4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
b'ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine kinase 2-beta
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
1P98A 4MGZE 4FA6A 1V49A 1D3ZA 1FXTB 2R0DA 2YS1A 1RRPB 4AJYB 1IYFA 2LGYA 3UZTA 2DAJA 1V80A 1OQYA 2KJHB 3MPXA 2MDXA 3R7QA 1NI2A 1K5DB 3DVNU 1MIXA 2UYZB 4PS8A 4K2OA 2WDTB 3DXCA 2KTRB 3A8PA 5C16A 2GMIC 2KC1A 2MLBA 3QC8B 1MKEA 4W9DA 4M8MA 3B08A 2PPHA 1PFJA 3X0WA 1WF9A 4A5KA 4WAAA 2FIFA 2FNJB 1P5TA 3PG7A 1U5EA 3M63B 3TVVA 3QX1A 4B95A 2K2JA 1M7EA 3KW5B 2IY0B 2QKLA 4KHBB 1WR1A 1RLFA 4WWOA 2NR2A 2ABDA 1V89A 1C3TA 4GPTB 3JSVA 5JHHA 3ULCA 2KOXA 2ELBA 3PHXB 3VUWA 3W1SA 2HE7A 2Z0DB 2ZJDA 2N1WA 2J0KA 5L81A 5C5BA 3VUXA 2KMAA 4YONA 2HD5B 1UZXB 3KYDD 2YSZA 4JIOU 2GS0A 3NZUA 1ZC4B 2M17A 3MDBC 2FCQA 4FJZA 3DXEA 4YL8A 4KDLB 3LJUX 2COCA 2UZRA 4G50A 5E6PA 4HAWB 4NQKE 2BPSA 1WI1A 2PEAA 2CY5A 2MBQA 2MX2A 2LULA 1HB6A 4GIVA 2M38A 4WVFB 1HE8A 4Z2MB 4G3XB 1ZKHA 2G4SA 5AZFA 2N9XA 4HB0B 2CRFA 4EFOA 2DHIA 5D3XA 3AU4A 3PRMB 1GC7A 5EDSA 2DYMA 2KZRA 4K7WA 3ZNID 2KANA 2J0MA 1WXSA 1H10A 3NHEB 1RAXA 2G35A 3HM6X 5G2NA 3PTFC 3EHVA 1XQQA 4RM9A 3D8FA 3HHMA 4JLCA 2P0DA 3OLMD 2IO3B 1PQSA 2I1KA 2K8BA 2W2WA 4GMXB 2DTCA 1WXAA 1ZC3B 2PE9A 3VQIA 4MELA 1WJNA 2M8SA 1WJ1A 1LB1A 4IWQA 4ZYNA 4XC2A 2XBBC 1GG3A 2FUHB 4GDKA 5C1ZA 1XD3B 3N3KB 2P0FA 4KV2A 1GC6A 2AEHA 2HJ8A 2NPTA 2EMTA 3FM8C 1DYNA 3FP5A 4PQ0A 2O6VD 2I5FA 4ASWC 2ZNVC 2D9VA 2DX5A 4M8NA 2KLGA 1W1GA 3V5WA 1K8RB 2IYBA 1SHCA 4HAZB 3GZNI 1EUVB 2I5CA 2FCNA 2KCJA 2GBNA 2BCJA 2GBKA 3S2AA 3L54A 4DDGD 2ZCCA 3H1UA 4HXDA 2CHZA 3HIZA 2MBOA 2ROZB 2GOWA 1WJ4A 3TFMA 2EKEC 1WGYA 2BYFA 1QC6A 3GYPA 1FHWA 2M14A 3ZNGC 3A9JB 3QWMA 1W1HA 1MIZB 4F1SA 1A5RA 1XCGA 2IYDB 2J59M 5CLQB 4GSWA 2UVMA 3RCPA 4KSKC 1LM8B 1MK9B 2JVCA 1XX0A 3ML8A 4ZRKA 5HE2A 2KWUB 2WH5A 2GCLA 1WM3A 1KZ7A 2J0JA 2D10A 3MJWA 3A9KA 4FN2A 3A1QB 4ANWA 3H6NA 1W1DA 2LXAA 5JP4A 4FHJA 1BT0A 3VXWA 1UELA 2Z59B 3F0WA 1NBFC 4MGYE 5HE3A 1NTIA 2LOXA 4II3B 4JL9A 3GYOA 1UNRA 3APCA 2OJRA 1WVHA 1ZW7A 4AWJA 2V76A 3PHWB 4HB3B 4NQLB 3WIMA 5J18A 4CHKA 3JVZX 1TTNA 1U5DA 4ZRIA 2UWQA 4Z2NA 4FJYA 2MBHA 5D3WA 3HQCA 2XQNM 2A4ZA 4HAXB 2CAYA 2CODA 2KK8A 5LOPB 2B3AA 4IWPA 1FGYA 2KO3A 4BBNC 2Z0PA 4HWIB 4IOYX 5E6OA 3M3JA 1TXDA 2ASQA 1E8XA 5J2RA 2K2UA 3RYTA 1XODA 2Q13A 2L3ZA 2YLMA 5HE0A 1KJTA 1TBEA 2KDFB 5AEKB 3EPYA 4HVBA 3WAMA 1WJMA 2FIDA 3TBLD 3ML4A 5CHWA 4BBKA 2CR5A 1KZGA 3SO6A 3P7ZA 4EZLA 2FAZA 3ENEA 2GCJA 2ZNVB 1WE7A 2K39A 2IY1B 2LVOA 2DHKA 3A33B 1UGMA 4GOCA 2C7HA 4GDLB 2KX3A 4LDTB 3A98B 2O2VA 3F5RA 2AL3A 2LGDA 5J3YA 5IA7A 2N4FA 4DXAB 1Y19B 5EFXA 1YX6B 2DAFA 3TIXA 1HBKA 2RPQA 3L17A 2DKPA 4BFRA 1FAOA 2NCNA 1V5PA 1WGDA 2C5LC 3DOWA 1UD7A 1U29A 3V6EB 3PGEA 1GUAB 1DDMA 4PNKA 1MK7B 3FSSA 2DZJA 2BWFA 2WWZA 2DN6A 2DYOA 2D9ZA 3PSCA 2M1MA 2RGNB 2V3SA 1IRSA 4P7IA 2LWPA 2ADZA 2ROVA 2Y5BB 2HRJA 2GBRA 4OVVA 5IJMA 4K2PA 2DZMA 1PLSA 4KIKB 4EUTA 5FI1A 4MY6A 2KTRA 4TKNA 1J0WA 3V61A 3SD5A 1U2BA 1LW3A 3QARA 4A6KA 2NZ8B 3V6CB 4CYEA 2JZ3B 1YQBA 5BO4B 3LDZE 3ZO5B 1DDVA 4KAXB 4H8SA 1E7VA 1KM7A 2YRYA 2ZEQA 5CTRC 3ZVRA 4I6PA 1UBIA 2REXA 2D9WA 3TMPB 3U8ZA 4L6EA 1C1YB 2LG1A 4KDIC 1GNUA 2Z0OA 4MDKE 3U30A 3CMMB 1KLVA 3IVFA 2KHWB 1H4RA 1YX5B 5LONB 1EAZA 1T0YA 2RSUA 3WANA 3CXBB 2NBVB 3RT3B 2LD9A 2D11A 1XKEA 1TZ1A 1Q1OA 3DCGA 2LASA 1P3QU 2ELAA 2IO1B 2LRUA 3A8QA 4E74A 4ANXA 3C0RB 3TCAA 1IP9A 5AZGA 3VH4B 3JYUA 1E8WA 1YIWA 2L2IA 2MWSB 2EC1A 4TYZA 3SUZA 2IO0B 2KFKB 3R7RA 4IC7B 1WX8A 2ZPNA 2KUPA 4IM3A 5D6JB 2N9PC 4B6WA 1M94A 3D8EA 4DBBA 2M4NA 3ZUNA 4FLHA 1E8ZA 4AP4C 2RLOA 3SU8X 2NBUA 1ZM0A 2G3QB 3H7PB 3IFWB 4MSQB 2MFQA 3ZIMA 1P3RA 2DYNA 3L08A 1WIAA 2KNBA 3NS8A 1J0GA 5D3VA 1WYWB 4HJKA 4GZUA 4HK2A 3TO1A 1ZGUB 3M1IB 3KY9A 1B55A 3AI5A 2RSGA 1OGWA 4LJOB 2OQBA 1SIFA 1Q5WB 4HAYB 4I6LB 4F7UP 2KN5A 4MM3A 4W9JA 3R66C 1V5MA 1PMSA 4GN1A 3T8MA 4K7SA 4HAVB 1V6EA 5C23A 4XZ4A 2L76A 3M95A 3JSVB 2H7DA 2ZVNA 2WYQA 3NZSA 1X1GA 4NJ6A 3PSEB 3EC8A 3QK0A 3SDLC 2N7EA 1Q0WB 3ZRCA 1K5GB 2MW5A 1MAIA 3HW2B 3ODWA 2L8JA 4WWNA 4MGIE 2COPA 1X11A 2JY6A 2BKFA 2FCMA 1U4AA 2HTHA 2JUOA 3WAPA 3HK0A 4TUUA 3K9OB 5CX3A 2W9NA 2QHOA 4LDTD 1E5WA 1DDWA 3PVUA 1S3SG 2K8HA 1S1QB 1V9JA 2KX0A 3A9JA 3M62B 2PZ1A 2GBJA 2JXXA 4DBGA 2KWCA 2KQSA 3KUCB 2BYVE 2D3GA 3OAWA 4ICVA 2YT1A 4NY0A 2P0HA 3CF6E 1BTNA 4RM8A 2BYEA 3DDCB 4IM2A 3EFUA 4N9F4 4NAWB 1NU2A 1X05A 4F8CB 3A1QA 3ODOA 2NVUI 4DK5A 4MSMB 4MT7A 2JF5A 4EZKA 3H9DA 4E3CA 3VTWA 2M0XA 2JP2A 1I7AA 3DBLI 4G11A 3RCZA 3KRXA 1WE6A 2KWVB 1YD8U 3W1YA 4WQOB 1X1MA 2LXCA 3APDA 2RNRB 1J19A 2AYOB 2MCNB 4HAUB 5JHGA 4DHZB 3RD2A 5J3QA 1V86A 2BGFA 3P2BA 2CHXA 3RZWC 4KHOA 1WH3A 2YVCA 2JRHA 3ECIA 3VDZA 1KOTA 3ML9A 2KJRA 2LRWA 3CSTA 3N32A 4KZ0A 4IFSA 3IG3A 2MWNB 5DIFB 2VKIA 3VVWB 1KI1B 1N3HA 1EGXA 3DVGY 3KSYA 4A6FB 3HM3A 2K00A 2L0FA 4ANVA 1WM2A 4LCDE 2V4LA 4HCPB 3SHQA 3AXCA 4BOZB 1FB8A 3EECA 4IAPA 5JLJB 3QQ8B 3KVFB 4IM0A 1E7UA 5JHAA 4MJSB 4A3PA 1EF1A 1TQZA 4GDLA 2CS4A 4W9EA 3ZKJC 3PVWA 3WYFB 1Z5SB 3CSFA 2XK5B 2ZPYA 1SE9A 4JGHB 3X23A 3VFKA 4A3OA 4I6NB 4HDOA 4BBNF 2CU1A 5L95C 5GMVA 2MBEA 4W9FA 4TQ0A 2O6VA 1U5GA 4HB4B 3ZVVA 1WMHB 2RQ1A 3PEGA 1DROA 5L83A 5FI0A 3SV1A 4PS7A 4B9KA 2G45B 5KQ4A 5D27A 2OTXA 3JW0X 4HPMB 4GB9A 4BVUC 2EMSA 4DDID 3PPAA 3NOBA 5JZEB 3V62A 4B6HA 2KFJA 3PVLA 4KIKA 3BY4B 1L7YA 2LBBA 2LJ5A 5CHVC 2QKMA 1WY8A 1EVHA 2RVBB 3ZNHB 4K1RB 2N7DA 4C0AA 1SGHA 1YJ1A 2RUKB 1UNPA 4PYZA 2Y8FA 2DFKA 4DX90 2KJ6A 1OTRB 1RFAA 4E71A 1I35A 4IG7B 2K1FA 2L0TA 4MH0E 3A4SC 1P0RA 4W9IA 4EMOA 2LVPA 2KC2A 1FGZA 3UQBA 4GGQA 2JT4B 2IO2B 2LI5A 3PT2B 3H7SA 4PS3A 3VH3B 3DVGX 2J7QB 1WX9A 2LUEA 2KQ7A 5D7GA 1WGRA 3W1SC 3GOEA 3B0AA 2K6DB 4AUQC 4FJVB 5DHFB 5JH5C 3BINA 1WGGA 4IUMB 1V5TA 2IFSA 3ODXA 2JRIB 3TL5A 4HB2B 1V5UA 1ZSQA 2KTFA 3SNHA 2KFKA 1UPRA 3ZRFA 1MG8A 5KHQA 3UIPB 4AOFA 1OY2A 3DBSA 1J8CA 2W2XC 2KMCA 3VOQA 1P1AA 3H7PA 1UPQA 1QZEA 1JRUA 2MQJA 2V1YA 2MSED 3VTUA 3RULA 2CB8A 2R09A 2NMBA 2N23A 3B1LX 2COAA 1FOEA 3DXDA 1FHXA 3TW1A 2JZZA 1X86A 2UZSA 4KVGB 5E6NA 4F7ZA 4IW0A 4DHJB 4G0NB 2MP2B 1NDDA 3AJ4A 5CLLB 2JWZA 3K9PB 2KDBA 1WRDB 3T9LA 4W9HA 2FDQA 1LXDA 5HE1A 2P8VA 1WGHA 1EO6A 4FULA 3UF8A 3RZFA 3QAQA 2Z0QA 4GXBA 2COFA 5J3TA 1WI0A 2R2OA 3RUIB 1HB8A 1UBQA 2ZZPB 2DX1A 4TV3A 1X1FA 3BJIA 4A20A 1VD2A 1UH6A 2KXJA 3KH0A 1OMWA 2YF0A 3VIAA 5HKHA 1TGZB 2MA9B 5D3YA 4IWOA 1ACAA 3FLVA 2FCSA 1P6SA 2AL6A 1WXVA 4DX8A 2CQUA 1WX7A 3KUZA 1E8YA 1U5FA 5D94A 1G6JA 1IPGA 1BAKA 1WGUA 2D9XA 2MBBB 3UQAA 3QWZB 1CMXB 5C5BB 3ZDTA 2ZVOA 4NAWA 4NSWA 4WJPA 2Y8GA 3U7DA 5TR5A 5IAAC 1H8CA 3PV1A 3CIKA 4DHZE 2VSZA 5C6RA 1NTYA 2YS5A 2LKOA 3PP2A 5CHFA 4F7HA 2GBMA 2MRPA 2XEWA 3I3TB 1I2HA 5DPRA 2WX1A 1AWEA 1TJ6A 4WSFA 5KCVA 1RJ2A 2IZVB 1MPHA 1Z87A 3OJ3A 2H7EA 4BOSC 4WJ7A 3DBHI 5C79A 2FJLA 4LJPB 2DKQA 4NNJB 4HLEA 4A6HA 2DHJA 3N30A 4F7GA 3UGBB 1ISNA 3L13A 3DQVA 3TJPA 5JHBA 3IBEA 4XWXA 4PYUA 3QHTA 4FADA 4GMVA 4XX5A 3UIOB 2LVQA 2G4DB 1XR0B 4W9GA 4W9KA 1ST7A 1VCBA 2YS3A 2KVRA 3ZTCA 2YT0A 3VTVA 2HTHB 4BKSD 3D8DA 1V61A 3ZNZB 4A6FA 3PLUA 3QCAA 3MHSD 2CHWA 3O96A 1WJ6A 3QIJA 1V2YA 3ULBA 1WR6E 3L0WB 2L7RA 1R4NI 3PRPB 3NY5A 1E90A 1R4MI 4GDKB 2D2QA 3T06A 3L10B 2I1JA 2DA0A 4CHJA 2DZKA 2RGFA 4II2B 4MEMA 4X57B 2NPTB 3ALBA 4OVUA 2Z0EB 2BF8B 2RD0A 4EKUA 4MJSA 3V60A 5DPTA 1P9DU 4EOYA 2Y7BA 3AULA 2DX5B 2C7MB 2XK5A 2FJ9A 4HCNB 3ZDMC 2LZ6A 3NSUA 4FBJB 3DPDA 3R3MA 1V81A 2RR9A 4D0NB 3ZW3A 1WMHA 4KSLC 3PREA 2K8CA 1WJUA 2L05A 1I42A 3PLVA 2AWTA 5DCNA 1OEYA 5DH9B 1OQNA 1NVLA 1FHOA 2LGXA 4ICUA 2A5UA 1AQCA 2R2QA 3ONSA 4NJ7A 1Y8RC 3ZTDA 2EJ8A 3L16A 3A4RA 3APFA 2IBIB 1BTKA 4EZJA 2DYBA 2L00B 4HPLB 2BWES 2KGXB 2E2XA 3MTNB 1WZ3A 4DHJD 3KYCD 1WGQA 3A9KB 2KKCA 2K6QA 2N1VA 1Q67A 4K17A 3QBVB 1OEYJ 1UEFA 1UNQA 2D4QA 4KHAA 3KRWA 4WJOA 5GOWB 5KHOA 2ZCBA 3G9WA 4WJQA 3N7CA 4HHVA 3Q3JA 2CY4A 2L1CA 5G55A 2C9WB 3IHPC 4Y94A 2KDEB 4K81A 4CHMA 2N0YA 1WXMA 2K25A 2DENB 1BWNA 1DBHA 5KQ1A 4WJNA 5AZHA 2BKRB 2VRWB 3DVNV 5D2MB 4W9LA 3AU5A 1F9JA 2VRRB 4BKSA 3VAWA 4M0WB 4NPNA 3OANA 2DHZA 2PJHA 4MK0A 5DI9B 2KD0A 1L2NA 1RRBA 2KDIA 3VUYA 2OOBB 4J6IA 3UINB 4KZCA 1WFYA 3KUDB 4URKA 4FHKA 4JQWC 3PZDA 1QQGA 3QJZA 1GJZA 1XT9B 2NS5A 4GU2A 2CKHB 3WA0A 2C60A 2D9YA 2O6VB 4WWPA 3Q3FA 2DYQA 2JPHA 4W9CA 2DLWA 3ZLZA 2GJYA 2C7NB 2D07B 2PE6B 1NTVA 5J17A 5LXIB 4EJNA 4EEWA 1AARA 1V88A 2KLCA 4CO7A 1U27A 5LXHA 2WX0A 1ZVRA 4DWFA 3VHTC 1WZ0A 2MKRA 3D32A 1EF5A 5DHAB 4AJWA 1XD4A 5DPWA 5LLIA 3WALA 4RMAA 2LYDA 1LQBA 4ZRJA 2O2VB 4HDQA 4BKTA 2W2XD 1WG7A 5FR6A 3PRZA 3KZ1A 3P6AA 1LFDA 2X18A 3DBRI 3O65B 3OJ4B 4BKGA 4HATB 4K7UA 3WAOA 3FEHA 2N9EB 3QA8A 5DPSA 2LOZA 2DZIA 1M7RA 3PS6A 4ANUA 4ZDVA 3SYXA 4MGKE 1Z2MA 2MP2A 1Y5OA 3LJ3A 1V5OA 2NBWB 4TQ1A
chains in the Genus database with same CATH superfamily
2WXFA 1P98A 1PDXA 3OG5A 3U52E 4MGZE 1GGOA 4FA6A 1V49A 1D3ZA 2OEDA 2R2YA 1FXTB 2R0DA 2YS1A 1RRPB 4AJYB 1IYFA 2LGYA 3UZTA 2DAJA 3HUIA 2W55A 1V80A 1OQYA 1ZP0B 2KJHB 3MPXA 4XYCA 4KGTA 4C7ZA 2MDXA 3R7QA 1NI2A 1K5DB 1D4BA 3DVNU 1MIXA 2UYZB 1K52A 3J9CA 1JWAD 3FVCA 4PS8A 3LB8C 4K2OA 2WDTB 1Y56A 3DXCA 1PGXA 2KTRB 3A8PA 2MJDA 5C16A 1DOXA 5AUIA 1NEKB 2GMIC 2KC1A 2MLBA 3QC8B 1MKEA 2LFIA 4W9DA 4M8MA 3B08A 2PPHA 3U12A 1PFJA 3LYYA 4YSYB 3X0WA 1WF9A 4A5KA 4WAAA 1F1HA 4WWMA 4ARIA 4FXCA 2FIFA 2FNJB 1P5TA 3PG7A 1U5EA 3M63B 3TVVA 3QX1A 3NJTA 4B95A 2K2JA 1M7EA 3KW5B 2IY0B 1YJIA 2QKLA 3N9YC 4KHBB 1WR1A 1RLFA 2GRIA 3IT4B 4WWOA 4LNFA 2NR2A 2ABDA 1V89A 1C3TA 2KIEA 3RNEC 4GPTB 3JSVA 5JHHA 1AYFA 1EU3A 3ULCA 2KOXA 1KLGD 1WWTA 4LNOA 1TS4A 3ZXVA 2ELBA 3PHXB 3VUWA 3W1SA 2HE7A 3RN9C 1JCKB 1XCQL 2Z0DB 2ZJDA 2N1WA 2OJWA 1HXYD 2J0KA 5L81A 2JXTA 5C5BA 2G1EA 2XNAC 3VUXA 3BWUD 2KMAA 4YONA 2HD5B 3ENBA 1UZXB 3KYDD 2YSZA 4JIOU 2BS3B 2GS0A 1WXQA 2LHEA 2W3RA 1FNWA 3SBGA 3RNGC 3NZUA 1ZC4B 2M17A 3MDBC 2FCQA 4FJZA 3DXEA 4YL8A 1LO5D 4KDLB 3LJUX 1D5XC 3HVZA 2COCA 2UZRA 4G50A 5E6PA 4HAWB 4NQKE 4DQOC 1SBBB 2BPSA 1WI1A 2PEAA 4WIPA 2CY5A 2MBQA 2MX2A 3B9JA 2LULA 1HB6A 1YQ4B 4GIVA 1FFVA 3AN1A 2M38A 4WVFB 1MHHE 1HE8A 4Z2MB 1XLPA 4G3XB 2PW9A 3W5UB 3PZ7A 1ZKHA 2G4SA 5AZFA 4R3DA 1N5XA 2N9XA 4HB0B 2AX5A 1E9MA 2IGGA 2CRFA 4EFOA 2DHIA 5C3JB 5D3XA 3AU4A 3PRMB 2AQ2B 1GC7A 1L0VB 3AM9A 5EDSA 2DYMA 2KZRA 2WXRA 1VZ6A 2HJ1A 3MFGA 3NWFA 1JDEA 4K7WA 3ZNID 2KANA 2J0MA 3DHGC 1WXSA 4YWGG 3BYYB 3PZ8A 1H10A 3NHEB 1RAXA 2G35A 2BS2B 3HM6X 1FM0D 2EELA 5G2NA 3PTFC 3EHVA 1XQQA 4RM9A 3D8FA 3HHMA 4JLCA 2P0DA 3OLMD 2IO3B 3Q2AC 3A58A 1PQSA 2I1KA 1HZ5A 2K8BA 2W2WA 4GMXB 2DTCA 3B77A 1WXAA 1I4QA 2JSVX 1ZC3B 1TT5B 3ZYYX 4JKHA 4JK9A 2PE9A 3VQIA 1ESFA 4MELA 1WJNA 2M8SA 1WJ1A 3FC4A 2K8EA 3Q8EA 3U2SC 1LB1A 4IWQA 4ZYNA 1ZYIA 4XC2A 2XBBC 1GG3A 2FUHB 4GDKA 5C1ZA 1XD3B 3N3KB 2P0FA 4K3CA 2IGDA 4KV2A 4IOIE 1GC6A 2AEHA 4B0EA 2HJ8A 1T6BX 1FIQA 2NPTA 2EMTA 1XF5L 3FM8C 1DYNA 3FP5A 1SF0A 4PQ0A 2KDMA 3B2GA 2O6VD 1MI0A 1EU4A 4C7YA 2I5FA 4ASWC 2ZNVC 2D9VA 4WURA 5HI1A 2DX5A 4M8NA 1QILA 2KLGA 1W1GA 3GS2A 3V5WA 3Q6BA 1K8RB 1FPYA 2IYBA 1SHCA 2Y3AA 4HAZB 3GZNI 3ZGZA 1EUVB 2I5CA 1ZDVA 2FCNA 4OZBA 2KCJA 2GBNA 2BCJA 2GBKA 2JYTA 3ZXRA 3S2AA 2N7JA 3FKYA 3L54A 3TSSA 4DDGD 2ZCCA 3H1UA 1OQQA 4HXDA 2VZKB 2CHZA 3GZNB 3HIZA 2MBOA 2ROZB 2KT7A 4OZCA 2KAJA 2GOWA 1WJ4A 3TFMA 2EKEC 1WGYA 2BYFA 1QC6A 3GYPA 1FHWA 1OQRA 2M14A 4GLSC 2ICIA 3ZNGC 2QIEB 3A9JB 3QWMA 2E6XA 1W1HA 1MIZB 4YXDB 5IN7A 4F1SA 2N9KA 4UDUC 1A5RA 1XCGA 3FILA 2IYDB 2J59M 5CLQB 4GSWA 2UVMA 3RCPA 4KSKC 1LM8B 1MK9B 2IJ0A 3DBLB 1QOGA 2JVCA 1XX0A 3ML8A 4ZRKA 5HE2A 2KWUB 2MEKA 3NVWA 2WNMA 2WH5A 2Q5WD 2GCLA 1WM3A 1KZ7A 2J0JA 4K3BA 2D10A 3MJWA 2WXHA 4NAMA 1ZE3D 4YT0B 4JX1C 5IKCM 3A9KA 1E6EB 4FN2A 1T0SC 1KRHA 3HRDD 3A1QB 4ANWA 3H6NA 1W1DA 2LXAA 4ILHA 2PVOD 2LGIA 2WP9B 5JP4A 2QMTA 4FHJA 1N6ZA 1BT0A 3VXWA 1UELA 2Z59B 3F0WA 3N1XC 1NBFC 3N1ZC 4MGYE 5HE3A 1NTIA 5BYSA 2LOXA 4II3B 4JL9A 1IBXB 3GYOA 1UNRA 3APCA 2OJRA 1WVHA 3NWAA 1ZW7A 3R2TA 3EUB2 1JRPA 1SE4A 3NZ3A 4AWJA 2V76A 2YT2A 1JWUD 3PHWB 4HB3B 1TS2A 1SSNA 4NQLB 4LNNA 1F52A 1DYQA 3WCQA 4A90A 2IGHA 4A6QA 1D5MC 3WIMA 5J18A 4CHKA 3JVZX 3AECB 1F77A 1YJJA 2I38A 1TTNA 3U4EG 1U5DA 4ZRIA 2UWQA 2MH7A 4Z2NA 4FJYA 2MBHA 5D3WA 3HQCA 4XDCA 2XQNM 2A4ZA 2WS3B 4HAXB 4M0WA 2CAYA 2CODA 2KK8A 5LOPB 2B3AA 4IWPA 4DXFA 1FGYA 2KO3A 4BBNC 2Z0PA 1L0XB 4HWIB 4IOYX 5E6OA 3M3JA 1TXDA 2ASQA 1E8XA 4C4VB 5J2RA 2K2UA 3KQ4A 3RYTA 1EWCA 5HFYA 1XODA 3W2DA 3AE6B 1UF0A 2Q13A 3HSAA 2L3ZA 5BMGA 2YLMA 4YSZB 5HE0A 1KJTA 2WU5B 1TBEA 2KDFB 4YTMB 1JQ4A 5AEKB 3EPYA 4HVBA 3WAMA 1WJMA 2FIDA 2V4IB 3TBLD 3ML4A 5CHWA 3HIEA 3AE4B 4BBKA 2FUG1 3Q3MC 2CR5A 1KZGA 3SO6A 3P7ZA 4EZLA 2FAZA 3ENEA 3C8YA 2GCJA 2ZNVB 5JVLA 1WE7A 2K39A 3AEDB 3BIID 3Q14C 2IY1B 1KF6B 2LVOA 2DHKA 3A33B 4P16A 1UGMA 4WAFA 4GOCA 4B0MA 2C7HA 1F2RC 3ZJTA 4JKGB 3BVGA 4GDLB 5G5GA 2KX3A 1SE2A 4LDTB 3A98B 2O2VA 1OFFA 3F5RA 2AL3A 2LGDA 5M4YB 5J3YA 1FFUA 5IA7A 2D3CA 2KVZA 2N4FA 4DXAB 2CU3A 2L52A 4ZOHC 1Y19B 5EFXA 1VLBA 5BMHA 1YX6B 2DAFA 3TIXA 1HBKA 2RPQA 3L17A 3Q69A 3RNBC 2FJUB 2DKPA 2DBYA 4BFRA 3TEZA 2JWUA 1FAOA 2NCNA 1V5PA 4CSQA 2C5LC 1WGDA 2Z8LA 3DOWA 1UD7A 1U29A 3V6EB 3PGEA 1TY0A 1GUAB 1DDMA 4PNKA 1UWXA 1MK7B 1AN8A 4XE0A 3FSSA 3BK1A 2WXIA 1ROEA 1HA5A 2YEPB 1IGDA 2DZJA 3IXSA 2IDYA 2BWFA 3IAM1 2TSSA 2WWZA 3RPFC 2DN6A 4WQMA 4QAYA 2ZW1A 2DYOA 1TS3A 2D9ZA 1V1PB 5C2TB 3PSCA 2M1MA 2RGNB 2V3SA 3KLSX 3BVZA 1IRSA 4RGOS 4P7IA 2LWPA 2ADZA 3Q8AA 1L6VA 1V97A 2ROVA 2Y5BB 4ITKA 2HRJA 2GBRA 4LK0M 4OVVA 5IJMA 4K2PA 3N1YC 2DZMA 1B9RA 1PLSA 4KIKB 2JX5A 4EUTA 5FI1A 4MY6A 2KTRA 3L4PA 4TKNA 1AW7A 1J0WA 3V61A 3SD5A 2WXJA 1U2BA 1LW3A 3QARA 4M00A 5JXVA 4A6KA 3IT6B 2RPVA 2NZ8B 1BUIC 3RNCC 2AQ1B 3V6CB 4CYEA 2JZ3B 2PTLA 3NW8A 1YQBA 4RH6A 2UU7A 5BO4B 4A55A 1JALA 3LDZE 3ZO5B 1DDVA 4KAXB 4H8SA 1E7VA 1HZ6A 1KM7A 2YRYA 2KWDA 2ZEQA 5CTRC 3ZVRA 4KHBA 4I6PA 1ACCA 4AQ7A 1UBIA 2REXA 2D9WA 3TMPB 1GB1A 2W54A 2PMVA 3U8ZA 2RRFA 2VZKD 4L6EA 1NENB 1C1YB 4ACFA 2LG1A 1UWMA 4KDIC 1GNUA 2Z0OA 3W5VB 2X38A 4MDKE 3U30A 3CMMB 4REZA 1KLVA 5EE0A 3IVFA 2KHWB 1H4RA 3RNAC 1YX5B 5LONB 1EAZA 3V3XA 1T0YA 2RSUA 4RFBA 4EE2A 3WANA 3CXBB 1T5XD 2NBVB 3RT3B 2LD9A 2D11A 1XKEA 1TZ1A 1Q1OA 3DCGA 2LASA 1P3QU 4OVZA 2ELAA 5GXGB 2IO1B 2LRUA 4JPSA 3A8QA 2M0AA 4JKCA 4E74A 4ANXA 1JMLA 3C0RB 2WDRB 3R2IA 3TCAA 1HEZE 1IP9A 5AZGA 3VH4B 4CQNA 3JYUA 1E8WA 3URYA 1YIWA 2L2IA 1DOIA 1N63A 2K49A 2M19A 2MWSB 2EC1A 4MT5A 2RDGA 4TYZA 2EKIA 3SUZA 2IO0B 1C78A 2KFKB 3SFDB 2WQYB 3R7RA 4IC7B 1WX8A 3AEFB 2ZPNA 2KUPA 4IM3A 5D6JB 1TJEA 2N9PC 1ZXHA 1E7PB 4B6WA 1M94A 3D8EA 4DBBA 2JU6X 2M4NA 3ZUNA 1FMAD 3Q3NC 1E8ZA 4FLHA 4AP4C 4NJCA 2RLOA 1TKEA 3SU8X 4RGTA 2NBUA 1ZM0A 2G3QB 3H7PB 1FEHA 2H88B 3IFWB 4MSQB 1NI3A 2MFQA 3NG0A 3ZIMA 3E9SA 1DIKA 4IDIA 1P3RA 2DYNA 3L08A 4ZHPA 3SFEB 3AE3B 1WIAA 2KNBA 3NS8A 1J0GA 4S17A 1GPXA 1ET6A 5D3VA 1WYWB 4HJKA 4GZUA 4HK2A 3TO1A 1ZGUB 3M1IB 3KY9A 1B55A 1IUEA 2WXGA 3E66A 3AI5A 2RSGA 1OGWA 4LJOB 3RI7C 1VJKA 2OQBA 1UUPA 1SIFA 1Q5WB 4HAYB 1I4PA 4I6LB 4F7UP 2KN5A 4MM3A 3GP7A 2LGSA 2KIGA 2PIAA 4W9JA 3R66C 1T77A 5FR3A 1V5MA 4ILJA 1SJHD 1PMSA 4GN1A 4O1NA 4XWWA 2V0GA 3T8MA 4K7SA 3VR8B 4HAVB 1V6EA 2BYTA 5C23A 1F0ZA 2INDC 1XLQA 4XZ4A 4JE3B 3NWDA 1EWYC 2L76A 2NTSA 3RFZB 3ZJVA 3M95A 1FNVA 3JSVB 2H7DA 2ZVNA 2WYQA 3NZSA 1X1GA 1J7AA 2Z4DA 4NJ6A 4QXAB 3PSEB 1VZ7A 3EC8A 3QK0A 3SDLC 2N7EA 1Q0WB 1YNTE 1QOFA 1ZDXA 3ZRCA 1K5GB 2KQ4X 2MW5A 1MAIA 1I4HA 3HW2B 3ODWA 1SB3C 2L8JA 4WWNA 4MGIE 1RM6C 4HSIA 1CK1A 2COPA 1X11A 2JY6A 2BKFA 2FCMA 1U4AA 1PFDA 4RGMA 4USAA 2HTHA 2JUOA 3WAPA 3HK0A 4TUUA 3K9OB 1T0QC 5CX3A 2W9NA 1TKGA 2KUQA 1K53A 2QHOA 4LDTD 1E5WA 3Q8FA 3E9PA 1DDWA 3PVUA 4RNAA 1S3SG 4KX6B 2K8HA 5EE1A 1S1QB 3SR6A 1V9JA 2KX0A 3A9JA 3M62B 2PZ1A 2GBJA 2JXXA 4DBGA 2MHJA 5IRSA 2KWCA 2KQSA 1TY2A 4M02A 3KUCB 2BYVE 1XXGA 2D3GA 2R61A 3NUHB 3E56A 2WXNA 3OAWA 4ICVA 3P4RB 2Z14A 2YT1A 4JK8A 1K50A 4NY0A 4OSNA 2DNFA 2P0HA 3CF6E 4L23A 1BTNA 1V1OA 4RM8A 2BYEA 2SEBD 3DDCB 4IM2A 3EFUA 4N9F4 4NAWB 1NU2A 1X05A 4F8CB 1KTKA 4ARCA 3A1QA 3ODOA 2NVUI 4DK5A 4MSMB 4MT7A 2JF5A 4M01A 4PK1A 4EZKA 2FBWB 3TEXA 2JYEA 3H9DA 1C77A 1QKZA 2Z59A 2PVGC 2KACA 3NVVA 4E3CA 3I63C 3VTWA 2M0XA 1KFYB 2VH2A 2JP2A 1I7AA 3DBLI 1QQRA 3ABVB 4G11A 2LEKA 2D5GA 3RCZA 3IAS1 2JZPA 3KRXA 1WE6A 2RDHA 2KWVB 1YD8U 3W1YA 4WQOB 1JROA 1X1MA 3ZQ4A 2QDFA 1FO4A 2LXCA 3OHMB 3APDA 2GLSA 2RNRB 1J19A 4S0RA 2AYOB 4HJGE 4DIXA 2MCNB 4HAUB 5JHGA 1C9FA 4RF1A 4DHZB 3RD2A 3AB5A 2YEPF 5J3QA 1V86A 2BGFA 3P2BA 2CHXA 3RZWC 2L1AA 4GOUA 4KHOA 1WH3A 1N62A 2BT6A 2YVCA 3AEEB 1MVKA 2JRHA 3ECIA 3VDZA 1KOTA 1TYGB 2XN9C 3ML9A 2KJRA 2LRWA 2OHFA 3FAHA 4C4VA 4LLGM 4C80A 3CSTA 3N32A 4KZ0A 4IFSA 3AE5B 4ZYSA 3IG3A 4ILGB 2MWNB 5DIFB 2VKIA 3VVWB 4QJ5B 1KI1B 2K3UA 1N3HA 1EGXA 3DVGY 3MJ5A 4P6VF 4JKBA 3KSYA 4A6FB 4LNIA 1MHXA 1D6EC 2K00A 1TZOA 3HM3A 2L0FA 4ANVA 1WM2A 3AV8A 4LCDE 2V4LA 4JKEA 4HCPB 3SHQA 2V3PA 3AXCA 2ZKMX 5FKAC 4BOZB 3AMZA 1FB8A 3EECA 1ZOYB 4KGRA 4IAPA 4LNKA 5JLJB 3QQ8B 3KVFB 2RMMA 2HTME 2NTTA 1E7UA 1PGAA 1RFKA 1TKYA 4IM0A 5JHAA 4MJSB 1DOYA 4A3PA 1EF1A 1HQRD 1TQZA 4JKGA 4GDLA 2CS4A 2JQRB 4W9EA 3ZKJC 3PVWA 1YN4A 3WYFB 5I2MA 1Z5SB 2X0SA 2LUMA 3CSFA 4HRSA 2XK5B 2ZPYA 1SE9A 3I5JC 4RCOA 4JGHB 3X23A 1B1ZA 3P4SB 3VFKA 4A3OA 4Q2JA 4I6NB 2HDEA 1SXTA 4HDOA 4BBNF 1FXAA 2CU1A 4HROA 5L95C 2RDBC 5GMVA 1CZPA 2BQQA 4IKGA 2MBEA 4W9FA 1YMHE 2O6VA 4JKAA 4TQ0A 4JWUC 1KBLA 1U5GA 4HB4B 1QOAA 2J53A 1WMHB 2RQ1A 3PEGA 1DROA 3ZVVA 5L83A 3T3OA 5FI0A 3SV1A 5G5HA 4PS7A 4B9KA 2G45B 5KQ4A 2NMQA 1FCCC 5D27A 2IPKD 2OTXA 3RNFC 1MFWA 1GOZA 4JKFA 3JW0X 1LGRA 4HPMB 4GB9A 4BVUC 2EMSA 1QF6A 1C76A 2GB1A 2QSDA 4DDID 1YOVB 3NOBA 3PPAA 5JZEB 3V62A 4B6HA 2KFJA 3PVLA 1E10A 4JK7A 4ZRQA 3BVMA 4KIKA 3BY4B 1MJDA 1L6UA 1L7YA 4NZLB 2LBBA 2LJ5A 5CHVC 2QKMA 1WY8A 1EVHA 2Y5CA 2RVBB 3ZNHB 4K1RB 1FD6A 2N7DA 4C0AA 1SGHA 1YJ1A 2WU2B 2INCC 2BTEA 2RUKB 4OT1A 1UNPA 3AEAB 4PYZA 2Y8FA 2DFKA 4YSXB 4DX90 2KJ6A 1OTRB 1RFAA 4E71A 3P1MA 1L0YB 4YTNB 4IG7B 1I35A 4JKDA 2K1FA 3GB1A 2L0TA 2J4XA 4MH0E 2B76B 1QOBA 3A4SC 5FK9C 1P0RA 4W9IA 2BBCA 4EMOA 5EE9A 1N61A 2LVPA 3AEBB 2X8XX 2KC2A 2V9HA 1FGZA 3UQBA 4GGQA 1VBHA 2JT4B 2IO2B 4H2AA 2LI5A 3I9V1 2ACZB 4BAXA 3NVYA 1YQ3B 3PT2B 1BXTA 2BW2A 3H7SA 4PS3A 3OWEB 2BB6A 3T3NA 3P42A 3VH3B 3DVGX 2J7QB 1WX9A 2LUEA 3VRBB 1ZUD2 2KQ7A 5D7GA 2NBVA 1WGRA 1XEEA 3GOEA 3W1SC 2ON8A 3CIRB 1I4XA 2K6DB 3B0AA 1PGBA 4AUQC 4FJVB 5DHFB 4RF0A 5E6JA 5JH5C 1NYQA 3BINA 3DCXA 1WGGA 4IUMB 1V5TA 2IFSA 3ODXA 3MC0B 2JRIB 3TL5A 2J42A 2WXOA 1RWSA 4HB2B 1WGKA 1V5UA 1ZSQA 5T8IA 4MACA 3SEBA 5TSSA 5HHDG 2M56B 2KTFA 1HTQA 3SNHA 2KFKA 3RMKC 1UPRA 4QJ3B 3ZRFA 1D5ZC 1MG8A 5KHQA 1GB4A 3UIPB 4AOFA 1OY2A 3DBSA 1J8CA 4TSSA 2W2XC 2KMCA 5AUKA 3VOQA 1P1AA 1NVID 5BYQA 1SEBD 3H7PA 3B2FA 1UPQA 1QZEA 1JRUA 3NVZA 2MQJA 1DGJA 2V1YA 1JWMD 2MSED 3VTUA 3BK2A 4JWSC 3RULA 4US8A 2CB8A 2I2YA 2R09A 2NMBA 2N23A 4PT5A 1P7EA 3B1LX 1J7CA 2COAA 1FOEA 3DXDA 3MHZA 4MH8A 1FHXA 3TW1A 3U7ZA 3ZJUA 1K51A 2JZZA 1F2RI 1X86A 2UZSA 4KVGB 5E6NA 4YTPB 4F7ZA 4IW0A 4DHJB 4G0NB 5I2SA 1RYJA 4D6WA 2MP2B 1NDDA 3AJ4A 5CLLB 2JWZA 3K9PB 4TMAB 2KDBA 1WRDB 3T9LA 4W9HA 1C79A 2FDQA 1V8CA 1LXDA 5HE1A 4D2KA 2P8VA 1WGHA 1EO6A 1XLNA 4FULA 3UF8A 1XCTL 1XO3A 3RZFA 3QAQA 1FCLA 1ZPSA 4N58A 2Z0QA 4GXBA 3DWMA 4P1BC 1VR9A 1CQVA 2COFA 4HPPA 5J3TA 1WI0A 2R2OA 1C4CA 3RUIB 1HB8A 1UBQA 2ZZPB 2DX1A 2MJ3A 1X1FA 4TV3A 2QCZA 1BMLC 2D3BA 3BJIA 3AH7A 5H8YE 4A20A 1VD2A 1UH6A 3H8HA 2KXJA 3KH0A 1SE3A 1OMWA 2YF0A 3VIAA 2QC8A 5HKHA 2MJEA 1TGZB 2MA9B 5D3YA 4IWOA 3W9CB 1ACAA 3FLVA 2FCSA 1P6SA 2KYWA 2AL6A 2DIKA 1WXVA 4DX8A 2CQUA 1WX7A 3AE9B 3KUZA 4OW0A 1E8YA 1U5FA 5D94A 1G6JA 3NRZA 2KN4A 1IPGA 1BAKA 1WGUA 2D9XA 2MBBB 4N59A 3UQAA 3QWZB 2SAKA 1CMXB 1EM7A 5C5BB 1C4PA 4QJ4B 3ZDTA 2ZVOA 4NAWA 4NSWA 2W82A 3EFCA 4WJPA 2Y8GA 3U7DA 3MC8A 4RGNA 2CJOA 5TR5A 5IAAC 1H8CA 3PV1A 2K9XA 1UNSA 3KWLA 3CIKA 1MG4A 4DHZE 1N5WA 2VSZA 4HKZE 2WDQB 2Y5PA 5C6RA 1KH0A 1NTYA 2YS5A 1VDVA 2LKOA 3PP2A 5CHFA 4F7HA 2GBMA 2MRPA 2J52A 2XEWA 3BZDB 3I3TB 1I2HA 5DPRA 2WX1A 1AWEA 1TJ6A 4WSFA 5KCVA 3TEYA 4MM3B 1RJ2A 2IZVB 1MPHA 1Z87A 3OJ3A 2H7EA 4BOSC 1ET9A 1YN3A 2WXQA 4WJ7A 3Q3OC 3DBHI 5C79A 1M4VA 2FJLA 4LJPB 2DKQA 4BZAA 4NNJB 4HLEA 4A6HA 2W3SA 2DHJA 3N30A 4DXGA 4F7GA 3UGBB 3DBHB 5D3DA 1ISNA 4OZAA 3L13A 2INPE 2ZW0A 3DQVA 3TJPA 5JHBA 3IBEA 2Z13A 4XWXA 4PYUA 1YN5A 2K22A 1GAQB 3QHTA 2WXMA 4FADA 4GMVA 4XX5A 4ZRPA 3UIOB 1J7BA 2LVQA 3UI3A 2G4DB 5D3IB 3EA6A 1XR0B 4GNKB 4W9GA 4W9KA 3BYTB 1ST7A 4WH4A 1HTOA 1IBXA 1VCBA 1AWDA 1WRIA 4A8XC 2YS3A 2KVRA 1R7SA 3ZTCA 2YT0A 3VTVA 2HTHB 4BKSD 3D8DA 2PLPA 3MP9A 4XWTA 1V61A 3ZNZB 4A6FA 3PLUA 2KMMA 3AEGB 3MHSD 3QCAA 2CHWA 3O96A 1WJ6A 3MC9A 3QIJA 1V2YA 3ULBA 1WR6E 3L0WB 5BYRA 2DWQA 2L7RA 1R4NI 3CWIA 3PRPB 3GE8C 3NY5A 1E90A 1R4MI 4GDKB 2K5PA 1TS5A 2D2QA 3T06A 1FRRA 3L10B 3EGRA 2I1JA 4XGAB 2DA0A 4CHJA 1R4NB 2DZKA 2RGFA 4II2B 4MEMA 4X57B 2NPTB 1UGJA 3ALBA 5BMIA 4LTUA 4OVUA 1R4MB 4P1CC 2PKOA 3I57A 3P63A 2Z0EB 2BF8B 2RD0A 4EKUA 4MJSA 3DHHC 3V60A 5DPTA 3PO0A 1P9DU 4EOYA 3KWVA 2Y7BA 2QEJC 1MI1A 1XLOA 5I4DA 3AULA 1T0RC 1MPEA 2DX5B 1I4RA 2C7MB 5MPOA 2BS4B 2L32A 2XK5A 2FJ9A 4HCNB 3ZDMC 3P4PB 2LZ6A 3NSUA 5IOIA 2K0PA 4FBJB 1FRDA 3DPDA 3R3MA 2CJNA 1V81A 1L4ZB 2RR9A 3VRAB 4KKJA 4D0NB 2AQ3B 3ZW3A 2INNE 3LXFA 1WMHA 3DWGC 4KSLC 3PREA 2K8CA 1WJUA 2L05A 1I42A 3PLVA 3P4QB 2AWTA 2GI9A 1C4AA 1I7HA 2LJIA 5DCNA 1OEYA 5DH9B 1OQNA 1JWSD 3FILB 1NVLA 1FHOA 2LGXA 4ICUA 2A5UA 1AQCA 2R2QA 3ONSA 4KKIA 2BVCA 4A9AA 4NJ7A 2LHDA 1Y8RC 3ZTDA 2FE8A 2EJ8A 3L16A 3A4RA 2E3TA 3APFA 2IBIB 4N6EB 1BTKA 4EZJA 2DYBA 2L00B 2WDVB 3NS1A 2BWES 4HPLB 2KGXB 1N60A 2WXLA 2E2XA 1ENFA 3MTNB 1WZ3A 4DHJD 1JW9D 4US9A 3KYCD 4L2YA 1WGQA 3A9KB 2KKCA 2K6QA 2LMCA 2N1VA 2VH1A 1Q67A 2N9LA 4K17A 3QBVB 1OEYJ 4HEA1 1UEFA 1UNQA 2D4QA 4KHAA 3KRWA 1L5PA 4WJOA 5GOWB 5KHOA 2ZCBA 3G9WA 4WJQA 3N7CA 4HHVA 1STEA 3Q3JA 1TIFA 2CY4A 2L1CA 5G55A 1FXIA 2G9HD 1PUTA 3N20C 2C9WB 3IHPC 5HG2A 4Y94A 2KDEB 4K81A 2R82A 4CHMA 3DHIC 1V1PA 3C19A 2N0YA 1WXMA 2K25A 2WLBA 2DENB 1BWNA 2BB5A 1DBHA 3E9OA 5KQ1A 4WJNA 1VZ8A 2BKRB 1WYGA 5AZHA 2VRWB 4L1RA 1I4GA 3DVNV 5D2MB 3TUOA 1P7FA 4W9LA 1WSPA 3R8BA 3AU5A 1CJEA 2QILA 4L1BA 4XDDA 1F9JA 2VRRB 4AS1A 4BKSA 1PYWD 1NYRA 3VAWA 1Q10A 2H89B 4M0WB 4NPNA 3OANA 2DHZA 2PJHA 4MK0A 3V05A 2ONQA 5DI9B 2KD0A 1L2NA 1ZXIA 2WGSA 1RRBA 2KDIA 3VUYA 4C56C 1A70A 3HVDA 1VBGA 2OOBB 5EE3A 1SJED 4J6IA 3AE1B 3UINB 4KZCA 1WFYA 3KUDB 4URKA 3GE3C 4FHKA 1E0ZA 4JQWC 3PZDA 1QQGA 3AE8B 3QJZA 1GJZA 1XT9B 2NS5A 4GU2A 2CKHB 1SIJA 2QJLA 1QT9A 3SBTA 3WA0A 2C60A 2D9YA 2O6VB 4WWPA 3Q3FA 2DYQA 2JPHA 1IGCA 4W9CA 2DLWA 3ZLZA 4OHJA 2GJYA 2C7NB 2D07B 2PE6B 5IO9A 1NTVA 5J17A 5H92C 5LXIB 4EJNA 4EEWA 3AE2B 5IP4D 1AARA 1V88A 2KLCA 2KR0A 4CO7A 1U27A 3O13A 5LXHA 2WX0A 1ZVRA 4ZHOA 4DWFA 3VHTC 2DLBA 1WZ0A 2MKRA 2N0SB 3D32A 1EF5A 5DHAB 2V3NA 4AJWA 1XD4A 5DPWA 5LLIA 1KLUD 3WALA 4RMAA 2WXPA 2LYDA 1LQBA 4ZRJA 2O2VB 4HDQA 3AE7B 1VRAB 1T3QA 4BKTA 5LG4B 2W2XD 1WG7A 4J3OD 5FR6A 1FNUA 3PRZA 3E9LA 3KZ1A 3P6AA 1LFDA 2X18A 3DBRI 3O65B 3OJ4B 2GUMA 2L83A 4BKGA 4HKQA 4HATB 4K7UA 3Q8CA 3WAOA 3FEHA 1QLBB 4C00A 2N9EB 3DBRB 3QA8A 5DPSA 2LOZA 1L4DB 2DZIA 2WXKA 1M7RA 2D3AA 4KGSA 1KC7A 3PS6A 4ANUA 4ZDVA 3VR9B 3SYXA 1JWBD 3TEWA 4MGKE 3ETRA 5LNK1 1Z2MA 3Q8BA 2MP2A 2WHIA 1Y5OA 3LJ3A 1V5OA 2NBWB 4TQ1A
chains in the Genus database with same CATH topology
1P98A 4MGZE 1GGOA 4FA6A 1V49A 1D3ZA 1FXTB 2R0DA 2YS1A 1RRPB 4AJYB 1IYFA 2LGYA 3UZTA 2DAJA 1V80A 1OQYA 2KJHB 3MPXA 2MDXA 3R7QA 1NI2A 1K5DB 3DVNU 1MIXA 2UYZB 4PS8A 4K2OA 2WDTB 3DXCA 2KTRB 3A8PA 5C16A 2GMIC 2KC1A 2MLBA 3QC8B 1MKEA 4W9DA 4M8MA 3B08A 2PPHA 1PFJA 3X0WA 1WF9A 4A5KA 4WAAA 2FIFA 2FNJB 1P5TA 3PG7A 1U5EA 3M63B 3TVVA 3QX1A 4B95A 2K2JA 1M7EA 3KW5B 2IY0B 2QKLA 4KHBB 1WR1A 1RLFA 4WWOA 2NR2A 2ABDA 1V89A 1C3TA 4GPTB 3JSVA 5JHHA 3ULCA 2KOXA 2ELBA 3PHXB 3VUWA 3W1SA 2HE7A 2Z0DB 2ZJDA 2N1WA 2J0KA 5L81A 5C5BA 3VUXA 2KMAA 4YONA 2HD5B 3ENBA 1UZXB 3KYDD 2YSZA 4JIOU 2GS0A 3SBGA 3NZUA 1ZC4B 2M17A 3MDBC 2FCQA 4FJZA 3DXEA 4YL8A 4KDLB 3LJUX 2COCA 2UZRA 4G50A 5E6PA 4HAWB 4NQKE 2BPSA 1WI1A 2PEAA 2CY5A 2MBQA 2MX2A 2LULA 1HB6A 4GIVA 2M38A 4WVFB 1HE8A 4Z2MB 4G3XB 1ZKHA 2G4SA 5AZFA 2N9XA 4HB0B 2CRFA 4EFOA 2DHIA 5D3XA 3AU4A 3PRMB 1GC7A 5EDSA 2DYMA 2KZRA 1JDEA 4K7WA 3ZNID 2KANA 2J0MA 1WXSA 1H10A 3NHEB 1RAXA 2G35A 3HM6X 5G2NA 3PTFC 3EHVA 1XQQA 4RM9A 3D8FA 3HHMA 4JLCA 2P0DA 3OLMD 2IO3B 1PQSA 2I1KA 2K8BA 2W2WA 4GMXB 2DTCA 1WXAA 1ZC3B 4JKHA 4JK9A 2PE9A 3VQIA 4MELA 1WJNA 2M8SA 1WJ1A 1LB1A 4IWQA 4ZYNA 4XC2A 2XBBC 1GG3A 2FUHB 4GDKA 5C1ZA 1XD3B 3N3KB 2P0FA 4KV2A 1GC6A 2AEHA 2HJ8A 2NPTA 2EMTA 3FM8C 1DYNA 3FP5A 4PQ0A 2O6VD 2I5FA 4ASWC 2ZNVC 2D9VA 2DX5A 4M8NA 2KLGA 1W1GA 3V5WA 1K8RB 2IYBA 1SHCA 4HAZB 3GZNI 1EUVB 2I5CA 2FCNA 2KCJA 2GBNA 2BCJA 2GBKA 3S2AA 3L54A 4DDGD 2ZCCA 3H1UA 4HXDA 2CHZA 3HIZA 2MBOA 2ROZB 2GOWA 1WJ4A 3TFMA 2EKEC 1WGYA 2BYFA 1QC6A 3GYPA 1FHWA 2M14A 3ZNGC 3A9JB 3QWMA 1W1HA 1MIZB 4F1SA 1A5RA 1XCGA 2IYDB 2J59M 5CLQB 4GSWA 2UVMA 3RCPA 4KSKC 1LM8B 1MK9B 2JVCA 1XX0A 3ML8A 4ZRKA 5HE2A 2KWUB 2WH5A 2GCLA 1WM3A 1KZ7A 2J0JA 2D10A 3MJWA 3A9KA 4FN2A 3A1QB 4ANWA 3H6NA 1W1DA 2LXAA 4ILHA 5JP4A 4FHJA 1BT0A 3VXWA 1UELA 2Z59B 3F0WA 1NBFC 4MGYE 5HE3A 1NTIA 2LOXA 4II3B 4JL9A 3GYOA 1UNRA 3APCA 2OJRA 1WVHA 1ZW7A 4AWJA 2V76A 3PHWB 4HB3B 4NQLB 3WIMA 5J18A 4CHKA 3JVZX 1TTNA 1U5DA 4ZRIA 2UWQA 4Z2NA 4FJYA 2MBHA 5D3WA 3HQCA 2XQNM 2A4ZA 4HAXB 2CAYA 2CODA 2KK8A 5LOPB 2B3AA 4IWPA 1FGYA 2KO3A 4BBNC 2Z0PA 4HWIB 4IOYX 5E6OA 3M3JA 1TXDA 2ASQA 1E8XA 5J2RA 2K2UA 3RYTA 1XODA 2Q13A 2L3ZA 2YLMA 5HE0A 1KJTA 1TBEA 2KDFB 5AEKB 3EPYA 4HVBA 3WAMA 1WJMA 2FIDA 3TBLD 3ML4A 5CHWA 4BBKA 2CR5A 1KZGA 3SO6A 3P7ZA 4EZLA 2FAZA 3ENEA 2GCJA 2ZNVB 5JVLA 1WE7A 2K39A 2IY1B 2LVOA 2DHKA 3A33B 1UGMA 4GOCA 2C7HA 4JKGB 4GDLB 2KX3A 4LDTB 3A98B 2O2VA 3F5RA 2AL3A 2LGDA 5J3YA 5IA7A 2N4FA 4DXAB 1Y19B 5EFXA 1YX6B 2DAFA 3TIXA 1HBKA 2RPQA 3L17A 2DKPA 4BFRA 1FAOA 2NCNA 1V5PA 1WGDA 2C5LC 3DOWA 1UD7A 1U29A 3V6EB 3PGEA 1GUAB 1DDMA 4PNKA 1MK7B 3FSSA 2DZJA 2BWFA 2WWZA 2DN6A 2DYOA 2D9ZA 3PSCA 2M1MA 2RGNB 2V3SA 1IRSA 4P7IA 2LWPA 2ADZA 2ROVA 2Y5BB 2HRJA 2GBRA 4OVVA 5IJMA 4K2PA 2DZMA 1PLSA 4KIKB 4EUTA 5FI1A 4MY6A 2KTRA 4TKNA 1J0WA 3V61A 3SD5A 1U2BA 1LW3A 3QARA 4A6KA 2NZ8B 3V6CB 4CYEA 2JZ3B 1YQBA 5BO4B 3LDZE 3ZO5B 1DDVA 4KAXB 4H8SA 1E7VA 1KM7A 2YRYA 2ZEQA 5CTRC 3ZVRA 4I6PA 1UBIA 2REXA 2D9WA 3TMPB 3U8ZA 4L6EA 1C1YB 2LG1A 4KDIC 1GNUA 2Z0OA 4MDKE 3U30A 3CMMB 1KLVA 3IVFA 2KHWB 1H4RA 1YX5B 5LONB 1EAZA 1T0YA 2RSUA 3WANA 3CXBB 2NBVB 3RT3B 2LD9A 2D11A 1XKEA 1TZ1A 1Q1OA 3DCGA 2LASA 1P3QU 2ELAA 2IO1B 2LRUA 3A8QA 4JKCA 4E74A 4ANXA 3C0RB 3TCAA 1IP9A 5AZGA 3VH4B 3JYUA 1E8WA 1YIWA 2L2IA 2MWSB 2EC1A 4TYZA 3SUZA 2IO0B 2KFKB 3R7RA 4IC7B 1WX8A 2ZPNA 2KUPA 4IM3A 5D6JB 2N9PC 4B6WA 1M94A 3D8EA 4DBBA 2M4NA 3ZUNA 4FLHA 1E8ZA 4AP4C 2RLOA 3SU8X 2NBUA 1ZM0A 2G3QB 3H7PB 3IFWB 4MSQB 2MFQA 3ZIMA 1DIKA 1P3RA 2DYNA 3L08A 1WIAA 2KNBA 3NS8A 1J0GA 5D3VA 1WYWB 4HJKA 4GZUA 4HK2A 3TO1A 1ZGUB 3M1IB 3KY9A 1B55A 3E66A 3AI5A 2RSGA 1OGWA 4LJOB 2OQBA 1SIFA 1Q5WB 4HAYB 4I6LB 4F7UP 2KN5A 4MM3A 4W9JA 3R66C 1V5MA 4ILJA 1PMSA 4GN1A 3T8MA 4K7SA 4HAVB 1V6EA 5C23A 4XZ4A 2L76A 3M95A 3JSVB 2H7DA 2ZVNA 2WYQA 3NZSA 1X1GA 4NJ6A 3PSEB 3EC8A 3QK0A 3SDLC 2N7EA 1Q0WB 3ZRCA 1K5GB 2MW5A 1MAIA 3HW2B 3ODWA 2L8JA 4WWNA 4MGIE 2COPA 1X11A 2JY6A 2BKFA 2FCMA 1U4AA 2HTHA 2JUOA 3WAPA 3HK0A 4TUUA 3K9OB 5CX3A 2W9NA 2QHOA 4LDTD 1E5WA 3E9PA 1DDWA 3PVUA 1S3SG 2K8HA 1S1QB 1V9JA 2KX0A 3A9JA 3M62B 2PZ1A 2GBJA 2JXXA 4DBGA 2KWCA 2KQSA 3KUCB 2BYVE 2D3GA 3OAWA 4ICVA 2YT1A 4JK8A 4NY0A 2P0HA 3CF6E 1BTNA 4RM8A 2BYEA 3DDCB 4IM2A 3EFUA 4N9F4 4NAWB 1NU2A 1X05A 4F8CB 3A1QA 3ODOA 2NVUI 4DK5A 4MSMB 4MT7A 2JF5A 4EZKA 3H9DA 4E3CA 3VTWA 2M0XA 2JP2A 1I7AA 3DBLI 4G11A 3RCZA 3KRXA 1WE6A 2KWVB 1YD8U 3W1YA 4WQOB 1X1MA 2LXCA 3APDA 2RNRB 1J19A 2AYOB 2MCNB 4HAUB 5JHGA 4DHZB 3RD2A 5J3QA 1V86A 2BGFA 3P2BA 2CHXA 3RZWC 4KHOA 1WH3A 2YVCA 2JRHA 3ECIA 3VDZA 1KOTA 3ML9A 2KJRA 2LRWA 3CSTA 3N32A 4KZ0A 4IFSA 3IG3A 4ILGB 2MWNB 5DIFB 2VKIA 3VVWB 1KI1B 1N3HA 1EGXA 3DVGY 4JKBA 3KSYA 4A6FB 3HM3A 2K00A 2L0FA 4ANVA 1WM2A 4LCDE 2V4LA 4JKEA 4HCPB 3SHQA 3AXCA 4BOZB 1FB8A 3EECA 4IAPA 5JLJB 3QQ8B 3KVFB 4IM0A 1E7UA 5JHAA 4MJSB 4A3PA 1EF1A 1TQZA 4JKGA 4GDLA 2CS4A 4W9EA 3ZKJC 3PVWA 3WYFB 1Z5SB 2X0SA 3CSFA 2XK5B 2ZPYA 1SE9A 4JGHB 3X23A 3VFKA 4A3OA 4I6NB 4HDOA 4BBNF 2CU1A 5L95C 5GMVA 2MBEA 4W9FA 4TQ0A 2O6VA 4JKAA 1KBLA 1U5GA 4HB4B 3ZVVA 1WMHB 2RQ1A 3PEGA 1DROA 5L83A 5FI0A 3SV1A 4PS7A 4B9KA 2G45B 5KQ4A 5D27A 2OTXA 4JKFA 3JW0X 4HPMB 4GB9A 4BVUC 2EMSA 4DDID 3PPAA 3NOBA 5JZEB 3V62A 4B6HA 2KFJA 3PVLA 4JK7A 4KIKA 3BY4B 1L7YA 2LBBA 2LJ5A 5CHVC 2QKMA 1WY8A 1EVHA 2RVBB 3ZNHB 4K1RB 2N7DA 4C0AA 1SGHA 1YJ1A 2RUKB 1UNPA 4PYZA 2Y8FA 2DFKA 4DX90 2KJ6A 1OTRB 1RFAA 4E71A 1I35A 4IG7B 4JKDA 2K1FA 2L0TA 4MH0E 3A4SC 1P0RA 4W9IA 4EMOA 2LVPA 2KC2A 1FGZA 3UQBA 4GGQA 1VBHA 2JT4B 2IO2B 2LI5A 3PT2B 3H7SA 4PS3A 3VH3B 3DVGX 2J7QB 1WX9A 2LUEA 2KQ7A 5D7GA 1WGRA 3GOEA 3W1SC 3B0AA 2K6DB 4AUQC 4FJVB 5DHFB 5JH5C 3BINA 1WGGA 4IUMB 1V5TA 2IFSA 3ODXA 2JRIB 3TL5A 4HB2B 1V5UA 1ZSQA 2KTFA 3SNHA 2KFKA 1UPRA 3ZRFA 1MG8A 5KHQA 3UIPB 4AOFA 1OY2A 3DBSA 1J8CA 2W2XC 2KMCA 3VOQA 1P1AA 3H7PA 1UPQA 1QZEA 1JRUA 2MQJA 2V1YA 2MSED 3VTUA 3RULA 2CB8A 2R09A 2NMBA 2N23A 3B1LX 2COAA 1FOEA 3DXDA 1FHXA 3TW1A 2JZZA 1X86A 2UZSA 4KVGB 5E6NA 4F7ZA 4IW0A 4DHJB 4G0NB 2MP2B 1NDDA 3AJ4A 5CLLB 2JWZA 3K9PB 2KDBA 1WRDB 3T9LA 4W9HA 2FDQA 1LXDA 5HE1A 2P8VA 1WGHA 1EO6A 4FULA 3UF8A 3RZFA 3QAQA 2Z0QA 4GXBA 2COFA 5J3TA 1WI0A 2R2OA 3RUIB 1HB8A 1UBQA 2ZZPB 2DX1A 4TV3A 1X1FA 3BJIA 4A20A 1VD2A 1UH6A 2KXJA 3KH0A 1OMWA 2YF0A 3VIAA 5HKHA 1TGZB 2MA9B 5D3YA 4IWOA 1ACAA 3FLVA 2FCSA 1P6SA 2AL6A 2DIKA 1WXVA 4DX8A 2CQUA 1WX7A 3KUZA 1E8YA 1U5FA 5D94A 1G6JA 1IPGA 1BAKA 1WGUA 2D9XA 2MBBB 3UQAA 3QWZB 1CMXB 5C5BB 3ZDTA 2ZVOA 4NAWA 4NSWA 4WJPA 2Y8GA 3U7DA 5TR5A 5IAAC 1H8CA 3PV1A 3CIKA 4DHZE 2VSZA 5C6RA 1NTYA 2YS5A 2LKOA 3PP2A 5CHFA 4F7HA 2GBMA 2MRPA 2XEWA 3I3TB 1I2HA 5DPRA 2WX1A 1AWEA 1TJ6A 4WSFA 5KCVA 1RJ2A 2IZVB 1MPHA 1Z87A 3OJ3A 2H7EA 4BOSC 4WJ7A 3DBHI 5C79A 2FJLA 4LJPB 2DKQA 4NNJB 4HLEA 4A6HA 2DHJA 3N30A 4F7GA 3UGBB 1ISNA 3L13A 3DQVA 3TJPA 5JHBA 3IBEA 4XWXA 4PYUA 3QHTA 4FADA 4GMVA 4XX5A 3UIOB 2LVQA 2G4DB 1XR0B 4W9GA 4W9KA 1ST7A 1VCBA 2YS3A 2KVRA 3ZTCA 2YT0A 3VTVA 2HTHB 4BKSD 3D8DA 1V61A 3ZNZB 4A6FA 3PLUA 3QCAA 3MHSD 2CHWA 3O96A 1WJ6A 3QIJA 1V2YA 3ULBA 1WR6E 3L0WB 2L7RA 1R4NI 3PRPB 3NY5A 1E90A 1R4MI 4GDKB 2D2QA 3T06A 3L10B 2I1JA 2DA0A 4CHJA 2DZKA 2RGFA 4II2B 4MEMA 4X57B 2NPTB 3ALBA 4OVUA 2Z0EB 2BF8B 2RD0A 4EKUA 4MJSA 3V60A 5DPTA 1P9DU 4EOYA 2Y7BA 3AULA 2DX5B 2C7MB 2XK5A 2FJ9A 4HCNB 3ZDMC 2LZ6A 3NSUA 4FBJB 3DPDA 3R3MA 1V81A 2RR9A 4D0NB 3ZW3A 1WMHA 4KSLC 3PREA 2K8CA 1WJUA 2L05A 1I42A 3PLVA 2AWTA 5DCNA 1OEYA 5DH9B 1OQNA 1NVLA 1FHOA 2LGXA 4ICUA 2A5UA 1AQCA 2R2QA 3ONSA 4NJ7A 1Y8RC 3ZTDA 2EJ8A 3L16A 3A4RA 3APFA 2IBIB 1BTKA 4EZJA 2DYBA 2L00B 4HPLB 2BWES 2KGXB 2E2XA 3MTNB 1WZ3A 4DHJD 3KYCD 1WGQA 3A9KB 2KKCA 2K6QA 2N1VA 1Q67A 4K17A 3QBVB 1OEYJ 1UEFA 1UNQA 2D4QA 4KHAA 3KRWA 4WJOA 5GOWB 5KHOA 2ZCBA 3G9WA 4WJQA 3N7CA 4HHVA 3Q3JA 2CY4A 2L1CA 5G55A 2C9WB 3IHPC 4Y94A 2KDEB 4K81A 2R82A 4CHMA 2N0YA 1WXMA 2K25A 2DENB 1BWNA 1DBHA 3E9OA 5KQ1A 4WJNA 5AZHA 2BKRB 2VRWB 3DVNV 5D2MB 4W9LA 3AU5A 1F9JA 2VRRB 4BKSA 3VAWA 4M0WB 4NPNA 3OANA 2DHZA 2PJHA 4MK0A 5DI9B 2KD0A 1L2NA 1RRBA 2KDIA 3VUYA 1VBGA 2OOBB 4J6IA 3UINB 4KZCA 1WFYA 3KUDB 4URKA 4FHKA 4JQWC 3PZDA 1QQGA 3QJZA 1GJZA 1XT9B 2NS5A 4GU2A 2CKHB 3SBTA 3WA0A 2C60A 2D9YA 2O6VB 4WWPA 3Q3FA 2DYQA 2JPHA 4W9CA 2DLWA 3ZLZA 2GJYA 2C7NB 2D07B 2PE6B 1NTVA 5J17A 5LXIB 4EJNA 4EEWA 1AARA 1V88A 2KLCA 4CO7A 1U27A 5LXHA 2WX0A 1ZVRA 4DWFA 3VHTC 1WZ0A 2MKRA 3D32A 1EF5A 5DHAB 4AJWA 1XD4A 5DPWA 5LLIA 3WALA 4RMAA 2LYDA 1LQBA 4ZRJA 2O2VB 4HDQA 4BKTA 2W2XD 1WG7A 5FR6A 3PRZA 3E9LA 3KZ1A 3P6AA 1LFDA 2X18A 3DBRI 3O65B 3OJ4B 4BKGA 4HATB 4K7UA 3WAOA 3FEHA 2N9EB 3QA8A 5DPSA 2LOZA 2DZIA 1M7RA 1KC7A 3PS6A 4ANUA 4ZDVA 3SYXA 4MGKE 1Z2MA 2MP2A 1Y5OA 3LJ3A 1V5OA 2NBWB 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P98 A;  4MGZ E;  4FA6 A;  1V49 A;  1D3Z A;  1FXT B;  2R0D A;  2YS1 A;  1RRP B;  4AJY B;  1IYF A;  2LGY A;  3UZT A;  2DAJ A;  1V80 A;  1OQY A;  2KJH B;  3MPX A;  2MDX A;  3R7Q A;  1NI2 A;  1K5D B;  3DVN U;  1MIX A;  2UYZ B;  4PS8 A;  4K2O A;  2WDT B;  3DXC A;  2KTR B;  3A8P A;  5C16 A;  2GMI C;  2KC1 A;  2MLB A;  3QC8 B;  1MKE A;  4W9D A;  4M8M A;  3B08 A;  2PPH A;  1PFJ A;  3X0W A;  1WF9 A;  4A5K A;  4WAA A;  2FIF A;  2FNJ B;  1P5T A;  3PG7 A;  1U5E A;  3M63 B;  3TVV A;  3QX1 A;  4B95 A;  2K2J A;  1M7E A;  3KW5 B;  2IY0 B;  2QKL A;  4KHB B;  1WR1 A;  1RLF A;  4WWO A;  2NR2 A;  2ABD A;  1V89 A;  1C3T A;  4GPT B;  3JSV A;  5JHH A;  3ULC A;  2KOX A;  2ELB A;  3PHX B;  3VUW A;  3W1S A;  2HE7 A;  2Z0D B;  2ZJD A;  2N1W A;  2J0K A;  5L81 A;  5C5B A;  3VUX A;  2KMA A;  4YON A;  2HD5 B;  1UZX B;  3KYD D;  2YSZ A;  4JIO U;  2GS0 A;  3NZU A;  1ZC4 B;  2M17 A;  3MDB C;  2FCQ A;  4FJZ A;  3DXE A;  4YL8 A;  4KDL B;  3LJU X;  2COC A;  2UZR A;  4G50 A;  5E6P A;  4HAW B;  4NQK E;  2BPS A;  1WI1 A;  2PEA A;  2CY5 A;  2MBQ A;  2MX2 A;  2LUL A;  1HB6 A;  4GIV A;  2M38 A;  4WVF B;  1HE8 A;  4Z2M B;  4G3X B;  1ZKH A;  2G4S A;  5AZF A;  2N9X A;  4HB0 B;  2CRF A;  4EFO A;  2DHI A;  5D3X A;  3AU4 A;  3PRM B;  1GC7 A;  5EDS A;  2DYM A;  2KZR A;  4K7W A;  3ZNI D;  2KAN A;  2J0M A;  1WXS A;  1H10 A;  3NHE B;  1RAX A;  2G35 A;  3HM6 X;  5G2N A;  3PTF C;  3EHV A;  1XQQ A;  4RM9 A;  3D8F A;  3HHM A;  4JLC A;  2P0D A;  3OLM D;  2IO3 B;  1PQS A;  2I1K A;  2K8B A;  2W2W A;  4GMX B;  2DTC A;  1WXA A;  1ZC3 B;  2PE9 A;  3VQI A;  4MEL A;  1WJN A;  2M8S A;  1WJ1 A;  1LB1 A;  4IWQ A;  4ZYN A;  4XC2 A;  2XBB C;  1GG3 A;  2FUH B;  4GDK A;  5C1Z A;  1XD3 B;  3N3K B;  2P0F A;  4KV2 A;  1GC6 A;  2AEH A;  2HJ8 A;  2NPT A;  2EMT A;  3FM8 C;  1DYN A;  3FP5 A;  4PQ0 A;  2O6V D;  2I5F A;  4ASW C;  2ZNV C;  2D9V A;  2DX5 A;  4M8N A;  2KLG A;  1W1G A;  3V5W A;  1K8R B;  2IYB A;  1SHC A;  4HAZ B;  3GZN I;  1EUV B;  2I5C A;  2FCN A;  2KCJ A;  2GBN A;  2BCJ A;  2GBK A;  3S2A A;  3L54 A;  4DDG D;  2ZCC A;  3H1U A;  4HXD A;  2CHZ A;  3HIZ A;  2MBO A;  2ROZ B;  2GOW A;  1WJ4 A;  3TFM A;  2EKE C;  1WGY A;  2BYF A;  1QC6 A;  3GYP A;  1FHW A;  2M14 A;  3ZNG C;  3A9J B;  3QWM A;  1W1H A;  1MIZ B;  4F1S A;  1A5R A;  1XCG A;  2IYD B;  2J59 M;  5CLQ B;  4GSW A;  2UVM A;  3RCP A;  4KSK C;  1LM8 B;  1MK9 B;  2JVC A;  1XX0 A;  3ML8 A;  4ZRK A;  5HE2 A;  2KWU B;  2WH5 A;  2GCL A;  1WM3 A;  1KZ7 A;  2J0J A;  2D10 A;  3MJW A;  3A9K A;  4FN2 A;  3A1Q B;  4ANW A;  3H6N A;  1W1D A;  2LXA A;  5JP4 A;  4FHJ A;  1BT0 A;  3VXW A;  1UEL A;  2Z59 B;  3F0W A;  1NBF C;  4MGY E;  5HE3 A;  1NTI A;  2LOX A;  4II3 B;  4JL9 A;  3GYO A;  1UNR A;  3APC A;  2OJR A;  1WVH A;  1ZW7 A;  4AWJ A;  2V76 A;  3PHW B;  4HB3 B;  4NQL B;  3WIM A;  5J18 A;  4CHK A;  3JVZ X;  1TTN A;  1U5D A;  4ZRI A;  2UWQ A;  4Z2N A;  4FJY A;  2MBH A;  5D3W A;  3HQC A;  2XQN M;  2A4Z A;  4HAX B;  2CAY A;  2COD A;  2KK8 A;  5LOP B;  2B3A A;  4IWP A;  1FGY A;  2KO3 A;  4BBN C;  2Z0P A;  4HWI B;  4IOY X;  5E6O A;  3M3J A;  1TXD A;  2ASQ A;  1E8X A;  5J2R A;  2K2U A;  3RYT A;  1XOD A;  2Q13 A;  2L3Z A;  2YLM A;  5HE0 A;  1KJT A;  1TBE A;  2KDF B;  5AEK B;  3EPY A;  4HVB A;  3WAM A;  1WJM A;  2FID A;  3TBL D;  3ML4 A;  5CHW A;  4BBK A;  2CR5 A;  1KZG A;  3SO6 A;  3P7Z A;  4EZL A;  2FAZ A;  3ENE A;  2GCJ A;  2ZNV B;  1WE7 A;  2K39 A;  2IY1 B;  2LVO A;  2DHK A;  3A33 B;  1UGM A;  4GOC A;  2C7H A;  4GDL B;  2KX3 A;  4LDT B;  3A98 B;  2O2V A;  3F5R A;  2AL3 A;  2LGD A;  5J3Y A;  5IA7 A;  2N4F A;  4DXA B;  1Y19 B;  5EFX A;  1YX6 B;  2DAF A;  3TIX A;  1HBK A;  2RPQ A;  3L17 A;  2DKP A;  4BFR A;  1FAO A;  2NCN A;  1V5P A;  1WGD A;  2C5L C;  3DOW A;  1UD7 A;  1U29 A;  3V6E B;  3PGE A;  1GUA B;  1DDM A;  4PNK A;  1MK7 B;  3FSS A;  2DZJ A;  2BWF A;  2WWZ A;  2DN6 A;  2DYO A;  2D9Z A;  3PSC A;  2M1M A;  2RGN B;  2V3S A;  1IRS A;  4P7I A;  2LWP A;  2ADZ A;  2ROV A;  2Y5B B;  2HRJ A;  2GBR A;  4OVV A;  5IJM A;  4K2P A;  2DZM A;  1PLS A;  4KIK B;  4EUT A;  5FI1 A;  4MY6 A;  2KTR A;  4TKN A;  1J0W A;  3V61 A;  3SD5 A;  1U2B A;  1LW3 A;  3QAR A;  4A6K A;  2NZ8 B;  3V6C B;  4CYE A;  2JZ3 B;  1YQB A;  5BO4 B;  3LDZ E;  3ZO5 B;  1DDV A;  4KAX B;  4H8S A;  1E7V A;  1KM7 A;  2YRY A;  2ZEQ A;  5CTR C;  3ZVR A;  4I6P A;  1UBI A;  2REX A;  2D9W A;  3TMP B;  3U8Z A;  4L6E A;  1C1Y B;  2LG1 A;  4KDI C;  1GNU A;  2Z0O A;  4MDK E;  3U30 A;  3CMM B;  1KLV A;  3IVF A;  2KHW B;  1H4R A;  1YX5 B;  5LON B;  1EAZ A;  1T0Y A;  2RSU A;  3WAN A;  3CXB B;  2NBV B;  3RT3 B;  2LD9 A;  2D11 A;  1XKE A;  1TZ1 A;  1Q1O A;  3DCG A;  2LAS A;  1P3Q U;  2ELA A;  2IO1 B;  2LRU A;  3A8Q A;  4E74 A;  4ANX A;  3C0R B;  3TCA A;  1IP9 A;  5AZG A;  3VH4 B;  3JYU A;  1E8W A;  1YIW A;  2L2I A;  2MWS B;  2EC1 A;  4TYZ A;  3SUZ A;  2IO0 B;  2KFK B;  3R7R A;  4IC7 B;  1WX8 A;  2ZPN A;  2KUP A;  4IM3 A;  5D6J B;  2N9P C;  4B6W A;  1M94 A;  3D8E A;  4DBB A;  2M4N A;  3ZUN A;  4FLH A;  1E8Z A;  4AP4 C;  2RLO A;  3SU8 X;  2NBU A;  1ZM0 A;  2G3Q B;  3H7P B;  3IFW B;  4MSQ B;  2MFQ A;  3ZIM A;  1P3R A;  2DYN A;  3L08 A;  1WIA A;  2KNB A;  3NS8 A;  1J0G A;  5D3V A;  1WYW B;  4HJK A;  4GZU A;  4HK2 A;  3TO1 A;  1ZGU B;  3M1I B;  3KY9 A;  1B55 A;  3AI5 A;  2RSG A;  1OGW A;  4LJO B;  2OQB A;  1SIF A;  1Q5W B;  4HAY B;  4I6L B;  4F7U P;  2KN5 A;  4MM3 A;  4W9J A;  3R66 C;  1V5M A;  1PMS A;  4GN1 A;  3T8M A;  4K7S A;  4HAV B;  1V6E A;  5C23 A;  4XZ4 A;  2L76 A;  3M95 A;  3JSV B;  2H7D A;  2ZVN A;  2WYQ A;  3NZS A;  1X1G A;  4NJ6 A;  3PSE B;  3EC8 A;  3QK0 A;  3SDL C;  2N7E A;  1Q0W B;  3ZRC A;  1K5G B;  2MW5 A;  1MAI A;  3HW2 B;  3ODW A;  2L8J A;  4WWN A;  4MGI E;  2COP A;  1X11 A;  2JY6 A;  2BKF A;  2FCM A;  1U4A A;  2HTH A;  2JUO A;  3WAP A;  3HK0 A;  4TUU A;  3K9O B;  5CX3 A;  2W9N A;  2QHO A;  4LDT D;  1E5W A;  1DDW A;  3PVU A;  1S3S G;  2K8H A;  1S1Q B;  1V9J A;  2KX0 A;  3A9J A;  3M62 B;  2PZ1 A;  2GBJ A;  2JXX A;  4DBG A;  2KWC A;  2KQS A;  3KUC B;  2BYV E;  2D3G A;  3OAW A;  4ICV A;  2YT1 A;  4NY0 A;  2P0H A;  3CF6 E;  1BTN A;  4RM8 A;  2BYE A;  3DDC B;  4IM2 A;  3EFU A;  4N9F 4;  4NAW B;  1NU2 A;  1X05 A;  4F8C B;  3A1Q A;  3ODO A;  2NVU I;  4DK5 A;  4MSM B;  4MT7 A;  2JF5 A;  4EZK A;  3H9D A;  4E3C A;  3VTW A;  2M0X A;  2JP2 A;  1I7A A;  3DBL I;  4G11 A;  3RCZ A;  3KRX A;  1WE6 A;  2KWV B;  1YD8 U;  3W1Y A;  4WQO B;  1X1M A;  2LXC A;  3APD A;  2RNR B;  1J19 A;  2AYO B;  2MCN B;  4HAU B;  5JHG A;  4DHZ B;  3RD2 A;  5J3Q A;  1V86 A;  2BGF A;  3P2B A;  2CHX A;  3RZW C;  4KHO A;  1WH3 A;  2YVC A;  2JRH A;  3ECI A;  3VDZ A;  1KOT A;  3ML9 A;  2KJR A;  2LRW A;  3CST A;  3N32 A;  4KZ0 A;  4IFS A;  3IG3 A;  2MWN B;  5DIF B;  2VKI A;  3VVW B;  1KI1 B;  1N3H A;  1EGX A;  3DVG Y;  3KSY A;  4A6F B;  3HM3 A;  2K00 A;  2L0F A;  4ANV A;  1WM2 A;  4LCD E;  2V4L A;  4HCP B;  3SHQ A;  3AXC A;  4BOZ B;  1FB8 A;  3EEC A;  4IAP A;  5JLJ B;  3QQ8 B;  3KVF B;  4IM0 A;  1E7U A;  5JHA A;  4MJS B;  4A3P A;  1EF1 A;  1TQZ A;  4GDL A;  2CS4 A;  4W9E A;  3ZKJ C;  3PVW A;  3WYF B;  1Z5S B;  3CSF A;  2XK5 B;  2ZPY A;  1SE9 A;  4JGH B;  3X23 A;  3VFK A;  4A3O A;  4I6N B;  4HDO A;  4BBN F;  2CU1 A;  5L95 C;  5GMV A;  2MBE A;  4W9F A;  4TQ0 A;  2O6V A;  1U5G A;  4HB4 B;  3ZVV A;  1WMH B;  2RQ1 A;  3PEG A;  1DRO A;  5L83 A;  5FI0 A;  3SV1 A;  4PS7 A;  4B9K A;  2G45 B;  5KQ4 A;  5D27 A;  2OTX A;  3JW0 X;  4HPM B;  4GB9 A;  4BVU C;  2EMS A;  4DDI D;  3PPA A;  3NOB A;  5JZE B;  3V62 A;  4B6H A;  2KFJ A;  3PVL A;  4KIK A;  3BY4 B;  1L7Y A;  2LBB A;  2LJ5 A;  5CHV C;  2QKM A;  1WY8 A;  1EVH A;  2RVB B;  3ZNH B;  4K1R B;  2N7D A;  4C0A A;  1SGH A;  1YJ1 A;  2RUK B;  1UNP A;  4PYZ A;  2Y8F A;  2DFK A;  4DX9 0;  2KJ6 A;  1OTR B;  1RFA A;  4E71 A;  1I35 A;  4IG7 B;  2K1F A;  2L0T A;  4MH0 E;  3A4S C;  1P0R A;  4W9I A;  4EMO A;  2LVP A;  2KC2 A;  1FGZ A;  3UQB A;  4GGQ A;  2JT4 B;  2IO2 B;  2LI5 A;  3PT2 B;  3H7S A;  4PS3 A;  3VH3 B;  3DVG X;  2J7Q B;  1WX9 A;  2LUE A;  2KQ7 A;  5D7G A;  1WGR A;  3W1S C;  3GOE A;  3B0A A;  2K6D B;  4AUQ C;  4FJV B;  5DHF B;  5JH5 C;  3BIN A;  1WGG A;  4IUM B;  1V5T A;  2IFS A;  3ODX A;  2JRI B;  3TL5 A;  4HB2 B;  1V5U A;  1ZSQ A;  2KTF A;  3SNH A;  2KFK A;  1UPR A;  3ZRF A;  1MG8 A;  5KHQ A;  3UIP B;  4AOF A;  1OY2 A;  3DBS A;  1J8C A;  2W2X C;  2KMC A;  3VOQ A;  1P1A A;  3H7P A;  1UPQ A;  1QZE A;  1JRU A;  2MQJ A;  2V1Y A;  2MSE D;  3VTU A;  3RUL A;  2CB8 A;  2R09 A;  2NMB A;  2N23 A;  3B1L X;  2COA A;  1FOE A;  3DXD A;  1FHX A;  3TW1 A;  2JZZ A;  1X86 A;  2UZS A;  4KVG B;  5E6N A;  4F7Z A;  4IW0 A;  4DHJ B;  4G0N B;  2MP2 B;  1NDD A;  3AJ4 A;  5CLL B;  2JWZ A;  3K9P B;  2KDB A;  1WRD B;  3T9L A;  4W9H A;  2FDQ A;  1LXD A;  5HE1 A;  2P8V A;  1WGH A;  1EO6 A;  4FUL A;  3UF8 A;  3RZF A;  3QAQ A;  2Z0Q A;  4GXB A;  2COF A;  5J3T A;  1WI0 A;  2R2O A;  3RUI B;  1HB8 A;  1UBQ A;  2ZZP B;  2DX1 A;  4TV3 A;  1X1F A;  3BJI A;  4A20 A;  1VD2 A;  1UH6 A;  2KXJ A;  3KH0 A;  1OMW A;  2YF0 A;  3VIA A;  5HKH A;  1TGZ B;  2MA9 B;  5D3Y A;  4IWO A;  1ACA A;  3FLV A;  2FCS A;  1P6S A;  2AL6 A;  1WXV A;  4DX8 A;  2CQU A;  1WX7 A;  3KUZ A;  1E8Y A;  1U5F A;  5D94 A;  1G6J A;  1IPG A;  1BAK A;  1WGU A;  2D9X A;  2MBB B;  3UQA A;  3QWZ B;  1CMX B;  5C5B B;  3ZDT A;  2ZVO A;  4NAW A;  4NSW A;  4WJP A;  2Y8G A;  3U7D A;  5TR5 A;  5IAA C;  1H8C A;  3PV1 A;  3CIK A;  4DHZ E;  2VSZ A;  5C6R A;  1NTY A;  2YS5 A;  2LKO A;  3PP2 A;  5CHF A;  4F7H A;  2GBM A;  2MRP A;  2XEW A;  3I3T B;  1I2H A;  5DPR A;  2WX1 A;  1AWE A;  1TJ6 A;  4WSF A;  5KCV A;  1RJ2 A;  2IZV B;  1MPH A;  1Z87 A;  3OJ3 A;  2H7E A;  4BOS C;  4WJ7 A;  3DBH I;  5C79 A;  2FJL A;  4LJP B;  2DKQ A;  4NNJ B;  4HLE A;  4A6H A;  2DHJ A;  3N30 A;  4F7G A;  3UGB B;  1ISN A;  3L13 A;  3DQV A;  3TJP A;  5JHB A;  3IBE A;  4XWX A;  4PYU A;  3QHT A;  4FAD A;  4GMV A;  4XX5 A;  3UIO B;  2LVQ A;  2G4D B;  1XR0 B;  4W9G A;  4W9K A;  1ST7 A;  1VCB A;  2YS3 A;  2KVR A;  3ZTC A;  2YT0 A;  3VTV A;  2HTH B;  4BKS D;  3D8D A;  1V61 A;  3ZNZ B;  4A6F A;  3PLU A;  3QCA A;  3MHS D;  2CHW A;  3O96 A;  1WJ6 A;  3QIJ A;  1V2Y A;  3ULB A;  1WR6 E;  3L0W B;  2L7R A;  1R4N I;  3PRP B;  3NY5 A;  1E90 A;  1R4M I;  4GDK B;  2D2Q A;  3T06 A;  3L10 B;  2I1J A;  2DA0 A;  4CHJ A;  2DZK A;  2RGF A;  4II2 B;  4MEM A;  4X57 B;  2NPT B;  3ALB A;  4OVU A;  2Z0E B;  2BF8 B;  2RD0 A;  4EKU A;  4MJS A;  3V60 A;  5DPT A;  1P9D U;  4EOY A;  2Y7B A;  3AUL A;  2DX5 B;  2C7M B;  2XK5 A;  2FJ9 A;  4HCN B;  3ZDM C;  2LZ6 A;  3NSU A;  4FBJ B;  3DPD A;  3R3M A;  1V81 A;  2RR9 A;  4D0N B;  3ZW3 A;  1WMH A;  4KSL C;  3PRE A;  2K8C A;  1WJU A;  2L05 A;  1I42 A;  3PLV A;  2AWT A;  5DCN A;  1OEY A;  5DH9 B;  1OQN A;  1NVL A;  1FHO A;  2LGX A;  4ICU A;  2A5U A;  1AQC A;  2R2Q A;  3ONS A;  4NJ7 A;  1Y8R C;  3ZTD A;  2EJ8 A;  3L16 A;  3A4R A;  3APF A;  2IBI B;  1BTK A;  4EZJ A;  2DYB A;  2L00 B;  4HPL B;  2BWE S;  2KGX B;  2E2X A;  3MTN B;  1WZ3 A;  4DHJ D;  3KYC D;  1WGQ A;  3A9K B;  2KKC A;  2K6Q A;  2N1V A;  1Q67 A;  4K17 A;  3QBV B;  1OEY J;  1UEF A;  1UNQ A;  2D4Q A;  4KHA A;  3KRW A;  4WJO A;  5GOW B;  5KHO A;  2ZCB A;  3G9W A;  4WJQ A;  3N7C A;  4HHV A;  3Q3J A;  2CY4 A;  2L1C A;  5G55 A;  2C9W B;  3IHP C;  4Y94 A;  2KDE B;  4K81 A;  4CHM A;  2N0Y A;  1WXM A;  2K25 A;  2DEN B;  1BWN A;  1DBH A;  5KQ1 A;  4WJN A;  5AZH A;  2BKR B;  2VRW B;  3DVN V;  5D2M B;  4W9L A;  3AU5 A;  1F9J A;  2VRR B;  4BKS A;  3VAW A;  4M0W B;  4NPN A;  3OAN A;  2DHZ A;  2PJH A;  4MK0 A;  5DI9 B;  2KD0 A;  1L2N A;  1RRB A;  2KDI A;  3VUY A;  2OOB B;  4J6I A;  3UIN B;  4KZC A;  1WFY A;  3KUD B;  4URK A;  4FHK A;  4JQW C;  3PZD A;  1QQG A;  3QJZ A;  1GJZ A;  1XT9 B;  2NS5 A;  4GU2 A;  2CKH B;  3WA0 A;  2C60 A;  2D9Y A;  2O6V B;  4WWP A;  3Q3F A;  2DYQ A;  2JPH A;  4W9C A;  2DLW A;  3ZLZ A;  2GJY A;  2C7N B;  2D07 B;  2PE6 B;  1NTV A;  5J17 A;  5LXI B;  4EJN A;  4EEW A;  1AAR A;  1V88 A;  2KLC A;  4CO7 A;  1U27 A;  5LXH A;  2WX0 A;  1ZVR A;  4DWF A;  3VHT C;  1WZ0 A;  2MKR A;  3D32 A;  1EF5 A;  5DHA B;  4AJW A;  1XD4 A;  5DPW A;  5LLI A;  3WAL A;  4RMA A;  2LYD A;  1LQB A;  4ZRJ A;  2O2V B;  4HDQ A;  4BKT A;  2W2X D;  1WG7 A;  5FR6 A;  3PRZ A;  3KZ1 A;  3P6A A;  1LFD A;  2X18 A;  3DBR I;  3O65 B;  3OJ4 B;  4BKG A;  4HAT B;  4K7U A;  3WAO A;  3FEH A;  2N9E B;  3QA8 A;  5DPS A;  2LOZ A;  2DZI A;  1M7R A;  3PS6 A;  4ANU A;  4ZDV A;  3SYX A;  4MGK E;  1Z2M A;  2MP2 A;  1Y5O A;  3LJ3 A;  1V5O A;  2NBW B;  4TQ1 A; 
#chains in the Genus database with same CATH topology
 2WXF A;  1P98 A;  1PDX A;  3OG5 A;  3U52 E;  4MGZ E;  1GGO A;  4FA6 A;  1V49 A;  1D3Z A;  2OED A;  2R2Y A;  1FXT B;  2R0D A;  2YS1 A;  1RRP B;  4AJY B;  1IYF A;  2LGY A;  3UZT A;  2DAJ A;  3HUI A;  2W55 A;  1V80 A;  1OQY A;  1ZP0 B;  2KJH B;  3MPX A;  4XYC A;  4KGT A;  4C7Z A;  2MDX A;  3R7Q A;  1NI2 A;  1K5D B;  1D4B A;  3DVN U;  1MIX A;  2UYZ B;  1K52 A;  3J9C A;  1JWA D;  3FVC A;  4PS8 A;  3LB8 C;  4K2O A;  2WDT B;  1Y56 A;  3DXC A;  1PGX A;  2KTR B;  3A8P A;  2MJD A;  5C16 A;  1DOX A;  5AUI A;  1NEK B;  2GMI C;  2KC1 A;  2MLB A;  3QC8 B;  1MKE A;  2LFI A;  4W9D A;  4M8M A;  3B08 A;  2PPH A;  3U12 A;  1PFJ A;  3LYY A;  4YSY B;  3X0W A;  1WF9 A;  4A5K A;  4WAA A;  1F1H A;  4WWM A;  4ARI A;  4FXC A;  2FIF A;  2FNJ B;  1P5T A;  3PG7 A;  1U5E A;  3M63 B;  3TVV A;  3QX1 A;  3NJT A;  4B95 A;  2K2J A;  1M7E A;  3KW5 B;  2IY0 B;  1YJI A;  2QKL A;  3N9Y C;  4KHB B;  1WR1 A;  1RLF A;  2GRI A;  3IT4 B;  4WWO A;  4LNF A;  2NR2 A;  2ABD A;  1V89 A;  1C3T A;  2KIE A;  3RNE C;  4GPT B;  3JSV A;  5JHH A;  1AYF A;  1EU3 A;  3ULC A;  2KOX A;  1KLG D;  1WWT A;  4LNO A;  1TS4 A;  3ZXV A;  2ELB A;  3PHX B;  3VUW A;  3W1S A;  2HE7 A;  3RN9 C;  1JCK B;  1XCQ L;  2Z0D B;  2ZJD A;  2N1W A;  2OJW A;  1HXY D;  2J0K A;  5L81 A;  2JXT A;  5C5B A;  2G1E A;  2XNA C;  3VUX A;  3BWU D;  2KMA A;  4YON A;  2HD5 B;  3ENB A;  1UZX B;  3KYD D;  2YSZ A;  4JIO U;  2BS3 B;  2GS0 A;  1WXQ A;  2LHE A;  2W3R A;  1FNW A;  3SBG A;  3RNG C;  3NZU A;  1ZC4 B;  2M17 A;  3MDB C;  2FCQ A;  4FJZ A;  3DXE A;  4YL8 A;  1LO5 D;  4KDL B;  3LJU X;  1D5X C;  3HVZ A;  2COC A;  2UZR A;  4G50 A;  5E6P A;  4HAW B;  4NQK E;  4DQO C;  1SBB B;  2BPS A;  1WI1 A;  2PEA A;  4WIP A;  2CY5 A;  2MBQ A;  2MX2 A;  3B9J A;  2LUL A;  1HB6 A;  1YQ4 B;  4GIV A;  1FFV A;  3AN1 A;  2M38 A;  4WVF B;  1MHH E;  1HE8 A;  4Z2M B;  1XLP A;  4G3X B;  2PW9 A;  3W5U B;  3PZ7 A;  1ZKH A;  2G4S A;  5AZF A;  4R3D A;  1N5X A;  2N9X A;  4HB0 B;  2AX5 A;  1E9M A;  2IGG A;  2CRF A;  4EFO A;  2DHI A;  5C3J B;  5D3X A;  3AU4 A;  3PRM B;  2AQ2 B;  1GC7 A;  1L0V B;  3AM9 A;  5EDS A;  2DYM A;  2KZR A;  2WXR A;  1VZ6 A;  2HJ1 A;  3MFG A;  3NWF A;  1JDE A;  4K7W A;  3ZNI D;  2KAN A;  2J0M A;  3DHG C;  1WXS A;  4YWG G;  3BYY B;  3PZ8 A;  1H10 A;  3NHE B;  1RAX A;  2G35 A;  2BS2 B;  3HM6 X;  1FM0 D;  2EEL A;  5G2N A;  3PTF C;  3EHV A;  1XQQ A;  4RM9 A;  3D8F A;  3HHM A;  4JLC A;  2P0D A;  3OLM D;  2IO3 B;  3Q2A C;  3A58 A;  1PQS A;  2I1K A;  1HZ5 A;  2K8B A;  2W2W A;  4GMX B;  2DTC A;  3B77 A;  1WXA A;  1I4Q A;  2JSV X;  1ZC3 B;  1TT5 B;  3ZYY X;  4JKH A;  4JK9 A;  2PE9 A;  3VQI A;  1ESF A;  4MEL A;  1WJN A;  2M8S A;  1WJ1 A;  3FC4 A;  2K8E A;  3Q8E A;  3U2S C;  1LB1 A;  4IWQ A;  4ZYN A;  1ZYI A;  4XC2 A;  2XBB C;  1GG3 A;  2FUH B;  4GDK A;  5C1Z A;  1XD3 B;  3N3K B;  2P0F A;  4K3C A;  2IGD A;  4KV2 A;  4IOI E;  1GC6 A;  2AEH A;  4B0E A;  2HJ8 A;  1T6B X;  1FIQ A;  2NPT A;  2EMT A;  1XF5 L;  3FM8 C;  1DYN A;  3FP5 A;  1SF0 A;  4PQ0 A;  2KDM A;  3B2G A;  2O6V D;  1MI0 A;  1EU4 A;  4C7Y A;  2I5F A;  4ASW C;  2ZNV C;  2D9V A;  4WUR A;  5HI1 A;  2DX5 A;  4M8N A;  1QIL A;  2KLG A;  1W1G A;  3GS2 A;  3V5W A;  3Q6B A;  1K8R B;  1FPY A;  2IYB A;  1SHC A;  2Y3A A;  4HAZ B;  3GZN I;  3ZGZ A;  1EUV B;  2I5C A;  1ZDV A;  2FCN A;  4OZB A;  2KCJ A;  2GBN A;  2BCJ A;  2GBK A;  2JYT A;  3ZXR A;  3S2A A;  2N7J A;  3FKY A;  3L54 A;  3TSS A;  4DDG D;  2ZCC A;  3H1U A;  1OQQ A;  4HXD A;  2VZK B;  2CHZ A;  3GZN B;  3HIZ A;  2MBO A;  2ROZ B;  2KT7 A;  4OZC A;  2KAJ A;  2GOW A;  1WJ4 A;  3TFM A;  2EKE C;  1WGY A;  2BYF A;  1QC6 A;  3GYP A;  1FHW A;  1OQR A;  2M14 A;  4GLS C;  2ICI A;  3ZNG C;  2QIE B;  3A9J B;  3QWM A;  2E6X A;  1W1H A;  1MIZ B;  4YXD B;  5IN7 A;  4F1S A;  2N9K A;  4UDU C;  1A5R A;  1XCG A;  3FIL A;  2IYD B;  2J59 M;  5CLQ B;  4GSW A;  2UVM A;  3RCP A;  4KSK C;  1LM8 B;  1MK9 B;  2IJ0 A;  3DBL B;  1QOG A;  2JVC A;  1XX0 A;  3ML8 A;  4ZRK A;  5HE2 A;  2KWU B;  2MEK A;  3NVW A;  2WNM A;  2WH5 A;  2Q5W D;  2GCL A;  1WM3 A;  1KZ7 A;  2J0J A;  4K3B A;  2D10 A;  3MJW A;  2WXH A;  4NAM A;  1ZE3 D;  4YT0 B;  4JX1 C;  5IKC M;  3A9K A;  1E6E B;  4FN2 A;  1T0S C;  1KRH A;  3HRD D;  3A1Q B;  4ANW A;  3H6N A;  1W1D A;  2LXA A;  4ILH A;  2PVO D;  2LGI A;  2WP9 B;  5JP4 A;  2QMT A;  4FHJ A;  1N6Z A;  1BT0 A;  3VXW A;  1UEL A;  2Z59 B;  3F0W A;  3N1X C;  1NBF C;  3N1Z C;  4MGY E;  5HE3 A;  1NTI A;  5BYS A;  2LOX A;  4II3 B;  4JL9 A;  1IBX B;  3GYO A;  1UNR A;  3APC A;  2OJR A;  1WVH A;  3NWA A;  1ZW7 A;  3R2T A;  3EUB 2;  1JRP A;  1SE4 A;  3NZ3 A;  4AWJ A;  2V76 A;  2YT2 A;  1JWU D;  3PHW B;  4HB3 B;  1TS2 A;  1SSN A;  4NQL B;  4LNN A;  1F52 A;  1DYQ A;  3WCQ A;  4A90 A;  2IGH A;  4A6Q A;  1D5M C;  3WIM A;  5J18 A;  4CHK A;  3JVZ X;  3AEC B;  1F77 A;  1YJJ A;  2I38 A;  1TTN A;  3U4E G;  1U5D A;  4ZRI A;  2UWQ A;  2MH7 A;  4Z2N A;  4FJY A;  2MBH A;  5D3W A;  3HQC A;  4XDC A;  2XQN M;  2A4Z A;  2WS3 B;  4HAX B;  4M0W A;  2CAY A;  2COD A;  2KK8 A;  5LOP B;  2B3A A;  4IWP A;  4DXF A;  1FGY A;  2KO3 A;  4BBN C;  2Z0P A;  1L0X B;  4HWI B;  4IOY X;  5E6O A;  3M3J A;  1TXD A;  2ASQ A;  1E8X A;  4C4V B;  5J2R A;  2K2U A;  3KQ4 A;  3RYT A;  1EWC A;  5HFY A;  1XOD A;  3W2D A;  3AE6 B;  1UF0 A;  2Q13 A;  3HSA A;  2L3Z A;  5BMG A;  2YLM A;  4YSZ B;  5HE0 A;  1KJT A;  2WU5 B;  1TBE A;  2KDF B;  4YTM B;  1JQ4 A;  5AEK B;  3EPY A;  4HVB A;  3WAM A;  1WJM A;  2FID A;  2V4I B;  3TBL D;  3ML4 A;  5CHW A;  3HIE A;  3AE4 B;  4BBK A;  2FUG 1;  3Q3M C;  2CR5 A;  1KZG A;  3SO6 A;  3P7Z A;  4EZL A;  2FAZ A;  3ENE A;  3C8Y A;  2GCJ A;  2ZNV B;  5JVL A;  1WE7 A;  2K39 A;  3AED B;  3BII D;  3Q14 C;  2IY1 B;  1KF6 B;  2LVO A;  2DHK A;  3A33 B;  4P16 A;  1UGM A;  4WAF A;  4GOC A;  4B0M A;  2C7H A;  1F2R C;  3ZJT A;  4JKG B;  3BVG A;  4GDL B;  5G5G A;  2KX3 A;  1SE2 A;  4LDT B;  3A98 B;  2O2V A;  1OFF A;  3F5R A;  2AL3 A;  2LGD A;  5M4Y B;  5J3Y A;  1FFU A;  5IA7 A;  2D3C A;  2KVZ A;  2N4F A;  4DXA B;  2CU3 A;  2L52 A;  4ZOH C;  1Y19 B;  5EFX A;  1VLB A;  5BMH A;  1YX6 B;  2DAF A;  3TIX A;  1HBK A;  2RPQ A;  3L17 A;  3Q69 A;  3RNB C;  2FJU B;  2DKP A;  2DBY A;  4BFR A;  3TEZ A;  2JWU A;  1FAO A;  2NCN A;  1V5P A;  4CSQ A;  2C5L C;  1WGD A;  2Z8L A;  3DOW A;  1UD7 A;  1U29 A;  3V6E B;  3PGE A;  1TY0 A;  1GUA B;  1DDM A;  4PNK A;  1UWX A;  1MK7 B;  1AN8 A;  4XE0 A;  3FSS A;  3BK1 A;  2WXI A;  1ROE A;  1HA5 A;  2YEP B;  1IGD A;  2DZJ A;  3IXS A;  2IDY A;  2BWF A;  3IAM 1;  2TSS A;  2WWZ A;  3RPF C;  2DN6 A;  4WQM A;  4QAY A;  2ZW1 A;  2DYO A;  1TS3 A;  2D9Z A;  1V1P B;  5C2T B;  3PSC A;  2M1M A;  2RGN B;  2V3S A;  3KLS X;  3BVZ A;  1IRS A;  4RGO S;  4P7I A;  2LWP A;  2ADZ A;  3Q8A A;  1L6V A;  1V97 A;  2ROV A;  2Y5B B;  4ITK A;  2HRJ A;  2GBR A;  4LK0 M;  4OVV A;  5IJM A;  4K2P A;  3N1Y C;  2DZM A;  1B9R A;  1PLS A;  4KIK B;  2JX5 A;  4EUT A;  5FI1 A;  4MY6 A;  2KTR A;  3L4P A;  4TKN A;  1AW7 A;  1J0W A;  3V61 A;  3SD5 A;  2WXJ A;  1U2B A;  1LW3 A;  3QAR A;  4M00 A;  5JXV A;  4A6K A;  3IT6 B;  2RPV A;  2NZ8 B;  1BUI C;  3RNC C;  2AQ1 B;  3V6C B;  4CYE A;  2JZ3 B;  2PTL A;  3NW8 A;  1YQB A;  4RH6 A;  2UU7 A;  5BO4 B;  4A55 A;  1JAL A;  3LDZ E;  3ZO5 B;  1DDV A;  4KAX B;  4H8S A;  1E7V A;  1HZ6 A;  1KM7 A;  2YRY A;  2KWD A;  2ZEQ A;  5CTR C;  3ZVR A;  4KHB A;  4I6P A;  1ACC A;  4AQ7 A;  1UBI A;  2REX A;  2D9W A;  3TMP B;  1GB1 A;  2W54 A;  2PMV A;  3U8Z A;  2RRF A;  2VZK D;  4L6E A;  1NEN B;  1C1Y B;  4ACF A;  2LG1 A;  1UWM A;  4KDI C;  1GNU A;  2Z0O A;  3W5V B;  2X38 A;  4MDK E;  3U30 A;  3CMM B;  4REZ A;  1KLV A;  5EE0 A;  3IVF A;  2KHW B;  1H4R A;  3RNA C;  1YX5 B;  5LON B;  1EAZ A;  3V3X A;  1T0Y A;  2RSU A;  4RFB A;  4EE2 A;  3WAN A;  3CXB B;  1T5X D;  2NBV B;  3RT3 B;  2LD9 A;  2D11 A;  1XKE A;  1TZ1 A;  1Q1O A;  3DCG A;  2LAS A;  1P3Q U;  4OVZ A;  2ELA A;  5GXG B;  2IO1 B;  2LRU A;  4JPS A;  3A8Q A;  2M0A A;  4JKC A;  4E74 A;  4ANX A;  1JML A;  3C0R B;  2WDR B;  3R2I A;  3TCA A;  1HEZ E;  1IP9 A;  5AZG A;  3VH4 B;  4CQN A;  3JYU A;  1E8W A;  3URY A;  1YIW A;  2L2I A;  1DOI A;  1N63 A;  2K49 A;  2M19 A;  2MWS B;  2EC1 A;  4MT5 A;  2RDG A;  4TYZ A;  2EKI A;  3SUZ A;  2IO0 B;  1C78 A;  2KFK B;  3SFD B;  2WQY B;  3R7R A;  4IC7 B;  1WX8 A;  3AEF B;  2ZPN A;  2KUP A;  4IM3 A;  5D6J B;  1TJE A;  2N9P C;  1ZXH A;  1E7P B;  4B6W A;  1M94 A;  3D8E A;  4DBB A;  2JU6 X;  2M4N A;  3ZUN A;  1FMA D;  3Q3N C;  1E8Z A;  4FLH A;  4AP4 C;  4NJC A;  2RLO A;  1TKE A;  3SU8 X;  4RGT A;  2NBU A;  1ZM0 A;  2G3Q B;  3H7P B;  1FEH A;  2H88 B;  3IFW B;  4MSQ B;  1NI3 A;  2MFQ A;  3NG0 A;  3ZIM A;  3E9S A;  1DIK A;  4IDI A;  1P3R A;  2DYN A;  3L08 A;  4ZHP A;  3SFE B;  3AE3 B;  1WIA A;  2KNB A;  3NS8 A;  1J0G A;  4S17 A;  1GPX A;  1ET6 A;  5D3V A;  1WYW B;  4HJK A;  4GZU A;  4HK2 A;  3TO1 A;  1ZGU B;  3M1I B;  3KY9 A;  1B55 A;  1IUE A;  2WXG A;  3E66 A;  3AI5 A;  2RSG A;  1OGW A;  4LJO B;  3RI7 C;  1VJK A;  2OQB A;  1UUP A;  1SIF A;  1Q5W B;  4HAY B;  1I4P A;  4I6L B;  4F7U P;  2KN5 A;  4MM3 A;  3GP7 A;  2LGS A;  2KIG A;  2PIA A;  4W9J A;  3R66 C;  1T77 A;  5FR3 A;  1V5M A;  4ILJ A;  1SJH D;  1PMS A;  4GN1 A;  4O1N A;  4XWW A;  2V0G A;  3T8M A;  4K7S A;  3VR8 B;  4HAV B;  1V6E A;  2BYT A;  5C23 A;  1F0Z A;  2IND C;  1XLQ A;  4XZ4 A;  4JE3 B;  3NWD A;  1EWY C;  2L76 A;  2NTS A;  3RFZ B;  3ZJV A;  3M95 A;  1FNV A;  3JSV B;  2H7D A;  2ZVN A;  2WYQ A;  3NZS A;  1X1G A;  1J7A A;  2Z4D A;  4NJ6 A;  4QXA B;  3PSE B;  1VZ7 A;  3EC8 A;  3QK0 A;  3SDL C;  2N7E A;  1Q0W B;  1YNT E;  1QOF A;  1ZDX A;  3ZRC A;  1K5G B;  2KQ4 X;  2MW5 A;  1MAI A;  1I4H A;  3HW2 B;  3ODW A;  1SB3 C;  2L8J A;  4WWN A;  4MGI E;  1RM6 C;  4HSI A;  1CK1 A;  2COP A;  1X11 A;  2JY6 A;  2BKF A;  2FCM A;  1U4A A;  1PFD A;  4RGM A;  4USA A;  2HTH A;  2JUO A;  3WAP A;  3HK0 A;  4TUU A;  3K9O B;  1T0Q C;  5CX3 A;  2W9N A;  1TKG A;  2KUQ A;  1K53 A;  2QHO A;  4LDT D;  1E5W A;  3Q8F A;  3E9P A;  1DDW A;  3PVU A;  4RNA A;  1S3S G;  4KX6 B;  2K8H A;  5EE1 A;  1S1Q B;  3SR6 A;  1V9J A;  2KX0 A;  3A9J A;  3M62 B;  2PZ1 A;  2GBJ A;  2JXX A;  4DBG A;  2MHJ A;  5IRS A;  2KWC A;  2KQS A;  1TY2 A;  4M02 A;  3KUC B;  2BYV E;  1XXG A;  2D3G A;  2R61 A;  3NUH B;  3E56 A;  2WXN A;  3OAW A;  4ICV A;  3P4R B;  2Z14 A;  2YT1 A;  4JK8 A;  1K50 A;  4NY0 A;  4OSN A;  2DNF A;  2P0H A;  3CF6 E;  4L23 A;  1BTN A;  1V1O A;  4RM8 A;  2BYE A;  2SEB D;  3DDC B;  4IM2 A;  3EFU A;  4N9F 4;  4NAW B;  1NU2 A;  1X05 A;  4F8C B;  1KTK A;  4ARC A;  3A1Q A;  3ODO A;  2NVU I;  4DK5 A;  4MSM B;  4MT7 A;  2JF5 A;  4M01 A;  4PK1 A;  4EZK A;  2FBW B;  3TEX A;  2JYE A;  3H9D A;  1C77 A;  1QKZ A;  2Z59 A;  2PVG C;  2KAC A;  3NVV A;  4E3C A;  3I63 C;  3VTW A;  2M0X A;  1KFY B;  2VH2 A;  2JP2 A;  1I7A A;  3DBL I;  1QQR A;  3ABV B;  4G11 A;  2LEK A;  2D5G A;  3RCZ A;  3IAS 1;  2JZP A;  3KRX A;  1WE6 A;  2RDH A;  2KWV B;  1YD8 U;  3W1Y A;  4WQO B;  1JRO A;  1X1M A;  3ZQ4 A;  2QDF A;  1FO4 A;  2LXC A;  3OHM B;  3APD A;  2GLS A;  2RNR B;  1J19 A;  4S0R A;  2AYO B;  4HJG E;  4DIX A;  2MCN B;  4HAU B;  5JHG A;  1C9F A;  4RF1 A;  4DHZ B;  3RD2 A;  3AB5 A;  2YEP F;  5J3Q A;  1V86 A;  2BGF A;  3P2B A;  2CHX A;  3RZW C;  2L1A A;  4GOU A;  4KHO A;  1WH3 A;  1N62 A;  2BT6 A;  2YVC A;  3AEE B;  1MVK A;  2JRH A;  3ECI A;  3VDZ A;  1KOT A;  1TYG B;  2XN9 C;  3ML9 A;  2KJR A;  2LRW A;  2OHF A;  3FAH A;  4C4V A;  4LLG M;  4C80 A;  3CST A;  3N32 A;  4KZ0 A;  4IFS A;  3AE5 B;  4ZYS A;  3IG3 A;  4ILG B;  2MWN B;  5DIF B;  2VKI A;  3VVW B;  4QJ5 B;  1KI1 B;  2K3U A;  1N3H A;  1EGX A;  3DVG Y;  3MJ5 A;  4P6V F;  4JKB A;  3KSY A;  4A6F B;  4LNI A;  1MHX A;  1D6E C;  2K00 A;  1TZO A;  3HM3 A;  2L0F A;  4ANV A;  1WM2 A;  3AV8 A;  4LCD E;  2V4L A;  4JKE A;  4HCP B;  3SHQ A;  2V3P A;  3AXC A;  2ZKM X;  5FKA C;  4BOZ B;  3AMZ A;  1FB8 A;  3EEC A;  1ZOY B;  4KGR A;  4IAP A;  4LNK A;  5JLJ B;  3QQ8 B;  3KVF B;  2RMM A;  2HTM E;  2NTT A;  1E7U A;  1PGA A;  1RFK A;  1TKY A;  4IM0 A;  5JHA A;  4MJS B;  1DOY A;  4A3P A;  1EF1 A;  1HQR D;  1TQZ A;  4JKG A;  4GDL A;  2CS4 A;  2JQR B;  4W9E A;  3ZKJ C;  3PVW A;  1YN4 A;  3WYF B;  5I2M A;  1Z5S B;  2X0S A;  2LUM A;  3CSF A;  4HRS A;  2XK5 B;  2ZPY A;  1SE9 A;  3I5J C;  4RCO A;  4JGH B;  3X23 A;  1B1Z A;  3P4S B;  3VFK A;  4A3O A;  4Q2J A;  4I6N B;  2HDE A;  1SXT A;  4HDO A;  4BBN F;  1FXA A;  2CU1 A;  4HRO A;  5L95 C;  2RDB C;  5GMV A;  1CZP A;  2BQQ A;  4IKG A;  2MBE A;  4W9F A;  1YMH E;  2O6V A;  4JKA A;  4TQ0 A;  4JWU C;  1KBL A;  1U5G A;  4HB4 B;  1QOA A;  2J53 A;  1WMH B;  2RQ1 A;  3PEG A;  1DRO A;  3ZVV A;  5L83 A;  3T3O A;  5FI0 A;  3SV1 A;  5G5H A;  4PS7 A;  4B9K A;  2G45 B;  5KQ4 A;  2NMQ A;  1FCC C;  5D27 A;  2IPK D;  2OTX A;  3RNF C;  1MFW A;  1GOZ A;  4JKF A;  3JW0 X;  1LGR A;  4HPM B;  4GB9 A;  4BVU C;  2EMS A;  1QF6 A;  1C76 A;  2GB1 A;  2QSD A;  4DDI D;  1YOV B;  3NOB A;  3PPA A;  5JZE B;  3V62 A;  4B6H A;  2KFJ A;  3PVL A;  1E10 A;  4JK7 A;  4ZRQ A;  3BVM A;  4KIK A;  3BY4 B;  1MJD A;  1L6U A;  1L7Y A;  4NZL B;  2LBB A;  2LJ5 A;  5CHV C;  2QKM A;  1WY8 A;  1EVH A;  2Y5C A;  2RVB B;  3ZNH B;  4K1R B;  1FD6 A;  2N7D A;  4C0A A;  1SGH A;  1YJ1 A;  2WU2 B;  2INC C;  2BTE A;  2RUK B;  4OT1 A;  1UNP A;  3AEA B;  4PYZ A;  2Y8F A;  2DFK A;  4YSX B;  4DX9 0;  2KJ6 A;  1OTR B;  1RFA A;  4E71 A;  3P1M A;  1L0Y B;  4YTN B;  4IG7 B;  1I35 A;  4JKD A;  2K1F A;  3GB1 A;  2L0T A;  2J4X A;  4MH0 E;  2B76 B;  1QOB A;  3A4S C;  5FK9 C;  1P0R A;  4W9I A;  2BBC A;  4EMO A;  5EE9 A;  1N61 A;  2LVP A;  3AEB B;  2X8X X;  2KC2 A;  2V9H A;  1FGZ A;  3UQB A;  4GGQ A;  1VBH A;  2JT4 B;  2IO2 B;  4H2A A;  2LI5 A;  3I9V 1;  2ACZ B;  4BAX A;  3NVY A;  1YQ3 B;  3PT2 B;  1BXT A;  2BW2 A;  3H7S A;  4PS3 A;  3OWE B;  2BB6 A;  3T3N A;  3P42 A;  3VH3 B;  3DVG X;  2J7Q B;  1WX9 A;  2LUE A;  3VRB B;  1ZUD 2;  2KQ7 A;  5D7G A;  2NBV A;  1WGR A;  1XEE A;  3GOE A;  3W1S C;  2ON8 A;  3CIR B;  1I4X A;  2K6D B;  3B0A A;  1PGB A;  4AUQ C;  4FJV B;  5DHF B;  4RF0 A;  5E6J A;  5JH5 C;  1NYQ A;  3BIN A;  3DCX A;  1WGG A;  4IUM B;  1V5T A;  2IFS A;  3ODX A;  3MC0 B;  2JRI B;  3TL5 A;  2J42 A;  2WXO A;  1RWS A;  4HB2 B;  1WGK A;  1V5U A;  1ZSQ A;  5T8I A;  4MAC A;  3SEB A;  5TSS A;  5HHD G;  2M56 B;  2KTF A;  1HTQ A;  3SNH A;  2KFK A;  3RMK C;  1UPR A;  4QJ3 B;  3ZRF A;  1D5Z C;  1MG8 A;  5KHQ A;  1GB4 A;  3UIP B;  4AOF A;  1OY2 A;  3DBS A;  1J8C A;  4TSS A;  2W2X C;  2KMC A;  5AUK A;  3VOQ A;  1P1A A;  1NVI D;  5BYQ A;  1SEB D;  3H7P A;  3B2F A;  1UPQ A;  1QZE A;  1JRU A;  3NVZ A;  2MQJ A;  1DGJ A;  2V1Y A;  1JWM D;  2MSE D;  3VTU A;  3BK2 A;  4JWS C;  3RUL A;  4US8 A;  2CB8 A;  2I2Y A;  2R09 A;  2NMB A;  2N23 A;  4PT5 A;  1P7E A;  3B1L X;  1J7C A;  2COA A;  1FOE A;  3DXD A;  3MHZ A;  4MH8 A;  1FHX A;  3TW1 A;  3U7Z A;  3ZJU A;  1K51 A;  2JZZ A;  1F2R I;  1X86 A;  2UZS A;  4KVG B;  5E6N A;  4YTP B;  4F7Z A;  4IW0 A;  4DHJ B;  4G0N B;  5I2S A;  1RYJ A;  4D6W A;  2MP2 B;  1NDD A;  3AJ4 A;  5CLL B;  2JWZ A;  3K9P B;  4TMA B;  2KDB A;  1WRD B;  3T9L A;  4W9H A;  1C79 A;  2FDQ A;  1V8C A;  1LXD A;  5HE1 A;  4D2K A;  2P8V A;  1WGH A;  1EO6 A;  1XLN A;  4FUL A;  3UF8 A;  1XCT L;  1XO3 A;  3RZF A;  3QAQ A;  1FCL A;  1ZPS A;  4N58 A;  2Z0Q A;  4GXB A;  3DWM A;  4P1B C;  1VR9 A;  1CQV A;  2COF A;  4HPP A;  5J3T A;  1WI0 A;  2R2O A;  1C4C A;  3RUI B;  1HB8 A;  1UBQ A;  2ZZP B;  2DX1 A;  2MJ3 A;  1X1F A;  4TV3 A;  2QCZ A;  1BML C;  2D3B A;  3BJI A;  3AH7 A;  5H8Y E;  4A20 A;  1VD2 A;  1UH6 A;  3H8H A;  2KXJ A;  3KH0 A;  1SE3 A;  1OMW A;  2YF0 A;  3VIA A;  2QC8 A;  5HKH A;  2MJE A;  1TGZ B;  2MA9 B;  5D3Y A;  4IWO A;  3W9C B;  1ACA A;  3FLV A;  2FCS A;  1P6S A;  2KYW A;  2AL6 A;  2DIK A;  1WXV A;  4DX8 A;  2CQU A;  1WX7 A;  3AE9 B;  3KUZ A;  4OW0 A;  1E8Y A;  1U5F A;  5D94 A;  1G6J A;  3NRZ A;  2KN4 A;  1IPG A;  1BAK A;  1WGU A;  2D9X A;  2MBB B;  4N59 A;  3UQA A;  3QWZ B;  2SAK A;  1CMX B;  1EM7 A;  5C5B B;  1C4P A;  4QJ4 B;  3ZDT A;  2ZVO A;  4NAW A;  4NSW A;  2W82 A;  3EFC A;  4WJP A;  2Y8G A;  3U7D A;  3MC8 A;  4RGN A;  2CJO A;  5TR5 A;  5IAA C;  1H8C A;  3PV1 A;  2K9X A;  1UNS A;  3KWL A;  3CIK A;  1MG4 A;  4DHZ E;  1N5W A;  2VSZ A;  4HKZ E;  2WDQ B;  2Y5P A;  5C6R A;  1KH0 A;  1NTY A;  2YS5 A;  1VDV A;  2LKO A;  3PP2 A;  5CHF A;  4F7H A;  2GBM A;  2MRP A;  2J52 A;  2XEW A;  3BZD B;  3I3T B;  1I2H A;  5DPR A;  2WX1 A;  1AWE A;  1TJ6 A;  4WSF A;  5KCV A;  3TEY A;  4MM3 B;  1RJ2 A;  2IZV B;  1MPH A;  1Z87 A;  3OJ3 A;  2H7E A;  4BOS C;  1ET9 A;  1YN3 A;  2WXQ A;  4WJ7 A;  3Q3O C;  3DBH I;  5C79 A;  1M4V A;  2FJL A;  4LJP B;  2DKQ A;  4BZA A;  4NNJ B;  4HLE A;  4A6H A;  2W3S A;  2DHJ A;  3N30 A;  4DXG A;  4F7G A;  3UGB B;  3DBH B;  5D3D A;  1ISN A;  4OZA A;  3L13 A;  2INP E;  2ZW0 A;  3DQV A;  3TJP A;  5JHB A;  3IBE A;  2Z13 A;  4XWX A;  4PYU A;  1YN5 A;  2K22 A;  1GAQ B;  3QHT A;  2WXM A;  4FAD A;  4GMV A;  4XX5 A;  4ZRP A;  3UIO B;  1J7B A;  2LVQ A;  3UI3 A;  2G4D B;  5D3I B;  3EA6 A;  1XR0 B;  4GNK B;  4W9G A;  4W9K A;  3BYT B;  1ST7 A;  4WH4 A;  1HTO A;  1IBX A;  1VCB A;  1AWD A;  1WRI A;  4A8X C;  2YS3 A;  2KVR A;  1R7S A;  3ZTC A;  2YT0 A;  3VTV A;  2HTH B;  4BKS D;  3D8D A;  2PLP A;  3MP9 A;  4XWT A;  1V61 A;  3ZNZ B;  4A6F A;  3PLU A;  2KMM A;  3AEG B;  3MHS D;  3QCA A;  2CHW A;  3O96 A;  1WJ6 A;  3MC9 A;  3QIJ A;  1V2Y A;  3ULB A;  1WR6 E;  3L0W B;  5BYR A;  2DWQ A;  2L7R A;  1R4N I;  3CWI A;  3PRP B;  3GE8 C;  3NY5 A;  1E90 A;  1R4M I;  4GDK B;  2K5P A;  1TS5 A;  2D2Q A;  3T06 A;  1FRR A;  3L10 B;  3EGR A;  2I1J A;  4XGA B;  2DA0 A;  4CHJ A;  1R4N B;  2DZK A;  2RGF A;  4II2 B;  4MEM A;  4X57 B;  2NPT B;  1UGJ A;  3ALB A;  5BMI A;  4LTU A;  4OVU A;  1R4M B;  4P1C C;  2PKO A;  3I57 A;  3P63 A;  2Z0E B;  2BF8 B;  2RD0 A;  4EKU A;  4MJS A;  3DHH C;  3V60 A;  5DPT A;  3PO0 A;  1P9D U;  4EOY A;  3KWV A;  2Y7B A;  2QEJ C;  1MI1 A;  1XLO A;  5I4D A;  3AUL A;  1T0R C;  1MPE A;  2DX5 B;  1I4R A;  2C7M B;  5MPO A;  2BS4 B;  2L32 A;  2XK5 A;  2FJ9 A;  4HCN B;  3ZDM C;  3P4P B;  2LZ6 A;  3NSU A;  5IOI A;  2K0P A;  4FBJ B;  1FRD A;  3DPD A;  3R3M A;  2CJN A;  1V81 A;  1L4Z B;  2RR9 A;  3VRA B;  4KKJ A;  4D0N B;  2AQ3 B;  3ZW3 A;  2INN E;  3LXF A;  1WMH A;  3DWG C;  4KSL C;  3PRE A;  2K8C A;  1WJU A;  2L05 A;  1I42 A;  3PLV A;  3P4Q B;  2AWT A;  2GI9 A;  1C4A A;  1I7H A;  2LJI A;  5DCN A;  1OEY A;  5DH9 B;  1OQN A;  1JWS D;  3FIL B;  1NVL A;  1FHO A;  2LGX A;  4ICU A;  2A5U A;  1AQC A;  2R2Q A;  3ONS A;  4KKI A;  2BVC A;  4A9A A;  4NJ7 A;  2LHD A;  1Y8R C;  3ZTD A;  2FE8 A;  2EJ8 A;  3L16 A;  3A4R A;  2E3T A;  3APF A;  2IBI B;  4N6E B;  1BTK A;  4EZJ A;  2DYB A;  2L00 B;  2WDV B;  3NS1 A;  2BWE S;  4HPL B;  2KGX B;  1N60 A;  2WXL A;  2E2X A;  1ENF A;  3MTN B;  1WZ3 A;  4DHJ D;  1JW9 D;  4US9 A;  3KYC D;  4L2Y A;  1WGQ A;  3A9K B;  2KKC A;  2K6Q A;  2LMC A;  2N1V A;  2VH1 A;  1Q67 A;  2N9L A;  4K17 A;  3QBV B;  1OEY J;  4HEA 1;  1UEF A;  1UNQ A;  2D4Q A;  4KHA A;  3KRW A;  1L5P A;  4WJO A;  5GOW B;  5KHO A;  2ZCB A;  3G9W A;  4WJQ A;  3N7C A;  4HHV A;  1STE A;  3Q3J A;  1TIF A;  2CY4 A;  2L1C A;  5G55 A;  1FXI A;  2G9H D;  1PUT A;  3N20 C;  2C9W B;  3IHP C;  5HG2 A;  4Y94 A;  2KDE B;  4K81 A;  2R82 A;  4CHM A;  3DHI C;  1V1P A;  3C19 A;  2N0Y A;  1WXM A;  2K25 A;  2WLB A;  2DEN B;  1BWN A;  2BB5 A;  1DBH A;  3E9O A;  5KQ1 A;  4WJN A;  1VZ8 A;  2BKR B;  1WYG A;  5AZH A;  2VRW B;  4L1R A;  1I4G A;  3DVN V;  5D2M B;  3TUO A;  1P7F A;  4W9L A;  1WSP A;  3R8B A;  3AU5 A;  1CJE A;  2QIL A;  4L1B A;  4XDD A;  1F9J A;  2VRR B;  4AS1 A;  4BKS A;  1PYW D;  1NYR A;  3VAW A;  1Q10 A;  2H89 B;  4M0W B;  4NPN A;  3OAN A;  2DHZ A;  2PJH A;  4MK0 A;  3V05 A;  2ONQ A;  5DI9 B;  2KD0 A;  1L2N A;  1ZXI A;  2WGS A;  1RRB A;  2KDI A;  3VUY A;  4C56 C;  1A70 A;  3HVD A;  1VBG A;  2OOB B;  5EE3 A;  1SJE D;  4J6I A;  3AE1 B;  3UIN B;  4KZC A;  1WFY A;  3KUD B;  4URK A;  3GE3 C;  4FHK A;  1E0Z A;  4JQW C;  3PZD A;  1QQG A;  3AE8 B;  3QJZ A;  1GJZ A;  1XT9 B;  2NS5 A;  4GU2 A;  2CKH B;  1SIJ A;  2QJL A;  1QT9 A;  3SBT A;  3WA0 A;  2C60 A;  2D9Y A;  2O6V B;  4WWP A;  3Q3F A;  2DYQ A;  2JPH A;  1IGC A;  4W9C A;  2DLW A;  3ZLZ A;  4OHJ A;  2GJY A;  2C7N B;  2D07 B;  2PE6 B;  5IO9 A;  1NTV A;  5J17 A;  5H92 C;  5LXI B;  4EJN A;  4EEW A;  3AE2 B;  5IP4 D;  1AAR A;  1V88 A;  2KLC A;  2KR0 A;  4CO7 A;  1U27 A;  3O13 A;  5LXH A;  2WX0 A;  1ZVR A;  4ZHO A;  4DWF A;  3VHT C;  2DLB A;  1WZ0 A;  2MKR A;  2N0S B;  3D32 A;  1EF5 A;  5DHA B;  2V3N A;  4AJW A;  1XD4 A;  5DPW A;  5LLI A;  1KLU D;  3WAL A;  4RMA A;  2WXP A;  2LYD A;  1LQB A;  4ZRJ A;  2O2V B;  4HDQ A;  3AE7 B;  1VRA B;  1T3Q A;  4BKT A;  5LG4 B;  2W2X D;  1WG7 A;  4J3O D;  5FR6 A;  1FNU A;  3PRZ A;  3E9L A;  3KZ1 A;  3P6A A;  1LFD A;  2X18 A;  3DBR I;  3O65 B;  3OJ4 B;  2GUM A;  2L83 A;  4BKG A;  4HKQ A;  4HAT B;  4K7U A;  3Q8C A;  3WAO A;  3FEH A;  1QLB B;  4C00 A;  2N9E B;  3DBR B;  3QA8 A;  5DPS A;  2LOZ A;  1L4D B;  2DZI A;  2WXK A;  1M7R A;  2D3A A;  4KGS A;  1KC7 A;  3PS6 A;  4ANU A;  4ZDV A;  3VR9 B;  3SYX A;  1JWB D;  3TEW A;  4MGK E;  3ETR A;  5LNK 1;  1Z2M A;  3Q8B A;  2MP2 A;  2WHI A;  1Y5O A;  3LJ3 A;  1V5O A;  2NBW B;  4TQ1 A; 
#chains in the Genus database with same CATH homology
 1P98 A;  4MGZ E;  1GGO A;  4FA6 A;  1V49 A;  1D3Z A;  1FXT B;  2R0D A;  2YS1 A;  1RRP B;  4AJY B;  1IYF A;  2LGY A;  3UZT A;  2DAJ A;  1V80 A;  1OQY A;  2KJH B;  3MPX A;  2MDX A;  3R7Q A;  1NI2 A;  1K5D B;  3DVN U;  1MIX A;  2UYZ B;  4PS8 A;  4K2O A;  2WDT B;  3DXC A;  2KTR B;  3A8P A;  5C16 A;  2GMI C;  2KC1 A;  2MLB A;  3QC8 B;  1MKE A;  4W9D A;  4M8M A;  3B08 A;  2PPH A;  1PFJ A;  3X0W A;  1WF9 A;  4A5K A;  4WAA A;  2FIF A;  2FNJ B;  1P5T A;  3PG7 A;  1U5E A;  3M63 B;  3TVV A;  3QX1 A;  4B95 A;  2K2J A;  1M7E A;  3KW5 B;  2IY0 B;  2QKL A;  4KHB B;  1WR1 A;  1RLF A;  4WWO A;  2NR2 A;  2ABD A;  1V89 A;  1C3T A;  4GPT B;  3JSV A;  5JHH A;  3ULC A;  2KOX A;  2ELB A;  3PHX B;  3VUW A;  3W1S A;  2HE7 A;  2Z0D B;  2ZJD A;  2N1W A;  2J0K A;  5L81 A;  5C5B A;  3VUX A;  2KMA A;  4YON A;  2HD5 B;  3ENB A;  1UZX B;  3KYD D;  2YSZ A;  4JIO U;  2GS0 A;  3SBG A;  3NZU A;  1ZC4 B;  2M17 A;  3MDB C;  2FCQ A;  4FJZ A;  3DXE A;  4YL8 A;  4KDL B;  3LJU X;  2COC A;  2UZR A;  4G50 A;  5E6P A;  4HAW B;  4NQK E;  2BPS A;  1WI1 A;  2PEA A;  2CY5 A;  2MBQ A;  2MX2 A;  2LUL A;  1HB6 A;  4GIV A;  2M38 A;  4WVF B;  1HE8 A;  4Z2M B;  4G3X B;  1ZKH A;  2G4S A;  5AZF A;  2N9X A;  4HB0 B;  2CRF A;  4EFO A;  2DHI A;  5D3X A;  3AU4 A;  3PRM B;  1GC7 A;  5EDS A;  2DYM A;  2KZR A;  1JDE A;  4K7W A;  3ZNI D;  2KAN A;  2J0M A;  1WXS A;  1H10 A;  3NHE B;  1RAX A;  2G35 A;  3HM6 X;  5G2N A;  3PTF C;  3EHV A;  1XQQ A;  4RM9 A;  3D8F A;  3HHM A;  4JLC A;  2P0D A;  3OLM D;  2IO3 B;  1PQS A;  2I1K A;  2K8B A;  2W2W A;  4GMX B;  2DTC A;  1WXA A;  1ZC3 B;  4JKH A;  4JK9 A;  2PE9 A;  3VQI A;  4MEL A;  1WJN A;  2M8S A;  1WJ1 A;  1LB1 A;  4IWQ A;  4ZYN A;  4XC2 A;  2XBB C;  1GG3 A;  2FUH B;  4GDK A;  5C1Z A;  1XD3 B;  3N3K B;  2P0F A;  4KV2 A;  1GC6 A;  2AEH A;  2HJ8 A;  2NPT A;  2EMT A;  3FM8 C;  1DYN A;  3FP5 A;  4PQ0 A;  2O6V D;  2I5F A;  4ASW C;  2ZNV C;  2D9V A;  2DX5 A;  4M8N A;  2KLG A;  1W1G A;  3V5W A;  1K8R B;  2IYB A;  1SHC A;  4HAZ B;  3GZN I;  1EUV B;  2I5C A;  2FCN A;  2KCJ A;  2GBN A;  2BCJ A;  2GBK A;  3S2A A;  3L54 A;  4DDG D;  2ZCC A;  3H1U A;  4HXD A;  2CHZ A;  3HIZ A;  2MBO A;  2ROZ B;  2GOW A;  1WJ4 A;  3TFM A;  2EKE C;  1WGY A;  2BYF A;  1QC6 A;  3GYP A;  1FHW A;  2M14 A;  3ZNG C;  3A9J B;  3QWM A;  1W1H A;  1MIZ B;  4F1S A;  1A5R A;  1XCG A;  2IYD B;  2J59 M;  5CLQ B;  4GSW A;  2UVM A;  3RCP A;  4KSK C;  1LM8 B;  1MK9 B;  2JVC A;  1XX0 A;  3ML8 A;  4ZRK A;  5HE2 A;  2KWU B;  2WH5 A;  2GCL A;  1WM3 A;  1KZ7 A;  2J0J A;  2D10 A;  3MJW A;  3A9K A;  4FN2 A;  3A1Q B;  4ANW A;  3H6N A;  1W1D A;  2LXA A;  4ILH A;  5JP4 A;  4FHJ A;  1BT0 A;  3VXW A;  1UEL A;  2Z59 B;  3F0W A;  1NBF C;  4MGY E;  5HE3 A;  1NTI A;  2LOX A;  4II3 B;  4JL9 A;  3GYO A;  1UNR A;  3APC A;  2OJR A;  1WVH A;  1ZW7 A;  4AWJ A;  2V76 A;  3PHW B;  4HB3 B;  4NQL B;  3WIM A;  5J18 A;  4CHK A;  3JVZ X;  1TTN A;  1U5D A;  4ZRI A;  2UWQ A;  4Z2N A;  4FJY A;  2MBH A;  5D3W A;  3HQC A;  2XQN M;  2A4Z A;  4HAX B;  2CAY A;  2COD A;  2KK8 A;  5LOP B;  2B3A A;  4IWP A;  1FGY A;  2KO3 A;  4BBN C;  2Z0P A;  4HWI B;  4IOY X;  5E6O A;  3M3J A;  1TXD A;  2ASQ A;  1E8X A;  5J2R A;  2K2U A;  3RYT A;  1XOD A;  2Q13 A;  2L3Z A;  2YLM A;  5HE0 A;  1KJT A;  1TBE A;  2KDF B;  5AEK B;  3EPY A;  4HVB A;  3WAM A;  1WJM A;  2FID A;  3TBL D;  3ML4 A;  5CHW A;  4BBK A;  2CR5 A;  1KZG A;  3SO6 A;  3P7Z A;  4EZL A;  2FAZ A;  3ENE A;  2GCJ A;  2ZNV B;  5JVL A;  1WE7 A;  2K39 A;  2IY1 B;  2LVO A;  2DHK A;  3A33 B;  1UGM A;  4GOC A;  2C7H A;  4JKG B;  4GDL B;  2KX3 A;  4LDT B;  3A98 B;  2O2V A;  3F5R A;  2AL3 A;  2LGD A;  5J3Y A;  5IA7 A;  2N4F A;  4DXA B;  1Y19 B;  5EFX A;  1YX6 B;  2DAF A;  3TIX A;  1HBK A;  2RPQ A;  3L17 A;  2DKP A;  4BFR A;  1FAO A;  2NCN A;  1V5P A;  1WGD A;  2C5L C;  3DOW A;  1UD7 A;  1U29 A;  3V6E B;  3PGE A;  1GUA B;  1DDM A;  4PNK A;  1MK7 B;  3FSS A;  2DZJ A;  2BWF A;  2WWZ A;  2DN6 A;  2DYO A;  2D9Z A;  3PSC A;  2M1M A;  2RGN B;  2V3S A;  1IRS A;  4P7I A;  2LWP A;  2ADZ A;  2ROV A;  2Y5B B;  2HRJ A;  2GBR A;  4OVV A;  5IJM A;  4K2P A;  2DZM A;  1PLS A;  4KIK B;  4EUT A;  5FI1 A;  4MY6 A;  2KTR A;  4TKN A;  1J0W A;  3V61 A;  3SD5 A;  1U2B A;  1LW3 A;  3QAR A;  4A6K A;  2NZ8 B;  3V6C B;  4CYE A;  2JZ3 B;  1YQB A;  5BO4 B;  3LDZ E;  3ZO5 B;  1DDV A;  4KAX B;  4H8S A;  1E7V A;  1KM7 A;  2YRY A;  2ZEQ A;  5CTR C;  3ZVR A;  4I6P A;  1UBI A;  2REX A;  2D9W A;  3TMP B;  3U8Z A;  4L6E A;  1C1Y B;  2LG1 A;  4KDI C;  1GNU A;  2Z0O A;  4MDK E;  3U30 A;  3CMM B;  1KLV A;  3IVF A;  2KHW B;  1H4R A;  1YX5 B;  5LON B;  1EAZ A;  1T0Y A;  2RSU A;  3WAN A;  3CXB B;  2NBV B;  3RT3 B;  2LD9 A;  2D11 A;  1XKE A;  1TZ1 A;  1Q1O A;  3DCG A;  2LAS A;  1P3Q U;  2ELA A;  2IO1 B;  2LRU A;  3A8Q A;  4JKC A;  4E74 A;  4ANX A;  3C0R B;  3TCA A;  1IP9 A;  5AZG A;  3VH4 B;  3JYU A;  1E8W A;  1YIW A;  2L2I A;  2MWS B;  2EC1 A;  4TYZ A;  3SUZ A;  2IO0 B;  2KFK B;  3R7R A;  4IC7 B;  1WX8 A;  2ZPN A;  2KUP A;  4IM3 A;  5D6J B;  2N9P C;  4B6W A;  1M94 A;  3D8E A;  4DBB A;  2M4N A;  3ZUN A;  4FLH A;  1E8Z A;  4AP4 C;  2RLO A;  3SU8 X;  2NBU A;  1ZM0 A;  2G3Q B;  3H7P B;  3IFW B;  4MSQ B;  2MFQ A;  3ZIM A;  1DIK A;  1P3R A;  2DYN A;  3L08 A;  1WIA A;  2KNB A;  3NS8 A;  1J0G A;  5D3V A;  1WYW B;  4HJK A;  4GZU A;  4HK2 A;  3TO1 A;  1ZGU B;  3M1I B;  3KY9 A;  1B55 A;  3E66 A;  3AI5 A;  2RSG A;  1OGW A;  4LJO B;  2OQB A;  1SIF A;  1Q5W B;  4HAY B;  4I6L B;  4F7U P;  2KN5 A;  4MM3 A;  4W9J A;  3R66 C;  1V5M A;  4ILJ A;  1PMS A;  4GN1 A;  3T8M A;  4K7S A;  4HAV B;  1V6E A;  5C23 A;  4XZ4 A;  2L76 A;  3M95 A;  3JSV B;  2H7D A;  2ZVN A;  2WYQ A;  3NZS A;  1X1G A;  4NJ6 A;  3PSE B;  3EC8 A;  3QK0 A;  3SDL C;  2N7E A;  1Q0W B;  3ZRC A;  1K5G B;  2MW5 A;  1MAI A;  3HW2 B;  3ODW A;  2L8J A;  4WWN A;  4MGI E;  2COP A;  1X11 A;  2JY6 A;  2BKF A;  2FCM A;  1U4A A;  2HTH A;  2JUO A;  3WAP A;  3HK0 A;  4TUU A;  3K9O B;  5CX3 A;  2W9N A;  2QHO A;  4LDT D;  1E5W A;  3E9P A;  1DDW A;  3PVU A;  1S3S G;  2K8H A;  1S1Q B;  1V9J A;  2KX0 A;  3A9J A;  3M62 B;  2PZ1 A;  2GBJ A;  2JXX A;  4DBG A;  2KWC A;  2KQS A;  3KUC B;  2BYV E;  2D3G A;  3OAW A;  4ICV A;  2YT1 A;  4JK8 A;  4NY0 A;  2P0H A;  3CF6 E;  1BTN A;  4RM8 A;  2BYE A;  3DDC B;  4IM2 A;  3EFU A;  4N9F 4;  4NAW B;  1NU2 A;  1X05 A;  4F8C B;  3A1Q A;  3ODO A;  2NVU I;  4DK5 A;  4MSM B;  4MT7 A;  2JF5 A;  4EZK A;  3H9D A;  4E3C A;  3VTW A;  2M0X A;  2JP2 A;  1I7A A;  3DBL I;  4G11 A;  3RCZ A;  3KRX A;  1WE6 A;  2KWV B;  1YD8 U;  3W1Y A;  4WQO B;  1X1M A;  2LXC A;  3APD A;  2RNR B;  1J19 A;  2AYO B;  2MCN B;  4HAU B;  5JHG A;  4DHZ B;  3RD2 A;  5J3Q A;  1V86 A;  2BGF A;  3P2B A;  2CHX A;  3RZW C;  4KHO A;  1WH3 A;  2YVC A;  2JRH A;  3ECI A;  3VDZ A;  1KOT A;  3ML9 A;  2KJR A;  2LRW A;  3CST A;  3N32 A;  4KZ0 A;  4IFS A;  3IG3 A;  4ILG B;  2MWN B;  5DIF B;  2VKI A;  3VVW B;  1KI1 B;  1N3H A;  1EGX A;  3DVG Y;  4JKB A;  3KSY A;  4A6F B;  3HM3 A;  2K00 A;  2L0F A;  4ANV A;  1WM2 A;  4LCD E;  2V4L A;  4JKE A;  4HCP B;  3SHQ A;  3AXC A;  4BOZ B;  1FB8 A;  3EEC A;  4IAP A;  5JLJ B;  3QQ8 B;  3KVF B;  4IM0 A;  1E7U A;  5JHA A;  4MJS B;  4A3P A;  1EF1 A;  1TQZ A;  4JKG A;  4GDL A;  2CS4 A;  4W9E A;  3ZKJ C;  3PVW A;  3WYF B;  1Z5S B;  2X0S A;  3CSF A;  2XK5 B;  2ZPY A;  1SE9 A;  4JGH B;  3X23 A;  3VFK A;  4A3O A;  4I6N B;  4HDO A;  4BBN F;  2CU1 A;  5L95 C;  5GMV A;  2MBE A;  4W9F A;  4TQ0 A;  2O6V A;  4JKA A;  1KBL A;  1U5G A;  4HB4 B;  3ZVV A;  1WMH B;  2RQ1 A;  3PEG A;  1DRO A;  5L83 A;  5FI0 A;  3SV1 A;  4PS7 A;  4B9K A;  2G45 B;  5KQ4 A;  5D27 A;  2OTX A;  4JKF A;  3JW0 X;  4HPM B;  4GB9 A;  4BVU C;  2EMS A;  4DDI D;  3PPA A;  3NOB A;  5JZE B;  3V62 A;  4B6H A;  2KFJ A;  3PVL A;  4JK7 A;  4KIK A;  3BY4 B;  1L7Y A;  2LBB A;  2LJ5 A;  5CHV C;  2QKM A;  1WY8 A;  1EVH A;  2RVB B;  3ZNH B;  4K1R B;  2N7D A;  4C0A A;  1SGH A;  1YJ1 A;  2RUK B;  1UNP A;  4PYZ A;  2Y8F A;  2DFK A;  4DX9 0;  2KJ6 A;  1OTR B;  1RFA A;  4E71 A;  1I35 A;  4IG7 B;  4JKD A;  2K1F A;  2L0T A;  4MH0 E;  3A4S C;  1P0R A;  4W9I A;  4EMO A;  2LVP A;  2KC2 A;  1FGZ A;  3UQB A;  4GGQ A;  1VBH A;  2JT4 B;  2IO2 B;  2LI5 A;  3PT2 B;  3H7S A;  4PS3 A;  3VH3 B;  3DVG X;  2J7Q B;  1WX9 A;  2LUE A;  2KQ7 A;  5D7G A;  1WGR A;  3GOE A;  3W1S C;  3B0A A;  2K6D B;  4AUQ C;  4FJV B;  5DHF B;  5JH5 C;  3BIN A;  1WGG A;  4IUM B;  1V5T A;  2IFS A;  3ODX A;  2JRI B;  3TL5 A;  4HB2 B;  1V5U A;  1ZSQ A;  2KTF A;  3SNH A;  2KFK A;  1UPR A;  3ZRF A;  1MG8 A;  5KHQ A;  3UIP B;  4AOF A;  1OY2 A;  3DBS A;  1J8C A;  2W2X C;  2KMC A;  3VOQ A;  1P1A A;  3H7P A;  1UPQ A;  1QZE A;  1JRU A;  2MQJ A;  2V1Y A;  2MSE D;  3VTU A;  3RUL A;  2CB8 A;  2R09 A;  2NMB A;  2N23 A;  3B1L X;  2COA A;  1FOE A;  3DXD A;  1FHX A;  3TW1 A;  2JZZ A;  1X86 A;  2UZS A;  4KVG B;  5E6N A;  4F7Z A;  4IW0 A;  4DHJ B;  4G0N B;  2MP2 B;  1NDD A;  3AJ4 A;  5CLL B;  2JWZ A;  3K9P B;  2KDB A;  1WRD B;  3T9L A;  4W9H A;  2FDQ A;  1LXD A;  5HE1 A;  2P8V A;  1WGH A;  1EO6 A;  4FUL A;  3UF8 A;  3RZF A;  3QAQ A;  2Z0Q A;  4GXB A;  2COF A;  5J3T A;  1WI0 A;  2R2O A;  3RUI B;  1HB8 A;  1UBQ A;  2ZZP B;  2DX1 A;  4TV3 A;  1X1F A;  3BJI A;  4A20 A;  1VD2 A;  1UH6 A;  2KXJ A;  3KH0 A;  1OMW A;  2YF0 A;  3VIA A;  5HKH A;  1TGZ B;  2MA9 B;  5D3Y A;  4IWO A;  1ACA A;  3FLV A;  2FCS A;  1P6S A;  2AL6 A;  2DIK A;  1WXV A;  4DX8 A;  2CQU A;  1WX7 A;  3KUZ A;  1E8Y A;  1U5F A;  5D94 A;  1G6J A;  1IPG A;  1BAK A;  1WGU A;  2D9X A;  2MBB B;  3UQA A;  3QWZ B;  1CMX B;  5C5B B;  3ZDT A;  2ZVO A;  4NAW A;  4NSW A;  4WJP A;  2Y8G A;  3U7D A;  5TR5 A;  5IAA C;  1H8C A;  3PV1 A;  3CIK A;  4DHZ E;  2VSZ A;  5C6R A;  1NTY A;  2YS5 A;  2LKO A;  3PP2 A;  5CHF A;  4F7H A;  2GBM A;  2MRP A;  2XEW A;  3I3T B;  1I2H A;  5DPR A;  2WX1 A;  1AWE A;  1TJ6 A;  4WSF A;  5KCV A;  1RJ2 A;  2IZV B;  1MPH A;  1Z87 A;  3OJ3 A;  2H7E A;  4BOS C;  4WJ7 A;  3DBH I;  5C79 A;  2FJL A;  4LJP B;  2DKQ A;  4NNJ B;  4HLE A;  4A6H A;  2DHJ A;  3N30 A;  4F7G A;  3UGB B;  1ISN A;  3L13 A;  3DQV A;  3TJP A;  5JHB A;  3IBE A;  4XWX A;  4PYU A;  3QHT A;  4FAD A;  4GMV A;  4XX5 A;  3UIO B;  2LVQ A;  2G4D B;  1XR0 B;  4W9G A;  4W9K A;  1ST7 A;  1VCB A;  2YS3 A;  2KVR A;  3ZTC A;  2YT0 A;  3VTV A;  2HTH B;  4BKS D;  3D8D A;  1V61 A;  3ZNZ B;  4A6F A;  3PLU A;  3QCA A;  3MHS D;  2CHW A;  3O96 A;  1WJ6 A;  3QIJ A;  1V2Y A;  3ULB A;  1WR6 E;  3L0W B;  2L7R A;  1R4N I;  3PRP B;  3NY5 A;  1E90 A;  1R4M I;  4GDK B;  2D2Q A;  3T06 A;  3L10 B;  2I1J A;  2DA0 A;  4CHJ A;  2DZK A;  2RGF A;  4II2 B;  4MEM A;  4X57 B;  2NPT B;  3ALB A;  4OVU A;  2Z0E B;  2BF8 B;  2RD0 A;  4EKU A;  4MJS A;  3V60 A;  5DPT A;  1P9D U;  4EOY A;  2Y7B A;  3AUL A;  2DX5 B;  2C7M B;  2XK5 A;  2FJ9 A;  4HCN B;  3ZDM C;  2LZ6 A;  3NSU A;  4FBJ B;  3DPD A;  3R3M A;  1V81 A;  2RR9 A;  4D0N B;  3ZW3 A;  1WMH A;  4KSL C;  3PRE A;  2K8C A;  1WJU A;  2L05 A;  1I42 A;  3PLV A;  2AWT A;  5DCN A;  1OEY A;  5DH9 B;  1OQN A;  1NVL A;  1FHO A;  2LGX A;  4ICU A;  2A5U A;  1AQC A;  2R2Q A;  3ONS A;  4NJ7 A;  1Y8R C;  3ZTD A;  2EJ8 A;  3L16 A;  3A4R A;  3APF A;  2IBI B;  1BTK A;  4EZJ A;  2DYB A;  2L00 B;  4HPL B;  2BWE S;  2KGX B;  2E2X A;  3MTN B;  1WZ3 A;  4DHJ D;  3KYC D;  1WGQ A;  3A9K B;  2KKC A;  2K6Q A;  2N1V A;  1Q67 A;  4K17 A;  3QBV B;  1OEY J;  1UEF A;  1UNQ A;  2D4Q A;  4KHA A;  3KRW A;  4WJO A;  5GOW B;  5KHO A;  2ZCB A;  3G9W A;  4WJQ A;  3N7C A;  4HHV A;  3Q3J A;  2CY4 A;  2L1C A;  5G55 A;  2C9W B;  3IHP C;  4Y94 A;  2KDE B;  4K81 A;  2R82 A;  4CHM A;  2N0Y A;  1WXM A;  2K25 A;  2DEN B;  1BWN A;  1DBH A;  3E9O A;  5KQ1 A;  4WJN A;  5AZH A;  2BKR B;  2VRW B;  3DVN V;  5D2M B;  4W9L A;  3AU5 A;  1F9J A;  2VRR B;  4BKS A;  3VAW A;  4M0W B;  4NPN A;  3OAN A;  2DHZ A;  2PJH A;  4MK0 A;  5DI9 B;  2KD0 A;  1L2N A;  1RRB A;  2KDI A;  3VUY A;  1VBG A;  2OOB B;  4J6I A;  3UIN B;  4KZC A;  1WFY A;  3KUD B;  4URK A;  4FHK A;  4JQW C;  3PZD A;  1QQG A;  3QJZ A;  1GJZ A;  1XT9 B;  2NS5 A;  4GU2 A;  2CKH B;  3SBT A;  3WA0 A;  2C60 A;  2D9Y A;  2O6V B;  4WWP A;  3Q3F A;  2DYQ A;  2JPH A;  4W9C A;  2DLW A;  3ZLZ A;  2GJY A;  2C7N B;  2D07 B;  2PE6 B;  1NTV A;  5J17 A;  5LXI B;  4EJN A;  4EEW A;  1AAR A;  1V88 A;  2KLC A;  4CO7 A;  1U27 A;  5LXH A;  2WX0 A;  1ZVR A;  4DWF A;  3VHT C;  1WZ0 A;  2MKR A;  3D32 A;  1EF5 A;  5DHA B;  4AJW A;  1XD4 A;  5DPW A;  5LLI A;  3WAL A;  4RMA A;  2LYD A;  1LQB A;  4ZRJ A;  2O2V B;  4HDQ A;  4BKT A;  2W2X D;  1WG7 A;  5FR6 A;  3PRZ A;  3E9L A;  3KZ1 A;  3P6A A;  1LFD A;  2X18 A;  3DBR I;  3O65 B;  3OJ4 B;  4BKG A;  4HAT B;  4K7U A;  3WAO A;  3FEH A;  2N9E B;  3QA8 A;  5DPS A;  2LOZ A;  2DZI A;  1M7R A;  1KC7 A;  3PS6 A;  4ANU A;  4ZDV A;  3SYX A;  4MGK E;  1Z2M A;  2MP2 A;  1Y5O A;  3LJ3 A;  1V5O A;  2NBW B;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...