G;  3IVF A;  1NOZ A;  2P51 A;  4CEQ A;  4BE0 A;  4CJS A;  3F9K A;  1U45 A;  4CJK A;  1TK5 A;  2F9W A;  4DTP A;  1ATR A;  4E7H A;  5FDL A;  3VET A;  3GE1 A;  1NK5 A;  2I5J A;  4CD3 A;  2CH6 A;  4AQY K;  4OKK A;  3OY9 A;  1L3V A;  1NLV A;  1XMO K;  3NH0 A;  4JI6 K;  4KI4 A;  1I39 A;  2W6K A;  4YFU A;  2FJ9 A;  1NTI A;  4EP5 A;  4F2S A;  1HQU A;  4X62 K;  4BWJ A;  4FK0 A;  1HRH A;  1RBR A;  3HI0 A;  3VEN A;  3ZX3 A;  4FLX A;  1T6C A;  3NCI A;  1U47 A;  4KPY A;  3D2E A;  3EEQ A;  1NGI A;  3CC7 N;  1WNS A;  1HNI A;  5BRD A;  3CFR A;  4PKI A;  4IOC L;  1OKJ A;  4KHN A;  3CCM N;  1VQL N;  1GLB G;  3CCL N;  2IVO A;  1JDE A;  4LC9 B;  4H8K A;  1KQS M;  2QWQ A;  2HHH K;  1BOT O;  2AEH A;  3CYM A;  4BVO A;  4CJR A;  3KKR A;  2VGM A;  3TPQ A;  4H0T B;  3PVL A;  4CJ7 A;  3OYC A;  3KIO A;  4K25 A;  3DI6 A;  4C1N K;  1XI1 A;  3CD6 N;  1D9F A;  1HBK A;  2FXU A;  1CLQ A;  3NBP A;  4JHD A;  3L4Q A;  3DXK B;  4DR1 K;  5EX5 A;  1VSH A;  3SQ2 A;  1EET A;  3A5O C;  1GG3 A;  1E4F T;  4A5A A;  2O4G A;  3DXM A;  2FF3 B;  4FJN A;  2E8A A;  3EL2 A;  3ZT1 A;  5JLF A;  3J80 O;  2FSK A;  1ISN A;  1BWF O;  2WFB A;  1NMD A;  1MIZ B;  3C6H A;  2YCH A;  2I7N A;  1NJW A;  3AA4 A;  3AGK A;  1NK7 A;  1Z6R A;  1N8R O;  3P31 A;  3CC2 N;  3UKU A;  3MEE A;  2VWB A;  5D3G A;  2KZZ A;  3LZI A;  3AVK A;  5C2F A;  2ITG A;  1VAZ A;  3CJ9 A;  4GKJ K;  2G8W A;  4JKG A;  2RQ1 A;  2BUP A;  2EMS A;  2AL6 A;  3F2K A;  4KO0 A;  3QLH A;  4B3M K;  1SGH A;  2GBZ A;  2RE2 A;  1E4G T;  4DF8 A;  4FJK A;  4BRO A;  3V9Z A;  1K8A O;  4BGB A;  5DM6 L;  2KTQ A;  4DR6 K;  4W5R A;  2YKN A;  3C0B A;  4GW6 A;  4ELU A;  5GAE P;  3THY B;  2ZQB A;  3AO4 A;  2DIK A;  4CJT A;  3VA3 A;  4B1W B;  2E88 A;  3ZX0 A;  5CZ1 A;  1EWR A;  3BZC A;  4B8C A;  3ULE B;  1LCU A;  3LWL A;  1GLF O;  3MCP A;  2E20 A;  1TK0 A;  4FW2 A;  1GLJ O;  1S22 A;  2OA8 A;  3LDS A;  3I55 N;  4DV4 K;  3VMF B;  3ZSV A;  3S3M A;  5AQR A;  1QVF M;  1D5A A;  3FFK B;  3TSQ A;  4CJ4 A;  1SAZ A;  5LMU K;  1L3U A;  4GVM A;  1WB9 A;  2QWR A;  2QM1 A;  3KK7 A;  1TKD A;  4IJA A;  2HB5 A;  3KLF A;  2ZJR L;  2WUS A;  2FBY A;  3LDO A;  3AVG A;  3D45 A;  3OYM A;  3C7N A;  4NLB A;  4MDA A;  4CHP A;  4YOX A;  3THX B;  1JLQ A;  3THW A;  4L8R B;  4X65 K;  2ASM A;  1JLF A;  4F4K A;  2PFU A;  4B9M A;  2P9U A;  2D5R A;  3C6U A;  3C95 A;  3MXM A;  4AHT A;  2HHT A;  4IEE A;  1S1U A;  2ETJ A;  1U04 A;  2FBT A;  3LP3 A;  4I7F A;  2HNZ A;  1BUP A;  2JGU A;  4CF1 A;  3V1Q A;  5HRO A;  2VGN A;  5BR9 A;  2UYT A;  1NGA A;  4DFJ A;  1BCO A;  3MEC A;  4FXD A;  4LD0 A;  1RFQ A;  1U2V B;  3TAQ A;  4LF7 K;  3PY8 A;  3WT0 A;  4BR0 A;  2GWJ A;  3GDQ A;  3J81 O;  4NYF A;  3K0S A;  2P9S A;  4CFB A;  3V6D A;  3A5L C;  5BPM A;  4I6M B;  1ZBL A;  4DR7 K;  1I94 K;  1QQN A;  3EKS A;  2FSN A;  5C42 A;  4R5P A;  1CZB A;  4CJP A;  3KLG A;  3IAY A;  4FLZ A;  3UB5 A;  3CI5 A;  4AH9 A;  2O8C B;  4DTR A;  4CEA A;  2F9T A;  3NFA A;  3THY A;  1YT3 A;  4FK4 A;  3SMS A;  4M3Z A;  2HE7 A;  3QFP A;  3AVB A;  1I3A A;  3C94 A;  3AA3 A;  3CHW A;  4H5N A;  5M1O A;  3WXL A;  4X64 K;  4BE2 A;  3L2V A;  1T3V A;  4CJ5 A;  5HBM A;  2G8U A;  3HVR A;  1HR0 K;  4YDU A;  3SMP A;  4JI8 K;  4FM1 A;  4JI4 K;  4LH4 A;  2NRX A;  3U9Z A;  3K5M A;  1VQO N;  3GBT A;  2IVN A;  3FP5 A;  4FJM A;  3CM5 A;  2G8H A;  4BRD A;  3MEG A;  4RW4 A;  3VEZ A;  1VSJ A;  2D0P A;  3VEO A;  4KB0 A;  3HRG A;  3DM2 A;  4HUF A;  4CGJ A;  1VQ7 N;  2HHV A;  3ZT0 A;  5AQH A;  3H3N O;  4ZTF A;  2NRW A;  1EF1 A;  1TYQ A;  3OBW A;  1S6P A;  4FLW A;  4A62 A;  2EX3 A;  3LAM A;  1DTQ A;  2E2N A;  3FGU A;  2UUB K;  1NM1 A;  4CK2 A;  4GV6 A;  2J0J A;  1J5O A;  3OYI A;  3H6E A;  3K9J A;  3MED A;  1D8Y A;  1IV0 A;  4F3T A;  5GIN A;  5I42 A;  3GOI A;  3K59 A;  4RW7 A;  3VTH A;  2H3G X;  1HJO A;  4CGD A;  4WF9 L;  1BI4 B;  2VG7 A;  5GAG P;  3L3U A;  3TAE A;  4JYA K;  3CQY A;  2UXD K;  1WSI A;  3QEP A;  3ZSY A;  3CQ8 A;  4RW8 A;  3JS6 A;  4FWN A;  4MO4 A;  3S3N A;  4O8U A;  4IO9 L;  2JLE A;  3B6P A;  1R0A A;  3DLK A;  1KLM A;  2I7P A;  1LWE A;  1Z26 A;  2JWK A;  1S5J A;  3MN6 A;  2D2Q A;  4KHU A;  3WQT A;  5AZI B;  1E5W A;  4IDH A;  4CZE A;  1U2V A;  3RMB A;  5CE3 A;  4E89 A;  4BRC A;  3ATV A;  3BEX A;  4KHP K;  2P9I B;  4HWI A;  2VWK A;  4FJ9 A;  1YTU A;  3T1Y K;  4JKD A;  3A5N C;  5J2M A;  2HVI A;  1KC7 A;  1K8K A;  5HRS A;  4ZRJ A;  4JN4 A;  4MO5 A;  3FLC O;  4DSE A;  1YXQ A;  3WEE B;  2E5L K;  2X6S A;  1S1T A;  3G9W A;  1SKS A;  4RW6 A;  3HO1 A;  5E26 A;  4CZG A;  2P1J A;  3EE8 A;  1WAF A;  5J2P A;  2YNH A;  1IG9 A;  2LSN A;  3O9T A;  4M63 C;  3OW2 M;  4QS7 A;  5KRT A;  1S6Q A;  3VEV A;  1JL1 A;  4CJV A;  3VQA A;  1A5V A;  3P39 A;  3TTF A;  4CD1 A;  4M3U A;  2KKZ A;  5KTQ A;  4CFD A;  3HL8 A;  3E9P A;  3HM9 A;  3IKM A;  4BG9 A;  4DTU A;  3MMV A;  5AQP A;  1X9M A;  3T1A A;  5M1Q A;  4JI7 K;  5BRH A;  4YOU A;  4QAG A;  5C24 A;  3SV4 A;  3LDN A;  4BRP A;  3D2F B;  4FSV A;  4CZJ A;  1VQK N;  1ACA A;  1OH7 A;  3EO3 A;  5GAD P;  1BGX T;  4BDZ A;  2RF2 A;  2DY4 A;  3W0L A;  2ZGZ A;  1OH5 A;  3G25 A;  3VER A;  4W5O A;  5C10 A;  1K9M O;  3BP8 A;  3T69 A;  3AVM A;  3EE9 A;  3LL3 A;  3NGI A;  1C1A A;  1K73 O;  3OYB A;  3F5T A;  3HTV A;  4FWP A;  1KVA A;  3ZX2 A;  3QIP A;  4BRN A;  1LOT B;  1C6V A;  1Q8I A;  3W3D A;  1ASW A;  3VQ4 A;  4B08 A;  3R1X A;  3WXK A;  4Y1C A;  1RDU A;  3ZCM A;  1P90 A;  1BI4 A;  4KBO A;  1VQ6 N;  2CGJ A;  3TR8 A;  2OPQ A;  1HKC A;  3K9K A;  3AV9 A;  3TSU A;  4DQS A;  4K8Z A;  4EP4 A;  2EMT A;  1KTQ A;  1JLB A;  1S9E A;  4B3T K;  1GC7 A;  3UIQ A;  5IJM A;  2HST A;  4FJH A;  1LAV A;  3ZSQ A;  3M8P A;  3CCQ N;  3V4I A;  5F2R A;  1G15 A;  3B8A X;  4RTF D;  2OPP A;  5AZI A;  2YHA A;  3N4P A;  1L3T A;  3DLH A;  3ISN C;  3MDQ A;  5BRF A;  2OPS A;  4CF8 A;  3SQ1 A;  4DSJ A;  3Q7B A;  4DQP A;  1VBG A;  3MN5 A;  3SI6 A;  3WNE A;  3LDP A;  4JKF A;  3WEE A;  4MLE A;  5K14 A;  4MLH A;  3SJJ A;  1Z05 A;  3ENB A;  2XHB A;  5JVH L;  4JS4 A;  3FE1 A;  4RW9 A;  4O4G A;  3QDK A;  4M3Y A;  3ID6 A;  4BRE A;  3HP6 A;  2QTD A;  3DJC A;  4A5B A;  3KK2 A;  4NY0 A;  4BVP A;  1GC6 A;  4LSL A;  5T7B A;  3QBW A;  2KLA A;  3O4N A;  3K58 A;  2ZM6 K;  4FM0 A;  2FF6 A;  4UY8 O;  1RT4 A;  3FFI A;  4JS5 A;  2HBJ A;  1VQ4 N;  3WA0 A;  3V1R A;  2OTL N;  2O4I A;  4DCH A;  4CHY A;  2QW9 A;  4K8X A;  1XQS C;  2XRI A;  3U8Z A;  4FVM A;  4K42 A;  5FPD A;  3L2Q A;  2WBN A;  4FLY A;  4CES A;  3RMC A;  4FWR A;  2FSJ A;  1C1B A;  3H1V X;  5J2Q A;  4UQG A;  4Z4I A;  2ZF5 O;  2D10 A;  1T44 A;  3DAW A;  4DQ8 A;  4F3O A;  2Q3S A;  2VQE K;  2X6N A;  3CXC M;  4RCH A;  3ZET B;  4A59 A;  1IKX A;  3OS0 A;  1UA0 A;  4KHY A;  2ZPY A;  4M3R A;  1WLJ A;  4FJL A;  3NH1 A;  4EAH D;  3CFP A;  4BRH A;  4IEI A;  3DRP A;  4FLV A;  4JK9 A;  1YIT N;  1MU2 A;  1SKR A;  2XY5 A;  1YF5 L;  1TKZ A;  4LF5 K;  3L3V A;  4PHT X;  5HP1 A;  2WOM A;  3TWH A;  2Z1H A;  1NK8 A;  4BQZ A;  3QO9 A;  2CGL A;  5AQG A;  3DOL A;  2F8T A;  3OS2 A;  4CEZ A;  2O8E B;  1O13 A;  5EXW A;  3OYH A;  3HT3 A;  5JVG L;  2QI2 A;  3WXM B;  1BA0 A;  4QS8 A;  3PSI A;  4OPH A;  4EHU A;  2OPR A;  1M1K O;  3RVC A;  1W2B M;  4BRK A;  4OKJ A;  5EOY A;  2R82 A;  1J6Z A;  1YAG A;  3IG1 A;  1JXB A;  4B3O A;  4FVU A;  3AA2 A;  3QIO A;  1C1C A;  2CQU A;  3VQ5 A;  5ELZ A;  3ZT4 A;  3H45 C;  1UA1 A;  4FOI A;  4KH6 A;  3RMA A;  4OLB A;  5ADX A;  3SUQ A;  1NU0 A;  3FZM A;  4C8L A;  3VQC A;  3PSF A;  4Z4E A;  1LV5 A;  3V9S A;  1HKG A;  2KFN A;  5AJ3 K;  2PYL A;  3PO4 A;  1MWK A;  2HNY A;  4CHN A;  1NGE A;  4YOT A;  2BTF A;  4EHT A;  4F2R A;  4FJI A;  5IT9 O;  1KD1 O;  2F8S A;  4C23 A;  3CCE N;  3ZSR A;  5DMR A;  1JCE A;  1LWF A;  2HHW A;  1RCH A;  4YY3 K;  3AU4 A;  5LMN K;  1IO2 A;  3E9L A;  3CJC A;  3FZK A;  3HYF A;  5GIO A;  1G99 A;  3H08 A;  2HMP A;  4DS5 A;  3QB0 A;  3IFR A;  1RGI A;  4DLG A;  3VES A;  2W42 A;  4DV7 K;  5JLH A;  3C6A A;  3OYD A;  3EN9 A;  4DF4 A;  3ENH A;  1NKB A;  4NCG A;  1IKW A;  4W5N A;  3SUN A;  1N33 K;  1BA1 A;  3AVL A;  4EIA A;  2P9N B;  3WNF A;  5M1F A;  4IOX A;  4H03 B;  3SBT A;  1WSG A;  4AHS A;  5I9E B;  4FM2 A;  4JKA A;  2VYP A;  3ZET A;  2HMI A;  2AA4 A;  3TSP A;  2Y1J A;  3A8Y A;  3KLI A;  2ZD1 A;  3ZYY X;  3VTI A;  5AQO A;  2FBV A;  4BRL A;  3CPE A;  2JWL A;  3AVC A;  2OZS A;  5JMV A;  4MDB A;  5BN9 A;  1BIU A;  1D4X A;  2Q1N A;  1S3X A;  5HOO A;  1SS6 A;  4PY5 A;  4P7I A;  1QHT A;  1LAW A;  3O1B A;  4XIU A;  4BWM A;  1XMQ K;  1Q18 A;  2QK9 A;  4BR4 A;  5MLC Q;  1GOA A;  4E1J A;  4OPA A;  4DB3 A;  4FJX A;  4H5R A;  2F7T A;  1T05 A;  1WSH A;  4AHC A;  1RTH A;  4ELT A;  2ZJP L;  2A5X A;  3AVH A;  4DQQ A;  4B1U B;  3P4I A;  4YHH K;  3RRH A;  3ZSO A;  4DU3 A;  3SK3 A;  3L2R A;  5CYM A;  4BY9 C;  1HMV A;  2Q97 A;  1QSS A;  4XH5 A;  2RKI A;  1MK7 B;  2E6L A;  2BE2 A;  1YVU A;  2HND A;  2Q36 A;  4FO0 A;  4NXM K;  1REV A;  3UKR B;  1GLD G;  1WAJ A;  4CGI A;  1JL2 A;  1Q7Y O;  3HK2 A;  4Q5V A;  2P9P B;  5FRO A;  1FK9 A;  3DWL A;  3G71 N;  4KRF A;  2BAN A;  3CG7 A;  1BL3 A;  3THV A;  4OLA A;  1RTJ A;  4E0D A;  5KGX A;  3ULD A;  2NZT A;  4BR9 A;  4I9L A;  3AVF A;  3RR7 A;  4WFN L;  1TL1 A;  1B9F A;  5A2Q O;  5E41 A;  2O8B B;  3PV8 A;  1BIZ A;  5AQF A;  4LY7 A;  4DV6 K;  4LH5 A;  1RIL A;  1WUA A;  4DTM A;  3U9D A;  4E19 A;  3MCA B;  3CM6 A;  2G8F A;  4A61 A;  4CHQ A;  1D9D A;  4KV8 A;  2O8F B;  2ITM A;  4B1V A;  2Q0R A;  4XEI A;  1TGO A;  4OO1 J;  4O5B A;  4DR4 K;  3DXK A;  4N56 A;  4H0P A;  1C0T A;  4ZTJ A;  1MK9 B;  1RBS A;  3AY9 A;  1XHX A;  2Z1I A;  4DSF A;  3CC4 N;  1YJ9 N;  3PUF A;  1S1W A;  3O9Q A;  1KFS A;  3O4W A;  4IFV A;  4LF4 K;  3JSM A;  3WQU A;  3MWT A;  1JCG A;  4DHY A;  4OKE A;  5AQQ A;  4YL8 A;  1HPM A;  1BU6 O;  5F0X A;  1TAQ A;  5M1K A;  2V7Y A;  5CY4 A;  1Q81 O;  4CJL A;  3WXI A;  2ABD A;  1YHQ N;  2PAV A;  4I2P A;  4NCA A;  3OYF A;  1Z25 A;  5JS2 A;  1N32 K;  5HL7 L;  4IOA L;  1NKE A;  3CJA A;  4FZY A;  3KJV A;  4KKO A;  2WH5 A;  4LFC K;  1BHL A;  3OA9 A;  4NCB A;  5AZJ B;  4TKN A;  5M1P A;  3V9W A;  4F9O A;  1QQM A;  2BH1 A;  4Z0U A;  2QWL A;  1MWM A;  5AQW A;  1VQP N;  1C0U A;  1S1V A;  1XC3 A;  2QA4 N;  3IUC A;  1DGK N;  1FKP A;  4FJJ A;  2UXB K;  2GEM A;  3ULE A;  2J0K A;  2DTU A;  1IBL K;  2DFF A;  4W5Q A;  1NWK A;  4CJE A;  2X78 A;  3VQE A;  4IKF A;  5FRN A;  2Z1J A;  3TAB A;  1U49 A;  4HTU A;  3OYG A;  4A57 A;  4AIL C;  1TUU A;  4AM6 A;  5JVL A;  4B3R K;  3M3Z A;  3KD5 E;  2P9P A;  2A42 A;  3VQQ A;  4FPB A;  4JI0 K;  3J7Y P;  2A41 A;  4DUZ K;  1TL3 A;  1YIJ N;  4Y0W A;  4PKG A;  3O5B A;  1QQC A;  1C0G A;  3BGR A;  1HX1 A;  3ALY A;  4DFK A;  1ATS A;  3NF7 A;  4FJ5 A;  4YOW A;  3THX A;  4IXC A;  2D0C A;  3PX4 A;  1N36 K;  3NMU A;  1FXX A;  4DFM A;  3ID8 A;  3P38 A;  4CK1 A;  3CCV N;  1NG9 A;  2HW3 A;  5LJW A;  4FJ8 A;  2O8F A;  5AQI A;  4KTZ A;  2W41 A;  1SV5 A;  4M45 A;  1B92 A;  3RMD A;  3M8S A;  3KZB A;  2E4L A;  4CIF A;  3QNO A;  5AQN A;  1TAU A;  3N4Q A;  1XUP O;  4KRE A;  4DV5 K;  4J2A A;  2QWP A;  3TAP A;  3M1F A;  2CGK A;  4BDP A;  2W6L A;  2QKB A;  1VSM A;  3K5L A;  3DLR A;  1X9S A;  1Y64 A;  4WE1 A;  2V7Z A;  2G8V A;  4M42 A;  2QXL A;  1L5U A;  1HNX K;  2E2O A;  1VSI A;  1MA9 B;  3SUP A;  5E84 A;  1LWC A;  1KVB A;  4C8M A;  4I6M A;  2HBK A;  5DK5 A;  3KWG A;  5AQJ A;  1JLC A;  3SNN A;  4U7B A;  2D4W A;  4CGF A;  4WCE L;  3FZF A;  3TI0 A;  3LPU A;  1XNR K;  4IWV A;  3BUZ B;  3S9H A;  2O8C A;  3S3O A;  2ZJQ L;  3MK6 A;  3OYK A;  3LP0 A;  4WQ5 A;  3KD1 E;  2E2Q A;  2YHB A;  3ENO A;  1R59 O;  1CXQ A;  3NF8 A;  3OVN A;  1Y19 B;  2YNG A;  4DXA B;  4FPA A;  4EKU A;  1IKY A;  2V52 B;  4J2B A;  5AR0 A;  1NJZ A;  1VQ8 N;  1TKX A;  3CCU N;  2GTD A;  1YVN A;  3SQ0 A;  5SWM A;  4CZH A;  4ZRI A;  3KWI A;  3I8D A;  3EZ5 A;  4H0O A;  3TAM A;  4NO7 A;  5HRR A;  3VF2 A;  3QEV A;  1J9A A;  3KKS A;  4DTS A;  3FR0 A;  3HVT A;  3VGK A;  5AQK A;  3H46 O;  2FLO A;  4CBU A;  2VWJ A;  2YI1 A;  1ASU A;  4FWQ A;  1RTD A;  5AFU A;  3OYJ A;  4B9L A;  3O9U A;  4CFC A;  4M7X A;  5AQZ A;  1W9H A;  1W97 L;  3DLL L;  4CF9 A;  2QEX N;  5TKW A;  4ELV A;  3R6M A;  3AVN A;  4FZZ A;  4DWI A;  3PX0 A;  3RWU A;  1QQO A;  4M7Y A;  1EP4 A;  4CJW A;  4BC4 A;  1RBU A;  4GVE A;  4ICL A;  3ZSZ A;  2VQF K;  3U4L A;  1ZXO A;  4L3Q A;  2OYQ A;  4EZ9 A;  4DV2 K;  4DV0 K;  1X3N A;  3U8X A;  2J0M A;  5BPN A;  4WFA L;  4DTO A;  4FZX C;  3IRX A;  5LL6 Z;  3WNG A;  2CH5 A;  1J53 A;  1YTA A;  4A2B A;  4ISG A;  5BR8 K;  3I0S A;  3SAG A;  3SAH A;  2HHS A;  4DQR A;  3S41 A;  5CYQ A;  5C12 A;  2E1Y A;  2P9I A;  3R3L A;  4E7J A;  4FJ7 A;  3QER A;  3U7D A;  1NK0 A;  4RG8 A;  3C65 A;  1HUX A;  4QOZ B;  1VK0 A;  1X9J A;  1NJX A;  3SBG A;  3J7A P;  4O5F A;  3VN5 A;  5DM7 L;  4AHU A;  4PKH A;  4IBN A;  3KK1 A;  4PL7 A;  1ZBI A;  4CJF A;  3SV3 A;  3SUO A;  4O55 A;  3CMA N;  4BG8 A;  4DS4 A;  2HVH A;  2UXC K;  4CBW A;  3HJF A;  3SQ4 A;  1CZA N;  2NUB A;  5BRE A;  4OJR A;  2HHX A;  4B8A B;  4YOV A;  4GV9 A;  3VA0 A;  3GG4 A;  3BIN A;  4DR2 K;  4JI3 K;  3LP1 A;  1OH6 A;  1MIX A;  2AP1 A;  3QML A;  4PQU A;  4HCC A;  1NGC A;  3BF3 A;  3NVM A;  4KH4 A;  1SL0 A;  3O4Q A;  1VSF A;  1ASV A;  1BG3 A;  4GV3 A;  3L0Q A;  1IBK K;  3D2F A;  3ASM A;  1SKW A;  2AJQ A;  1ESV A;  2YV0 X;  3VF4 A;  4B9N A;  3ZLJ A;  5JIC A;  1JLE A;  1WBB A;  3VEX A;  4BRA A;  1DKG D;  3O3G A;  1TUY A;  3A5M C;  4C8O A;  1SQK A;  1NNE A;  5ADX H;  2V51 B;  4CYE A;  1JXE A;  3OHR A;  1X9W A;  4CZL A;  4DUY K;  3T3F A;  3TAG A;  4N41 A;  2GX9 A;  3QEI A;  4DV1 K;  4DV3 K;  5BPL A;  2KQ2 A;  3FLV A;  5BN8 A;  2IS3 A;  3LAL A;  3Q7C A;  4AHV A;  4M3W A;  3MX2 A;  4JHD B;  1HB8 A;  4BR2 A;  3P1G A;  2A1R A;  4KI6 A;  2FBX A;  4E7K A;  1KSP A;  1NI2 A;  1GOC A;  4YDU C;  3DXM B;  4PL8 A;  4JKH A;  3CCR N;  4CVN E;  1H1V A;  4IZ9 A;  1NK9 A;  1U6Z A;  3EPY A;  4NB4 A;  3O8M A;  4B9U A;  4IDK A;  2B6A A;  4FLU A;  4W5T A;  4O44 A;  3L2U A;  1VRT A;  3QES A;  1NMN A;  2GUI A;  1HJR A;  4H0X B;  3ZT3 A;  3SPY A;  3ZSX A;  3JYT A;  1ZBS A;  2R7Y A;  2A40 A;  3NVK A;  4CEC A;  3QIC A;  3D7E O;  3BZK A;  1OVQ A;  4HDQ A;  2KW4 A;  3K5O A;  3LAN A;  4M41 A;  4ISF A;  1WOQ A;  4CGH A;  3VPZ A;  4FWO A;  1RDB A;  4DLE A;  3E66 A;  5KRS A;  1V4T A;  1RDD A;  4DSL A;  1RNH A;  2D1K A;  5SZT A;  4M3X A;  4BQL A;  3O9S A;  2XO7 A;  5KPR A;  1NGB A;  4FWL A;  3CFO A;  3D0P A;  5I3U A;  1T8E A;  4CCH A;  1A5X A;  1KAX A;  1IH7 A;  3H3O B;  1S72 N;  5EU7 A;  3NDK A;  1T6D A;  1WSE A;  4E1N A;  4KB1 A;  5J1E A;  4DR5 K;  4LF6 K;  2XY6 A;  1NGJ A;  5J2N A;  3QIN A;  4QCL A;  3IDH A;  3HXM A;  4KAZ A;  1QTM A;  1NOY A;  4WYB A;  1YUW A;  4NXN K;  4H5T A;  4BRI A;  4OPK A;  1T03 A;  3HPH A;  4OGC A;  2VCP A;  4DKW A;  3PLA A;  2UU9 K;  1F21 A;  3B6O A;  1IBM K;  2Y1I A;  4KTQ A;  2IAJ A;  3HZ6 A;  1JKH A;  2Z1G A;  1KBL A;  3X23 A;  3PX6 A;  2HHQ A;  4GNI A;  3TU5 A;  1XC9 A;  1LW2 A;  4FJG A;  3JAM O;  3C7N B;  4ZHR A;  2P5O A;  2HBL A;  2HHU A;  3THW B;  3ATU A;  3CCJ N;  4JNE A;  2GUP A;  4J2E A;  4JEP A;  3WXJ A;  4B1X B;  2YHW A;  5KQ8 A;  1RDA A;  4BAC A;  2P9U B;  1RT6 A;  4I2Q A;  1T7P A;  1VBH A;  4K43 A;  4CEF A;  4WQ5 C;  3HBT A;  4IO8 A;  4C8N A;  1KAY A;  5FRM A;  2OZM A;  4LF8 K;  2O8E A;  4O0J A;  2A3Z A;  5AQY A;  3CIP A;  4B9V A;  3A0I X;  3MN9 A;  3AAP A;  1HYS A;  4H4O A;  4DR3 K;  3I8B A;  4CGG A;  4K41 A;  5AQM A;  4V19 S;  1X3M A;  3HST B;  2X0S A;  3T7Z A;  1A5W A;  4FLT A;  4CHO A;  3DRS A;  3MXJ A;  5TKY A;  1NBW A;  3VGL A;  3OYE A;  1OH8 A;  3O80 A;  4O0I A;  4B9S A;  3QEX A;  3V81 A;  2IC3 A;  2P9S B;  4H4M A;  1NGF A;  1ZBU A;  3PIO L;  2QWO A;  3LDQ A;  4FWK A;  4BC5 A;  1KRP A;  2D0O A;  3HOT A;  2NRH A;  4CZI A;  2G8I A;  1KAZ A;  1DIK A;  5HLF A;  4Z4G A;  1JCF A;  2QWN A;  5AQX A;  3RSE B;  3EY1 A;  5AQU A;  4ZRK A;  2OTJ N;  4A2A A;  4DMN A;  2COP A;  3CJB A;  5C15 A;  1BQM A;  3OBY A;  4FYD A;  1H4R A;  1RT1 A;  2YNI A;  3PIP L;  5EVZ A;  2QWM A;  4AHR A;  3LDL A;  1VQ5 N;  4IG3 A;  4WQ4 A;  3HP9 A;  4JK8 A;  3AO3 A;  3KLH A;  3QEW A;  1NJI O;  1EXQ A;  2FC0 A;  2RPI A;  3CER A;  3OYL A;  1FW6 A;  4GMJ B;  2D11 A;  4F8R A;  1QZ6 A;  4ISE A;  3TAN A;  1KCF A;  1EX4 A;  2VG6 A;  4XH4 A;  1TYQ B;  1VRU A;  1JJ2 M;  3KK3 A;  1GOB A;  4O8K A;  2P9N A;  2GEL A;  4CJQ A;  4TSX A;  1Q9X A;  1VSD A;  4FL9 A;  2ASO A;  2BGG A;  1KXP A;  1ZYQ A;  2LBB A;  1NGG A;  1J54 A;  2F4V K;  3LPT A;  4Q0B A;  3DMJ A;  4Z4C A;  1BCM A;  1IKV A;  1WN7 A;  3RR8 A;  1ST7 A;  4C8K A;  4E1M A;  2QXF A;  4GKK K;  1VSL A;  4AM7 A;  4BGA A;  4DTN A;  1W7A A;  3M8Q A;  2NLX A;  3NGY A;  2IVP A;  3QIJ A;  3O9R A;  2Q31 A;  3M8R A;  4JK7 A;  2KHO A;  2OAN A;  3U3Y A;  4HVJ A;  1TK8 A;  2NRZ A;  4J8F A;  4BR7 A;  2GV9 A;  3TTC A;  1DLO A;  5F1X A;  2IGI A;  4HTL A;  2PZS A;  4KHS A;  3L8B A;  3NHG A;  1VQ9 N;  4BE1 A;  3AVI A;  2GWK A;  2P9K B;  1EWQ A;  3K57 A;  4F7G A;  5CZ2 A;  3C6T A;  3VQ9 A;  4H5V A;  1DTT A;  4YOR A;  5EY4 A;  1X1P A;  3AGR A;  3V9X A;  1K8K B;  1N5Y A;  3R9P A;  1RT7 A;  2EHG A;  2Q2R A;  3AAQ A;  3VQD A;  3O3F A;  1VHX A;  1N34 K;  2DPN A;  1NVL A;  2O8D B;  4KH5 A;  1KC8 O;  1J5E K;  1ATN A;  3DOK A;  5C2D A;  4E7I A;  2IDO A;  4CBX A;  3E01 A;  1UWB A;  1HPZ A;  3L2W A;  1BQN A;  1MDU B;  3ZEU B;  2Q0U A;  2XY8 A;  3O1W A;  4OGE A;  3RSE A;  1NK6 A;  2HOE A;  3OS1 A;  1ITG A;  3NF6 A;  1RTI A;  5GIP A;  4JKB A;  4DSK A;  3DLG A;  3TAR A;  3QBX A;  3QFU A;  4RWT A;  4MQ3 A;  2PY5 A;  4BRQ A;  4GXB A;  1HQE A;  5AQS A;  3UKR A;  2J4R A;  4R79 A;  3EKU A;  1HYV A;  3MX5 A;  4CW7 B;  4LFB K;  3K2P A;  1TVR A;  3NAE A;  4HUE A;  1GGO A;  2YJF A;  4FWS A;  4DFP A;  2KZM A;  1HB6 A;  3VQ7 A;  3WUH A;  4X66 K;  3J7Z O;  2O8B A;  4DTX A;  4KTW A;  3PZD A;  1Y97 A;  4OVL A;  3KLE A;  1HNZ K;  1ZBH A;  2YHX A;  2P9L B;  1OVY A;  3T19 A;  4J2D A;  2XY7 A;  4CIG A;  3I33 A;  4CJU A;  4JD2 B;  3SZ2 A;  4CFA A;  3NH2 A;  1DEJ A;  2UUA K;  5AQT A;  2RHK A;  3G6E N;  1K6Y A;  4HUG A;  2OCE A;  3VQB A;  5AQL A;  3O6W A;  4U67 L;  4CEO A;  1HNV A;  2PYJ A;  4CF2 A;  5HRP A;  3SCX A;  2ZGY A;  1NJY A;  3KTQ A;  1QZ5 A;  5KPT A;  3CPW M;  1QSL A;  4NLC A;  3U3G A;  1CZ9 A;  3OJS A;  5CHI A;  1BO5 O;  4FOE A;  3RTV A;  1KFD A;  3O08 A;  1V4S A;  2HRJ A;  1QS4 A;  1RDC A;  3G0Z A;  1E3M A;  4CIE A;  1KLN A;  3V1O A;  2WTU A;  1J19 A;  5AFU H;  4HDO A;  1RBV A;  1B9D A;  4LSN A;  4B9Q A;  4JRP A;  1HKB A;  3MN7 A;  1Q86 O;  3TAF A;  1Q82 O;  2HF3 A;  1EO1 A;  3TTD A;  2P9K A;  5FPM A;  2HF4 A;  4IG0 A;  3AA5 X;  2HBM A;  1P8Z A;  4FWM A;  5H1S Q;  3HPO A;  3D6R A;  4CK3 A;  1S9G A;  1S1X A;  5AZJ A;  5IWA K;  2E2P A;  3VQ8 A;  1ILY A;  3O3H A;  3BF1 A;  2QKK A;  2O8D A;  3OJU A;  3DLB A;  4YNQ A;  2A6A A;  4ILH A;  4BRG A;  4JI2 K;  2UUC K;  2IIR A;  5JS1 A;  3L6Q A;  4OX9 K;  1WSF A;  1RBT A;  4Y1D A;  1RT5 A;  1U48 A;  1QE1 A;  1VSK A;  1UAX A;  1C0F A;  3ZEU A;  1HYZ A;  4DQI A;  2B5J A;  4I9Q A;  4CF0 A;  3OYA A;  3ITH A;  3MWP A;  2ZE2 A;  4CED A;  5CR4 A;  4H5W A;  3OYN A;  1RT2 A;  4BR5 A;  3U6F A;  3AVA A;  3AAR A;  4N5S A;  3UE5 A;  5LY3 A;  1ZC6 A;  4CEB A;  2I1J A;  3HSC A;  5AQV A;  1O1W A;  2RN2 A;  4DG1 A;  4HHT A;  3DLE A;  4HCB A;  3CJ7 A;  3K5N A;  1YJN N;  5FPE A;  1BDG A;  1NK4 A;  4B3S K;  4N76 A;  1IG8 A;  2WC9 A;  4B1Y B;  5C0Y A;  2P9L A;  4BC3 A;  3ZDT A;  4CZK A;  3VOV A;  4FK2 A;  3KVG A;  1QVG M;  4JD2 A;  1FJG K;  2D0A A;  4CZM A;  3E9O A;  1TKT A;  1LW0 A;  5KGW A;  5HRN A;  3SAF A;  4ID5 A;  3SPZ A;  1VQN N;  5KQD A;  3R8E A;  2ATQ A;  3NF9 A;  1XWL A;  4G9Z A;  5B8H A;  4IFY A;  4WFB L;  3ZT2 A;  4KFB A;  1SUQ A;  4ILG B;  2YNF A;  1JLG A;  3DRR A;  1L3S A;  5M1N A;  3CQX A;  3M5R A;  1YJW N;  3HPG A;  2KFZ A;  4IJN A;  1IJJ A;  1DT9 A;  3F73 A;  4BDY A;  3CET A;  3FZH A;  4BRM A;  1RDW X;  3AVJ A;  4PWD A;  1GLC G;  3VGM A;  2YHY A;  3GL1 A;  2I1K A;  4JKC A;  5C25 A;  2NRR A;  3F9M A;  4BRF A;  4EFH A;  3AU5 A;  1GLL O;  2ZWH A;  4FCY A;  3LM9 A;  3VF6 A;  1SZ2 A;  4WQ4 C;  3OTO K;  1QSY A;  4LF9 K;  1VSE A;  3ZSW A;  2VG5 A;  3BY5 A;  1FKO A;  4G1Q A;  2NRT A;  1WSJ A;  2CB8 A;  3CME N;  4Z4F A;  3VQ6 A;  3QNN A;  4H0V B;  4AF1 A;  2EWS A;  2BDP A;  4NYN A;  2E1Z A;  2YJE A;  3KHY A;  4CJ3 A;  4DU4 A;  4CZF A;  4N47 A;  3G4S N;  3H1Q A;  2X74 A;  4PA1 A;  4Z4H A;  2B4J A;  4K0K K;  3IMX A;  3EYZ A;  4OPJ A;  4MFB A;  3I0R A;  4IFE A;  5FPN A;  4H0Y B;  3E1Y A;  3M6G A;  4EZ6 A;  3VQP A;  1WBD A;  3MAQ A;  3L4I A;  3VEW A;  3D2E B;  1XNQ K;  4JKE A;  4DSI A;  2ASP A;  3LAK A;  3LZJ A;  4CEE A;  1TV6 A;  1YI2 N;  1UOC A;  2D0B A;  4Z94 A;  4JAX A;  1GLE G;  4JI1 K;  3I56 N;  2DFH A;  1CXU A;  5LJV A;  4CHZ A;  4CE9 A;  2A1S A;  3RRG A;  3FZL A;  4QS9 A;  3V9U A;  4ILJ A;  4ID1 A;  3EZW A;  1NKC A;  3A2F A;  4DU1 A;  3SLC A;  3SYZ A;  3CJ1 A;  3P83 D;  4FW1 A;  5KI6 A;  4B1Z A;  3AO2 A;  1VQM N;  4BC2 A;  3HOS A;  3SJH A;  3PO5 A;  4LFA K;  2WON A;  3IS9 A;  4JLH A;  2DFE A;  4JRQ A;  3P5J A;  1NGD A;  5FLX O;  1HNW K;  3CCS N;  1QHA A;  2IOC A;  1KVC A;  2YX6 A;  2G8K A;  2P5G A;  3QET A;  2F96 A;  1C0M A;  3NGZ A;  1ZBF A;  1Q9Y A;  3LM2 A;  4KHQ A;  4KHW A;  4B9T A;  1HLU A;  1EKE A;  3J8A A;  3LP2 A;  4DTJ A;  3VEY A;  1W0H A;  3LWM A;  1NGH A;  4E7L A;  1RT3 A;  3G10 A;  1SL1 A;  1N6Q A;  4GY2 B;  4XH1 A;  4CI6 A;  4E3S A;  4JV5 K;  3MXI A;  4YOY A;  2PBD A; 
#chains in the Genus database with same CATH homology
 2D0O A;  3HOT A;  1K73 O;  4AM6 A;  2NRH A;  5JVL A;  1EQY A;  3F5T A;  3HTV A;  4CZI A;  4FWP A;  2W40 A;  3M3Z A;  3HM8 A;  1KAZ A;  2NRV A;  1DIK A;  3UKU B;  3ZX2 A;  4C1N I;  5GAH P;  2P9P A;  3CF5 L;  2A42 A;  3JXU A;  5KPZ A;  1JCF A;  2QWN A;  1LOT B;  5AQX A;  4BRN A;  4FPB A;  3W3D A;  3RSE B;  2A41 A;  4JKG B;  5AQU A;  4ZRK A;  1YIJ N;  2OTJ N;  4Y0W A;  3R1X A;  4PKG A;  4A2A A;  3WXK A;  1RDU A;  3O5B A;  2COP A;  2YVC A;  1C0G A;  1HX1 A;  1P90 A;  2NNW A;  3CJB A;  2FDQ A;  4KBO A;  1GLA G;  3IVF A;  2CGJ A;  5C15 A;  1M90 O;  1VQ6 N;  1ATS A;  3OBY A;  1HKC A;  4YOW A;  4IXC A;  3K9K A;  3NMU A;  1H4R A;  2F9W A;  1ATR A;  3TSU A;  3ID8 A;  3PIP L;  5EVZ A;  3P38 A;  3VET A;  2EMT A;  3GE1 A;  2QWM A;  3LDL A;  1VQ5 N;  3CCV N;  4CD3 A;  1GC7 A;  2CH6 A;  5IJM A;  5LJW A;  4WQ4 A;  2HST A;  4JK8 A;  1NJI O;  3CCQ N;  1NLV A;  5AQI A;  5F2R A;  3CER A;  3B8A X;  2W41 A;  2FJ9 A;  4RTF D;  5AZI A;  2D11 A;  1NTI A;  1QZ6 A;  4ISE A;  3KZB A;  3N4P A;  3MDQ A;  5BRF A;  3HI0 A;  3VEN A;  5AQN A;  3ZX3 A;  3N4Q A;  1XUP O;  4XH4 A;  1TYQ B;  1JJ2 M;  1T6C A;  3Q7B A;  2QWP A;  3M1F A;  4O8K A;  2P9N A;  2GEL A;  1VBG A;  3D2E A;  1NGI A;  3MN5 A;  2CGK A;  3CC7 N;  3LDP A;  4JKF A;  4FL9 A;  4MLE A;  3WEE A;  5BRD A;  4MLH A;  4PKI A;  2ASO A;  1OKJ A;  4IOC L;  1Y64 A;  1Z05 A;  3CCM N;  3ENB A;  2V7Z A;  1KXP A;  5JVH L;  1VQL N;  1GLB G;  3FE1 A;  3CCL N;  2LBB A;  2QXL A;  3QDK A;  2IVO A;  3ID6 A;  1NGG A;  2E2O A;  4BRE A;  1JDE A;  2QTD A;  4LC9 B;  3DJC A;  1MA9 B;  1KQS M;  2QWQ A;  4A5B A;  4NY0 A;  5E84 A;  4BVP A;  1ST7 A;  1BOT O;  1GC6 A;  2AEH A;  3QBW A;  2KLA A;  4I6M A;  4AM7 A;  4BGA A;  4BVO A;  2HBK A;  2NLX A;  3KWG A;  5AQJ A;  2FF6 A;  2IVP A;  2VGM A;  3TPQ A;  4U7B A;  3QIJ A;  4H0T B;  2D4W A;  3O9R A;  4WCE L;  2Q31 A;  3FZF A;  4JK7 A;  2KHO A;  3PVL A;  4CJ7 A;  2OAN A;  2HBJ A;  1VQ4 N;  3WA0 A;  2OTL N;  4K25 A;  2NRZ A;  4J8F A;  4BR7 A;  4C1N K;  4IWV A;  3BUZ B;  4DCH A;  3CD6 N;  2QW9 A;  3TTC A;  2ZJQ L;  5F1X A;  3MK6 A;  4WQ5 A;  1XQS C;  2E2Q A;  3ENO A;  1R59 O;  1HBK A;  2FXU A;  4HTL A;  3U8Z A;  4K42 A;  1Y19 B;  4JHD A;  5FPD A;  2WBN A;  1VQ9 N;  4DXA B;  3L4Q A;  4FPA A;  4EKU A;  2V52 B;  5AR0 A;  2GWK A;  1VQ8 N;  2P9K B;  3DXK B;  5EX5 A;  4F7G A;  2FSJ A;  2GTD A;  4FWR A;  3CCU N;  4H5V A;  1YVN A;  4YOR A;  5EY4 A;  3H1V X;  3A5O C;  3AGR A;  1GG3 A;  2ZF5 O;  1E4F T;  4ZRI A;  4CZH A;  4A5A A;  3KWI A;  1K8K B;  3DXM A;  3R9P A;  2FF3 B;  2D10 A;  1T44 A;  2E8A A;  2Q2R A;  3DAW A;  3AAQ A;  3EL2 A;  4H0O A;  4DQ8 A;  2DPN A;  4NO7 A;  1NVL A;  5JLF A;  3VF2 A;  2FSK A;  4KH5 A;  1ISN A;  1BWF O;  2WFB A;  1KC8 O;  3CXC M;  1NMD A;  1ATN A;  4RCH A;  1MIZ B;  3C6H A;  5C2D A;  3ZET B;  4A59 A;  2YCH A;  4CBX A;  2I7N A;  3FR0 A;  3VGK A;  5AQK A;  3AGK A;  3H46 O;  2FLO A;  2ZPY A;  1Z6R A;  4CBU A;  3P31 A;  1N8R O;  3CC2 N;  2YI1 A;  3UKU A;  2VWB A;  4EAH D;  4BRH A;  1MDU B;  3ZEU B;  4IEI A;  5C2F A;  4FWQ A;  2Q0U A;  4JK9 A;  1VAZ A;  3CJ9 A;  3O1W A;  1YIT N;  3RSE A;  2HOE A;  4JKG A;  2RQ1 A;  1YF5 L;  5AFU A;  5GIP A;  2BUP A;  2EMS A;  4JKB A;  3O9U A;  2AL6 A;  3QBX A;  3F2K A;  3QFU A;  4PHT X;  1SGH A;  2RE2 A;  4M7X A;  1E4G T;  4BQZ A;  5AQZ A;  4BRQ A;  4RWT A;  1W97 L;  4GXB A;  2CGL A;  5AQG A;  5AQS A;  2J4R A;  3UKR A;  4BRO A;  4R79 A;  2QEX N;  5TKW A;  3EKU A;  1K8A O;  4BGB A;  1O13 A;  5EXW A;  3MX5 A;  3R6M A;  5DM6 L;  5JVG L;  2QI2 A;  3WXM B;  1BA0 A;  1QQO A;  3C0B A;  4QS8 A;  5GAE P;  4M7Y A;  1GGO A;  2YJF A;  4FWS A;  4OPH A;  4BC4 A;  4GVE A;  3DLL L;  4EHU A;  1M1K O;  2DIK A;  3RVC A;  1HB6 A;  3WUH A;  1W2B M;  4BRK A;  4B1W B;  2E88 A;  5EOY A;  3U4L A;  1ZXO A;  3J7Z O;  2R82 A;  4L3Q A;  1J6Z A;  3ZX0 A;  1YAG A;  3PZD A;  3ULE B;  1LCU A;  4FVU A;  2YHX A;  1GLF O;  2P9L B;  1OVY A;  3MCP A;  2E20 A;  1X3N A;  2CQU A;  3U8X A;  2J0M A;  5BPN A;  4WFA L;  1GLJ O;  5ELZ A;  1S22 A;  3H45 C;  3I33 A;  4JD2 B;  4FOI A;  4KH6 A;  2CH5 A;  3I55 N;  1DEJ A;  3VMF B;  5ADX A;  5AQT A;  4A2B A;  2RHK A;  3FZM A;  4ISG A;  3SAG A;  3G6E N;  3SAH A;  5AQR A;  3S41 A;  5C12 A;  1QVF M;  2E1Y A;  2P9I A;  3FFK B;  3TSQ A;  1HKG A;  5AQL A;  1SAZ A;  3O6W A;  4U67 L;  3R3L A;  2QWR A;  2QM1 A;  3KK7 A;  1MWK A;  4IJA A;  2ZJR L;  3U7D A;  2ZGY A;  1NGE A;  2WUS A;  4YOT A;  3C65 A;  1QZ5 A;  2BTF A;  1HUX A;  3LDO A;  5KPT A;  4EHT A;  3CPW M;  3C7N A;  4NLC A;  1X9J A;  1KD1 O;  4NLB A;  4MDA A;  4C23 A;  3SBG A;  4YOX A;  3CCE N;  1JCE A;  5CHI A;  1BO5 O;  4FOE A;  4O5F A;  3AU4 A;  2ASM A;  5DM7 L;  3O08 A;  1V4S A;  4PKH A;  2HRJ A;  4PL7 A;  2PFU A;  3E9L A;  2P9U A;  3CJC A;  3FZK A;  5GIO A;  1G99 A;  3CMA N;  4BG8 A;  1J19 A;  2HMP A;  4HDO A;  3QB0 A;  5AFU H;  3IFR A;  4IEE A;  1RGI A;  4B9Q A;  3VES A;  4CBW A;  5JLH A;  3C6A A;  1HKB A;  3MN7 A;  1Q86 O;  1Q82 O;  1CZA N;  2HF3 A;  1BUP A;  3TTD A;  2P9K A;  5FPM A;  3EN9 A;  2HF4 A;  1EO1 A;  3ENH A;  5BRE A;  2VGN A;  2HBM A;  1P8Z A;  4FWM A;  5BR9 A;  5H1S Q;  3D6R A;  4YOV A;  4GV9 A;  1BA1 A;  2UYT A;  3GG4 A;  3BIN A;  4EIA A;  5AZJ A;  2P9N B;  2E2P A;  1ILY A;  1NGA A;  5M1F A;  4IOX A;  4H03 B;  3BF1 A;  1MIX A;  3SBT A;  2AP1 A;  3QML A;  5I9E B;  2A6A A;  4ILH A;  1NGC A;  1RFQ A;  1U2V B;  3BF3 A;  3NVM A;  2IIR A;  4KH4 A;  4BRG A;  4JKA A;  1BG3 A;  2VYP A;  3L6Q A;  3L0Q A;  2GWJ A;  3WT0 A;  3ZET A;  4BR0 A;  4GV3 A;  2AA4 A;  3D2F A;  3TSP A;  4UY8 O;  3GDQ A;  3A8Y A;  3ZYY X;  1ESV A;  3VTI A;  3VF4 A;  5AQO A;  1C0F A;  3ZEU A;  5JIC A;  4BRL A;  2P9S A;  3CPE A;  3VEX A;  3A5L C;  5BPM A;  4BRA A;  1DKG D;  4I6M B;  2JWL A;  3MWP A;  1TUY A;  3A5M C;  4BR9 A;  1SQK A;  5CR4 A;  5ADX H;  4H5W A;  5JMV A;  1QQN A;  4CYE A;  2V51 B;  3EKS A;  4MDB A;  2FSN A;  3OHR A;  5BN9 A;  4BR5 A;  1D4X A;  4CZL A;  2GX9 A;  3AAR A;  3UB5 A;  2Q1N A;  1S3X A;  3CI5 A;  3UE5 A;  1ZC6 A;  1SS6 A;  5BPL A;  5LY3 A;  5HOO A;  3FLV A;  2I1J A;  2F9T A;  3HSC A;  3Q7C A;  5AQV A;  5BN8 A;  4P7I A;  3O1B A;  3MX2 A;  3SMS A;  4JHD B;  2HE7 A;  3QFP A;  3CJ7 A;  5CE3 A;  1YJN N;  3CHW A;  3WXL A;  1HB8 A;  4H5N A;  5FPE A;  5M1O A;  1BDG A;  4BR2 A;  1T3V A;  1Q18 A;  4BR4 A;  1IG8 A;  2WC9 A;  5MLC Q;  4B1Y B;  4E1J A;  5C0Y A;  1NI2 A;  2P9L A;  4BC3 A;  4OPA A;  3ZDT A;  4CZK A;  4YDU A;  4YDU C;  3VOV A;  3SMP A;  3DXM B;  4PL8 A;  4DB3 A;  4JKH A;  4H5R A;  3CCR N;  2F7T A;  2NRX A;  3U9Z A;  1H1V A;  1VQO N;  3KVG A;  1QVG M;  4JD2 A;  4IZ9 A;  4CZM A;  3GBT A;  3E9O A;  3FP5 A;  1U6Z A;  2IVN A;  3SAF A;  4BRD A;  2ZJP L;  2A5X A;  1VQN N;  3EPY A;  3VEZ A;  4NB4 A;  3O8M A;  4B1U B;  5KQD A;  3R8E A;  2D0P A;  3P4I A;  3VEO A;  3HRG A;  1VQ7 N;  4G9Z A;  5AQH A;  3H3N O;  3SK3 A;  5B8H A;  4WFB L;  4BY9 C;  2NRW A;  1EF1 A;  4ILG B;  1TYQ A;  2Q97 A;  3OBW A;  4H0X B;  1ZBS A;  4A62 A;  5M1N A;  2A40 A;  3CQX A;  4XH5 A;  3M5R A;  2E2N A;  3FGU A;  1MK7 B;  1YJW N;  1NM1 A;  3NVK A;  1IJJ A;  3QIC A;  4IJN A;  3D7E O;  1DT9 A;  2Q36 A;  4FO0 A;  4GV6 A;  2J0J A;  3CET A;  3FZH A;  3UKR B;  1GLD G;  4BRM A;  1RDW X;  1Q7Y O;  4HDQ A;  3H6E A;  3K9J A;  2P9P B;  3G71 N;  3DWL A;  4ISF A;  1GLC G;  1WOQ A;  2YHY A;  3GL1 A;  2I1K A;  4FWO A;  4JKC A;  3VGM A;  3VPZ A;  2NRR A;  3E66 A;  1V4T A;  3F9M A;  5GIN A;  4BRF A;  4EFH A;  3AU5 A;  1GLL O;  2ZWH A;  3GOI A;  2NZT A;  3LM9 A;  2D1K A;  3VF6 A;  2H3G X;  3VTH A;  1SZ2 A;  1HJO A;  3O9S A;  4WQ4 C;  4BQL A;  5KPR A;  1NGB A;  4WFN L;  4WF9 L;  4FWL A;  5GAG P;  2NRT A;  3CME N;  2CB8 A;  1KAX A;  3CQY A;  5AQF A;  3H3O B;  4H0V B;  4AF1 A;  2EWS A;  1S72 N;  1WUA A;  1T6D A;  3JS6 A;  4FWN A;  4MO4 A;  3MCA B;  3U9D A;  2E1Z A;  2YJE A;  4O8U A;  4IO9 L;  3KHY A;  4A61 A;  4CZF A;  3G4S N;  3H1Q A;  2ITM A;  2I7P A;  2Q0R A;  4XEI A;  2JWK A;  4B1V A;  1NGJ A;  3MN6 A;  4OO1 J;  2D2Q A;  3IDH A;  3IMX A;  3WQT A;  5AZI B;  1E5W A;  4IDH A;  4CZE A;  1U2V A;  4IFE A;  5FPN A;  4H0Y B;  1YUW A;  4WYB A;  4H5T A;  3E1Y A;  3M6G A;  3ATV A;  4BRI A;  3BEX A;  4BRC A;  3DXK A;  2P9I B;  4HWI A;  4DKW A;  2VCP A;  4H0P A;  3PLA A;  4JKD A;  3A5N C;  1MK9 B;  3AY9 A;  3HZ6 A;  1KC7 A;  1K8K A;  4ZRJ A;  1KBL A;  3L4I A;  3VEW A;  3X23 A;  3D2E B;  4JKE A;  4JN4 A;  4MO5 A;  3CC4 N;  3FLC O;  2ASP A;  1YXQ A;  1YJ9 N;  4GNI A;  3O9Q A;  3O4W A;  3WEE B;  3TU5 A;  1YI2 N;  3WQU A;  4Z94 A;  3MWT A;  3C7N B;  3G9W A;  1JCG A;  1GLE G;  4JAX A;  5AQQ A;  4DHY A;  3I56 N;  4YL8 A;  5E26 A;  4CZG A;  1HPM A;  1BU6 O;  2HBL A;  5LJV A;  5F0X A;  3ATU A;  3EE8 A;  5M1K A;  3CCJ N;  4JNE A;  2GUP A;  3FZL A;  4JEP A;  2V7Y A;  4QS9 A;  4ILJ A;  3EZW A;  3WXJ A;  3O9T A;  2YHW A;  4B1X B;  4M63 C;  5KQ8 A;  3SLC A;  1Q81 O;  3CJ1 A;  3OW2 M;  4QS7 A;  2P9U B;  3VEV A;  1VBH A;  4K43 A;  3WXI A;  4B1Z A;  4WQ5 C;  3P39 A;  4BC2 A;  3HOS A;  3TTF A;  4CD1 A;  1VQM N;  3SJH A;  2ABD A;  1YHQ N;  3HBT A;  2KKZ A;  2PAV A;  4IO8 A;  1KAY A;  3E9P A;  5HL7 L;  3IKM A;  4BG9 A;  1NGD A;  3MMV A;  4IOA L;  5AQP A;  3CJA A;  2A3Z A;  3CCS N;  2WH5 A;  5AQY A;  5M1Q A;  1QHA A;  3CIP A;  2YX6 A;  3OA9 A;  3A0I X;  3MN9 A;  3AAP A;  5AZJ B;  4TKN A;  5BRH A;  5M1P A;  3I8B A;  4K41 A;  3LM2 A;  5AQM A;  1QQM A;  1X3M A;  2BH1 A;  2QWL A;  1MWM A;  4YOU A;  4F9O A;  1HLU A;  5AQW A;  2X0S A;  3T7Z A;  1VQP N;  3LDN A;  1XC3 A;  3J8A A;  2QA4 N;  3VEY A;  3IUC A;  5TKY A;  1DGK N;  1NBW A;  3VGL A;  2GEM A;  4BRP A;  1NGH A;  3D2F B;  4FSV A;  4CZJ A;  1ACA A;  3O80 A;  2J0K A;  3EO3 A;  3ULE A;  1VQK N;  1NWK A;  5GAD P;  3W0L A;  2ZGZ A;  3G25 A;  4GY2 B;  4XH1 A;  3VER A;  4CI6 A;  2P9S B;  5C10 A;  1K9M O;  1NGF A;  3BP8 A;  3PIO L;  2QWO A;  3LDQ A;  3T69 A;  3EE9 A;  4FWK A;  3LL3 A;  4BC5 A;  4YOY A;  4A57 A;  2PBD A;  1TUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...