4JKDA

Open and closed forms of i1790y human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
220
structure length
220
Chain Sequence
ELFSNQIIWFVDDTNVYRVTYHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jkdA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jkdA01
4JKBA 4JKFA 4JK9A 4JK8A 3E66A 3SBGA 4JK7A 4JKEA 4JKAA 3E9LA 4JKGA 4JKHA 3E9PA 4JKCA 3ENBA 4ILHA 3SBTA 4ILJA 4JKGB 4ILGB 3E9OA 4JKDA
chains in the Genus database with same CATH superfamily
3PIPL 2WH5A 4LD0A 3E01A 3CQ8A 4WFAL 1WSGA 2VG7A 4IBNA 2R7YA 1K9MO 1TL3A 4KO0A 3CETA 1ZBHA 3O8MA 3I33A 3CMEN 2B6AA 1Q8IA 4LFBK 4YY3K 4FJ8A 3RRGA 2KQ2A 2HF3A 3V6DA 2A1SA 1IG8A 4PHTX 1S6QA 4ZHRA 5BPMA 2IDOA 4FK0A 1JLQA 3DXKB 3AARA 2HBLA 4O0IA 3G6EN 2ZQBA 3RVCA 4EP5A 3O1WA 2X6SA 1SKSA 3DXMB 1L3TA 4CZEA 3WNEA 5CE3A 1BIZA 1VSHA 4WQ4A 4Z94A 3DAWA 3THWB 3NGYA 4FWOA 2ZGZA 3P39A 1GOCA 3HJFA 2RKIA 3T1HK 1HMVA 2P9KB 5DK5A 3LWMA 3CD6N 3VENA 5GIPA 2DTUA 4CJPA 1NGFA 3KWIA 5LJWA 3IS9A 4MQ3A 4BRLA 3LDPA 4XH1A 2ASMA 2HHVA 3FZMA 1DTQA 4WYBA 5AQYA 1JLAA 4AF1A 4ILJA 2F8TA 1X9WA 1LW0A 3E9OA 1WBDA 4RW6A 4CHOA 5TKWA 1JKHA 4A62A 3OBWA 3ITHA 3SAGA 2G8HA 5LMNK 1J5EK 1NGHA 4FXDA 3ZT1A 2YJEA 3MXMA 1SKRA 2E2QA 5LL6Z 3U9DA 3WUHA 1YHQN 2CH5A 4DR2K 1TKZA 3L2QA 5AQOA 3ZX0A 3NF9A 3O6WA 2VCPA 3TR8A 1T8EA 5C15A 4EAHD 4FWMA 3F73A 2O8CA 5ELZA 2BTFA 2Z1GA 3ZT4A 3HVTA 1ZBUA 1JCEA 4ID1A 1U47A 2KZMA 2VWBA 4DQ8A 3CJCA 3LANA 3E9PA 3D2EB 4DG1A 3CCMN 4ZTJA 3IVFA 2ASPA 1NK5A 2ZGYA 3RMBA 3RMCA 1GLDG 5MLCQ 1SL2A 3C6UA 4BDYA 4DR3K 3LALA 4JKDA 3CJ7A 1ILYA 3VEOA 3CXCM 1L5UA 1D5AA 3CFPA 3KVGA 3C6HA 1G99A 4H03B 3U7DA 1B9FA 4N47A 5C12A 1O1WA 2PAVA 2O8DA 2YHBA 1TK8A 2D1KA 1FKOA 1HKBA 4CGFA 4FWKA 5F2RA 5KRTA 1ATRA 3HBTA 3ZETA 3X23A 4CZLA 1KVCA 4EIAA 3K9KA 2G8UA 4MLEA 1HYZA 1XNRK 4JK9A 4JI8K 4LH5A 3UKUB 4DR4K 3PSIA 4CI6A 2YX6A 4FJMA 4JHDB 3MECA 3WNFA 2ZPYA 4IJNA 4DFPA 3AGKA 2HNYA 3MEDA 5DMRA 4JRQA 1VQNN 4J2EA 3A5NC 4IO9L 1Q81O 4IG0A 1XI1A 1TAUA 1HRHA 2RF2A 2WTUA 3WEEB 4B9QA 4F3TA 5A2QO 3HT3A 4IKFA 3AO1A 4IJAA 1TUUA 1KLNA 1NKBA 1MK7B 2W6KA 1S9EA 5IJMA 2WOMA 5EX5A 3SUOA 1UAXA 3SYZA 1FW6A 3K0SA 1EF1A 1TYQA 4E7HA 4AHVA 4X62K 3DMJA 5ADXH 4BACA 2ZJRL 4LF5K 3UE5A 4R5PA 5SZTA 3NVMA 2EX3A 3VQ9A 4DV1K 3SQ4A 2HHQA 2NUBA 1XQSC 4WQ5C 3RR8A 1BCMA 4A61A 4KI6A 5JVHL 1HLUA 3TTFA 3VF2A 1NU0A 3L2VA 1QVFM 2FBXA 3GE1A 3FZFA 2J0KA 3ULEB 4BGBA 4DF4A 4Z4EA 1R0AA 3RSEB 3ZEUA 3D7EO 5KGWA 4GW6A 2VQEK 3R3LA 1K6YA 4NXMK 5EU7A 3OS0A 2HHXA 4N56A 1GLBG 3P31A 2HBMA 3AVAA 1S5JA 3O4WA 3ZX3A 1S1VA 4DLEA 1E4FT 3SI6A 4PL7A 2W42A 3VOVA 4LH4A 1MIXA 4HDOA 4B3SK 3HL8A 1KXPA 2X0SA 4BRPA 4OJRA 4JEPA 3CHWA 3ATUA 2P51A 3PZDA 5BN9A 3F5TA 3FZKA 4O8UA 2E1ZA 3UKRB 4H5RA 3WXMB 4IDHA 2E6MA 2UXDK 3D2FB 1TV6A 4CHQA 4YFUA 2EMSA 1HYSA 2HSTA 1KAXA 1C0TA 3LDNA 4CIFA 3CM5A 3PSFA 4I2QA 4J2DA 1ZBSA 4GXBA 4DSKA 4GY2B 4YOUA 3ZSVA 5HOOA 2Q3SA 2XY8A 2Q31A 5B8HA 4DU3A 4JKGA 3AAPA 1Q9XA 1NMNA 4CF1A 2YVCA 4PWDA 4BC2A 1QQCA 1BGXT 2BUPA 4FLWA 3PX6A 2XY6A 4FYDA 3L2UA 1VQ8N 4BROA 5I3UA 3SQ2A 4RW7A 2GELA 1GLAG 2DFEA 4RCHA 5HROA 3M3ZA 3HO1A 3IUCA 4FW1A 1X1PA 4AHCA 1RTJA 2ASOA 5BPNA 5LJVA 1YJWN 1VQMN 2UU9K 4M3UA 3GDQA 3H3OB 3K2PA 5JICA 1ATSA 4YHHK 2NRVA 4FPAA 1TAQA 1CZBA 4CFAA 3PO5A 3TANA 3U4LA 3HK2A 1M90O 1UA1A 4WQ5A 2YNGA 1G15A 4CF0A 1K8AO 3O80A 2KZZA 3BINA 5E26A 3MXIA 4O8KA 2P9LA 3LDLA 3LP0A 1VSEA 3D2FA 1S1XA 4BE2A 4BREA 1WSEA 3SK3A 4DU4A 1BHLA 2ZF5O 4Z4CA 3TAQA 4FLXA 1BQNA 4CHPA 3LZJA 1NGEA 3K59A 4N41A 2VG6A 4QOZB 1B9DA 1NGAA 2I7PA 2QK9A 3EE8A 3NGIA 4K41A 1KC8O 3QFPA 3ZT2A 1CXUA 3HOSA 3LP3A 3QICA 1QZ5A 3SLCA 1VK0A 4HUGA 4G1QA 3EO3A 1NGCA 5JS1A 4IZ9A 4GV3A 1KD1O 2YKMA 4X65K 4E0DA 1ITGA 3LZIA 2V7YA 3DWLA 1EX4A 2NRWA 2YHAA 3KLEA 4DKWA 4H0YB 3UB5A 5FPNA 1TUYA 4BRIA 4KHQA 3VGLA 2HRJA 1RT6A 4DFKA 1SL1A 2XHBA 2JWKA 4CZGA 5BR8K 4WF9L 3MN7A 4FM0A 2DFHA 3AA3A 3ISNC 3SMSA 3QESA 2ZJQL 1Y97A 4A2BA 2O8EA 4H0OA 5AQKA 3OJSA 4FWRA 1QQNA 3VQEA 1JCGA 1RDAA 3CQXA 2RN2A 4DQIA 1HJOA 2UUAK 3LPTA 2AL6A 4DS5A 3N4PA 1VSIA 1QQMA 3NF8A 3OYBA 3I56N 3NAEA 3VQAA 4BRNA 1I94K 3OVNA 4DCHA 5C24A 2RE2A 2OA8A 3KTQA 3JYTA 3THYB 2P9PA 3A5LC 3WEEA 5GAGP 1M1KO 2I5JA 4KH5A 4CEQA 2BANA 3FZLA 3WXLA 3HXMA 3HYFA 4XIUA 1C0MA 1BUPA 3LM9A 4F2SA 2KFZA 3TSQA 3WXKA 4K8XA 5T7BA 4OGEA 4DSLA 5C0YA 1ZBLA 1ASUA 3AV9A 1C1CA 4BQLA 3VA0A 1YT3A 3HM9A 4DQRA 2WC9A 4JKAA 2DFFA 2J0JA 4DTJA 3C94A 4JYAK 1VSJA 4FLZA 2B5JA 2GUPA 1P90A 5AQRA 3T1AA 4DV5K 4FVMA 3CMAN 3CJAA 3T19A 4CJ7A 1Q18A 4JS5A 2XY7A 2VGNA 3O9TA 1X9MA 3CFRA 4DUZK 1RTHA 1RDWX 4JD2B 3CCLN 1NG9A 5J2MA 1P8ZA 2JLEA 3VESA 1NNEA 3T1YK 4JD2A 3V1QA 4CZFA 4HUEA 2UXBK 4FJJA 3MXJA 1EWRA 3OBYA 3LWLA 1UA0A 4CF9A 5KQDA 4I2PA 1HPMA 1KCFA 2W6LA 3K58A 3S3MA 1WSHA 3SCXA 2O8CB 4JI5K 3H1VX 4RW4A 3H3NO 5AQWA 4FZXC 3C95A 5KTQA 1J54A 3ID6A 4YNQA 2UUBK 1HR0K 4LFCK 4MO5A 3NMUA 2E2PA 3KK1A 3O9SA 4AILC 5EVZA 3PV8A 2KTQA 3HZ6A 3KLGA 4TKNA 2NRTA 3GBTA 4NB4A 2JWLA 5JVGL 2QA4N 1JLFA 2QI2A 4FM1A 1IBKK 3BUZB 3ENOA 1RT3A 5FPEA 3ZT3A 3I8BA 3W0LA 1HX1A 3KZBA 1BA0A 4JAXA 5AQHA 3VTIA 4IDKA 1XC3A 1VSLA 4B1XB 3HPOA 4IFVA 4BRCA 1IJJA 1K8KA 2PY5A 3FFKB 3V9UA 4JI6K 3RMAA 4H4MA 4CFBA 2WONA 2FJ9A 4TSXA 3DLEA 4ILGB 1RNHA 1L3SA 4CZKA 3DXMA 4YDUA 2D10A 4YOVA 3CJ1A 3HSTB 4CJ3A 3G4SN 3AVJA 3U3GA 1VBGA 4DF8A 1JDEA 1N34K 5I9EB 1MIZB 1FK9A 2OTLN 3P5JA 3J80O 2E6LA 5CYQA 1J19A 5AQFA 4F4KA 4JRPA 3QIPA 4YOXA 1J5OA 1KC7A 4CCHA 4JV5K 3L2RA 1T05A 3G0ZA 3DLGA 1LOTB 1KAZA 2OPRA 2KKZA 3PX4A 4FJLA 2GV9A 3AVIA 1TKXA 1ZXOA 2OPSA 3NDKA 3E1YA 3QNNA 4DMNA 1BIUA 1BOTO 1Q9YA 2P9LB 5M1QA 3HP9A 3DM2A 4KTWA 1Z6RA 3L8BA 4DV0K 4DQSA 3L2WA 3SAFA 2HHTA 3SJHA 3QFUA 1WB9A 4OLAA 3CCUN 4DR7K 3L3VA 4OGCA 4W5RA 2F96A 1ISNA 3A8YA 2Y1IA 1GLJO 1GLLO 3CCRN 3PO4A 4FW2A 4DV7K 1BDGA 4BE1A 3MN6A 3ALYA 5HP1A 5CYMA 4XEIA 1JL2A 3DLBA 3NH1A 4JI0K 1VBHA 2O8BA 4OPKA 4Z4IA 4X66K 2D0CA 3V4IA 4NYFA 2AA4A 3EPYA 4FZZA 4E7KA 3CCJN 3CC4N 4FOIA 1VQON 3EE9A 3DOKA 4I6MA 1BISA 3SPZA 2V52B 3DLKA 3VGMA 1LV5A 3HSCA 1TKDA 1RBVA 1GC6A 3R8EA 4EP4A 3OY9A 2G8KA 4CZIA 1B92A 1HJRA 3ZSYA 3IG1A 4BC5A 2GX9A 3MMVA 2A41A 2E8AA 1DGKN 3IFRA 5CY4A 2D5RA 4C8MA 4OPHA 4YDUC 3UKRA 1VQ6N 3HPHA 5CZ1A 4DSEA 4BRQA 4F9OA 4PQUA 1CZAN 4Q0BA 2DY4A 1N8RO 3BF3A 2UUCK 3TAFA 2PFUA 1QE1A 2YI1A 3CCEN 4HTUA 3QEIA 4KTQA 1IKVA 2WUSA 5DM6L 4E1NA 1HYVA 4GKJK 4OKKA 4WQ4C 1X3MA 2B4JA 3EZWA 1NGBA 4R79A 2QWQA 4BWMA 4JKEA 4FJKA 1UOCA 2P9IB 4DU1A 1HNWK 4U67L 1FJGK 4B9TA 3MX2A 1XC9A 3VA3A 4GMJB 3OS1A 2A40A 3CPEA 2BH1A 1NK7A 1S9GA 4M45A 1DTTA 3QBWA 3OYJA 1EXQA 3LDQA 3O5BA 3OA9A 4JLHA 4M3WA 2G8VA 2P9IA 3ULEA 2HHSA 2O4IA 2P9NA 4M63C 1YJ9N 2Q0RA 1T6CA 3VTHA 2QW9A 4K0KK 2V51B 3MWPA 3E9LA 5C42A 1HKCA 3Q7CA 2Z1HA 3KK7A 4BRFA 3RMDA 3V1RA 3ASMA 1NBWA 1HPZA 3TAMA 4BR4A 4M41A 2CGLA 1QHTA 4E3SA 4GVEA 4CEOA 2GWKA 3TAPA 1RT7A 2Q36A 4I6MB 3O4NA 4CK2A 3D6RA 3I0RA 2OANA 4PY5A 3O9UA 1BG3A 4CJVA 1QSLA 1KRPA 2NRXA 2GBZA 1HQEA 2W40A 3DRRA 2FSKA 4JHDA 1IO2A 4YOTA 4BR0A 2LSNA 4BR2A 3UKUA 4B1WB 3R6MA 3AGRA 1ZBFA 3PUFA 1U4BA 4B08A 5HL7L 5AZJB 1X3NA 3J8AA 4A5AA 3ZSZA 1NTIA 5AQQA 3FGUA 4H5NA 4BC4A 4I9LA 1QHAA 3TTDA 2Q1NA 2PZSA 4DV6K 3QLHA 1JXBA 4LF6K 2WFBA 2FDQA 1D8YA 4B3OA 5J1EA 3IDHA 3LDSA 3S3OA 1CZ9A 1T7PA 3FFIA 1VSDA 5EY4A 5LMUK 3BDPA 4BRGA 3O4QA 1U45A 3O3FA 1NGDA 3ZYYX 4CJSA 4LF4K 2HVHA 4W5QA 3TWHA 2E2NA 3PIOL 2KLAA 1HNZK 3HRGA 5J2PA 2D0PA 3D45A 4QCLA 3CFOA 4B3RK 2AJQA 2HF4A 4O4GA 1ZBIA 2IAJA 3JS6A 2QTDA 1NGJA 1XMQK 1NVLA 2E2OA 4DLGA 2JGUA 3JXUA 2CGJA 2Q2RA 4CD3A 3CF5L 3S3NA 1S1WA 1NLVA 5AQXA 4DSFA 3AO4A 4N76A 3JSMA 4ELVA 2NRHA 2DPNA 1IG9A 3AVMA 3KD1E 1WOQA 2YV0X 5IWAK 4CJUA 1QQOA 3MCAB 5C10A 5FRNA 1UWBA 3DLLL 5C25A 2FSJA 4FOEA 1W0HA 2FSNA 4L8RB 3THVA 3AU5A 1NM1A 4BR5A 3KJVA 4C8OA 3FP5A 1WAFA 3NVKA 1K8KB 2W41A 3KIOA 4ID5A 3CI5A 3A5MC 1H1VA 4LSNA 4Y1DA 4P7IA 4DSIA 1KQSM 4H4OA 3WNGA 2PYLA 2D0AA 3AVNA 4CHZA 4UQGA 1KTQA 4KHYA 1SS6A 4B8AB 4EHUA 3M8RA 3F9MA 1T6DA 1N36K 2EWSA 4WCEL 3EZ5A 4CK1A 4AHUA 4J2AA 3VQQA 1LAVA 2Q97A 4CESA 1OH8A 2HHUA 2IGIA 3CJ9A 3K5OA 5AQMA 1X9JA 5AQNA 3K5MA 4DWIA 1IBLK 2O4GA 3B8AX 3L4IA 1QVGM 2P9KA 3TI0A 1RBUA 2X74A 3VQ6A 3FLCO 3BZCA 3AA4A 4MDBA 4KTZA 4G9ZA 1JLGA 2CB8A 2HMPA 2CGKA 1W97L 3P38A 5EOYA 1WBBA 2HB5A 4RWTA 2OZSA 1MDUB 1WAJA 5F1XA 4OVLA 1VQ4N 3VPZA 4CFDA 3QINA 5C2DA 3EN9A 3AVCA 1SGHA 5KPTA 4LSLA 4H0TB 3AVFA 3DOLA 1XNQK 3UIQA 4JS4A 1JLEA 4H8KA 1A5WA 1I3AA 4M3ZA 2FBTA 1RT4A 3J7AP 3GOIA 2HNDA 5AFUA 1XWLA 3OTOK 4B9LA 3QDKA 1V4SA 3U3YA 2HMIA 1GLFO 2FBVA 1NJXA 2ZE2A 4K25A 3KLIA 4FWQA 3J7YP 1HB6A 4NLBA 4KHWA 4AH9A 4M42A 3C7NA 3PVLA 1YXQA 3AA2A 4BC3A 1F21A 5M1KA 4ZRJA 3CQYA 3QETA 3HPGA 1VRUA 3R1XA 1JLCA 1WN7A 4ELTA 3H6EA 1E5WA 1RBRA 1YITN 1NK0A 1A5XA 3AVLA 3KD5E 4J2BA 3BY5A 1KSPA 1SKWA 5E41A 5BRFA 2P9UB 3VGKA 4B1ZA 5AZJA 3U9ZA 1RFQA 3THXB 1NJWA 3I8DA 4QS9A 1EO1A 3M8PA 3LDOA 4KH6A 5AQUA 3QO9A 3R9PA 4CYEA 3OYKA 3U6FA 3V1OA 4CGGA 1DIKA 3MEGA 1U04A 3ZSXA 4BR9A 2P5OA 2HVIA 2OPPA 5D3GA 1ESVA 2ZD1A 4DXAB 1W2BM 4B8CA 1KAYA 1YF5L 1XHXA 3L3UA 3SNNA 2FBYA 5KQ8A 3CYMA 2P9PB 1GOAA 3F2KA 1QSSA 3THYA 3J81O 3T3FA 3AA5X 1NK8A 2YCHA 3EEQA 3KK3A 3SUPA 1HNIA 2GUIA 3QEWA 1EETA 1VHXA 2F7TA 1ZYQA 4HDQA 4OX9K 4FSVA 3CJBA 4Z4HA 4CFCA 3TSUA 4KPYA 1S1TA 3PX0A 1DLOA 4CEZA 4FJHA 4GNIA 3DLHA 4PL8A 4DB3A 4BGAA 3OJUA 4H5WA 4FJ5A 2P9NB 4CJQA 4BY9C 2YJFA 4E7LA 4DR5K 3B6PA 3FLVA 1OH5A 2F9TA 4CD1A 1KLMA 1QZ6A 4DTXA 1Q7YO 4BVPA 5FPDA 1NJIO 3VQPA 2HHWA 2GTDA 1Z05A 1NK6A 4KB1A 4FL9A 4RW8A 3OYEA 4FK2A 5AFUH 3CPWM 1QSYA 4I7FA 4LF7K 1IKXA 3NCIA 1Y64A 4E89A 4ELUA 4JK7A 4E1JA 3V81A 4Y0WA 4M3TA 2X78A 4RW9A 4LF8K 3IAYA 3TSPA 2COPA 3ENBA 1BU6O 1VQKN 4DTSA 3BP8A 1TK5A 3SUQA 1D9FA 3SV3A 4C1NI 4FM2A 2YNIA 1VQPN 3ULDA 4CBWA 3SQ0A 1CXQA 1LAWA 3IKMA 1IV0A 4IOCL 2E5LK 4B9SA 3D0PA 4JK8A 3ZSQA 2J0MA 2YHWA 3ZCMA 1U49A 5K14A 2WBNA 1C6VA 4JI4K 1KVAA 2D0OA 4NY0A 2PBDA 4C23A 3QNOA 1S72N 1HB8A 4AQYK 4DS4A 2XO7A 4CW7B 4HUFA 2LBBA 2Z1IA 2GWJA 2I1KA 4EHTA 3QEPA 4BG8A 3SPYA 3DRSA 5AR0A 1NOYA 3J7ZO 3EYZA 2AEHA 5EXWA 3EL2A 3SMPA 1C0UA 3AAQA 4NO7A 4DR6K 3F9KA 1L3UA 3CCQN 4H0XB 1YTAA 1RCHA 2BDPA 1T03A 3N4QA 5HLFA 4M3XA 1WLJA 4Q5VA 3TARA 3EKSA 4N5SA 3C6AA 1C0GA 2OYQA 1TL1A 4JKGB 3QMLA 3KK2A 2O8FA 4Z4GA 5AQLA 1BL3A 4NXNK 3U8XA 2QWLA 4BRHA 4DQQA 1ASVA 1RDDA 5HRSA 3K5NA 3VEXA 4IOXA 3NF6A 2HBJA 2FXUA 1Y19B 4FPBA 4DQPA 4GV6A 4HVJA 4BRDA 1J53A 3TABA 1L3VA 3AVGA 4IEEA 1U48A 3SAHA 2VG5A 3SJJA 3O9RA 2A42A 1NK4A 4NCGA 3CCVN 2A5XA 5GAHP 4O44A 4DR1K 3AVBA 4F8RA 4DV4K 4PA1A 1RT1A 4CJRA 3VMFB 2F9WA 4RTFD 2A6AA 4E7JA 2YHXA 5HBMA 4HCBA 1EQYA 2OPQA 4KB0A 3PY8A 4DTOA 2IVPA 1XHZA 4HTLA 1NGIA 2YHYA 2G8WA 3ZEUB 2RQ1A 3H46O 5IT9O 2G8IA 3C65A 2F8SA 1SZ2A 2GEMA 3K57A 3NBPA 5AQIA 3HTVA 1N33K 4KFBA 3IRXA 5GAEP 3TU5A 3LP2A 4HHTA 4BDZA 3M5RA 2V7ZA 5M1FA 4CIGA 3CG7A 4Y1CA 4B3TK 5AQJA 1HUXA 4HCCA 1MA9B 1ST7A 1C1AA 3TAEA 4NLCA 3SV4A 1TKTA 4X64K 3P4IA 1R59O 4LY7A 3NH0A 1S22A 4CJEA 3DJCA 3TAGA 3LP1A 1JXEA 5FRMA 2BE2A 5BPLA 5AJ3K 3AO5A 5HRRA 4CF8A 2QWOA 4IOAL 3BEXA 3ZSOA 3VEZA 1HNVA 4E19A 3H08A 1BQMA 1E3MA 5AQVA 3S9HA 4C8LA 2E4LA 3MAQA 3DLRA 4CGIA 3K5LA 2D0BA 3VQ5A 5JVLA 2HHHK 1LW2A 1N5YA 3ZETB 1NJYA 4KRFA 4H0PA 5KGXA 3O3GA 3P83D 3IMXA 3O1BA 4DFMA 4BG9A 4FLTA 2P9SA 2O8DB 5GIOA 2FF3B 3GL1A 4IG3A 5GINA 2ZWHA 3OYMA 2QM1A 4YL8A 3VQ7A 2NZTA 5AQTA 4CJKA 3WA0A 4CJWA 2X6NA 4CGDA 1SQKA 4XH5A 2EHGA 4IFYA 4BDPA 1BA1A 3OW2M 4I9QA 5M1PA 4FJIA 4FWLA 3D2EA 1XUPO 4AHSA 2IVOA 3HOTA 2P5GA 5AQPA 5JLHA 4CJFA 2E1YA 3NHGA 1NKCA 2QWPA 1VQ9N 4FJXA 1U2VA 4ZTFA 2HOEA 5HRPA 4CEEA 3OYLA 3M8QA 1GOBA 1IBMK 4DTMA 3AY9A 4W5OA 3OHRA 3LAMA 5FLXO 4CHNA 1RILA 2EMTA 4AHRA 4DHYA 1X9SA 1A5VA 3LM2A 1LWCA 4FLVA 1FXXA 2RPIA 3G25A 1NI2A 1LWEA 5JS2A 3L0QA 4M7YA 3LAKA 4FCYA 4JKFA 3G10A 1YTUA 5TKYA 4KKOA 5FROA 4BE0A 2NNWA 1ASWA 1VQLN 4H5VA 3B6OA 4IEIA 2OCEA 1NMDA 4WFNL 1NGGA 3MK6A 3WT0A 4CHYA 2NRRA 1VQ7N 5M1OA 4BRKA 4YORA 2VWJA 3FR0A 1EP4A 2J4RA 3KKRA 4B1YB 4B1VA 3K9JA 4KAZA 1RDCA 2NLXA 4KHUA 3WXJA 2O8EB 3CIPA 2ITGA 4A2AA 1VRTA 3AU4A 1MU2A 4ISEA 1GC7A 3QIJA 3G71N 4ISGA 1BCOA 3QB0A 1YAGA 1E4GT 4CJTA 3SBTA 3QERA 4DTNA 1NKEA 2I1JA 1TK0A 5E84A 4HWIA 4NYNA 4CECA 3WQTA 3VERA 4JNEA 4DTPA 4OO1J 3O3HA 5KPZA 3SBGA 2QKKA 1IKWA 2I7NA 3VN5A 1H4RA 2QXFA 4J8FA 4O0JA 4H5TA 4DV2K 3DI6A 3C0BA 4JI7K 2Q0UA 1GGOA 1I39A 4IXCA 3U8ZA 1NOZA 3LPUA 3ZDTA 2D11A 1REVA 3VQDA 2NRZA 4CZJA 4OLBA 3EKUA 3FZHA 1U2VB 4K42A 3LL3A 2QWNA 1YI2N 1MK9B 4BVOA 1VSKA 3AVHA 1C0FA 4FJGA 2IVNA 1OKJA 5KPRA 3CM6A 4U7BA 4EZ6A 2ABDA 4IWVA 1J9AA 5JLFA 1Z25A 3RTVA 4QS8A 1YJNN 3KKSA 5J2NA 3BF1A 2UYTA 1XMOK 3P1GA 3RWUA 3V9XA 2HNZA 4OKEA 1GLCG 3C7NB 2OZMA 4KV8A 4ICLA 3VQ8A 3H45C 1KVBA 4FJ7A 3CERA 5DM7L 3PLAA 2P9SB 3TPQA 4CK3A 2ATQA 1OVQA 2XRIA 1RTIA 5H1SQ 1HNXK 4B9NA 1GG3A 2E88A 3G9WA 3HM8A 4BWJA 1U6ZA 4DUYK 1QS4A 2IS3A 3AO3A 5JMVA 2QWMA 3MDQA 2YNFA 4PKIA 3ZX2A 3EY1A 2QEXN 4ISFA 3OYGA 2E20A 4C8KA 1QTMA 1YUWA 4GV9A 1LCUA 1MWKA 5J2QA 4RG8A 5SWMA 3VEWA 3MX5A 5GADP 4LC9B 3ZT0A 4LFAK 1BI4B 4JKHA 1WSIA 4O55A 2KHOA 4DV3K 2AP1A 2XY5A 4K43A 3OYCA 4ZRKA 5BRHA 3SQ1A 3SZ2A 1OH7A 4MDAA 3FE1A 4WFBL 4JI3K 4AHTA 3V9WA 3L6QA 1NJZA 4FWSA 3O9QA 5LY3A 3VF4A 3M1FA 3SUNA 1RBTA 4KHPK 3AO2A 1KBLA 3A2FA 2QXLA 4FLYA 2G8FA 4FZYA 4JI1K 3H1QA 3I0SA 3OYDA 4GKKK 1S1UA 5BREA 4IO8A 3NGZA 1SUQA 4B9UA 3QEVA 3ID8A 2VQFK 3RSEA 4Z4FA 3MN5A 4DTUA 4FWPA 5ADXA 1RT5A 2ZJPL 4CIEA 2RHKA 4CEFA 4CJLA 2DIKA 1HKGA 1W9HA 4O5BA 3E66A 4A57A 4OKJA 2BGGA 1SL0A 1HBKA 4W5TA 4PKGA 3NFAA 4YOYA 1YVNA 1ATNA 1RGIA 4M3RA 1VSMA 3OYAA 2ETJA 3OYIA 1TYQB 1LWFA 2ZM6K 3HVRA 4LF9K 1RDUA 1DT9A 1NWKA 2FF6A 3QIOA 2D4WA 1WUAA 4A5BA 4GVMA 1KFSA 1RTDA 4KI4A 5AZIB 4B3MK 4JN4A 4FO0A 5I42A 5F0XA 1V4TA 2HBKA 1TGOA 1BO5O 4JKCA 3VEVA 3OYHA 2HW3A 2FC0A 1O13A 1S6PA 4L3QA 1JLBA 3S41A 4BR7A 4FVUA 1T3VA 1GLEG 3BZKA 1EKEA 3MN9A 2F4VK 2FLOA 1J6ZA 1C1BA 3CCSN 1TVRA 3ZSWA 4PUOA 1ZC6A 2R82A 5FDLA 5C2FA 1MWMA 4CJ5A 2O8FB 3KLHA 3ENHA 3VETA 1JJ2M 2H3GX 2UXCK 3MCPA 4B9VA 1JL1A 4CVNE 4ILHA 5CR4A 3KWGA 2HE7A 3T69A 3DRPA 2ITMA 3NH2A 1RBSA 3JAMO 3RR7A 4CEBA 2VYPA 4JKBA 4NCAA 5KI6A 4MLHA 5CZ2A 5BN8A 4F2RA 4H0VB 5KRSA 1SV5A 3RRHA 5AQZA 4AM6A 4C8NA 1IH7A 3VEYA 1K73O 2KW4A 4EZ9A 3OYFA 4E7IA 4B1UB 3V9ZA 3M8SA 3A5OC 5CHIA 3A0IX 4CGJA 3C6TA 3MEEA 4BQZA 4CE9A 4B9MA 5M1NA 5AZIA 1FKPA 3KLFA 3AVKA 1KFDA 3VF6A 4DTRA 4FWNA 1VQ5N 5HRNA 3MWTA 4Z0UA 4KBOA 4KH4A 3KHYA 3CC2N 3CC7N 3WQUA 2A3ZA 2PYJA 4K8ZA 3TTCA 1DKGD 1SAZA 2CH6A 1CLQA 4ZRIA 2P1JA 3VQBA 1NK9A 3O08A 3WXIA 3VQ4A 3ZSRA 3DYAA 4FLUA 4WE1A 2IIRA 3Q7BA 4CGHA 1T44A 4CEDA 4V19S 1WSFA 3NF7A 3L4QA 4OPAA 4PKHA 1EWQA 3ZLJA 3OYNA 3QEXA 1RT2A 1IKYA 4E1MA 3GG4A 3HP6A 4KHSA 1RDBA 4CEAA 1D9DA 4FJNA 4FJ9A 3W3DA 5AQGA 4FK4A 4CERA 4CBUA 3NE6A 4XH4A 1ACAA 2YKNA 3THWA 4MO4A 1WNSA 4M3YA 3BGRA 2VGMA 4W5NA 4A59A 4CJ4A 2Y1JA 1BWFO 1Q82O 1BI4A 1HQUA 4JI2K 4OPJA 4CZMA 1OH6A 5BR9A 1YIJN 5AQSA 4EKUA 1D4XA 4CZHA 4CBXA 4CF2A 1VSFA 3DXKA 3WNHA 4AM7A 3QBXA 2QKBA 1Z26A 4QS7A 5FPMA 3OS2A 3V9SA 2KFNA 1S3XA 4F7GA 4EFHA 4O5FA 4NCBA 4QAGA 3M6GA 4IFEA 1W7AA 2CQUA 3I55N 2OTJN 3T7ZA 2IOCA 1WSJA 5BRDA 2D2QA 2Z1JA 2O8BB 4KHNA 2A1RA 4DSJA 1JCFA 4MFBA 3THXA 4DFJA 4F3OA 2IC3A 1DEJA 2P9UA 3VQCA 4UY8O 4C1NK 4BRMA 3ATVA 1Q86O 3HI0A 4KREA 1YVUA 4M7XA 1N32K 1N6QA 1VAZA 2QWRA 1OVYA 2VWKA 4BRAA 4YOWA 2YNHA
chains in the Genus database with same CATH topology
5AQNA 4BQLA 3PIPL 4JKFA 2WH5A 3B8AX 3L4IA 5TKYA 1QVGM 2P9KA 4WFAL 2NNWA 2WC9A 1K9MO 4JKAA 2J0JA 1VQLN 3CETA 4H5VA 4IEIA 1NMDA 4WFNL 3O8MA 1NGGA 3MK6A 3I33A 3WT0A 3FLCO 3CMEN 2GUPA 1P90A 5AQRA 2NRRA 1VQ7N 5M1OA 4BRKA 3CMAN 2HF3A 4YORA 3CJAA 1IG8A 3FR0A 1Q18A 4MDBA 2J4RA 4CJ7A 4G9ZA 4B1YB 2VGNA 2CB8A 4B1VA 4PHTX 2HMPA 3K9JA 3O9TA 2CGKA 1W97L 2NLXA 3P38A 5EOYA 3WXJA 5BPMA 1RDWX 3CIPA 4JD2B 3CCLN 4A2AA 3DXKB 4RWTA 3AARA 2HBLA 1MDUB 1P8ZA 5F1XA 3VESA 3G6EN 3AU4A 4ISEA 1VQ4N 4JD2A 1GC7A 4CZFA 3VPZA 3QIJA 5C2DA 3EN9A 3RVCA 3O1WA 1SGHA 5KPTA 3DXMB 3G71N 4ISGA 4H0TB 3OBYA 4CZEA 3QB0A 1YAGA 5CE3A 1E4GT 4WQ4A 4Z94A 3SBTA 5KQDA 2I1JA 3DAWA 5E84A 3GOIA 5AFUA 4FWOA 4HWIA 2ZGZA 3P39A 1HPMA 3QDKA 1V4SA 1GLFO 4K25A 2P9KB 4FWQA 3VERA 4JNEA 3WQTA 1HB6A 4NLBA 3CD6N 4OO1J 5KPZA 3C7NA 3PVLA 1YXQA 3VENA 3SBGA 5GIPA 2I7NA 1NGFA 3KWIA 5LJWA 4BC3A 3H1VX 5M1KA 4ZRJA 1H4RA 3H3NO 4J8FA 4BRLA 3CQYA 5AQWA 4H5TA 3LDPA 4XH1A 2ASMA 3C0BA 3ID6A 3FZMA 3R1XA 4WYBA 5AQYA 2Q0UA 3H6EA 4AF1A 1GGOA 1E5WA 4IXCA 4MO5A 3U8ZA 3NMUA 4ILJA 3ZDTA 2D11A 2E2PA 1YITN 3E9OA 2NRZA 3O9SA 4CZJA 5BRFA 2P9UB 5EVZA 3EKUA 3VGKA 4B1ZA 5AZJA 3HZ6A 3U9ZA 1RFQA 3FZHA 1U2VB 4TKNA 4K42A 5TKWA 4A62A 3LL3A 3OBWA 3SAGA 2NRTA 2QWNA 1MK9B 1YI2N 4QS9A 4BVOA 1EO1A 1NGHA 3LDOA 1C0FA 4KH6A 3GBTA 4NB4A 5AQUA 2IVNA 3R9PA 4CYEA 1OKJA 2JWLA 5JVGL 5KPRA 2QA4N 2QI2A 1DIKA 2YJEA 4U7BA 2E2QA 2ABDA 4BR9A 4IWVA 3U9DA 3WUHA 5JLFA 1YHQN 3BUZB 3ENOA 2CH5A 4QS8A 1ESVA 5FPEA 4DXAB 1W2BM 1YJNN 1KAYA 5AQOA 1YF5L 3ZX0A 3O6WA 3I8BA 3W0LA 1HX1A 2VCPA 3BF1A 2UYTA 3KZBA 1BA0A 4JAXA 5AQHA 3VTIA 5C15A 5KQ8A 4EAHD 4FWMA 2P9PB 1GLCG 3C7NB 1XC3A 5ELZA 3F2KA 2BTFA 2YCHA 3H45C 4B1XB 4BRCA 1IJJA 1K8KA 1JCEA 3CERA 5DM7L 3FFKB 2VWBA 3PLAA 4DQ8A 2P9SB 2F7TA 3TPQA 3CJCA 4HDQA 5C0YA 3E9PA 3D2EB 4FSVA 3CJBA 3CCMN 3IVFA 2ASPA 5H1SQ 2ZGYA 2FJ9A 1GG3A 1GLDG 2E88A 3G9WA 3HM8A 3TSUA 4ILGB 5MLCQ 1U6ZA 3DXMA 4CZKA 4YDUA 5JMVA 2D10A 4YOVA 3CJ1A 4GNIA 2QWMA 3G4SN 3MDQA 4PKIA 1VBGA 4PL8A 3ZX2A 4BGAA 4DB3A 4JKDA 3CJ7A 1ILYA 4H5WA 3VEOA 2QEXN 4ISFA 3CXCM 2E20A 1JDEA 5I9EB 1MIZB 1YUWA 4GV9A 1LCUA 3KVGA 2P9NB 1MWKA 4BY9C 3C6HA 1G99A 4H03B 2OTLN 3U7DA 2YJFA 1J19A 3VEWA 2PAVA 5C12A 5AQFA 2D1KA 3MX5A 5GADP 3FLVA 4LC9B 4YOXA 4JKHA 1KC7A 2F9TA 4CD1A 1HKBA 1QZ6A 2KHOA 4BVPA 1Q7YO 5FPDA 4FWKA 5F2RA 1NJIO 1ATRA 2GTDA 3HBTA 2AP1A 1LOTB 3ZETA 3X23A 1KAZA 4ZRKA 1Z05A 4K43A 4CZLA 5BRHA 2KKZA 4EIAA 4FL9A 4MDAA 3FE1A 3K9KA 4WFBL 5AFUH 1ZXOA 3L6QA 4MLEA 4FWSA 3E1YA 3O9QA 3CPWM 5LY3A 3VF4A 1BOTO 4JK9A 2P9LB 3M1FA 5M1QA 3UKUB 1KBLA 1Y64A 4CI6A 1Z6RA 2QXLA 2YX6A 4JK7A 4E1JA 4Y0WA 4JHDB 3H1QA 2ZPYA 4IJNA 3SAFA 3AGKA 5BREA 3SJHA 4IO8A 3QFUA 3TSPA 1VQNN 3A5NC 2COPA 3ENBA 3CCUN 4IO9L 1Q81O 1BU6O 1VQKN 3BP8A 3ID8A 4C1NI 3RSEA 1ISNA 3A8YA 3WEEB 1GLJO 3MN5A 1VQPN 4FWPA 5ADXA 4B9QA 4CBWA 2ZJPL 3IKMA 1GLLO 3CCRN 4IOCL 1BDGA 4IJAA 2RHKA 1TUUA 3MN6A 2DIKA 1HKGA 4JK8A 4XEIA 2J0MA 2YHWA 1MK7B 4A57A 3E66A 2WBNA 5EX5A 5IJMA 1VBHA 1EF1A 2D0OA 1TYQA 1HBKA 4NY0A 2PBDA 4PKGA 5ADXH 4YOYA 2ZJRL 4C23A 1S72N 1YVNA 3UE5A 2AA4A 1HB8A 3EPYA 1ATNA 3NVMA 1RGIA 2LBBA 3CCJN 3CC4N 2GWJA 4FOIA 1VQON 3EE9A 1TYQB 4I6MA 2I1KA 4EHTA 1XQSC 2V52B 4WQ5C 5AR0A 3VGMA 4BG8A 3HSCA 3J7ZO 1RDUA 1DT9A 1NWKA 2FF6A 2AEHA 4A61A 1GC6A 3R8EA 5JVHL 2D4WA 1WUAA 4CZIA 1HLUA 4A5BA 5EXWA 3TTFA 3EL2A 3SMPA 3VF2A 4BC5A 2GX9A 3MMVA 1QVFM 2A41A 3AAQA 4NO7A 4JN4A 3GE1A 3FZFA 2J0KA 2E8AA 5AZIB 3ULEB 4BGBA 1DGKN 3IFRA 4FO0A 3CCQN 4H0XB 4OPHA 5F0XA 3RSEB 4YDUC 3UKRA 3ZEUA 1V4TA 3N4QA 3D7EO 1VQ6N 2HBKA 3R3LA 1BO5O 4JKCA 4BRQA 4F9OA 3EKSA 3VEVA 1CZAN 3C6AA 1N8RO 1C0GA 1O13A 4L3QA 1GLBG 3P31A 4JKGB 3S41A 3BF3A 2HBMA 3QMLA 1T3VA 4BR7A 4FVUA 1GLEG 2PFUA 3O4WA 5AQLA 3ZX3A 2YI1A 3CCEN 3MN9A 2FLOA 1J6ZA 3U8XA 1E4FT 2QWLA 2WUSA 4BRHA 5DM6L 3CCSN 4WQ4C 4PL7A 3VEXA 1X3MA 3VOVA 3EZWA 4IOXA 1NGBA 4R79A 1ZC6A 2QWQA 2R82A 4JKEA 1MIXA 4HDOA 2P9IB 2HBJA 2FXUA 5C2FA 1MWMA 1Y19B 4FPBA 1KXPA 3MX2A 4U67L 4GV6A 4BRDA 2X0SA 3ENHA 4BRPA 2A40A 3CPEA 3VETA 2BH1A 3CHWA 2H3GX 3ATUA 3PZDA 4JEPA 5BN9A 3MCPA 1JJ2M 3F5TA 4ILHA 3FZKA 4IEEA 3KWGA 2HE7A 4O8UA 3QBWA 5CR4A 3T69A 3SAHA 2E1ZA 3LDQA 3O5BA 3OA9A 3UKRB 3O9RA 2ITMA 2P9IA 2A42A 4H5RA 3WXMB 4IDHA 2VYPA 3ULEA 4JKBA 2A5XA 3D2FB 5GAHP 3CCVN 2P9NA 4M63C 1YJ9N 2Q0RA 1T6CA 2EMSA 4MLHA 2HSTA 1KAXA 3LDNA 3VTHA 3VMFB 2F9WA 2QW9A 5BN8A 1ZBSA 4GXBA 2V51B 4RTFD 3MWPA 4GY2B 2A6AA 3E9LA 4H0VB 2YHXA 4YOUA 5HOOA 1HKCA 2Q31A 3Q7CA 5B8HA 4JKGA 3AAPA 1EQYA 5AQZA 4AM6A 3KK7A 2YVCA 4BRFA 4BC2A 2BUPA 3VEYA 2IVPA 1VQ8N 1K73O 4BROA 4HTLA 1NGIA 1NBWA 2YHYA 4B1UB 3ZEUB 3A5OC 2RQ1A 2GELA 3H46O 5CHIA 3A0IX 4BR4A 3C65A 1GLAG 4BQZA 4RCHA 5M1NA 1SZ2A 2CGLA 2GEMA 5AZIA 3M3ZA 3IUCA 3VF6A 1VQ5N 4FWNA 5AQIA 3MWTA 4GVEA 2GWKA 4KBOA 2ASOA 3HTVA 5BPNA 4KH4A 5LJVA 1YJWN 3KHYA 1VQMN 3CC2N 3GDQA 3H3OB 4I6MB 2Q36A 5JICA 5GAEP 1ATSA 3TU5A 3CC7N 3WQUA 2A3ZA 3D6RA 2OANA 2NRVA 3O9UA 4FPAA 1BG3A 3M5RA 2V7ZA 3TTCA 1DKGD 5M1FA 2NRXA 3U4LA 1SAZA 2W40A 1M90O 5AQJA 1HUXA 2CH6A 4WQ5A 2FSKA 4JHDA 1MA9B 1ST7A 4ZRIA 4YOTA 4BR0A 1K8AO 3O80A 4NLCA 4BR2A 3BINA 3O08A 5E26A 4O8KA 3UKUA 3WXIA 4B1WB 2P9LA 3R6MA 3AGRA 3LDLA 3D2FA 3P4IA 2IIRA 1R59O 3Q7BA 5HL7L 5AZJB 1X3NA 3J8AA 3SK3A 4A5AA 4BREA 1NTIA 1T44A 5AQQA 3FGUA 1S22A 2ZF5O 3DJCA 4H5NA 4BC4A 3L4QA 4OPAA 1QHAA 4PKHA 3TTDA 2Q1NA 1NGEA 5BPLA 2WFBA 2FDQA 1NGAA 2I7PA 2QWOA 4IOAL 3EE8A 4K41A 3BEXA 3IDHA 3VEZA 1KC8O 3QFPA 3GG4A 5EY4A 5AQVA 4BRGA 3HOSA 3QICA 3SLCA 1QZ5A 3W3DA 1NGDA 5AQGA 3ZYYX 3EO3A 1NGCA 4CBUA 4XH4A 4IZ9A 4GV3A 1KD1O 1ACAA 5JVLA 2E2NA 3PIOL 2KLAA 3HRGA 2D0PA 2V7YA 4MO4A 3DWLA 3ZETB 2NRWA 2VGMA 4H0PA 4A59A 4DKWA 4H0YB 2HF4A 3UB5A 5FPNA 3IMXA 1TUYA 1BWFO 1Q82O 3O1BA 4BG9A 3JS6A 2QTDA 1NGJA 4BRIA 3VGLA 1NVLA 2HRJA 2P9SA 4CZMA 5GIOA 2E2OA 5BR9A 3JXUA 1YIJN 5AQSA 4EKUA 2FF3B 2JWKA 2CGJA 3GL1A 4CZGA 2Q2RA 1D4XA 2ZWHA 3MN7A 4CD3A 5GINA 4WF9L 2QM1A 4CZHA 4YL8A 4CBXA 3CF5L 2NZTA 3DXKA 3SMSA 1NLVA 5AQTA 5AQXA 4AM7A 2ZJQL 3QBXA 4A2BA 4QS7A 3WA0A 4H0OA 5AQKA 4FWRA 2NRHA 1QQNA 2DPNA 5FPMA 1JCGA 1S3XA 4F7GA 1SQKA 1WOQA 3CQXA 4XH5A 4O5FA 4EFHA 1HJOA 1QQOA 3M6GA 3MCAB 2AL6A 4IFEA 5C10A 1BA1A 3OW2M 3N4PA 3DLLL 1QQMA 2CQUA 2FSJA 4FOEA 5M1PA 3I56N 3I55N 4FWLA 2FSNA 3D2EA 3T7ZA 2OTJN 4BRNA 3AU5A 1NM1A 1XUPO 5BRDA 4BR5A 2D2QA 2IVOA 3HOTA 3FP5A 5AQPA 5JLHA 4DCHA 3NVKA 1K8KB 2W41A 2RE2A 2E1YA 2QWPA 1VQ9N 3CI5A 1JCFA 3A5MC 1U2VA 1H1VA 2P9PA 2HOEA 3A5LC 4P7IA 1DEJA 2P9UA 1KQSM 3WEEA 5GAGP 1M1KO 4UY8O 4C1NK 4KH5A 4BRMA 3FZLA 3WXLA 1SS6A 3AY9A 3ATVA 4EHUA 1Q86O 3HI0A 3OHRA 3F9MA 2EMTA 4M7XA 1BUPA 1T6DA 4DHYA 3LM9A 3LM2A 2EWSA 4WCEL 3TSQA 1VAZA 3WXKA 2Q97A 3G25A 2QWRA 1NI2A 1OVYA 4BRAA 3L0QA 3CJ9A 4M7YA 4YOWA 5AQMA 1X9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  4JKF A;  4JK9 A;  4JK8 A;  3E66 A;  3SBG A;  4JK7 A;  4JKE A;  4JKA A;  3E9L A;  4JKG A;  4JKH A;  3E9P A;  4JKC A;  3ENB A;  4ILH A;  3SBT A;  4ILJ A;  4JKG B;  4ILG B;  3E9O A;  4JKD A; 
#chains in the Genus database with same CATH topology
 3PIP L;  2WH5 A;  4LD0 A;  3E01 A;  3CQ8 A;  4WFA L;  1WSG A;  2VG7 A;  4IBN A;  2R7Y A;  1K9M O;  1TL3 A;  4KO0 A;  3CET A;  1ZBH A;  3O8M A;  3I33 A;  3CME N;  2B6A A;  1Q8I A;  4LFB K;  4YY3 K;  4FJ8 A;  3RRG A;  2KQ2 A;  2HF3 A;  3V6D A;  2A1S A;  1IG8 A;  4PHT X;  1S6Q A;  4ZHR A;  5BPM A;  2IDO A;  4FK0 A;  1JLQ A;  3DXK B;  3AAR A;  2HBL A;  4O0I A;  3G6E N;  2ZQB A;  3RVC A;  4EP5 A;  3O1W A;  2X6S A;  1SKS A;  3DXM B;  1L3T A;  4CZE A;  3WNE A;  5CE3 A;  1BIZ A;  1VSH A;  4WQ4 A;  4Z94 A;  3DAW A;  3THW B;  3NGY A;  4FWO A;  2ZGZ A;  3P39 A;  1GOC A;  3HJF A;  2RKI A;  3T1H K;  1HMV A;  2P9K B;  5DK5 A;  3LWM A;  3CD6 N;  3VEN A;  5GIP A;  2DTU A;  4CJP A;  1NGF A;  3KWI A;  5LJW A;  3IS9 A;  4MQ3 A;  4BRL A;  3LDP A;  4XH1 A;  2ASM A;  2HHV A;  3FZM A;  1DTQ A;  4WYB A;  5AQY A;  1JLA A;  4AF1 A;  4ILJ A;  2F8T A;  1X9W A;  1LW0 A;  3E9O A;  1WBD A;  4RW6 A;  4CHO A;  5TKW A;  1JKH A;  4A62 A;  3OBW A;  3ITH A;  3SAG A;  2G8H A;  5LMN K;  1J5E K;  1NGH A;  4FXD A;  3ZT1 A;  2YJE A;  3MXM A;  1SKR A;  2E2Q A;  5LL6 Z;  3U9D A;  3WUH A;  1YHQ N;  2CH5 A;  4DR2 K;  1TKZ A;  3L2Q A;  5AQO A;  3ZX0 A;  3NF9 A;  3O6W A;  2VCP A;  3TR8 A;  1T8E A;  5C15 A;  4EAH D;  4FWM A;  3F73 A;  2O8C A;  5ELZ A;  2BTF A;  2Z1G A;  3ZT4 A;  3HVT A;  1ZBU A;  1JCE A;  4ID1 A;  1U47 A;  2KZM A;  2VWB A;  4DQ8 A;  3CJC A;  3LAN A;  3E9P A;  3D2E B;  4DG1 A;  3CCM N;  4ZTJ A;  3IVF A;  2ASP A;  1NK5 A;  2ZGY A;  3RMB A;  3RMC A;  1GLD G;  5MLC Q;  1SL2 A;  3C6U A;  4BDY A;  4DR3 K;  3LAL A;  4JKD A;  3CJ7 A;  1ILY A;  3VEO A;  3CXC M;  1L5U A;  1D5A A;  3CFP A;  3KVG A;  3C6H A;  1G99 A;  4H03 B;  3U7D A;  1B9F A;  4N47 A;  5C12 A;  1O1W A;  2PAV A;  2O8D A;  2YHB A;  1TK8 A;  2D1K A;  1FKO A;  1HKB A;  4CGF A;  4FWK A;  5F2R A;  5KRT A;  1ATR A;  3HBT A;  3ZET A;  3X23 A;  4CZL A;  1KVC A;  4EIA A;  3K9K A;  2G8U A;  4MLE A;  1HYZ A;  1XNR K;  4JK9 A;  4JI8 K;  4LH5 A;  3UKU B;  4DR4 K;  3PSI A;  4CI6 A;  2YX6 A;  4FJM A;  4JHD B;  3MEC A;  3WNF A;  2ZPY A;  4IJN A;  4DFP A;  3AGK A;  2HNY A;  3MED A;  5DMR A;  4JRQ A;  1VQN N;  4J2E A;  3A5N C;  4IO9 L;  1Q81 O;  4IG0 A;  1XI1 A;  1TAU A;  1HRH A;  2RF2 A;  2WTU A;  3WEE B;  4B9Q A;  4F3T A;  5A2Q O;  3HT3 A;  4IKF A;  3AO1 A;  4IJA A;  1TUU A;  1KLN A;  1NKB A;  1MK7 B;  2W6K A;  1S9E A;  5IJM A;  2WOM A;  5EX5 A;  3SUO A;  1UAX A;  3SYZ A;  1FW6 A;  3K0S A;  1EF1 A;  1TYQ A;  4E7H A;  4AHV A;  4X62 K;  3DMJ A;  5ADX H;  4BAC A;  2ZJR L;  4LF5 K;  3UE5 A;  4R5P A;  5SZT A;  3NVM A;  2EX3 A;  3VQ9 A;  4DV1 K;  3SQ4 A;  2HHQ A;  2NUB A;  1XQS C;  4WQ5 C;  3RR8 A;  1BCM A;  4A61 A;  4KI6 A;  5JVH L;  1HLU A;  3TTF A;  3VF2 A;  1NU0 A;  3L2V A;  1QVF M;  2FBX A;  3GE1 A;  3FZF A;  2J0K A;  3ULE B;  4BGB A;  4DF4 A;  4Z4E A;  1R0A A;  3RSE B;  3ZEU A;  3D7E O;  5KGW A;  4GW6 A;  2VQE K;  3R3L A;  1K6Y A;  4NXM K;  5EU7 A;  3OS0 A;  2HHX A;  4N56 A;  1GLB G;  3P31 A;  2HBM A;  3AVA A;  1S5J A;  3O4W A;  3ZX3 A;  1S1V A;  4DLE A;  1E4F T;  3SI6 A;  4PL7 A;  2W42 A;  3VOV A;  4LH4 A;  1MIX A;  4HDO A;  4B3S K;  3HL8 A;  1KXP A;  2X0S A;  4BRP A;  4OJR A;  4JEP A;  3CHW A;  3ATU A;  2P51 A;  3PZD A;  5BN9 A;  3F5T A;  3FZK A;  4O8U A;  2E1Z A;  3UKR B;  4H5R A;  3WXM B;  4IDH A;  2E6M A;  2UXD K;  3D2F B;  1TV6 A;  4CHQ A;  4YFU A;  2EMS A;  1HYS A;  2HST A;  1KAX A;  1C0T A;  3LDN A;  4CIF A;  3CM5 A;  3PSF A;  4I2Q A;  4J2D A;  1ZBS A;  4GXB A;  4DSK A;  4GY2 B;  4YOU A;  3ZSV A;  5HOO A;  2Q3S A;  2XY8 A;  2Q31 A;  5B8H A;  4DU3 A;  4JKG A;  3AAP A;  1Q9X A;  1NMN A;  4CF1 A;  2YVC A;  4PWD A;  4BC2 A;  1QQC A;  1BGX T;  2BUP A;  4FLW A;  3PX6 A;  2XY6 A;  4FYD A;  3L2U A;  1VQ8 N;  4BRO A;  5I3U A;  3SQ2 A;  4RW7 A;  2GEL A;  1GLA G;  2DFE A;  4RCH A;  5HRO A;  3M3Z A;  3HO1 A;  3IUC A;  4FW1 A;  1X1P A;  4AHC A;  1RTJ A;  2ASO A;  5BPN A;  5LJV A;  1YJW N;  1VQM N;  2UU9 K;  4M3U A;  3GDQ A;  3H3O B;  3K2P A;  5JIC A;  1ATS A;  4YHH K;  2NRV A;  4FPA A;  1TAQ A;  1CZB A;  4CFA A;  3PO5 A;  3TAN A;  3U4L A;  3HK2 A;  1M90 O;  1UA1 A;  4WQ5 A;  2YNG A;  1G15 A;  4CF0 A;  1K8A O;  3O80 A;  2KZZ A;  3BIN A;  5E26 A;  3MXI A;  4O8K A;  2P9L A;  3LDL A;  3LP0 A;  1VSE A;  3D2F A;  1S1X A;  4BE2 A;  4BRE A;  1WSE A;  3SK3 A;  4DU4 A;  1BHL A;  2ZF5 O;  4Z4C A;  3TAQ A;  4FLX A;  1BQN A;  4CHP A;  3LZJ A;  1NGE A;  3K59 A;  4N41 A;  2VG6 A;  4QOZ B;  1B9D A;  1NGA A;  2I7P A;  2QK9 A;  3EE8 A;  3NGI A;  4K41 A;  1KC8 O;  3QFP A;  3ZT2 A;  1CXU A;  3HOS A;  3LP3 A;  3QIC A;  1QZ5 A;  3SLC A;  1VK0 A;  4HUG A;  4G1Q A;  3EO3 A;  1NGC A;  5JS1 A;  4IZ9 A;  4GV3 A;  1KD1 O;  2YKM A;  4X65 K;  4E0D A;  1ITG A;  3LZI A;  2V7Y A;  3DWL A;  1EX4 A;  2NRW A;  2YHA A;  3KLE A;  4DKW A;  4H0Y B;  3UB5 A;  5FPN A;  1TUY A;  4BRI A;  4KHQ A;  3VGL A;  2HRJ A;  1RT6 A;  4DFK A;  1SL1 A;  2XHB A;  2JWK A;  4CZG A;  5BR8 K;  4WF9 L;  3MN7 A;  4FM0 A;  2DFH A;  3AA3 A;  3ISN C;  3SMS A;  3QES A;  2ZJQ L;  1Y97 A;  4A2B A;  2O8E A;  4H0O A;  5AQK A;  3OJS A;  4FWR A;  1QQN A;  3VQE A;  1JCG A;  1RDA A;  3CQX A;  2RN2 A;  4DQI A;  1HJO A;  2UUA K;  3LPT A;  2AL6 A;  4DS5 A;  3N4P A;  1VSI A;  1QQM A;  3NF8 A;  3OYB A;  3I56 N;  3NAE A;  3VQA A;  4BRN A;  1I94 K;  3OVN A;  4DCH A;  5C24 A;  2RE2 A;  2OA8 A;  3KTQ A;  3JYT A;  3THY B;  2P9P A;  3A5L C;  3WEE A;  5GAG P;  1M1K O;  2I5J A;  4KH5 A;  4CEQ A;  2BAN A;  3FZL A;  3WXL A;  3HXM A;  3HYF A;  4XIU A;  1C0M A;  1BUP A;  3LM9 A;  4F2S A;  2KFZ A;  3TSQ A;  3WXK A;  4K8X A;  5T7B A;  4OGE A;  4DSL A;  5C0Y A;  1ZBL A;  1ASU A;  3AV9 A;  1C1C A;  4BQL A;  3VA0 A;  1YT3 A;  3HM9 A;  4DQR A;  2WC9 A;  4JKA A;  2DFF A;  2J0J A;  4DTJ A;  3C94 A;  4JYA K;  1VSJ A;  4FLZ A;  2B5J A;  2GUP A;  1P90 A;  5AQR A;  3T1A A;  4DV5 K;  4FVM A;  3CMA N;  3CJA A;  3T19 A;  4CJ7 A;  1Q18 A;  4JS5 A;  2XY7 A;  2VGN A;  3O9T A;  1X9M A;  3CFR A;  4DUZ K;  1RTH A;  1RDW X;  4JD2 B;  3CCL N;  1NG9 A;  5J2M A;  1P8Z A;  2JLE A;  3VES A;  1NNE A;  3T1Y K;  4JD2 A;  3V1Q A;  4CZF A;  4HUE A;  2UXB K;  4FJJ A;  3MXJ A;  1EWR A;  3OBY A;  3LWL A;  1UA0 A;  4CF9 A;  5KQD A;  4I2P A;  1HPM A;  1KCF A;  2W6L A;  3K58 A;  3S3M A;  1WSH A;  3SCX A;  2O8C B;  4JI5 K;  3H1V X;  4RW4 A;  3H3N O;  5AQW A;  4FZX C;  3C95 A;  5KTQ A;  1J54 A;  3ID6 A;  4YNQ A;  2UUB K;  1HR0 K;  4LFC K;  4MO5 A;  3NMU A;  2E2P A;  3KK1 A;  3O9S A;  4AIL C;  5EVZ A;  3PV8 A;  2KTQ A;  3HZ6 A;  3KLG A;  4TKN A;  2NRT A;  3GBT A;  4NB4 A;  2JWL A;  5JVG L;  2QA4 N;  1JLF A;  2QI2 A;  4FM1 A;  1IBK K;  3BUZ B;  3ENO A;  1RT3 A;  5FPE A;  3ZT3 A;  3I8B A;  3W0L A;  1HX1 A;  3KZB A;  1BA0 A;  4JAX A;  5AQH A;  3VTI A;  4IDK A;  1XC3 A;  1VSL A;  4B1X B;  3HPO A;  4IFV A;  4BRC A;  1IJJ A;  1K8K A;  2PY5 A;  3FFK B;  3V9U A;  4JI6 K;  3RMA A;  4H4M A;  4CFB A;  2WON A;  2FJ9 A;  4TSX A;  3DLE A;  4ILG B;  1RNH A;  1L3S A;  4CZK A;  3DXM A;  4YDU A;  2D10 A;  4YOV A;  3CJ1 A;  3HST B;  4CJ3 A;  3G4S N;  3AVJ A;  3U3G A;  1VBG A;  4DF8 A;  1JDE A;  1N34 K;  5I9E B;  1MIZ B;  1FK9 A;  2OTL N;  3P5J A;  3J80 O;  2E6L A;  5CYQ A;  1J19 A;  5AQF A;  4F4K A;  4JRP A;  3QIP A;  4YOX A;  1J5O A;  1KC7 A;  4CCH A;  4JV5 K;  3L2R A;  1T05 A;  3G0Z A;  3DLG A;  1LOT B;  1KAZ A;  2OPR A;  2KKZ A;  3PX4 A;  4FJL A;  2GV9 A;  3AVI A;  1TKX A;  1ZXO A;  2OPS A;  3NDK A;  3E1Y A;  3QNN A;  4DMN A;  1BIU A;  1BOT O;  1Q9Y A;  2P9L B;  5M1Q A;  3HP9 A;  3DM2 A;  4KTW A;  1Z6R A;  3L8B A;  4DV0 K;  4DQS A;  3L2W A;  3SAF A;  2HHT A;  3SJH A;  3QFU A;  1WB9 A;  4OLA A;  3CCU N;  4DR7 K;  3L3V A;  4OGC A;  4W5R A;  2F96 A;  1ISN A;  3A8Y A;  2Y1I A;  1GLJ O;  1GLL O;  3CCR N;  3PO4 A;  4FW2 A;  4DV7 K;  1BDG A;  4BE1 A;  3MN6 A;  3ALY A;  5HP1 A;  5CYM A;  4XEI A;  1JL2 A;  3DLB A;  3NH1 A;  4JI0 K;  1VBH A;  2O8B A;  4OPK A;  4Z4I A;  4X66 K;  2D0C A;  3V4I A;  4NYF A;  2AA4 A;  3EPY A;  4FZZ A;  4E7K A;  3CCJ N;  3CC4 N;  4FOI A;  1VQO N;  3EE9 A;  3DOK A;  4I6M A;  1BIS A;  3SPZ A;  2V52 B;  3DLK A;  3VGM A;  1LV5 A;  3HSC A;  1TKD A;  1RBV A;  1GC6 A;  3R8E A;  4EP4 A;  3OY9 A;  2G8K A;  4CZI A;  1B92 A;  1HJR A;  3ZSY A;  3IG1 A;  4BC5 A;  2GX9 A;  3MMV A;  2A41 A;  2E8A A;  1DGK N;  3IFR A;  5CY4 A;  2D5R A;  4C8M A;  4OPH A;  4YDU C;  3UKR A;  1VQ6 N;  3HPH A;  5CZ1 A;  4DSE A;  4BRQ A;  4F9O A;  4PQU A;  1CZA N;  4Q0B A;  2DY4 A;  1N8R O;  3BF3 A;  2UUC K;  3TAF A;  2PFU A;  1QE1 A;  2YI1 A;  3CCE N;  4HTU A;  3QEI A;  4KTQ A;  1IKV A;  2WUS A;  5DM6 L;  4E1N A;  1HYV A;  4GKJ K;  4OKK A;  4WQ4 C;  1X3M A;  2B4J A;  3EZW A;  1NGB A;  4R79 A;  2QWQ A;  4BWM A;  4JKE A;  4FJK A;  1UOC A;  2P9I B;  4DU1 A;  1HNW K;  4U67 L;  1FJG K;  4B9T A;  3MX2 A;  1XC9 A;  3VA3 A;  4GMJ B;  3OS1 A;  2A40 A;  3CPE A;  2BH1 A;  1NK7 A;  1S9G A;  4M45 A;  1DTT A;  3QBW A;  3OYJ A;  1EXQ A;  3LDQ A;  3O5B A;  3OA9 A;  4JLH A;  4M3W A;  2G8V A;  2P9I A;  3ULE A;  2HHS A;  2O4I A;  2P9N A;  4M63 C;  1YJ9 N;  2Q0R A;  1T6C A;  3VTH A;  2QW9 A;  4K0K K;  2V51 B;  3MWP A;  3E9L A;  5C42 A;  1HKC A;  3Q7C A;  2Z1H A;  3KK7 A;  4BRF A;  3RMD A;  3V1R A;  3ASM A;  1NBW A;  1HPZ A;  3TAM A;  4BR4 A;  4M41 A;  2CGL A;  1QHT A;  4E3S A;  4GVE A;  4CEO A;  2GWK A;  3TAP A;  1RT7 A;  2Q36 A;  4I6M B;  3O4N A;  4CK2 A;  3D6R A;  3I0R A;  2OAN A;  4PY5 A;  3O9U A;  1BG3 A;  4CJV A;  1QSL A;  1KRP A;  2NRX A;  2GBZ A;  1HQE A;  2W40 A;  3DRR A;  2FSK A;  4JHD A;  1IO2 A;  4YOT A;  4BR0 A;  2LSN A;  4BR2 A;  3UKU A;  4B1W B;  3R6M A;  3AGR A;  1ZBF A;  3PUF A;  1U4B A;  4B08 A;  5HL7 L;  5AZJ B;  1X3N A;  3J8A A;  4A5A A;  3ZSZ A;  1NTI A;  5AQQ A;  3FGU A;  4H5N A;  4BC4 A;  4I9L A;  1QHA A;  3TTD A;  2Q1N A;  2PZS A;  4DV6 K;  3QLH A;  1JXB A;  4LF6 K;  2WFB A;  2FDQ A;  1D8Y A;  4B3O A;  5J1E A;  3IDH A;  3LDS A;  3S3O A;  1CZ9 A;  1T7P A;  3FFI A;  1VSD A;  5EY4 A;  5LMU K;  3BDP A;  4BRG A;  3O4Q A;  1U45 A;  3O3F A;  1NGD A;  3ZYY X;  4CJS A;  4LF4 K;  2HVH A;  4W5Q A;  3TWH A;  2E2N A;  3PIO L;  2KLA A;  1HNZ K;  3HRG A;  5J2P A;  2D0P A;  3D45 A;  4QCL A;  3CFO A;  4B3R K;  2AJQ A;  2HF4 A;  4O4G A;  1ZBI A;  2IAJ A;  3JS6 A;  2QTD A;  1NGJ A;  1XMQ K;  1NVL A;  2E2O A;  4DLG A;  2JGU A;  3JXU A;  2CGJ A;  2Q2R A;  4CD3 A;  3CF5 L;  3S3N A;  1S1W A;  1NLV A;  5AQX A;  4DSF A;  3AO4 A;  4N76 A;  3JSM A;  4ELV A;  2NRH A;  2DPN A;  1IG9 A;  3AVM A;  3KD1 E;  1WOQ A;  2YV0 X;  5IWA K;  4CJU A;  1QQO A;  3MCA B;  5C10 A;  5FRN A;  1UWB A;  3DLL L;  5C25 A;  2FSJ A;  4FOE A;  1W0H A;  2FSN A;  4L8R B;  3THV A;  3AU5 A;  1NM1 A;  4BR5 A;  3KJV A;  4C8O A;  3FP5 A;  1WAF A;  3NVK A;  1K8K B;  2W41 A;  3KIO A;  4ID5 A;  3CI5 A;  3A5M C;  1H1V A;  4LSN A;  4Y1D A;  4P7I A;  4DSI A;  1KQS M;  4H4O A;  3WNG A;  2PYL A;  2D0A A;  3AVN A;  4CHZ A;  4UQG A;  1KTQ A;  4KHY A;  1SS6 A;  4B8A B;  4EHU A;  3M8R A;  3F9M A;  1T6D A;  1N36 K;  2EWS A;  4WCE L;  3EZ5 A;  4CK1 A;  4AHU A;  4J2A A;  3VQQ A;  1LAV A;  2Q97 A;  4CES A;  1OH8 A;  2HHU A;  2IGI A;  3CJ9 A;  3K5O A;  5AQM A;  1X9J A;  5AQN A;  3K5M A;  4DWI A;  1IBL K;  2O4G A;  3B8A X;  3L4I A;  1QVG M;  2P9K A;  3TI0 A;  1RBU A;  2X74 A;  3VQ6 A;  3FLC O;  3BZC A;  3AA4 A;  4MDB A;  4KTZ A;  4G9Z A;  1JLG A;  2CB8 A;  2HMP A;  2CGK A;  1W97 L;  3P38 A;  5EOY A;  1WBB A;  2HB5 A;  4RWT A;  2OZS A;  1MDU B;  1WAJ A;  5F1X A;  4OVL A;  1VQ4 N;  3VPZ A;  4CFD A;  3QIN A;  5C2D A;  3EN9 A;  3AVC A;  1SGH A;  5KPT A;  4LSL A;  4H0T B;  3AVF A;  3DOL A;  1XNQ K;  3UIQ A;  4JS4 A;  1JLE A;  4H8K A;  1A5W A;  1I3A A;  4M3Z A;  2FBT A;  1RT4 A;  3J7A P;  3GOI A;  2HND A;  5AFU A;  1XWL A;  3OTO K;  4B9L A;  3QDK A;  1V4S A;  3U3Y A;  2HMI A;  1GLF O;  2FBV A;  1NJX A;  2ZE2 A;  4K25 A;  3KLI A;  4FWQ A;  3J7Y P;  1HB6 A;  4NLB A;  4KHW A;  4AH9 A;  4M42 A;  3C7N A;  3PVL A;  1YXQ A;  3AA2 A;  4BC3 A;  1F21 A;  5M1K A;  4ZRJ A;  3CQY A;  3QET A;  3HPG A;  1VRU A;  3R1X A;  1JLC A;  1WN7 A;  4ELT A;  3H6E A;  1E5W A;  1RBR A;  1YIT N;  1NK0 A;  1A5X A;  3AVL A;  3KD5 E;  4J2B A;  3BY5 A;  1KSP A;  1SKW A;  5E41 A;  5BRF A;  2P9U B;  3VGK A;  4B1Z A;  5AZJ A;  3U9Z A;  1RFQ A;  3THX B;  1NJW A;  3I8D A;  4QS9 A;  1EO1 A;  3M8P A;  3LDO A;  4KH6 A;  5AQU A;  3QO9 A;  3R9P A;  4CYE A;  3OYK A;  3U6F A;  3V1O A;  4CGG A;  1DIK A;  3MEG A;  1U04 A;  3ZSX A;  4BR9 A;  2P5O A;  2HVI A;  2OPP A;  5D3G A;  1ESV A;  2ZD1 A;  4DXA B;  1W2B M;  4B8C A;  1KAY A;  1YF5 L;  1XHX A;  3L3U A;  3SNN A;  2FBY A;  5KQ8 A;  3CYM A;  2P9P B;  1GOA A;  3F2K A;  1QSS A;  3THY A;  3J81 O;  3T3F A;  3AA5 X;  1NK8 A;  2YCH A;  3EEQ A;  3KK3 A;  3SUP A;  1HNI A;  2GUI A;  3QEW A;  1EET A;  1VHX A;  2F7T A;  1ZYQ A;  4HDQ A;  4OX9 K;  4FSV A;  3CJB A;  4Z4H A;  4CFC A;  3TSU A;  4KPY A;  1S1T A;  3PX0 A;  1DLO A;  4CEZ A;  4FJH A;  4GNI A;  3DLH A;  4PL8 A;  4DB3 A;  4BGA A;  3OJU A;  4H5W A;  4FJ5 A;  2P9N B;  4CJQ A;  4BY9 C;  2YJF A;  4E7L A;  4DR5 K;  3B6P A;  3FLV A;  1OH5 A;  2F9T A;  4CD1 A;  1KLM A;  1QZ6 A;  4DTX A;  1Q7Y O;  4BVP A;  5FPD A;  1NJI O;  3VQP A;  2HHW A;  2GTD A;  1Z05 A;  1NK6 A;  4KB1 A;  4FL9 A;  4RW8 A;  3OYE A;  4FK2 A;  5AFU H;  3CPW M;  1QSY A;  4I7F A;  4LF7 K;  1IKX A;  3NCI A;  1Y64 A;  4E89 A;  4ELU A;  4JK7 A;  4E1J A;  3V81 A;  4Y0W A;  4M3T A;  2X78 A;  4RW9 A;  4LF8 K;  3IAY A;  3TSP A;  2COP A;  3ENB A;  1BU6 O;  1VQK N;  4DTS A;  3BP8 A;  1TK5 A;  3SUQ A;  1D9F A;  3SV3 A;  4C1N I;  4FM2 A;  2YNI A;  1VQP N;  3ULD A;  4CBW A;  3SQ0 A;  1CXQ A;  1LAW A;  3IKM A;  1IV0 A;  4IOC L;  2E5L K;  4B9S A;  3D0P A;  4JK8 A;  3ZSQ A;  2J0M A;  2YHW A;  3ZCM A;  1U49 A;  5K14 A;  2WBN A;  1C6V A;  4JI4 K;  1KVA A;  2D0O A;  4NY0 A;  2PBD A;  4C23 A;  3QNO A;  1S72 N;  1HB8 A;  4AQY K;  4DS4 A;  2XO7 A;  4CW7 B;  4HUF A;  2LBB A;  2Z1I A;  2GWJ A;  2I1K A;  4EHT A;  3QEP A;  4BG8 A;  3SPY A;  3DRS A;  5AR0 A;  1NOY A;  3J7Z O;  3EYZ A;  2AEH A;  5EXW A;  3EL2 A;  3SMP A;  1C0U A;  3AAQ A;  4NO7 A;  4DR6 K;  3F9K A;  1L3U A;  3CCQ N;  4H0X B;  1YTA A;  1RCH A;  2BDP A;  1T03 A;  3N4Q A;  5HLF A;  4M3X A;  1WLJ A;  4Q5V A;  3TAR A;  3EKS A;  4N5S A;  3C6A A;  1C0G A;  2OYQ A;  1TL1 A;  4JKG B;  3QML A;  3KK2 A;  2O8F A;  4Z4G A;  5AQL A;  1BL3 A;  4NXN K;  3U8X A;  2QWL A;  4BRH A;  4DQQ A;  1ASV A;  1RDD A;  5HRS A;  3K5N A;  3VEX A;  4IOX A;  3NF6 A;  2HBJ A;  2FXU A;  1Y19 B;  4FPB A;  4DQP A;  4GV6 A;  4HVJ A;  4BRD A;  1J53 A;  3TAB A;  1L3V A;  3AVG A;  4IEE A;  1U48 A;  3SAH A;  2VG5 A;  3SJJ A;  3O9R A;  2A42 A;  1NK4 A;  4NCG A;  3CCV N;  2A5X A;  5GAH P;  4O44 A;  4DR1 K;  3AVB A;  4F8R A;  4DV4 K;  4PA1 A;  1RT1 A;  4CJR A;  3VMF B;  2F9W A;  4RTF D;  2A6A A;  4E7J A;  2YHX A;  5HBM A;  4HCB A;  1EQY A;  2OPQ A;  4KB0 A;  3PY8 A;  4DTO A;  2IVP A;  1XHZ A;  4HTL A;  1NGI A;  2YHY A;  2G8W A;  3ZEU B;  2RQ1 A;  3H46 O;  5IT9 O;  2G8I A;  3C65 A;  2F8S A;  1SZ2 A;  2GEM A;  3K57 A;  3NBP A;  5AQI A;  3HTV A;  1N33 K;  4KFB A;  3IRX A;  5GAE P;  3TU5 A;  3LP2 A;  4HHT A;  4BDZ A;  3M5R A;  2V7Z A;  5M1F A;  4CIG A;  3CG7 A;  4Y1C A;  4B3T K;  5AQJ A;  1HUX A;  4HCC A;  1MA9 B;  1ST7 A;  1C1A A;  3TAE A;  4NLC A;  3SV4 A;  1TKT A;  4X64 K;  3P4I A;  1R59 O;  4LY7 A;  3NH0 A;  1S22 A;  4CJE A;  3DJC A;  3TAG A;  3LP1 A;  1JXE A;  5FRM A;  2BE2 A;  5BPL A;  5AJ3 K;  3AO5 A;  5HRR A;  4CF8 A;  2QWO A;  4IOA L;  3BEX A;  3ZSO A;  3VEZ A;  1HNV A;  4E19 A;  3H08 A;  1BQM A;  1E3M A;  5AQV A;  3S9H A;  4C8L A;  2E4L A;  3MAQ A;  3DLR A;  4CGI A;  3K5L A;  2D0B A;  3VQ5 A;  5JVL A;  2HHH K;  1LW2 A;  1N5Y A;  3ZET B;  1NJY A;  4KRF A;  4H0P A;  5KGX A;  3O3G A;  3P83 D;  3IMX A;  3O1B A;  4DFM A;  4BG9 A;  4FLT A;  2P9S A;  2O8D B;  5GIO A;  2FF3 B;  3GL1 A;  4IG3 A;  5GIN A;  2ZWH A;  3OYM A;  2QM1 A;  4YL8 A;  3VQ7 A;  2NZT A;  5AQT A;  4CJK A;  3WA0 A;  4CJW A;  2X6N A;  4CGD A;  1SQK A;  4XH5 A;  2EHG A;  4IFY A;  4BDP A;  1BA1 A;  3OW2 M;  4I9Q A;  5M1P A;  4FJI A;  4FWL A;  3D2E A;  1XUP O;  4AHS A;  2IVO A;  3HOT A;  2P5G A;  5AQP A;  5JLH A;  4CJF A;  2E1Y A;  3NHG A;  1NKC A;  2QWP A;  1VQ9 N;  4FJX A;  1U2V A;  4ZTF A;  2HOE A;  5HRP A;  4CEE A;  3OYL A;  3M8Q A;  1GOB A;  1IBM K;  4DTM A;  3AY9 A;  4W5O A;  3OHR A;  3LAM A;  5FLX O;  4CHN A;  1RIL A;  2EMT A;  4AHR A;  4DHY A;  1X9S A;  1A5V A;  3LM2 A;  1LWC A;  4FLV A;  1FXX A;  2RPI A;  3G25 A;  1NI2 A;  1LWE A;  5JS2 A;  3L0Q A;  4M7Y A;  3LAK A;  4FCY A;  4JKF A;  3G10 A;  1YTU A;  5TKY A;  4KKO A;  5FRO A;  4BE0 A;  2NNW A;  1ASW A;  1VQL N;  4H5V A;  3B6O A;  4IEI A;  2OCE A;  1NMD A;  4WFN L;  1NGG A;  3MK6 A;  3WT0 A;  4CHY A;  2NRR A;  1VQ7 N;  5M1O A;  4BRK A;  4YOR A;  2VWJ A;  3FR0 A;  1EP4 A;  2J4R A;  3KKR A;  4B1Y B;  4B1V A;  3K9J A;  4KAZ A;  1RDC A;  2NLX A;  4KHU A;  3WXJ A;  2O8E B;  3CIP A;  2ITG A;  4A2A A;  1VRT A;  3AU4 A;  1MU2 A;  4ISE A;  1GC7 A;  3QIJ A;  3G71 N;  4ISG A;  1BCO A;  3QB0 A;  1YAG A;  1E4G T;  4CJT A;  3SBT A;  3QER A;  4DTN A;  1NKE A;  2I1J A;  1TK0 A;  5E84 A;  4HWI A;  4NYN A;  4CEC A;  3WQT A;  3VER A;  4JNE A;  4DTP A;  4OO1 J;  3O3H A;  5KPZ A;  3SBG A;  2QKK A;  1IKW A;  2I7N A;  3VN5 A;  1H4R A;  2QXF A;  4J8F A;  4O0J A;  4H5T A;  4DV2 K;  3DI6 A;  3C0B A;  4JI7 K;  2Q0U A;  1GGO A;  1I39 A;  4IXC A;  3U8Z A;  1NOZ A;  3LPU A;  3ZDT A;  2D11 A;  1REV A;  3VQD A;  2NRZ A;  4CZJ A;  4OLB A;  3EKU A;  3FZH A;  1U2V B;  4K42 A;  3LL3 A;  2QWN A;  1YI2 N;  1MK9 B;  4BVO A;  1VSK A;  3AVH A;  1C0F A;  4FJG A;  2IVN A;  1OKJ A;  5KPR A;  3CM6 A;  4U7B A;  4EZ6 A;  2ABD A;  4IWV A;  1J9A A;  5JLF A;  1Z25 A;  3RTV A;  4QS8 A;  1YJN N;  3KKS A;  5J2N A;  3BF1 A;  2UYT A;  1XMO K;  3P1G A;  3RWU A;  3V9X A;  2HNZ A;  4OKE A;  1GLC G;  3C7N B;  2OZM A;  4KV8 A;  4ICL A;  3VQ8 A;  3H45 C;  1KVB A;  4FJ7 A;  3CER A;  5DM7 L;  3PLA A;  2P9S B;  3TPQ A;  4CK3 A;  2ATQ A;  1OVQ A;  2XRI A;  1RTI A;  5H1S Q;  1HNX K;  4B9N A;  1GG3 A;  2E88 A;  3G9W A;  3HM8 A;  4BWJ A;  1U6Z A;  4DUY K;  1QS4 A;  2IS3 A;  3AO3 A;  5JMV A;  2QWM A;  3MDQ A;  2YNF A;  4PKI A;  3ZX2 A;  3EY1 A;  2QEX N;  4ISF A;  3OYG A;  2E20 A;  4C8K A;  1QTM A;  1YUW A;  4GV9 A;  1LCU A;  1MWK A;  5J2Q A;  4RG8 A;  5SWM A;  3VEW A;  3MX5 A;  5GAD P;  4LC9 B;  3ZT0 A;  4LFA K;  1BI4 B;  4JKH A;  1WSI A;  4O55 A;  2KHO A;  4DV3 K;  2AP1 A;  2XY5 A;  4K43 A;  3OYC A;  4ZRK A;  5BRH A;  3SQ1 A;  3SZ2 A;  1OH7 A;  4MDA A;  3FE1 A;  4WFB L;  4JI3 K;  4AHT A;  3V9W A;  3L6Q A;  1NJZ A;  4FWS A;  3O9Q A;  5LY3 A;  3VF4 A;  3M1F A;  3SUN A;  1RBT A;  4KHP K;  3AO2 A;  1KBL A;  3A2F A;  2QXL A;  4FLY A;  2G8F A;  4FZY A;  4JI1 K;  3H1Q A;  3I0S A;  3OYD A;  4GKK K;  1S1U A;  5BRE A;  4IO8 A;  3NGZ A;  1SUQ A;  4B9U A;  3QEV A;  3ID8 A;  2VQF K;  3RSE A;  4Z4F A;  3MN5 A;  4DTU A;  4FWP A;  5ADX A;  1RT5 A;  2ZJP L;  4CIE A;  2RHK A;  4CEF A;  4CJL A;  2DIK A;  1HKG A;  1W9H A;  4O5B A;  3E66 A;  4A57 A;  4OKJ A;  2BGG A;  1SL0 A;  1HBK A;  4W5T A;  4PKG A;  3NFA A;  4YOY A;  1YVN A;  1ATN A;  1RGI A;  4M3R A;  1VSM A;  3OYA A;  2ETJ A;  3OYI A;  1TYQ B;  1LWF A;  2ZM6 K;  3HVR A;  4LF9 K;  1RDU A;  1DT9 A;  1NWK A;  2FF6 A;  3QIO A;  2D4W A;  1WUA A;  4A5B A;  4GVM A;  1KFS A;  1RTD A;  4KI4 A;  5AZI B;  4B3M K;  4JN4 A;  4FO0 A;  5I42 A;  5F0X A;  1V4T A;  2HBK A;  1TGO A;  1BO5 O;  4JKC A;  3VEV A;  3OYH A;  2HW3 A;  2FC0 A;  1O13 A;  1S6P A;  4L3Q A;  1JLB A;  3S41 A;  4BR7 A;  4FVU A;  1T3V A;  1GLE G;  3BZK A;  1EKE A;  3MN9 A;  2F4V K;  2FLO A;  1J6Z A;  1C1B A;  3CCS N;  1TVR A;  3ZSW A;  4PUO A;  1ZC6 A;  2R82 A;  5FDL A;  5C2F A;  1MWM A;  4CJ5 A;  2O8F B;  3KLH A;  3ENH A;  3VET A;  1JJ2 M;  2H3G X;  2UXC K;  3MCP A;  4B9V A;  1JL1 A;  4CVN E;  4ILH A;  5CR4 A;  3KWG A;  2HE7 A;  3T69 A;  3DRP A;  2ITM A;  3NH2 A;  1RBS A;  3JAM O;  3RR7 A;  4CEB A;  2VYP A;  4JKB A;  4NCA A;  5KI6 A;  4MLH A;  5CZ2 A;  5BN8 A;  4F2R A;  4H0V B;  5KRS A;  1SV5 A;  3RRH A;  5AQZ A;  4AM6 A;  4C8N A;  1IH7 A;  3VEY A;  1K73 O;  2KW4 A;  4EZ9 A;  3OYF A;  4E7I A;  4B1U B;  3V9Z A;  3M8S A;  3A5O C;  5CHI A;  3A0I X;  4CGJ A;  3C6T A;  3MEE A;  4BQZ A;  4CE9 A;  4B9M A;  5M1N A;  5AZI A;  1FKP A;  3KLF A;  3AVK A;  1KFD A;  3VF6 A;  4DTR A;  4FWN A;  1VQ5 N;  5HRN A;  3MWT A;  4Z0U A;  4KBO A;  4KH4 A;  3KHY A;  3CC2 N;  3CC7 N;  3WQU A;  2A3Z A;  2PYJ A;  4K8Z A;  3TTC A;  1DKG D;  1SAZ A;  2CH6 A;  1CLQ A;  4ZRI A;  2P1J A;  3VQB A;  1NK9 A;  3O08 A;  3WXI A;  3VQ4 A;  3ZSR A;  3DYA A;  4FLU A;  4WE1 A;  2IIR A;  3Q7B A;  4CGH A;  1T44 A;  4CED A;  4V19 S;  1WSF A;  3NF7 A;  3L4Q A;  4OPA A;  4PKH A;  1EWQ A;  3ZLJ A;  3OYN A;  3QEX A;  1RT2 A;  1IKY A;  4E1M A;  3GG4 A;  3HP6 A;  4KHS A;  1RDB A;  4CEA A;  1D9D A;  4FJN A;  4FJ9 A;  3W3D A;  5AQG A;  4FK4 A;  4CER A;  4CBU A;  3NE6 A;  4XH4 A;  1ACA A;  2YKN A;  3THW A;  4MO4 A;  1WNS A;  4M3Y A;  3BGR A;  2VGM A;  4W5N A;  4A59 A;  4CJ4 A;  2Y1J A;  1BWF O;  1Q82 O;  1BI4 A;  1HQU A;  4JI2 K;  4OPJ A;  4CZM A;  1OH6 A;  5BR9 A;  1YIJ N;  5AQS A;  4EKU A;  1D4X A;  4CZH A;  4CBX A;  4CF2 A;  1VSF A;  3DXK A;  3WNH A;  4AM7 A;  3QBX A;  2QKB A;  1Z26 A;  4QS7 A;  5FPM A;  3OS2 A;  3V9S A;  2KFN A;  1S3X A;  4F7G A;  4EFH A;  4O5F A;  4NCB A;  4QAG A;  3M6G A;  4IFE A;  1W7A A;  2CQU A;  3I55 N;  2OTJ N;  3T7Z A;  2IOC A;  1WSJ A;  5BRD A;  2D2Q A;  2Z1J A;  2O8B B;  4KHN A;  2A1R A;  4DSJ A;  1JCF A;  4MFB A;  3THX A;  4DFJ A;  4F3O A;  2IC3 A;  1DEJ A;  2P9U A;  3VQC A;  4UY8 O;  4C1N K;  4BRM A;  3ATV A;  1Q86 O;  3HI0 A;  4KRE A;  1YVU A;  4M7X A;  1N32 K;  1N6Q A;  1VAZ A;  2QWR A;  1OVY A;  2VWK A;  4BRA A;  4YOW A;  2YNH A; 
#chains in the Genus database with same CATH homology
 5AQN A;  4BQL A;  3PIP L;  4JKF A;  2WH5 A;  3B8A X;  3L4I A;  5TKY A;  1QVG M;  2P9K A;  4WFA L;  2NNW A;  2WC9 A;  1K9M O;  4JKA A;  2J0J A;  1VQL N;  3CET A;  4H5V A;  4IEI A;  1NMD A;  4WFN L;  3O8M A;  1NGG A;  3MK6 A;  3I33 A;  3WT0 A;  3FLC O;  3CME N;  2GUP A;  1P90 A;  5AQR A;  2NRR A;  1VQ7 N;  5M1O A;  4BRK A;  3CMA N;  2HF3 A;  4YOR A;  3CJA A;  1IG8 A;  3FR0 A;  1Q18 A;  4MDB A;  2J4R A;  4CJ7 A;  4G9Z A;  4B1Y B;  2VGN A;  2CB8 A;  4B1V A;  4PHT X;  2HMP A;  3K9J A;  3O9T A;  2CGK A;  1W97 L;  2NLX A;  3P38 A;  5EOY A;  3WXJ A;  5BPM A;  1RDW X;  3CIP A;  4JD2 B;  3CCL N;  4A2A A;  3DXK B;  4RWT A;  3AAR A;  2HBL A;  1MDU B;  1P8Z A;  5F1X A;  3VES A;  3G6E N;  3AU4 A;  4ISE A;  1VQ4 N;  4JD2 A;  1GC7 A;  4CZF A;  3VPZ A;  3QIJ A;  5C2D A;  3EN9 A;  3RVC A;  3O1W A;  1SGH A;  5KPT A;  3DXM B;  3G71 N;  4ISG A;  4H0T B;  3OBY A;  4CZE A;  3QB0 A;  1YAG A;  5CE3 A;  1E4G T;  4WQ4 A;  4Z94 A;  3SBT A;  5KQD A;  2I1J A;  3DAW A;  5E84 A;  3GOI A;  5AFU A;  4FWO A;  4HWI A;  2ZGZ A;  3P39 A;  1HPM A;  3QDK A;  1V4S A;  1GLF O;  4K25 A;  2P9K B;  4FWQ A;  3VER A;  4JNE A;  3WQT A;  1HB6 A;  4NLB A;  3CD6 N;  4OO1 J;  5KPZ A;  3C7N A;  3PVL A;  1YXQ A;  3VEN A;  3SBG A;  5GIP A;  2I7N A;  1NGF A;  3KWI A;  5LJW A;  4BC3 A;  3H1V X;  5M1K A;  4ZRJ A;  1H4R A;  3H3N O;  4J8F A;  4BRL A;  3CQY A;  5AQW A;  4H5T A;  3LDP A;  4XH1 A;  2ASM A;  3C0B A;  3ID6 A;  3FZM A;  3R1X A;  4WYB A;  5AQY A;  2Q0U A;  3H6E A;  4AF1 A;  1GGO A;  1E5W A;  4IXC A;  4MO5 A;  3U8Z A;  3NMU A;  4ILJ A;  3ZDT A;  2D11 A;  2E2P A;  1YIT N;  3E9O A;  2NRZ A;  3O9S A;  4CZJ A;  5BRF A;  2P9U B;  5EVZ A;  3EKU A;  3VGK A;  4B1Z A;  5AZJ A;  3HZ6 A;  3U9Z A;  1RFQ A;  3FZH A;  1U2V B;  4TKN A;  4K42 A;  5TKW A;  4A62 A;  3LL3 A;  3OBW A;  3SAG A;  2NRT A;  2QWN A;  1MK9 B;  1YI2 N;  4QS9 A;  4BVO A;  1EO1 A;  1NGH A;  3LDO A;  1C0F A;  4KH6 A;  3GBT A;  4NB4 A;  5AQU A;  2IVN A;  3R9P A;  4CYE A;  1OKJ A;  2JWL A;  5JVG L;  5KPR A;  2QA4 N;  2QI2 A;  1DIK A;  2YJE A;  4U7B A;  2E2Q A;  2ABD A;  4BR9 A;  4IWV A;  3U9D A;  3WUH A;  5JLF A;  1YHQ N;  3BUZ B;  3ENO A;  2CH5 A;  4QS8 A;  1ESV A;  5FPE A;  4DXA B;  1W2B M;  1YJN N;  1KAY A;  5AQO A;  1YF5 L;  3ZX0 A;  3O6W A;  3I8B A;  3W0L A;  1HX1 A;  2VCP A;  3BF1 A;  2UYT A;  3KZB A;  1BA0 A;  4JAX A;  5AQH A;  3VTI A;  5C15 A;  5KQ8 A;  4EAH D;  4FWM A;  2P9P B;  1GLC G;  3C7N B;  1XC3 A;  5ELZ A;  3F2K A;  2BTF A;  2YCH A;  3H45 C;  4B1X B;  4BRC A;  1IJJ A;  1K8K A;  1JCE A;  3CER A;  5DM7 L;  3FFK B;  2VWB A;  3PLA A;  4DQ8 A;  2P9S B;  2F7T A;  3TPQ A;  3CJC A;  4HDQ A;  5C0Y A;  3E9P A;  3D2E B;  4FSV A;  3CJB A;  3CCM N;  3IVF A;  2ASP A;  5H1S Q;  2ZGY A;  2FJ9 A;  1GG3 A;  1GLD G;  2E88 A;  3G9W A;  3HM8 A;  3TSU A;  4ILG B;  5MLC Q;  1U6Z A;  3DXM A;  4CZK A;  4YDU A;  5JMV A;  2D10 A;  4YOV A;  3CJ1 A;  4GNI A;  2QWM A;  3G4S N;  3MDQ A;  4PKI A;  1VBG A;  4PL8 A;  3ZX2 A;  4BGA A;  4DB3 A;  4JKD A;  3CJ7 A;  1ILY A;  4H5W A;  3VEO A;  2QEX N;  4ISF A;  3CXC M;  2E20 A;  1JDE A;  5I9E B;  1MIZ B;  1YUW A;  4GV9 A;  1LCU A;  3KVG A;  2P9N B;  1MWK A;  4BY9 C;  3C6H A;  1G99 A;  4H03 B;  2OTL N;  3U7D A;  2YJF A;  1J19 A;  3VEW A;  2PAV A;  5C12 A;  5AQF A;  2D1K A;  3MX5 A;  5GAD P;  3FLV A;  4LC9 B;  4YOX A;  4JKH A;  1KC7 A;  2F9T A;  4CD1 A;  1HKB A;  1QZ6 A;  2KHO A;  4BVP A;  1Q7Y O;  5FPD A;  4FWK A;  5F2R A;  1NJI O;  1ATR A;  2GTD A;  3HBT A;  2AP1 A;  1LOT B;  3ZET A;  3X23 A;  1KAZ A;  4ZRK A;  1Z05 A;  4K43 A;  4CZL A;  5BRH A;  2KKZ A;  4EIA A;  4FL9 A;  4MDA A;  3FE1 A;  3K9K A;  4WFB L;  5AFU H;  1ZXO A;  3L6Q A;  4MLE A;  4FWS A;  3E1Y A;  3O9Q A;  3CPW M;  5LY3 A;  3VF4 A;  1BOT O;  4JK9 A;  2P9L B;  3M1F A;  5M1Q A;  3UKU B;  1KBL A;  1Y64 A;  4CI6 A;  1Z6R A;  2QXL A;  2YX6 A;  4JK7 A;  4E1J A;  4Y0W A;  4JHD B;  3H1Q A;  2ZPY A;  4IJN A;  3SAF A;  3AGK A;  5BRE A;  3SJH A;  4IO8 A;  3QFU A;  3TSP A;  1VQN N;  3A5N C;  2COP A;  3ENB A;  3CCU N;  4IO9 L;  1Q81 O;  1BU6 O;  1VQK N;  3BP8 A;  3ID8 A;  4C1N I;  3RSE A;  1ISN A;  3A8Y A;  3WEE B;  1GLJ O;  3MN5 A;  1VQP N;  4FWP A;  5ADX A;  4B9Q A;  4CBW A;  2ZJP L;  3IKM A;  1GLL O;  3CCR N;  4IOC L;  1BDG A;  4IJA A;  2RHK A;  1TUU A;  3MN6 A;  2DIK A;  1HKG A;  4JK8 A;  4XEI A;  2J0M A;  2YHW A;  1MK7 B;  4A57 A;  3E66 A;  2WBN A;  5EX5 A;  5IJM A;  1VBH A;  1EF1 A;  2D0O A;  1TYQ A;  1HBK A;  4NY0 A;  2PBD A;  4PKG A;  5ADX H;  4YOY A;  2ZJR L;  4C23 A;  1S72 N;  1YVN A;  3UE5 A;  2AA4 A;  1HB8 A;  3EPY A;  1ATN A;  3NVM A;  1RGI A;  2LBB A;  3CCJ N;  3CC4 N;  2GWJ A;  4FOI A;  1VQO N;  3EE9 A;  1TYQ B;  4I6M A;  2I1K A;  4EHT A;  1XQS C;  2V52 B;  4WQ5 C;  5AR0 A;  3VGM A;  4BG8 A;  3HSC A;  3J7Z O;  1RDU A;  1DT9 A;  1NWK A;  2FF6 A;  2AEH A;  4A61 A;  1GC6 A;  3R8E A;  5JVH L;  2D4W A;  1WUA A;  4CZI A;  1HLU A;  4A5B A;  5EXW A;  3TTF A;  3EL2 A;  3SMP A;  3VF2 A;  4BC5 A;  2GX9 A;  3MMV A;  1QVF M;  2A41 A;  3AAQ A;  4NO7 A;  4JN4 A;  3GE1 A;  3FZF A;  2J0K A;  2E8A A;  5AZI B;  3ULE B;  4BGB A;  1DGK N;  3IFR A;  4FO0 A;  3CCQ N;  4H0X B;  4OPH A;  5F0X A;  3RSE B;  4YDU C;  3UKR A;  3ZEU A;  1V4T A;  3N4Q A;  3D7E O;  1VQ6 N;  2HBK A;  3R3L A;  1BO5 O;  4JKC A;  4BRQ A;  4F9O A;  3EKS A;  3VEV A;  1CZA N;  3C6A A;  1N8R O;  1C0G A;  1O13 A;  4L3Q A;  1GLB G;  3P31 A;  4JKG B;  3S41 A;  3BF3 A;  2HBM A;  3QML A;  1T3V A;  4BR7 A;  4FVU A;  1GLE G;  2PFU A;  3O4W A;  5AQL A;  3ZX3 A;  2YI1 A;  3CCE N;  3MN9 A;  2FLO A;  1J6Z A;  3U8X A;  1E4F T;  2QWL A;  2WUS A;  4BRH A;  5DM6 L;  3CCS N;  4WQ4 C;  4PL7 A;  3VEX A;  1X3M A;  3VOV A;  3EZW A;  4IOX A;  1NGB A;  4R79 A;  1ZC6 A;  2QWQ A;  2R82 A;  4JKE A;  1MIX A;  4HDO A;  2P9I B;  2HBJ A;  2FXU A;  5C2F A;  1MWM A;  1Y19 B;  4FPB A;  1KXP A;  3MX2 A;  4U67 L;  4GV6 A;  4BRD A;  2X0S A;  3ENH A;  4BRP A;  2A40 A;  3CPE A;  3VET A;  2BH1 A;  3CHW A;  2H3G X;  3ATU A;  3PZD A;  4JEP A;  5BN9 A;  3MCP A;  1JJ2 M;  3F5T A;  4ILH A;  3FZK A;  4IEE A;  3KWG A;  2HE7 A;  4O8U A;  3QBW A;  5CR4 A;  3T69 A;  3SAH A;  2E1Z A;  3LDQ A;  3O5B A;  3OA9 A;  3UKR B;  3O9R A;  2ITM A;  2P9I A;  2A42 A;  4H5R A;  3WXM B;  4IDH A;  2VYP A;  3ULE A;  4JKB A;  2A5X A;  3D2F B;  5GAH P;  3CCV N;  2P9N A;  4M63 C;  1YJ9 N;  2Q0R A;  1T6C A;  2EMS A;  4MLH A;  2HST A;  1KAX A;  3LDN A;  3VTH A;  3VMF B;  2F9W A;  2QW9 A;  5BN8 A;  1ZBS A;  4GXB A;  2V51 B;  4RTF D;  3MWP A;  4GY2 B;  2A6A A;  3E9L A;  4H0V B;  2YHX A;  4YOU A;  5HOO A;  1HKC A;  2Q31 A;  3Q7C A;  5B8H A;  4JKG A;  3AAP A;  1EQY A;  5AQZ A;  4AM6 A;  3KK7 A;  2YVC A;  4BRF A;  4BC2 A;  2BUP A;  3VEY A;  2IVP A;  1VQ8 N;  1K73 O;  4BRO A;  4HTL A;  1NGI A;  1NBW A;  2YHY A;  4B1U B;  3ZEU B;  3A5O C;  2RQ1 A;  2GEL A;  3H46 O;  5CHI A;  3A0I X;  4BR4 A;  3C65 A;  1GLA G;  4BQZ A;  4RCH A;  5M1N A;  1SZ2 A;  2CGL A;  2GEM A;  5AZI A;  3M3Z A;  3IUC A;  3VF6 A;  1VQ5 N;  4FWN A;  5AQI A;  3MWT A;  4GVE A;  2GWK A;  4KBO A;  2ASO A;  3HTV A;  5BPN A;  4KH4 A;  5LJV A;  1YJW N;  3KHY A;  1VQM N;  3CC2 N;  3GDQ A;  3H3O B;  4I6M B;  2Q36 A;  5JIC A;  5GAE P;  1ATS A;  3TU5 A;  3CC7 N;  3WQU A;  2A3Z A;  3D6R A;  2OAN A;  2NRV A;  3O9U A;  4FPA A;  1BG3 A;  3M5R A;  2V7Z A;  3TTC A;  1DKG D;  5M1F A;  2NRX A;  3U4L A;  1SAZ A;  2W40 A;  1M90 O;  5AQJ A;  1HUX A;  2CH6 A;  4WQ5 A;  2FSK A;  4JHD A;  1MA9 B;  1ST7 A;  4ZRI A;  4YOT A;  4BR0 A;  1K8A O;  3O80 A;  4NLC A;  4BR2 A;  3BIN A;  3O08 A;  5E26 A;  4O8K A;  3UKU A;  3WXI A;  4B1W B;  2P9L A;  3R6M A;  3AGR A;  3LDL A;  3D2F A;  3P4I A;  2IIR A;  1R59 O;  3Q7B A;  5HL7 L;  5AZJ B;  1X3N A;  3J8A A;  3SK3 A;  4A5A A;  4BRE A;  1NTI A;  1T44 A;  5AQQ A;  3FGU A;  1S22 A;  2ZF5 O;  3DJC A;  4H5N A;  4BC4 A;  3L4Q A;  4OPA A;  1QHA A;  4PKH A;  3TTD A;  2Q1N A;  1NGE A;  5BPL A;  2WFB A;  2FDQ A;  1NGA A;  2I7P A;  2QWO A;  4IOA L;  3EE8 A;  4K41 A;  3BEX A;  3IDH A;  3VEZ A;  1KC8 O;  3QFP A;  3GG4 A;  5EY4 A;  5AQV A;  4BRG A;  3HOS A;  3QIC A;  3SLC A;  1QZ5 A;  3W3D A;  1NGD A;  5AQG A;  3ZYY X;  3EO3 A;  1NGC A;  4CBU A;  4XH4 A;  4IZ9 A;  4GV3 A;  1KD1 O;  1ACA A;  5JVL A;  2E2N A;  3PIO L;  2KLA A;  3HRG A;  2D0P A;  2V7Y A;  4MO4 A;  3DWL A;  3ZET B;  2NRW A;  2VGM A;  4H0P A;  4A59 A;  4DKW A;  4H0Y B;  2HF4 A;  3UB5 A;  5FPN A;  3IMX A;  1TUY A;  1BWF O;  1Q82 O;  3O1B A;  4BG9 A;  3JS6 A;  2QTD A;  1NGJ A;  4BRI A;  3VGL A;  1NVL A;  2HRJ A;  2P9S A;  4CZM A;  5GIO A;  2E2O A;  5BR9 A;  3JXU A;  1YIJ N;  5AQS A;  4EKU A;  2FF3 B;  2JWK A;  2CGJ A;  3GL1 A;  4CZG A;  2Q2R A;  1D4X A;  2ZWH A;  3MN7 A;  4CD3 A;  5GIN A;  4WF9 L;  2QM1 A;  4CZH A;  4YL8 A;  4CBX A;  3CF5 L;  2NZT A;  3DXK A;  3SMS A;  1NLV A;  5AQT A;  5AQX A;  4AM7 A;  2ZJQ L;  3QBX A;  4A2B A;  4QS7 A;  3WA0 A;  4H0O A;  5AQK A;  4FWR A;  2NRH A;  1QQN A;  2DPN A;  5FPM A;  1JCG A;  1S3X A;  4F7G A;  1SQK A;  1WOQ A;  3CQX A;  4XH5 A;  4O5F A;  4EFH A;  1HJO A;  1QQO A;  3M6G A;  3MCA B;  2AL6 A;  4IFE A;  5C10 A;  1BA1 A;  3OW2 M;  3N4P A;  3DLL L;  1QQM A;  2CQU A;  2FSJ A;  4FOE A;  5M1P A;  3I56 N;  3I55 N;  4FWL A;  2FSN A;  3D2E A;  3T7Z A;  2OTJ N;  4BRN A;  3AU5 A;  1NM1 A;  1XUP O;  5BRD A;  4BR5 A;  2D2Q A;  2IVO A;  3HOT A;  3FP5 A;  5AQP A;  5JLH A;  4DCH A;  3NVK A;  1K8K B;  2W41 A;  2RE2 A;  2E1Y A;  2QWP A;  1VQ9 N;  3CI5 A;  1JCF A;  3A5M C;  1U2V A;  1H1V A;  2P9P A;  2HOE A;  3A5L C;  4P7I A;  1DEJ A;  2P9U A;  1KQS M;  3WEE A;  5GAG P;  1M1K O;  4UY8 O;  4C1N K;  4KH5 A;  4BRM A;  3FZL A;  3WXL A;  1SS6 A;  3AY9 A;  3ATV A;  4EHU A;  1Q86 O;  3HI0 A;  3OHR A;  3F9M A;  2EMT A;  4M7X A;  1BUP A;  1T6D A;  4DHY A;  3LM9 A;  3LM2 A;  2EWS A;  4WCE L;  3TSQ A;  1VAZ A;  3WXK A;  2Q97 A;  3G25 A;  2QWR A;  1NI2 A;  1OVY A;  4BRA A;  3L0Q A;  3CJ9 A;  4M7Y A;  4YOW A;  5AQM A;  1X9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...