4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine kinase 2-beta
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
1OEYA 3CF6E 1V5PA 1V89A 2KDIA 4MSMB 3DVNV 2DN6A 2BF8B 5C79A 1RRBA 2RGFA 1BTKA 1Q5WB 2KC2A 4DHZB 1LQBA 3JW0X 5CX3A 2PE6B 4CHMA 2UZRA 2N1WA 3TL5A 2KHWB 4EZLA 4J6IA 3OLMD 5IAAC 2K1FA 3RT3B 2KWUB 4URKA 1V5OA 4A5KA 3P2BA 2WX0A 2MQJA 1J0GA 4PS8A 2LXCA 1CMXB 2RUKB 3ECIA 3KW5B 4W9KA 3H7PA 2XBBC 3RCZA 2KX3A 2VKIA 4K81A 1ZW7A 3UIOB 4IWQA 5EFXA 1G6JA 2D07B 1OEYJ 2KTFA 2DX5B 3AJ4A 1J19A 2O2VA 4DK5A 1V86A 3U7DA 1ZC3B 1E8ZA 2HJ8A 4WWPA 1U5DA 1TJ6A 1V5MA 1NBFC 3K9OB 5FI1A 2LKOA 1DYNA 4W9CA 1WFYA 4GB9A 2Z0PA 2N23A 2RSUA 3VFKA 5JH5C 4K7SA 3N30A 1WGYA 2J59M 3ONSA 2DAJA 1K8RB 4XX5A 2ZNVB 4A6KA 1EF5A 3VUWA 4IWPA 3W1SC 3FSSA 4KHAA 2P0HA 2KMAA 2L0TA 3O96A 2LOZA 1WGGA 3DVNU 3RULA 1KZGA 2LYDA 3HK0A 2LRWA 2KVRA 3PVWA 3H7PB 1RLFA 4YL8A 2LGXA 3VUXA 2BCJA 4A6FA 1WH3A 4GDLA 4RMAA 3PSEB 1NTIA 3ZRCA 3KRWA 2DHJA 3GYPA 4PYUA 4HAVB 3UQAA 2G4SA 4HLEA 1U2BA 3P7ZA 4BKTA 4G50A 2Q13A 2UZSA 1U5GA 3V62A 1FHWA 3SDLC 2LD9A 1PQSA 1BT0A 3CSFA 4OVUA 2E2XA 3QWZB 4BOSC 1WJNA 2LGDA 4MH0E 5G2NA 1M7EA 5JZEB 4W9LA 3KUCB 2MBEA 1KLVA 1WR6E 2L7RA 2N9EB 2O6VB 2GBNA 2G45B 3B08A 1KJTA 4WJOA 3AU5A 4E3CA 3N32A 2JZZA 3QHTA 3HHMA 5D3XA 2YF0A 3DBLI 4TQ1A 1YJ1A 2MX2A 4EFOA 5LXHA 2RPQA 2FJ9A 3VUYA 1ZC4B 4EEWA 2DZJA 2DHIA 3RD2A 1FXTB 3A9JA 4CO7A 1AARA 2NS5A 3L08A 2DX1A 3K9PB 4NJ7A 4B95A 2MWNB 3A8QA 4EOYA 1WG7A 1FAOA 3ODOA 1YQBA 1EGXA 1UD7A 2IY0B 2CS4A 1W1HA 2EJ8A 4FJYA 4M0WB 1WGUA 4NAWB 4HB2B 1WXVA 5D3WA 3NS8A 4AP4C 5E6NA 2I5FA 2KD0A 2IYBA 3V6EB 2MFQA 5LLIA 4BFRA 3VH3B 1OQNA 2GCLA 2I1KA 4K2PA 3Q3FA 3ZNZB 4RM9A 2HE7A 1WX9A 4Z2NA 2FIDA 2LVQA 1KZ7A 1TQZA 4MGZE 5C1ZA 2QKLA 1WXSA 2DZKA 2JT4B 3QBVB 4HCPB 4MGIE 5KHOA 3SV1A 3ZVRA 4IAPA 2GMIC 5C23A 5TR5A 1XT9B 1I2HA 3DBHI 3G9WA 3WAOA 2D9WA 4DBGA 1S3SG 3CMMB 5BO4B 1WF9A 2MDXA 2KOXA 2CR5A 4OVVA 5HKHA 2KANA 2W2XC 4HK2A 5KQ4A 3SD5A 2ZCBA 2YRYA 2FCSA 4KIKB 3ZRFA 1P1AA 2DLWA 2R0DA 2A4ZA 5D3VA 2K39A 2ZVNA 4G0NB 5JHBA 4A20A 4TYZA 2OJRA 4TV3A 5DI9B 3D8FA 2L1CA 2IO3B 3W1YA 3VVWB 2D4QA 1MG8A 3P6AA 3PV1A 3TIXA 1P3RA 4EKUA 5EDSA 4MGKE 2RLOA 2RGNB 3T06A 4M8NA 1I35A 4M8MA 1OQYA 2COCA 2LRUA 3TMPB 2DYOA 1GJZA 1WJMA 2KTRA 3SU8X 2GBKA 1ST7A 2RVBB 3VTUA 4KV2A 4MJSA 2XEWA 3R66C 2IFSA 1E7VA 4GMVA 2DZMA 3Q3JA 4LCDE 1Z5SB 3KSYA 4HAUB 3IVFA 4MK0A 2J0MA 4HJKA 4A3OA 3F5RA 4NSWA 3R7QA 3SNHA 1EVHA 4JQWC 3UQBA 2FDQA 3EHVA 1WM2A 3NZUA 3QK0A 1WXAA 5CLQB 1NI2A 3FM8C 1WJ4A 1WX7A 2K8HA 3LDZE 3RZWC 1XD4A 1E8WA 1WJ6A 3TBLD 5J17A 2I1JA 4HCNB 2ZPYA 1L7YA 3H9DA 3UF8A 2WH5A 2ELAA 1QQGA 3GYOA 3VIAA 2DYBA 2JRIB 2MLBA 1UGMA 4G3XB 1GC7A 4WSFA 4II2B 1WMHA 2Y7BA 4IFSA 3PEGA 1DROA 4WJQA 4BKSD 4N9F4 4K2OA 2BYEA 3AXCA 1E8YA 3DPDA 4FLHA 4GDKB 4NNJB 3ML9A 4DDID 1Z87A 2MP2B 1V5TA 2FUHB 1K5GB 2MBBB 2KC1A 1VCBA 2KWCA 3EC8A 1V9JA 4KSLC 3VTVA 4ANUA 4F7GA 2M38A 2RSGA 3EFUA 4C0AA 4DDGD 4ZRJA 2V76A 1K5DB 2D9VA 3PPAA 4P7IA 2BYVE 2C60A 4IUMB 5CLLB 3S2AA 3HIZA 1L2NA 3QARA 2HRJA 4HAYB 3FEHA 3ZUNA 2AL3A 4IWOA 2ZVOA 4F7ZA 1XCGA 4BVUC 2DTCA 1WRDB 4AWJA 4EZKA 2K6QA 5AEKB 5IJMA 1S1QB 1DBHA 3DCGA 2GCJA 3DXCA 2MSED 2L05A 3R3MA 2LI5A 2PPHA 3PG7A 1Y5OA 1V80A 2BWES 4PYZA 2BKFA 2W2XD 4X57B 3IHPC 4ANXA 4EMOA 1UNRA 3TO1A 1OGWA 1R4MI 2L0FA 4KZCA 1ZVRA 5GMVA 3DVGX 1FOEA 4CYEA 1XKEA 4HAZB 1WE6A 5CHVC 3IBEA 3JSVB 4MJSB 1Y19B 1W1GA 4IM2A 3TW1A 3L10B 3PP2A 1SHCA 2O2VB 3OAWA 1UBQA 1MK7B 4YONA 2KLCA 5C16A 3A9KB 4JGHB 4K1RB 1IRSA 1ACAA 2FCMA 5FI0A 2KWVB 2N1VA 1WYWB 3PRZA 1WIAA 2MCNB 2KGXB 4E74A 5D6JB 2REXA 4I6NB 4BOZB 3D8DA 2G3QB 5LOPB 2N9PC 1KI1B 3VXWA 1DDMA 3N7CA 3PVUA 2W9NA 1BTNA 2JZ3B 3V60A 4CHKA 2Z0QA 2DYNA 3EECA 4LDTD 3KY9A 2RNRB 2ZZPB 3V6CB 3CXBB 1U5FA 1QZEA 4IM0A 3IG3A 3VH4B 1P5TA 4DHZE 4GDKA 3A4RA 2KFKB 4CHJA 3MPXA 2KN5A 3PS6A 4HWIB 3U30A 1J8CA 2OTXA 4ZYNA 4W9JA 4KAXB 1M94A 1PFJA 2NVUI 3GZNI 2MA9B 2NMBA 1LB1A 5DH9B 2JF5A 1WM3A 3JSVA 2J7QB 1UPRA 4GZUA 1NU2A 3MHSD 4WVFB 3OANA 1P6SA 2M4NA 1MIXA 2ZJDA 4FJZA 4K7WA 5JHGA 5J3YA 2CU1A 3DDCB 4DHJD 5L83A 1OY2A 4GIVA 2UVMA 3DXDA 2C7NB 2LULA 2PZ1A 1GUAB 4FHJA 3ZW3A 4A6FB 4GDLB 4HVBA 5L95C 4IOYX 1UH6A 4JIOU 2KFJA 4BKGA 3HM3A 4FBJB 5JLJB 5HE3A 2VRRB 3KUDB 1LM8B 1GC6A 2RQ1A 2P8VA 1TTNA 2FNJB 2Z0EB 2IZVB 2KO3A 3M63B 3ZKJC 4PS3A 4B6WA 3D32A 2A5UA 1XR0B 4Y94A 1I7AA 5HE0A 1LFDA 3SUZA 1OTRB 1KOTA 3VAWA 2BYFA 2NCNA 3APCA 4WJPA 3WAMA 2PJHA 2P0DA 4WJNA 2LOXA 1LW3A 4ZRIA 5KQ1A 2K8CA 3M62B 4IM3A 5DPWA 1X1FA 3BINA 5DHFB 2LBBA 3UZTA 2M1MA 2M0XA 3QAQA 1V2YA 1E7UA 1WGQA 1RRPB 2CAYA 4HHVA 2KXJA 4LJOB 1WI1A 3UGBB 4JL9A 2DENB 1C3TA 3D8EA 2CHWA 2KLGA 2EMTA 5C6RA 2L00B 1GNUA 2JWZA 1NTYA 1EAZA 2DZIA 4FJVB 1WX8A 4FADA 4AUQC 4W9GA 1FHOA 2CKHB 4MDKE 4PQ0A 3QA8A 1UELA 1T0YA 1X05A 1ISNA 4B9KA 2D11A 4B6HA 2MBOA 5AZFA 1WJUA 4ICVA 5L81A 2YVCA 4HPLB 3B0AA 4MGYE 1MIZB 4BKSA 1SE9A 5J2RA 4HB0B 1WXMA 3NY5A 2KK8A 3X0WA 4AJYB 5J18A 4DWFA 1Q0WB 3X23A 3HQCA 2MWSB 1V88A 2R09A 5JHHA 3H6NA 1WY8A 1KM7A 2JUOA 2CY5A 4BBNF 2LVPA 2RR9A 3PRPB 4II3B 5DPRA 3WIMA 2N7EA 1V5UA 2MKRA 2GOWA 3B1LX 3KYCD 2XK5A 4IW0A 3WALA 4XC2A 4ASWC 1TXDA 1HBKA 3MDBC 5CTRC 2ELBA 2GBMA 3M95A 1WGRA 1Z2MA 3A33B 2CY4A 3JVZX 2YSZA 3KYDD 3PHXB 1P98A 3RCPA 5D7GA 3PHWB 5JHAA 2LGYA 2O6VA 2CHXA 3IFWB 1XX0A 3VQIA 5KHQA 3QWMA 2GS0A 2BGFA 2X18A 2IO1B 2K2UA 2WWZA 3NHEB 3N3KB 2H7DA 3ML4A 2DFKA 3ODWA 3WANA 1FB8A 1U4AA 4TKNA 2KX0A 2OOBB 3T9LA 1Y8RC 4KSKC 4GN1A 5KCVA 1TZ1A 1SGHA 5GOWB 3DOWA 2NZ8B 2VRWB 3ZO5B 3LJ3A 3QC8B 2R2QA 3ZVVA 4F7HA 2FIFA 2C7HA 2AEHA 1TBEA 3H7SA 1PMSA 2DYQA 2M14A 2COAA 2KDFB 2LUEA 1BAKA 1WE7A 1V61A 2YLMA 3NZSA 4ZDVA 4KHOA 1DDWA 1N3HA 2LJ5A 2ZEQA 2EKEC 2KMCA 1MK9B 4WQOB 1RJ2A 3LJUX 1A5RA 2YS3A 1WGDA 2V4LA 3A9KA 1E90A 2Z0OA 2ZPNA 4I6LB 2B3AA 4NAWA 4KIKA 3MJWA 2NBWB 3KZ1A 1RAXA 5IA7A 3PLVA 3A8PA 3APFA 3T8MA 3U8ZA 3KRXA 3PSCA 3SYXA 4TUUA 4PNKA 1FGZA 5DHAB 2LXAA 4E71A 4ANWA 3FLVA 2CRFA 2JPHA 4I6PA 5DCNA 1MKEA 4EJNA 4HPMB 1Q1OA 3PREA 1LXDA 1IP9A 4DX8A 3A98B 3QIJA 4DBBA 4WJ7A 2K8BA 3HM6X 3UIPB 1ZKHA 2LASA 4AOFA 5C5BA 2N4FA 1MAIA 2AWTA 1IYFA 3KVFB 2COFA 2GJYA 1EUVB 1WR1A 2YS1A 4ZRKA 1X86A 2QKMA 2KJ6A 2M8SA 3NOBA 3TFMA 2UWQA 1AWEA 4HDOA 2DYMA 1XODA 3TCAA 2XK5B 4XZ4A 5DPTA 2EC1A 3JYUA 4A3PA 3V5WA 2NBUA 5CHFA 5LXIB 2UYZB 1UBIA 3I3TB 3OJ4B 3PVLA 4RM8A 3QQ8B 2L76A 2AYOB 3WAPA 5LONB 4L6EA 4EZJA 3L17A 2W2WA 2R2OA 3SHQA 3RZFA 4FA6A 2Y8GA 4XWXA 4HAXB 2JY6A 2J0JA 2ROZB 2YT1A 5JP4A 5J3QA 4MT7A 2IYDB 2MRPA 1WMHB 4W9IA 5D94A 3VTWA 3CSTA 4GSWA 4MM3A 4KVGB 2JVCA 2K6DB 4WWNA 4MSQB 5E6PA 2D9ZA 1AQCA 3VOQA 2IBIB 2ZNVC 2P0FA 4FHKA 4NJ6A 4HDQA 1HB8A 4HXDA 5AZHA 1R4NI 3PZDA 2ZCCA 3QJZA 5J3TA 2BKRB 2N0YA 1UPQA 1E5WA 2FCNA 2LVOA 2MBHA 4IC7B 4JLCA 4F1SA 4HATB 2CHZA 4DX90 3ZDTA 3HW2B 2QHOA 4NQLB 1EO6A 1P9DU 3MTNB 5D3YA 3AULA 2YT0A 2NPTA 2V3SA 3L13A 2KKCA 2CB8A 4KDIC 3W1SA 4KHBB 1EF1A 3SO6A 3M3JA 3KUZA 2YS5A 2VSZA 2NR2A 2EMSA 1B55A 1H10A 1X11A 2G35A 1M7RA 2V1YA 1I42A 4K17A 1YX6B 2Y8FA 1X1GA 1YX5B 1U27A 2IO2B 1PLSA 1RFAA 2CQUA 4DXAB 2DAFA 5G55A 2FJLA 3ZIMA 4GU2A 1JRUA 3TVVA 4GXBA 1TGZB 1UZXB 4F7UP 5D27A 4FULA 4A6HA 1ZSQA 3AI5A 2IO0B 2D3GA 1U29A 2N7DA 1W1DA 2D2QA 1SIFA 2DA0A 2ROVA 1IPGA 2FAZA 2G4DB 3GOEA 3QCAA 1U5EA 3WA0A 1V6EA 4GMXB 4MY6A 1V81A 2C9WB 3H1UA 1J0WA 4W9EA 3ALBA 3V61A 1XQQA 1YD8U 3PT2B 2DKQA 3ZTCA 3DXEA 2L8JA 2N9XA 5DIFB 2HTHB 1WJ1A 2D9XA 2L2IA 3OJ3A 1YIWA 3PTFC 4NY0A 3M1IB 2K00A 3ZNID 2JP2A 1ZM0A 4K7UA 2MBQA 2XQNM 5CHWA 1MPHA 1UNQA 1NDDA 3RUIB 4TQ0A 2ASQA 3AU4A 1BWNA 2L3ZA 4HB3B 4W9DA 2GBJA 1WI0A 1XD3B 2O6VD 4W9HA 4HB4B 2JXXA 3ULBA 1WZ3A 4IG7B 3ZNGC 2COPA 2KTRB 3RYTA 2DHKA 3ZNHB 1H8CA 2PEAA 2KNBA 3A9JB 1QC6A 4F8CB 2KZRA 3A1QA 4WWOA 5C5BB 2ABDA 2KDEB 3KH0A 3VHTC 2J0KA 1FHXA 3TJPA 3ENEA 1NTVA 2HD5B 3ULCA 2KDBA 4LDTB 3ZTDA 4NQKE 2FCQA 2KJHB 1FGYA 2K2JA 3ZLZA 3ZDMC 2AL6A 2HTHA 2I5CA 2WYQA 3A4SC 3CIKA 3L0WB 1UEFA 4GPTB 2Y5BB 4Z2MB 2WX1A 2LG1A 3VDZA 4BBKA 2PE9A 2D10A 2D9YA 3BJIA 3ODXA 5D2MB 4AJWA 1GG3A 2OQBA 4KZ0A 2RD0A 5DPSA 4MEMA 3NSUA 2CODA 4D0NB 1X1MA 2KJRA 5FR6A 3DBRI 4ANVA 3PLUA 2IY1B 4DHJB 3PRMB 2Z59B 2KUPA 1ZGUB 3QX1A 3EPYA 2GBRA 3R7RA 3WYFB 2KCJA 3PGEA 1V49A 1H4RA 1HE8A 2DHZA 2KQ7A 2KQSA 3A1QB 1DDVA 3BY4B 4G11A 3ML8A 1HB6A 2NBVB 2K25A 3APDA 4KDLB 1NVLA 3DQVA 1F9JA 4NPNA 4PS7A 4WAAA 4GOCA 4W9FA 4ICUA 1VD2A 4GGQA 3UINB 2MW5A 1OMWA 2BWFA 2JRHA 3FP5A 2BPSA 2C7MB 2NPTB 1D3ZA 2H7EA 4FN2A 4LJPB 2C5LC 2MP2A 5AZGA 1C1YB 2LZ6A 3F0WA 4MELA 3L16A 1P0RA 3DVGY 2DKPA 2ADZA 2Z0DB 4EUTA 3DBSA 1E8XA 5HE1A 2WDTB 2M17A 1WGHA 4H8SA 2LWPA 3C0RB 4BBNC 4HAWB 3L54A 2DX5A 1UNPA 3O65B 1WZ0A 1WVHA 5HE2A 2KFKA 5E6OA 1P3QU 1Q67A
chains in the Genus database with same CATH superfamily
1OEYA 1V5PA 3ZXVA 1VZ8A 2J4XA 3DVNV 2DN6A 1IGCA 3Q8BA 4DHZB 2PVOD 3P4RB 3GP7A 3OLMD 2MEKA 4RGMA 3RT3B 4URKA 2WX0A 2LXCA 2QILA 1HXYD 3H7PA 1KF6B 2XBBC 3RPFC 1ZW7A 3UIOB 4IWQA 1PGXA 1OEYJ 2KTFA 5I4DA 2O2VA 1N60A 1V86A 2HJ8A 2NMQA 5G5GA 2LKOA 1VZ7A 4W9CA 2Z0PA 4RGTA 2JQRB 1C77A 5I2SA 3ONSA 2DAJA 1JWBD 1K8RB 3W1SC 4IWPA 4KKIA 3FSSA 3BYYB 4US9A 4KHAA 2P0HA 1C4AA 3O96A 1WGGA 3RULA 3HK0A 2BCJA 3PSEB 2PW9A 1U2BA 3P7ZA 2UZSA 5BYRA 3AE4B 3NRZA 5JZEB 4ZRQA 4MH0E 2K8EA 4W9LA 3KUCB 2N9EB 2JZZA 5LXHA 2YF0A 4C80A 2KIEA 1NEKB 1AWDA 2DHIA 3J9CA 4CO7A 2WQYB 4EOYA 1WG7A 1YQBA 2EJ8A 4HEA1 1D6EC 2IYBA 2MFQA 2GCLA 1SJHD 4IKGA 3Q3FA 1WX9A 2FIDA 1TQZA 5C1ZA 1I4HA 2JXTA 1ENFA 3AEDB 5C3JB 4HCPB 1PFDA 3QBVB 3SV1A 1FCLA 4IAPA 3WAOA 2Y5PA 2PTLA 3G9WA 4K3BA 1S3SG 3CMMB 1T3QA 1SXTA 1ZYIA 2LEKA 2KOXA 1F0ZA 2E3TA 5KQ4A 3ZRFA 1P1AA 2A4ZA 4G0NB 1QT9A 1F52A 2L1CA 1V97A 2D4QA 1P3RA 1C9FA 4HKZE 2XNAC 5EDSA 3AMZA 2KTRA 3AV8A 4ZRPA 2XEWA 1FXIA 4XWTA 2LHEA 4HAUB 3UQBA 3F5RA 3MFGA 3I57A 1GOZA 2BYTA 5MPOA 3NZUA 4OZAA 2QJLA 3RZWC 3LDZE 2RDGA 3OG5A 2I1JA 3UF8A 1MI0A 2WH5A 2JRIB 3ZQ4A 3VIAA 4G3XB 3TL5A 1UGMA 4WSFA 3KWVA 1N62A 1DROA 3SR6A 2WP9B 4GDKB 1V5TA 2FUHB 4P6VF 1T6BX 4KSLC 3W9CB 1PGBA 1D4BA 3AE1B 3PPAA 1TYGB 3L4PA 2C60A 4IUMB 2KR0A 1XCGA 2DTCA 4EZKA 3SBGA 5IJMA 1S1QB 4P1CC 3DCGA 3AEGB 2MSED 3AEEB 4ILHA 2PPHA 3PG7A 3MC0B 2JZPA 3AE8B 1RM6C 2W2XD 4OW0A 2KN4A 4EMOA 5GMVA 3AE5B 4IOIE 1WE6A 4WURA 3JSVB 1IUEA 1Y19B 2J52A 3TW1A 3PP2A 1SHCA 1UBQA 3A9KB 4YONA 4LK0M 5C16A 3MC8A 1ACAA 2FCMA 2KWVB 2SEBD 5D6JB 3RNBC 1DDMA 3PVUA 1BTNA 2JZ3B 3IT4B 4AS1A 1XO3A 2RNRB 4LDTD 1D5MC 3V6CB 1U5FA 4IM0A 4DHZE 4GDKA 3VR8B 4CHJA 1EU4A 4US8A 3PS6A 2KN5A 3U30A 1M94A 1XF5L 5DH9B 2JF5A 5HFYA 4OZBA 4MT5A 2OHFA 4FJZA 5J3YA 2C7NB 4IOYX 4JIOU 2KFJA 4JKEA 5HE3A 3KUDB 4A8XC 2RQ1A 1QOBA 1TTNA 2IZVB 4HLEA 2BS4B 3DHGC 4B6WA 1XR0B 4Y94A 1LFDA 2NCNA 3WAMA 4C00A 1P7EA 2ON8A 4WJNA 1HQRD 2MH7A 4QJ3B 2YEPB 2CAYA 4LJOB 3UGBB 1WYGA 2CHWA 4FJVB 1EAZA 4C7YA 4FADA 4AUQC 1IBXB 3AB5A 4OZCA 4PQ0A 4B9KA 2D11A 1SSNA 3CWIA 4ICVA 4HPLB 2KK8A 5J18A 4YSYB 3X23A 1NVID 5IRSA 1V88A 4BBNF 2RR9A 3PRPB 4II3B 1EWYC 2BQQA 1JMLA 1V5UA 2GOWA 2WXLA 3ZYYX 4Q2JA 2V9HA 3JVZX 3N1YC 3RCPA 2WXNA 3VQIA 2BGFA 2WWZA 2X18A 2K2UA 1U4AA 4TKNA 1MPEA 1Y8RC 4KSKC 2Z8LA 4GN1A 3DOWA 2NZ8B 1C79A 3H7SA 2M14A 2HDEA 2KDFB 1WE7A 1E6EB 3VRBB 2MJEA 1YN5A 2KMCA 4WQOB 3BYTB 1UWMA 1A5RA 2V4LA 1TS5A 4K3CA 2B3AA 4KIKA 1EWCA 3MJWA 2PIAA 5IA7A 1ZP0B 2AQ2B 3T8MA 4EE2A 3NVZA 4TUUA 2M56B 1FGZA 2LXAA 4E71A 3FLVA 2JPHA 1MKEA 4MM3B 5LNK1 3A98B 3QIJA 4DBBA 3AH7A 2K8BA 2LASA 2W82A 2IGGA 1MI1A 2COFA 3NOBA 4HDOA 2WXHA 3JYUA 3V5WA 3WAPA 2D5GA 1TKGA 2R2OA 4J3OD 4HAXB 5HHDG 2ROZB 4W9IA 5J3QA 5D94A 1WMHB 1ZE3D 2K6DB 3DHHC 3I5JC 2KQ4X 1AQCA 3VOQA 2IBIB 4HDQA 4YTNB 3PZDA 1E5WA 2LVOA 4IC7B 2MBHA 3TUOA 2QHOA 4DX90 3ZDTA 3HW2B 1MHXA 3AULA 2NPTA 2V3SA 4L2YA 2Y3AA 4KHBB 3M3JA 2VSZA 3FVCA 2WXGA 2EMSA 1B55A 1X11A 2Y8FA 1YX5B 1U27A 2IO2B 1E9MA 1RFAA 2CQUA 4DXAB 2DAFA 5G55A 1K50A 2X8XX 5D27A 3AI5A 5E6JA 1U29A 1W1DA 1ZUD2 2ROVA 1U5EA 1V81A 3ALBA 2L8JA 1VBGA 2N9XA 1FRRA 2D9XA 3PTFC 3ZGZA 2XQNM 1MPHA 4TQ0A 1NDDA 3AU4A 4W9DA 1WI0A 4W9HA 1H8CA 2KTRB 3NZ3A 3AEBB 2KNBA 1F2RI 3A1QA 3VHTC 2KDEB 1QKZA 1FHXA 3ENEA 1NTVA 3E9OA 1AYFA 4MH8A 2MJDA 5FR3A 3U2SC 2KUQA 2RRFA 1GB4A 2Y5BB 4Z2MB 4KGRA 2D9YA 3ODXA 2OQBA 4ANVA 3TEYA 1L6UA 2G9HD 2IY1B 3PRMB 1I4GA 3QX1A 2KCJA 3P4SB 1H4RA 2GUMA 3TEWA 1DDVA 2K25A 3APDA 4PS7A 4W9FA 1VD2A 2NPTB 2N9LA 2H7EA 4FN2A 2C5LC 2MP2A 1C1YB 2QCZA 4DXFA 4MELA 3DVGY 2LJIA 3O65B 1WZ0A 5E6OA 5HE2A 1ET6A 1UWXA 3VTUA 4HJKA 3U7ZA 3ZXRA 1V89A 4MSMB 4QJ4B 1RRBA 5CX3A 1D5ZC 2N1WA 4EZLA 2PLPA 4M0WA 2K1FA 2KWUB 4A5KA 3P2BA 2RUKB 1FFUA 2KX3A 2VKIA 1TKEA 5EFXA 1G6JA 2D07B 3Q3OC 2DX5B 3AJ4A 1L5PA 4WWPA 1U5DA 2H89B 1V5MA 3VFKA 2J59M 1VBHA 2ZNVB 4A6KA 2KMAA 2L0TA 1T0QC 4UDUC 3R2IA 4M02A 3VR9B 4CSQA 3VUXA 1WH3A 4A6FA 2IGHA 4GDLA 1NTIA 3ZRCA 3GYPA 4PYUA 3Q6BA 1L0YB 3SDLC 2LD9A 1PQSA 1BT0A 4OVUA 2E2XA 1WJNA 5G2NA 3B2GA 1KLGD 2G45B 3B08A 1UUPA 4WJOA 3AU5A 4E3CA 1SJED 3HHMA 4EFOA 2RPQA 3GE3C 4EEWA 1ZC4B 2DX1A 3K9PB 4JKDA 1FD6A 1FAOA 2IY0B 2MHJA 3KWLA 4FJYA 1W1HA 1WGKA 1YOVB 5E6NA 2I5FA 4BFRA 2WXOA 2I1KA 3ZNZB 5DPWA 2LVQA 2QKLA 1WXSA 5KHOA 4MGIE 4RGOS 3ZVRA 5C23A 2GMIC 3MP9A 1XT9B 3DBHI 2D9WA 2MDXA 2CR5A 5HKHA 2KANA 2SAKA 2ZCBA 2DLWA 2R0DA 5D3VA 5JHBA 1ET9A 2AQ3B 4YSXB 4JK9A 4TV3A 1FCCC 3TIXA 3P6AA 3PV1A 4M8NA 3T06A 3TMPB 1GJZA 3B77A 2GBKA 3VRAB 1N5XA 3R66C 2IFSA 4JK7A 1TZOA 2WLBA 3IVFA 4A3OA 2J0MA 4FXCA 1EVHA 2KWDA 1WM2A 1WXAA 1NI2A 2K8HA 1XD4A 1WJ6A 1PUTA 3ZJUA 1TS4A 3IAM1 4HCNB 4H2AA 1L7YA 1QQGA 2DLBA 2DYBA 1WMHA 4IFSA 1E7PB 4K2OA 3AXCA 4NNJB 1E8YA 2MP2B 4RCOA 2MBBB 2INDC 2GLSA 3VTVA 4F7GA 3EFUA 3GB1A 1K5DB 2D9VA 2BYVE 1DIKA 4RFBA 5CLLB 3HIZA 3FEHA 3ZUNA 4IWOA 4F7ZA 5AEKB 2QSDA 1DBHA 4PK1A 2J42A 2L05A 4ZYSA 1V80A 1Y5OA 4PYZA 2W3SA 4ACFA 4A90A 4X57B 4ANXA 1UNRA 4LLGM 1XLQA 4CYEA 1XKEA 1L4ZB 2DNFA 3IXSA 1W1GA 1OQQA 4IM2A 2D3CA 1MK7B 4K1RB 2MCNB 1FEHA 3TEZA 2KT7A 4I6NB 1FNVA 4S17A 2G3QB 3W2DA 4REZA 3HVDA 3N7CA 2W9NA 1YN3A 2DYNA 2ZZPB 3CXBB 1NENB 3IG3A 3VH4B 3MPXA 1J8CA 1PFJA 3GZNI 2MA9B 1WM3A 1BMLC 4AQ7A 3MHSD 2I38A 2ZJDA 2DIKA 4WIPA 4HVBA 1QOGA 3ZW3A 5L95C 4FBJB 5JLJB 4A55A 3M63B 2A5UA 5HE0A 1OTRB 1KOTA 1PDXA 2BYFA 3APCA 4WJPA 2P0DA 2LOXA 1ZXHA 1X1FA 2LBBA 3UZTA 1MVKA 3QAQA 1V2YA 1E7UA 3BK1A 1RRPB 4HHVA 4JL9A 2KLGA 1LO5D 2EMTA 2L00B 3B1LX 1GNUA 2DZIA 1YMHE 2D3BA 3BVZA 3Q14C 3QA8A 1LGRA 4C7ZA 4D6WA 4B6HA 4GOUA 1WJUA 4RF0A 1HZ5A 1SE9A 1WXMA 3NY5A 1KC7A 2FUG1 5IN7A 1KM7A 4JX1C 5JVLA 1WSPA 3KYCD 2TSSA 2XK5A 2FJUB 3FC4A 1HBKA 3MDBC 2H88B 2EELA 2ELBA 5CTRC 1WGRA 4DQOC 1P98A 3PHWB 5JHAA 4YXDB 3QWMA 2GS0A 3NW8A 2BB5A 2E6XA 3WANA 3ML4A 1M4VA 1FB8A 2KX0A 2OOBB 3AE9B 1FO4A 2VRWB 3LJ3A 3QC8B 3ZVVA 2C7HA 3RNAC 2RPVA 2AEHA 1DYQA 1TBEA 2DYQA 4RH6A 4GNKB 3EGRA 1N3HA 1MK9B 3LJUX 1WGDA 4NAWA 3HVZA 3KZ1A 1RAXA 3PLVA 3A8PA 2N7JA 3APFA 2K0PA 3PSCA 4PNKA 5DHAB 2WU2B 4WAFA 2CRFA 5DCNA 2K22A 4EJNA 1VLBA 4WJ7A 2N4FA 2QKMA 3TFMA 4BVUC 2DYMA 2XK5B 4OT1A 2GB1A 4A3PA 4DIXA 2UYZB 1J7AA 4RM8A 1JALA 3QQ8B 2L76A 5LONB 3L17A 2W2WA 2Y8GA 4DXGA 3AEFB 5JP4A 2YT1A 1NYQA 4KVGB 4JKCA 1OQRA 4HRSA 5E6PA 4WWNA 3E9PA 4MSQB 4NJ6A 4ZHPA 4FHKA 5EE9A 3AE6B 5AZHA 3QJZA 2FCNA 2RDBC 2CHZA 2X38A 1P9DU 1VDVA 3MTNB 4JKFA 2YT0A 1L0XB 2KKCA 2CB8A 2Z14A 4KDIC 1T77A 1EF1A 3PZ8A 1V1PA 2V1YA 2YT2A 3N9YC 1PLSA 3KQ4A 3RN9C 4C4VB 4N6EB 3GE8C 2K3UA 3GOEA 2DA0A 3QCAA 1IPGA 2FAZA 4GMXB 5BYQA 2C9WB 3ZTCA 3FILB 3DXEA 5DIFB 2HTHB 3OJ3A 1YIWA 3M1IB 2KACA 3WCQA 1ZM0A 4MACA 1I4XA 3RUIB 4PT5A 1VZ6A 4HB3B 3DBLB 2JXXA 4IG7B 2INCC 3RYTA 2DHKA 3ZNHB 4F8CB 2KZRA 3P1MA 4WWOA 3KH0A 2OEDA 4A6QA 2J0KA 2BS3B 3BK2A 1XLPA 3ULCA 2HD5B 2KDBA 1F77A 4LDTB 4LNOA 4NQKE 2KJHB 1FGYA 3ZLZA 2R82A 1WXQA 2AL6A 3ABVB 5G5HA 3CIKA 3L0WB 5LG4B 2K9XA 1UEFA 3U12A 4D2KA 3B2FA 2PE9A 2D10A 5D2MB 3BJIA 4AJWA 4KZ0A 5DPSA 2RD0A 3NVYA 3NSUA 2CODA 2KJRA 3DBRI 1JW9D 3EPYA 2GBRA 3R7RA 1GB1A 3NJTA 1V49A 2WXMA 2KQSA 2N0SB 3ML8A 4KDLB 2NBVB 4LTUA 1YQ3B 2XN9C 3DQVA 1F9JA 4WAAA 1D5XC 2MW5A 4ITKA 1OMWA 4ARCA 4HROA 2JRHA 3FP5A 1K53A 2C7MB 3N20C 4LJPB 4LNFA 2LZ6A 3F0WA 2ADZA 1E8XA 5HE1A 2M17A 1WGHA 4BBNC 3B9JA 1WVHA 3SFDB 4JWUC 2KDIA 2RGFA 4RNAA 2KC2A 1Q5WB 1LQBA 3JW0X 4R3DA 5EE0A 2PE6B 4CHMA 2CJNA 1YQ4B 4TSSA 4J6IA 5IAAC 1V5OA 4PS8A 1CMXB 4W9KA 3HUIA 3RCZA 2D3AA 3RNGC 4K81A 2X0SA 1B1ZA 2W55A 4JE3B 2I2YA 1UF0A 2JX5A 1E8ZA 1TJ6A 5FI1A 4C4VA 4GB9A 2RSUA 5AUIA 1I4QA 3N30A 3H8HA 1B9RA 1EF5A 4B0MA 3RNCC 3EUB2 3DVNU 3ZJTA 2LRWA 3H7PB 3PVWA 3PZ7A 4YL8A 1RWSA 2CJOA 2Z59A 3KRWA 3C19A 2DHJA 2BVCA 3UQAA 2G4SA 2EKIA 1HA5A 4BKTA 1U5GA 1FHWA 2WXQA 4M01A 2DBYA 1TY0A 2JYEA 2LGDA 1M7EA 4ILJA 3P4PB 3OHMB 2JU6X 1ROEA 3QHTA 5D3XA 4TQ1A 2MX2A 1MG4A 4WQMA 3VUYA 2DZJA 1FXTB 1AARA 2NS5A 3L08A 4TMAB 4B95A 2Q5WD 3HIEA 3ODOA 1EGXA 3U52E 1WGUA 1SE4A 2R2YA 5D3WA 1WXVA 3NS8A 3NUHB 4XE0A 2KD0A 3Q3NC 1OQNA 4K2PA 3DWMA 4Z2NA 2DZKA 3LXFA 4KGSA 5TR5A 2J53A 5BO4B 2HJ1A 1WF9A 1SF0A 2W2XC 2YRYA 4KIKB 2ZVNA 2K39A 1MJDA 4A20A 2OJRA 3D8FA 3DWGC 3W1YA 1R4NB 2WHIA 4EKUA 1V1PB 2KYWA 2LRUA 2COCA 4M8MA 1WJMA 1QF6A 4KV2A 4MJSA 2DZMA 4LCDE 4GMVA 3Q3JA 3KSYA 1XLOA 3SNHA 4JQWC 3EHVA 1T0RC 3QK0A 5CLQB 1WJ4A 1E8WA 2ZPYA 3H9DA 2ELAA 3GYOA 4AOFA 3W5VB 5D3DA 4BKSD 4C56C 2Y7BA 3PEGA 1YN4A 4N9F4 3DPDA 4FLHA 3ML9A 3AM9A 1J7BA 2N9KA 3EC8A 3E9SA 1VCBA 2KWCA 1V9JA 4ANUA 4DDGD 2V76A 3N1XC 4P7IA 1SE2A 2B76B 3S2AA 4L23A 3QARA 1L2NA 1QILA 2CU3A 2ZVOA 4JKBA 1WRDB 2K6QA 2GCJA 3P4QB 3P63A 5IKCM 3DXCA 3R3MA 3AN1A 2LI5A 2BWES 2BKFA 4P16A 1R4MI 3TO1A 1QOFA 3NVWA 2L0FA 1DOXA 1ZVRA 1FOEA 4HAZB 4XDCA 1V1OA 1AW7A 5CHVC 2MJ3A 3IBEA 4MJSB 3I9V1 3RNFC 3OAWA 4CHKA 1L4DB 4O1NA 5BMIA 1WYWB 1WIAA 2KGXB 4BOZB 3D8DA 3UI3A 2N9PC 1KI1B 1GGOA 2KAJA 3VXWA 3V60A 1NI3A 3EECA 1K51A 1C76A 1QZEA 3A4RA 4HWIB 2JSVX 1TIFA 4KGTA 2NMBA 3JSVA 1FFVA 3BVGA 3EA6A 2J7QB 3RNEC 1NU2A 4WVFB 1YJIA 1T0SC 5JHGA 2CU1A 3DDCB 4DHJD 2WDRB 5L83A 2UVMA 2LULA 2PZ1A 4QJ5B 4ILGB 1I4PA 2PKOA 4NZLB 2FNJB 3ZKJC 4PS3A 1SIJA 2L83A 1KH0A 4M00A 5KQ1A 1LW3A 2K8CA 3M62B 4GLSC 3RMKC 2YEPF 3BINA 2M1MA 2V4IB 1WGQA 2KXJA 1WI1A 3T3OA 3D8EA 1I7HA 2JWZA 4IDIA 3LB8C 1WX8A 2W3RA 4W9GA 1FHOA 2CKHB 2FE8A 1X05A 2MBOA 4MGYE 2YVCA 1JROA 3B0AA 1MIZB 5J2RA 4HB0B 4AJYB 1ZDXA 4KX6B 4BAXA 1Q0WB 3HQCA 2MWSB 3BIID 2R09A 1TJEA 3H6NA 1WY8A 2JUOA 2LVPA 3AE7B 2K49A 4ASWC 2JYTA 2GBMA 3A33B 2KDMA 2WGSA 3PHXB 5D7GA 2ZW0A 2LGYA 3ETRA 5KHQA 1XX0A 3NHEB 2H7DA 3ODWA 1J7CA 3DBRB 1SGHA 5GOWB 3ZO5B 2R2QA 2FIFA 3A58A 2V3NA 4GSWA 1C4PA 2LUEA 3NZSA 1V61A 3MC9A 4ZDVA 4HJGE 2ZEQA 1CJEA 3SFEB 2RMMA 5IP4D 2YS3A 3A9KA 1E90A 2Z0OA 4I6LB 4WH4A 3SYXA 4ZOHC 5C2TB 4ANWA 4HPMB 4DX8A 3O13A 4XWWA 3V05A 3N1ZC 3HM6X 2LGIA 1MAIA 2AWTA 3KVFB 1EUVB 2GJYA 2YS1A 4ZRKA 1X86A 1E10A 2WXRA 4XZ4A 1AWEA 3PO0A 1XODA 5DPTA 5LXIB 3I3TB 4L6EA 1KTKA 4BZAA 4OVZA 4FA6A 3SHQA 4P1BC 4XWXA 2MRPA 2IYDB 3E9LA 4MT7A 4MM3A 2P0FA 2VZKB 3OWEB 4HXDA 2BKRB 2N0YA 1UPQA 4JLCA 3CIRB 1JWMD 5HI1A 2FBWB 3KUZA 5FKAC 5IOIA 2NBVA 3AE2B 1X1GA 3ZIMA 1XLNA 2FJLA 2L1AA 3NG0A 1UGJA 3TVVA 1C78A 1TGZB 4FULA 4F7UP 4A6HA 2GRIA 2IO0B 1KFYB 3R2TA 2N7DA 3H1UA 2D2QA 2G4DB 1KRHA 5M4YB 1WWTA 1J0WA 3V61A 1EM7A 1XQQA 1YD8U 2DKQA 3PT2B 1QQRA 5HG2A 2L2IA 3ZNID 3E56A 1FM0D 4K7UA 1ZOYB 1UNQA 1EU3A 2ASQA 1BWNA 1N63A 2L3ZA 2GBJA 3TEXA 3ULBA 1WZ3A 3ZNGC 2BW2A 1BUIC 1DGJA 1TY2A 2ABDA 3SEBA 2WXFA 2QMTA 2FCQA 4JWSC 2I5CA 5GXGB 5BYSA 2QC8A 2LG1A 1A70A 4LNKA 1GG3A 1FMAD 4MEMA 5FR6A 2V0GA 4D0NB 1X1MA 2W54A 2LFIA 4DHJB 1XCTL 2Z59B 2KUPA 1VR9A 1ZGUB 4HPPA 4XDDA 3PGEA 3A1QB 1HE8A 2KQ7A 3BY4B 1SE3A 2IGDA 2V3PA 4NPNA 2BWFA 2BPSA 1D3ZA 3DHIC 5AZGA 1HEZE 3L16A 2DKPA 1TT5B 4EUTA 2LUMA 2WDTB 1SEBD 1SB3C 3C0RB 3L54A 2DX5A 1JCKB 2WXIA 2KFKA 3FILA 1HZ6A 1Q67A 2L32A 3CF6E 2BF8B 5C79A 3BZDB 1BTKA 2UZRA 2KHWB 5D3IB 1IGDA 1E0ZA 2MQJA 1J0GA 1STEA 2NTSA 3ECIA 3KW5B 3HSAA 2ZW1A 3T3NA 4YT0B 4DK5A 1J19A 3U7DA 1ZC3B 1Y56A 3Q2AC 2G1EA 1NBFC 3K9OB 1DYNA 1WFYA 2N23A 5JH5C 4K7SA 1CZPA 1Q10A 3RFZB 2INPE 1WGYA 1GAQB 4XX5A 2DWQA 3VUWA 2IPKD 2LOZA 1KZGA 2LYDA 2KVRA 1RLFA 2LGXA 1PYWD 3BVMA 1ZDVA 4OHJA 4RMAA 2M0AA 1BXTA 1VRAB 2BBCA 2RDHA 5TSSA 4HAVB 1JRPA 3DCXA 3AECB 4USAA 4G50A 2Q13A 3V62A 2WXPA 3IAS1 3CSFA 4BOSC 3QWZB 2MBEA 3URYA 1KLVA 1WR6E 2L7RA 2O6VB 2GBNA 1KJTA 3N32A 3DBLI 1YJ1A 2FJ9A 2UU7A 3A9JA 3RD2A 2LHDA 4NJ7A 4NJCA 2MWNB 3A8QA 1UD7A 2CS4A 4M0WB 3NWAA 4LNIA 1T5XD 4NAWB 4HB2B 3V6EB 3VH3B 4YWGG 3NVVA 1GPXA 4RM9A 2HE7A 4JKGB 1KZ7A 4MGZE 2AQ1B 2JT4B 2ZKMX 2IDYA 3VAWA 3P42A 4HSIA 1I2HA 2BB6A 4DBGA 4OVVA 4HK2A 1RFKA 3SD5A 1DOIA 2Z13A 2FCSA 1XEEA 3FAHA 1ZPSA 4TYZA 5DI9B 1MFWA 2IO3B 3VVWB 3RI7C 4ARIA 1MG8A 2QDFA 4MGKE 2RLOA 2RGNB 1I35A 1OQYA 2DYOA 3SU8X 4YTMB 1ST7A 2RVBB 4KHBA 3Q8EA 1E7VA 1FPYA 1Z5SB 5FK9C 4MK0A 4NSWA 3R7QA 2FDQA 3ZJVA 3R8BA 3FM8C 1WX7A 3TBLD 5J17A 1WRIA 2WDQB 1TKYA 4II2B 2MLBA 1GC7A 4L1BA 4WJQA 5BMHA 2ACZB 1XXGA 2BYEA 4N59A 4DDID 1Z87A 1FXAA 1K5GB 2KC1A 1DOYA 2M38A 5EE1A 2RSGA 4C0AA 4ZRJA 4QXAB 2HRJA 4HAYB 2AL3A 4AWJA 1ZXIA 3DBHB 1AN8A 1HTQA 1K52A 1ESFA 3IHPC 4JPSA 4KZCA 1OGWA 3DVGX 2ONQA 2KMMA 5LLIA 3L10B 2O2VB 4JGHB 2Y5CA 2KLCA 1IRSA 5FI0A 2N1VA 3PRZA 4E74A 2REXA 3GS2A 4A9AA 3Q8FA 5LOPB 2WXJA 4ZHOA 3Q3MC 2Z0QA 3KY9A 2BTEA 4NAMA 5H8YE 1P5TA 1QLBB 1TS2A 3ENBA 2KFKB 3Q69A 2OTXA 4ZYNA 4W9JA 4KAXB 1JWSD 2NVUI 1LB1A 1NYRA 4XGAB 1UPRA 4GZUA 3OANA 1P6SA 1L6VA 2M4NA 1MIXA 2AX5A 4K7WA 1OY2A 4HKQA 4GIVA 3DXDA 4FHJA 1GUAB 4A6FB 4GDLB 1FNWA 1N5WA 1UH6A 2QIEB 4BKGA 2KVZA 3HM3A 2VRRB 1LM8B 1GC6A 2PVGC 2P8VA 5BMGA 2Z0EB 2KO3A 3D32A 1I7AA 5AUKA 1IBXA 3SUZA 2R61A 2PJHA 1KBLA 4ZRIA 4IM3A 5DHFB 1JDEA 2M0XA 4OSNA 3EFCA 2WNMA 1V8CA 1C3TA 2DENB 5C6RA 2JWUA 3W5UB 2OJWA 1NTYA 2BS2B 4MDKE 4L1RA 1UELA 1T0YA 1ISNA 3HRDD 5EE3A 5AZFA 5L81A 4BKSA 2WU5B 1N6ZA 3X0WA 4DWFA 1R7SA 5JHHA 2CY5A 5DPRA 3WIMA 2WS3B 1RYJA 2N7EA 2MKRA 2ICIA 4IW0A 3WALA 1FRDA 4XC2A 1TXDA 4S0RA 1XCQL 2WDVB 3M95A 1Z2MA 4N58A 2CY4A 2YSZA 3KYDD 1ACCA 1I4RA 2O6VA 1JQ4A 2CHXA 3IFWB 3TSSA 2M19A 2IO1B 3N3KB 2HTME 4JKAA 2DFKA 3T9LA 5KCVA 1TZ1A 3E66A 1R4MB 4F7HA 1PMSA 3Q8AA 3I63C 2COAA 3GZNB 1BAKA 2YLMA 4KHOA 1DDWA 4JKGA 2LJ5A 1P7FA 2EKEC 1TS3A 2PMVA 1RJ2A 2ZPNA 1KLUD 5I2MA 2NBWB 2GI9A 4JK8A 3U8ZA 3KRXA 1OFFA 4I6PA 1Q1OA 3PREA 1LXDA 1IP9A 5T8IA 3LYYA 3NWDA 3UIPB 1FNUA 1ZKHA 5C5BA 1IYFA 1CK1A 1WR1A 2M8SA 2KJ6A 2UWQA 3TCAA 2EC1A 2NBUA 5CHFA 1UBIA 3BWUD 3PVLA 3OJ4B 2AYOB 4YTPB 3Q8CA 4EZJA 1VJKA 3RZFA 2JY6A 2Z4DA 2J0JA 1YNTE 3VTWA 2K5PA 3CSTA 2JVCA 3MHZA 3FKYA 4WWMA 2D9ZA 2ZNVC 1F2RC 1HB8A 1R4NI 2ZCCA 5J3TA 2BT6A 4AP4C 4F1SA 1MHHE 4B0EA 4HATB 4NQLB 4RGNA 1EO6A 5D3YA 3L13A 3W1SA 4YSZB 3SO6A 3IT6B 2YS5A 1C4CA 2NR2A 4LNNA 1H10A 2G35A 1M7RA 3AEAB 4QAYA 1FIQA 4K17A 1YX6B 4CQNA 1I42A 3NWFA 4JKHA 3C8YA 4GU2A 1JRUA 1UZXB 4GXBA 2LMCA 2WXKA 1ZSQA 1L0VB 2D3GA 1PGAA 1SIFA 3WA0A 1V6EA 4MY6A 1UNSA 4W9EA 1WJ1A 2L52A 4NY0A 5H92C 2K00A 2JP2A 2MBQA 5JXVA 5CHWA 3MJ5A 1XD3B 2O6VD 2NTTA 4HB4B 3AE3B 2COPA 2QEJC 2PEAA 3A9JB 1QC6A 2VZKD 2IJ0A 5C5BB 3TJPA 3V3XA 3ZTDA 2K2JA 3ZDMC 2HTHA 3A4SC 2WYQA 3KLSX 4GPTB 3NS1A 1CQVA 1JWAD 2KIGA 2VH1A 2WX1A 3SBTA 3VDZA 4BBKA 4KKJA 3U4EG 3PLUA 1N61A 1QOAA 4XYCA 5IO9A 3WYFB 2DHZA 4G11A 1HB6A 1NVLA 4GOCA 3UINB 4ICUA 4GGQA 1F1HA 1SBBB 1YJJA 1P0RA 2Z0DB 3DBSA 2LGSA 2INNE 1HTOA 1JWUD 4H8SA 2LWPA 4HAWB 2VH2A 1UNPA 1P3QU 4RF1A
chains in the Genus database with same CATH topology
1OEYA 1V5PA 3DVNV 2DN6A 4DHZB 3OLMD 3RT3B 4URKA 2WX0A 2LXCA 3H7PA 2XBBC 1ZW7A 3UIOB 4IWQA 1OEYJ 2KTFA 2O2VA 1V86A 2HJ8A 2LKOA 4W9CA 2Z0PA 3ONSA 2DAJA 1K8RB 3W1SC 4IWPA 3FSSA 4KHAA 2P0HA 3O96A 1WGGA 3RULA 3HK0A 2BCJA 3PSEB 1U2BA 3P7ZA 2UZSA 5JZEB 4MH0E 4W9LA 3KUCB 2N9EB 2JZZA 5LXHA 2YF0A 2DHIA 4CO7A 4EOYA 1WG7A 1YQBA 2EJ8A 2IYBA 2MFQA 2GCLA 3Q3FA 1WX9A 2FIDA 1TQZA 5C1ZA 4HCPB 3QBVB 3SV1A 4IAPA 3WAOA 3G9WA 1S3SG 3CMMB 2KOXA 5KQ4A 3ZRFA 1P1AA 2A4ZA 4G0NB 2L1CA 2D4QA 1P3RA 5EDSA 2KTRA 2XEWA 4HAUB 3UQBA 3F5RA 3NZUA 3RZWC 3LDZE 2I1JA 3UF8A 2WH5A 2JRIB 3VIAA 3TL5A 4G3XB 1UGMA 4WSFA 1DROA 4GDKB 1V5TA 2FUHB 4KSLC 3PPAA 2C60A 4IUMB 1XCGA 2DTCA 4EZKA 3SBGA 5IJMA 1S1QB 3DCGA 2MSED 4ILHA 2PPHA 3PG7A 2W2XD 4EMOA 5GMVA 1WE6A 3JSVB 1Y19B 3TW1A 3PP2A 1SHCA 1UBQA 3A9KB 4YONA 5C16A 1ACAA 2FCMA 2KWVB 5D6JB 1DDMA 3PVUA 1BTNA 2JZ3B 4LDTD 2RNRB 3V6CB 1U5FA 4IM0A 4DHZE 4GDKA 4CHJA 3PS6A 2KN5A 3U30A 1M94A 5DH9B 2JF5A 4FJZA 5J3YA 2C7NB 4IOYX 4JIOU 2KFJA 4JKEA 5HE3A 3KUDB 2RQ1A 1TTNA 2IZVB 4HLEA 4B6WA 1XR0B 4Y94A 1LFDA 2NCNA 3WAMA 4WJNA 2CAYA 4LJOB 3UGBB 2CHWA 4FJVB 1EAZA 4FADA 4AUQC 4PQ0A 4B9KA 2D11A 4ICVA 4HPLB 2KK8A 5J18A 3X23A 1V88A 4BBNF 2RR9A 3PRPB 4II3B 1V5UA 2GOWA 3JVZX 3RCPA 3VQIA 2BGFA 2WWZA 2X18A 2K2UA 1U4AA 4TKNA 1Y8RC 4KSKC 4GN1A 3DOWA 2NZ8B 3H7SA 2M14A 2KDFB 1WE7A 2KMCA 4WQOB 1A5RA 2V4LA 2B3AA 4KIKA 3MJWA 5IA7A 3T8MA 4TUUA 1FGZA 2LXAA 4E71A 3FLVA 2JPHA 1MKEA 3A98B 3QIJA 4DBBA 2K8BA 2LASA 2COFA 3NOBA 4HDOA 3JYUA 3V5WA 3WAPA 2R2OA 4HAXB 2ROZB 4W9IA 5J3QA 5D94A 1WMHB 2K6DB 1AQCA 3VOQA 2IBIB 4HDQA 3PZDA 1E5WA 2LVOA 4IC7B 2MBHA 2QHOA 4DX90 3ZDTA 3HW2B 3AULA 2NPTA 2V3SA 4KHBB 3M3JA 2VSZA 2EMSA 1B55A 1X11A 2Y8FA 1YX5B 1U27A 2IO2B 1RFAA 2CQUA 4DXAB 2DAFA 5G55A 5D27A 3AI5A 1U29A 1W1DA 2ROVA 1U5EA 1V81A 3ALBA 2L8JA 1VBGA 2N9XA 2D9XA 3PTFC 2XQNM 1MPHA 4TQ0A 1NDDA 3AU4A 4W9DA 1WI0A 4W9HA 1H8CA 2KTRB 2KNBA 3A1QA 3VHTC 2KDEB 1FHXA 3ENEA 1NTVA 3E9OA 2Y5BB 4Z2MB 2D9YA 3ODXA 2OQBA 4ANVA 2IY1B 3PRMB 3QX1A 2KCJA 1H4RA 1DDVA 2K25A 3APDA 4PS7A 4W9FA 1VD2A 2NPTB 2H7EA 4FN2A 2C5LC 2MP2A 1C1YB 4MELA 3DVGY 3O65B 1WZ0A 5E6OA 5HE2A 3VTUA 4HJKA 1V89A 4MSMB 1RRBA 5CX3A 2N1WA 4EZLA 2K1FA 2KWUB 4A5KA 3P2BA 2RUKB 2KX3A 2VKIA 5EFXA 1G6JA 2D07B 2DX5B 3AJ4A 4WWPA 1U5DA 1V5MA 3VFKA 2J59M 1VBHA 2ZNVB 4A6KA 2KMAA 2L0TA 3VUXA 1WH3A 4A6FA 4GDLA 1NTIA 3ZRCA 3GYPA 4PYUA 3SDLC 2LD9A 1PQSA 1BT0A 4OVUA 2E2XA 1WJNA 5G2NA 2G45B 3B08A 4WJOA 3AU5A 4E3CA 3HHMA 4EFOA 2RPQA 4EEWA 1ZC4B 2DX1A 3K9PB 4JKDA 1FAOA 2IY0B 4FJYA 1W1HA 5E6NA 2I5FA 4BFRA 2I1KA 3ZNZB 5DPWA 2LVQA 2QKLA 1WXSA 5KHOA 4MGIE 3ZVRA 5C23A 2GMIC 1XT9B 3DBHI 2D9WA 2MDXA 2CR5A 5HKHA 2KANA 2ZCBA 2DLWA 2R0DA 5D3VA 5JHBA 1P3QU 4JK9A 4TV3A 3TIXA 3P6AA 3PV1A 4M8NA 3T06A 3TMPB 1GJZA 2GBKA 3R66C 2IFSA 4JK7A 4A3OA 3IVFA 2J0MA 1EVHA 1WM2A 1WXAA 1NI2A 2K8HA 1XD4A 1WJ6A 4HCNB 1L7YA 1QQGA 2DYBA 1WMHA 4IFSA 4K2OA 3AXCA 4NNJB 1E8YA 2MP2B 2MBBB 3VTVA 4F7GA 3EFUA 1K5DB 2D9VA 2BYVE 1DIKA 5CLLB 3HIZA 3FEHA 3ZUNA 4IWOA 4F7ZA 5AEKB 1DBHA 2L05A 1V80A 1Y5OA 4PYZA 4X57B 4ANXA 1UNRA 4CYEA 1XKEA 1W1GA 4IM2A 1MK7B 4K1RB 2MCNB 4I6NB 2G3QB 3N7CA 2W9NA 2DYNA 2ZZPB 3CXBB 3IG3A 3VH4B 3MPXA 1J8CA 1PFJA 3GZNI 2MA9B 1WM3A 3MHSD 2ZJDA 2DIKA 4HVBA 3ZW3A 4FBJB 5JLJB 3M63B 2A5UA 5HE0A 1OTRB 1KOTA 2BYFA 3APCA 4WJPA 2P0DA 2LOXA 1X1FA 2LBBA 3UZTA 3QAQA 1V2YA 1E7UA 1RRPB 4HHVA 4JL9A 2KLGA 2L00B 2EMTA 3B1LX 1GNUA 2DZIA 3QA8A 4B6HA 1WJUA 1SE9A 1WXMA 3NY5A 1KC7A 1KM7A 5JVLA 3KYCD 2XK5A 1HBKA 3MDBC 5CTRC 2ELBA 1WGRA 1P98A 3PHWB 5JHAA 3QWMA 2GS0A 3WANA 3ML4A 1FB8A 2KX0A 2OOBB 2VRWB 3LJ3A 3QC8B 3ZVVA 2C7HA 2AEHA 1TBEA 2DYQA 1N3HA 1MK9B 3LJUX 1WGDA 4NAWA 3KZ1A 1RAXA 3PLVA 3A8PA 3APFA 3PSCA 4PNKA 5DHAB 2CRFA 5DCNA 4EJNA 4WJ7A 2N4FA 2QKMA 3TFMA 4BVUC 2DYMA 2XK5B 4A3PA 2UYZB 4RM8A 3QQ8B 2L76A 5LONB 3L17A 2W2WA 2Y8GA 5JP4A 2YT1A 4KVGB 4JKCA 5E6PA 4WWNA 3E9PA 4MSQB 4NJ6A 4FHKA 5AZHA 3QJZA 2FCNA 2CHZA 1P9DU 3MTNB 4JKFA 2YT0A 2KKCA 2CB8A 4KDIC 1EF1A 2V1YA 1PLSA 3GOEA 2DA0A 3QCAA 1IPGA 2FAZA 4GMXB 2C9WB 3ZTCA 3DXEA 5DIFB 2HTHB 3OJ3A 1YIWA 3M1IB 1ZM0A 3RUIB 4HB3B 2JXXA 4IG7B 3RYTA 2DHKA 3ZNHB 4F8CB 2KZRA 4WWOA 3KH0A 2J0KA 2HD5B 3ULCA 2KDBA 4LDTB 4NQKE 2KJHB 1FGYA 3ZLZA 2R82A 2AL6A 3CIKA 3L0WB 1UEFA 2PE9A 2D10A 5D2MB 3BJIA 4AJWA 4KZ0A 5DPSA 2RD0A 3NSUA 2CODA 2KJRA 3DBRI 3EPYA 2GBRA 3R7RA 1V49A 2KQSA 3ML8A 4KDLB 2NBVB 3DQVA 1F9JA 4WAAA 2MW5A 1OMWA 2JRHA 3FP5A 2C7MB 4LJPB 2LZ6A 3F0WA 2ADZA 1E8XA 5HE1A 2M17A 1WGHA 4BBNC 1WVHA 2KDIA 2RGFA 2KC2A 1Q5WB 1LQBA 3JW0X 2PE6B 4CHMA 4J6IA 5IAAC 1V5OA 4PS8A 1CMXB 4W9KA 3RCZA 4K81A 2X0SA 1E8ZA 1TJ6A 5FI1A 4GB9A 2RSUA 3N30A 1EF5A 3DVNU 2LRWA 3H7PB 3PVWA 4YL8A 3KRWA 2DHJA 3UQAA 2G4SA 4BKTA 1U5GA 1FHWA 2LGDA 1M7EA 4ILJA 3QHTA 5D3XA 4TQ1A 2MX2A 3VUYA 2DZJA 1FXTB 1AARA 2NS5A 3L08A 4B95A 3ODOA 1EGXA 1WGUA 1WXVA 5D3WA 3NS8A 2KD0A 1OQNA 4K2PA 4Z2NA 2DZKA 5TR5A 5BO4B 1WF9A 2W2XC 2YRYA 4KIKB 2ZVNA 2K39A 4A20A 2OJRA 3D8FA 3W1YA 4EKUA 4M8MA 2LRUA 2COCA 1WJMA 4KV2A 4MJSA 2DZMA 4LCDE 4GMVA 3Q3JA 3KSYA 3SNHA 4JQWC 3EHVA 3QK0A 5CLQB 1WJ4A 1E8WA 2ZPYA 3H9DA 2ELAA 3GYOA 4AOFA 4BKSD 2Y7BA 3PEGA 4N9F4 3DPDA 4FLHA 3ML9A 3EC8A 1VCBA 2KWCA 1V9JA 4ANUA 4DDGD 2V76A 4P7IA 3S2AA 1L2NA 3QARA 2ZVOA 4JKBA 1WRDB 2K6QA 2GCJA 3DXCA 3R3MA 2LI5A 2BWES 2BKFA 1R4MI 3TO1A 2L0FA 1ZVRA 1FOEA 4HAZB 5CHVC 3IBEA 4MJSB 4CHKA 3OAWA 1WYWB 1WIAA 2KGXB 4BOZB 3D8DA 2N9PC 1KI1B 1GGOA 3VXWA 3V60A 3EECA 1QZEA 3A4RA 4HWIB 2NMBA 3JSVA 2J7QB 1NU2A 4WVFB 5JHGA 2CU1A 3DDCB 4DHJD 5L83A 2UVMA 2LULA 2PZ1A 4ILGB 2FNJB 3ZKJC 4PS3A 5KQ1A 1LW3A 2K8CA 3M62B 3BINA 2M1MA 1WGQA 2KXJA 1WI1A 3D8EA 2JWZA 1WX8A 4W9GA 1FHOA 2CKHB 1X05A 2MBOA 4MGYE 2YVCA 3B0AA 1MIZB 5J2RA 4HB0B 4AJYB 1Q0WB 3HQCA 2MWSB 2R09A 3H6NA 1WY8A 2JUOA 2LVPA 4ASWC 2GBMA 3A33B 3PHXB 5D7GA 2LGYA 5KHQA 1XX0A 3NHEB 2H7DA 3ODWA 1SGHA 5GOWB 3ZO5B 2R2QA 2FIFA 4GSWA 2LUEA 3NZSA 1V61A 4ZDVA 2ZEQA 2YS3A 3A9KA 1E90A 2Z0OA 4I6LB 3SYXA 4ANWA 4HPMB 4DX8A 3HM6X 1MAIA 2AWTA 3KVFB 1EUVB 2GJYA 2YS1A 4ZRKA 1X86A 4XZ4A 1AWEA 1XODA 5DPTA 5LXIB 3I3TB 4L6EA 4FA6A 3SHQA 4XWXA 2IYDB 2MRPA 3E9LA 4MT7A 4MM3A 2P0FA 4HXDA 2BKRB 2N0YA 1UPQA 4JLCA 3KUZA 1X1GA 3ZIMA 2FJLA 3TVVA 4FULA 1TGZB 4F7UP 4A6HA 2IO0B 2N7DA 3H1UA 2D2QA 2G4DB 1J0WA 3V61A 1XQQA 1YD8U 3PT2B 2DKQA 2L2IA 3ZNID 4K7UA 1UNQA 2ASQA 1BWNA 2L3ZA 2GBJA 3ULBA 1WZ3A 3ZNGC 2ABDA 2FCQA 2I5CA 2LG1A 1GG3A 4MEMA 5FR6A 4D0NB 1X1MA 4DHJB 2Z59B 2KUPA 1ZGUB 3PGEA 3A1QB 1HE8A 2KQ7A 3BY4B 4NPNA 2BWFA 2BPSA 1D3ZA 5AZGA 3L16A 2DKPA 4EUTA 2WDTB 3C0RB 3L54A 2DX5A 2KFKA 1Q67A 3CF6E 2BF8B 5C79A 1BTKA 2UZRA 2KHWB 2MQJA 1J0GA 3ECIA 3KW5B 4DK5A 1J19A 3U7DA 1ZC3B 1NBFC 3K9OB 1DYNA 1WFYA 2N23A 5JH5C 4K7SA 1WGYA 4XX5A 3VUWA 2LOZA 1KZGA 2LYDA 2KVRA 1RLFA 2LGXA 4RMAA 4HAVB 4G50A 2Q13A 3V62A 3CSFA 4BOSC 3QWZB 2MBEA 1KLVA 1WR6E 2L7RA 2O6VB 2GBNA 1KJTA 3N32A 3DBLI 1YJ1A 2FJ9A 3RD2A 3A9JA 4NJ7A 2MWNB 3A8QA 1UD7A 2CS4A 4M0WB 4NAWB 4HB2B 3V6EB 3VH3B 4RM9A 2HE7A 4JKGB 1KZ7A 4MGZE 2JT4B 3VAWA 1I2HA 4DBGA 4OVVA 4HK2A 3SD5A 2FCSA 4TYZA 5DI9B 2IO3B 3VVWB 1MG8A 4MGKE 2RLOA 2RGNB 1I35A 1OQYA 2DYOA 3SU8X 1ST7A 2RVBB 1E7VA 1Z5SB 4MK0A 4NSWA 3R7QA 2FDQA 3FM8C 1WX7A 3TBLD 5J17A 4II2B 2MLBA 1GC7A 4WJQA 2BYEA 4DDID 1Z87A 1K5GB 2KC1A 2M38A 2RSGA 4C0AA 4ZRJA 2HRJA 4HAYB 2AL3A 4AWJA 3IHPC 4KZCA 1OGWA 3DVGX 5LLIA 3L10B 2O2VB 4JGHB 2KLCA 1IRSA 5FI0A 2N1VA 3PRZA 4E74A 2REXA 5LOPB 2Z0QA 3KY9A 1P5TA 3ENBA 2KFKB 2OTXA 4ZYNA 4W9JA 4KAXB 2NVUI 1LB1A 1UPRA 4GZUA 3OANA 1P6SA 2M4NA 1MIXA 4K7WA 1OY2A 4GIVA 3DXDA 4FHJA 1GUAB 4A6FB 4GDLB 1UH6A 4BKGA 3HM3A 2VRRB 1LM8B 1GC6A 2P8VA 2Z0EB 2KO3A 3D32A 1I7AA 3SUZA 2PJHA 1KBLA 4ZRIA 4IM3A 5DHFB 1JDEA 2M0XA 1C3TA 2DENB 5C6RA 1NTYA 4MDKE 1UELA 1T0YA 1ISNA 5AZFA 5L81A 4BKSA 3X0WA 4DWFA 5JHHA 2CY5A 5DPRA 3WIMA 2N7EA 2MKRA 4IW0A 3WALA 4XC2A 1TXDA 3M95A 1Z2MA 2CY4A 2YSZA 3KYDD 2O6VA 2CHXA 3IFWB 2IO1B 3N3KB 4JKAA 2DFKA 3T9LA 5KCVA 1TZ1A 3E66A 4F7HA 1PMSA 2COAA 1BAKA 2YLMA 4KHOA 1DDWA 4JKGA 2LJ5A 2EKEC 1RJ2A 2ZPNA 2NBWB 4JK8A 3U8ZA 3KRXA 4I6PA 1Q1OA 3PREA 1LXDA 1IP9A 3UIPB 1ZKHA 5C5BA 1IYFA 1WR1A 2M8SA 2KJ6A 2UWQA 3TCAA 2EC1A 2NBUA 5CHFA 1UBIA 3OJ4B 3PVLA 2AYOB 4EZJA 3RZFA 2JY6A 2J0JA 3VTWA 3CSTA 2JVCA 2D9ZA 2ZNVC 1HB8A 1R4NI 2ZCCA 4AP4C 5J3TA 4F1SA 4HATB 4NQLB 1EO6A 5D3YA 3L13A 3W1SA 3SO6A 2YS5A 2NR2A 1H10A 2G35A 1M7RA 1I42A 4K17A 1YX6B 4JKHA 4GU2A 1JRUA 1UZXB 4GXBA 1ZSQA 2D3GA 1SIFA 3WA0A 1V6EA 4MY6A 4W9EA 1WJ1A 4NY0A 2K00A 2JP2A 2MBQA 5CHWA 1XD3B 2O6VD 4HB4B 2COPA 2PEAA 3A9JB 1QC6A 5C5BB 3TJPA 3ZTDA 2K2JA 3ZDMC 2HTHA 3A4SC 2WYQA 4GPTB 2WX1A 3SBTA 3VDZA 4BBKA 3PLUA 3WYFB 2DHZA 4G11A 1HB6A 1NVLA 4GOCA 3UINB 4ICUA 4GGQA 1P0RA 2Z0DB 3DBSA 4H8SA 2LWPA 4HAWB 1UNPA 5L95C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OEY A;  3CF6 E;  1V5P A;  1V89 A;  2KDI A;  4MSM B;  3DVN V;  2DN6 A;  2BF8 B;  5C79 A;  1RRB A;  2RGF A;  1BTK A;  1Q5W B;  2KC2 A;  4DHZ B;  1LQB A;  3JW0 X;  5CX3 A;  2PE6 B;  4CHM A;  2UZR A;  2N1W A;  3TL5 A;  2KHW B;  4EZL A;  4J6I A;  3OLM D;  5IAA C;  2K1F A;  3RT3 B;  2KWU B;  4URK A;  1V5O A;  4A5K A;  3P2B A;  2WX0 A;  2MQJ A;  1J0G A;  4PS8 A;  2LXC A;  1CMX B;  2RUK B;  3ECI A;  3KW5 B;  4W9K A;  3H7P A;  2XBB C;  3RCZ A;  2KX3 A;  2VKI A;  4K81 A;  1ZW7 A;  3UIO B;  4IWQ A;  5EFX A;  1G6J A;  2D07 B;  1OEY J;  2KTF A;  2DX5 B;  3AJ4 A;  1J19 A;  2O2V A;  4DK5 A;  1V86 A;  3U7D A;  1ZC3 B;  1E8Z A;  2HJ8 A;  4WWP A;  1U5D A;  1TJ6 A;  1V5M A;  1NBF C;  3K9O B;  5FI1 A;  2LKO A;  1DYN A;  4W9C A;  1WFY A;  4GB9 A;  2Z0P A;  2N23 A;  2RSU A;  3VFK A;  5JH5 C;  4K7S A;  3N30 A;  1WGY A;  2J59 M;  3ONS A;  2DAJ A;  1K8R B;  4XX5 A;  2ZNV B;  4A6K A;  1EF5 A;  3VUW A;  4IWP A;  3W1S C;  3FSS A;  4KHA A;  2P0H A;  2KMA A;  2L0T A;  3O96 A;  2LOZ A;  1WGG A;  3DVN U;  3RUL A;  1KZG A;  2LYD A;  3HK0 A;  2LRW A;  2KVR A;  3PVW A;  3H7P B;  1RLF A;  4YL8 A;  2LGX A;  3VUX A;  2BCJ A;  4A6F A;  1WH3 A;  4GDL A;  4RMA A;  3PSE B;  1NTI A;  3ZRC A;  3KRW A;  2DHJ A;  3GYP A;  4PYU A;  4HAV B;  3UQA A;  2G4S A;  4HLE A;  1U2B A;  3P7Z A;  4BKT A;  4G50 A;  2Q13 A;  2UZS A;  1U5G A;  3V62 A;  1FHW A;  3SDL C;  2LD9 A;  1PQS A;  1BT0 A;  3CSF A;  4OVU A;  2E2X A;  3QWZ B;  4BOS C;  1WJN A;  2LGD A;  4MH0 E;  5G2N A;  1M7E A;  5JZE B;  4W9L A;  3KUC B;  2MBE A;  1KLV A;  1WR6 E;  2L7R A;  2N9E B;  2O6V B;  2GBN A;  2G45 B;  3B08 A;  1KJT A;  4WJO A;  3AU5 A;  4E3C A;  3N32 A;  2JZZ A;  3QHT A;  3HHM A;  5D3X A;  2YF0 A;  3DBL I;  4TQ1 A;  1YJ1 A;  2MX2 A;  4EFO A;  5LXH A;  2RPQ A;  2FJ9 A;  3VUY A;  1ZC4 B;  4EEW A;  2DZJ A;  2DHI A;  3RD2 A;  1FXT B;  3A9J A;  4CO7 A;  1AAR A;  2NS5 A;  3L08 A;  2DX1 A;  3K9P B;  4NJ7 A;  4B95 A;  2MWN B;  3A8Q A;  4EOY A;  1WG7 A;  1FAO A;  3ODO A;  1YQB A;  1EGX A;  1UD7 A;  2IY0 B;  2CS4 A;  1W1H A;  2EJ8 A;  4FJY A;  4M0W B;  1WGU A;  4NAW B;  4HB2 B;  1WXV A;  5D3W A;  3NS8 A;  4AP4 C;  5E6N A;  2I5F A;  2KD0 A;  2IYB A;  3V6E B;  2MFQ A;  5LLI A;  4BFR A;  3VH3 B;  1OQN A;  2GCL A;  2I1K A;  4K2P A;  3Q3F A;  3ZNZ B;  4RM9 A;  2HE7 A;  1WX9 A;  4Z2N A;  2FID A;  2LVQ A;  1KZ7 A;  1TQZ A;  4MGZ E;  5C1Z A;  2QKL A;  1WXS A;  2DZK A;  2JT4 B;  3QBV B;  4HCP B;  4MGI E;  5KHO A;  3SV1 A;  3ZVR A;  4IAP A;  2GMI C;  5C23 A;  5TR5 A;  1XT9 B;  1I2H A;  3DBH I;  3G9W A;  3WAO A;  2D9W A;  4DBG A;  1S3S G;  3CMM B;  5BO4 B;  1WF9 A;  2MDX A;  2KOX A;  2CR5 A;  4OVV A;  5HKH A;  2KAN A;  2W2X C;  4HK2 A;  5KQ4 A;  3SD5 A;  2ZCB A;  2YRY A;  2FCS A;  4KIK B;  3ZRF A;  1P1A A;  2DLW A;  2R0D A;  2A4Z A;  5D3V A;  2K39 A;  2ZVN A;  4G0N B;  5JHB A;  4A20 A;  4TYZ A;  2OJR A;  4TV3 A;  5DI9 B;  3D8F A;  2L1C A;  2IO3 B;  3W1Y A;  3VVW B;  2D4Q A;  1MG8 A;  3P6A A;  3PV1 A;  3TIX A;  1P3R A;  4EKU A;  5EDS A;  4MGK E;  2RLO A;  2RGN B;  3T06 A;  4M8N A;  1I35 A;  4M8M A;  1OQY A;  2COC A;  2LRU A;  3TMP B;  2DYO A;  1GJZ A;  1WJM A;  2KTR A;  3SU8 X;  2GBK A;  1ST7 A;  2RVB B;  3VTU A;  4KV2 A;  4MJS A;  2XEW A;  3R66 C;  2IFS A;  1E7V A;  4GMV A;  2DZM A;  3Q3J A;  4LCD E;  1Z5S B;  3KSY A;  4HAU B;  3IVF A;  4MK0 A;  2J0M A;  4HJK A;  4A3O A;  3F5R A;  4NSW A;  3R7Q A;  3SNH A;  1EVH A;  4JQW C;  3UQB A;  2FDQ A;  3EHV A;  1WM2 A;  3NZU A;  3QK0 A;  1WXA A;  5CLQ B;  1NI2 A;  3FM8 C;  1WJ4 A;  1WX7 A;  2K8H A;  3LDZ E;  3RZW C;  1XD4 A;  1E8W A;  1WJ6 A;  3TBL D;  5J17 A;  2I1J A;  4HCN B;  2ZPY A;  1L7Y A;  3H9D A;  3UF8 A;  2WH5 A;  2ELA A;  1QQG A;  3GYO A;  3VIA A;  2DYB A;  2JRI B;  2MLB A;  1UGM A;  4G3X B;  1GC7 A;  4WSF A;  4II2 B;  1WMH A;  2Y7B A;  4IFS A;  3PEG A;  1DRO A;  4WJQ A;  4BKS D;  4N9F 4;  4K2O A;  2BYE A;  3AXC A;  1E8Y A;  3DPD A;  4FLH A;  4GDK B;  4NNJ B;  3ML9 A;  4DDI D;  1Z87 A;  2MP2 B;  1V5T A;  2FUH B;  1K5G B;  2MBB B;  2KC1 A;  1VCB A;  2KWC A;  3EC8 A;  1V9J A;  4KSL C;  3VTV A;  4ANU A;  4F7G A;  2M38 A;  2RSG A;  3EFU A;  4C0A A;  4DDG D;  4ZRJ A;  2V76 A;  1K5D B;  2D9V A;  3PPA A;  4P7I A;  2BYV E;  2C60 A;  4IUM B;  5CLL B;  3S2A A;  3HIZ A;  1L2N A;  3QAR A;  2HRJ A;  4HAY B;  3FEH A;  3ZUN A;  2AL3 A;  4IWO A;  2ZVO A;  4F7Z A;  1XCG A;  4BVU C;  2DTC A;  1WRD B;  4AWJ A;  4EZK A;  2K6Q A;  5AEK B;  5IJM A;  1S1Q B;  1DBH A;  3DCG A;  2GCJ A;  3DXC A;  2MSE D;  2L05 A;  3R3M A;  2LI5 A;  2PPH A;  3PG7 A;  1Y5O A;  1V80 A;  2BWE S;  4PYZ A;  2BKF A;  2W2X D;  4X57 B;  3IHP C;  4ANX A;  4EMO A;  1UNR A;  3TO1 A;  1OGW A;  1R4M I;  2L0F A;  4KZC A;  1ZVR A;  5GMV A;  3DVG X;  1FOE A;  4CYE A;  1XKE A;  4HAZ B;  1WE6 A;  5CHV C;  3IBE A;  3JSV B;  4MJS B;  1Y19 B;  1W1G A;  4IM2 A;  3TW1 A;  3L10 B;  3PP2 A;  1SHC A;  2O2V B;  3OAW A;  1UBQ A;  1MK7 B;  4YON A;  2KLC A;  5C16 A;  3A9K B;  4JGH B;  4K1R B;  1IRS A;  1ACA A;  2FCM A;  5FI0 A;  2KWV B;  2N1V A;  1WYW B;  3PRZ A;  1WIA A;  2MCN B;  2KGX B;  4E74 A;  5D6J B;  2REX A;  4I6N B;  4BOZ B;  3D8D A;  2G3Q B;  5LOP B;  2N9P C;  1KI1 B;  3VXW A;  1DDM A;  3N7C A;  3PVU A;  2W9N A;  1BTN A;  2JZ3 B;  3V60 A;  4CHK A;  2Z0Q A;  2DYN A;  3EEC A;  4LDT D;  3KY9 A;  2RNR B;  2ZZP B;  3V6C B;  3CXB B;  1U5F A;  1QZE A;  4IM0 A;  3IG3 A;  3VH4 B;  1P5T A;  4DHZ E;  4GDK A;  3A4R A;  2KFK B;  4CHJ A;  3MPX A;  2KN5 A;  3PS6 A;  4HWI B;  3U30 A;  1J8C A;  2OTX A;  4ZYN A;  4W9J A;  4KAX B;  1M94 A;  1PFJ A;  2NVU I;  3GZN I;  2MA9 B;  2NMB A;  1LB1 A;  5DH9 B;  2JF5 A;  1WM3 A;  3JSV A;  2J7Q B;  1UPR A;  4GZU A;  1NU2 A;  3MHS D;  4WVF B;  3OAN A;  1P6S A;  2M4N A;  1MIX A;  2ZJD A;  4FJZ A;  4K7W A;  5JHG A;  5J3Y A;  2CU1 A;  3DDC B;  4DHJ D;  5L83 A;  1OY2 A;  4GIV A;  2UVM A;  3DXD A;  2C7N B;  2LUL A;  2PZ1 A;  1GUA B;  4FHJ A;  3ZW3 A;  4A6F B;  4GDL B;  4HVB A;  5L95 C;  4IOY X;  1UH6 A;  4JIO U;  2KFJ A;  4BKG A;  3HM3 A;  4FBJ B;  5JLJ B;  5HE3 A;  2VRR B;  3KUD B;  1LM8 B;  1GC6 A;  2RQ1 A;  2P8V A;  1TTN A;  2FNJ B;  2Z0E B;  2IZV B;  2KO3 A;  3M63 B;  3ZKJ C;  4PS3 A;  4B6W A;  3D32 A;  2A5U A;  1XR0 B;  4Y94 A;  1I7A A;  5HE0 A;  1LFD A;  3SUZ A;  1OTR B;  1KOT A;  3VAW A;  2BYF A;  2NCN A;  3APC A;  4WJP A;  3WAM A;  2PJH A;  2P0D A;  4WJN A;  2LOX A;  1LW3 A;  4ZRI A;  5KQ1 A;  2K8C A;  3M62 B;  4IM3 A;  5DPW A;  1X1F A;  3BIN A;  5DHF B;  2LBB A;  3UZT A;  2M1M A;  2M0X A;  3QAQ A;  1V2Y A;  1E7U A;  1WGQ A;  1RRP B;  2CAY A;  4HHV A;  2KXJ A;  4LJO B;  1WI1 A;  3UGB B;  4JL9 A;  2DEN B;  1C3T A;  3D8E A;  2CHW A;  2KLG A;  2EMT A;  5C6R A;  2L00 B;  1GNU A;  2JWZ A;  1NTY A;  1EAZ A;  2DZI A;  4FJV B;  1WX8 A;  4FAD A;  4AUQ C;  4W9G A;  1FHO A;  2CKH B;  4MDK E;  4PQ0 A;  3QA8 A;  1UEL A;  1T0Y A;  1X05 A;  1ISN A;  4B9K A;  2D11 A;  4B6H A;  2MBO A;  5AZF A;  1WJU A;  4ICV A;  5L81 A;  2YVC A;  4HPL B;  3B0A A;  4MGY E;  1MIZ B;  4BKS A;  1SE9 A;  5J2R A;  4HB0 B;  1WXM A;  3NY5 A;  2KK8 A;  3X0W A;  4AJY B;  5J18 A;  4DWF A;  1Q0W B;  3X23 A;  3HQC A;  2MWS B;  1V88 A;  2R09 A;  5JHH A;  3H6N A;  1WY8 A;  1KM7 A;  2JUO A;  2CY5 A;  4BBN F;  2LVP A;  2RR9 A;  3PRP B;  4II3 B;  5DPR A;  3WIM A;  2N7E A;  1V5U A;  2MKR A;  2GOW A;  3B1L X;  3KYC D;  2XK5 A;  4IW0 A;  3WAL A;  4XC2 A;  4ASW C;  1TXD A;  1HBK A;  3MDB C;  5CTR C;  2ELB A;  2GBM A;  3M95 A;  1WGR A;  1Z2M A;  3A33 B;  2CY4 A;  3JVZ X;  2YSZ A;  3KYD D;  3PHX B;  1P98 A;  3RCP A;  5D7G A;  3PHW B;  5JHA A;  2LGY A;  2O6V A;  2CHX A;  3IFW B;  1XX0 A;  3VQI A;  5KHQ A;  3QWM A;  2GS0 A;  2BGF A;  2X18 A;  2IO1 B;  2K2U A;  2WWZ A;  3NHE B;  3N3K B;  2H7D A;  3ML4 A;  2DFK A;  3ODW A;  3WAN A;  1FB8 A;  1U4A A;  4TKN A;  2KX0 A;  2OOB B;  3T9L A;  1Y8R C;  4KSK C;  4GN1 A;  5KCV A;  1TZ1 A;  1SGH A;  5GOW B;  3DOW A;  2NZ8 B;  2VRW B;  3ZO5 B;  3LJ3 A;  3QC8 B;  2R2Q A;  3ZVV A;  4F7H A;  2FIF A;  2C7H A;  2AEH A;  1TBE A;  3H7S A;  1PMS A;  2DYQ A;  2M14 A;  2COA A;  2KDF B;  2LUE A;  1BAK A;  1WE7 A;  1V61 A;  2YLM A;  3NZS A;  4ZDV A;  4KHO A;  1DDW A;  1N3H A;  2LJ5 A;  2ZEQ A;  2EKE C;  2KMC A;  1MK9 B;  4WQO B;  1RJ2 A;  3LJU X;  1A5R A;  2YS3 A;  1WGD A;  2V4L A;  3A9K A;  1E90 A;  2Z0O A;  2ZPN A;  4I6L B;  2B3A A;  4NAW A;  4KIK A;  3MJW A;  2NBW B;  3KZ1 A;  1RAX A;  5IA7 A;  3PLV A;  3A8P A;  3APF A;  3T8M A;  3U8Z A;  3KRX A;  3PSC A;  3SYX A;  4TUU A;  4PNK A;  1FGZ A;  5DHA B;  2LXA A;  4E71 A;  4ANW A;  3FLV A;  2CRF A;  2JPH A;  4I6P A;  5DCN A;  1MKE A;  4EJN A;  4HPM B;  1Q1O A;  3PRE A;  1LXD A;  1IP9 A;  4DX8 A;  3A98 B;  3QIJ A;  4DBB A;  4WJ7 A;  2K8B A;  3HM6 X;  3UIP B;  1ZKH A;  2LAS A;  4AOF A;  5C5B A;  2N4F A;  1MAI A;  2AWT A;  1IYF A;  3KVF B;  2COF A;  2GJY A;  1EUV B;  1WR1 A;  2YS1 A;  4ZRK A;  1X86 A;  2QKM A;  2KJ6 A;  2M8S A;  3NOB A;  3TFM A;  2UWQ A;  1AWE A;  4HDO A;  2DYM A;  1XOD A;  3TCA A;  2XK5 B;  4XZ4 A;  5DPT A;  2EC1 A;  3JYU A;  4A3P A;  3V5W A;  2NBU A;  5CHF A;  5LXI B;  2UYZ B;  1UBI A;  3I3T B;  3OJ4 B;  3PVL A;  4RM8 A;  3QQ8 B;  2L76 A;  2AYO B;  3WAP A;  5LON B;  4L6E A;  4EZJ A;  3L17 A;  2W2W A;  2R2O A;  3SHQ A;  3RZF A;  4FA6 A;  2Y8G A;  4XWX A;  4HAX B;  2JY6 A;  2J0J A;  2ROZ B;  2YT1 A;  5JP4 A;  5J3Q A;  4MT7 A;  2IYD B;  2MRP A;  1WMH B;  4W9I A;  5D94 A;  3VTW A;  3CST A;  4GSW A;  4MM3 A;  4KVG B;  2JVC A;  2K6D B;  4WWN A;  4MSQ B;  5E6P A;  2D9Z A;  1AQC A;  3VOQ A;  2IBI B;  2ZNV C;  2P0F A;  4FHK A;  4NJ6 A;  4HDQ A;  1HB8 A;  4HXD A;  5AZH A;  1R4N I;  3PZD A;  2ZCC A;  3QJZ A;  5J3T A;  2BKR B;  2N0Y A;  1UPQ A;  1E5W A;  2FCN A;  2LVO A;  2MBH A;  4IC7 B;  4JLC A;  4F1S A;  4HAT B;  2CHZ A;  4DX9 0;  3ZDT A;  3HW2 B;  2QHO A;  4NQL B;  1EO6 A;  1P9D U;  3MTN B;  5D3Y A;  3AUL A;  2YT0 A;  2NPT A;  2V3S A;  3L13 A;  2KKC A;  2CB8 A;  4KDI C;  3W1S A;  4KHB B;  1EF1 A;  3SO6 A;  3M3J A;  3KUZ A;  2YS5 A;  2VSZ A;  2NR2 A;  2EMS A;  1B55 A;  1H10 A;  1X11 A;  2G35 A;  1M7R A;  2V1Y A;  1I42 A;  4K17 A;  1YX6 B;  2Y8F A;  1X1G A;  1YX5 B;  1U27 A;  2IO2 B;  1PLS A;  1RFA A;  2CQU A;  4DXA B;  2DAF A;  5G55 A;  2FJL A;  3ZIM A;  4GU2 A;  1JRU A;  3TVV A;  4GXB A;  1TGZ B;  1UZX B;  4F7U P;  5D27 A;  4FUL A;  4A6H A;  1ZSQ A;  3AI5 A;  2IO0 B;  2D3G A;  1U29 A;  2N7D A;  1W1D A;  2D2Q A;  1SIF A;  2DA0 A;  2ROV A;  1IPG A;  2FAZ A;  2G4D B;  3GOE A;  3QCA A;  1U5E A;  3WA0 A;  1V6E A;  4GMX B;  4MY6 A;  1V81 A;  2C9W B;  3H1U A;  1J0W A;  4W9E A;  3ALB A;  3V61 A;  1XQQ A;  1YD8 U;  3PT2 B;  2DKQ A;  3ZTC A;  3DXE A;  2L8J A;  2N9X A;  5DIF B;  2HTH B;  1WJ1 A;  2D9X A;  2L2I A;  3OJ3 A;  1YIW A;  3PTF C;  4NY0 A;  3M1I B;  2K00 A;  3ZNI D;  2JP2 A;  1ZM0 A;  4K7U A;  2MBQ A;  2XQN M;  5CHW A;  1MPH A;  1UNQ A;  1NDD A;  3RUI B;  4TQ0 A;  2ASQ A;  3AU4 A;  1BWN A;  2L3Z A;  4HB3 B;  4W9D A;  2GBJ A;  1WI0 A;  1XD3 B;  2O6V D;  4W9H A;  4HB4 B;  2JXX A;  3ULB A;  1WZ3 A;  4IG7 B;  3ZNG C;  2COP A;  2KTR B;  3RYT A;  2DHK A;  3ZNH B;  1H8C A;  2PEA A;  2KNB A;  3A9J B;  1QC6 A;  4F8C B;  2KZR A;  3A1Q A;  4WWO A;  5C5B B;  2ABD A;  2KDE B;  3KH0 A;  3VHT C;  2J0K A;  1FHX A;  3TJP A;  3ENE A;  1NTV A;  2HD5 B;  3ULC A;  2KDB A;  4LDT B;  3ZTD A;  4NQK E;  2FCQ A;  2KJH B;  1FGY A;  2K2J A;  3ZLZ A;  3ZDM C;  2AL6 A;  2HTH A;  2I5C A;  2WYQ A;  3A4S C;  3CIK A;  3L0W B;  1UEF A;  4GPT B;  2Y5B B;  4Z2M B;  2WX1 A;  2LG1 A;  3VDZ A;  4BBK A;  2PE9 A;  2D10 A;  2D9Y A;  3BJI A;  3ODX A;  5D2M B;  4AJW A;  1GG3 A;  2OQB A;  4KZ0 A;  2RD0 A;  5DPS A;  4MEM A;  3NSU A;  2COD A;  4D0N B;  1X1M A;  2KJR A;  5FR6 A;  3DBR I;  4ANV A;  3PLU A;  2IY1 B;  4DHJ B;  3PRM B;  2Z59 B;  2KUP A;  1ZGU B;  3QX1 A;  3EPY A;  2GBR A;  3R7R A;  3WYF B;  2KCJ A;  3PGE A;  1V49 A;  1H4R A;  1HE8 A;  2DHZ A;  2KQ7 A;  2KQS A;  3A1Q B;  1DDV A;  3BY4 B;  4G11 A;  3ML8 A;  1HB6 A;  2NBV B;  2K25 A;  3APD A;  4KDL B;  1NVL A;  3DQV A;  1F9J A;  4NPN A;  4PS7 A;  4WAA A;  4GOC A;  4W9F A;  4ICU A;  1VD2 A;  4GGQ A;  3UIN B;  2MW5 A;  1OMW A;  2BWF A;  2JRH A;  3FP5 A;  2BPS A;  2C7M B;  2NPT B;  1D3Z A;  2H7E A;  4FN2 A;  4LJP B;  2C5L C;  2MP2 A;  5AZG A;  1C1Y B;  2LZ6 A;  3F0W A;  4MEL A;  3L16 A;  1P0R A;  3DVG Y;  2DKP A;  2ADZ A;  2Z0D B;  4EUT A;  3DBS A;  1E8X A;  5HE1 A;  2WDT B;  2M17 A;  1WGH A;  4H8S A;  2LWP A;  3C0R B;  4BBN C;  4HAW B;  3L54 A;  2DX5 A;  1UNP A;  3O65 B;  1WZ0 A;  1WVH A;  5HE2 A;  2KFK A;  5E6O A;  1P3Q U;  1Q67 A; 
#chains in the Genus database with same CATH topology
 1OEY A;  1V5P A;  3ZXV A;  1VZ8 A;  2J4X A;  3DVN V;  2DN6 A;  1IGC A;  3Q8B A;  4DHZ B;  2PVO D;  3P4R B;  3GP7 A;  3OLM D;  2MEK A;  4RGM A;  3RT3 B;  4URK A;  2WX0 A;  2LXC A;  2QIL A;  1HXY D;  3H7P A;  1KF6 B;  2XBB C;  3RPF C;  1ZW7 A;  3UIO B;  4IWQ A;  1PGX A;  1OEY J;  2KTF A;  5I4D A;  2O2V A;  1N60 A;  1V86 A;  2HJ8 A;  2NMQ A;  5G5G A;  2LKO A;  1VZ7 A;  4W9C A;  2Z0P A;  4RGT A;  2JQR B;  1C77 A;  5I2S A;  3ONS A;  2DAJ A;  1JWB D;  1K8R B;  3W1S C;  4IWP A;  4KKI A;  3FSS A;  3BYY B;  4US9 A;  4KHA A;  2P0H A;  1C4A A;  3O96 A;  1WGG A;  3RUL A;  3HK0 A;  2BCJ A;  3PSE B;  2PW9 A;  1U2B A;  3P7Z A;  2UZS A;  5BYR A;  3AE4 B;  3NRZ A;  5JZE B;  4ZRQ A;  4MH0 E;  2K8E A;  4W9L A;  3KUC B;  2N9E B;  2JZZ A;  5LXH A;  2YF0 A;  4C80 A;  2KIE A;  1NEK B;  1AWD A;  2DHI A;  3J9C A;  4CO7 A;  2WQY B;  4EOY A;  1WG7 A;  1YQB A;  2EJ8 A;  4HEA 1;  1D6E C;  2IYB A;  2MFQ A;  2GCL A;  1SJH D;  4IKG A;  3Q3F A;  1WX9 A;  2FID A;  1TQZ A;  5C1Z A;  1I4H A;  2JXT A;  1ENF A;  3AED B;  5C3J B;  4HCP B;  1PFD A;  3QBV B;  3SV1 A;  1FCL A;  4IAP A;  3WAO A;  2Y5P A;  2PTL A;  3G9W A;  4K3B A;  1S3S G;  3CMM B;  1T3Q A;  1SXT A;  1ZYI A;  2LEK A;  2KOX A;  1F0Z A;  2E3T A;  5KQ4 A;  3ZRF A;  1P1A A;  2A4Z A;  4G0N B;  1QT9 A;  1F52 A;  2L1C A;  1V97 A;  2D4Q A;  1P3R A;  1C9F A;  4HKZ E;  2XNA C;  5EDS A;  3AMZ A;  2KTR A;  3AV8 A;  4ZRP A;  2XEW A;  1FXI A;  4XWT A;  2LHE A;  4HAU B;  3UQB A;  3F5R A;  3MFG A;  3I57 A;  1GOZ A;  2BYT A;  5MPO A;  3NZU A;  4OZA A;  2QJL A;  3RZW C;  3LDZ E;  2RDG A;  3OG5 A;  2I1J A;  3UF8 A;  1MI0 A;  2WH5 A;  2JRI B;  3ZQ4 A;  3VIA A;  4G3X B;  3TL5 A;  1UGM A;  4WSF A;  3KWV A;  1N62 A;  1DRO A;  3SR6 A;  2WP9 B;  4GDK B;  1V5T A;  2FUH B;  4P6V F;  1T6B X;  4KSL C;  3W9C B;  1PGB A;  1D4B A;  3AE1 B;  3PPA A;  1TYG B;  3L4P A;  2C60 A;  4IUM B;  2KR0 A;  1XCG A;  2DTC A;  4EZK A;  3SBG A;  5IJM A;  1S1Q B;  4P1C C;  3DCG A;  3AEG B;  2MSE D;  3AEE B;  4ILH A;  2PPH A;  3PG7 A;  3MC0 B;  2JZP A;  3AE8 B;  1RM6 C;  2W2X D;  4OW0 A;  2KN4 A;  4EMO A;  5GMV A;  3AE5 B;  4IOI E;  1WE6 A;  4WUR A;  3JSV B;  1IUE A;  1Y19 B;  2J52 A;  3TW1 A;  3PP2 A;  1SHC A;  1UBQ A;  3A9K B;  4YON A;  4LK0 M;  5C16 A;  3MC8 A;  1ACA A;  2FCM A;  2KWV B;  2SEB D;  5D6J B;  3RNB C;  1DDM A;  3PVU A;  1BTN A;  2JZ3 B;  3IT4 B;  4AS1 A;  1XO3 A;  2RNR B;  4LDT D;  1D5M C;  3V6C B;  1U5F A;  4IM0 A;  4DHZ E;  4GDK A;  3VR8 B;  4CHJ A;  1EU4 A;  4US8 A;  3PS6 A;  2KN5 A;  3U30 A;  1M94 A;  1XF5 L;  5DH9 B;  2JF5 A;  5HFY A;  4OZB A;  4MT5 A;  2OHF A;  4FJZ A;  5J3Y A;  2C7N B;  4IOY X;  4JIO U;  2KFJ A;  4JKE A;  5HE3 A;  3KUD B;  4A8X C;  2RQ1 A;  1QOB A;  1TTN A;  2IZV B;  4HLE A;  2BS4 B;  3DHG C;  4B6W A;  1XR0 B;  4Y94 A;  1LFD A;  2NCN A;  3WAM A;  4C00 A;  1P7E A;  2ON8 A;  4WJN A;  1HQR D;  2MH7 A;  4QJ3 B;  2YEP B;  2CAY A;  4LJO B;  3UGB B;  1WYG A;  2CHW A;  4FJV B;  1EAZ A;  4C7Y A;  4FAD A;  4AUQ C;  1IBX B;  3AB5 A;  4OZC A;  4PQ0 A;  4B9K A;  2D11 A;  1SSN A;  3CWI A;  4ICV A;  4HPL B;  2KK8 A;  5J18 A;  4YSY B;  3X23 A;  1NVI D;  5IRS A;  1V88 A;  4BBN F;  2RR9 A;  3PRP B;  4II3 B;  1EWY C;  2BQQ A;  1JML A;  1V5U A;  2GOW A;  2WXL A;  3ZYY X;  4Q2J A;  2V9H A;  3JVZ X;  3N1Y C;  3RCP A;  2WXN A;  3VQI A;  2BGF A;  2WWZ A;  2X18 A;  2K2U A;  1U4A A;  4TKN A;  1MPE A;  1Y8R C;  4KSK C;  2Z8L A;  4GN1 A;  3DOW A;  2NZ8 B;  1C79 A;  3H7S A;  2M14 A;  2HDE A;  2KDF B;  1WE7 A;  1E6E B;  3VRB B;  2MJE A;  1YN5 A;  2KMC A;  4WQO B;  3BYT B;  1UWM A;  1A5R A;  2V4L A;  1TS5 A;  4K3C A;  2B3A A;  4KIK A;  1EWC A;  3MJW A;  2PIA A;  5IA7 A;  1ZP0 B;  2AQ2 B;  3T8M A;  4EE2 A;  3NVZ A;  4TUU A;  2M56 B;  1FGZ A;  2LXA A;  4E71 A;  3FLV A;  2JPH A;  1MKE A;  4MM3 B;  5LNK 1;  3A98 B;  3QIJ A;  4DBB A;  3AH7 A;  2K8B A;  2LAS A;  2W82 A;  2IGG A;  1MI1 A;  2COF A;  3NOB A;  4HDO A;  2WXH A;  3JYU A;  3V5W A;  3WAP A;  2D5G A;  1TKG A;  2R2O A;  4J3O D;  4HAX B;  5HHD G;  2ROZ B;  4W9I A;  5J3Q A;  5D94 A;  1WMH B;  1ZE3 D;  2K6D B;  3DHH C;  3I5J C;  2KQ4 X;  1AQC A;  3VOQ A;  2IBI B;  4HDQ A;  4YTN B;  3PZD A;  1E5W A;  2LVO A;  4IC7 B;  2MBH A;  3TUO A;  2QHO A;  4DX9 0;  3ZDT A;  3HW2 B;  1MHX A;  3AUL A;  2NPT A;  2V3S A;  4L2Y A;  2Y3A A;  4KHB B;  3M3J A;  2VSZ A;  3FVC A;  2WXG A;  2EMS A;  1B55 A;  1X11 A;  2Y8F A;  1YX5 B;  1U27 A;  2IO2 B;  1E9M A;  1RFA A;  2CQU A;  4DXA B;  2DAF A;  5G55 A;  1K50 A;  2X8X X;  5D27 A;  3AI5 A;  5E6J A;  1U29 A;  1W1D A;  1ZUD 2;  2ROV A;  1U5E A;  1V81 A;  3ALB A;  2L8J A;  1VBG A;  2N9X A;  1FRR A;  2D9X A;  3PTF C;  3ZGZ A;  2XQN M;  1MPH A;  4TQ0 A;  1NDD A;  3AU4 A;  4W9D A;  1WI0 A;  4W9H A;  1H8C A;  2KTR B;  3NZ3 A;  3AEB B;  2KNB A;  1F2R I;  3A1Q A;  3VHT C;  2KDE B;  1QKZ A;  1FHX A;  3ENE A;  1NTV A;  3E9O A;  1AYF A;  4MH8 A;  2MJD A;  5FR3 A;  3U2S C;  2KUQ A;  2RRF A;  1GB4 A;  2Y5B B;  4Z2M B;  4KGR A;  2D9Y A;  3ODX A;  2OQB A;  4ANV A;  3TEY A;  1L6U A;  2G9H D;  2IY1 B;  3PRM B;  1I4G A;  3QX1 A;  2KCJ A;  3P4S B;  1H4R A;  2GUM A;  3TEW A;  1DDV A;  2K25 A;  3APD A;  4PS7 A;  4W9F A;  1VD2 A;  2NPT B;  2N9L A;  2H7E A;  4FN2 A;  2C5L C;  2MP2 A;  1C1Y B;  2QCZ A;  4DXF A;  4MEL A;  3DVG Y;  2LJI A;  3O65 B;  1WZ0 A;  5E6O A;  5HE2 A;  1ET6 A;  1UWX A;  3VTU A;  4HJK A;  3U7Z A;  3ZXR A;  1V89 A;  4MSM B;  4QJ4 B;  1RRB A;  5CX3 A;  1D5Z C;  2N1W A;  4EZL A;  2PLP A;  4M0W A;  2K1F A;  2KWU B;  4A5K A;  3P2B A;  2RUK B;  1FFU A;  2KX3 A;  2VKI A;  1TKE A;  5EFX A;  1G6J A;  2D07 B;  3Q3O C;  2DX5 B;  3AJ4 A;  1L5P A;  4WWP A;  1U5D A;  2H89 B;  1V5M A;  3VFK A;  2J59 M;  1VBH A;  2ZNV B;  4A6K A;  2KMA A;  2L0T A;  1T0Q C;  4UDU C;  3R2I A;  4M02 A;  3VR9 B;  4CSQ A;  3VUX A;  1WH3 A;  4A6F A;  2IGH A;  4GDL A;  1NTI A;  3ZRC A;  3GYP A;  4PYU A;  3Q6B A;  1L0Y B;  3SDL C;  2LD9 A;  1PQS A;  1BT0 A;  4OVU A;  2E2X A;  1WJN A;  5G2N A;  3B2G A;  1KLG D;  2G45 B;  3B08 A;  1UUP A;  4WJO A;  3AU5 A;  4E3C A;  1SJE D;  3HHM A;  4EFO A;  2RPQ A;  3GE3 C;  4EEW A;  1ZC4 B;  2DX1 A;  3K9P B;  4JKD A;  1FD6 A;  1FAO A;  2IY0 B;  2MHJ A;  3KWL A;  4FJY A;  1W1H A;  1WGK A;  1YOV B;  5E6N A;  2I5F A;  4BFR A;  2WXO A;  2I1K A;  3ZNZ B;  5DPW A;  2LVQ A;  2QKL A;  1WXS A;  5KHO A;  4MGI E;  4RGO S;  3ZVR A;  5C23 A;  2GMI C;  3MP9 A;  1XT9 B;  3DBH I;  2D9W A;  2MDX A;  2CR5 A;  5HKH A;  2KAN A;  2SAK A;  2ZCB A;  2DLW A;  2R0D A;  5D3V A;  5JHB A;  1ET9 A;  2AQ3 B;  4YSX B;  4JK9 A;  4TV3 A;  1FCC C;  3TIX A;  3P6A A;  3PV1 A;  4M8N A;  3T06 A;  3TMP B;  1GJZ A;  3B77 A;  2GBK A;  3VRA B;  1N5X A;  3R66 C;  2IFS A;  4JK7 A;  1TZO A;  2WLB A;  3IVF A;  4A3O A;  2J0M A;  4FXC A;  1EVH A;  2KWD A;  1WM2 A;  1WXA A;  1NI2 A;  2K8H A;  1XD4 A;  1WJ6 A;  1PUT A;  3ZJU A;  1TS4 A;  3IAM 1;  4HCN B;  4H2A A;  1L7Y A;  1QQG A;  2DLB A;  2DYB A;  1WMH A;  4IFS A;  1E7P B;  4K2O A;  3AXC A;  4NNJ B;  1E8Y A;  2MP2 B;  4RCO A;  2MBB B;  2IND C;  2GLS A;  3VTV A;  4F7G A;  3EFU A;  3GB1 A;  1K5D B;  2D9V A;  2BYV E;  1DIK A;  4RFB A;  5CLL B;  3HIZ A;  3FEH A;  3ZUN A;  4IWO A;  4F7Z A;  5AEK B;  2QSD A;  1DBH A;  4PK1 A;  2J42 A;  2L05 A;  4ZYS A;  1V80 A;  1Y5O A;  4PYZ A;  2W3S A;  4ACF A;  4A90 A;  4X57 B;  4ANX A;  1UNR A;  4LLG M;  1XLQ A;  4CYE A;  1XKE A;  1L4Z B;  2DNF A;  3IXS A;  1W1G A;  1OQQ A;  4IM2 A;  2D3C A;  1MK7 B;  4K1R B;  2MCN B;  1FEH A;  3TEZ A;  2KT7 A;  4I6N B;  1FNV A;  4S17 A;  2G3Q B;  3W2D A;  4REZ A;  3HVD A;  3N7C A;  2W9N A;  1YN3 A;  2DYN A;  2ZZP B;  3CXB B;  1NEN B;  3IG3 A;  3VH4 B;  3MPX A;  1J8C A;  1PFJ A;  3GZN I;  2MA9 B;  1WM3 A;  1BML C;  4AQ7 A;  3MHS D;  2I38 A;  2ZJD A;  2DIK A;  4WIP A;  4HVB A;  1QOG A;  3ZW3 A;  5L95 C;  4FBJ B;  5JLJ B;  4A55 A;  3M63 B;  2A5U A;  5HE0 A;  1OTR B;  1KOT A;  1PDX A;  2BYF A;  3APC A;  4WJP A;  2P0D A;  2LOX A;  1ZXH A;  1X1F A;  2LBB A;  3UZT A;  1MVK A;  3QAQ A;  1V2Y A;  1E7U A;  3BK1 A;  1RRP B;  4HHV A;  4JL9 A;  2KLG A;  1LO5 D;  2EMT A;  2L00 B;  3B1L X;  1GNU A;  2DZI A;  1YMH E;  2D3B A;  3BVZ A;  3Q14 C;  3QA8 A;  1LGR A;  4C7Z A;  4D6W A;  4B6H A;  4GOU A;  1WJU A;  4RF0 A;  1HZ5 A;  1SE9 A;  1WXM A;  3NY5 A;  1KC7 A;  2FUG 1;  5IN7 A;  1KM7 A;  4JX1 C;  5JVL A;  1WSP A;  3KYC D;  2TSS A;  2XK5 A;  2FJU B;  3FC4 A;  1HBK A;  3MDB C;  2H88 B;  2EEL A;  2ELB A;  5CTR C;  1WGR A;  4DQO C;  1P98 A;  3PHW B;  5JHA A;  4YXD B;  3QWM A;  2GS0 A;  3NW8 A;  2BB5 A;  2E6X A;  3WAN A;  3ML4 A;  1M4V A;  1FB8 A;  2KX0 A;  2OOB B;  3AE9 B;  1FO4 A;  2VRW B;  3LJ3 A;  3QC8 B;  3ZVV A;  2C7H A;  3RNA C;  2RPV A;  2AEH A;  1DYQ A;  1TBE A;  2DYQ A;  4RH6 A;  4GNK B;  3EGR A;  1N3H A;  1MK9 B;  3LJU X;  1WGD A;  4NAW A;  3HVZ A;  3KZ1 A;  1RAX A;  3PLV A;  3A8P A;  2N7J A;  3APF A;  2K0P A;  3PSC A;  4PNK A;  5DHA B;  2WU2 B;  4WAF A;  2CRF A;  5DCN A;  2K22 A;  4EJN A;  1VLB A;  4WJ7 A;  2N4F A;  2QKM A;  3TFM A;  4BVU C;  2DYM A;  2XK5 B;  4OT1 A;  2GB1 A;  4A3P A;  4DIX A;  2UYZ B;  1J7A A;  4RM8 A;  1JAL A;  3QQ8 B;  2L76 A;  5LON B;  3L17 A;  2W2W A;  2Y8G A;  4DXG A;  3AEF B;  5JP4 A;  2YT1 A;  1NYQ A;  4KVG B;  4JKC A;  1OQR A;  4HRS A;  5E6P A;  4WWN A;  3E9P A;  4MSQ B;  4NJ6 A;  4ZHP A;  4FHK A;  5EE9 A;  3AE6 B;  5AZH A;  3QJZ A;  2FCN A;  2RDB C;  2CHZ A;  2X38 A;  1P9D U;  1VDV A;  3MTN B;  4JKF A;  2YT0 A;  1L0X B;  2KKC A;  2CB8 A;  2Z14 A;  4KDI C;  1T77 A;  1EF1 A;  3PZ8 A;  1V1P A;  2V1Y A;  2YT2 A;  3N9Y C;  1PLS A;  3KQ4 A;  3RN9 C;  4C4V B;  4N6E B;  3GE8 C;  2K3U A;  3GOE A;  2DA0 A;  3QCA A;  1IPG A;  2FAZ A;  4GMX B;  5BYQ A;  2C9W B;  3ZTC A;  3FIL B;  3DXE A;  5DIF B;  2HTH B;  3OJ3 A;  1YIW A;  3M1I B;  2KAC A;  3WCQ A;  1ZM0 A;  4MAC A;  1I4X A;  3RUI B;  4PT5 A;  1VZ6 A;  4HB3 B;  3DBL B;  2JXX A;  4IG7 B;  2INC C;  3RYT A;  2DHK A;  3ZNH B;  4F8C B;  2KZR A;  3P1M A;  4WWO A;  3KH0 A;  2OED A;  4A6Q A;  2J0K A;  2BS3 B;  3BK2 A;  1XLP A;  3ULC A;  2HD5 B;  2KDB A;  1F77 A;  4LDT B;  4LNO A;  4NQK E;  2KJH B;  1FGY A;  3ZLZ A;  2R82 A;  1WXQ A;  2AL6 A;  3ABV B;  5G5H A;  3CIK A;  3L0W B;  5LG4 B;  2K9X A;  1UEF A;  3U12 A;  4D2K A;  3B2F A;  2PE9 A;  2D10 A;  5D2M B;  3BJI A;  4AJW A;  4KZ0 A;  5DPS A;  2RD0 A;  3NVY A;  3NSU A;  2COD A;  2KJR A;  3DBR I;  1JW9 D;  3EPY A;  2GBR A;  3R7R A;  1GB1 A;  3NJT A;  1V49 A;  2WXM A;  2KQS A;  2N0S B;  3ML8 A;  4KDL B;  2NBV B;  4LTU A;  1YQ3 B;  2XN9 C;  3DQV A;  1F9J A;  4WAA A;  1D5X C;  2MW5 A;  4ITK A;  1OMW A;  4ARC A;  4HRO A;  2JRH A;  3FP5 A;  1K53 A;  2C7M B;  3N20 C;  4LJP B;  4LNF A;  2LZ6 A;  3F0W A;  2ADZ A;  1E8X A;  5HE1 A;  2M17 A;  1WGH A;  4BBN C;  3B9J A;  1WVH A;  3SFD B;  4JWU C;  2KDI A;  2RGF A;  4RNA A;  2KC2 A;  1Q5W B;  1LQB A;  3JW0 X;  4R3D A;  5EE0 A;  2PE6 B;  4CHM A;  2CJN A;  1YQ4 B;  4TSS A;  4J6I A;  5IAA C;  1V5O A;  4PS8 A;  1CMX B;  4W9K A;  3HUI A;  3RCZ A;  2D3A A;  3RNG C;  4K81 A;  2X0S A;  1B1Z A;  2W55 A;  4JE3 B;  2I2Y A;  1UF0 A;  2JX5 A;  1E8Z A;  1TJ6 A;  5FI1 A;  4C4V A;  4GB9 A;  2RSU A;  5AUI A;  1I4Q A;  3N30 A;  3H8H A;  1B9R A;  1EF5 A;  4B0M A;  3RNC C;  3EUB 2;  3DVN U;  3ZJT A;  2LRW A;  3H7P B;  3PVW A;  3PZ7 A;  4YL8 A;  1RWS A;  2CJO A;  2Z59 A;  3KRW A;  3C19 A;  2DHJ A;  2BVC A;  3UQA A;  2G4S A;  2EKI A;  1HA5 A;  4BKT A;  1U5G A;  1FHW A;  2WXQ A;  4M01 A;  2DBY A;  1TY0 A;  2JYE A;  2LGD A;  1M7E A;  4ILJ A;  3P4P B;  3OHM B;  2JU6 X;  1ROE A;  3QHT A;  5D3X A;  4TQ1 A;  2MX2 A;  1MG4 A;  4WQM A;  3VUY A;  2DZJ A;  1FXT B;  1AAR A;  2NS5 A;  3L08 A;  4TMA B;  4B95 A;  2Q5W D;  3HIE A;  3ODO A;  1EGX A;  3U52 E;  1WGU A;  1SE4 A;  2R2Y A;  5D3W A;  1WXV A;  3NS8 A;  3NUH B;  4XE0 A;  2KD0 A;  3Q3N C;  1OQN A;  4K2P A;  3DWM A;  4Z2N A;  2DZK A;  3LXF A;  4KGS A;  5TR5 A;  2J53 A;  5BO4 B;  2HJ1 A;  1WF9 A;  1SF0 A;  2W2X C;  2YRY A;  4KIK B;  2ZVN A;  2K39 A;  1MJD A;  4A20 A;  2OJR A;  3D8F A;  3DWG C;  3W1Y A;  1R4N B;  2WHI A;  4EKU A;  1V1P B;  2KYW A;  2LRU A;  2COC A;  4M8M A;  1WJM A;  1QF6 A;  4KV2 A;  4MJS A;  2DZM A;  4LCD E;  4GMV A;  3Q3J A;  3KSY A;  1XLO A;  3SNH A;  4JQW C;  3EHV A;  1T0R C;  3QK0 A;  5CLQ B;  1WJ4 A;  1E8W A;  2ZPY A;  3H9D A;  2ELA A;  3GYO A;  4AOF A;  3W5V B;  5D3D A;  4BKS D;  4C56 C;  2Y7B A;  3PEG A;  1YN4 A;  4N9F 4;  3DPD A;  4FLH A;  3ML9 A;  3AM9 A;  1J7B A;  2N9K A;  3EC8 A;  3E9S A;  1VCB A;  2KWC A;  1V9J A;  4ANU A;  4DDG D;  2V76 A;  3N1X C;  4P7I A;  1SE2 A;  2B76 B;  3S2A A;  4L23 A;  3QAR A;  1L2N A;  1QIL A;  2CU3 A;  2ZVO A;  4JKB A;  1WRD B;  2K6Q A;  2GCJ A;  3P4Q B;  3P63 A;  5IKC M;  3DXC A;  3R3M A;  3AN1 A;  2LI5 A;  2BWE S;  2BKF A;  4P16 A;  1R4M I;  3TO1 A;  1QOF A;  3NVW A;  2L0F A;  1DOX A;  1ZVR A;  1FOE A;  4HAZ B;  4XDC A;  1V1O A;  1AW7 A;  5CHV C;  2MJ3 A;  3IBE A;  4MJS B;  3I9V 1;  3RNF C;  3OAW A;  4CHK A;  1L4D B;  4O1N A;  5BMI A;  1WYW B;  1WIA A;  2KGX B;  4BOZ B;  3D8D A;  3UI3 A;  2N9P C;  1KI1 B;  1GGO A;  2KAJ A;  3VXW A;  3V60 A;  1NI3 A;  3EEC A;  1K51 A;  1C76 A;  1QZE A;  3A4R A;  4HWI B;  2JSV X;  1TIF A;  4KGT A;  2NMB A;  3JSV A;  1FFV A;  3BVG A;  3EA6 A;  2J7Q B;  3RNE C;  1NU2 A;  4WVF B;  1YJI A;  1T0S C;  5JHG A;  2CU1 A;  3DDC B;  4DHJ D;  2WDR B;  5L83 A;  2UVM A;  2LUL A;  2PZ1 A;  4QJ5 B;  4ILG B;  1I4P A;  2PKO A;  4NZL B;  2FNJ B;  3ZKJ C;  4PS3 A;  1SIJ A;  2L83 A;  1KH0 A;  4M00 A;  5KQ1 A;  1LW3 A;  2K8C A;  3M62 B;  4GLS C;  3RMK C;  2YEP F;  3BIN A;  2M1M A;  2V4I B;  1WGQ A;  2KXJ A;  1WI1 A;  3T3O A;  3D8E A;  1I7H A;  2JWZ A;  4IDI A;  3LB8 C;  1WX8 A;  2W3R A;  4W9G A;  1FHO A;  2CKH B;  2FE8 A;  1X05 A;  2MBO A;  4MGY E;  2YVC A;  1JRO A;  3B0A A;  1MIZ B;  5J2R A;  4HB0 B;  4AJY B;  1ZDX A;  4KX6 B;  4BAX A;  1Q0W B;  3HQC A;  2MWS B;  3BII D;  2R09 A;  1TJE A;  3H6N A;  1WY8 A;  2JUO A;  2LVP A;  3AE7 B;  2K49 A;  4ASW C;  2JYT A;  2GBM A;  3A33 B;  2KDM A;  2WGS A;  3PHX B;  5D7G A;  2ZW0 A;  2LGY A;  3ETR A;  5KHQ A;  1XX0 A;  3NHE B;  2H7D A;  3ODW A;  1J7C A;  3DBR B;  1SGH A;  5GOW B;  3ZO5 B;  2R2Q A;  2FIF A;  3A58 A;  2V3N A;  4GSW A;  1C4P A;  2LUE A;  3NZS A;  1V61 A;  3MC9 A;  4ZDV A;  4HJG E;  2ZEQ A;  1CJE A;  3SFE B;  2RMM A;  5IP4 D;  2YS3 A;  3A9K A;  1E90 A;  2Z0O A;  4I6L B;  4WH4 A;  3SYX A;  4ZOH C;  5C2T B;  4ANW A;  4HPM B;  4DX8 A;  3O13 A;  4XWW A;  3V05 A;  3N1Z C;  3HM6 X;  2LGI A;  1MAI A;  2AWT A;  3KVF B;  1EUV B;  2GJY A;  2YS1 A;  4ZRK A;  1X86 A;  1E10 A;  2WXR A;  4XZ4 A;  1AWE A;  3PO0 A;  1XOD A;  5DPT A;  5LXI B;  3I3T B;  4L6E A;  1KTK A;  4BZA A;  4OVZ A;  4FA6 A;  3SHQ A;  4P1B C;  4XWX A;  2MRP A;  2IYD B;  3E9L A;  4MT7 A;  4MM3 A;  2P0F A;  2VZK B;  3OWE B;  4HXD A;  2BKR B;  2N0Y A;  1UPQ A;  4JLC A;  3CIR B;  1JWM D;  5HI1 A;  2FBW B;  3KUZ A;  5FKA C;  5IOI A;  2NBV A;  3AE2 B;  1X1G A;  3ZIM A;  1XLN A;  2FJL A;  2L1A A;  3NG0 A;  1UGJ A;  3TVV A;  1C78 A;  1TGZ B;  4FUL A;  4F7U P;  4A6H A;  2GRI A;  2IO0 B;  1KFY B;  3R2T A;  2N7D A;  3H1U A;  2D2Q A;  2G4D B;  1KRH A;  5M4Y B;  1WWT A;  1J0W A;  3V61 A;  1EM7 A;  1XQQ A;  1YD8 U;  2DKQ A;  3PT2 B;  1QQR A;  5HG2 A;  2L2I A;  3ZNI D;  3E56 A;  1FM0 D;  4K7U A;  1ZOY B;  1UNQ A;  1EU3 A;  2ASQ A;  1BWN A;  1N63 A;  2L3Z A;  2GBJ A;  3TEX A;  3ULB A;  1WZ3 A;  3ZNG C;  2BW2 A;  1BUI C;  1DGJ A;  1TY2 A;  2ABD A;  3SEB A;  2WXF A;  2QMT A;  2FCQ A;  4JWS C;  2I5C A;  5GXG B;  5BYS A;  2QC8 A;  2LG1 A;  1A70 A;  4LNK A;  1GG3 A;  1FMA D;  4MEM A;  5FR6 A;  2V0G A;  4D0N B;  1X1M A;  2W54 A;  2LFI A;  4DHJ B;  1XCT L;  2Z59 B;  2KUP A;  1VR9 A;  1ZGU B;  4HPP A;  4XDD A;  3PGE A;  3A1Q B;  1HE8 A;  2KQ7 A;  3BY4 B;  1SE3 A;  2IGD A;  2V3P A;  4NPN A;  2BWF A;  2BPS A;  1D3Z A;  3DHI C;  5AZG A;  1HEZ E;  3L16 A;  2DKP A;  1TT5 B;  4EUT A;  2LUM A;  2WDT B;  1SEB D;  1SB3 C;  3C0R B;  3L54 A;  2DX5 A;  1JCK B;  2WXI A;  2KFK A;  3FIL A;  1HZ6 A;  1Q67 A;  2L32 A;  3CF6 E;  2BF8 B;  5C79 A;  3BZD B;  1BTK A;  2UZR A;  2KHW B;  5D3I B;  1IGD A;  1E0Z A;  2MQJ A;  1J0G A;  1STE A;  2NTS A;  3ECI A;  3KW5 B;  3HSA A;  2ZW1 A;  3T3N A;  4YT0 B;  4DK5 A;  1J19 A;  3U7D A;  1ZC3 B;  1Y56 A;  3Q2A C;  2G1E A;  1NBF C;  3K9O B;  1DYN A;  1WFY A;  2N23 A;  5JH5 C;  4K7S A;  1CZP A;  1Q10 A;  3RFZ B;  2INP E;  1WGY A;  1GAQ B;  4XX5 A;  2DWQ A;  3VUW A;  2IPK D;  2LOZ A;  1KZG A;  2LYD A;  2KVR A;  1RLF A;  2LGX A;  1PYW D;  3BVM A;  1ZDV A;  4OHJ A;  4RMA A;  2M0A A;  1BXT A;  1VRA B;  2BBC A;  2RDH A;  5TSS A;  4HAV B;  1JRP A;  3DCX A;  3AEC B;  4USA A;  4G50 A;  2Q13 A;  3V62 A;  2WXP A;  3IAS 1;  3CSF A;  4BOS C;  3QWZ B;  2MBE A;  3URY A;  1KLV A;  1WR6 E;  2L7R A;  2O6V B;  2GBN A;  1KJT A;  3N32 A;  3DBL I;  1YJ1 A;  2FJ9 A;  2UU7 A;  3A9J A;  3RD2 A;  2LHD A;  4NJ7 A;  4NJC A;  2MWN B;  3A8Q A;  1UD7 A;  2CS4 A;  4M0W B;  3NWA A;  4LNI A;  1T5X D;  4NAW B;  4HB2 B;  3V6E B;  3VH3 B;  4YWG G;  3NVV A;  1GPX A;  4RM9 A;  2HE7 A;  4JKG B;  1KZ7 A;  4MGZ E;  2AQ1 B;  2JT4 B;  2ZKM X;  2IDY A;  3VAW A;  3P42 A;  4HSI A;  1I2H A;  2BB6 A;  4DBG A;  4OVV A;  4HK2 A;  1RFK A;  3SD5 A;  1DOI A;  2Z13 A;  2FCS A;  1XEE A;  3FAH A;  1ZPS A;  4TYZ A;  5DI9 B;  1MFW A;  2IO3 B;  3VVW B;  3RI7 C;  4ARI A;  1MG8 A;  2QDF A;  4MGK E;  2RLO A;  2RGN B;  1I35 A;  1OQY A;  2DYO A;  3SU8 X;  4YTM B;  1ST7 A;  2RVB B;  4KHB A;  3Q8E A;  1E7V A;  1FPY A;  1Z5S B;  5FK9 C;  4MK0 A;  4NSW A;  3R7Q A;  2FDQ A;  3ZJV A;  3R8B A;  3FM8 C;  1WX7 A;  3TBL D;  5J17 A;  1WRI A;  2WDQ B;  1TKY A;  4II2 B;  2MLB A;  1GC7 A;  4L1B A;  4WJQ A;  5BMH A;  2ACZ B;  1XXG A;  2BYE A;  4N59 A;  4DDI D;  1Z87 A;  1FXA A;  1K5G B;  2KC1 A;  1DOY A;  2M38 A;  5EE1 A;  2RSG A;  4C0A A;  4ZRJ A;  4QXA B;  2HRJ A;  4HAY B;  2AL3 A;  4AWJ A;  1ZXI A;  3DBH B;  1AN8 A;  1HTQ A;  1K52 A;  1ESF A;  3IHP C;  4JPS A;  4KZC A;  1OGW A;  3DVG X;  2ONQ A;  2KMM A;  5LLI A;  3L10 B;  2O2V B;  4JGH B;  2Y5C A;  2KLC A;  1IRS A;  5FI0 A;  2N1V A;  3PRZ A;  4E74 A;  2REX A;  3GS2 A;  4A9A A;  3Q8F A;  5LOP B;  2WXJ A;  4ZHO A;  3Q3M C;  2Z0Q A;  3KY9 A;  2BTE A;  4NAM A;  5H8Y E;  1P5T A;  1QLB B;  1TS2 A;  3ENB A;  2KFK B;  3Q69 A;  2OTX A;  4ZYN A;  4W9J A;  4KAX B;  1JWS D;  2NVU I;  1LB1 A;  1NYR A;  4XGA B;  1UPR A;  4GZU A;  3OAN A;  1P6S A;  1L6V A;  2M4N A;  1MIX A;  2AX5 A;  4K7W A;  1OY2 A;  4HKQ A;  4GIV A;  3DXD A;  4FHJ A;  1GUA B;  4A6F B;  4GDL B;  1FNW A;  1N5W A;  1UH6 A;  2QIE B;  4BKG A;  2KVZ A;  3HM3 A;  2VRR B;  1LM8 B;  1GC6 A;  2PVG C;  2P8V A;  5BMG A;  2Z0E B;  2KO3 A;  3D32 A;  1I7A A;  5AUK A;  1IBX A;  3SUZ A;  2R61 A;  2PJH A;  1KBL A;  4ZRI A;  4IM3 A;  5DHF B;  1JDE A;  2M0X A;  4OSN A;  3EFC A;  2WNM A;  1V8C A;  1C3T A;  2DEN B;  5C6R A;  2JWU A;  3W5U B;  2OJW A;  1NTY A;  2BS2 B;  4MDK E;  4L1R A;  1UEL A;  1T0Y A;  1ISN A;  3HRD D;  5EE3 A;  5AZF A;  5L81 A;  4BKS A;  2WU5 B;  1N6Z A;  3X0W A;  4DWF A;  1R7S A;  5JHH A;  2CY5 A;  5DPR A;  3WIM A;  2WS3 B;  1RYJ A;  2N7E A;  2MKR A;  2ICI A;  4IW0 A;  3WAL A;  1FRD A;  4XC2 A;  1TXD A;  4S0R A;  1XCQ L;  2WDV B;  3M95 A;  1Z2M A;  4N58 A;  2CY4 A;  2YSZ A;  3KYD D;  1ACC A;  1I4R A;  2O6V A;  1JQ4 A;  2CHX A;  3IFW B;  3TSS A;  2M19 A;  2IO1 B;  3N3K B;  2HTM E;  4JKA A;  2DFK A;  3T9L A;  5KCV A;  1TZ1 A;  3E66 A;  1R4M B;  4F7H A;  1PMS A;  3Q8A A;  3I63 C;  2COA A;  3GZN B;  1BAK A;  2YLM A;  4KHO A;  1DDW A;  4JKG A;  2LJ5 A;  1P7F A;  2EKE C;  1TS3 A;  2PMV A;  1RJ2 A;  2ZPN A;  1KLU D;  5I2M A;  2NBW B;  2GI9 A;  4JK8 A;  3U8Z A;  3KRX A;  1OFF A;  4I6P A;  1Q1O A;  3PRE A;  1LXD A;  1IP9 A;  5T8I A;  3LYY A;  3NWD A;  3UIP B;  1FNU A;  1ZKH A;  5C5B A;  1IYF A;  1CK1 A;  1WR1 A;  2M8S A;  2KJ6 A;  2UWQ A;  3TCA A;  2EC1 A;  2NBU A;  5CHF A;  1UBI A;  3BWU D;  3PVL A;  3OJ4 B;  2AYO B;  4YTP B;  3Q8C A;  4EZJ A;  1VJK A;  3RZF A;  2JY6 A;  2Z4D A;  2J0J A;  1YNT E;  3VTW A;  2K5P A;  3CST A;  2JVC A;  3MHZ A;  3FKY A;  4WWM A;  2D9Z A;  2ZNV C;  1F2R C;  1HB8 A;  1R4N I;  2ZCC A;  5J3T A;  2BT6 A;  4AP4 C;  4F1S A;  1MHH E;  4B0E A;  4HAT B;  4NQL B;  4RGN A;  1EO6 A;  5D3Y A;  3L13 A;  3W1S A;  4YSZ B;  3SO6 A;  3IT6 B;  2YS5 A;  1C4C A;  2NR2 A;  4LNN A;  1H10 A;  2G35 A;  1M7R A;  3AEA B;  4QAY A;  1FIQ A;  4K17 A;  1YX6 B;  4CQN A;  1I42 A;  3NWF A;  4JKH A;  3C8Y A;  4GU2 A;  1JRU A;  1UZX B;  4GXB A;  2LMC A;  2WXK A;  1ZSQ A;  1L0V B;  2D3G A;  1PGA A;  1SIF A;  3WA0 A;  1V6E A;  4MY6 A;  1UNS A;  4W9E A;  1WJ1 A;  2L52 A;  4NY0 A;  5H92 C;  2K00 A;  2JP2 A;  2MBQ A;  5JXV A;  5CHW A;  3MJ5 A;  1XD3 B;  2O6V D;  2NTT A;  4HB4 B;  3AE3 B;  2COP A;  2QEJ C;  2PEA A;  3A9J B;  1QC6 A;  2VZK D;  2IJ0 A;  5C5B B;  3TJP A;  3V3X A;  3ZTD A;  2K2J A;  3ZDM C;  2HTH A;  3A4S C;  2WYQ A;  3KLS X;  4GPT B;  3NS1 A;  1CQV A;  1JWA D;  2KIG A;  2VH1 A;  2WX1 A;  3SBT A;  3VDZ A;  4BBK A;  4KKJ A;  3U4E G;  3PLU A;  1N61 A;  1QOA A;  4XYC A;  5IO9 A;  3WYF B;  2DHZ A;  4G11 A;  1HB6 A;  1NVL A;  4GOC A;  3UIN B;  4ICU A;  4GGQ A;  1F1H A;  1SBB B;  1YJJ A;  1P0R A;  2Z0D B;  3DBS A;  2LGS A;  2INN E;  1HTO A;  1JWU D;  4H8S A;  2LWP A;  4HAW B;  2VH2 A;  1UNP A;  1P3Q U;  4RF1 A; 
#chains in the Genus database with same CATH homology
 1OEY A;  1V5P A;  3DVN V;  2DN6 A;  4DHZ B;  3OLM D;  3RT3 B;  4URK A;  2WX0 A;  2LXC A;  3H7P A;  2XBB C;  1ZW7 A;  3UIO B;  4IWQ A;  1OEY J;  2KTF A;  2O2V A;  1V86 A;  2HJ8 A;  2LKO A;  4W9C A;  2Z0P A;  3ONS A;  2DAJ A;  1K8R B;  3W1S C;  4IWP A;  3FSS A;  4KHA A;  2P0H A;  3O96 A;  1WGG A;  3RUL A;  3HK0 A;  2BCJ A;  3PSE B;  1U2B A;  3P7Z A;  2UZS A;  5JZE B;  4MH0 E;  4W9L A;  3KUC B;  2N9E B;  2JZZ A;  5LXH A;  2YF0 A;  2DHI A;  4CO7 A;  4EOY A;  1WG7 A;  1YQB A;  2EJ8 A;  2IYB A;  2MFQ A;  2GCL A;  3Q3F A;  1WX9 A;  2FID A;  1TQZ A;  5C1Z A;  4HCP B;  3QBV B;  3SV1 A;  4IAP A;  3WAO A;  3G9W A;  1S3S G;  3CMM B;  2KOX A;  5KQ4 A;  3ZRF A;  1P1A A;  2A4Z A;  4G0N B;  2L1C A;  2D4Q A;  1P3R A;  5EDS A;  2KTR A;  2XEW A;  4HAU B;  3UQB A;  3F5R A;  3NZU A;  3RZW C;  3LDZ E;  2I1J A;  3UF8 A;  2WH5 A;  2JRI B;  3VIA A;  3TL5 A;  4G3X B;  1UGM A;  4WSF A;  1DRO A;  4GDK B;  1V5T A;  2FUH B;  4KSL C;  3PPA A;  2C60 A;  4IUM B;  1XCG A;  2DTC A;  4EZK A;  3SBG A;  5IJM A;  1S1Q B;  3DCG A;  2MSE D;  4ILH A;  2PPH A;  3PG7 A;  2W2X D;  4EMO A;  5GMV A;  1WE6 A;  3JSV B;  1Y19 B;  3TW1 A;  3PP2 A;  1SHC A;  1UBQ A;  3A9K B;  4YON A;  5C16 A;  1ACA A;  2FCM A;  2KWV B;  5D6J B;  1DDM A;  3PVU A;  1BTN A;  2JZ3 B;  4LDT D;  2RNR B;  3V6C B;  1U5F A;  4IM0 A;  4DHZ E;  4GDK A;  4CHJ A;  3PS6 A;  2KN5 A;  3U30 A;  1M94 A;  5DH9 B;  2JF5 A;  4FJZ A;  5J3Y A;  2C7N B;  4IOY X;  4JIO U;  2KFJ A;  4JKE A;  5HE3 A;  3KUD B;  2RQ1 A;  1TTN A;  2IZV B;  4HLE A;  4B6W A;  1XR0 B;  4Y94 A;  1LFD A;  2NCN A;  3WAM A;  4WJN A;  2CAY A;  4LJO B;  3UGB B;  2CHW A;  4FJV B;  1EAZ A;  4FAD A;  4AUQ C;  4PQ0 A;  4B9K A;  2D11 A;  4ICV A;  4HPL B;  2KK8 A;  5J18 A;  3X23 A;  1V88 A;  4BBN F;  2RR9 A;  3PRP B;  4II3 B;  1V5U A;  2GOW A;  3JVZ X;  3RCP A;  3VQI A;  2BGF A;  2WWZ A;  2X18 A;  2K2U A;  1U4A A;  4TKN A;  1Y8R C;  4KSK C;  4GN1 A;  3DOW A;  2NZ8 B;  3H7S A;  2M14 A;  2KDF B;  1WE7 A;  2KMC A;  4WQO B;  1A5R A;  2V4L A;  2B3A A;  4KIK A;  3MJW A;  5IA7 A;  3T8M A;  4TUU A;  1FGZ A;  2LXA A;  4E71 A;  3FLV A;  2JPH A;  1MKE A;  3A98 B;  3QIJ A;  4DBB A;  2K8B A;  2LAS A;  2COF A;  3NOB A;  4HDO A;  3JYU A;  3V5W A;  3WAP A;  2R2O A;  4HAX B;  2ROZ B;  4W9I A;  5J3Q A;  5D94 A;  1WMH B;  2K6D B;  1AQC A;  3VOQ A;  2IBI B;  4HDQ A;  3PZD A;  1E5W A;  2LVO A;  4IC7 B;  2MBH A;  2QHO A;  4DX9 0;  3ZDT A;  3HW2 B;  3AUL A;  2NPT A;  2V3S A;  4KHB B;  3M3J A;  2VSZ A;  2EMS A;  1B55 A;  1X11 A;  2Y8F A;  1YX5 B;  1U27 A;  2IO2 B;  1RFA A;  2CQU A;  4DXA B;  2DAF A;  5G55 A;  5D27 A;  3AI5 A;  1U29 A;  1W1D A;  2ROV A;  1U5E A;  1V81 A;  3ALB A;  2L8J A;  1VBG A;  2N9X A;  2D9X A;  3PTF C;  2XQN M;  1MPH A;  4TQ0 A;  1NDD A;  3AU4 A;  4W9D A;  1WI0 A;  4W9H A;  1H8C A;  2KTR B;  2KNB A;  3A1Q A;  3VHT C;  2KDE B;  1FHX A;  3ENE A;  1NTV A;  3E9O A;  2Y5B B;  4Z2M B;  2D9Y A;  3ODX A;  2OQB A;  4ANV A;  2IY1 B;  3PRM B;  3QX1 A;  2KCJ A;  1H4R A;  1DDV A;  2K25 A;  3APD A;  4PS7 A;  4W9F A;  1VD2 A;  2NPT B;  2H7E A;  4FN2 A;  2C5L C;  2MP2 A;  1C1Y B;  4MEL A;  3DVG Y;  3O65 B;  1WZ0 A;  5E6O A;  5HE2 A;  3VTU A;  4HJK A;  1V89 A;  4MSM B;  1RRB A;  5CX3 A;  2N1W A;  4EZL A;  2K1F A;  2KWU B;  4A5K A;  3P2B A;  2RUK B;  2KX3 A;  2VKI A;  5EFX A;  1G6J A;  2D07 B;  2DX5 B;  3AJ4 A;  4WWP A;  1U5D A;  1V5M A;  3VFK A;  2J59 M;  1VBH A;  2ZNV B;  4A6K A;  2KMA A;  2L0T A;  3VUX A;  1WH3 A;  4A6F A;  4GDL A;  1NTI A;  3ZRC A;  3GYP A;  4PYU A;  3SDL C;  2LD9 A;  1PQS A;  1BT0 A;  4OVU A;  2E2X A;  1WJN A;  5G2N A;  2G45 B;  3B08 A;  4WJO A;  3AU5 A;  4E3C A;  3HHM A;  4EFO A;  2RPQ A;  4EEW A;  1ZC4 B;  2DX1 A;  3K9P B;  4JKD A;  1FAO A;  2IY0 B;  4FJY A;  1W1H A;  5E6N A;  2I5F A;  4BFR A;  2I1K A;  3ZNZ B;  5DPW A;  2LVQ A;  2QKL A;  1WXS A;  5KHO A;  4MGI E;  3ZVR A;  5C23 A;  2GMI C;  1XT9 B;  3DBH I;  2D9W A;  2MDX A;  2CR5 A;  5HKH A;  2KAN A;  2ZCB A;  2DLW A;  2R0D A;  5D3V A;  5JHB A;  1P3Q U;  4JK9 A;  4TV3 A;  3TIX A;  3P6A A;  3PV1 A;  4M8N A;  3T06 A;  3TMP B;  1GJZ A;  2GBK A;  3R66 C;  2IFS A;  4JK7 A;  4A3O A;  3IVF A;  2J0M A;  1EVH A;  1WM2 A;  1WXA A;  1NI2 A;  2K8H A;  1XD4 A;  1WJ6 A;  4HCN B;  1L7Y A;  1QQG A;  2DYB A;  1WMH A;  4IFS A;  4K2O A;  3AXC A;  4NNJ B;  1E8Y A;  2MP2 B;  2MBB B;  3VTV A;  4F7G A;  3EFU A;  1K5D B;  2D9V A;  2BYV E;  1DIK A;  5CLL B;  3HIZ A;  3FEH A;  3ZUN A;  4IWO A;  4F7Z A;  5AEK B;  1DBH A;  2L05 A;  1V80 A;  1Y5O A;  4PYZ A;  4X57 B;  4ANX A;  1UNR A;  4CYE A;  1XKE A;  1W1G A;  4IM2 A;  1MK7 B;  4K1R B;  2MCN B;  4I6N B;  2G3Q B;  3N7C A;  2W9N A;  2DYN A;  2ZZP B;  3CXB B;  3IG3 A;  3VH4 B;  3MPX A;  1J8C A;  1PFJ A;  3GZN I;  2MA9 B;  1WM3 A;  3MHS D;  2ZJD A;  2DIK A;  4HVB A;  3ZW3 A;  4FBJ B;  5JLJ B;  3M63 B;  2A5U A;  5HE0 A;  1OTR B;  1KOT A;  2BYF A;  3APC A;  4WJP A;  2P0D A;  2LOX A;  1X1F A;  2LBB A;  3UZT A;  3QAQ A;  1V2Y A;  1E7U A;  1RRP B;  4HHV A;  4JL9 A;  2KLG A;  2L00 B;  2EMT A;  3B1L X;  1GNU A;  2DZI A;  3QA8 A;  4B6H A;  1WJU A;  1SE9 A;  1WXM A;  3NY5 A;  1KC7 A;  1KM7 A;  5JVL A;  3KYC D;  2XK5 A;  1HBK A;  3MDB C;  5CTR C;  2ELB A;  1WGR A;  1P98 A;  3PHW B;  5JHA A;  3QWM A;  2GS0 A;  3WAN A;  3ML4 A;  1FB8 A;  2KX0 A;  2OOB B;  2VRW B;  3LJ3 A;  3QC8 B;  3ZVV A;  2C7H A;  2AEH A;  1TBE A;  2DYQ A;  1N3H A;  1MK9 B;  3LJU X;  1WGD A;  4NAW A;  3KZ1 A;  1RAX A;  3PLV A;  3A8P A;  3APF A;  3PSC A;  4PNK A;  5DHA B;  2CRF A;  5DCN A;  4EJN A;  4WJ7 A;  2N4F A;  2QKM A;  3TFM A;  4BVU C;  2DYM A;  2XK5 B;  4A3P A;  2UYZ B;  4RM8 A;  3QQ8 B;  2L76 A;  5LON B;  3L17 A;  2W2W A;  2Y8G A;  5JP4 A;  2YT1 A;  4KVG B;  4JKC A;  5E6P A;  4WWN A;  3E9P A;  4MSQ B;  4NJ6 A;  4FHK A;  5AZH A;  3QJZ A;  2FCN A;  2CHZ A;  1P9D U;  3MTN B;  4JKF A;  2YT0 A;  2KKC A;  2CB8 A;  4KDI C;  1EF1 A;  2V1Y A;  1PLS A;  3GOE A;  2DA0 A;  3QCA A;  1IPG A;  2FAZ A;  4GMX B;  2C9W B;  3ZTC A;  3DXE A;  5DIF B;  2HTH B;  3OJ3 A;  1YIW A;  3M1I B;  1ZM0 A;  3RUI B;  4HB3 B;  2JXX A;  4IG7 B;  3RYT A;  2DHK A;  3ZNH B;  4F8C B;  2KZR A;  4WWO A;  3KH0 A;  2J0K A;  2HD5 B;  3ULC A;  2KDB A;  4LDT B;  4NQK E;  2KJH B;  1FGY A;  3ZLZ A;  2R82 A;  2AL6 A;  3CIK A;  3L0W B;  1UEF A;  2PE9 A;  2D10 A;  5D2M B;  3BJI A;  4AJW A;  4KZ0 A;  5DPS A;  2RD0 A;  3NSU A;  2COD A;  2KJR A;  3DBR I;  3EPY A;  2GBR A;  3R7R A;  1V49 A;  2KQS A;  3ML8 A;  4KDL B;  2NBV B;  3DQV A;  1F9J A;  4WAA A;  2MW5 A;  1OMW A;  2JRH A;  3FP5 A;  2C7M B;  4LJP B;  2LZ6 A;  3F0W A;  2ADZ A;  1E8X A;  5HE1 A;  2M17 A;  1WGH A;  4BBN C;  1WVH A;  2KDI A;  2RGF A;  2KC2 A;  1Q5W B;  1LQB A;  3JW0 X;  2PE6 B;  4CHM A;  4J6I A;  5IAA C;  1V5O A;  4PS8 A;  1CMX B;  4W9K A;  3RCZ A;  4K81 A;  2X0S A;  1E8Z A;  1TJ6 A;  5FI1 A;  4GB9 A;  2RSU A;  3N30 A;  1EF5 A;  3DVN U;  2LRW A;  3H7P B;  3PVW A;  4YL8 A;  3KRW A;  2DHJ A;  3UQA A;  2G4S A;  4BKT A;  1U5G A;  1FHW A;  2LGD A;  1M7E A;  4ILJ A;  3QHT A;  5D3X A;  4TQ1 A;  2MX2 A;  3VUY A;  2DZJ A;  1FXT B;  1AAR A;  2NS5 A;  3L08 A;  4B95 A;  3ODO A;  1EGX A;  1WGU A;  1WXV A;  5D3W A;  3NS8 A;  2KD0 A;  1OQN A;  4K2P A;  4Z2N A;  2DZK A;  5TR5 A;  5BO4 B;  1WF9 A;  2W2X C;  2YRY A;  4KIK B;  2ZVN A;  2K39 A;  4A20 A;  2OJR A;  3D8F A;  3W1Y A;  4EKU A;  4M8M A;  2LRU A;  2COC A;  1WJM A;  4KV2 A;  4MJS A;  2DZM A;  4LCD E;  4GMV A;  3Q3J A;  3KSY A;  3SNH A;  4JQW C;  3EHV A;  3QK0 A;  5CLQ B;  1WJ4 A;  1E8W A;  2ZPY A;  3H9D A;  2ELA A;  3GYO A;  4AOF A;  4BKS D;  2Y7B A;  3PEG A;  4N9F 4;  3DPD A;  4FLH A;  3ML9 A;  3EC8 A;  1VCB A;  2KWC A;  1V9J A;  4ANU A;  4DDG D;  2V76 A;  4P7I A;  3S2A A;  1L2N A;  3QAR A;  2ZVO A;  4JKB A;  1WRD B;  2K6Q A;  2GCJ A;  3DXC A;  3R3M A;  2LI5 A;  2BWE S;  2BKF A;  1R4M I;  3TO1 A;  2L0F A;  1ZVR A;  1FOE A;  4HAZ B;  5CHV C;  3IBE A;  4MJS B;  4CHK A;  3OAW A;  1WYW B;  1WIA A;  2KGX B;  4BOZ B;  3D8D A;  2N9P C;  1KI1 B;  1GGO A;  3VXW A;  3V60 A;  3EEC A;  1QZE A;  3A4R A;  4HWI B;  2NMB A;  3JSV A;  2J7Q B;  1NU2 A;  4WVF B;  5JHG A;  2CU1 A;  3DDC B;  4DHJ D;  5L83 A;  2UVM A;  2LUL A;  2PZ1 A;  4ILG B;  2FNJ B;  3ZKJ C;  4PS3 A;  5KQ1 A;  1LW3 A;  2K8C A;  3M62 B;  3BIN A;  2M1M A;  1WGQ A;  2KXJ A;  1WI1 A;  3D8E A;  2JWZ A;  1WX8 A;  4W9G A;  1FHO A;  2CKH B;  1X05 A;  2MBO A;  4MGY E;  2YVC A;  3B0A A;  1MIZ B;  5J2R A;  4HB0 B;  4AJY B;  1Q0W B;  3HQC A;  2MWS B;  2R09 A;  3H6N A;  1WY8 A;  2JUO A;  2LVP A;  4ASW C;  2GBM A;  3A33 B;  3PHX B;  5D7G A;  2LGY A;  5KHQ A;  1XX0 A;  3NHE B;  2H7D A;  3ODW A;  1SGH A;  5GOW B;  3ZO5 B;  2R2Q A;  2FIF A;  4GSW A;  2LUE A;  3NZS A;  1V61 A;  4ZDV A;  2ZEQ A;  2YS3 A;  3A9K A;  1E90 A;  2Z0O A;  4I6L B;  3SYX A;  4ANW A;  4HPM B;  4DX8 A;  3HM6 X;  1MAI A;  2AWT A;  3KVF B;  1EUV B;  2GJY A;  2YS1 A;  4ZRK A;  1X86 A;  4XZ4 A;  1AWE A;  1XOD A;  5DPT A;  5LXI B;  3I3T B;  4L6E A;  4FA6 A;  3SHQ A;  4XWX A;  2IYD B;  2MRP A;  3E9L A;  4MT7 A;  4MM3 A;  2P0F A;  4HXD A;  2BKR B;  2N0Y A;  1UPQ A;  4JLC A;  3KUZ A;  1X1G A;  3ZIM A;  2FJL A;  3TVV A;  4FUL A;  1TGZ B;  4F7U P;  4A6H A;  2IO0 B;  2N7D A;  3H1U A;  2D2Q A;  2G4D B;  1J0W A;  3V61 A;  1XQQ A;  1YD8 U;  3PT2 B;  2DKQ A;  2L2I A;  3ZNI D;  4K7U A;  1UNQ A;  2ASQ A;  1BWN A;  2L3Z A;  2GBJ A;  3ULB A;  1WZ3 A;  3ZNG C;  2ABD A;  2FCQ A;  2I5C A;  2LG1 A;  1GG3 A;  4MEM A;  5FR6 A;  4D0N B;  1X1M A;  4DHJ B;  2Z59 B;  2KUP A;  1ZGU B;  3PGE A;  3A1Q B;  1HE8 A;  2KQ7 A;  3BY4 B;  4NPN A;  2BWF A;  2BPS A;  1D3Z A;  5AZG A;  3L16 A;  2DKP A;  4EUT A;  2WDT B;  3C0R B;  3L54 A;  2DX5 A;  2KFK A;  1Q67 A;  3CF6 E;  2BF8 B;  5C79 A;  1BTK A;  2UZR A;  2KHW B;  2MQJ A;  1J0G A;  3ECI A;  3KW5 B;  4DK5 A;  1J19 A;  3U7D A;  1ZC3 B;  1NBF C;  3K9O B;  1DYN A;  1WFY A;  2N23 A;  5JH5 C;  4K7S A;  1WGY A;  4XX5 A;  3VUW A;  2LOZ A;  1KZG A;  2LYD A;  2KVR A;  1RLF A;  2LGX A;  4RMA A;  4HAV B;  4G50 A;  2Q13 A;  3V62 A;  3CSF A;  4BOS C;  3QWZ B;  2MBE A;  1KLV A;  1WR6 E;  2L7R A;  2O6V B;  2GBN A;  1KJT A;  3N32 A;  3DBL I;  1YJ1 A;  2FJ9 A;  3RD2 A;  3A9J A;  4NJ7 A;  2MWN B;  3A8Q A;  1UD7 A;  2CS4 A;  4M0W B;  4NAW B;  4HB2 B;  3V6E B;  3VH3 B;  4RM9 A;  2HE7 A;  4JKG B;  1KZ7 A;  4MGZ E;  2JT4 B;  3VAW A;  1I2H A;  4DBG A;  4OVV A;  4HK2 A;  3SD5 A;  2FCS A;  4TYZ A;  5DI9 B;  2IO3 B;  3VVW B;  1MG8 A;  4MGK E;  2RLO A;  2RGN B;  1I35 A;  1OQY A;  2DYO A;  3SU8 X;  1ST7 A;  2RVB B;  1E7V A;  1Z5S B;  4MK0 A;  4NSW A;  3R7Q A;  2FDQ A;  3FM8 C;  1WX7 A;  3TBL D;  5J17 A;  4II2 B;  2MLB A;  1GC7 A;  4WJQ A;  2BYE A;  4DDI D;  1Z87 A;  1K5G B;  2KC1 A;  2M38 A;  2RSG A;  4C0A A;  4ZRJ A;  2HRJ A;  4HAY B;  2AL3 A;  4AWJ A;  3IHP C;  4KZC A;  1OGW A;  3DVG X;  5LLI A;  3L10 B;  2O2V B;  4JGH B;  2KLC A;  1IRS A;  5FI0 A;  2N1V A;  3PRZ A;  4E74 A;  2REX A;  5LOP B;  2Z0Q A;  3KY9 A;  1P5T A;  3ENB A;  2KFK B;  2OTX A;  4ZYN A;  4W9J A;  4KAX B;  2NVU I;  1LB1 A;  1UPR A;  4GZU A;  3OAN A;  1P6S A;  2M4N A;  1MIX A;  4K7W A;  1OY2 A;  4GIV A;  3DXD A;  4FHJ A;  1GUA B;  4A6F B;  4GDL B;  1UH6 A;  4BKG A;  3HM3 A;  2VRR B;  1LM8 B;  1GC6 A;  2P8V A;  2Z0E B;  2KO3 A;  3D32 A;  1I7A A;  3SUZ A;  2PJH A;  1KBL A;  4ZRI A;  4IM3 A;  5DHF B;  1JDE A;  2M0X A;  1C3T A;  2DEN B;  5C6R A;  1NTY A;  4MDK E;  1UEL A;  1T0Y A;  1ISN A;  5AZF A;  5L81 A;  4BKS A;  3X0W A;  4DWF A;  5JHH A;  2CY5 A;  5DPR A;  3WIM A;  2N7E A;  2MKR A;  4IW0 A;  3WAL A;  4XC2 A;  1TXD A;  3M95 A;  1Z2M A;  2CY4 A;  2YSZ A;  3KYD D;  2O6V A;  2CHX A;  3IFW B;  2IO1 B;  3N3K B;  4JKA A;  2DFK A;  3T9L A;  5KCV A;  1TZ1 A;  3E66 A;  4F7H A;  1PMS A;  2COA A;  1BAK A;  2YLM A;  4KHO A;  1DDW A;  4JKG A;  2LJ5 A;  2EKE C;  1RJ2 A;  2ZPN A;  2NBW B;  4JK8 A;  3U8Z A;  3KRX A;  4I6P A;  1Q1O A;  3PRE A;  1LXD A;  1IP9 A;  3UIP B;  1ZKH A;  5C5B A;  1IYF A;  1WR1 A;  2M8S A;  2KJ6 A;  2UWQ A;  3TCA A;  2EC1 A;  2NBU A;  5CHF A;  1UBI A;  3OJ4 B;  3PVL A;  2AYO B;  4EZJ A;  3RZF A;  2JY6 A;  2J0J A;  3VTW A;  3CST A;  2JVC A;  2D9Z A;  2ZNV C;  1HB8 A;  1R4N I;  2ZCC A;  4AP4 C;  5J3T A;  4F1S A;  4HAT B;  4NQL B;  1EO6 A;  5D3Y A;  3L13 A;  3W1S A;  3SO6 A;  2YS5 A;  2NR2 A;  1H10 A;  2G35 A;  1M7R A;  1I42 A;  4K17 A;  1YX6 B;  4JKH A;  4GU2 A;  1JRU A;  1UZX B;  4GXB A;  1ZSQ A;  2D3G A;  1SIF A;  3WA0 A;  1V6E A;  4MY6 A;  4W9E A;  1WJ1 A;  4NY0 A;  2K00 A;  2JP2 A;  2MBQ A;  5CHW A;  1XD3 B;  2O6V D;  4HB4 B;  2COP A;  2PEA A;  3A9J B;  1QC6 A;  5C5B B;  3TJP A;  3ZTD A;  2K2J A;  3ZDM C;  2HTH A;  3A4S C;  2WYQ A;  4GPT B;  2WX1 A;  3SBT A;  3VDZ A;  4BBK A;  3PLU A;  3WYF B;  2DHZ A;  4G11 A;  1HB6 A;  1NVL A;  4GOC A;  3UIN B;  4ICU A;  4GGQ A;  1P0R A;  2Z0D B;  3DBS A;  4H8S A;  2LWP A;  4HAW B;  1UNP A;  5L95 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...