4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein-tyrosine kinase 2-beta
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
4W9IA 3PHWB 4ZRIA 3D32A 2R09A 5L95C 2COAA 2BKRB 5CLLB 4EOYA 2YVCA 2K2JA 3OANA 5AZFA 1MAIA 1UBQA 4GXBA 2J7QB 3AU4A 1WX7A 1I7AA 1X05A 2LXAA 2DLWA 3MHSD 1ZW7A 4KHAA 1BTNA 1PFJA 2V3SA 4NSWA 1WY8A 4BKSA 4F8CB 3P2BA 4B95A 1X1FA 2HTHA 1WXVA 2BGFA 2GCLA 2G45B 2WYQA 1NTYA 2CB8A 4CO7A 4IM2A 2N9PC 3CMMB 2CU1A 4ZDVA 1V5TA 2K25A 1LFDA 1ZM0A 1PLSA 2HRJA 1J0WA 5JH5C 1WMHB 3OJ3A 3N3KB 2MW5A 3CXBB 1WG7A 2KTRA 4II3B 1R4NI 3ML9A 4ZRJA 2IFSA 2DENB 4MGYE 4AJWA 4KSKC 2LYDA 2WX0A 2Z0OA 4CHMA 1UZXB 2K00A 4ANUA 3SHQA 2K6DB 5J2RA 3FSSA 3HHMA 1E90A 1SE9A 2N7EA 3ENEA 3RZFA 5DHAB 4GB9A 5CHVC 2W2XC 2KQ7A 4HLEA 2CQUA 3OAWA 2NBVB 4B9KA 2Z0PA 1WJUA 2BYFA 3X0WA 2JRIB 2K8CA 2LJ5A 2LVOA 4NPNA 2D2QA 2ZCCA 2PJHA 3VH3B 3KYCD 5DPTA 2HD5B 5IA7A 3IVFA 1OQYA 4KHBB 4HPLB 1IRSA 4WSFA 2DHKA 2CY4A 5C6RA 1OTRB 2LUEA 2M0XA 4IM3A 2ZVOA 2MWSB 1OEYA 3DBHI 4IWOA 2JZ3B 2D9VA 4BFRA 3A98B 1J19A 2NR2A 3H7PB 4WQOB 3QWMA 2I1JA 1EAZA 1WVHA 2KWVB 1WRDB 2N1VA 4ZYNA 3ML4A 1RLFA 2DKPA 1C1YB 4KZ0A 1WJNA 3WA0A 1EF5A 1E5WA 2KWCA 3TJPA 1SHCA 4K1RB 1W1HA 4MH0E 2LRUA 3APCA 1DBHA 1PQSA 1J8CA 2MP2B 1WGQA 1WJ6A 3PRMB 2ZJDA 1QZEA 2DKQA 1KJTA 2O6VB 5DI9B 4PS3A 4JQWC 3DVNU 2W2WA 3VUYA 2I5FA 3SNHA 3DCGA 2KWUB 4AUQC 2YF0A 1Z2MA 5D27A 3I3TB 4HAUB 1WM3A 4GGQA 2DX5B 4ANVA 2IO1B 3DVNV 2P8VA 1TXDA 3UZTA 1FB8A 3VUXA 2M38A 2GBKA 4XWXA 2O6VD 2FUHB 2GS0A 2G4SA 1V2YA 5JHGA 4ANWA 3V60A 4E74A 1NBFC 4LJPB 1IP9A 3A8QA 4K7UA 3PGEA 2ELAA 3TFMA 2KOXA 2KQSA 3IBEA 4MELA 2CY5A 3GYOA 1X1GA 4G50A 1MIXA 1OEYJ 2ROZB 2RNRB 5AZHA 3W1YA 1WF9A 3JVZX 3A9JA 3PHXB 3TL5A 3ULCA 4NAWB 4HJKA 1UPQA 2RVBB 3TMPB 3MPXA 4IM0A 2R0DA 1YQBA 3S2AA 3JSVA 2ZPNA 2YS3A 1MIZB 1Z5SB 1P1AA 4M8MA 3DBSA 1OY2A 5C79A 1I2HA 2UZRA 2MA9B 2IYDB 4HAYB 4LJOB 1ZKHA 1OQNA 3CIKA 1P0RA 2R2QA 4HWIB 1RRBA 4W9HA 2FDQA 2LKOA 3A9KB 2Y7BA 1WIAA 4K2PA 3L54A 3PLUA 1RRPB 4GDKB 2IO0B 4PYUA 4A6FB 4WJQA 2NCNA 2I1KA 4DHZB 1X1MA 4BKGA 4DDGD 1Q0WB 3QHTA 1E7VA 3MJWA 5KHQA 1HE8A 1WXAA 1V6EA 1UNPA 1SIFA 5HE0A 1X86A 3ZNZB 1RFAA 3UGBB 4DBBA 1TQZA 2VRRB 2NS5A 2N9EB 1TGZB 2BYEA 2ZNVC 2DZMA 1UNRA 2L3ZA 2C5LC 3ZDTA 2NPTB 4GSWA 3ZTCA 1MK7B 4KAXB 2MBOA 5HE2A 4X57B 3QARA 2D3GA 4WWPA 1C3TA 4F7HA 3LJ3A 3ODWA 1ZC4B 2N0YA 4P7IA 2BWFA 4XC2A 3BY4B 4B6HA 3BJIA 2IYBA 4GU2A 3FP5A 3D8EA 1DDVA 3R3MA 3RCZA 4HDQA 1Y8RC 2LXCA 4MM3A 5D3XA 2FJ9A 2NBUA 4KHOA 3QX1A 1FGYA 5EFXA 2GOWA 4HXDA 1WJMA 3PS6A 3H9DA 1N3HA 1AARA 2IY1B 4N9F4 3F0WA 3ZRCA 2HE7A 3SV1A 4PQ0A 1EO6A 1P3QU 3QAQA 1IPGA 2JRHA 2YS1A 2NPTA 3IFWB 1TZ1A 2DFKA 1IYFA 2YSZA 3KZ1A 4GDLA 2KLCA 5LOPB 1E8WA 3SDLC 5DCNA 4PNKA 3LJUX 3ZUNA 1B55A 3RYTA 1H10A 3H6NA 2KC2A 4PYZA 3HM6X 4ZRKA 3HW2B 5J3QA 1ZGUB 2J0MA 3NZUA 4IUMB 2QKMA 2RR9A 2RGFA 2RSGA 2D9WA 2HTHB 2CKHB 4A6HA 2FCSA 2KX0A 2I5CA 1MKEA 1NI2A 3K9OB 4NQLB 4IWPA 2DZIA 1Q1OA 1WGYA 3W1SA 2MBQA 4YONA 2WH5A 1U2BA 4Y94A 4IWQA 1XT9B 2KTRB 2KJHB 1KOTA 4BKSD 1U4AA 2DAFA 4FN2A 2ROVA 3NZSA 1RJ2A 2ABDA 2BKFA 4AP4C 2K2UA 3SO6A 4HCNB 1V5PA 5L83A 3WAOA 3TIXA 2DZJA 2CS4A 3NSUA 3M62B 2MKRA 5DH9B 5D3YA 4RM9A 4W9KA 5C23A 4HB0B 2JXXA 2DTCA 4HAZB 1E8YA 3T06A 5JLJB 1WR6E 1NTIA 2YT1A 4K81A 4MGIE 3SD5A 4NQKE 3DVGX 2PPHA 4LDTB 2KK8A 3TBLD 2PE6B 2FIDA 4EKUA 2P0FA 1P5TA 4HAVB 3R7QA 1Y19B 3WIMA 3MTNB 4WWNA 1WE7A 4W9JA 3Q3FA 1WZ3A 1WXSA 3ZRFA 3K9PB 5JZEB 1GJZA 3VHTC 3RUIB 3U8ZA 4FADA 2JPHA 1WGDA 5GMVA 4MSMB 3PV1A 2XK5A 2W2XD 2ADZA 4K2OA 5LLIA 3CSTA 3PEGA 3NHEB 3ZVVA 1TTNA 3QC8B 3D8DA 4LDTD 3VTVA 4E71A 1I35A 5CHFA 2DYNA 1LB1A 5KCVA 4GMXB 2OQBA 2D10A 2AWTA 1FOEA 4NNJB 2IO3B 3DXEA 1UGMA 2D4QA 2ZPYA 2LI5A 3UINB 5AEKB 1FHXA 2AEHA 2AL6A 2DZKA 3KUZA 4C0AA 5E6OA 2LOZA 1Z87A 2GMIC 2D11A 3EECA 2MX2A 4OVUA 3ZTDA 1FHWA 2Y5BB 2YT0A 4A5KA 2KGXB 1UEFA 2RPQA 2KDFB 4HATB 2L76A 2WWZA 1M7RA 2D07B 2AL3A 2O2VA 4EZJA 5D6JB 1V88A 2JF5A 3KYDD 3O96A 2J59M 4DK5A 2OTXA 1HB8A 1XCGA 5D3WA 1P6SA 2G3QB 4TV3A 1V86A 1E7UA 4TYZA 4GOCA 3PVUA 1VCBA 2REXA 3GYPA 4TQ0A 3VQIA 1V89A 3SYXA 4KIKA 1TJ6A 4A3PA 4XX5A 1BTKA 3H1UA 2D9XA 3CSFA 3GOEA 5C16A 3VTWA 4BOZB 1WZ0A 3A9JB 2BCJA 3DBRI 1NDDA 2JP2A 2KDEB 3UQBA 2CHZA 2KXJA 3GZNI 2KDIA 3NY5A 4MDKE 3JSVB 2XQNM 4KSLC 3APDA 1A5RA 5DPSA 1J0GA 1UD7A 1ST7A 1YIWA 3DQVA 2DAJA 4G0NB 2M14A 5LONB 3PP2A 4ANXA 4H8SA 1WE6A 3PRZA 2KLGA 4BBNF 4FBJB 5LXHA 3FLVA 3VUWA 5BO4B 2KVRA 2EKEC 5CX3A 5G55A 1U29A 1WR1A 4HHVA 2KFJA 1FGZA 3DOWA 3QJZA 4W9CA 4EZKA 4GPTB 3A4SC 2JUOA 3PVLA 3QBVB 5C5BA 3A1QA 2L0FA 4TQ1A 3ZIMA 4EUTA 4PS8A 2ELBA 3V6CB 3TO1A 3PVWA 2ZNVB 2VRWB 3B1LX 1DDWA 2DYQA 2ZEQA 2H7DA 3QK0A 2C9WB 1UELA 2COFA 1WGGA 1LW3A 2N23A 4DHZE 2Y8GA 2K6QA 2KJRA 4AJYB 2JZZA 1NVLA 2Q13A 3UIPB 1Q67A 1WH3A 3WANA 2LVQA 2FIFA 1M94A 3NOBA 4URKA 2LWPA 2IY0B 3RT3B 3WAMA 3ZNGC 5TR5A 3OLMD 1K5DB 3L16A 2KN5A 2QHOA 2MRPA 3KSYA 3V6EB 4K7WA 3AJ4A 3AULA 1DDMA 2UVMA 1L7YA 4HAWB 1M7EA 1R4MI 2E2XA 1LQBA 2FCNA 2KFKA 3L10B 2VSZA 2J0KA 1WM2A 3VDZA 2KHWB 2JVCA 4GDLB 4WJPA 2Z59B 1E8ZA 2ZCBA 2DYOA 1GC6A 1ACAA 2M8SA 3RD2A 2DN6A 4FJZA 3P6AA 1ISNA 4GMVA 4NY0A 2ZVNA 2FCQA 2G35A 2W9NA 2D9ZA 2NMBA 2XBBC 1U5EA 2MCNB 2C7MB 2LGDA 2LZ6A 3M95A 1BT0A 1NU2A 2MQJA 1EUVB 2KZRA 5FR6A 4FJVB 3ZVRA 1GC7A 4DX90 4DDID 2EC1A 4WVFB 1S1QB 4ICVA 3C0RB 3ODXA 2LG1A 4W9DA 1XKEA 5CLQB 2KJ6A 1XD4A 4HPMB 3UQAA 2C7HA 4FLHA 4WWOA 3PPAA 4FULA 4FJYA 2KDBA 3WYFB 1WJ4A 4F7ZA 2KO3A 2L00B 4KDIC 1XQQA 4NJ7A 1X11A 1H4RA 3F5RA 4IAPA 3T8MA 1ZSQA 3EHVA 4MGZE 1V80A 5D3VA 2NBWB 2KD0A 2GBJA 4KVGB 2LASA 2COCA 3CF6E 4II2B 2RSUA 1Q5WB 4W9LA 3L0WB 2YS5A 2CR5A 3W1SC 4IFSA 4I6NB 4KDLB 3KUDB 2K8HA 1WI1A 2UWQA 2L05A 4BBNC 2CHXA 3M63B 1WGHA 1RAXA 4ASWC 3KH0A 3OJ4B 1U5GA 3UF8A 3H7SA 2KUPA 3APFA 1NTVA 2EJ8A 3PTFC 3SUZA 1D3ZA 4FHJA 3QWZB 2GBRA 2XK5B 1KM7A 2JT4B 3PG7A 2KKCA 1G6JA 1U27A 2COPA 4HB4B 3T9LA 3M3JA 1V49A 4MJSA 2ASQA 3V62A 3FM8C 2LGXA 5LXIB 3PRPB 1F9JA 4IG7B 4DX8A 3N30A 3KRWA 2P0HA 1YX5B 4BOSC 4HVBA 2MLBA 3ZO5B 3FEHA 3TW1A 5KQ1A 1EF1A 3VFKA 4OVVA 2DYMA 1WI0A 2Z0DB 2EMTA 3P7ZA 2MFQA 2DYBA 2D9YA 1FHOA 4DXAB 4MK0A 2PZ1A 1ZVRA 2AYOB 2B3AA 2L7RA 1V5MA 2C7NB 1MPHA 1YX6B 2YLMA 4HB3B 3R7RA 4MT7A 3DBLI 2O2VB 1QC6A 4A3OA 3QA8A 4A20A 2FAZA 1KLVA 2KTFA 1W1DA 2A5UA 2V4LA 4DWFA 2JWZA 5IJMA 3L17A 4DBGA 2RLOA 3PSCA 2MBBB 1GNUA 4GZUA 2V1YA 1HBKA 1XR0B 4MGKE 3O65B 1FAOA 4KIKB 4IW0A 3SU8X 5D94A 2BWES 1KZ7A 3U7DA 2Z0QA 4BKTA 2ZZPB 2N9XA 2RGNB 2IBIB 5E6NA 1PMSA 3MDBC 1GUAB 3HQCA 2A4ZA 3D8FA 4TKNA 5HE1A 5EDSA 4W9GA 3VAWA 5D2MB 3VTUA 1WMHA 1WYWB 5KQ4A 4HAXB 4CHJA 1W1GA 3PZDA 2PE9A 4WJNA 3B08A 4PS7A 4JGHB 4DHJB 4BBKA 5G2NA 5GOWB 2M17A 3UIOB 2GCJA 1MK9B 2OJRA 1JRUA 2KC1A 2YRYA 1Y5OA 4IC7B 3ULBA 1WJ1A 1I42A 1H8CA 3ZKJC 2R2OA 4JL9A 1UPRA 2DHZA 3ECIA 4WAAA 2LULA 4M0WB 2GBNA 3M1IB 4RMAA 3ZW3A 2NZ8B 4DHJD 3L13A 1BAKA 1L2NA 4FHKA 2LRWA 1WGUA 3PT2B 1TBEA 2FJLA 5FI1A 1P9DU 5J18A 4B6WA 3HIZA 4MY6A 4WJ7A 3N7CA 3DPDA 5C5BB 1VD2A 3HK0A 2WDTB 3A1QB 3IG3A 2BYVE 2KMCA 5DIFB 2C60A 3ONSA 1XX0A 1AWEA 4WJOA 4YL8A 2PEAA 2M1MA 2KNBA 1U5DA 1S3SG 4AOFA 2EMSA 3PREA 4EZLA 1V5UA 4EJNA 1E8XA 4W9FA 3V61A 1FXTB 1WX9A 2MDXA 1UH6A 3QCAA 1MG8A 3H7PA 3VOQA 5CHWA 4LCDE 3PSEB 3KY9A 4AWJA 4G11A 2K1FA 2N1WA 1ZC3B 4A6KA 2MBHA 4EFOA 3LDZE 2KX3A 4CYEA 2IO2B 2FCMA 3NS8A 3ML8A 3RCPA 2CODA 2HJ8A 2MP2A 2L8JA 4K17A 1BWNA 3R66C 1EGXA 5IAAC 2DHIA 2KFKB 1V81A 3EC8A 2O6VA 2DX1A 4JIOU 1YD8U 3V5WA 2GBMA 3RZWC 4HK2A 3A4RA 4CHKA 3WALA 1SGHA 4TUUA 3QIJA 2OOBB 3TVVA 2L0TA 2DX5A 3G9WA 4J6IA 2LD9A 3VXWA 1WGRA 1UBIA 4ICUA 3KW5B 2XEWA 4BVUC 3EFUA 1XD3B 2NVUI 2BF8B 5L81A 3N32A 4GIVA 2DHJA 1YJ1A 2LBBA 3VIAA 2LOXA 5HE3A 1K8RB 5JP4A 1WFYA 1WXMA 3IHPC 3WAPA 3Q3JA 3ZDMC 4L6EA 4NJ6A 2P0DA 4Z2MB 1CMXB 3ODOA 3KUCB 2J0JA 5JHHA 2H7EA 5KHOA 2K39A 5HKHA 3A33B 3B0AA 1P98A 4Z2NA 4NAWA 3QQ8B 4K7SA 3DDCB 3U30A 2FNJB 3HM3A 1V61A 2QKLA 5DPRA 2LVPA 1K5GB 5J3YA 5J3TA 1T0YA 2KMAA 5AZGA 1U5FA 3EPYA 2KCJA 1OMWA 4HDOA 3ZLZA 4EMOA 1EVHA 3ALBA 3X23A 1DROA 1XODA 3DXCA 3A9KA 2MWNB 2X18A 4MEMA 2MBEA 4GDKA 1KZGA 4A6FA 4I6LB 5DHFB 2L2IA 2WX1A 3AXCA 4IOYX 3L08A 5CTRC 2IZVB 2KANA 5JHBA 2CRFA 2DA0A 3ZNHB 4KV2A 2LGYA 2GJYA 4JLCA 2N7DA 3RULA 3TCAA 4M8NA 1HB6A 1QQGA 4FA6A 4F7UP 2RD0A 2UZSA 2G4DB 1LXDA 3AU5A 2M4NA 4D0NB 1V9JA 4I6PA 4HB2B 3VH4B 5C1ZA 3A8PA 2N4FA 3DXDA 2BPSA 4E3CA 3AI5A 3PLVA 2Y8FA 4RM8A 2CAYA 1KI1B 2VKIA 3ZNID 1GG3A 2Z0EB 1V5OA 1WX8A 2UYZB 4MJSB 1AQCA 2V76A 5J17A 3BINA 2L1CA 4F1SA 4G3XB 2RQ1A 5JHAA 3KVFB 5FI0A 1UNQA 4GN1A 3KRXA 3VVWB 2RUKB 3DVGY 4XZ4A 1P3RA 1LM8B 4F7GA 3JYUA 2CHWA 1OGWA 2MSED 4W9EA 5DPWA 2JY6A 4HCPB 2K8BA 4EEWA 4MSQB 5D7GA 1DYNA 3JW0X 5E6PA 4KZCA
chains in the Genus database with same CATH superfamily
4LTUA 4W9IA 3PHWB 2WXNA 1I4GA 1FXAA 4ZRIA 3D32A 2R09A 3AE7B 5L95C 2COAA 2BKRB 4REZA 1JWAD 5CLLB 4EOYA 2YVCA 3NVZA 1PGAA 1ROEA 3ENBA 2K2JA 3OANA 5AZFA 2B76B 1SE3A 1MAIA 4KGSA 1UBQA 4GXBA 1F2RI 3NUHB 2XNAC 3RFZB 5BYQA 2WXMA 2J7QB 4XYCA 1GOZA 3AU4A 1WX7A 1I7AA 1X05A 2LXAA 2DLWA 1M4VA 3MHSD 1ZW7A 4KHAA 1BTNA 4J3OD 5EE0A 1SJED 1PFJA 1HA5A 2V3SA 1OQQA 4NSWA 1WY8A 4BKSA 4F8CB 3P2BA 4ACFA 4B95A 1X1FA 2HTHA 2QSDA 1WXVA 2BGFA 2GCLA 2G45B 2WYQA 2ON8A 1NTYA 1FMAD 2CB8A 4CO7A 2UU7A 4IM2A 4PK1A 2N9PC 3CMMB 1JDEA 2CU1A 2JZPA 4ZDVA 1V5TA 1CJEA 2K25A 1LFDA 1ZM0A 1PLSA 1J7BA 2QDFA 2HRJA 3VRAB 1J0WA 5JH5C 1WMHB 3OJ3A 3N3KB 2MW5A 3CXBB 1WG7A 2KTRA 4II3B 1R4NI 3ML9A 4JKHA 4ZRJA 3V05A 4AS1A 2IFSA 3RPFC 4LLGM 1P7EA 2DENB 4MGYE 4AJWA 5JXVA 1FFVA 2AX5A 4KSKC 2LYDA 2WX0A 2Z0OA 4CHMA 1UZXB 2K00A 4C4VA 4ANUA 4L1RA 3SHQA 1BXTA 2K6DB 5J2RA 3KQ4A 3FSSA 3HHMA 1E90A 1SE9A 4LNNA 3FVCA 1YOVB 2N7EA 3ENEA 1F2RC 3RZFA 3W9CB 5DHAB 4GB9A 3DBLB 2RDHA 5CHVC 1JROA 2W2XC 3C8YA 2KQ7A 4HLEA 3HVZA 1I4XA 2ICIA 1P7FA 2CQUA 2N9LA 3OAWA 2NBVB 3FKYA 4P1CC 4B9KA 2Z0PA 2YT2A 1WJUA 2KVZA 2BYFA 3X0WA 1CK1A 2D3AA 4FXCA 2JRIB 2K8CA 3KWLA 4WURA 2LJ5A 2LVOA 5FR3A 4NPNA 2D2QA 4BAXA 2ZCCA 2PJHA 5HG2A 3DHGC 2YEPB 3VH3B 4QXAB 1E0ZA 1GB1A 3KYCD 5IO9A 5DPTA 2HD5B 2BYTA 2DBYA 5IA7A 3IVFA 2L83A 1OQYA 4KHBB 1IRSA 4WSFA 5C6RA 2DHKA 2CY4A 1OTRB 2M0XA 2LUEA 4HPLB 4IM3A 1T5XD 2ZVOA 1MI0A 2MWSB 1OEYA 3DBHI 3BYTB 4IWOA 1EU4A 2JZ3B 2D9VA 4BFRA 3A98B 1J19A 2PIAA 2NR2A 3H7PB 1DOYA 2INCC 5BMIA 4WQOB 4LK0M 4DQOC 3QWMA 2WXLA 2I1JA 2NTSA 1EAZA 4C7YA 2FE8A 1WVHA 2KWVB 1WRDB 2N1VA 4ZYNA 3E9LA 3ML4A 2WXKA 3AE8B 1RLFA 2DKPA 1SB3C 1C1YB 1HTQA 4KZ0A 1WJNA 3Q14C 4R3DA 3WA0A 1HZ5A 1EF5A 1E5WA 2KWCA 3TJPA 1SHCA 5I2MA 4K1RB 3ZXVA 1W1HA 4ILJA 4MH0E 2LRUA 3APCA 1DBHA 1PQSA 1J8CA 2MP2B 1WGQA 1MHXA 3W5VB 4C80A 1WJ6A 3DWGC 3PRMB 1UF0A 2ZJDA 4ZRQA 1QZEA 3N20C 1T0RC 5AUIA 2DKQA 1KJTA 2O6VB 5DI9B 4PS3A 4JQWC 3DVNU 4OZCA 2JSVX 3T3NA 3H8HA 4L2YA 2W2WA 3VUYA 1SXTA 2I5FA 3SNHA 3DCGA 2KWUB 4JK8A 2KAJA 4AUQC 2YF0A 4US8A 1Z2MA 5D27A 3I3TB 4HAUB 1WM3A 4GGQA 3ZXRA 2DX5B 4ANVA 4LNKA 2IO1B 3DVNV 5D3IB 2P8VA 1TXDA 3UZTA 1FB8A 2G1EA 3AEFB 3E66A 3VUXA 2M38A 2M19A 2VH2A 2GBKA 4XWXA 2O6VD 2NTTA 2FUHB 2GS0A 2CJOA 2G4SA 4LNIA 3ZGZA 1PDXA 1V2YA 5JHGA 4ANWA 3V60A 4E74A 1NBFC 4LJPB 1ET9A 1IP9A 3A8QA 2V9HA 4K7UA 1Y56A 3PGEA 5HHDG 2ELAA 3TFMA 2LHEA 2KOXA 2KQSA 3IBEA 4MELA 2CY5A 3GYOA 3ZQ4A 2I2YA 1X1GA 4G50A 1MIXA 1OEYJ 4QJ5B 2ROZB 2RNRB 2J4XA 5AZHA 3W1YA 1KF6B 1WF9A 3JVZX 1E10A 3A9JA 1MVKA 3PHXB 3TL5A 3ULCA 4NAWB 1RYJA 2WNMA 4HJKA 1UPQA 1TS5A 5BMGA 2RVBB 3TMPB 1XCQL 3MPXA 4IM0A 2R0DA 4ZRPA 1YQBA 3S2AA 1DIKA 2PW9A 2ZPNA 3JSVA 2YS3A 2ONQA 1MIZB 1FD6A 1Z5SB 1P1AA 1HTOA 2DWQA 4M8MA 3DBSA 1OY2A 5C79A 1I2HA 2UZRA 1XXGA 2MA9B 2IYDB 4HAYB 4LJOB 1ZKHA 4JWSC 1OQNA 3CIKA 2DNFA 1P0RA 2R2QA 4HWIB 1RRBA 4W9HA 2L1AA 2FDQA 2LKOA 2CJNA 3A9KB 2Y7BA 1WIAA 5LNK1 4K2PA 3L54A 3PLUA 1RRPB 4GDKB 2IO0B 4PYUA 4A6FB 4WJQA 2NCNA 4MM3B 2I1KA 4DHZB 1X1MA 1ZPSA 4BKGA 4DDGD 1Q0WB 3QHTA 3RMKC 1E7VA 3MJWA 5KHQA 1HE8A 1WXAA 1V6EA 3B2FA 3N1ZC 1UNPA 4GOUA 1SIFA 1QQRA 5HE0A 1D5ZC 1X86A 3ZNZB 1RFAA 3N9YC 3UGBB 4DBBA 1TQZA 2VRRB 1RWSA 2NS5A 1EWCA 1GAQB 2N9EB 1UGJA 1TGZB 4WIPA 2BYEA 3P4QB 2ZNVC 2DZMA 1XF5L 2WLBA 1UNRA 4C00A 1TYGB 2L3ZA 2C5LC 3ZDTA 4HKQA 2NPTB 4GSWA 3ZTCA 3P4RB 1MK7B 4KAXB 2MBOA 5HE2A 4X57B 2K49A 1MHHE 3QARA 2D3GA 2MEKA 4WWPA 1C3TA 4F7HA 3LJ3A 3ODWA 1ZC4B 1FIQA 2N0YA 2KT7A 4P7IA 1ZE3D 2BWFA 2RDGA 3RNFC 4XC2A 3BY4B 4JKBA 3FILB 4B6HA 1QOBA 3BJIA 5C2TB 1N61A 2IYBA 4GU2A 3FP5A 2LGSA 3D8EA 1DDVA 4YWGG 3I9V1 4K3BA 3R3MA 1IUEA 3RCZA 1HEZE 4HDQA 1Y8RC 2LXCA 4MM3A 5D3XA 1XLQA 2FJ9A 4IDIA 4B0EA 2NBUA 2WU2B 4KHOA 1B9RA 1Q10A 3NS1A 3QX1A 1FGYA 5FKAC 5EFXA 2GOWA 4HXDA 1D5MC 1WJMA 3PS6A 3H9DA 1N3HA 1JCKB 1AARA 2FUG1 3RNCC 4QJ3B 2IY1B 4N9F4 4XWTA 4OW0A 3F0WA 2Y5PA 3ZRCA 2HE7A 3SV1A 1NYRA 3ABVB 4PQ0A 4ZHPA 1EO6A 1JWMD 1P3QU 3QAQA 4OZAA 3RNAC 1J7CA 1IPGA 3AH7A 1SE2A 2JRHA 1YNTE 2M56B 2YS1A 2NPTA 3IFWB 1TZ1A 2DFKA 1MFWA 1IYFA 4JK9A 2YSZA 3KZ1A 4GDLA 2LJIA 2KLCA 2Z59A 1C4PA 5LOPB 2E6XA 1E8WA 3SEBA 4CQNA 3Q8CA 3SDLC 3FAHA 4P1BC 1TS4A 2BTEA 4US9A 5DCNA 4PNKA 3BVGA 5JVLA 3LJUX 3ZUNA 1B55A 2BS2B 4HPPA 3RYTA 1H10A 3H6NA 2KC2A 4PYZA 4A6QA 3HM6X 4ZRKA 3HW2B 5J3QA 1STEA 1LGRA 2WS3B 1ZGUB 3U52E 2AQ3B 2J0MA 3DCXA 3NZUA 4IUMB 2K22A 2PKOA 2QKMA 2RR9A 3AEEB 3BVMA 2RGFA 2RSGA 2D9WA 2HTHB 2CKHB 2KIGA 2ZW0A 4A6HA 1RFKA 2FCSA 2BW2A 2KX0A 3AM9A 2I5CA 3R2TA 2Q5WD 1MKEA 1NI2A 3KLSX 3PZ7A 2TSSA 3K9OB 4NQLB 3BYYB 4IWPA 2DZIA 1Q1OA 1WGYA 3W1SA 1JALA 1PGXA 2MBQA 2OEDA 4YONA 2WH5A 3NJTA 1N5WA 1U2BA 3BZDB 4YSZB 4KX6B 4Y94A 4IWQA 1XT9B 2WXIA 1ZXIA 2KTRB 2KJHB 1KOTA 4BKSD 1U4AA 2DAFA 2PVGC 2WXPA 4FN2A 4A8XC 2ROVA 1F0ZA 3NZSA 2G9HD 4EE2A 1RJ2A 2ABDA 2KMMA 2X38A 2BKFA 4AP4C 4YXDB 3DHIC 2K2UA 3SO6A 1SBBB 4C7ZA 4HCNB 3BK1A 1V5PA 4C4VB 5L83A 3WAOA 3TIXA 2DZJA 2CS4A 3NSUA 4XE0A 3Q8AA 3M62B 4OVZA 2MKRA 3SFEB 2ZW1A 4JKGA 5DH9B 1UNSA 2I38A 5D3YA 4RM9A 4JKEA 4W9KA 5C23A 3TEZA 4HB0B 2X0SA 1C76A 2JXXA 2WP9B 5IRSA 3EGRA 4ZOHC 3AECB 2DTCA 4HAZB 2QIEB 1VLBA 1E8YA 3U2SC 3T06A 5JLJB 1WR6E 2WXOA 1NTIA 2K5PA 2PLPA 2YT1A 4K81A 1MPEA 2JYEA 4MGIE 1YQ4B 3SD5A 4NQKE 3DVGX 2PPHA 4LDTB 2KK8A 3TBLD 2PE6B 1RM6C 2FIDA 2WGSA 4EKUA 2P0FA 1P5TA 1DGJA 4HAVB 3R7QA 1Y19B 3WIMA 4IOIE 3MTNB 5E6JA 1A70A 4WWNA 1WE7A 4W9JA 3Q3FA 1WZ3A 3IXSA 1WXSA 3ZRFA 3K9PB 5JZEB 1GJZA 3VHTC 1L4ZB 1YN3A 3RUIB 3RI7C 3U8ZA 4FADA 2JPHA 1WGDA 1WGKA 4HRSA 5GMVA 4MSMB 1OFFA 3PV1A 1FNVA 2XK5A 2W2XD 1YQ3B 2ADZA 4K2OA 5LLIA 3CSTA 3PEGA 3NHEB 3ZVVA 1TTNA 3QC8B 3Q3OC 4YSXB 3Q6BA 3D8DA 4LDTD 3VTVA 4E71A 3AEAB 1I35A 1ET6A 1C79A 5CHFA 2V4IB 2DYNA 1LB1A 5KCVA 4L23A 4GMXB 2OQBA 2D10A 2AWTA 1FOEA 4C56C 1L6UA 1R4NB 4NNJB 1L0XB 1KH0A 2VZKB 2Z8LA 2KDMA 2IO3B 3DXEA 3PO0A 1UGMA 2N9KA 2D4QA 3A58A 2V3NA 3URYA 5IKCM 3NWFA 2ZPYA 3VRBB 3HIEA 2LI5A 3UINB 5AEKB 1L6VA 2W55A 1FHXA 2AQ1B 1I4HA 2AEHA 2FJUB 2AL6A 1L0YB 2DZKA 1VRAB 3KUZA 3HRDD 4C0AA 1KFYB 4QAYA 5E6OA 4XDCA 2LOZA 1I4PA 2HDEA 1Z87A 2GMIC 4HJGE 2D11A 1KLGD 3EECA 4RF0A 2MX2A 4OVUA 1FXIA 3ZTDA 1MI1A 3Q3MC 1FHWA 2Y5BB 3W2DA 3AE6B 2YT0A 5FK9C 4A5KA 3P4SB 2VZKD 2KGXB 1UEFA 2RPQA 3AV8A 2K9XA 2KDFB 4HATB 2L76A 2WWZA 1M7RA 3MJ5A 2PMVA 2D07B 4OSNA 2AL3A 2O2VA 4EZJA 5D6JB 1SJHD 1V88A 4M00A 3E56A 2JF5A 2GB1A 1ENFA 3KYDD 1N60A 3O96A 3B77A 2J59M 4DK5A 2OTXA 1HB8A 1XCGA 5D3WA 1EWYC 1P6SA 2G3QB 4TV3A 1V86A 5HFYA 1YJIA 1B1ZA 1E7UA 1FRDA 2QEJC 1ZUD2 2MHJA 4TYZA 4GOCA 4OHJA 3PVUA 3NZ3A 1VCBA 1WRIA 1N63A 2REXA 2INNE 3DBHB 2MJDA 3GYPA 4JX1C 3MC9A 1VJKA 4TQ0A 3VQIA 1GGOA 1V89A 4XWWA 3SYXA 4KIKA 4KGRA 1TJ6A 4A3PA 1JW9D 4XX5A 2PTLA 1BTKA 2QILA 3H1UA 2D9XA 3CSFA 3GOEA 5C16A 3VTWA 4BOZB 3Q8BA 1JWBD 3IAM1 2WXGA 1CQVA 1QF6A 3U7ZA 3P4PB 1L0VB 1WZ0A 3A9JB 2BCJA 2BS4B 1NDDA 3DBRI 1FNUA 2JP2A 2KDEB 2LEKA 4A90A 3UQBA 2CHZA 2KXJA 4NJCA 3GZNI 2KDIA 3NY5A 4MDKE 1J7AA 3JSVB 2XQNM 4KSLC 3APDA 3AMZA 1NENB 3BWUD 3OWEB 4TMAB 1A5RA 2R2YA 4N6EB 3SFDB 2IGHA 5DPSA 1EM7A 1J0GA 1UD7A 2RDBC 2BBCA 1ST7A 1YIWA 1L4DB 3DQVA 1YJJA 3NVVA 2DAJA 3NWDA 4G0NB 5IP4D 1FFUA 3GE8C 4UDUC 2M14A 1PFDA 3ZYYX 3N1XC 5LONB 3PP2A 3AEGB 4ANXA 2WDQB 4YSYB 4H8SA 1WE6A 3PRZA 1KRHA 3U4EG 3MC8A 2KLGA 4BBNF 1FRRA 4FBJB 2BB5A 5LXHA 3FLVA 5G5HA 3VUWA 4YTPB 4M0WA 2KVRA 5BO4B 3FC4A 4JKAA 1V1PA 4WH4A 2EKEC 5CX3A 5G55A 1U29A 2FBWB 1WR1A 1IBXA 4HHVA 2KFJA 2GRIA 1FGZA 2Z4DA 1VBGA 4JE3B 4GLSC 3DOWA 3QJZA 4W9CA 4EZKA 4GPTB 2Y3AA 1EU3A 4H2AA 3A4SC 2JUOA 3PVLA 3QBVB 5C5BA 3A1QA 2L0FA 4TQ1A 3ZIMA 4EUTA 4PS8A 1VBHA 2ELBA 3V6CB 2JXTA 4HSIA 5TSSA 3TO1A 3NVYA 2MJEA 3PVWA 2ZNVB 2VRWB 4TSSA 3B1LX 1DDWA 2DYQA 2ZEQA 2HJ1A 4S17A 2H7DA 1QOFA 1SE4A 3Q8FA 3QK0A 2C9WB 1UELA 2COFA 1WGGA 1LW3A 2N23A 4DHZE 2Y8GA 2K6QA 2KJRA 1ESFA 1FEHA 1F52A 1K52A 4RGMA 4AJYB 2JZZA 1NVLA 1TZOA 2Q13A 4RNAA 3UIPB 3AN1A 1Q67A 4P16A 1WH3A 3AE1B 3WANA 3ZJUA 2LVQA 2FIFA 1M94A 3NOBA 4S0RA 1YN5A 4URKA 3SR6A 2LWPA 2IY0B 2KWDA 4ILHA 3RT3B 1FCLA 3EUB2 5H8YE 1V1OA 3WAMA 1MJDA 1QT9A 3ZNGC 5TR5A 3OLMD 1K5DB 3L16A 4PT5A 3R8BA 2KN5A 5BMHA 2WXQA 4KGTA 2QHOA 1FO4A 2MRPA 3KSYA 3V6EB 1KBLA 1PYWD 4K7WA 3AJ4A 3AULA 4M02A 1DDMA 2UVMA 3PZ8A 1L7YA 4HAWB 4ITKA 1M7EA 1R4MI 3E9PA 3AE3B 2E2XA 1LQBA 2FCNA 2KFKA 3L10B 1I4QA 2VSZA 2J0KA 3B2GA 3T3OA 4WWMA 1WM2A 3VDZA 3VR9B 2KHWB 2JVCA 4GDLB 4WJPA 2Z59B 1E8ZA 2EKIA 2ZCBA 2DYOA 4ZYSA 1GB4A 4OT1A 3NVWA 1GC6A 1ACAA 2M8SA 3RD2A 4B0MA 2DN6A 4FJZA 3P6AA 2IGGA 1ISNA 4GMVA 4D6WA 4NY0A 2JU6X 2FCQA 2ZVNA 2G35A 2W9NA 2D9ZA 2NMBA 2XBBC 1U5EA 3NG0A 2MCNB 2C7MB 2LGDA 2MH7A 2LZ6A 2KYWA 3M95A 3GE3C 1BT0A 1NU2A 3AEDB 2MQJA 3HUIA 3IT6B 1EUVB 2KZRA 5FR6A 4FJVB 1WSPA 1DOXA 2WXRA 3ZVRA 1GC7A 4DX90 4DDID 2V3PA 2EC1A 1TY0A 4WVFB 1S1QB 1LO5D 3MC0B 4ICVA 4XDDA 3C0RB 3ODXA 1T77A 2LG1A 1UWMA 4W9DA 1XKEA 5MPOA 2WXFA 5CLQB 4A55A 4USAA 2KJ6A 1XD4A 2RRFA 1HXYD 1TJEA 3Q2AC 4HPMB 1XCTL 3UQAA 3AEBB 2C7HA 4FLHA 4WWOA 3PPAA 4FULA 4FJYA 1VZ7A 2KDBA 3WYFB 3P42A 1WJ4A 4F7ZA 2KO3A 2L00B 4KDIC 1N6ZA 1XQQA 4NJ7A 1X11A 1H4RA 3F5RA 4IAPA 2WDVB 3T8MA 1ZSQA 3IT4B 3EHVA 4JKGB 1V80A 4MGZE 5D3VA 2NBWB 2KD0A 3RNEC 2GBJA 1JMLA 2X8XX 2YEPF 4KVGB 2LASA 2COCA 3GS2A 3CF6E 4II2B 3MFGA 1C9FA 2RSUA 2W3SA 1Q5WB 4W9LA 2KIEA 3L0WB 2YS5A 2CR5A 2BS3B 3W1SC 1ZDVA 4IFSA 4I6NB 4A9AA 1V8CA 3LYYA 5H92C 1KC7A 2VH1A 1C4CA 4KDLB 3KUDB 2K8HA 1WI1A 2KACA 2UWQA 2L05A 1UUPA 4BBNC 3NW8A 2CHXA 3M63B 1WGHA 3C19A 1RAXA 4ASWC 3KH0A 2V0GA 2LMCA 3OJ4B 1U5GA 3UF8A 3H7SA 3B9JA 2KUPA 1K50A 3APFA 1N62A 1NTVA 3MP9A 2EJ8A 3PTFC 3SUZA 1D3ZA 4FHJA 3QWZB 2GBRA 3HSAA 2XK5B 3U12A 3RN9C 1KM7A 1V97A 2JT4B 4IKGA 1QOGA 3PG7A 1T0QC 2KKCA 1G6JA 4JKFA 2J42A 1U27A 2COPA 4HB4B 3LXFA 3T9LA 3M3JA 1NI3A 1V49A 4MJSA 2ASQA 3V62A 3FM8C 3AE2B 2LGXA 5LXIB 1DOIA 3PRPB 1F9JA 4O1NA 1NYQA 4IG7B 4DX8A 3N30A 3KRWA 2P0HA 1YX5B 1OQRA 4BOSC 1AN8A 2CU3A 4HVBA 2MLBA 3ZO5B 5AUKA 3FEHA 3CIRB 3TW1A 3GP7A 5KQ1A 1EF1A 3VFKA 5LG4B 1I7HA 4OVVA 1DYQA 2DYMA 1WI0A 2Z0DB 4CSQA 2K3UA 4GNKB 2EMTA 2EELA 3P7ZA 2MFQA 2DYBA 2D9YA 1FHOA 4DXAB 4MK0A 2PZ1A 1ZVRA 2AYOB 2B3AA 2NMQA 1T3QA 1C77A 2L7RA 1V5MA 2C7NB 1MPHA 1YX6B 2YLMA 4BZAA 1UWXA 4HB3B 3R7RA 4MT7A 3DBLI 2O2VB 1YN4A 1QC6A 2QC8A 1TKGA 4A3OA 4QJ4B 3QA8A 4A20A 5I2SA 2FAZA 1KLVA 2KTFA 1W1DA 2A5UA 2V4LA 4DWFA 2HTME 2JWZA 5IJMA 4RCOA 2MJ3A 3L17A 4DBGA 1FCCC 2RLOA 4AQ7A 2JYTA 1WXQA 3PSCA 2MBBB 1GNUA 3E9OA 3ZJTA 4GZUA 2D3BA 1FM0D 5HI1A 2V1YA 2IPKD 4RH6A 1HBKA 5BYRA 4P6VF 1XR0B 4MGKE 1JWUD 2GLSA 2H88B 2JWUA 3O65B 1FAOA 4KIKB 4IW0A 4RF1A 3SU8X 5D94A 2BWES 1KZ7A 3U7DA 3RNGC 2Z0QA 1ZXHA 4BKTA 2ZZPB 4RGNA 2M0AA 2N9XA 3TEWA 2RGNB 2IBIB 5E6NA 1PMSA 3Q69A 3MDBC 1GUAB 1D4BA 2JQRB 3HQCA 2A4ZA 3LB8C 3CWIA 3D8FA 4TKNA 5HE1A 5EDSA 2J52A 4W9GA 5D2MB 3VAWA 2K0PA 3VTUA 4ZHOA 4M01A 3WCQA 1WMHA 1XLNA 2KUQA 1NEKB 1PGBA 1WYWB 5KQ4A 4K3CA 5EE1A 4HAXB 4CHJA 1W1GA 3PZDA 2PE9A 4WJNA 3B08A 3OG5A 4PS7A 4JGHB 4DHJB 4BBKA 1TIFA 3AB5A 5G2NA 5C3JB 1XLPA 5GOWB 4YTMB 2M17A 3ZJVA 2IGDA 3UIOB 3E9SA 1QLBB 2GCJA 3I57A 1MK9B 2OJRA 1JRUA 2KC1A 1IGCA 5D3DA 4OZBA 2YRYA 3TSSA 2RPVA 1SIJA 2J53A 1Y5OA 1XEEA 4IC7B 3ULBA 1WJ1A 4RGTA 1I42A 5GXGB 1H8CA 3ZKJC 2R2OA 4JL9A 4JKDA 1TS2A 3HVDA 2QJLA 1UPRA 1SF0A 2DHZA 3ECIA 4WAAA 2LULA 4M0WB 2L52A 1V1PB 1L5PA 2GBNA 3M1IB 1K51A 3EA6A 4RMAA 2QMTA 2NBVA 3ZW3A 2NZ8B 1VDVA 2LUMA 4DHJD 4ARCA 3L13A 1BAKA 4XGAB 5EE3A 1VR9A 1L2NA 4D2KA 4FHKA 1IBXB 2LRWA 1WGUA 3PT2B 2SEBD 1TBEA 2WU5B 1SEBD 2FJLA 1QOAA 5FI1A 1P9DU 2WDRB 1D5XC 5J18A 4B6WA 2RMMA 3HIZA 4YTNB 4MY6A 3P1MA 4WJ7A 3N7CA 3OHMB 3DPDA 3GB1A 5C5BB 1CZPA 3HK0A 1VD2A 2WDTB 3A1QB 2SAKA 3IG3A 1ZYIA 2BYVE 2KMCA 3BIID 2DLBA 2OHFA 5DIFB 2C60A 3ONSA 1XX0A 1AWEA 4RGOS 4WJOA 4YL8A 2PEAA 3BK2A 4KHBA 4DXFA 4HKZE 2M1MA 2WHIA 2KNBA 1U5DA 3AE9B 1S3SG 4AOFA 2EMSA 3PREA 4EZLA 1V5UA 4EJNA 3RNBC 1E8XA 1BMLC 4W9FA 2Y5CA 5IOIA 3V61A 1FXTB 3DBRB 1WX9A 3SBTA 4JWUC 2MDXA 1UH6A 3QCAA 4LNFA 1MG8A 3H7PA 3VOQA 5CHWA 3AE4B 1KTKA 4LCDE 4MT5A 1HQRD 2D5GA 3GZNB 3PSEB 4WQMA 4DIXA 1IGDA 3KY9A 4AWJA 4G11A 2IDYA 4KKJA 2K1FA 2WXJA 4NZLB 2N1WA 1ZC3B 4A6KA 2MBHA 2JX5A 2BVCA 1D6EC 1WYGA 4EFOA 1FNWA 2KX3A 3LDZE 1KLUD 4CYEA 2IO2B 3EFCA 4HROA 1QKZA 5G5GA 2FCMA 3NS8A 1GPXA 3ML8A 3RCPA 2CODA 2HJ8A 2MP2A 2L8JA 3AE5B 4K17A 4N59A 4ARIA 1BWNA 3R66C 1EGXA 5IAAC 2DHIA 2KFKB 1V81A 2W54A 3EC8A 2O6VA 2DX1A 4JIOU 1YD8U 3I5JC 3V5WA 1TY2A 1E7PB 1JWSD 2GBMA 3ETRA 1NVID 2ZKMX 3RZWC 4HK2A 3A4RA 2BQQA 4CHKA 1YMHE 2AQ2B 3WALA 1C78A 1SGHA 4TUUA 3QIJA 2OOBB 3TVVA 2L0TA 2KR0A 2DX5A 1N5XA 3G9WA 4J6IA 2N0SB 5T8IA 2LD9A 3VXWA 2QCZA 3V3XA 1WGRA 1F1HA 4KKIA 1UBIA 2XN9C 4ICUA 1I4RA 3KW5B 2XEWA 1AYFA 2W3RA 4JPSA 2PVOD 4BVUC 3EFUA 1XD3B 2NVUI 2BF8B 5L81A 3N32A 4GIVA 1ACCA 2DHJA 1YJ1A 3MHZA 1ZOYB 2LBBA 3VIAA 2LOXA 2N7JA 5HE3A 1K8RB 5EE9A 1VZ6A 2R82A 5JP4A 1WFYA 1WXMA 3IHPC 3WAPA 3Q3JA 2GUMA 3ZDMC 4L1BA 2Z14A 2LHDA 4L6EA 4NJ6A 2P0DA 3R2IA 4Z2MB 1CMXB 3ODOA 1XO3A 1TKYA 3KUCB 3NRZA 4JK7A 2J0JA 5JHHA 2H7EA 3L4PA 5KHOA 2K39A 1R7SA 5HKHA 3A33B 3B0AA 2LGIA 4MH8A 1VZ8A 1P98A 1BUIC 2R61A 4Z2NA 3O13A 4LNOA 4NAWA 3QQ8B 1ZP0B 1TT5B 2LFIA 4K7SA 3DDCB 3U30A 3W5UB 2FNJB 3HM3A 2L32A 1V61A 1AW7A 2WXHA 2QKLA 5I4DA 5DPRA 2LVPA 1K5GB 2BB6A 2DIKA 5J3YA 5J3TA 1T0YA 1R4MB 2KMAA 3DWMA 3KWVA 5AZGA 1U5FA 3EPYA 2KCJA 1ZDXA 1E6EB 1TS3A 1OMWA 4NAMA 4HDOA 3ZLZA 4EMOA 1EVHA 3ALBA 3X23A 1DROA 1XODA 3VR8B 3DXCA 1T6BX 3J9CA 3I63C 3A9KA 2MWNB 2X18A 4MEMA 2MBEA 4GDKA 3BVZA 1JRPA 1KZGA 4A6FA 2GI9A 3TEYA 4I6LB 5DHFB 2L2IA 1PUTA 2WX1A 3AXCA 4IOYX 3L08A 1MG4A 5CTRC 2IZVB 2KANA 5JHBA 3P63A 2ACZB 5IN7A 2CRFA 2DA0A 3ZNHB 2D3CA 4KV2A 2LGYA 2GJYA 4JLCA 2N7DA 3RULA 3TCAA 4M8NA 1HB6A 1QQGA 4FA6A 4Q2JA 4F7UP 2KN4A 2E3TA 2RD0A 4ILGB 2UZSA 2G4DB 1LXDA 2K8EA 2INPE 3AU5A 3IAS1 2M4NA 4D0NB 1V9JA 4I6PA 4HB2B 3VH4B 2KQ4X 5C1ZA 3A8PA 2N4FA 3DXDA 1TKEA 2BPSA 3AI5A 4E3CA 3Q8EA 3PLVA 2Y8FA 3NWAA 2W82A 4RM8A 2CAYA 1KI1B 2VKIA 2IJ0A 1SSNA 4YT0B 3DHHC 2BT6A 3ZNID 1GG3A 2Z0EB 5M4YB 1WWTA 3FILA 1V5OA 1WX8A 2UYZB 4MJSB 3N1YC 2WQYB 4HEA1 1AQCA 3UI3A 2V76A 5J17A 3BINA 2L1CA 1QILA 1T0SC 4F1SA 4G3XB 2RQ1A 1AWDA 3TUOA 5JHAA 3KVFB 4JKCA 2Z13A 5FI0A 1UNQA 4GN1A 1F77A 1C4AA 3TEXA 4MACA 3KRXA 3VVWB 2RUKB 4N58A 3SBGA 3DVGY 1HZ6A 5BYSA 2OJWA 1JQ4A 1E9MA 4XZ4A 1P3RA 1LM8B 4F7GA 3JYUA 2CHWA 4WAFA 1OGWA 3Q3NC 1K53A 2MSED 4W9EA 5DPWA 1FPYA 4RFBA 4DXGA 2JY6A 4HCPB 2K8BA 4EEWA 4MSQB 1XLOA 2H89B 5D7GA 1DYNA 3JW0X 2INDC 5E6PA 4KZCA
chains in the Genus database with same CATH topology
4W9IA 3PHWB 4ZRIA 3D32A 2R09A 5L95C 2COAA 2BKRB 5CLLB 4EOYA 2YVCA 3ENBA 2K2JA 3OANA 5AZFA 1MAIA 1UBQA 4GXBA 2J7QB 3AU4A 1WX7A 1I7AA 1X05A 2LXAA 2DLWA 3MHSD 1ZW7A 4KHAA 1BTNA 1PFJA 2V3SA 4NSWA 1WY8A 4BKSA 4F8CB 3P2BA 4B95A 1X1FA 2HTHA 1WXVA 2BGFA 2GCLA 2G45B 2WYQA 1NTYA 2CB8A 4CO7A 4IM2A 2N9PC 3CMMB 1JDEA 2CU1A 4ZDVA 1V5TA 2K25A 1LFDA 1ZM0A 1PLSA 2HRJA 1J0WA 5JH5C 1WMHB 3OJ3A 3N3KB 2MW5A 3CXBB 1WG7A 2KTRA 4II3B 1R4NI 3ML9A 4JKHA 4ZRJA 2IFSA 2DENB 4MGYE 4AJWA 4KSKC 2LYDA 2WX0A 2Z0OA 4CHMA 1UZXB 2K00A 4ANUA 3SHQA 2K6DB 5J2RA 3FSSA 3HHMA 1E90A 1SE9A 2N7EA 3ENEA 3RZFA 5DHAB 4GB9A 5CHVC 2W2XC 2KQ7A 4HLEA 2CQUA 3OAWA 2NBVB 4B9KA 2Z0PA 1WJUA 2BYFA 3X0WA 2JRIB 2K8CA 2LJ5A 2LVOA 4NPNA 2D2QA 2ZCCA 2PJHA 3VH3B 3KYCD 5DPTA 2HD5B 5IA7A 3IVFA 1OQYA 4KHBB 4HPLB 1IRSA 4WSFA 2DHKA 2CY4A 5C6RA 1OTRB 2LUEA 2M0XA 4IM3A 2ZVOA 2MWSB 1OEYA 3DBHI 4IWOA 2JZ3B 2D9VA 4BFRA 3A98B 1J19A 2NR2A 3H7PB 4WQOB 3QWMA 2I1JA 1EAZA 1WVHA 2KWVB 1WRDB 2N1VA 4ZYNA 3E9LA 3ML4A 1RLFA 2DKPA 1C1YB 4KZ0A 1WJNA 3WA0A 1EF5A 1E5WA 2KWCA 3TJPA 1SHCA 4K1RB 1W1HA 4ILJA 4MH0E 2LRUA 3APCA 1DBHA 1PQSA 1J8CA 2MP2B 1WGQA 1WJ6A 3PRMB 2ZJDA 1QZEA 2DKQA 1KJTA 2O6VB 5DI9B 4PS3A 4JQWC 3DVNU 2W2WA 3VUYA 2I5FA 3SNHA 3DCGA 4JK8A 2KWUB 4AUQC 2YF0A 1Z2MA 5D27A 3I3TB 4HAUB 1WM3A 4GGQA 2DX5B 4ANVA 2IO1B 3DVNV 2P8VA 1TXDA 3UZTA 1FB8A 3E66A 3VUXA 2M38A 2GBKA 4XWXA 2O6VD 2FUHB 2GS0A 2G4SA 1V2YA 5JHGA 4ANWA 3V60A 4E74A 1NBFC 4LJPB 1IP9A 3A8QA 4K7UA 3PGEA 2ELAA 3TFMA 2KOXA 2KQSA 3IBEA 4MELA 2CY5A 3GYOA 1X1GA 4G50A 1MIXA 1OEYJ 2ROZB 2RNRB 5AZHA 3W1YA 1WF9A 3JVZX 3A9JA 3PHXB 3TL5A 3ULCA 4NAWB 4HJKA 1UPQA 2RVBB 3TMPB 3MPXA 4IM0A 2R0DA 1YQBA 3S2AA 1DIKA 3JSVA 2ZPNA 2YS3A 1MIZB 1Z5SB 1P1AA 4M8MA 3DBSA 1OY2A 5C79A 1I2HA 2UZRA 2MA9B 2IYDB 4HAYB 4LJOB 1ZKHA 1OQNA 3CIKA 1P0RA 2R2QA 4HWIB 1RRBA 4W9HA 2FDQA 2LKOA 3A9KB 2Y7BA 1WIAA 4K2PA 3L54A 3PLUA 1RRPB 4GDKB 2IO0B 4PYUA 4A6FB 4WJQA 2NCNA 2I1KA 4DHZB 1X1MA 4BKGA 4DDGD 1Q0WB 3QHTA 1E7VA 3MJWA 5KHQA 1HE8A 1WXAA 1V6EA 1UNPA 1SIFA 5HE0A 1X86A 3ZNZB 1RFAA 3UGBB 4DBBA 1TQZA 2VRRB 2NS5A 2N9EB 1TGZB 2BYEA 2ZNVC 2DZMA 1UNRA 2L3ZA 2C5LC 3ZDTA 2NPTB 4GSWA 3ZTCA 1MK7B 4KAXB 2MBOA 5HE2A 4X57B 3QARA 2D3GA 4WWPA 1C3TA 4F7HA 3LJ3A 3ODWA 1ZC4B 2N0YA 4P7IA 2BWFA 4XC2A 3BY4B 4JKBA 4B6HA 3BJIA 2IYBA 4GU2A 3FP5A 3D8EA 1DDVA 3R3MA 3RCZA 4HDQA 1Y8RC 2LXCA 4MM3A 5D3XA 2FJ9A 2NBUA 4KHOA 3QX1A 1FGYA 5EFXA 2GOWA 4HXDA 1WJMA 3PS6A 3H9DA 1N3HA 1AARA 2IY1B 4N9F4 3F0WA 3ZRCA 2HE7A 3SV1A 4PQ0A 1EO6A 1P3QU 3QAQA 1IPGA 2JRHA 2YS1A 2NPTA 3IFWB 1TZ1A 2DFKA 1IYFA 4JK9A 2YSZA 3KZ1A 4GDLA 2KLCA 5LOPB 1E8WA 3SDLC 5DCNA 4PNKA 5JVLA 3LJUX 3ZUNA 1B55A 3RYTA 1H10A 3H6NA 2KC2A 4PYZA 3HM6X 4ZRKA 3HW2B 5J3QA 1ZGUB 2J0MA 3NZUA 4IUMB 2QKMA 2RR9A 2RGFA 2RSGA 2D9WA 2HTHB 2CKHB 4A6HA 2FCSA 2KX0A 2I5CA 1MKEA 1NI2A 3K9OB 4NQLB 4IWPA 2DZIA 1Q1OA 1WGYA 3W1SA 2MBQA 4YONA 2WH5A 1U2BA 4Y94A 4IWQA 1XT9B 2KTRB 2KJHB 1KOTA 4BKSD 1U4AA 2DAFA 4FN2A 2ROVA 3NZSA 1RJ2A 2ABDA 2BKFA 4AP4C 2K2UA 3SO6A 4HCNB 1V5PA 5L83A 3WAOA 3TIXA 2DZJA 2CS4A 3NSUA 3M62B 2MKRA 4JKGA 5DH9B 5D3YA 4RM9A 4JKEA 4W9KA 5C23A 4HB0B 2X0SA 2JXXA 2DTCA 4HAZB 1E8YA 3T06A 5JLJB 1WR6E 1NTIA 2YT1A 4K81A 4MGIE 3SD5A 4NQKE 3DVGX 2PPHA 4LDTB 2KK8A 3TBLD 2PE6B 2FIDA 4EKUA 2P0FA 1P5TA 4HAVB 3R7QA 1Y19B 3WIMA 3MTNB 4WWNA 1WE7A 4W9JA 3Q3FA 1WZ3A 1WXSA 3ZRFA 3K9PB 5JZEB 1GJZA 3VHTC 3RUIB 3U8ZA 4FADA 2JPHA 1WGDA 5GMVA 4MSMB 3PV1A 2XK5A 2W2XD 2ADZA 4K2OA 5LLIA 3CSTA 3PEGA 3NHEB 3ZVVA 1TTNA 3QC8B 3D8DA 4LDTD 3VTVA 4E71A 1I35A 5CHFA 2DYNA 1LB1A 5KCVA 4GMXB 2OQBA 2D10A 2AWTA 1FOEA 4NNJB 2IO3B 3DXEA 1UGMA 2D4QA 2ZPYA 2LI5A 3UINB 5AEKB 1FHXA 2AEHA 2AL6A 2DZKA 3KUZA 4C0AA 5E6OA 2LOZA 1Z87A 2GMIC 2D11A 3EECA 2MX2A 4OVUA 3ZTDA 1FHWA 2Y5BB 2YT0A 4A5KA 2KGXB 1UEFA 2RPQA 2KDFB 4HATB 2L76A 2WWZA 1M7RA 2D07B 2AL3A 2O2VA 4EZJA 5D6JB 1V88A 2JF5A 3KYDD 3O96A 2J59M 4DK5A 2OTXA 1HB8A 1XCGA 5D3WA 1P6SA 2G3QB 4TV3A 1V86A 1E7UA 4TYZA 4GOCA 3PVUA 1VCBA 2REXA 3GYPA 4TQ0A 3VQIA 1GGOA 1V89A 3SYXA 4KIKA 1TJ6A 4A3PA 4XX5A 1BTKA 3H1UA 2D9XA 3CSFA 3GOEA 5C16A 3VTWA 4BOZB 1WZ0A 3A9JB 2BCJA 3DBRI 1NDDA 2JP2A 2KDEB 3UQBA 2CHZA 2KXJA 3GZNI 2KDIA 3NY5A 4MDKE 3JSVB 2XQNM 4KSLC 3APDA 1A5RA 5DPSA 1J0GA 1UD7A 1ST7A 1YIWA 3DQVA 2DAJA 4G0NB 2M14A 5LONB 3PP2A 4ANXA 4H8SA 1WE6A 3PRZA 2KLGA 4BBNF 4FBJB 5LXHA 3FLVA 3VUWA 5BO4B 2KVRA 4JKAA 2EKEC 5CX3A 5G55A 1U29A 1WR1A 4HHVA 2KFJA 1FGZA 1VBGA 3DOWA 3QJZA 4W9CA 4EZKA 4GPTB 3A4SC 2JUOA 3PVLA 3QBVB 5C5BA 3A1QA 2L0FA 4TQ1A 3ZIMA 4EUTA 4PS8A 1VBHA 2ELBA 3V6CB 3TO1A 3PVWA 2ZNVB 2VRWB 3B1LX 1DDWA 2DYQA 2ZEQA 2H7DA 3QK0A 2C9WB 1UELA 2COFA 1WGGA 1LW3A 2N23A 4DHZE 2Y8GA 2K6QA 2KJRA 4AJYB 2JZZA 1NVLA 2Q13A 3UIPB 1Q67A 1WH3A 3WANA 2LVQA 2FIFA 1M94A 3NOBA 4URKA 2LWPA 2IY0B 4ILHA 3RT3B 3WAMA 3ZNGC 5TR5A 3OLMD 1K5DB 3L16A 2KN5A 2QHOA 2MRPA 3KSYA 3V6EB 1KBLA 4K7WA 3AJ4A 3AULA 1DDMA 2UVMA 1L7YA 4HAWB 1M7EA 1R4MI 3E9PA 2E2XA 1LQBA 2FCNA 2KFKA 3L10B 2VSZA 2J0KA 1WM2A 3VDZA 2KHWB 2JVCA 4GDLB 4WJPA 2Z59B 1E8ZA 2ZCBA 2DYOA 1GC6A 1ACAA 2M8SA 3RD2A 2DN6A 4FJZA 3P6AA 1ISNA 4GMVA 4NY0A 2ZVNA 2FCQA 2G35A 2W9NA 2D9ZA 2NMBA 2XBBC 1U5EA 2MCNB 2C7MB 2LGDA 2LZ6A 3M95A 1BT0A 1NU2A 2MQJA 1EUVB 2KZRA 5FR6A 4FJVB 3ZVRA 1GC7A 4DX90 4DDID 2EC1A 4WVFB 1S1QB 4ICVA 3C0RB 3ODXA 2LG1A 4W9DA 1XKEA 5CLQB 2KJ6A 1XD4A 4HPMB 3UQAA 2C7HA 4FLHA 4WWOA 3PPAA 4FULA 4FJYA 2KDBA 3WYFB 1WJ4A 4F7ZA 2KO3A 2L00B 4KDIC 1XQQA 4NJ7A 1X11A 1H4RA 3F5RA 4IAPA 3T8MA 1ZSQA 3EHVA 4JKGB 4MGZE 1V80A 5D3VA 2NBWB 2KD0A 2GBJA 4KVGB 2LASA 2COCA 3CF6E 4II2B 2RSUA 1Q5WB 4W9LA 3L0WB 2YS5A 2CR5A 3W1SC 4IFSA 4I6NB 1KC7A 4KDLB 3KUDB 2K8HA 1WI1A 2UWQA 2L05A 4BBNC 2CHXA 3M63B 1WGHA 1RAXA 4ASWC 3KH0A 3OJ4B 1U5GA 3UF8A 3H7SA 2KUPA 3APFA 1NTVA 2EJ8A 3PTFC 3SUZA 1D3ZA 4FHJA 3QWZB 2GBRA 2XK5B 1KM7A 2JT4B 3PG7A 2KKCA 1G6JA 4JKFA 1U27A 2COPA 4HB4B 3T9LA 3M3JA 1V49A 4MJSA 2ASQA 3V62A 3FM8C 2LGXA 5LXIB 3PRPB 1F9JA 4IG7B 4DX8A 3N30A 3KRWA 2P0HA 1YX5B 4BOSC 4HVBA 2MLBA 3ZO5B 3FEHA 3TW1A 5KQ1A 1EF1A 3VFKA 4OVVA 2DYMA 1WI0A 2Z0DB 2EMTA 3P7ZA 2MFQA 2DYBA 2D9YA 1FHOA 4DXAB 4MK0A 2PZ1A 1ZVRA 2AYOB 2B3AA 2L7RA 1V5MA 2C7NB 1MPHA 1YX6B 2YLMA 4HB3B 3R7RA 4MT7A 3DBLI 2O2VB 1QC6A 4A3OA 3QA8A 4A20A 2FAZA 1KLVA 2KTFA 1W1DA 2A5UA 2V4LA 4DWFA 2JWZA 5IJMA 3L17A 4DBGA 2RLOA 3PSCA 2MBBB 1GNUA 3E9OA 4GZUA 2V1YA 1HBKA 1XR0B 4MGKE 3O65B 1FAOA 4KIKB 4IW0A 3SU8X 5D94A 2BWES 1KZ7A 3U7DA 2Z0QA 4BKTA 2ZZPB 2N9XA 2RGNB 2IBIB 5E6NA 1PMSA 3MDBC 1GUAB 3HQCA 2A4ZA 3D8FA 4TKNA 5HE1A 5EDSA 4W9GA 3VAWA 5D2MB 3VTUA 1WMHA 1WYWB 5KQ4A 4HAXB 4CHJA 1W1GA 3PZDA 2PE9A 4WJNA 3B08A 4PS7A 4JGHB 4DHJB 4BBKA 5G2NA 5GOWB 2M17A 3UIOB 2GCJA 1MK9B 2OJRA 1JRUA 2KC1A 2YRYA 1Y5OA 4IC7B 3ULBA 1WJ1A 1I42A 1H8CA 3ZKJC 2R2OA 4JL9A 4JKDA 1UPRA 2DHZA 3ECIA 4WAAA 2LULA 4M0WB 2GBNA 3M1IB 4RMAA 3ZW3A 2NZ8B 4DHJD 3L13A 1BAKA 1L2NA 4FHKA 2LRWA 1WGUA 3PT2B 1TBEA 2FJLA 5FI1A 1P9DU 5J18A 4B6WA 3HIZA 4MY6A 4WJ7A 3N7CA 3DPDA 5C5BB 1VD2A 3HK0A 2WDTB 3A1QB 3IG3A 2BYVE 2KMCA 5DIFB 2C60A 3ONSA 1XX0A 1AWEA 4WJOA 4YL8A 2PEAA 2M1MA 2KNBA 1U5DA 1S3SG 4AOFA 2EMSA 3PREA 4EZLA 1V5UA 4EJNA 1E8XA 4W9FA 3V61A 1FXTB 1WX9A 3SBTA 2MDXA 1UH6A 3QCAA 1MG8A 3H7PA 3VOQA 5CHWA 4LCDE 3PSEB 3KY9A 4AWJA 4G11A 2K1FA 2N1WA 1ZC3B 4A6KA 2MBHA 4EFOA 3LDZE 2KX3A 4CYEA 2IO2B 2FCMA 3NS8A 3ML8A 3RCPA 2CODA 2HJ8A 2MP2A 2L8JA 4K17A 1BWNA 3R66C 1EGXA 5IAAC 2DHIA 2KFKB 1V81A 3EC8A 2O6VA 2DX1A 4JIOU 1YD8U 3V5WA 2GBMA 3RZWC 4HK2A 3A4RA 4CHKA 3WALA 1SGHA 4TUUA 3QIJA 2OOBB 3TVVA 2L0TA 2DX5A 3G9WA 4J6IA 2LD9A 3VXWA 1WGRA 1UBIA 4ICUA 3KW5B 2XEWA 4BVUC 3EFUA 1XD3B 2NVUI 2BF8B 5L81A 3N32A 4GIVA 2DHJA 1YJ1A 2LBBA 3VIAA 2LOXA 5HE3A 1K8RB 2R82A 5JP4A 1WFYA 1WXMA 3IHPC 3WAPA 3Q3JA 3ZDMC 4L6EA 4NJ6A 2P0DA 4Z2MB 1CMXB 3ODOA 3KUCB 4JK7A 2J0JA 5JHHA 2H7EA 5KHOA 2K39A 5HKHA 3A33B 3B0AA 1P98A 4Z2NA 4NAWA 3QQ8B 4K7SA 3DDCB 3U30A 2FNJB 3HM3A 1V61A 2QKLA 5DPRA 2LVPA 1K5GB 2DIKA 5J3YA 5J3TA 1T0YA 2KMAA 5AZGA 1U5FA 3EPYA 2KCJA 1OMWA 4HDOA 3ZLZA 4EMOA 1EVHA 3ALBA 3X23A 1DROA 1XODA 3DXCA 3A9KA 2MWNB 2X18A 4MEMA 2MBEA 4GDKA 1KZGA 4A6FA 4I6LB 5DHFB 2L2IA 2WX1A 3AXCA 4IOYX 3L08A 5CTRC 2IZVB 2KANA 5JHBA 2CRFA 2DA0A 3ZNHB 4KV2A 2LGYA 2GJYA 4JLCA 2N7DA 3RULA 3TCAA 4M8NA 1HB6A 1QQGA 4FA6A 4F7UP 2RD0A 4ILGB 2UZSA 2G4DB 1LXDA 3AU5A 2M4NA 4D0NB 1V9JA 4I6PA 4HB2B 3VH4B 5C1ZA 3A8PA 2N4FA 3DXDA 2BPSA 4E3CA 3AI5A 3PLVA 2Y8FA 4RM8A 2CAYA 1KI1B 2VKIA 3ZNID 1GG3A 2Z0EB 1V5OA 1WX8A 2UYZB 4MJSB 1AQCA 2V76A 5J17A 3BINA 2L1CA 4F1SA 4G3XB 2RQ1A 5JHAA 3KVFB 4JKCA 5FI0A 1UNQA 4GN1A 3KRXA 3VVWB 2RUKB 3SBGA 3DVGY 4XZ4A 1P3RA 1LM8B 4F7GA 3JYUA 2CHWA 1OGWA 2MSED 4W9EA 5DPWA 2JY6A 4HCPB 2K8BA 4EEWA 4MSQB 5D7GA 1DYNA 3JW0X 5E6PA 4KZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9I A;  3PHW B;  4ZRI A;  3D32 A;  2R09 A;  5L95 C;  2COA A;  2BKR B;  5CLL B;  4EOY A;  2YVC A;  2K2J A;  3OAN A;  5AZF A;  1MAI A;  1UBQ A;  4GXB A;  2J7Q B;  3AU4 A;  1WX7 A;  1I7A A;  1X05 A;  2LXA A;  2DLW A;  3MHS D;  1ZW7 A;  4KHA A;  1BTN A;  1PFJ A;  2V3S A;  4NSW A;  1WY8 A;  4BKS A;  4F8C B;  3P2B A;  4B95 A;  1X1F A;  2HTH A;  1WXV A;  2BGF A;  2GCL A;  2G45 B;  2WYQ A;  1NTY A;  2CB8 A;  4CO7 A;  4IM2 A;  2N9P C;  3CMM B;  2CU1 A;  4ZDV A;  1V5T A;  2K25 A;  1LFD A;  1ZM0 A;  1PLS A;  2HRJ A;  1J0W A;  5JH5 C;  1WMH B;  3OJ3 A;  3N3K B;  2MW5 A;  3CXB B;  1WG7 A;  2KTR A;  4II3 B;  1R4N I;  3ML9 A;  4ZRJ A;  2IFS A;  2DEN B;  4MGY E;  4AJW A;  4KSK C;  2LYD A;  2WX0 A;  2Z0O A;  4CHM A;  1UZX B;  2K00 A;  4ANU A;  3SHQ A;  2K6D B;  5J2R A;  3FSS A;  3HHM A;  1E90 A;  1SE9 A;  2N7E A;  3ENE A;  3RZF A;  5DHA B;  4GB9 A;  5CHV C;  2W2X C;  2KQ7 A;  4HLE A;  2CQU A;  3OAW A;  2NBV B;  4B9K A;  2Z0P A;  1WJU A;  2BYF A;  3X0W A;  2JRI B;  2K8C A;  2LJ5 A;  2LVO A;  4NPN A;  2D2Q A;  2ZCC A;  2PJH A;  3VH3 B;  3KYC D;  5DPT A;  2HD5 B;  5IA7 A;  3IVF A;  1OQY A;  4KHB B;  4HPL B;  1IRS A;  4WSF A;  2DHK A;  2CY4 A;  5C6R A;  1OTR B;  2LUE A;  2M0X A;  4IM3 A;  2ZVO A;  2MWS B;  1OEY A;  3DBH I;  4IWO A;  2JZ3 B;  2D9V A;  4BFR A;  3A98 B;  1J19 A;  2NR2 A;  3H7P B;  4WQO B;  3QWM A;  2I1J A;  1EAZ A;  1WVH A;  2KWV B;  1WRD B;  2N1V A;  4ZYN A;  3ML4 A;  1RLF A;  2DKP A;  1C1Y B;  4KZ0 A;  1WJN A;  3WA0 A;  1EF5 A;  1E5W A;  2KWC A;  3TJP A;  1SHC A;  4K1R B;  1W1H A;  4MH0 E;  2LRU A;  3APC A;  1DBH A;  1PQS A;  1J8C A;  2MP2 B;  1WGQ A;  1WJ6 A;  3PRM B;  2ZJD A;  1QZE A;  2DKQ A;  1KJT A;  2O6V B;  5DI9 B;  4PS3 A;  4JQW C;  3DVN U;  2W2W A;  3VUY A;  2I5F A;  3SNH A;  3DCG A;  2KWU B;  4AUQ C;  2YF0 A;  1Z2M A;  5D27 A;  3I3T B;  4HAU B;  1WM3 A;  4GGQ A;  2DX5 B;  4ANV A;  2IO1 B;  3DVN V;  2P8V A;  1TXD A;  3UZT A;  1FB8 A;  3VUX A;  2M38 A;  2GBK A;  4XWX A;  2O6V D;  2FUH B;  2GS0 A;  2G4S A;  1V2Y A;  5JHG A;  4ANW A;  3V60 A;  4E74 A;  1NBF C;  4LJP B;  1IP9 A;  3A8Q A;  4K7U A;  3PGE A;  2ELA A;  3TFM A;  2KOX A;  2KQS A;  3IBE A;  4MEL A;  2CY5 A;  3GYO A;  1X1G A;  4G50 A;  1MIX A;  1OEY J;  2ROZ B;  2RNR B;  5AZH A;  3W1Y A;  1WF9 A;  3JVZ X;  3A9J A;  3PHX B;  3TL5 A;  3ULC A;  4NAW B;  4HJK A;  1UPQ A;  2RVB B;  3TMP B;  3MPX A;  4IM0 A;  2R0D A;  1YQB A;  3S2A A;  3JSV A;  2ZPN A;  2YS3 A;  1MIZ B;  1Z5S B;  1P1A A;  4M8M A;  3DBS A;  1OY2 A;  5C79 A;  1I2H A;  2UZR A;  2MA9 B;  2IYD B;  4HAY B;  4LJO B;  1ZKH A;  1OQN A;  3CIK A;  1P0R A;  2R2Q A;  4HWI B;  1RRB A;  4W9H A;  2FDQ A;  2LKO A;  3A9K B;  2Y7B A;  1WIA A;  4K2P A;  3L54 A;  3PLU A;  1RRP B;  4GDK B;  2IO0 B;  4PYU A;  4A6F B;  4WJQ A;  2NCN A;  2I1K A;  4DHZ B;  1X1M A;  4BKG A;  4DDG D;  1Q0W B;  3QHT A;  1E7V A;  3MJW A;  5KHQ A;  1HE8 A;  1WXA A;  1V6E A;  1UNP A;  1SIF A;  5HE0 A;  1X86 A;  3ZNZ B;  1RFA A;  3UGB B;  4DBB A;  1TQZ A;  2VRR B;  2NS5 A;  2N9E B;  1TGZ B;  2BYE A;  2ZNV C;  2DZM A;  1UNR A;  2L3Z A;  2C5L C;  3ZDT A;  2NPT B;  4GSW A;  3ZTC A;  1MK7 B;  4KAX B;  2MBO A;  5HE2 A;  4X57 B;  3QAR A;  2D3G A;  4WWP A;  1C3T A;  4F7H A;  3LJ3 A;  3ODW A;  1ZC4 B;  2N0Y A;  4P7I A;  2BWF A;  4XC2 A;  3BY4 B;  4B6H A;  3BJI A;  2IYB A;  4GU2 A;  3FP5 A;  3D8E A;  1DDV A;  3R3M A;  3RCZ A;  4HDQ A;  1Y8R C;  2LXC A;  4MM3 A;  5D3X A;  2FJ9 A;  2NBU A;  4KHO A;  3QX1 A;  1FGY A;  5EFX A;  2GOW A;  4HXD A;  1WJM A;  3PS6 A;  3H9D A;  1N3H A;  1AAR A;  2IY1 B;  4N9F 4;  3F0W A;  3ZRC A;  2HE7 A;  3SV1 A;  4PQ0 A;  1EO6 A;  1P3Q U;  3QAQ A;  1IPG A;  2JRH A;  2YS1 A;  2NPT A;  3IFW B;  1TZ1 A;  2DFK A;  1IYF A;  2YSZ A;  3KZ1 A;  4GDL A;  2KLC A;  5LOP B;  1E8W A;  3SDL C;  5DCN A;  4PNK A;  3LJU X;  3ZUN A;  1B55 A;  3RYT A;  1H10 A;  3H6N A;  2KC2 A;  4PYZ A;  3HM6 X;  4ZRK A;  3HW2 B;  5J3Q A;  1ZGU B;  2J0M A;  3NZU A;  4IUM B;  2QKM A;  2RR9 A;  2RGF A;  2RSG A;  2D9W A;  2HTH B;  2CKH B;  4A6H A;  2FCS A;  2KX0 A;  2I5C A;  1MKE A;  1NI2 A;  3K9O B;  4NQL B;  4IWP A;  2DZI A;  1Q1O A;  1WGY A;  3W1S A;  2MBQ A;  4YON A;  2WH5 A;  1U2B A;  4Y94 A;  4IWQ A;  1XT9 B;  2KTR B;  2KJH B;  1KOT A;  4BKS D;  1U4A A;  2DAF A;  4FN2 A;  2ROV A;  3NZS A;  1RJ2 A;  2ABD A;  2BKF A;  4AP4 C;  2K2U A;  3SO6 A;  4HCN B;  1V5P A;  5L83 A;  3WAO A;  3TIX A;  2DZJ A;  2CS4 A;  3NSU A;  3M62 B;  2MKR A;  5DH9 B;  5D3Y A;  4RM9 A;  4W9K A;  5C23 A;  4HB0 B;  2JXX A;  2DTC A;  4HAZ B;  1E8Y A;  3T06 A;  5JLJ B;  1WR6 E;  1NTI A;  2YT1 A;  4K81 A;  4MGI E;  3SD5 A;  4NQK E;  3DVG X;  2PPH A;  4LDT B;  2KK8 A;  3TBL D;  2PE6 B;  2FID A;  4EKU A;  2P0F A;  1P5T A;  4HAV B;  3R7Q A;  1Y19 B;  3WIM A;  3MTN B;  4WWN A;  1WE7 A;  4W9J A;  3Q3F A;  1WZ3 A;  1WXS A;  3ZRF A;  3K9P B;  5JZE B;  1GJZ A;  3VHT C;  3RUI B;  3U8Z A;  4FAD A;  2JPH A;  1WGD A;  5GMV A;  4MSM B;  3PV1 A;  2XK5 A;  2W2X D;  2ADZ A;  4K2O A;  5LLI A;  3CST A;  3PEG A;  3NHE B;  3ZVV A;  1TTN A;  3QC8 B;  3D8D A;  4LDT D;  3VTV A;  4E71 A;  1I35 A;  5CHF A;  2DYN A;  1LB1 A;  5KCV A;  4GMX B;  2OQB A;  2D10 A;  2AWT A;  1FOE A;  4NNJ B;  2IO3 B;  3DXE A;  1UGM A;  2D4Q A;  2ZPY A;  2LI5 A;  3UIN B;  5AEK B;  1FHX A;  2AEH A;  2AL6 A;  2DZK A;  3KUZ A;  4C0A A;  5E6O A;  2LOZ A;  1Z87 A;  2GMI C;  2D11 A;  3EEC A;  2MX2 A;  4OVU A;  3ZTD A;  1FHW A;  2Y5B B;  2YT0 A;  4A5K A;  2KGX B;  1UEF A;  2RPQ A;  2KDF B;  4HAT B;  2L76 A;  2WWZ A;  1M7R A;  2D07 B;  2AL3 A;  2O2V A;  4EZJ A;  5D6J B;  1V88 A;  2JF5 A;  3KYD D;  3O96 A;  2J59 M;  4DK5 A;  2OTX A;  1HB8 A;  1XCG A;  5D3W A;  1P6S A;  2G3Q B;  4TV3 A;  1V86 A;  1E7U A;  4TYZ A;  4GOC A;  3PVU A;  1VCB A;  2REX A;  3GYP A;  4TQ0 A;  3VQI A;  1V89 A;  3SYX A;  4KIK A;  1TJ6 A;  4A3P A;  4XX5 A;  1BTK A;  3H1U A;  2D9X A;  3CSF A;  3GOE A;  5C16 A;  3VTW A;  4BOZ B;  1WZ0 A;  3A9J B;  2BCJ A;  3DBR I;  1NDD A;  2JP2 A;  2KDE B;  3UQB A;  2CHZ A;  2KXJ A;  3GZN I;  2KDI A;  3NY5 A;  4MDK E;  3JSV B;  2XQN M;  4KSL C;  3APD A;  1A5R A;  5DPS A;  1J0G A;  1UD7 A;  1ST7 A;  1YIW A;  3DQV A;  2DAJ A;  4G0N B;  2M14 A;  5LON B;  3PP2 A;  4ANX A;  4H8S A;  1WE6 A;  3PRZ A;  2KLG A;  4BBN F;  4FBJ B;  5LXH A;  3FLV A;  3VUW A;  5BO4 B;  2KVR A;  2EKE C;  5CX3 A;  5G55 A;  1U29 A;  1WR1 A;  4HHV A;  2KFJ A;  1FGZ A;  3DOW A;  3QJZ A;  4W9C A;  4EZK A;  4GPT B;  3A4S C;  2JUO A;  3PVL A;  3QBV B;  5C5B A;  3A1Q A;  2L0F A;  4TQ1 A;  3ZIM A;  4EUT A;  4PS8 A;  2ELB A;  3V6C B;  3TO1 A;  3PVW A;  2ZNV B;  2VRW B;  3B1L X;  1DDW A;  2DYQ A;  2ZEQ A;  2H7D A;  3QK0 A;  2C9W B;  1UEL A;  2COF A;  1WGG A;  1LW3 A;  2N23 A;  4DHZ E;  2Y8G A;  2K6Q A;  2KJR A;  4AJY B;  2JZZ A;  1NVL A;  2Q13 A;  3UIP B;  1Q67 A;  1WH3 A;  3WAN A;  2LVQ A;  2FIF A;  1M94 A;  3NOB A;  4URK A;  2LWP A;  2IY0 B;  3RT3 B;  3WAM A;  3ZNG C;  5TR5 A;  3OLM D;  1K5D B;  3L16 A;  2KN5 A;  2QHO A;  2MRP A;  3KSY A;  3V6E B;  4K7W A;  3AJ4 A;  3AUL A;  1DDM A;  2UVM A;  1L7Y A;  4HAW B;  1M7E A;  1R4M I;  2E2X A;  1LQB A;  2FCN A;  2KFK A;  3L10 B;  2VSZ A;  2J0K A;  1WM2 A;  3VDZ A;  2KHW B;  2JVC A;  4GDL B;  4WJP A;  2Z59 B;  1E8Z A;  2ZCB A;  2DYO A;  1GC6 A;  1ACA A;  2M8S A;  3RD2 A;  2DN6 A;  4FJZ A;  3P6A A;  1ISN A;  4GMV A;  4NY0 A;  2ZVN A;  2FCQ A;  2G35 A;  2W9N A;  2D9Z A;  2NMB A;  2XBB C;  1U5E A;  2MCN B;  2C7M B;  2LGD A;  2LZ6 A;  3M95 A;  1BT0 A;  1NU2 A;  2MQJ A;  1EUV B;  2KZR A;  5FR6 A;  4FJV B;  3ZVR A;  1GC7 A;  4DX9 0;  4DDI D;  2EC1 A;  4WVF B;  1S1Q B;  4ICV A;  3C0R B;  3ODX A;  2LG1 A;  4W9D A;  1XKE A;  5CLQ B;  2KJ6 A;  1XD4 A;  4HPM B;  3UQA A;  2C7H A;  4FLH A;  4WWO A;  3PPA A;  4FUL A;  4FJY A;  2KDB A;  3WYF B;  1WJ4 A;  4F7Z A;  2KO3 A;  2L00 B;  4KDI C;  1XQQ A;  4NJ7 A;  1X11 A;  1H4R A;  3F5R A;  4IAP A;  3T8M A;  1ZSQ A;  3EHV A;  4MGZ E;  1V80 A;  5D3V A;  2NBW B;  2KD0 A;  2GBJ A;  4KVG B;  2LAS A;  2COC A;  3CF6 E;  4II2 B;  2RSU A;  1Q5W B;  4W9L A;  3L0W B;  2YS5 A;  2CR5 A;  3W1S C;  4IFS A;  4I6N B;  4KDL B;  3KUD B;  2K8H A;  1WI1 A;  2UWQ A;  2L05 A;  4BBN C;  2CHX A;  3M63 B;  1WGH A;  1RAX A;  4ASW C;  3KH0 A;  3OJ4 B;  1U5G A;  3UF8 A;  3H7S A;  2KUP A;  3APF A;  1NTV A;  2EJ8 A;  3PTF C;  3SUZ A;  1D3Z A;  4FHJ A;  3QWZ B;  2GBR A;  2XK5 B;  1KM7 A;  2JT4 B;  3PG7 A;  2KKC A;  1G6J A;  1U27 A;  2COP A;  4HB4 B;  3T9L A;  3M3J A;  1V49 A;  4MJS A;  2ASQ A;  3V62 A;  3FM8 C;  2LGX A;  5LXI B;  3PRP B;  1F9J A;  4IG7 B;  4DX8 A;  3N30 A;  3KRW A;  2P0H A;  1YX5 B;  4BOS C;  4HVB A;  2MLB A;  3ZO5 B;  3FEH A;  3TW1 A;  5KQ1 A;  1EF1 A;  3VFK A;  4OVV A;  2DYM A;  1WI0 A;  2Z0D B;  2EMT A;  3P7Z A;  2MFQ A;  2DYB A;  2D9Y A;  1FHO A;  4DXA B;  4MK0 A;  2PZ1 A;  1ZVR A;  2AYO B;  2B3A A;  2L7R A;  1V5M A;  2C7N B;  1MPH A;  1YX6 B;  2YLM A;  4HB3 B;  3R7R A;  4MT7 A;  3DBL I;  2O2V B;  1QC6 A;  4A3O A;  3QA8 A;  4A20 A;  2FAZ A;  1KLV A;  2KTF A;  1W1D A;  2A5U A;  2V4L A;  4DWF A;  2JWZ A;  5IJM A;  3L17 A;  4DBG A;  2RLO A;  3PSC A;  2MBB B;  1GNU A;  4GZU A;  2V1Y A;  1HBK A;  1XR0 B;  4MGK E;  3O65 B;  1FAO A;  4KIK B;  4IW0 A;  3SU8 X;  5D94 A;  2BWE S;  1KZ7 A;  3U7D A;  2Z0Q A;  4BKT A;  2ZZP B;  2N9X A;  2RGN B;  2IBI B;  5E6N A;  1PMS A;  3MDB C;  1GUA B;  3HQC A;  2A4Z A;  3D8F A;  4TKN A;  5HE1 A;  5EDS A;  4W9G A;  3VAW A;  5D2M B;  3VTU A;  1WMH A;  1WYW B;  5KQ4 A;  4HAX B;  4CHJ A;  1W1G A;  3PZD A;  2PE9 A;  4WJN A;  3B08 A;  4PS7 A;  4JGH B;  4DHJ B;  4BBK A;  5G2N A;  5GOW B;  2M17 A;  3UIO B;  2GCJ A;  1MK9 B;  2OJR A;  1JRU A;  2KC1 A;  2YRY A;  1Y5O A;  4IC7 B;  3ULB A;  1WJ1 A;  1I42 A;  1H8C A;  3ZKJ C;  2R2O A;  4JL9 A;  1UPR A;  2DHZ A;  3ECI A;  4WAA A;  2LUL A;  4M0W B;  2GBN A;  3M1I B;  4RMA A;  3ZW3 A;  2NZ8 B;  4DHJ D;  3L13 A;  1BAK A;  1L2N A;  4FHK A;  2LRW A;  1WGU A;  3PT2 B;  1TBE A;  2FJL A;  5FI1 A;  1P9D U;  5J18 A;  4B6W A;  3HIZ A;  4MY6 A;  4WJ7 A;  3N7C A;  3DPD A;  5C5B B;  1VD2 A;  3HK0 A;  2WDT B;  3A1Q B;  3IG3 A;  2BYV E;  2KMC A;  5DIF B;  2C60 A;  3ONS A;  1XX0 A;  1AWE A;  4WJO A;  4YL8 A;  2PEA A;  2M1M A;  2KNB A;  1U5D A;  1S3S G;  4AOF A;  2EMS A;  3PRE A;  4EZL A;  1V5U A;  4EJN A;  1E8X A;  4W9F A;  3V61 A;  1FXT B;  1WX9 A;  2MDX A;  1UH6 A;  3QCA A;  1MG8 A;  3H7P A;  3VOQ A;  5CHW A;  4LCD E;  3PSE B;  3KY9 A;  4AWJ A;  4G11 A;  2K1F A;  2N1W A;  1ZC3 B;  4A6K A;  2MBH A;  4EFO A;  3LDZ E;  2KX3 A;  4CYE A;  2IO2 B;  2FCM A;  3NS8 A;  3ML8 A;  3RCP A;  2COD A;  2HJ8 A;  2MP2 A;  2L8J A;  4K17 A;  1BWN A;  3R66 C;  1EGX A;  5IAA C;  2DHI A;  2KFK B;  1V81 A;  3EC8 A;  2O6V A;  2DX1 A;  4JIO U;  1YD8 U;  3V5W A;  2GBM A;  3RZW C;  4HK2 A;  3A4R A;  4CHK A;  3WAL A;  1SGH A;  4TUU A;  3QIJ A;  2OOB B;  3TVV A;  2L0T A;  2DX5 A;  3G9W A;  4J6I A;  2LD9 A;  3VXW A;  1WGR A;  1UBI A;  4ICU A;  3KW5 B;  2XEW A;  4BVU C;  3EFU A;  1XD3 B;  2NVU I;  2BF8 B;  5L81 A;  3N32 A;  4GIV A;  2DHJ A;  1YJ1 A;  2LBB A;  3VIA A;  2LOX A;  5HE3 A;  1K8R B;  5JP4 A;  1WFY A;  1WXM A;  3IHP C;  3WAP A;  3Q3J A;  3ZDM C;  4L6E A;  4NJ6 A;  2P0D A;  4Z2M B;  1CMX B;  3ODO A;  3KUC B;  2J0J A;  5JHH A;  2H7E A;  5KHO A;  2K39 A;  5HKH A;  3A33 B;  3B0A A;  1P98 A;  4Z2N A;  4NAW A;  3QQ8 B;  4K7S A;  3DDC B;  3U30 A;  2FNJ B;  3HM3 A;  1V61 A;  2QKL A;  5DPR A;  2LVP A;  1K5G B;  5J3Y A;  5J3T A;  1T0Y A;  2KMA A;  5AZG A;  1U5F A;  3EPY A;  2KCJ A;  1OMW A;  4HDO A;  3ZLZ A;  4EMO A;  1EVH A;  3ALB A;  3X23 A;  1DRO A;  1XOD A;  3DXC A;  3A9K A;  2MWN B;  2X18 A;  4MEM A;  2MBE A;  4GDK A;  1KZG A;  4A6F A;  4I6L B;  5DHF B;  2L2I A;  2WX1 A;  3AXC A;  4IOY X;  3L08 A;  5CTR C;  2IZV B;  2KAN A;  5JHB A;  2CRF A;  2DA0 A;  3ZNH B;  4KV2 A;  2LGY A;  2GJY A;  4JLC A;  2N7D A;  3RUL A;  3TCA A;  4M8N A;  1HB6 A;  1QQG A;  4FA6 A;  4F7U P;  2RD0 A;  2UZS A;  2G4D B;  1LXD A;  3AU5 A;  2M4N A;  4D0N B;  1V9J A;  4I6P A;  4HB2 B;  3VH4 B;  5C1Z A;  3A8P A;  2N4F A;  3DXD A;  2BPS A;  4E3C A;  3AI5 A;  3PLV A;  2Y8F A;  4RM8 A;  2CAY A;  1KI1 B;  2VKI A;  3ZNI D;  1GG3 A;  2Z0E B;  1V5O A;  1WX8 A;  2UYZ B;  4MJS B;  1AQC A;  2V76 A;  5J17 A;  3BIN A;  2L1C A;  4F1S A;  4G3X B;  2RQ1 A;  5JHA A;  3KVF B;  5FI0 A;  1UNQ A;  4GN1 A;  3KRX A;  3VVW B;  2RUK B;  3DVG Y;  4XZ4 A;  1P3R A;  1LM8 B;  4F7G A;  3JYU A;  2CHW A;  1OGW A;  2MSE D;  4W9E A;  5DPW A;  2JY6 A;  4HCP B;  2K8B A;  4EEW A;  4MSQ B;  5D7G A;  1DYN A;  3JW0 X;  5E6P A;  4KZC A; 
#chains in the Genus database with same CATH topology
 4LTU A;  4W9I A;  3PHW B;  2WXN A;  1I4G A;  1FXA A;  4ZRI A;  3D32 A;  2R09 A;  3AE7 B;  5L95 C;  2COA A;  2BKR B;  4REZ A;  1JWA D;  5CLL B;  4EOY A;  2YVC A;  3NVZ A;  1PGA A;  1ROE A;  3ENB A;  2K2J A;  3OAN A;  5AZF A;  2B76 B;  1SE3 A;  1MAI A;  4KGS A;  1UBQ A;  4GXB A;  1F2R I;  3NUH B;  2XNA C;  3RFZ B;  5BYQ A;  2WXM A;  2J7Q B;  4XYC A;  1GOZ A;  3AU4 A;  1WX7 A;  1I7A A;  1X05 A;  2LXA A;  2DLW A;  1M4V A;  3MHS D;  1ZW7 A;  4KHA A;  1BTN A;  4J3O D;  5EE0 A;  1SJE D;  1PFJ A;  1HA5 A;  2V3S A;  1OQQ A;  4NSW A;  1WY8 A;  4BKS A;  4F8C B;  3P2B A;  4ACF A;  4B95 A;  1X1F A;  2HTH A;  2QSD A;  1WXV A;  2BGF A;  2GCL A;  2G45 B;  2WYQ A;  2ON8 A;  1NTY A;  1FMA D;  2CB8 A;  4CO7 A;  2UU7 A;  4IM2 A;  4PK1 A;  2N9P C;  3CMM B;  1JDE A;  2CU1 A;  2JZP A;  4ZDV A;  1V5T A;  1CJE A;  2K25 A;  1LFD A;  1ZM0 A;  1PLS A;  1J7B A;  2QDF A;  2HRJ A;  3VRA B;  1J0W A;  5JH5 C;  1WMH B;  3OJ3 A;  3N3K B;  2MW5 A;  3CXB B;  1WG7 A;  2KTR A;  4II3 B;  1R4N I;  3ML9 A;  4JKH A;  4ZRJ A;  3V05 A;  4AS1 A;  2IFS A;  3RPF C;  4LLG M;  1P7E A;  2DEN B;  4MGY E;  4AJW A;  5JXV A;  1FFV A;  2AX5 A;  4KSK C;  2LYD A;  2WX0 A;  2Z0O A;  4CHM A;  1UZX B;  2K00 A;  4C4V A;  4ANU A;  4L1R A;  3SHQ A;  1BXT A;  2K6D B;  5J2R A;  3KQ4 A;  3FSS A;  3HHM A;  1E90 A;  1SE9 A;  4LNN A;  3FVC A;  1YOV B;  2N7E A;  3ENE A;  1F2R C;  3RZF A;  3W9C B;  5DHA B;  4GB9 A;  3DBL B;  2RDH A;  5CHV C;  1JRO A;  2W2X C;  3C8Y A;  2KQ7 A;  4HLE A;  3HVZ A;  1I4X A;  2ICI A;  1P7F A;  2CQU A;  2N9L A;  3OAW A;  2NBV B;  3FKY A;  4P1C C;  4B9K A;  2Z0P A;  2YT2 A;  1WJU A;  2KVZ A;  2BYF A;  3X0W A;  1CK1 A;  2D3A A;  4FXC A;  2JRI B;  2K8C A;  3KWL A;  4WUR A;  2LJ5 A;  2LVO A;  5FR3 A;  4NPN A;  2D2Q A;  4BAX A;  2ZCC A;  2PJH A;  5HG2 A;  3DHG C;  2YEP B;  3VH3 B;  4QXA B;  1E0Z A;  1GB1 A;  3KYC D;  5IO9 A;  5DPT A;  2HD5 B;  2BYT A;  2DBY A;  5IA7 A;  3IVF A;  2L83 A;  1OQY A;  4KHB B;  1IRS A;  4WSF A;  5C6R A;  2DHK A;  2CY4 A;  1OTR B;  2M0X A;  2LUE A;  4HPL B;  4IM3 A;  1T5X D;  2ZVO A;  1MI0 A;  2MWS B;  1OEY A;  3DBH I;  3BYT B;  4IWO A;  1EU4 A;  2JZ3 B;  2D9V A;  4BFR A;  3A98 B;  1J19 A;  2PIA A;  2NR2 A;  3H7P B;  1DOY A;  2INC C;  5BMI A;  4WQO B;  4LK0 M;  4DQO C;  3QWM A;  2WXL A;  2I1J A;  2NTS A;  1EAZ A;  4C7Y A;  2FE8 A;  1WVH A;  2KWV B;  1WRD B;  2N1V A;  4ZYN A;  3E9L A;  3ML4 A;  2WXK A;  3AE8 B;  1RLF A;  2DKP A;  1SB3 C;  1C1Y B;  1HTQ A;  4KZ0 A;  1WJN A;  3Q14 C;  4R3D A;  3WA0 A;  1HZ5 A;  1EF5 A;  1E5W A;  2KWC A;  3TJP A;  1SHC A;  5I2M A;  4K1R B;  3ZXV A;  1W1H A;  4ILJ A;  4MH0 E;  2LRU A;  3APC A;  1DBH A;  1PQS A;  1J8C A;  2MP2 B;  1WGQ A;  1MHX A;  3W5V B;  4C80 A;  1WJ6 A;  3DWG C;  3PRM B;  1UF0 A;  2ZJD A;  4ZRQ A;  1QZE A;  3N20 C;  1T0R C;  5AUI A;  2DKQ A;  1KJT A;  2O6V B;  5DI9 B;  4PS3 A;  4JQW C;  3DVN U;  4OZC A;  2JSV X;  3T3N A;  3H8H A;  4L2Y A;  2W2W A;  3VUY A;  1SXT A;  2I5F A;  3SNH A;  3DCG A;  2KWU B;  4JK8 A;  2KAJ A;  4AUQ C;  2YF0 A;  4US8 A;  1Z2M A;  5D27 A;  3I3T B;  4HAU B;  1WM3 A;  4GGQ A;  3ZXR A;  2DX5 B;  4ANV A;  4LNK A;  2IO1 B;  3DVN V;  5D3I B;  2P8V A;  1TXD A;  3UZT A;  1FB8 A;  2G1E A;  3AEF B;  3E66 A;  3VUX A;  2M38 A;  2M19 A;  2VH2 A;  2GBK A;  4XWX A;  2O6V D;  2NTT A;  2FUH B;  2GS0 A;  2CJO A;  2G4S A;  4LNI A;  3ZGZ A;  1PDX A;  1V2Y A;  5JHG A;  4ANW A;  3V60 A;  4E74 A;  1NBF C;  4LJP B;  1ET9 A;  1IP9 A;  3A8Q A;  2V9H A;  4K7U A;  1Y56 A;  3PGE A;  5HHD G;  2ELA A;  3TFM A;  2LHE A;  2KOX A;  2KQS A;  3IBE A;  4MEL A;  2CY5 A;  3GYO A;  3ZQ4 A;  2I2Y A;  1X1G A;  4G50 A;  1MIX A;  1OEY J;  4QJ5 B;  2ROZ B;  2RNR B;  2J4X A;  5AZH A;  3W1Y A;  1KF6 B;  1WF9 A;  3JVZ X;  1E10 A;  3A9J A;  1MVK A;  3PHX B;  3TL5 A;  3ULC A;  4NAW B;  1RYJ A;  2WNM A;  4HJK A;  1UPQ A;  1TS5 A;  5BMG A;  2RVB B;  3TMP B;  1XCQ L;  3MPX A;  4IM0 A;  2R0D A;  4ZRP A;  1YQB A;  3S2A A;  1DIK A;  2PW9 A;  2ZPN A;  3JSV A;  2YS3 A;  2ONQ A;  1MIZ B;  1FD6 A;  1Z5S B;  1P1A A;  1HTO A;  2DWQ A;  4M8M A;  3DBS A;  1OY2 A;  5C79 A;  1I2H A;  2UZR A;  1XXG A;  2MA9 B;  2IYD B;  4HAY B;  4LJO B;  1ZKH A;  4JWS C;  1OQN A;  3CIK A;  2DNF A;  1P0R A;  2R2Q A;  4HWI B;  1RRB A;  4W9H A;  2L1A A;  2FDQ A;  2LKO A;  2CJN A;  3A9K B;  2Y7B A;  1WIA A;  5LNK 1;  4K2P A;  3L54 A;  3PLU A;  1RRP B;  4GDK B;  2IO0 B;  4PYU A;  4A6F B;  4WJQ A;  2NCN A;  4MM3 B;  2I1K A;  4DHZ B;  1X1M A;  1ZPS A;  4BKG A;  4DDG D;  1Q0W B;  3QHT A;  3RMK C;  1E7V A;  3MJW A;  5KHQ A;  1HE8 A;  1WXA A;  1V6E A;  3B2F A;  3N1Z C;  1UNP A;  4GOU A;  1SIF A;  1QQR A;  5HE0 A;  1D5Z C;  1X86 A;  3ZNZ B;  1RFA A;  3N9Y C;  3UGB B;  4DBB A;  1TQZ A;  2VRR B;  1RWS A;  2NS5 A;  1EWC A;  1GAQ B;  2N9E B;  1UGJ A;  1TGZ B;  4WIP A;  2BYE A;  3P4Q B;  2ZNV C;  2DZM A;  1XF5 L;  2WLB A;  1UNR A;  4C00 A;  1TYG B;  2L3Z A;  2C5L C;  3ZDT A;  4HKQ A;  2NPT B;  4GSW A;  3ZTC A;  3P4R B;  1MK7 B;  4KAX B;  2MBO A;  5HE2 A;  4X57 B;  2K49 A;  1MHH E;  3QAR A;  2D3G A;  2MEK A;  4WWP A;  1C3T A;  4F7H A;  3LJ3 A;  3ODW A;  1ZC4 B;  1FIQ A;  2N0Y A;  2KT7 A;  4P7I A;  1ZE3 D;  2BWF A;  2RDG A;  3RNF C;  4XC2 A;  3BY4 B;  4JKB A;  3FIL B;  4B6H A;  1QOB A;  3BJI A;  5C2T B;  1N61 A;  2IYB A;  4GU2 A;  3FP5 A;  2LGS A;  3D8E A;  1DDV A;  4YWG G;  3I9V 1;  4K3B A;  3R3M A;  1IUE A;  3RCZ A;  1HEZ E;  4HDQ A;  1Y8R C;  2LXC A;  4MM3 A;  5D3X A;  1XLQ A;  2FJ9 A;  4IDI A;  4B0E A;  2NBU A;  2WU2 B;  4KHO A;  1B9R A;  1Q10 A;  3NS1 A;  3QX1 A;  1FGY A;  5FKA C;  5EFX A;  2GOW A;  4HXD A;  1D5M C;  1WJM A;  3PS6 A;  3H9D A;  1N3H A;  1JCK B;  1AAR A;  2FUG 1;  3RNC C;  4QJ3 B;  2IY1 B;  4N9F 4;  4XWT A;  4OW0 A;  3F0W A;  2Y5P A;  3ZRC A;  2HE7 A;  3SV1 A;  1NYR A;  3ABV B;  4PQ0 A;  4ZHP A;  1EO6 A;  1JWM D;  1P3Q U;  3QAQ A;  4OZA A;  3RNA C;  1J7C A;  1IPG A;  3AH7 A;  1SE2 A;  2JRH A;  1YNT E;  2M56 B;  2YS1 A;  2NPT A;  3IFW B;  1TZ1 A;  2DFK A;  1MFW A;  1IYF A;  4JK9 A;  2YSZ A;  3KZ1 A;  4GDL A;  2LJI A;  2KLC A;  2Z59 A;  1C4P A;  5LOP B;  2E6X A;  1E8W A;  3SEB A;  4CQN A;  3Q8C A;  3SDL C;  3FAH A;  4P1B C;  1TS4 A;  2BTE A;  4US9 A;  5DCN A;  4PNK A;  3BVG A;  5JVL A;  3LJU X;  3ZUN A;  1B55 A;  2BS2 B;  4HPP A;  3RYT A;  1H10 A;  3H6N A;  2KC2 A;  4PYZ A;  4A6Q A;  3HM6 X;  4ZRK A;  3HW2 B;  5J3Q A;  1STE A;  1LGR A;  2WS3 B;  1ZGU B;  3U52 E;  2AQ3 B;  2J0M A;  3DCX A;  3NZU A;  4IUM B;  2K22 A;  2PKO A;  2QKM A;  2RR9 A;  3AEE B;  3BVM A;  2RGF A;  2RSG A;  2D9W A;  2HTH B;  2CKH B;  2KIG A;  2ZW0 A;  4A6H A;  1RFK A;  2FCS A;  2BW2 A;  2KX0 A;  3AM9 A;  2I5C A;  3R2T A;  2Q5W D;  1MKE A;  1NI2 A;  3KLS X;  3PZ7 A;  2TSS A;  3K9O B;  4NQL B;  3BYY B;  4IWP A;  2DZI A;  1Q1O A;  1WGY A;  3W1S A;  1JAL A;  1PGX A;  2MBQ A;  2OED A;  4YON A;  2WH5 A;  3NJT A;  1N5W A;  1U2B A;  3BZD B;  4YSZ B;  4KX6 B;  4Y94 A;  4IWQ A;  1XT9 B;  2WXI A;  1ZXI A;  2KTR B;  2KJH B;  1KOT A;  4BKS D;  1U4A A;  2DAF A;  2PVG C;  2WXP A;  4FN2 A;  4A8X C;  2ROV A;  1F0Z A;  3NZS A;  2G9H D;  4EE2 A;  1RJ2 A;  2ABD A;  2KMM A;  2X38 A;  2BKF A;  4AP4 C;  4YXD B;  3DHI C;  2K2U A;  3SO6 A;  1SBB B;  4C7Z A;  4HCN B;  3BK1 A;  1V5P A;  4C4V B;  5L83 A;  3WAO A;  3TIX A;  2DZJ A;  2CS4 A;  3NSU A;  4XE0 A;  3Q8A A;  3M62 B;  4OVZ A;  2MKR A;  3SFE B;  2ZW1 A;  4JKG A;  5DH9 B;  1UNS A;  2I38 A;  5D3Y A;  4RM9 A;  4JKE A;  4W9K A;  5C23 A;  3TEZ A;  4HB0 B;  2X0S A;  1C76 A;  2JXX A;  2WP9 B;  5IRS A;  3EGR A;  4ZOH C;  3AEC B;  2DTC A;  4HAZ B;  2QIE B;  1VLB A;  1E8Y A;  3U2S C;  3T06 A;  5JLJ B;  1WR6 E;  2WXO A;  1NTI A;  2K5P A;  2PLP A;  2YT1 A;  4K81 A;  1MPE A;  2JYE A;  4MGI E;  1YQ4 B;  3SD5 A;  4NQK E;  3DVG X;  2PPH A;  4LDT B;  2KK8 A;  3TBL D;  2PE6 B;  1RM6 C;  2FID A;  2WGS A;  4EKU A;  2P0F A;  1P5T A;  1DGJ A;  4HAV B;  3R7Q A;  1Y19 B;  3WIM A;  4IOI E;  3MTN B;  5E6J A;  1A70 A;  4WWN A;  1WE7 A;  4W9J A;  3Q3F A;  1WZ3 A;  3IXS A;  1WXS A;  3ZRF A;  3K9P B;  5JZE B;  1GJZ A;  3VHT C;  1L4Z B;  1YN3 A;  3RUI B;  3RI7 C;  3U8Z A;  4FAD A;  2JPH A;  1WGD A;  1WGK A;  4HRS A;  5GMV A;  4MSM B;  1OFF A;  3PV1 A;  1FNV A;  2XK5 A;  2W2X D;  1YQ3 B;  2ADZ A;  4K2O A;  5LLI A;  3CST A;  3PEG A;  3NHE B;  3ZVV A;  1TTN A;  3QC8 B;  3Q3O C;  4YSX B;  3Q6B A;  3D8D A;  4LDT D;  3VTV A;  4E71 A;  3AEA B;  1I35 A;  1ET6 A;  1C79 A;  5CHF A;  2V4I B;  2DYN A;  1LB1 A;  5KCV A;  4L23 A;  4GMX B;  2OQB A;  2D10 A;  2AWT A;  1FOE A;  4C56 C;  1L6U A;  1R4N B;  4NNJ B;  1L0X B;  1KH0 A;  2VZK B;  2Z8L A;  2KDM A;  2IO3 B;  3DXE A;  3PO0 A;  1UGM A;  2N9K A;  2D4Q A;  3A58 A;  2V3N A;  3URY A;  5IKC M;  3NWF A;  2ZPY A;  3VRB B;  3HIE A;  2LI5 A;  3UIN B;  5AEK B;  1L6V A;  2W55 A;  1FHX A;  2AQ1 B;  1I4H A;  2AEH A;  2FJU B;  2AL6 A;  1L0Y B;  2DZK A;  1VRA B;  3KUZ A;  3HRD D;  4C0A A;  1KFY B;  4QAY A;  5E6O A;  4XDC A;  2LOZ A;  1I4P A;  2HDE A;  1Z87 A;  2GMI C;  4HJG E;  2D11 A;  1KLG D;  3EEC A;  4RF0 A;  2MX2 A;  4OVU A;  1FXI A;  3ZTD A;  1MI1 A;  3Q3M C;  1FHW A;  2Y5B B;  3W2D A;  3AE6 B;  2YT0 A;  5FK9 C;  4A5K A;  3P4S B;  2VZK D;  2KGX B;  1UEF A;  2RPQ A;  3AV8 A;  2K9X A;  2KDF B;  4HAT B;  2L76 A;  2WWZ A;  1M7R A;  3MJ5 A;  2PMV A;  2D07 B;  4OSN A;  2AL3 A;  2O2V A;  4EZJ A;  5D6J B;  1SJH D;  1V88 A;  4M00 A;  3E56 A;  2JF5 A;  2GB1 A;  1ENF A;  3KYD D;  1N60 A;  3O96 A;  3B77 A;  2J59 M;  4DK5 A;  2OTX A;  1HB8 A;  1XCG A;  5D3W A;  1EWY C;  1P6S A;  2G3Q B;  4TV3 A;  1V86 A;  5HFY A;  1YJI A;  1B1Z A;  1E7U A;  1FRD A;  2QEJ C;  1ZUD 2;  2MHJ A;  4TYZ A;  4GOC A;  4OHJ A;  3PVU A;  3NZ3 A;  1VCB A;  1WRI A;  1N63 A;  2REX A;  2INN E;  3DBH B;  2MJD A;  3GYP A;  4JX1 C;  3MC9 A;  1VJK A;  4TQ0 A;  3VQI A;  1GGO A;  1V89 A;  4XWW A;  3SYX A;  4KIK A;  4KGR A;  1TJ6 A;  4A3P A;  1JW9 D;  4XX5 A;  2PTL A;  1BTK A;  2QIL A;  3H1U A;  2D9X A;  3CSF A;  3GOE A;  5C16 A;  3VTW A;  4BOZ B;  3Q8B A;  1JWB D;  3IAM 1;  2WXG A;  1CQV A;  1QF6 A;  3U7Z A;  3P4P B;  1L0V B;  1WZ0 A;  3A9J B;  2BCJ A;  2BS4 B;  1NDD A;  3DBR I;  1FNU A;  2JP2 A;  2KDE B;  2LEK A;  4A90 A;  3UQB A;  2CHZ A;  2KXJ A;  4NJC A;  3GZN I;  2KDI A;  3NY5 A;  4MDK E;  1J7A A;  3JSV B;  2XQN M;  4KSL C;  3APD A;  3AMZ A;  1NEN B;  3BWU D;  3OWE B;  4TMA B;  1A5R A;  2R2Y A;  4N6E B;  3SFD B;  2IGH A;  5DPS A;  1EM7 A;  1J0G A;  1UD7 A;  2RDB C;  2BBC A;  1ST7 A;  1YIW A;  1L4D B;  3DQV A;  1YJJ A;  3NVV A;  2DAJ A;  3NWD A;  4G0N B;  5IP4 D;  1FFU A;  3GE8 C;  4UDU C;  2M14 A;  1PFD A;  3ZYY X;  3N1X C;  5LON B;  3PP2 A;  3AEG B;  4ANX A;  2WDQ B;  4YSY B;  4H8S A;  1WE6 A;  3PRZ A;  1KRH A;  3U4E G;  3MC8 A;  2KLG A;  4BBN F;  1FRR A;  4FBJ B;  2BB5 A;  5LXH A;  3FLV A;  5G5H A;  3VUW A;  4YTP B;  4M0W A;  2KVR A;  5BO4 B;  3FC4 A;  4JKA A;  1V1P A;  4WH4 A;  2EKE C;  5CX3 A;  5G55 A;  1U29 A;  2FBW B;  1WR1 A;  1IBX A;  4HHV A;  2KFJ A;  2GRI A;  1FGZ A;  2Z4D A;  1VBG A;  4JE3 B;  4GLS C;  3DOW A;  3QJZ A;  4W9C A;  4EZK A;  4GPT B;  2Y3A A;  1EU3 A;  4H2A A;  3A4S C;  2JUO A;  3PVL A;  3QBV B;  5C5B A;  3A1Q A;  2L0F A;  4TQ1 A;  3ZIM A;  4EUT A;  4PS8 A;  1VBH A;  2ELB A;  3V6C B;  2JXT A;  4HSI A;  5TSS A;  3TO1 A;  3NVY A;  2MJE A;  3PVW A;  2ZNV B;  2VRW B;  4TSS A;  3B1L X;  1DDW A;  2DYQ A;  2ZEQ A;  2HJ1 A;  4S17 A;  2H7D A;  1QOF A;  1SE4 A;  3Q8F A;  3QK0 A;  2C9W B;  1UEL A;  2COF A;  1WGG A;  1LW3 A;  2N23 A;  4DHZ E;  2Y8G A;  2K6Q A;  2KJR A;  1ESF A;  1FEH A;  1F52 A;  1K52 A;  4RGM A;  4AJY B;  2JZZ A;  1NVL A;  1TZO A;  2Q13 A;  4RNA A;  3UIP B;  3AN1 A;  1Q67 A;  4P16 A;  1WH3 A;  3AE1 B;  3WAN A;  3ZJU A;  2LVQ A;  2FIF A;  1M94 A;  3NOB A;  4S0R A;  1YN5 A;  4URK A;  3SR6 A;  2LWP A;  2IY0 B;  2KWD A;  4ILH A;  3RT3 B;  1FCL A;  3EUB 2;  5H8Y E;  1V1O A;  3WAM A;  1MJD A;  1QT9 A;  3ZNG C;  5TR5 A;  3OLM D;  1K5D B;  3L16 A;  4PT5 A;  3R8B A;  2KN5 A;  5BMH A;  2WXQ A;  4KGT A;  2QHO A;  1FO4 A;  2MRP A;  3KSY A;  3V6E B;  1KBL A;  1PYW D;  4K7W A;  3AJ4 A;  3AUL A;  4M02 A;  1DDM A;  2UVM A;  3PZ8 A;  1L7Y A;  4HAW B;  4ITK A;  1M7E A;  1R4M I;  3E9P A;  3AE3 B;  2E2X A;  1LQB A;  2FCN A;  2KFK A;  3L10 B;  1I4Q A;  2VSZ A;  2J0K A;  3B2G A;  3T3O A;  4WWM A;  1WM2 A;  3VDZ A;  3VR9 B;  2KHW B;  2JVC A;  4GDL B;  4WJP A;  2Z59 B;  1E8Z A;  2EKI A;  2ZCB A;  2DYO A;  4ZYS A;  1GB4 A;  4OT1 A;  3NVW A;  1GC6 A;  1ACA A;  2M8S A;  3RD2 A;  4B0M A;  2DN6 A;  4FJZ A;  3P6A A;  2IGG A;  1ISN A;  4GMV A;  4D6W A;  4NY0 A;  2JU6 X;  2FCQ A;  2ZVN A;  2G35 A;  2W9N A;  2D9Z A;  2NMB A;  2XBB C;  1U5E A;  3NG0 A;  2MCN B;  2C7M B;  2LGD A;  2MH7 A;  2LZ6 A;  2KYW A;  3M95 A;  3GE3 C;  1BT0 A;  1NU2 A;  3AED B;  2MQJ A;  3HUI A;  3IT6 B;  1EUV B;  2KZR A;  5FR6 A;  4FJV B;  1WSP A;  1DOX A;  2WXR A;  3ZVR A;  1GC7 A;  4DX9 0;  4DDI D;  2V3P A;  2EC1 A;  1TY0 A;  4WVF B;  1S1Q B;  1LO5 D;  3MC0 B;  4ICV A;  4XDD A;  3C0R B;  3ODX A;  1T77 A;  2LG1 A;  1UWM A;  4W9D A;  1XKE A;  5MPO A;  2WXF A;  5CLQ B;  4A55 A;  4USA A;  2KJ6 A;  1XD4 A;  2RRF A;  1HXY D;  1TJE A;  3Q2A C;  4HPM B;  1XCT L;  3UQA A;  3AEB B;  2C7H A;  4FLH A;  4WWO A;  3PPA A;  4FUL A;  4FJY A;  1VZ7 A;  2KDB A;  3WYF B;  3P42 A;  1WJ4 A;  4F7Z A;  2KO3 A;  2L00 B;  4KDI C;  1N6Z A;  1XQQ A;  4NJ7 A;  1X11 A;  1H4R A;  3F5R A;  4IAP A;  2WDV B;  3T8M A;  1ZSQ A;  3IT4 B;  3EHV A;  4JKG B;  1V80 A;  4MGZ E;  5D3V A;  2NBW B;  2KD0 A;  3RNE C;  2GBJ A;  1JML A;  2X8X X;  2YEP F;  4KVG B;  2LAS A;  2COC A;  3GS2 A;  3CF6 E;  4II2 B;  3MFG A;  1C9F A;  2RSU A;  2W3S A;  1Q5W B;  4W9L A;  2KIE A;  3L0W B;  2YS5 A;  2CR5 A;  2BS3 B;  3W1S C;  1ZDV A;  4IFS A;  4I6N B;  4A9A A;  1V8C A;  3LYY A;  5H92 C;  1KC7 A;  2VH1 A;  1C4C A;  4KDL B;  3KUD B;  2K8H A;  1WI1 A;  2KAC A;  2UWQ A;  2L05 A;  1UUP A;  4BBN C;  3NW8 A;  2CHX A;  3M63 B;  1WGH A;  3C19 A;  1RAX A;  4ASW C;  3KH0 A;  2V0G A;  2LMC A;  3OJ4 B;  1U5G A;  3UF8 A;  3H7S A;  3B9J A;  2KUP A;  1K50 A;  3APF A;  1N62 A;  1NTV A;  3MP9 A;  2EJ8 A;  3PTF C;  3SUZ A;  1D3Z A;  4FHJ A;  3QWZ B;  2GBR A;  3HSA A;  2XK5 B;  3U12 A;  3RN9 C;  1KM7 A;  1V97 A;  2JT4 B;  4IKG A;  1QOG A;  3PG7 A;  1T0Q C;  2KKC A;  1G6J A;  4JKF A;  2J42 A;  1U27 A;  2COP A;  4HB4 B;  3LXF A;  3T9L A;  3M3J A;  1NI3 A;  1V49 A;  4MJS A;  2ASQ A;  3V62 A;  3FM8 C;  3AE2 B;  2LGX A;  5LXI B;  1DOI A;  3PRP B;  1F9J A;  4O1N A;  1NYQ A;  4IG7 B;  4DX8 A;  3N30 A;  3KRW A;  2P0H A;  1YX5 B;  1OQR A;  4BOS C;  1AN8 A;  2CU3 A;  4HVB A;  2MLB A;  3ZO5 B;  5AUK A;  3FEH A;  3CIR B;  3TW1 A;  3GP7 A;  5KQ1 A;  1EF1 A;  3VFK A;  5LG4 B;  1I7H A;  4OVV A;  1DYQ A;  2DYM A;  1WI0 A;  2Z0D B;  4CSQ A;  2K3U A;  4GNK B;  2EMT A;  2EEL A;  3P7Z A;  2MFQ A;  2DYB A;  2D9Y A;  1FHO A;  4DXA B;  4MK0 A;  2PZ1 A;  1ZVR A;  2AYO B;  2B3A A;  2NMQ A;  1T3Q A;  1C77 A;  2L7R A;  1V5M A;  2C7N B;  1MPH A;  1YX6 B;  2YLM A;  4BZA A;  1UWX A;  4HB3 B;  3R7R A;  4MT7 A;  3DBL I;  2O2V B;  1YN4 A;  1QC6 A;  2QC8 A;  1TKG A;  4A3O A;  4QJ4 B;  3QA8 A;  4A20 A;  5I2S A;  2FAZ A;  1KLV A;  2KTF A;  1W1D A;  2A5U A;  2V4L A;  4DWF A;  2HTM E;  2JWZ A;  5IJM A;  4RCO A;  2MJ3 A;  3L17 A;  4DBG A;  1FCC C;  2RLO A;  4AQ7 A;  2JYT A;  1WXQ A;  3PSC A;  2MBB B;  1GNU A;  3E9O A;  3ZJT A;  4GZU A;  2D3B A;  1FM0 D;  5HI1 A;  2V1Y A;  2IPK D;  4RH6 A;  1HBK A;  5BYR A;  4P6V F;  1XR0 B;  4MGK E;  1JWU D;  2GLS A;  2H88 B;  2JWU A;  3O65 B;  1FAO A;  4KIK B;  4IW0 A;  4RF1 A;  3SU8 X;  5D94 A;  2BWE S;  1KZ7 A;  3U7D A;  3RNG C;  2Z0Q A;  1ZXH A;  4BKT A;  2ZZP B;  4RGN A;  2M0A A;  2N9X A;  3TEW A;  2RGN B;  2IBI B;  5E6N A;  1PMS A;  3Q69 A;  3MDB C;  1GUA B;  1D4B A;  2JQR B;  3HQC A;  2A4Z A;  3LB8 C;  3CWI A;  3D8F A;  4TKN A;  5HE1 A;  5EDS A;  2J52 A;  4W9G A;  5D2M B;  3VAW A;  2K0P A;  3VTU A;  4ZHO A;  4M01 A;  3WCQ A;  1WMH A;  1XLN A;  2KUQ A;  1NEK B;  1PGB A;  1WYW B;  5KQ4 A;  4K3C A;  5EE1 A;  4HAX B;  4CHJ A;  1W1G A;  3PZD A;  2PE9 A;  4WJN A;  3B08 A;  3OG5 A;  4PS7 A;  4JGH B;  4DHJ B;  4BBK A;  1TIF A;  3AB5 A;  5G2N A;  5C3J B;  1XLP A;  5GOW B;  4YTM B;  2M17 A;  3ZJV A;  2IGD A;  3UIO B;  3E9S A;  1QLB B;  2GCJ A;  3I57 A;  1MK9 B;  2OJR A;  1JRU A;  2KC1 A;  1IGC A;  5D3D A;  4OZB A;  2YRY A;  3TSS A;  2RPV A;  1SIJ A;  2J53 A;  1Y5O A;  1XEE A;  4IC7 B;  3ULB A;  1WJ1 A;  4RGT A;  1I42 A;  5GXG B;  1H8C A;  3ZKJ C;  2R2O A;  4JL9 A;  4JKD A;  1TS2 A;  3HVD A;  2QJL A;  1UPR A;  1SF0 A;  2DHZ A;  3ECI A;  4WAA A;  2LUL A;  4M0W B;  2L52 A;  1V1P B;  1L5P A;  2GBN A;  3M1I B;  1K51 A;  3EA6 A;  4RMA A;  2QMT A;  2NBV A;  3ZW3 A;  2NZ8 B;  1VDV A;  2LUM A;  4DHJ D;  4ARC A;  3L13 A;  1BAK A;  4XGA B;  5EE3 A;  1VR9 A;  1L2N A;  4D2K A;  4FHK A;  1IBX B;  2LRW A;  1WGU A;  3PT2 B;  2SEB D;  1TBE A;  2WU5 B;  1SEB D;  2FJL A;  1QOA A;  5FI1 A;  1P9D U;  2WDR B;  1D5X C;  5J18 A;  4B6W A;  2RMM A;  3HIZ A;  4YTN B;  4MY6 A;  3P1M A;  4WJ7 A;  3N7C A;  3OHM B;  3DPD A;  3GB1 A;  5C5B B;  1CZP A;  3HK0 A;  1VD2 A;  2WDT B;  3A1Q B;  2SAK A;  3IG3 A;  1ZYI A;  2BYV E;  2KMC A;  3BII D;  2DLB A;  2OHF A;  5DIF B;  2C60 A;  3ONS A;  1XX0 A;  1AWE A;  4RGO S;  4WJO A;  4YL8 A;  2PEA A;  3BK2 A;  4KHB A;  4DXF A;  4HKZ E;  2M1M A;  2WHI A;  2KNB A;  1U5D A;  3AE9 B;  1S3S G;  4AOF A;  2EMS A;  3PRE A;  4EZL A;  1V5U A;  4EJN A;  3RNB C;  1E8X A;  1BML C;  4W9F A;  2Y5C A;  5IOI A;  3V61 A;  1FXT B;  3DBR B;  1WX9 A;  3SBT A;  4JWU C;  2MDX A;  1UH6 A;  3QCA A;  4LNF A;  1MG8 A;  3H7P A;  3VOQ A;  5CHW A;  3AE4 B;  1KTK A;  4LCD E;  4MT5 A;  1HQR D;  2D5G A;  3GZN B;  3PSE B;  4WQM A;  4DIX A;  1IGD A;  3KY9 A;  4AWJ A;  4G11 A;  2IDY A;  4KKJ A;  2K1F A;  2WXJ A;  4NZL B;  2N1W A;  1ZC3 B;  4A6K A;  2MBH A;  2JX5 A;  2BVC A;  1D6E C;  1WYG A;  4EFO A;  1FNW A;  2KX3 A;  3LDZ E;  1KLU D;  4CYE A;  2IO2 B;  3EFC A;  4HRO A;  1QKZ A;  5G5G A;  2FCM A;  3NS8 A;  1GPX A;  3ML8 A;  3RCP A;  2COD A;  2HJ8 A;  2MP2 A;  2L8J A;  3AE5 B;  4K17 A;  4N59 A;  4ARI A;  1BWN A;  3R66 C;  1EGX A;  5IAA C;  2DHI A;  2KFK B;  1V81 A;  2W54 A;  3EC8 A;  2O6V A;  2DX1 A;  4JIO U;  1YD8 U;  3I5J C;  3V5W A;  1TY2 A;  1E7P B;  1JWS D;  2GBM A;  3ETR A;  1NVI D;  2ZKM X;  3RZW C;  4HK2 A;  3A4R A;  2BQQ A;  4CHK A;  1YMH E;  2AQ2 B;  3WAL A;  1C78 A;  1SGH A;  4TUU A;  3QIJ A;  2OOB B;  3TVV A;  2L0T A;  2KR0 A;  2DX5 A;  1N5X A;  3G9W A;  4J6I A;  2N0S B;  5T8I A;  2LD9 A;  3VXW A;  2QCZ A;  3V3X A;  1WGR A;  1F1H A;  4KKI A;  1UBI A;  2XN9 C;  4ICU A;  1I4R A;  3KW5 B;  2XEW A;  1AYF A;  2W3R A;  4JPS A;  2PVO D;  4BVU C;  3EFU A;  1XD3 B;  2NVU I;  2BF8 B;  5L81 A;  3N32 A;  4GIV A;  1ACC A;  2DHJ A;  1YJ1 A;  3MHZ A;  1ZOY B;  2LBB A;  3VIA A;  2LOX A;  2N7J A;  5HE3 A;  1K8R B;  5EE9 A;  1VZ6 A;  2R82 A;  5JP4 A;  1WFY A;  1WXM A;  3IHP C;  3WAP A;  3Q3J A;  2GUM A;  3ZDM C;  4L1B A;  2Z14 A;  2LHD A;  4L6E A;  4NJ6 A;  2P0D A;  3R2I A;  4Z2M B;  1CMX B;  3ODO A;  1XO3 A;  1TKY A;  3KUC B;  3NRZ A;  4JK7 A;  2J0J A;  5JHH A;  2H7E A;  3L4P A;  5KHO A;  2K39 A;  1R7S A;  5HKH A;  3A33 B;  3B0A A;  2LGI A;  4MH8 A;  1VZ8 A;  1P98 A;  1BUI C;  2R61 A;  4Z2N A;  3O13 A;  4LNO A;  4NAW A;  3QQ8 B;  1ZP0 B;  1TT5 B;  2LFI A;  4K7S A;  3DDC B;  3U30 A;  3W5U B;  2FNJ B;  3HM3 A;  2L32 A;  1V61 A;  1AW7 A;  2WXH A;  2QKL A;  5I4D A;  5DPR A;  2LVP A;  1K5G B;  2BB6 A;  2DIK A;  5J3Y A;  5J3T A;  1T0Y A;  1R4M B;  2KMA A;  3DWM A;  3KWV A;  5AZG A;  1U5F A;  3EPY A;  2KCJ A;  1ZDX A;  1E6E B;  1TS3 A;  1OMW A;  4NAM A;  4HDO A;  3ZLZ A;  4EMO A;  1EVH A;  3ALB A;  3X23 A;  1DRO A;  1XOD A;  3VR8 B;  3DXC A;  1T6B X;  3J9C A;  3I63 C;  3A9K A;  2MWN B;  2X18 A;  4MEM A;  2MBE A;  4GDK A;  3BVZ A;  1JRP A;  1KZG A;  4A6F A;  2GI9 A;  3TEY A;  4I6L B;  5DHF B;  2L2I A;  1PUT A;  2WX1 A;  3AXC A;  4IOY X;  3L08 A;  1MG4 A;  5CTR C;  2IZV B;  2KAN A;  5JHB A;  3P63 A;  2ACZ B;  5IN7 A;  2CRF A;  2DA0 A;  3ZNH B;  2D3C A;  4KV2 A;  2LGY A;  2GJY A;  4JLC A;  2N7D A;  3RUL A;  3TCA A;  4M8N A;  1HB6 A;  1QQG A;  4FA6 A;  4Q2J A;  4F7U P;  2KN4 A;  2E3T A;  2RD0 A;  4ILG B;  2UZS A;  2G4D B;  1LXD A;  2K8E A;  2INP E;  3AU5 A;  3IAS 1;  2M4N A;  4D0N B;  1V9J A;  4I6P A;  4HB2 B;  3VH4 B;  2KQ4 X;  5C1Z A;  3A8P A;  2N4F A;  3DXD A;  1TKE A;  2BPS A;  3AI5 A;  4E3C A;  3Q8E A;  3PLV A;  2Y8F A;  3NWA A;  2W82 A;  4RM8 A;  2CAY A;  1KI1 B;  2VKI A;  2IJ0 A;  1SSN A;  4YT0 B;  3DHH C;  2BT6 A;  3ZNI D;  1GG3 A;  2Z0E B;  5M4Y B;  1WWT A;  3FIL A;  1V5O A;  1WX8 A;  2UYZ B;  4MJS B;  3N1Y C;  2WQY B;  4HEA 1;  1AQC A;  3UI3 A;  2V76 A;  5J17 A;  3BIN A;  2L1C A;  1QIL A;  1T0S C;  4F1S A;  4G3X B;  2RQ1 A;  1AWD A;  3TUO A;  5JHA A;  3KVF B;  4JKC A;  2Z13 A;  5FI0 A;  1UNQ A;  4GN1 A;  1F77 A;  1C4A A;  3TEX A;  4MAC A;  3KRX A;  3VVW B;  2RUK B;  4N58 A;  3SBG A;  3DVG Y;  1HZ6 A;  5BYS A;  2OJW A;  1JQ4 A;  1E9M A;  4XZ4 A;  1P3R A;  1LM8 B;  4F7G A;  3JYU A;  2CHW A;  4WAF A;  1OGW A;  3Q3N C;  1K53 A;  2MSE D;  4W9E A;  5DPW A;  1FPY A;  4RFB A;  4DXG A;  2JY6 A;  4HCP B;  2K8B A;  4EEW A;  4MSQ B;  1XLO A;  2H89 B;  5D7G A;  1DYN A;  3JW0 X;  2IND C;  5E6P A;  4KZC A; 
#chains in the Genus database with same CATH homology
 4W9I A;  3PHW B;  4ZRI A;  3D32 A;  2R09 A;  5L95 C;  2COA A;  2BKR B;  5CLL B;  4EOY A;  2YVC A;  3ENB A;  2K2J A;  3OAN A;  5AZF A;  1MAI A;  1UBQ A;  4GXB A;  2J7Q B;  3AU4 A;  1WX7 A;  1I7A A;  1X05 A;  2LXA A;  2DLW A;  3MHS D;  1ZW7 A;  4KHA A;  1BTN A;  1PFJ A;  2V3S A;  4NSW A;  1WY8 A;  4BKS A;  4F8C B;  3P2B A;  4B95 A;  1X1F A;  2HTH A;  1WXV A;  2BGF A;  2GCL A;  2G45 B;  2WYQ A;  1NTY A;  2CB8 A;  4CO7 A;  4IM2 A;  2N9P C;  3CMM B;  1JDE A;  2CU1 A;  4ZDV A;  1V5T A;  2K25 A;  1LFD A;  1ZM0 A;  1PLS A;  2HRJ A;  1J0W A;  5JH5 C;  1WMH B;  3OJ3 A;  3N3K B;  2MW5 A;  3CXB B;  1WG7 A;  2KTR A;  4II3 B;  1R4N I;  3ML9 A;  4JKH A;  4ZRJ A;  2IFS A;  2DEN B;  4MGY E;  4AJW A;  4KSK C;  2LYD A;  2WX0 A;  2Z0O A;  4CHM A;  1UZX B;  2K00 A;  4ANU A;  3SHQ A;  2K6D B;  5J2R A;  3FSS A;  3HHM A;  1E90 A;  1SE9 A;  2N7E A;  3ENE A;  3RZF A;  5DHA B;  4GB9 A;  5CHV C;  2W2X C;  2KQ7 A;  4HLE A;  2CQU A;  3OAW A;  2NBV B;  4B9K A;  2Z0P A;  1WJU A;  2BYF A;  3X0W A;  2JRI B;  2K8C A;  2LJ5 A;  2LVO A;  4NPN A;  2D2Q A;  2ZCC A;  2PJH A;  3VH3 B;  3KYC D;  5DPT A;  2HD5 B;  5IA7 A;  3IVF A;  1OQY A;  4KHB B;  4HPL B;  1IRS A;  4WSF A;  2DHK A;  2CY4 A;  5C6R A;  1OTR B;  2LUE A;  2M0X A;  4IM3 A;  2ZVO A;  2MWS B;  1OEY A;  3DBH I;  4IWO A;  2JZ3 B;  2D9V A;  4BFR A;  3A98 B;  1J19 A;  2NR2 A;  3H7P B;  4WQO B;  3QWM A;  2I1J A;  1EAZ A;  1WVH A;  2KWV B;  1WRD B;  2N1V A;  4ZYN A;  3E9L A;  3ML4 A;  1RLF A;  2DKP A;  1C1Y B;  4KZ0 A;  1WJN A;  3WA0 A;  1EF5 A;  1E5W A;  2KWC A;  3TJP A;  1SHC A;  4K1R B;  1W1H A;  4ILJ A;  4MH0 E;  2LRU A;  3APC A;  1DBH A;  1PQS A;  1J8C A;  2MP2 B;  1WGQ A;  1WJ6 A;  3PRM B;  2ZJD A;  1QZE A;  2DKQ A;  1KJT A;  2O6V B;  5DI9 B;  4PS3 A;  4JQW C;  3DVN U;  2W2W A;  3VUY A;  2I5F A;  3SNH A;  3DCG A;  4JK8 A;  2KWU B;  4AUQ C;  2YF0 A;  1Z2M A;  5D27 A;  3I3T B;  4HAU B;  1WM3 A;  4GGQ A;  2DX5 B;  4ANV A;  2IO1 B;  3DVN V;  2P8V A;  1TXD A;  3UZT A;  1FB8 A;  3E66 A;  3VUX A;  2M38 A;  2GBK A;  4XWX A;  2O6V D;  2FUH B;  2GS0 A;  2G4S A;  1V2Y A;  5JHG A;  4ANW A;  3V60 A;  4E74 A;  1NBF C;  4LJP B;  1IP9 A;  3A8Q A;  4K7U A;  3PGE A;  2ELA A;  3TFM A;  2KOX A;  2KQS A;  3IBE A;  4MEL A;  2CY5 A;  3GYO A;  1X1G A;  4G50 A;  1MIX A;  1OEY J;  2ROZ B;  2RNR B;  5AZH A;  3W1Y A;  1WF9 A;  3JVZ X;  3A9J A;  3PHX B;  3TL5 A;  3ULC A;  4NAW B;  4HJK A;  1UPQ A;  2RVB B;  3TMP B;  3MPX A;  4IM0 A;  2R0D A;  1YQB A;  3S2A A;  1DIK A;  3JSV A;  2ZPN A;  2YS3 A;  1MIZ B;  1Z5S B;  1P1A A;  4M8M A;  3DBS A;  1OY2 A;  5C79 A;  1I2H A;  2UZR A;  2MA9 B;  2IYD B;  4HAY B;  4LJO B;  1ZKH A;  1OQN A;  3CIK A;  1P0R A;  2R2Q A;  4HWI B;  1RRB A;  4W9H A;  2FDQ A;  2LKO A;  3A9K B;  2Y7B A;  1WIA A;  4K2P A;  3L54 A;  3PLU A;  1RRP B;  4GDK B;  2IO0 B;  4PYU A;  4A6F B;  4WJQ A;  2NCN A;  2I1K A;  4DHZ B;  1X1M A;  4BKG A;  4DDG D;  1Q0W B;  3QHT A;  1E7V A;  3MJW A;  5KHQ A;  1HE8 A;  1WXA A;  1V6E A;  1UNP A;  1SIF A;  5HE0 A;  1X86 A;  3ZNZ B;  1RFA A;  3UGB B;  4DBB A;  1TQZ A;  2VRR B;  2NS5 A;  2N9E B;  1TGZ B;  2BYE A;  2ZNV C;  2DZM A;  1UNR A;  2L3Z A;  2C5L C;  3ZDT A;  2NPT B;  4GSW A;  3ZTC A;  1MK7 B;  4KAX B;  2MBO A;  5HE2 A;  4X57 B;  3QAR A;  2D3G A;  4WWP A;  1C3T A;  4F7H A;  3LJ3 A;  3ODW A;  1ZC4 B;  2N0Y A;  4P7I A;  2BWF A;  4XC2 A;  3BY4 B;  4JKB A;  4B6H A;  3BJI A;  2IYB A;  4GU2 A;  3FP5 A;  3D8E A;  1DDV A;  3R3M A;  3RCZ A;  4HDQ A;  1Y8R C;  2LXC A;  4MM3 A;  5D3X A;  2FJ9 A;  2NBU A;  4KHO A;  3QX1 A;  1FGY A;  5EFX A;  2GOW A;  4HXD A;  1WJM A;  3PS6 A;  3H9D A;  1N3H A;  1AAR A;  2IY1 B;  4N9F 4;  3F0W A;  3ZRC A;  2HE7 A;  3SV1 A;  4PQ0 A;  1EO6 A;  1P3Q U;  3QAQ A;  1IPG A;  2JRH A;  2YS1 A;  2NPT A;  3IFW B;  1TZ1 A;  2DFK A;  1IYF A;  4JK9 A;  2YSZ A;  3KZ1 A;  4GDL A;  2KLC A;  5LOP B;  1E8W A;  3SDL C;  5DCN A;  4PNK A;  5JVL A;  3LJU X;  3ZUN A;  1B55 A;  3RYT A;  1H10 A;  3H6N A;  2KC2 A;  4PYZ A;  3HM6 X;  4ZRK A;  3HW2 B;  5J3Q A;  1ZGU B;  2J0M A;  3NZU A;  4IUM B;  2QKM A;  2RR9 A;  2RGF A;  2RSG A;  2D9W A;  2HTH B;  2CKH B;  4A6H A;  2FCS A;  2KX0 A;  2I5C A;  1MKE A;  1NI2 A;  3K9O B;  4NQL B;  4IWP A;  2DZI A;  1Q1O A;  1WGY A;  3W1S A;  2MBQ A;  4YON A;  2WH5 A;  1U2B A;  4Y94 A;  4IWQ A;  1XT9 B;  2KTR B;  2KJH B;  1KOT A;  4BKS D;  1U4A A;  2DAF A;  4FN2 A;  2ROV A;  3NZS A;  1RJ2 A;  2ABD A;  2BKF A;  4AP4 C;  2K2U A;  3SO6 A;  4HCN B;  1V5P A;  5L83 A;  3WAO A;  3TIX A;  2DZJ A;  2CS4 A;  3NSU A;  3M62 B;  2MKR A;  4JKG A;  5DH9 B;  5D3Y A;  4RM9 A;  4JKE A;  4W9K A;  5C23 A;  4HB0 B;  2X0S A;  2JXX A;  2DTC A;  4HAZ B;  1E8Y A;  3T06 A;  5JLJ B;  1WR6 E;  1NTI A;  2YT1 A;  4K81 A;  4MGI E;  3SD5 A;  4NQK E;  3DVG X;  2PPH A;  4LDT B;  2KK8 A;  3TBL D;  2PE6 B;  2FID A;  4EKU A;  2P0F A;  1P5T A;  4HAV B;  3R7Q A;  1Y19 B;  3WIM A;  3MTN B;  4WWN A;  1WE7 A;  4W9J A;  3Q3F A;  1WZ3 A;  1WXS A;  3ZRF A;  3K9P B;  5JZE B;  1GJZ A;  3VHT C;  3RUI B;  3U8Z A;  4FAD A;  2JPH A;  1WGD A;  5GMV A;  4MSM B;  3PV1 A;  2XK5 A;  2W2X D;  2ADZ A;  4K2O A;  5LLI A;  3CST A;  3PEG A;  3NHE B;  3ZVV A;  1TTN A;  3QC8 B;  3D8D A;  4LDT D;  3VTV A;  4E71 A;  1I35 A;  5CHF A;  2DYN A;  1LB1 A;  5KCV A;  4GMX B;  2OQB A;  2D10 A;  2AWT A;  1FOE A;  4NNJ B;  2IO3 B;  3DXE A;  1UGM A;  2D4Q A;  2ZPY A;  2LI5 A;  3UIN B;  5AEK B;  1FHX A;  2AEH A;  2AL6 A;  2DZK A;  3KUZ A;  4C0A A;  5E6O A;  2LOZ A;  1Z87 A;  2GMI C;  2D11 A;  3EEC A;  2MX2 A;  4OVU A;  3ZTD A;  1FHW A;  2Y5B B;  2YT0 A;  4A5K A;  2KGX B;  1UEF A;  2RPQ A;  2KDF B;  4HAT B;  2L76 A;  2WWZ A;  1M7R A;  2D07 B;  2AL3 A;  2O2V A;  4EZJ A;  5D6J B;  1V88 A;  2JF5 A;  3KYD D;  3O96 A;  2J59 M;  4DK5 A;  2OTX A;  1HB8 A;  1XCG A;  5D3W A;  1P6S A;  2G3Q B;  4TV3 A;  1V86 A;  1E7U A;  4TYZ A;  4GOC A;  3PVU A;  1VCB A;  2REX A;  3GYP A;  4TQ0 A;  3VQI A;  1GGO A;  1V89 A;  3SYX A;  4KIK A;  1TJ6 A;  4A3P A;  4XX5 A;  1BTK A;  3H1U A;  2D9X A;  3CSF A;  3GOE A;  5C16 A;  3VTW A;  4BOZ B;  1WZ0 A;  3A9J B;  2BCJ A;  3DBR I;  1NDD A;  2JP2 A;  2KDE B;  3UQB A;  2CHZ A;  2KXJ A;  3GZN I;  2KDI A;  3NY5 A;  4MDK E;  3JSV B;  2XQN M;  4KSL C;  3APD A;  1A5R A;  5DPS A;  1J0G A;  1UD7 A;  1ST7 A;  1YIW A;  3DQV A;  2DAJ A;  4G0N B;  2M14 A;  5LON B;  3PP2 A;  4ANX A;  4H8S A;  1WE6 A;  3PRZ A;  2KLG A;  4BBN F;  4FBJ B;  5LXH A;  3FLV A;  3VUW A;  5BO4 B;  2KVR A;  4JKA A;  2EKE C;  5CX3 A;  5G55 A;  1U29 A;  1WR1 A;  4HHV A;  2KFJ A;  1FGZ A;  1VBG A;  3DOW A;  3QJZ A;  4W9C A;  4EZK A;  4GPT B;  3A4S C;  2JUO A;  3PVL A;  3QBV B;  5C5B A;  3A1Q A;  2L0F A;  4TQ1 A;  3ZIM A;  4EUT A;  4PS8 A;  1VBH A;  2ELB A;  3V6C B;  3TO1 A;  3PVW A;  2ZNV B;  2VRW B;  3B1L X;  1DDW A;  2DYQ A;  2ZEQ A;  2H7D A;  3QK0 A;  2C9W B;  1UEL A;  2COF A;  1WGG A;  1LW3 A;  2N23 A;  4DHZ E;  2Y8G A;  2K6Q A;  2KJR A;  4AJY B;  2JZZ A;  1NVL A;  2Q13 A;  3UIP B;  1Q67 A;  1WH3 A;  3WAN A;  2LVQ A;  2FIF A;  1M94 A;  3NOB A;  4URK A;  2LWP A;  2IY0 B;  4ILH A;  3RT3 B;  3WAM A;  3ZNG C;  5TR5 A;  3OLM D;  1K5D B;  3L16 A;  2KN5 A;  2QHO A;  2MRP A;  3KSY A;  3V6E B;  1KBL A;  4K7W A;  3AJ4 A;  3AUL A;  1DDM A;  2UVM A;  1L7Y A;  4HAW B;  1M7E A;  1R4M I;  3E9P A;  2E2X A;  1LQB A;  2FCN A;  2KFK A;  3L10 B;  2VSZ A;  2J0K A;  1WM2 A;  3VDZ A;  2KHW B;  2JVC A;  4GDL B;  4WJP A;  2Z59 B;  1E8Z A;  2ZCB A;  2DYO A;  1GC6 A;  1ACA A;  2M8S A;  3RD2 A;  2DN6 A;  4FJZ A;  3P6A A;  1ISN A;  4GMV A;  4NY0 A;  2ZVN A;  2FCQ A;  2G35 A;  2W9N A;  2D9Z A;  2NMB A;  2XBB C;  1U5E A;  2MCN B;  2C7M B;  2LGD A;  2LZ6 A;  3M95 A;  1BT0 A;  1NU2 A;  2MQJ A;  1EUV B;  2KZR A;  5FR6 A;  4FJV B;  3ZVR A;  1GC7 A;  4DX9 0;  4DDI D;  2EC1 A;  4WVF B;  1S1Q B;  4ICV A;  3C0R B;  3ODX A;  2LG1 A;  4W9D A;  1XKE A;  5CLQ B;  2KJ6 A;  1XD4 A;  4HPM B;  3UQA A;  2C7H A;  4FLH A;  4WWO A;  3PPA A;  4FUL A;  4FJY A;  2KDB A;  3WYF B;  1WJ4 A;  4F7Z A;  2KO3 A;  2L00 B;  4KDI C;  1XQQ A;  4NJ7 A;  1X11 A;  1H4R A;  3F5R A;  4IAP A;  3T8M A;  1ZSQ A;  3EHV A;  4JKG B;  4MGZ E;  1V80 A;  5D3V A;  2NBW B;  2KD0 A;  2GBJ A;  4KVG B;  2LAS A;  2COC A;  3CF6 E;  4II2 B;  2RSU A;  1Q5W B;  4W9L A;  3L0W B;  2YS5 A;  2CR5 A;  3W1S C;  4IFS A;  4I6N B;  1KC7 A;  4KDL B;  3KUD B;  2K8H A;  1WI1 A;  2UWQ A;  2L05 A;  4BBN C;  2CHX A;  3M63 B;  1WGH A;  1RAX A;  4ASW C;  3KH0 A;  3OJ4 B;  1U5G A;  3UF8 A;  3H7S A;  2KUP A;  3APF A;  1NTV A;  2EJ8 A;  3PTF C;  3SUZ A;  1D3Z A;  4FHJ A;  3QWZ B;  2GBR A;  2XK5 B;  1KM7 A;  2JT4 B;  3PG7 A;  2KKC A;  1G6J A;  4JKF A;  1U27 A;  2COP A;  4HB4 B;  3T9L A;  3M3J A;  1V49 A;  4MJS A;  2ASQ A;  3V62 A;  3FM8 C;  2LGX A;  5LXI B;  3PRP B;  1F9J A;  4IG7 B;  4DX8 A;  3N30 A;  3KRW A;  2P0H A;  1YX5 B;  4BOS C;  4HVB A;  2MLB A;  3ZO5 B;  3FEH A;  3TW1 A;  5KQ1 A;  1EF1 A;  3VFK A;  4OVV A;  2DYM A;  1WI0 A;  2Z0D B;  2EMT A;  3P7Z A;  2MFQ A;  2DYB A;  2D9Y A;  1FHO A;  4DXA B;  4MK0 A;  2PZ1 A;  1ZVR A;  2AYO B;  2B3A A;  2L7R A;  1V5M A;  2C7N B;  1MPH A;  1YX6 B;  2YLM A;  4HB3 B;  3R7R A;  4MT7 A;  3DBL I;  2O2V B;  1QC6 A;  4A3O A;  3QA8 A;  4A20 A;  2FAZ A;  1KLV A;  2KTF A;  1W1D A;  2A5U A;  2V4L A;  4DWF A;  2JWZ A;  5IJM A;  3L17 A;  4DBG A;  2RLO A;  3PSC A;  2MBB B;  1GNU A;  3E9O A;  4GZU A;  2V1Y A;  1HBK A;  1XR0 B;  4MGK E;  3O65 B;  1FAO A;  4KIK B;  4IW0 A;  3SU8 X;  5D94 A;  2BWE S;  1KZ7 A;  3U7D A;  2Z0Q A;  4BKT A;  2ZZP B;  2N9X A;  2RGN B;  2IBI B;  5E6N A;  1PMS A;  3MDB C;  1GUA B;  3HQC A;  2A4Z A;  3D8F A;  4TKN A;  5HE1 A;  5EDS A;  4W9G A;  3VAW A;  5D2M B;  3VTU A;  1WMH A;  1WYW B;  5KQ4 A;  4HAX B;  4CHJ A;  1W1G A;  3PZD A;  2PE9 A;  4WJN A;  3B08 A;  4PS7 A;  4JGH B;  4DHJ B;  4BBK A;  5G2N A;  5GOW B;  2M17 A;  3UIO B;  2GCJ A;  1MK9 B;  2OJR A;  1JRU A;  2KC1 A;  2YRY A;  1Y5O A;  4IC7 B;  3ULB A;  1WJ1 A;  1I42 A;  1H8C A;  3ZKJ C;  2R2O A;  4JL9 A;  4JKD A;  1UPR A;  2DHZ A;  3ECI A;  4WAA A;  2LUL A;  4M0W B;  2GBN A;  3M1I B;  4RMA A;  3ZW3 A;  2NZ8 B;  4DHJ D;  3L13 A;  1BAK A;  1L2N A;  4FHK A;  2LRW A;  1WGU A;  3PT2 B;  1TBE A;  2FJL A;  5FI1 A;  1P9D U;  5J18 A;  4B6W A;  3HIZ A;  4MY6 A;  4WJ7 A;  3N7C A;  3DPD A;  5C5B B;  1VD2 A;  3HK0 A;  2WDT B;  3A1Q B;  3IG3 A;  2BYV E;  2KMC A;  5DIF B;  2C60 A;  3ONS A;  1XX0 A;  1AWE A;  4WJO A;  4YL8 A;  2PEA A;  2M1M A;  2KNB A;  1U5D A;  1S3S G;  4AOF A;  2EMS A;  3PRE A;  4EZL A;  1V5U A;  4EJN A;  1E8X A;  4W9F A;  3V61 A;  1FXT B;  1WX9 A;  3SBT A;  2MDX A;  1UH6 A;  3QCA A;  1MG8 A;  3H7P A;  3VOQ A;  5CHW A;  4LCD E;  3PSE B;  3KY9 A;  4AWJ A;  4G11 A;  2K1F A;  2N1W A;  1ZC3 B;  4A6K A;  2MBH A;  4EFO A;  3LDZ E;  2KX3 A;  4CYE A;  2IO2 B;  2FCM A;  3NS8 A;  3ML8 A;  3RCP A;  2COD A;  2HJ8 A;  2MP2 A;  2L8J A;  4K17 A;  1BWN A;  3R66 C;  1EGX A;  5IAA C;  2DHI A;  2KFK B;  1V81 A;  3EC8 A;  2O6V A;  2DX1 A;  4JIO U;  1YD8 U;  3V5W A;  2GBM A;  3RZW C;  4HK2 A;  3A4R A;  4CHK A;  3WAL A;  1SGH A;  4TUU A;  3QIJ A;  2OOB B;  3TVV A;  2L0T A;  2DX5 A;  3G9W A;  4J6I A;  2LD9 A;  3VXW A;  1WGR A;  1UBI A;  4ICU A;  3KW5 B;  2XEW A;  4BVU C;  3EFU A;  1XD3 B;  2NVU I;  2BF8 B;  5L81 A;  3N32 A;  4GIV A;  2DHJ A;  1YJ1 A;  2LBB A;  3VIA A;  2LOX A;  5HE3 A;  1K8R B;  2R82 A;  5JP4 A;  1WFY A;  1WXM A;  3IHP C;  3WAP A;  3Q3J A;  3ZDM C;  4L6E A;  4NJ6 A;  2P0D A;  4Z2M B;  1CMX B;  3ODO A;  3KUC B;  4JK7 A;  2J0J A;  5JHH A;  2H7E A;  5KHO A;  2K39 A;  5HKH A;  3A33 B;  3B0A A;  1P98 A;  4Z2N A;  4NAW A;  3QQ8 B;  4K7S A;  3DDC B;  3U30 A;  2FNJ B;  3HM3 A;  1V61 A;  2QKL A;  5DPR A;  2LVP A;  1K5G B;  2DIK A;  5J3Y A;  5J3T A;  1T0Y A;  2KMA A;  5AZG A;  1U5F A;  3EPY A;  2KCJ A;  1OMW A;  4HDO A;  3ZLZ A;  4EMO A;  1EVH A;  3ALB A;  3X23 A;  1DRO A;  1XOD A;  3DXC A;  3A9K A;  2MWN B;  2X18 A;  4MEM A;  2MBE A;  4GDK A;  1KZG A;  4A6F A;  4I6L B;  5DHF B;  2L2I A;  2WX1 A;  3AXC A;  4IOY X;  3L08 A;  5CTR C;  2IZV B;  2KAN A;  5JHB A;  2CRF A;  2DA0 A;  3ZNH B;  4KV2 A;  2LGY A;  2GJY A;  4JLC A;  2N7D A;  3RUL A;  3TCA A;  4M8N A;  1HB6 A;  1QQG A;  4FA6 A;  4F7U P;  2RD0 A;  4ILG B;  2UZS A;  2G4D B;  1LXD A;  3AU5 A;  2M4N A;  4D0N B;  1V9J A;  4I6P A;  4HB2 B;  3VH4 B;  5C1Z A;  3A8P A;  2N4F A;  3DXD A;  2BPS A;  4E3C A;  3AI5 A;  3PLV A;  2Y8F A;  4RM8 A;  2CAY A;  1KI1 B;  2VKI A;  3ZNI D;  1GG3 A;  2Z0E B;  1V5O A;  1WX8 A;  2UYZ B;  4MJS B;  1AQC A;  2V76 A;  5J17 A;  3BIN A;  2L1C A;  4F1S A;  4G3X B;  2RQ1 A;  5JHA A;  3KVF B;  4JKC A;  5FI0 A;  1UNQ A;  4GN1 A;  3KRX A;  3VVW B;  2RUK B;  3SBG A;  3DVG Y;  4XZ4 A;  1P3R A;  1LM8 B;  4F7G A;  3JYU A;  2CHW A;  1OGW A;  2MSE D;  4W9E A;  5DPW A;  2JY6 A;  4HCP B;  2K8B A;  4EEW A;  4MSQ B;  5D7G A;  1DYN A;  3JW0 X;  5E6P A;  4KZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...