4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine kinase 2-beta
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
2LUEA 3D8EA 3V5WA 3CIKA 3AJ4A 1RRBA 4WQOB 3ZNID 2E2XA 4GGQA 1AWEA 1FGYA 2YSZA 1EO6A 1OQYA 2IY1B 3IFWB 1Z87A 3WYFB 2BGFA 2KO3A 2N1VA 3ALBA 2LVOA 5LONB 2MFQA 1TZ1A 4MGYE 4FN2A 4XC2A 2IFSA 5CLQB 5JZEB 1SIFA 1WE7A 2K39A 1WG7A 2P0FA 2RGNB 1DYNA 3H7PA 4PS7A 4PS8A 3TJPA 5LXIB 1QC6A 2A5UA 2LRUA 2LRWA 1Y5OA 4HAYB 2WDTB 1X1FA 1KJTA 3CF6E 3VTUA 4XZ4A 2YS5A 4AP4C 4EKUA 2Q13A 2PE9A 1Z2MA 2L2IA 3ZNHB 3M95A 4EOYA 2FUHB 1I7AA 3QA8A 4FLHA 2DKQA 2LASA 3K9PB 3DXCA 4HDQA 2P8VA 2KD0A 4B6HA 4NQKE 2GMIC 5CTRC 4EFOA 1P6SA 1QQGA 1WE6A 2JZZA 3ML9A 1X1GA 4KIKA 2HRJA 3VDZA 5J18A 3KSYA 1IP9A 2JRHA 3DVGY 2YF0A 1PQSA 2NZ8B 1KI1B 2PJHA 4HPLB 3KW5B 5E6NA 4ZYNA 2KX3A 4JQWC 1UNPA 2KWUB 1ZC3B 1WH3A 4WWNA 1FXTB 1V2YA 3VAWA 3TW1A 2K8CA 5D3XA 2LVPA 3I3TB 3WALA 4FADA 4GN1A 2FIDA 1SE9A 2DTCA 3MDBC 1WX7A 2CS4A 1WF9A 2KTRA 2OTXA 2PEAA 5CHWA 3PTFC 3ZNZB 2JP2A 4A6KA 3QAQA 3CSTA 2KDBA 4D0NB 1GUAB 2K8HA 1VD2A 2LBBA 2V76A 5DH9B 3X23A 1DDMA 5JP4A 3L16A 4E74A 2MWNB 4GDKB 1WGQA 4XX5A 5KHQA 2H7EA 2KGXB 1P9DU 1EF5A 1WR6E 2KWCA 5C5BA 2DKPA 3F0WA 4J6IA 2ZNVC 3B1LX 1WIAA 3L0WB 2MBEA 3C0RB 4I6PA 1UNRA 3M3JA 1D3ZA 3DXEA 1ZSQA 2K2JA 3GZNI 5D27A 2K6DB 5J3TA 4K81A 2LI5A 4W9GA 1WI0A 2IYDB 4HJKA 2ROVA 2MBOA 4GDLA 4DDID 3AU4A 2DHJA 4C0AA 1WY8A 3ZO5B 5D3VA 5DIFB 2C7HA 1LFDA 4AWJA 4H8SA 3WAMA 3M63B 3N3KB 3W1SA 4A3OA 4KZ0A 4ANXA 1U5GA 2YVCA 1HBKA 1UBIA 2KDFB 2KLGA 2RR9A 4HB0B 2ZPNA 4Y94A 3W1SC 4MSMB 2KQ7A 2FDQA 2P0HA 3SYXA 2LULA 3KRWA 3ULCA 2REXA 3PHXB 3ZRCA 4DHJB 2Y7BA 1WVHA 2M14A 2VRWB 3VQIA 3RZWC 1NU2A 1TTNA 3VFKA 2C7NB 5D3YA 1UEFA 3TFMA 3EC8A 3QX1A 2NBVB 1E8YA 5DCNA 3APCA 2GCLA 1NBFC 3M62B 5D94A 1XD4A 2AL3A 2BKFA 5AEKB 2R0DA 4TKNA 1ZC4B 1GJZA 1K5DB 2C5LC 2KJ6A 2K00A 1V5OA 2N9PC 2O6VA 3ZKJC 4HHVA 5C16A 2ASQA 4A3PA 2H7DA 1WRDB 2KDIA 2UWQA 3PV1A 3QBVB 2AYOB 2HTHB 1V9JA 4NY0A 2KTFA 4P7IA 1OMWA 3L08A 2O6VB 4MDKE 3VUYA 4Z2MB 3ONSA 5D7GA 1GC7A 1ZVRA 3ODOA 2ZCBA 2J7QB 3OLMD 3BJIA 4YONA 4N9F4 3UZTA 3JSVB 2CHXA 5IJMA 1K5GB 1WGUA 2D9YA 3QWMA 3SUZA 2DHKA 2IY0B 4LCDE 3RCZA 3WANA 2HE7A 2RLOA 4BKSA 2EC1A 1H10A 2N7EA 2K25A 2JF5A 3RT3B 4B6WA 4FA6A 5JLJB 4PQ0A 2NPTB 4KHBB 3H7SA 1N3HA 1V5MA 3R3MA 2D10A 4LJOB 2N4FA 2NVUI 4MK0A 4ZRJA 2CHWA 2I5FA 4PYUA 1R4MI 2G3QB 4TV3A 1WGYA 4KSLC 4ZDVA 3SHQA 4URKA 2Y5BB 2LGYA 2KC2A 2YLMA 2XBBC 3N32A 4HXDA 2PE6B 2D3GA 2LXAA 2EMSA 4F7ZA 1PFJA 2J0MA 4YL8A 1V5UA 5G2NA 2DAJA 2FJ9A 1WXMA 2BF8B 3QWZB 3ZDMC 1YD8U 4AUQC 4BOSC 3NY5A 2K2UA 2BWFA 2D9VA 3CXBB 2RGFA 3L10B 5JHBA 4FJYA 5HE3A 4F7GA 3AI5A 3KUCB 3L54A 1FB8A 4HDOA 4ANWA 3P6AA 3PG7A 4GDKA 3PRZA 1OQNA 3ODXA 2DHZA 2JY6A 2JWZA 2L0TA 1YX6B 3OAWA 2EMTA 1ZKHA 3DPDA 5CHVC 2G45B 1UPRA 2N9EB 4GOCA 1KZ7A 3ZRFA 2A4ZA 3APDA 1UELA 2R2QA 2G4DB 3D8FA 2KHWB 4WSFA 2IYBA 4GMVA 1BAKA 3PPAA 2D9ZA 3VVWB 5DPTA 1J0GA 2LD9A 3V6CB 3WA0A 2KJHB 1WM3A 3A9JA 1KOTA 4EZKA 4IAPA 4TYZA 2K1FA 3A4SC 4PNKA 1MK9B 2X18A 1X11A 3NSUA 2BPSA 2BWES 2FIFA 2K6QA 1TJ6A 2YS3A 2DX5B 4BOZB 1TXDA 2KOXA 1YQBA 3HW2B 3GYOA 2DYNA 4NPNA 2OJRA 3X0WA 2MCNB 2I5CA 4W9IA 2DHIA 3EHVA 5AZHA 5FI0A 3QC8B 1FOEA 1V88A 3KUZA 1IPGA 3RYTA 2RUKB 1E8ZA 2ELAA 3FSSA 2UYZB 3DXDA 4II2B 4DXAB 2QKMA 2MP2A 4EEWA 1NTIA 1WJ6A 1PMSA 2KX0A 1RAXA 2ZJDA 3R7QA 3VXWA 2MDXA 1TQZA 2ZNVB 2JXXA 1C1YB 1LXDA 1LM8B 4IM3A 2RNRB 1V49A 3SDLC 1VCBA 5L83A 3ZIMA 4DBBA 1MIZB 2OQBA 3KH0A 4K7UA 2MP2B 2FCMA 2NBUA 1BTKA 5DHAB 3VH4B 4IC7B 1ZGUB 5HKHA 1WX8A 3ZLZA 2UZRA 1P0RA 3TCAA 3P7ZA 2KMCA 2M0XA 1L2NA 5DI9B 2DZJA 4GDLB 2B3AA 1I42A 3PVUA 2MBBB 1XX0A 2M38A 4KV2A 2BCJA 4ZRIA 1RRPB 3TVVA 1LQBA 4JLCA 2WX0A 2J0KA 4HATB 3DQVA 4W9EA 4BBNC 4NNJB 4CHMA 1P3RA 5KQ1A 2FCSA 4W9JA 3ENEA 1EAZA 1UD7A 2N23A 5D3WA 4TQ1A 2LGXA 4IUMB 2KTRB 2D07B 1OTRB 3V61A 1FHXA 1WX9A 3UF8A 2QHOA 4W9KA 3O96A 1E8WA 3FEHA 4WJNA 4W9CA 4GZUA 4AOFA 4TQ0A 2LYDA 2DZIA 1UH6A 2IO1B 2MQJA 4IM2A 1WI1A 4WWOA 3S2AA 1FHWA 3UINB 2DX1A 1WJ1A 2G35A 1E90A 2NMBA 1WJMA 1EUVB 4K2PA 2BKRB 5HE1A 1WMHA 2GBKA 2LJ5A 2LVQA 3NS8A 5CHFA 3VHTC 4GU2A 5AZGA 1Q67A 4DHJD 2VKIA 4KIKB 4W9DA 4BKTA 4I6NB 3QCAA 5DHFB 1WR1A 2AWTA 2NS5A 5CX3A 2N9XA 4MGIE 3BINA 2KZRA 2D2QA 3PSEB 4A5KA 1OEYJ 3L17A 4II3B 4RMAA 1SHCA 4NSWA 1WMHB 5L81A 3DBLI 2LXCA 3QARA 1WXVA 2KQSA 2RPQA 1TBEA 2MBQA 3HQCA 2KVRA 1P98A 1MIXA 3ZW3A 1Q1OA 1U5FA 5DPRA 3F5RA 4JGHB 1NTYA 2G4SA 2L8JA 3ECIA 1W1GA 2GBNA 2WH5A 2MSED 3QIJA 2KCJA 3ZDTA 2BYEA 4MGKE 1UNQA 3G9WA 1X05A 4GPTB 1WGHA 3EFUA 3VUXA 1G6JA 1H4RA 1Y8RC 4RM9A 3UIOB 3TL5A 3AU5A 4BKSD 2KK8A 4FHJA 2L1CA 1PLSA 2COAA 3W1YA 4HAXB 5C79A 2HD5B 1HB6A 2KFKB 2XEWA 4AJYB 4NAWB 5BO4B 2EJ8A 4HAUB 5J3QA 5J3YA 2Y8FA 1Q5WB 2KFJA 1Q0WB 2ZVNA 3DOWA 3VTVA 4G11A 3ML4A 4MY6A 2YT0A 4ANUA 3IG3A 4K1RB 3LJUX 3NOBA 4X57B 4IM0A 1WZ3A 1DDWA 2Z0OA 2L00B 3T8MA 1MK7B 3WIMA 1UPQA 4IFSA 2O6VD 4HAVB 4MT7A 2JT4B 3A4RA 2CR5A 3CSFA 4CYEA 4HPMB 5JHHA 1W1DA 5L95C 1WGRA 1HB8A 1S3SG 5AZFA 4IOYX 5IA7A 3PVWA 1FGZA 2P0DA 2FJLA 4NAWA 3UQBA 3A8PA 2L7RA 1M94A 2MX2A 1RJ2A 5IAAC 3HM3A 1ACAA 4DHZE 4XWXA 3N7CA 5G55A 2Z0PA 1NTVA 2KLCA 4M8NA 5EDSA 2DYOA 4K17A 3PSCA 2RSGA 3DVNV 3PEGA 1X86A 3H6NA 4GSWA 3TO1A 3KYCD 3U8ZA 4ICUA 4MELA 5C23A 4DBGA 3ZUNA 2CY4A 1DROA 2N0YA 2JPHA 3A98B 4GXBA 2KNBA 3O65B 1CMXB 3PHWB 5TR5A 3PVLA 1UZXB 4W9HA 1ZW7A 1FAOA 2CB8A 2J59M 1WJNA 2ABDA 3CMMB 3IBEA 4ZRKA 1V80A 1B55A 4MEMA 3UGBB 2KMAA 1NI2A 3ZTDA 2XK5B 2OOBB 3UIPB 4RM8A 4E3CA 4IW0A 2FCNA 2BYVE 2MRPA 1MKEA 4HCNB 4IWPA 3SD5A 4B95A 1YX5B 2CQUA 2CRFA 3QK0A 4FBJB 1I35A 4MJSB 3ODWA 4EZLA 2C9WB 4BVUC 4EJNA 2FAZA 3JSVA 3RD2A 1GG3A 2MWSB 2FCQA 1DDVA 4A6FA 4AJWA 4FJZA 2C7MB 3MPXA 3A9KA 4FJVB 1RLFA 1AARA 4KHOA 2DYBA 2JRIB 2W9NA 3NZSA 3FM8C 4G50A 2GJYA 3B0AA 5DPWA 1XT9B 3DVGX 4LDTB 1SGHA 2COCA 4G3XB 1DBHA 3SNHA 2O2VA 2XK5A 2ZCCA 4HVBA 4DK5A 1XQQA 1E7VA 2CHZA 2I1JA 2CY5A 2DLWA 4Z2NA 3A9JB 3HIZA 3H7PB 1U4AA 5E6PA 1XR0B 2NBWB 4CO7A 3P2BA 4MJSA 2LZ6A 3OJ3A 2WWZA 4HCPB 3DVNU 1WJ4A 3KY9A 5JH5C 2O2VB 2N7DA 2VRRB 1KLVA 3ZVRA 1BT0A 5HE2A 2MBHA 3VTWA 2KJRA 2DAFA 4FHKA 1FHOA 2UZSA 1TGZB 1X1MA 3IVFA 2ADZA 2YT1A 2RSUA 3PLUA 3LDZE 3HHMA 1U29A 1U5DA 1ZM0A 2C60A 2RD0A 1XKEA 2XQNM 1F9JA 2M17A 3MHSD 5JHAA 4KAXB 1KM7A 3D8DA 3AULA 4EUTA 1A5RA 5J17A 1Y19B 4JIOU 2JZ3B 2K8BA 3AXCA 3SU8X 3QHTA 2YRYA 1ISNA 3PS6A 4OVUA 2DA0A 1T0YA 4TUUA 2D4QA 1V5TA 3KVFB 1K8RB 4F1SA 2ELBA 4A6HA 2D9WA 3PREA 4A20A 1YJ1A 4BKGA 2CU1A 4MM3A 1UGMA 1U5EA 5D2MB 2LWPA 4JL9A 4I6LB 1ST7A 1GC6A 2BYFA 2V3SA 2V1YA 1P1AA 3A1QB 3OJ4B 3TMPB 3PZDA 4ASWC 3RZFA 2DYQA 3KUDB 2DX5A 2W2WA 2GOWA 4MH0E 4WJPA 5KCVA 2QKLA 4L6EA 2JVCA 1EF1A 5D6JB 2FNJB 5GOWB 2Z0DB 1W1HA 3SO6A 5KQ4A 4KHAA 2DZMA 2Z59B 4ICVA 4E71A 3U7DA 2M1MA 2V4LA 4ANVA 2KWVB 3V6EB 3FLVA 4HWIB 3DCGA 1I2HA 3QQ8B 2MKRA 4WAAA 2LG1A 4M8MA 3SV1A 3EPYA 2Z0EB 3JVZX 1E8XA 4HAWB 2KANA 1WJUA 2ZZPB 3B08A 1U2BA 3IHPC 3L13A 1WXAA 2L05A 5LXHA 1WYWB 2R2OA 3A1QA 2YS1A 4GMXB 2RVBB 3PLVA 2LOZA 2KFKA 1NVLA 2ZVOA 4NJ6A 1E7UA 1Z5SB 2ZPYA 2WYQA 1KZGA 2N1WA 2HTHA 3V60A 4BFRA 2ROZB 1QZEA 4W9FA 5CLLB 1HE8A 2IO3B 2R09A 1XD3B 3GOEA 1WZ0A 5GMVA 5JHGA 1JRUA 3RCPA 1R4NI 4DWFA 1WGGA 1BTNA 2L3ZA 3KZ1A 4W9LA 5KHOA 2IBIB 2KN5A 4F8CB 5LOPB 1OY2A 4HLEA 2Z0QA 4NQLB 4M0WB 2LGDA 4A6FB 4GB9A 3H1UA 4KSKC 1V6EA 2COPA 1LW3A 1V61A 4KDLB 3NZUA 2W2XD 5DPSA 5LLIA 5HE0A 3V62A 3ZNGC 5E6OA 1C3TA 3T9LA 1L7YA 4KDIC 2NPTA 3FP5A 4PS3A 4IG7B 1EGXA 5EFXA 4CHJA 4FULA 4PYZA 3TIXA 4DHZB 3BY4B 3M1IB 4WVFB 4OVVA 4HAZB 4DX90 2LOXA 2DENB 1V86A 2IO0B 3KYDD 3WAPA 4F7HA 3PT2B 4KZCA 2MW5A 2PPHA 4KVGB 3VH3B 4GIVA 2DFKA 1OEYA 4F7UP 4MGZE 3U30A 3WAOA 1M7RA 2COFA 3QJZA 2M4NA 4HB2B 4K2OA 3RUIB 3UQAA 4BBNF 4NJ7A 1YIWA 3D32A 1LB1A 1S1QB 2VSZA 4WWPA 2L76A 3DBRI 1WM2A 3Q3FA 2L0FA 3TBLD 1WGDA 2EKEC 3LJ3A 2IZVB 2RQ1A 1M7EA 2KC1A 3MTNB 1BWNA 2LKOA 3HK0A 4IWQA 5C5BB 2MA9B 4DX8A 2HJ8A 1NDDA 1XODA 3RULA 2I1KA 2CKHB 2KKCA 1P5TA 1J8CA 3PRPB 1XCGA 3DBHI 3JYUA 2DZKA 4WJOA 1E5WA 2KDEB 1UBQA 2GBRA 3DBSA 4CHKA 3T06A 3A9KB 4G0NB 1V89A 1EVHA 2W2XC 2J0JA 1MG8A 3A8QA 2Y8GA 2GBJA 2KXJA 2ZEQA 4B9KA 2UVMA 1H8CA 4MSQB 4EZJA 3PRMB 5C1ZA 1WXSA 3PP2A 1RFAA 1OGWA 1V5PA 4BBKA 4WJQA 4K7WA 3APFA 3EECA 3ZVVA 2DYMA 3A33B 1GNUA 1IYFA 2NCNA 3VOQA 2GBMA 2CODA 1MAIA 5FI1A 2MLBA 1AQCA 3NHEB 2JUOA 4LJPB 1J19A 2AEHA 3KRXA 4HB3B 2D11A 5C6RA 3PGEA 4LDTD 3VUWA 2DN6A 4HB4B 1WFYA 2IO2B 3VIAA 2M8SA 2GCJA 2WX1A 2NR2A 3OANA 3N30A 3R7RA 1V81A 1J0WA 2D9XA 3Q3JA 3JW0X 3GYPA 4WJ7A 3R66C 4EMOA 5FR6A 3K9OB 4HK2A 5J2RA 3MJWA 1U27A 2GS0A 2AL6A 1P3QU 1IRSA 3ULBA 3DDCB 3H9DA 3HM6X 4IWOA 3ZTCA 2PZ1A 1MPHA 2CAYA 3ML8A 4K7SA 4DDGD 2KUPA
chains in the Genus database with same CATH superfamily
3ZNID 1PGXA 1AYFA 4Q2JA 3IFWB 3IHPC 2IY1B 2KO3A 3NS1A 4LNNA 3RZWC 2WQYB 2IFSA 5CLQB 2WS3B 1WG7A 2P0FA 2RGNB 4PS7A 3TJPA 3A58A 1QC6A 2A5UA 2J42A 3DHIC 1Z2MA 2FUHB 2DKQA 2LASA 4JWUC 4HDQA 2KD0A 2GMIC 1P6SA 1QQGA 3GP7A 4N58A 1KI1B 1ZDXA 4HPLB 4A55A 1RYJA 2W55A 2K8CA 5D3XA 3WALA 4FADA 1SE9A 3B2FA 1WX7A 2KTRA 1AWDA 3QAQA 3CSTA 3O13A 2K8HA 4WWMA 3X23A 2MWNB 2RDBC 2MHJA 2KWCA 5C5BA 1D4BA 4ILJA 4I6PA 1EM7A 1UNRA 1D3ZA 3GZNI 2K6DB 5J3TA 3AE2B 4JK9A 2ROVA 2MBOA 4DDID 4C0AA 1WY8A 1YN4A 3ZO5B 5D3VA 1ZYIA 4OT1A 5DIFB 2C7HA 4C4VA 5EE1A 1K51A 1TKYA 4ANXA 2KDFB 1DOIA 2NMQA 2KQ7A 4MSMB 3ZRCA 2G9HD 2M14A 2VRWB 3TFMA 1E8YA 3AM9A 3APCA 1R7SA 2GCLA 3M62B 5AEKB 2AL3A 1EU3A 3SFDB 1ZC4B 2B76B 4JKDA 4QJ5B 4A3PA 1NYQA 2INCC 2KDIA 3R2IA 3QBVB 1V9JA 3VRBB 3URYA 2O6VB 4MDKE 3ODOA 1NVID 1F2RI 1UWMA 3KWVA 4C56C 1T5XD 1QLBB 5IJMA 2D9YA 2QCZA 4LCDE 2HE7A 2RLOA 1KTKA 1H10A 2JF5A 2L1AA 1E10A 1FM0D 4KHBB 3H7SA 2NVUI 2INDC 5I2MA 2WU2B 1CZPA 2HDEA 4URKA 2Y5BB 1T0QC 1ET9A 2J0MA 2DAJA 3QWZB 1WXMA 2BF8B 3NWFA 1RWSA 1RFKA 3CXBB 5JHBA 3AI5A 1SE2A 4DXFA 4L23A 4GDKA 3RPFC 1XCQL 2PTLA 4O1NA 3ZRFA 1KZ7A 3HSAA 3APDA 2R2QA 4MACA 3D8FA 2KHWB 4WSFA 2PVOD 1J0GA 2LD9A 4M01A 1KOTA 4IAPA 4TYZA 2JU6X 3A4SC 2X18A 2BWES 4JKEA 2V4IB 2KOXA 1TXDA 2BBCA 2I5CA 2LJIA 4W9IA 5JVLA 1SXTA 2RUKB 3AEDB 2ELAA 3FSSA 1VJKA 4II2B 4UDUC 1JDEA 1ENFA 1XF5L 3C19A 1NTIA 2GI9A 1PMSA 3R7QA 3VXWA 1LXDA 1LM8B 4IM3A 2YT2A 1SSNA 3ZIMA 3HUIA 2OQBA 2WLBA 4NZLB 2PW9A 5DHAB 1FNWA 1RM6C 1WX8A 3ZLZA 2KMCA 3P7ZA 2DZJA 1I42A 4KV2A 2MBBB 2LGSA 2BCJA 1LQBA 3VAWA 4LNKA 4HATB 1P3RA 5KQ1A 1EAZA 5D3WA 4IUMB 2D07B 1WX9A 2QHOA 3FEHA 1I4PA 4W9CA 4AOFA 3PO0A 4WWOA 2IGDA 2DX1A 2G35A 2ZNVB 4JWSC 5HE1A 5AZGA 4DHJD 1FXIA 4W9DA 3QCAA 3L4PA 2N9XA 2KZRA 1WRIA 3PSEB 4L1RA 2H88B 1OEYJ 4II3B 4NSWA 3AH7A 4P1CC 2QIEB 1FFUA 4C80A 1TBEA 3HQCA 3DBLB 1U5FA 2OJWA 4JGHB 1NTYA 3AE8B 3RNFC 1C77A 1WXQA 3QIJA 3TEZA 1MG4A 2BYEA 4GPTB 3VUXA 1G6JA 1N63A 3AU5A 2COAA 1J7CA 3W1YA 1TS2A 2XEWA 5BO4B 2BT6A 2JYEA 2ZVNA 4OZCA 2IGGA 3TEWA 3ETRA 1KFYB 2X38A 2KWDA 4IM0A 3T8MA 1UPQA 2O6VD 4HPMB 1W1DA 1S3SG 4RNAA 4IOYX 2FJLA 2WXMA 2L7RA 1RJ2A 5IAAC 4C4VB 3HM3A 2JX5A 4DHZE 4XWXA 1VRAB 4M8NA 2DYOA 1X86A 1E9MA 3ZUNA 4K3BA 2N0YA 2JPHA 2KNBA 1CMXB 4W9HA 1FAOA 2CB8A 2KUQA 1WJNA 3SBTA 4ZRKA 1L5PA 4NAMA 4IWPA 4B95A 2R82A 1XXGA 3JSVA 1GG3A 2FCQA 4J3OD 4FJZA 3MPXA 2Y5PA 5MPOA 1AARA 3NZSA 5EE3A 3FILA 4G50A 3B0AA 1OQRA 3IXSA 4LDTB 2COCA 3SNHA 2D3AA 1YQ3B 3DBRB 1XQQA 2I1JA 1K53A 3AV8A 3H7PB 1U4AA 1A70A 4MJSA 4HCPB 3EA6A 1QOAA 1BT0A 2X0SA 1T3QA 1X1MA 4QXAB 1KLGD 2ADZA 2YT1A 1TGZB 2RSUA 3RNAC 3LDZE 3HHMA 1ZM0A 1ESFA 5HHDG 3AULA 1Y19B 1C4PA 4JIOU 5AUKA 4TUUA 3BWUD 3NZ3A 1K8RB 2EELA 1JROA 3PREA 4A6HA 2D9WA 3AEFB 4IOIE 1YJ1A 1TS4A 2CU1A 3BZDB 2NTSA 1ST7A 3OJ4B 1I4XA 4M02A 3TMPB 3PZDA 3ZYYX 3RZFA 2DYQA 2DX5A 2GOWA 2PVGC 5KCVA 2FNJB 4E71A 2Z59B 3ZJTA 1JWAD 1ZE3D 3V6EB 3V05A 2MKRA 4WAAA 1DGJA 2LG1A 4WURA 1TZOA 3Q14C 2ZZPB 4BAXA 1U2BA 3MC0B 5IRSA 2DIKA 1UNSA 4GMXB 3PLVA 3LB8C 2KFKA 2WDVB 2ZVOA 1Z5SB 3Q6BA 3U7ZA 3V60A 4M0WA 4LTUA 2RDGA 2R09A 1XD3B 3GOEA 1R4NI 1HZ5A 2PMVA 2KN5A 4F8CB 4HLEA 2K9XA 4A6FB 4GB9A 1V6EA 1LW3A 1V61A 1ET6A 5DPSA 2PIAA 1L7YA 2NPTA 4IG7B 4CHJA 1MPEA 3BY4B 3M1IB 1E6EB 4HAZB 1V86A 4F7HA 4XWTA 4GIVA 2DFKA 3U4EG 3U30A 2M4NA 3UQAA 3D32A 1DOYA 2L0FA 1WGDA 2EKEC 3LJ3A 4P16A 5H92C 2IZVB 1XLQA 2HJ8A 2I1KA 1FPYA 2WXKA 5HFYA 3DBHI 3DBSA 1IGCA 3A9KB 1WGKA 2J0JA 2KXJA 2Y8GA 2UVMA 4MSQB 2LMCA 1RFAA 4WJQA 1V5PA 4BBKA 3FAHA 3NJTA 1Q10A 1FRDA 2MLBA 2CODA 1AQCA 4W9KA 4LDTD 5C6RA 2R61A 1FNUA 2BQQA 1WFYA 4L2YA 3LXFA 2Z13A 2M8SA 4BZAA 3NWAA 3Q3JA 3RI7C 3JW0X 3U12A 5FR6A 1U27A 1MPHA 3E9LA 4HKQA 4K7SA 1P0RA 3AJ4A 2E2XA 4GGQA 1D5MC 3ALBA 5LONB 2GLSA 1JWMD 1F0ZA 2LRUA 3CF6E 1L0YB 2Q13A 2PE9A 3T3OA 1I7AA 2WXQA 4M00A 4B6HA 4KIKA 1ACCA 4KGTA 1PQSA 2NZ8B 1K52A 2PJHA 3KW5B 1YOVB 2KX3A 4JQWC 4K3CA 3DWMA 1V2YA 2VH2A 3TW1A 3ZGZA 3I3TB 3I9V1 3ABVB 2PEAA 1WF9A 1I4QA 4HEA1 4HSIA 1GUAB 2LBBA 5LG4B 1DDMA 3H8HA 4E74A 4XX5A 2H7EA 1WR6E 1P9DU 3Q8CA 2ZNVC 3B1LX 1FO4A 2K49A 2MBEA 2K2JA 4K81A 1I7HA 1MI0A 3J9CA 4JE3B 4GDLA 1PUTA 3AU4A 2DHJA 1N6ZA 1UWXA 1LFDA 1SJED 3W1SA 4KZ0A 1HBKA 1UBIA 2KLGA 1VZ6A 4HB0B 2RR9A 2LGIA 3ULCA 3KRWA 4DHJB 2REXA 2Y7BA 3P4RB 1CK1A 3VQIA 1ROEA 2Z4DA 2C7NB 3EC8A 3QX1A 5DCNA 2BKFA 4TKNA 1GJZA 2C5LC 1V5OA 2N9PC 3ZKJC 4HHVA 1PYWD 2IJ0A 1JALA 1WWTA 2AYOB 1C79A 3FC4A 4NY0A 5BMIA 4P7IA 1L6VA 2WU5B 2BS3B 3VUYA 3BJIA 1GGOA 2K8EA 4N9F4 3ZJVA 1WGUA 3IT6B 3WANA 3SUZA 1V97A 2ZKMX 4BKSA 2N7EA 1SJHD 5JLJB 2AQ2B 4LJOB 4ILHA 2CHWA 1R4MI 2G3QB 3MC9A 1F1HA 2PLPA 3AEAB 1R4NB 5IKCM 4HXDA 3N32A 2XBBC 2KAJA 2D3GA 2LXAA 2RDHA 4AUQC 3NY5A 2ACZB 2BWFA 1B9RA 3L54A 1HQRD 1FB8A 3PG7A 2JY6A 2JWZA 2ONQA 3OAWA 2K5PA 2EMTA 2BB5A 2IYBA 4A90A 3A9JA 4EZKA 1QQRA 4MGZE 4YTPB 2KDMA 4PNKA 2K6QA 1X11A 1IGDA 2RPVA 4BOZB 1TJ6A 1YN3A 3HW2B 2N9LA 3KUZA 3N1ZC 3RYTA 2QKMA 4EEWA 3IAM1 2KX0A 1TQZA 1C1YB 1SBBB 1YJIA 2RNRB 4DBBA 1MIZB 3KH0A 2MP2B 2FCMA 1M4VA 1ZGUB 1N60A 2M0XA 2BTEA 1L2NA 4N6EB 3PVUA 3TVVA 4W9EA 5AZHA 3DQVA 4YXDB 1TKEA 3MJ5A 2N23A 2LGXA 3HRDD 1FHXA 1DOXA 1YNTE 3O96A 5C2TB 4IM2A 1UH6A 2IO1B 2MQJA 1WI1A 1FHWA 1E90A 1WJMA 1EUVB 2LJ5A 1WMHA 3B2GA 3NS8A 3VHTC 4A6QA 1Q67A 2VKIA 1GB1A 4BKTA 3DBHB 4I6NB 5DHFB 1WR1A 2AWTA 4MGIE 2D2QA 4A5KA 4ZRPA 2FBWB 4RMAA 1WXVA 2KQSA 3Q2AC 1MIXA 2K0PA 4WQMA 2GBNA 2BW2A 2KCJA 3EFUA 3AMZA 1JMLA 1H4RA 1TT5B 4RM9A 3UIOB 3TL5A 1MVKA 4FHJA 4ZRQA 4R3DA 2HD5B 1HB6A 2N7JA 1HXYD 1FNVA 3DOWA 2KFJA 3WCQA 1Q0WB 4MY6A 2YT0A 3IG3A 4K1RB 5IO9A 3NOBA 3TEXA 1WZ3A 1DDWA 5I2SA 3WIMA 1MK7B 4HAVB 4MT7A 3NG0A 5JHHA 1WGRA 1BXTA 5AZFA 3RN9C 3PVWA 2P0DA 1MJDA 2YEPF 2UU7A 3BYYB 2WXOA 3N7CA 5G55A 2KLCA 2V9HA 3PEGA 5C23A 3AE1B 2CY4A 4GXBA 3A98B 3PHWB 3N20C 3PVLA 2NTTA 5BYQA 1ZW7A 1KF6B 2J59M 3CMMB 2ABDA 1V80A 4MEMA 3DWGC 2K22A 2XK5B 2BYVE 2MRPA 3SD5A 4A9AA 2CRFA 2QILA 4EZLA 4BVUC 2FAZA 3NVVA 2DYBA 2W9NA 1JW9D 3HIEA 1T0RC 1SGHA 1DBHA 2WXPA 2ZCCA 5BYSA 1SEBD 1E7VA 2CY5A 2DLWA 1Y56A 4CO7A 1KC7A 1XR0B 1WYGA 1V8CA 4JX1C 2O2VB 2N7DA 4D6WA 1KLVA 3E9SA 3Q3NC 5HE2A 2KJRA 3EFCA 1XCTL 4LNOA 1XEEA 3PLUA 1XKEA 2XQNM 1F9JA 4KAXB 2JZ3B 3AXCA 2YRYA 2DA0A 3RFZB 5FK9C 2V3NA 3AEGB 4MM3A 5D2MB 2BYFA 2V3SA 4LK0M 5IA7A 4GLSC 2XN9C 4MT5A 4L6EA 2JVCA 5GOWB 5KQ4A 2KWVB 4HWIB 1I2HA 2QJLA 1L0XB 3EPYA 3JVZX 4RF1A 3L13A 2L05A 5BMGA 1OFFA 2YS1A 3HVDA 4NJ6A 1E7UA 1KZGA 2IO3B 5GMVA 4KGSA 3BK2A 1VBHA 4W9LA 5KHOA 2COPA 1JQ4A 3NZUA 2W2XD 5LLIA 1CJEA 3MC8A 5EFXA 3TIXA 4GNKB 4KZCA 2MW5A 3VH3B 1I4RA 3WAOA 5D3IB 2COFA 3QJZA 4HB2B 1GAQB 4ZYSA 1YIWA 3BYTB 3R2TA 3Q3MC 2VSZA 4WWPA 4YSYB 3DBRI 3TBLD 1YN5A 3B77A 2RQ1A 1BWNA 3OG5A 5C5BB 3OWEB 1V1OA 2NBVA 4WJOA 2DZKA 4KKIA 1D6EC 2KDEB 2GBRA 4XE0A 2Z14A 3UI3A 3T06A 3OHMB 1MG8A 2JYTA 4B9KA 2ZEQA 4XDCA 4EZJA 3PRMB 5C1ZA 2QSDA 1OGWA 3ZVVA 3APFA 3EECA 2LHDA 2DYMA 1MHHE 5HG2A 3VOQA 4LJPB 1MAIA 3VUWA 5JHAA 2AEHA 2D11A 4HB4B 3P42A 2GCJA 2WX1A 2NR2A 3OANA 4MH8A 3R7RA 1V81A 1J0WA 4P6VF 2GS0A 1P3QU 1IRSA 3ULBA 3DDCB 5C3JB 3ML8A 4DDGD 3C8YA 3D8EA 3V5WA 3CIKA 1RRBA 4WQOB 1L6UA 2YSZA 1EO6A 1Z87A 3WYFB 2BGFA 2LVOA 1TZ1A 4MGYE 4FN2A 4XC2A 1I35A 1SIFA 1WE7A 2K39A 3VTVA 5LXIB 1DYNA 2LRWA 1Y5OA 4HAYB 1X1FA 1KJTA 1QOFA 1FCLA 2YS5A 4AP4C 4A8XC 2L2IA 3ZNHB 4EOYA 4EFOA 5CTRC 3GE3C 4NQKE 1D5XC 1J7BA 3VDZA 2HRJA 2JRHA 2K3UA 3DVGY 2YF0A 4ZYNA 1UNPA 2Z8LA 1ZPSA 4C00A 1ZC3B 1FXTB 3PZ8A 4HPPA 1XLNA 2LVPA 4GN1A 2FIDA 2DTCA 5CHWA 5G5GA 4PK1A 4A6KA 2KDBA 4D0NB 1VD2A 2V76A 5DH9B 1BMLC 3L16A 4GDKB 2KGXB 1XO3A 2DKPA 3F0WA 4J6IA 2J53A 1WIAA 3C0RB 2KVZA 3M3JA 1LO5D 3DXEA 2LI5A 4W9GA 2IYDB 4CSQA 3NVZA 1HTQA 2J4XA 2MJEA 4ZHOA 1U5GA 2ZPNA 2FDQA 2P0HA 1ZXHA 2LULA 1WVHA 4WH4A 5D3YA 1UEFA 2WDRB 3VRAB 2GUMA 1MHXA 1VZ7A 4JKFA 2K00A 2O6VA 2YEPB 2H7DA 3PV1A 1PGBA 2HTHB 2KTFA 4Z2MB 3ONSA 1ZVRA 3IAS1 4OVZA 2ZCBA 3UZTA 1V1PB 2CHXA 1K5GB 1GPXA 3W5UB 2IPKD 4NJCA 2EC1A 4B6WA 4H2AA 5FR3A 4PQ0A 2D3CA 2NPTB 1N3HA 2N4FA 2I5FA 4TV3A 2KR0A 4LLGM 1WGYA 3SHQA 3AE6B 2W3RA 2PE6B 1KLUD 4YL8A 1V5UA 2HJ1A 3SEBA 1YD8U 2K2UA 1T6BX 2G1EA 3L10B 3NW8A 4F7GA 4PT5A 3P6AA 2DWQA 3PRZA 1OQNA 3ODXA 2CU3A 2DHZA 2KACA 2L0TA 1YX6B 1ZKHA 2D5GA 3DPDA 2N9EB 4GOCA 1UELA 1E0ZA 5JXVA 1BAKA 4GMVA 3PPAA 3VVWB 2D9ZA 3I57A 3P4QB 5DPTA 2M56B 2KJHB 4YSXB 2VZKB 4A3OA 2BPSA 2WX0A 3NSUA 2WXIA 2WDQB 3VR9B 2DX5B 4JKAA 4NPNA 2OJRA 5GXGB 2MCNB 2LHEA 2DHIA 3EHVA 5FI0A 3QC8B 1FOEA 3RNGC 1IPGA 1EU4A 1E8ZA 3KQ4A 2L52A 2RRFA 2UYZB 4DXAB 1STEA 2MP2A 4OW0A 1XLPA 4RGOS 2ZJDA 2EKIA 2JXXA 5AUIA 1V49A 3SDLC 3FILB 2NBUA 1BTKA 3VH4B 5HKHA 2UZRA 2BS2B 5DI9B 1F77A 2B3AA 1PDXA 1XX0A 2M38A 3SFEB 4ZRIA 4JPSA 4JLCA 3W5VB 4NNJB 4CHMA 4W9JA 4YTNB 3ENEA 1UD7A 4TQ1A 2QEJC 3N9YC 3V61A 3UF8A 4TQ0A 4GZUA 1KH0A 4LNFA 3S2AA 5IN7A 3UINB 1QF6A 1WJ1A 2BKRB 2WXLA 4HKZE 3LYYA 1I4HA 4KIKB 2J52A 3BINA 1PFDA 1PGAA 1SHCA 3DBLI 2RPQA 4JKGA 1P98A 3BVZA 4RH6A 3ZW3A 5DPRA 3F5RA 2Z59A 2L8JA 1N61A 3AE7B 1W1GA 1FIQA 2MSED 3ZDTA 1UNQA 3G9WA 1UUPA 3TSSA 1T0SC 4AQ7A 4OHJA 4BKSD 2KK8A 1PLSA 4HAXB 3AN1A 4NAWB 2CJNA 2EJ8A 4HAUB 5J3QA 2Y8FA 1JWBD 4ANUA 1B1ZA 4X57B 4ZHPA 1N5XA 2L00B 5BMHA 2JT4B 3A4RA 2CR5A 3CSFA 4CYEA 2DNFA 5FKAC 5L95C 4KX6B 4AS1A 1FGZA 4NAWA 4JKCA 2MX2A 1M94A 1ZP0B 4WIPA 1ACAA 2Z0PA 1NTVA 5EDSA 3W9CB 3PSCA 3H6NA 4ICUA 4GSWA 3TO1A 4KHBA 3U8ZA 4MELA 4DBGA 1HA5A 3O65B 2OHFA 1SIJA 4LNIA 2KN4A 2M0AA 1B55A 3UGBB 4US9A 5EE0A 3UIPB 4RM8A 4E3CA 1MKEA 2WXHA 3QK0A 1FMAD 2C9WB 1I4GA 3RD2A 1DDVA 3NVYA 5E6OA 2C7MB 3A9KA 4OVUA 1RLFA 2JRIB 4B0EA 3EGRA 5DPWA 1TKGA 3DVGX 2O2VA 2XK5A 4RGTA 4DK5A 4ITKA 2CHZA 4Z2NA 5E6PA 4XWWA 3P2BA 3OJ3A 2WWZA 2XNAC 1WJ4A 1EWCA 1IUEA 4JKHA 1XLOA 2SEBD 2OEDA 3DHGC 1ZOYB 1U29A 1U5DA 2C60A 1JCKB 3MHSD 3NVWA 3Q8EA 4CQNA 2LUMA 3GS2A 2K8BA 3SU8X 1ISNA 2IGHA 3PS6A 5EE9A 1T0YA 1UF0A 1V5TA 2FUG1 1VDVA 3GE8C 1FFVA 2L32A 1U5EA 5M4YB 2LWPA 4JL9A 4I6LB 3A1QB 3BVMA 2BS4B 4WJPA 2W2WA 1OQQA 3AEBB 1EF1A 2INPE 1W1HA 2DZMA 4ICVA 2INNE 2M1MA 1HTOA 2V4LA 4ANVA 2QC8A 3DCGA 2BVCA 1P7FA 4M8MA 5LXHA 3PZ7A 1WYWB 2LOZA 2W3SA 2WYQA 4BFRA 1V1PA 2ROZB 4W9FA 5CLLB 1WZ0A 3RCPA 4DWFA 1BTNA 2L3ZA 5LOPB 1OY2A 2Z0QA 4M0WB 3Q3OC 3H1UA 4QAYA 1TS5A 2DLBA 3ZNGC 2JZPA 4DXGA 4ILGB 1C3TA 2KT7A 3KLSX 4PS3A 3FP5A 4L1BA 2WP9B 1EGXA 4FULA 1AW7A 4PYZA 4DHZB 4OVVA 3KYDD 4DX90 2LOXA 2DENB 2IO0B 3PT2B 2DBYA 3Q8FA 4F7UP 1M7RA 3IT4B 4K2OA 3DHHC 3FVCA 1LB1A 3Q3FA 4ZOHC 3RNEC 1VZ8A 3MTNB 2KC1A 4QJ3B 2LKOA 4IWQA 2MA9B 1XODA 1P7EA 1DYQA 2KKCA 3PRPB 1E5WA 1UBQA 4CHKA 4MM3B 4G0NB 1V89A 2AQ3B 1EVHA 2GBJA 3EUB2 1F52A 4HRSA 4OZAA 3PP2A 4K7WA 3A33B 1GOZA 2MEKA 1ZXIA 5FI1A 1NYRA 3NHEB 2JUOA 1J19A 3KRXA 4HB3B 3PGEA 2DN6A 2IO2B 3VIAA 3N30A 3ENBA 3GYPA 3R66C 3K9OB 4DQOC 5IP4D 4IWOA 2AL6A 3HM6X 4XDDA 1VR9A 2WXGA 3ZTCA 1EWYC 2JXTA 2KUPA 2LUEA 2WXJA 1TY2A 4WAFA 1AWEA 1FGYA 1OQYA 4ZDVA 1HZ6A 2N1VA 3P1MA 3NUHB 2MFQA 4QJ4B 5BYRA 5JZEB 4PS8A 1C9FA 2E6XA 3H7PA 3KWLA 1C4AA 2WDTB 2WHIA 3VTUA 4XZ4A 4EKUA 3M95A 3BIID 3QA8A 4FLHA 3K9PB 3DXCA 2P8VA 1WE6A 1VLBA 2JZZA 3ML9A 1X1GA 5J18A 3KSYA 1IP9A 2QDFA 5E6NA 3TUOA 2KWUB 5HI1A 1WH3A 4WWNA 2M19A 1CQVA 2WXNA 3MDBC 2CS4A 2OTXA 3PTFC 3ZNZB 2JP2A 5LNK1 3I63C 4ARCA 5JP4A 5KHQA 1WGQA 2BB6A 3NWDA 1EF5A 3L0WB 4RGMA 2VZKD 1ZSQA 1TYGB 5D27A 3VR8B 1WI0A 3AE3B 2V3PA 1TIFA 4AWJA 4H8SA 3WAMA 3M63B 3N3KB 2WNMA 2YVCA 2HTME 3W1SC 4Y94A 1JWSD 3SYXA 2L83A 1YJJA 3PHXB 3AE5B 3E66A 1NU2A 1TTNA 1ZDVA 3VFKA 2KIGA 2NBVB 5D3DA 1NBFC 5D94A 1XD4A 2RMMA 2R0DA 5T8IA 3ZQ4A 1K5DB 2KJ6A 1UGJA 5C16A 2ASQA 1WRDB 2UWQA 5IOIA 2JSVX 4ACFA 1OMWA 3L08A 5D7GA 1GC7A 3V3XA 2J7QB 3OLMD 4YONA 3JSVB 2IY0B 3QWMA 3RCZA 2DHKA 3RT3B 2K25A 4FA6A 2N0SB 1V5MA 2E3TA 2D10A 3R3MA 4C7YA 4MK0A 4ZRJA 1J8CA 4PYUA 4KSLC 3CIRB 1L0VB 4IKGA 4C7ZA 2LGYA 2KC2A 2YLMA 4JKGB 2EMSA 4F7ZA 1PFJA 5G2NA 2FJ9A 4BOSC 3ZDMC 1FCCC 2ZW1A 3FKYA 2D9VA 1NI3A 2RGFA 4JKBA 4FJYA 5HE3A 3KUCB 4ANWA 4HDOA 1YMHE 2CJOA 2G45B 1UPRA 4TMAB 1HEZE 2A4ZA 4REZA 2G4DB 3ZXRA 3V6CB 3WA0A 1WM3A 1J7AA 2K1FA 1MK9B 5CHVC 2FIFA 2YS3A 1MI1A 1YQBA 4RFBA 3GYOA 2DYNA 3X0WA 2LFIA 2TSSA 2GRIA 1SE4A 1V88A 3DXDA 3GZNB 1WJ6A 1RAXA 2MDXA 1E7PB 2N9KA 4HROA 5L83A 1VCBA 2ON8A 4K7UA 3U2SC 4IC7B 1JRPA 4ARIA 3TCAA 4GDLB 4RGNA 4XGAB 1RRPB 4YSZB 2J0KA 4BBNC 1GB4A 2FCSA 3P63A 2KTRB 1OTRB 4WJNA 2PKOA 1E8WA 2LYDA 1FEHA 2DZIA 2ICIA 2NMBA 2GBKA 4K2PA 1SF0A 2LVQA 5CHFA 1F2RC 4YWGG 4GU2A 1NENB 2MH7A 3RMKC 5CX3A 2NS5A 4FXCA 1WSPA 1SB3C 2MJDA 3L17A 1WMHB 5L81A 2LXCA 4JK8A 2R2YA 4P1BC 1YQ4B 3QARA 2MBQA 4HJGE 2KVRA 3AEEB 1FD6A 1Q1OA 4D2KA 1ZUD2 2AX5A 2G4SA 3HVZA 3ECIA 2WH5A 2GB1A 4MGKE 1X05A 1WGHA 1R4MB 5I4DA 5G5HA 1Y8RC 3ZXVA 4YTMB 4KGRA 1LGRA 3U52E 2L1CA 4IDIA 5C79A 2KFKB 4AJYB 3N1YC 1Q5WB 2FJUB 5J3YA 3P4SB 4G11A 3ML4A 4DIXA 1QOGA 3LJUX 4RF0A 2Z0OA 4IFSA 1HB8A 4XYCA 3A8PA 3UQBA 3GB1A 3Q8BA 3CWIA 2W82A 3BVGA 4K17A 2RSGA 2KMMA 3DVNV 3KYCD 1DROA 1KBLA 5TR5A 1T77A 1UZXB 3N1XC 3IBEA 2WXFA 5E6JA 3ZJUA 2KMAA 1NI2A 3ZTDA 3I5JC 2OOBB 4IW0A 2FCNA 4HCNB 1YX5B 3NRZA 2CQUA 4FBJB 4MJSB 3ODWA 4EJNA 2MWSB 1C76A 2IDYA 4A6FA 4AJWA 4FJVB 4HJKA 4S0RA 4KHOA 3FM8C 2GJYA 2JWUA 2D3BA 1XT9B 2Q5WD 4G3XB 2I2YA 4JK7A 4HVBA 4OZBA 3Q8AA 3HIZA 3A9JB 2NBWB 2LZ6A 3DVNU 5JH5C 3KY9A 3DCXA 2VRRB 3ZVRA 2MBHA 2WXRA 3R8BA 3VTWA 1BUIC 2DAFA 4FHKA 1FHOA 2UZSA 3IVFA 4S17A 2RD0A 5TSSA 2M17A 1KM7A 4EUTA 3D8DA 1A5RA 5J17A 3RNCC 3QHTA 2D4QA 2I38A 3KVFB 1IBXA 1C4CA 4F1SA 2ELBA 4A20A 1C78A 4RCOA 2QMTA 4BKGA 2Y3AA 1UGMA 1GC6A 2VH1A 2V1YA 1P1AA 4ASWC 3E9PA 3KUDB 4MH0E 5D6JB 3Q69A 2QKLA 2Z0DB 3SO6A 3BK1A 4KHAA 3U7DA 2X8XX 3W2DA 1TJEA 3FLVA 1IBXB 3QQ8B 3SV1A 1L4ZB 2Z0EB 1E8XA 4HAWB 2KANA 1WJUA 3B08A 1WXAA 4YT0B 2KIEA 2R2OA 3A1QA 2RVBB 4N59A 3SR6A 1NVLA 2ZPYA 2N1WA 3AE4B 2HTHA 1QZEA 3RULA 3E9OA 1HE8A 5JHGA 1JRUA 1K50A 1DIKA 1FRRA 1WGGA 3KZ1A 2IBIB 3B9JA 2H89B 4TSSA 4NQLB 2SAKA 2LGDA 1QT9A 1NEKB 2FE8A 4KSKC 1TY0A 4KDLB 3V62A 1N62A 5HE0A 1SE3A 3T9LA 4KDIC 3P4PB 3AB5A 3MFGA 2ZW0A 4WVFB 5H8YE 1QILA 2KQ4X 3WAPA 1QOBA 2KYWA 4KVGB 2PPHA 1OEYA 3AECB 2V0GA 1N5WA 3RUIB 4OSNA 4BBNF 4NJ7A 3MHZA 1S1QB 2L76A 1L4DB 1WM2A 2JQRB 4US8A 1M7EA 4KKJA 3HK0A 4DX8A 3TEYA 1NDDA 1VBGA 2LEKA 2CKHB 1P5TA 1FXAA 2W54A 1XCGA 1D5ZC 3JYUA 1QKZA 2W2XC 4EE2A 3A8QA 2WGSA 3SBGA 1H8CA 2MJ3A 4GOUA 3AE9B 3E56A 4B0MA 1WXSA 2Y5CA 1IYFA 1GNUA 2NCNA 1KRHA 2GBMA 2BYTA 3MP9A 3RNBC 1AN8A 2AQ1B 2D9XA 4WJ7A 4EMOA 5J2RA 4HK2A 3MJWA 1TS3A 3H9DA 1MFWA 1JWUD 4USAA 3T3NA 2PZ1A 2CAYA
chains in the Genus database with same CATH topology
3ZNID 3IFWB 3IHPC 2IY1B 2KO3A 3RZWC 2IFSA 5CLQB 1WG7A 2P0FA 2RGNB 4PS7A 3TJPA 1QC6A 2A5UA 1Z2MA 2FUHB 2DKQA 2LASA 4HDQA 2KD0A 2GMIC 1P6SA 1QQGA 1KI1B 4HPLB 2K8CA 5D3XA 3WALA 4FADA 1SE9A 1WX7A 2KTRA 3QAQA 3CSTA 2K8HA 3X23A 2MWNB 2KWCA 5C5BA 4ILJA 4I6PA 1UNRA 1D3ZA 3GZNI 2K6DB 5J3TA 4JK9A 2ROVA 2MBOA 4DDID 4C0AA 1WY8A 3ZO5B 5D3VA 5DIFB 2C7HA 4ANXA 2KDFB 4MSMB 2KQ7A 3ZRCA 2M14A 2VRWB 3TFMA 1E8YA 3APCA 2GCLA 3M62B 5AEKB 2AL3A 1ZC4B 4JKDA 4A3PA 2KDIA 3QBVB 1V9JA 2O6VB 4MDKE 3ODOA 5IJMA 2D9YA 4LCDE 2HE7A 2RLOA 1H10A 2JF5A 4KHBB 3H7SA 2NVUI 4URKA 2Y5BB 2J0MA 2DAJA 3QWZB 1WXMA 2BF8B 3CXBB 5JHBA 3AI5A 4GDKA 3ZRFA 1KZ7A 3APDA 2R2QA 3D8FA 2KHWB 4WSFA 1J0GA 2LD9A 1KOTA 4IAPA 4TYZA 3A4SC 2X18A 2BWES 4JKEA 1TXDA 2KOXA 2I5CA 4W9IA 5JVLA 2RUKB 2ELAA 3FSSA 4II2B 1JDEA 1NTIA 1PMSA 3R7QA 3VXWA 1LXDA 1LM8B 4IM3A 3ZIMA 2OQBA 5DHAB 1WX8A 3ZLZA 2KMCA 3P7ZA 2DZJA 1I42A 4KV2A 2MBBB 2BCJA 3VAWA 1LQBA 4HATB 1P3RA 5KQ1A 1EAZA 5D3WA 4IUMB 2D07B 1WX9A 2QHOA 3FEHA 4W9CA 4AOFA 4WWOA 2DX1A 2G35A 2ZNVB 5HE1A 5AZGA 4DHJD 4W9DA 3QCAA 2N9XA 2KZRA 3PSEB 4II3B 1OEYJ 4NSWA 1TBEA 3HQCA 1U5FA 4JGHB 1NTYA 3QIJA 2BYEA 4GPTB 3VUXA 1G6JA 3AU5A 2COAA 3W1YA 2XEWA 5BO4B 2ZVNA 4IM0A 3T8MA 1UPQA 2O6VD 4HPMB 1W1DA 1S3SG 4IOYX 2FJLA 2L7RA 1RJ2A 5IAAC 3HM3A 4DHZE 4XWXA 4M8NA 2DYOA 1X86A 3ZUNA 2N0YA 2JPHA 2KNBA 1CMXB 4W9HA 1FAOA 2CB8A 1WJNA 3SBTA 4ZRKA 4IWPA 4B95A 2R82A 3JSVA 1GG3A 2FCQA 4FJZA 3MPXA 1AARA 3NZSA 4G50A 3B0AA 4LDTB 2COCA 3SNHA 1XQQA 2I1JA 3H7PB 1U4AA 4MJSA 4HCPB 1BT0A 2X0SA 1X1MA 1TGZB 2RSUA 2ADZA 2YT1A 3LDZE 3HHMA 1ZM0A 3AULA 1Y19B 4JIOU 4TUUA 1K8RB 3PREA 4A6HA 2D9WA 1YJ1A 2CU1A 1ST7A 3OJ4B 3TMPB 3PZDA 3RZFA 2DYQA 2DX5A 2GOWA 5KCVA 2FNJB 4E71A 2Z59B 3V6EB 2MKRA 4WAAA 2LG1A 2ZZPB 1U2BA 2DIKA 4GMXB 3PLVA 2KFKA 2ZVOA 1Z5SB 3V60A 2R09A 1XD3B 3GOEA 1R4NI 2KN5A 4F8CB 4HLEA 4A6FB 4GB9A 1V6EA 1LW3A 1V61A 5DPSA 1L7YA 2NPTA 4IG7B 4CHJA 3BY4B 3M1IB 4HAZB 1V86A 4F7HA 4GIVA 2DFKA 3U30A 2M4NA 3UQAA 3D32A 2L0FA 1WGDA 2EKEC 3LJ3A 2IZVB 2HJ8A 2I1KA 3DBHI 3DBSA 3A9KB 2J0JA 2KXJA 2Y8GA 2UVMA 4MSQB 1RFAA 4WJQA 1V5PA 4BBKA 2CODA 2MLBA 1AQCA 4W9KA 4LDTD 5C6RA 1WFYA 2M8SA 3Q3JA 3JW0X 5FR6A 1U27A 1MPHA 3E9LA 4K7SA 1P0RA 3AJ4A 2E2XA 4GGQA 3ALBA 5LONB 2LRUA 3CF6E 2Q13A 2PE9A 1I7AA 4B6HA 4KIKA 1PQSA 2NZ8B 2PJHA 3KW5B 2KX3A 4JQWC 1V2YA 3TW1A 3I3TB 2PEAA 1WF9A 1GUAB 2LBBA 1DDMA 4E74A 4XX5A 2H7EA 1WR6E 1P9DU 2ZNVC 3B1LX 2MBEA 2K2JA 4K81A 4GDLA 3AU4A 2DHJA 1LFDA 3W1SA 4KZ0A 1HBKA 1UBIA 2KLGA 2RR9A 4HB0B 3ULCA 3KRWA 4DHJB 2REXA 2Y7BA 3VQIA 2C7NB 3EC8A 3QX1A 5DCNA 2BKFA 4TKNA 1GJZA 2C5LC 1V5OA 2N9PC 3ZKJC 4HHVA 2AYOB 4NY0A 4P7IA 3VUYA 3BJIA 1GGOA 4N9F4 1WGUA 3WANA 3SUZA 4BKSA 2N7EA 5JLJB 4LJOB 4ILHA 2CHWA 1R4MI 2G3QB 4HXDA 3N32A 2XBBC 2D3GA 2LXAA 4AUQC 3NY5A 2BWFA 3L54A 1FB8A 3PG7A 2JY6A 2JWZA 3OAWA 2EMTA 2IYBA 3A9JA 4EZKA 4MGZE 4PNKA 2K6QA 1X11A 4BOZB 1TJ6A 3HW2B 3KUZA 3RYTA 2QKMA 4EEWA 2KX0A 1TQZA 1C1YB 2RNRB 4DBBA 1MIZB 3KH0A 2MP2B 2FCMA 1ZGUB 2M0XA 1L2NA 3PVUA 5AZHA 3TVVA 4W9EA 3DQVA 2N23A 2LGXA 1FHXA 3O96A 4IM2A 1UH6A 2IO1B 2MQJA 1WI1A 1FHWA 1E90A 1WJMA 1EUVB 2LJ5A 1WMHA 3NS8A 3VHTC 1Q67A 2VKIA 4BKTA 4I6NB 5DHFB 1WR1A 2AWTA 4MGIE 2D2QA 4A5KA 4RMAA 1WXVA 2KQSA 1MIXA 2GBNA 2KCJA 3EFUA 1H4RA 4RM9A 3UIOB 3TL5A 4FHJA 2HD5B 1HB6A 3DOWA 2KFJA 1Q0WB 4MY6A 2YT0A 3IG3A 4K1RB 3NOBA 1WZ3A 1DDWA 3WIMA 1MK7B 4HAVB 4MT7A 5JHHA 1WGRA 5AZFA 3PVWA 2P0DA 3N7CA 5G55A 2KLCA 3PEGA 5C23A 2CY4A 4GXBA 3A98B 3PHWB 3PVLA 1ZW7A 2J59M 3CMMB 2ABDA 1V80A 4MEMA 2XK5B 2BYVE 2MRPA 3SD5A 2CRFA 4EZLA 4BVUC 2FAZA 2DYBA 2W9NA 1SGHA 1DBHA 2ZCCA 1E7VA 2CY5A 2DLWA 4CO7A 1KC7A 1XR0B 2O2VB 2N7DA 1KLVA 5HE2A 2KJRA 3PLUA 1XKEA 2XQNM 1F9JA 4KAXB 2JZ3B 3AXCA 2YRYA 2DA0A 4MM3A 5D2MB 2BYFA 2V3SA 5IA7A 4L6EA 2JVCA 5GOWB 5KQ4A 2KWVB 4HWIB 1I2HA 3EPYA 3JVZX 3L13A 2L05A 2YS1A 4NJ6A 1E7UA 1KZGA 5GMVA 2IO3B 1VBHA 4W9LA 5KHOA 2COPA 3NZUA 2W2XD 5LLIA 5EFXA 3TIXA 4KZCA 2MW5A 3VH3B 3WAOA 2COFA 3QJZA 4HB2B 1YIWA 2VSZA 4WWPA 3DBRI 3TBLD 2RQ1A 1BWNA 5C5BB 4WJOA 2DZKA 2KDEB 2GBRA 3T06A 1MG8A 4B9KA 2ZEQA 4EZJA 3PRMB 5C1ZA 1OGWA 3ZVVA 3APFA 3EECA 2DYMA 3VOQA 4LJPB 1MAIA 3VUWA 5JHAA 2AEHA 2D11A 4HB4B 2GCJA 2WX1A 2NR2A 3OANA 3R7RA 1V81A 1J0WA 2GS0A 1P3QU 1IRSA 3ULBA 3DDCB 3ML8A 4DDGD 3D8EA 3V5WA 3CIKA 1RRBA 4WQOB 2YSZA 1EO6A 1Z87A 3WYFB 2BGFA 2LVOA 1TZ1A 4MGYE 4FN2A 4XC2A 1I35A 1SIFA 1WE7A 2K39A 3VTVA 5LXIB 1DYNA 2LRWA 1Y5OA 4HAYB 1X1FA 1KJTA 2YS5A 4AP4C 2L2IA 3ZNHB 4EOYA 4EFOA 5CTRC 4NQKE 3VDZA 2HRJA 2JRHA 3DVGY 2YF0A 4ZYNA 1UNPA 1ZC3B 1FXTB 2LVPA 4GN1A 2FIDA 2DTCA 5CHWA 4A6KA 2KDBA 4D0NB 1VD2A 2V76A 5DH9B 3L16A 4GDKB 2KGXB 2DKPA 3F0WA 4J6IA 1WIAA 3C0RB 3M3JA 3DXEA 2LI5A 4W9GA 2IYDB 1U5GA 2ZPNA 2FDQA 2P0HA 2LULA 1WVHA 5D3YA 1UEFA 4JKFA 2K00A 2O6VA 2H7DA 3PV1A 2HTHB 2KTFA 4Z2MB 3ONSA 1ZVRA 2ZCBA 3UZTA 2CHXA 1K5GB 2EC1A 4B6WA 4PQ0A 2NPTB 1N3HA 2N4FA 2I5FA 4TV3A 1WGYA 3SHQA 2PE6B 4YL8A 1V5UA 1YD8U 2K2UA 3L10B 4F7GA 3P6AA 3PRZA 1OQNA 3ODXA 2DHZA 2L0TA 1YX6B 1ZKHA 3DPDA 2N9EB 4GOCA 1UELA 1BAKA 4GMVA 3PPAA 3VVWB 2D9ZA 5DPTA 2KJHB 4A3OA 2BPSA 2WX0A 3NSUA 2DX5B 4JKAA 4NPNA 2OJRA 2MCNB 2DHIA 3EHVA 5FI0A 3QC8B 1FOEA 1IPGA 1E8ZA 2UYZB 4DXAB 2MP2A 2ZJDA 2JXXA 1V49A 3SDLC 2NBUA 1BTKA 3VH4B 5HKHA 2UZRA 5DI9B 2B3AA 1XX0A 2M38A 4ZRIA 4JLCA 4NNJB 4CHMA 4W9JA 3ENEA 1UD7A 4TQ1A 3V61A 3UF8A 4TQ0A 4GZUA 3S2AA 3UINB 1WJ1A 2BKRB 4KIKB 3BINA 1SHCA 3DBLI 2RPQA 4JKGA 1P98A 3ZW3A 5DPRA 3F5RA 2L8JA 1W1GA 2MSED 3ZDTA 1UNQA 3G9WA 4BKSD 2KK8A 1PLSA 4HAXB 4NAWB 2EJ8A 4HAUB 5J3QA 2Y8FA 4ANUA 4X57B 2L00B 2JT4B 3A4RA 2CR5A 3CSFA 4CYEA 5L95C 1FGZA 4NAWA 4JKCA 2MX2A 1M94A 1ACAA 2Z0PA 1NTVA 5EDSA 3PSCA 3H6NA 4ICUA 4GSWA 3TO1A 4MELA 3U8ZA 4DBGA 3O65B 1B55A 3UGBB 3UIPB 4RM8A 4E3CA 1MKEA 3QK0A 2C9WB 3RD2A 1DDVA 5E6OA 2C7MB 3A9KA 4OVUA 1RLFA 2JRIB 5DPWA 3DVGX 2O2VA 2XK5A 4DK5A 2CHZA 4Z2NA 5E6PA 3P2BA 3OJ3A 2WWZA 1WJ4A 4JKHA 1U29A 1U5DA 2C60A 3MHSD 2K8BA 3SU8X 1ISNA 3PS6A 1T0YA 1V5TA 1U5EA 2LWPA 4JL9A 4I6LB 3A1QB 4WJPA 2W2WA 1EF1A 1W1HA 2DZMA 4ICVA 2M1MA 2V4LA 4ANVA 3DCGA 4M8MA 5LXHA 1WYWB 2LOZA 2WYQA 4BFRA 2ROZB 4W9FA 5CLLB 1WZ0A 3RCPA 4DWFA 1BTNA 2L3ZA 5LOPB 1OY2A 2Z0QA 4M0WB 3H1UA 3ZNGC 4ILGB 1C3TA 4PS3A 3FP5A 4PYZA 1EGXA 4FULA 4DHZB 4OVVA 3KYDD 4DX90 2LOXA 2DENB 2IO0B 3PT2B 4F7UP 1M7RA 4K2OA 1LB1A 3Q3FA 3MTNB 2KC1A 2LKOA 4IWQA 2MA9B 1XODA 2KKCA 3PRPB 1E5WA 1UBQA 4CHKA 4G0NB 1V89A 1EVHA 2GBJA 3PP2A 4K7WA 3A33B 5FI1A 3NHEB 2JUOA 1J19A 3KRXA 4HB3B 3PGEA 2DN6A 2IO2B 3VIAA 3N30A 3ENBA 3GYPA 3R66C 3K9OB 4IWOA 2AL6A 3HM6X 3ZTCA 2KUPA 2LUEA 1AWEA 1FGYA 1OQYA 4ZDVA 2N1VA 2MFQA 5JZEB 4PS8A 3H7PA 2WDTB 3VTUA 4XZ4A 4EKUA 3M95A 3QA8A 4FLHA 3K9PB 3DXCA 2P8VA 1WE6A 2JZZA 3ML9A 1X1GA 5J18A 3KSYA 1IP9A 5E6NA 2KWUB 1WH3A 4WWNA 3MDBC 2CS4A 2OTXA 3PTFC 3ZNZB 2JP2A 5JP4A 5KHQA 1WGQA 1EF5A 3L0WB 1ZSQA 5D27A 1WI0A 4AWJA 4H8SA 3WAMA 3M63B 3N3KB 2YVCA 3W1SC 4Y94A 3SYXA 3PHXB 3E66A 1NU2A 1TTNA 3VFKA 2NBVB 1NBFC 5D94A 1XD4A 2R0DA 1K5DB 2KJ6A 5C16A 2ASQA 1WRDB 2UWQA 1OMWA 3L08A 5D7GA 1GC7A 2J7QB 3OLMD 4YONA 3JSVB 2IY0B 3QWMA 3RCZA 2DHKA 3RT3B 2K25A 4FA6A 1V5MA 3R3MA 2D10A 4MK0A 4ZRJA 1J8CA 4PYUA 4KSLC 2LGYA 2KC2A 2YLMA 4JKGB 2EMSA 4F7ZA 1PFJA 5G2NA 2FJ9A 4BOSC 3ZDMC 2D9VA 2RGFA 4JKBA 4FJYA 5HE3A 3KUCB 4ANWA 4HDOA 2G45B 1UPRA 2A4ZA 2G4DB 3V6CB 3WA0A 1WM3A 2K1FA 5CHVC 1MK9B 2FIFA 2YS3A 1YQBA 3X0WA 3GYOA 2DYNA 1V88A 3DXDA 1WJ6A 1RAXA 2MDXA 5L83A 1VCBA 4K7UA 4IC7B 3TCAA 4GDLB 1RRPB 2J0KA 4BBNC 2FCSA 2KTRB 1OTRB 4WJNA 1E8WA 2LYDA 2DZIA 2NMBA 2GBKA 4K2PA 2LVQA 5CHFA 4GU2A 5CX3A 2NS5A 3L17A 1WMHB 5L81A 2LXCA 4JK8A 3QARA 2MBQA 2KVRA 1Q1OA 2G4SA 3ECIA 2WH5A 4MGKE 1X05A 1WGHA 1Y8RC 2L1CA 5C79A 2KFKB 4AJYB 1Q5WB 5J3YA 4G11A 3ML4A 3LJUX 2Z0OA 4IFSA 1HB8A 3UQBA 3A8PA 4K17A 2RSGA 3DVNV 3KYCD 1DROA 1KBLA 5TR5A 1UZXB 3IBEA 2KMAA 1NI2A 3ZTDA 2OOBB 4IW0A 2FCNA 4HCNB 1YX5B 2CQUA 4FBJB 4MJSB 3ODWA 4EJNA 2MWSB 4A6FA 4AJWA 4FJVB 4HJKA 4KHOA 3FM8C 2GJYA 1XT9B 4G3XB 4JK7A 4HVBA 3HIZA 3A9JB 2NBWB 2LZ6A 3DVNU 5JH5C 3KY9A 2VRRB 3ZVRA 2MBHA 3VTWA 2DAFA 4FHKA 1FHOA 2UZSA 3IVFA 2RD0A 2M17A 1KM7A 4EUTA 3D8DA 1A5RA 5J17A 3QHTA 2D4QA 3KVFB 4F1SA 2ELBA 4A20A 4BKGA 1UGMA 1GC6A 2V1YA 1P1AA 4ASWC 3E9PA 3KUDB 4MH0E 5D6JB 2QKLA 2Z0DB 3SO6A 4KHAA 3U7DA 3FLVA 3QQ8B 3SV1A 2Z0EB 1E8XA 4HAWB 2KANA 1WJUA 3B08A 1WXAA 2R2OA 3A1QA 2RVBB 1NVLA 2ZPYA 2N1WA 2HTHA 1QZEA 3RULA 3E9OA 1HE8A 5JHGA 1JRUA 1DIKA 1WGGA 3KZ1A 2IBIB 4NQLB 2LGDA 4KSKC 4KDLB 3V62A 5HE0A 3T9LA 4KDIC 4WVFB 3WAPA 2PPHA 4KVGB 1OEYA 3RUIB 4BBNF 4NJ7A 1S1QB 2L76A 1WM2A 1M7EA 3HK0A 4DX8A 1NDDA 1VBGA 2CKHB 1P5TA 1XCGA 3JYUA 2W2XC 3A8QA 3SBGA 1H8CA 1WXSA 1IYFA 1GNUA 2NCNA 2GBMA 2D9XA 4WJ7A 4EMOA 5J2RA 4HK2A 3MJWA 3H9DA 2PZ1A 2CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUE A;  3D8E A;  3V5W A;  3CIK A;  3AJ4 A;  1RRB A;  4WQO B;  3ZNI D;  2E2X A;  4GGQ A;  1AWE A;  1FGY A;  2YSZ A;  1EO6 A;  1OQY A;  2IY1 B;  3IFW B;  1Z87 A;  3WYF B;  2BGF A;  2KO3 A;  2N1V A;  3ALB A;  2LVO A;  5LON B;  2MFQ A;  1TZ1 A;  4MGY E;  4FN2 A;  4XC2 A;  2IFS A;  5CLQ B;  5JZE B;  1SIF A;  1WE7 A;  2K39 A;  1WG7 A;  2P0F A;  2RGN B;  1DYN A;  3H7P A;  4PS7 A;  4PS8 A;  3TJP A;  5LXI B;  1QC6 A;  2A5U A;  2LRU A;  2LRW A;  1Y5O A;  4HAY B;  2WDT B;  1X1F A;  1KJT A;  3CF6 E;  3VTU A;  4XZ4 A;  2YS5 A;  4AP4 C;  4EKU A;  2Q13 A;  2PE9 A;  1Z2M A;  2L2I A;  3ZNH B;  3M95 A;  4EOY A;  2FUH B;  1I7A A;  3QA8 A;  4FLH A;  2DKQ A;  2LAS A;  3K9P B;  3DXC A;  4HDQ A;  2P8V A;  2KD0 A;  4B6H A;  4NQK E;  2GMI C;  5CTR C;  4EFO A;  1P6S A;  1QQG A;  1WE6 A;  2JZZ A;  3ML9 A;  1X1G A;  4KIK A;  2HRJ A;  3VDZ A;  5J18 A;  3KSY A;  1IP9 A;  2JRH A;  3DVG Y;  2YF0 A;  1PQS A;  2NZ8 B;  1KI1 B;  2PJH A;  4HPL B;  3KW5 B;  5E6N A;  4ZYN A;  2KX3 A;  4JQW C;  1UNP A;  2KWU B;  1ZC3 B;  1WH3 A;  4WWN A;  1FXT B;  1V2Y A;  3VAW A;  3TW1 A;  2K8C A;  5D3X A;  2LVP A;  3I3T B;  3WAL A;  4FAD A;  4GN1 A;  2FID A;  1SE9 A;  2DTC A;  3MDB C;  1WX7 A;  2CS4 A;  1WF9 A;  2KTR A;  2OTX A;  2PEA A;  5CHW A;  3PTF C;  3ZNZ B;  2JP2 A;  4A6K A;  3QAQ A;  3CST A;  2KDB A;  4D0N B;  1GUA B;  2K8H A;  1VD2 A;  2LBB A;  2V76 A;  5DH9 B;  3X23 A;  1DDM A;  5JP4 A;  3L16 A;  4E74 A;  2MWN B;  4GDK B;  1WGQ A;  4XX5 A;  5KHQ A;  2H7E A;  2KGX B;  1P9D U;  1EF5 A;  1WR6 E;  2KWC A;  5C5B A;  2DKP A;  3F0W A;  4J6I A;  2ZNV C;  3B1L X;  1WIA A;  3L0W B;  2MBE A;  3C0R B;  4I6P A;  1UNR A;  3M3J A;  1D3Z A;  3DXE A;  1ZSQ A;  2K2J A;  3GZN I;  5D27 A;  2K6D B;  5J3T A;  4K81 A;  2LI5 A;  4W9G A;  1WI0 A;  2IYD B;  4HJK A;  2ROV A;  2MBO A;  4GDL A;  4DDI D;  3AU4 A;  2DHJ A;  4C0A A;  1WY8 A;  3ZO5 B;  5D3V A;  5DIF B;  2C7H A;  1LFD A;  4AWJ A;  4H8S A;  3WAM A;  3M63 B;  3N3K B;  3W1S A;  4A3O A;  4KZ0 A;  4ANX A;  1U5G A;  2YVC A;  1HBK A;  1UBI A;  2KDF B;  2KLG A;  2RR9 A;  4HB0 B;  2ZPN A;  4Y94 A;  3W1S C;  4MSM B;  2KQ7 A;  2FDQ A;  2P0H A;  3SYX A;  2LUL A;  3KRW A;  3ULC A;  2REX A;  3PHX B;  3ZRC A;  4DHJ B;  2Y7B A;  1WVH A;  2M14 A;  2VRW B;  3VQI A;  3RZW C;  1NU2 A;  1TTN A;  3VFK A;  2C7N B;  5D3Y A;  1UEF A;  3TFM A;  3EC8 A;  3QX1 A;  2NBV B;  1E8Y A;  5DCN A;  3APC A;  2GCL A;  1NBF C;  3M62 B;  5D94 A;  1XD4 A;  2AL3 A;  2BKF A;  5AEK B;  2R0D A;  4TKN A;  1ZC4 B;  1GJZ A;  1K5D B;  2C5L C;  2KJ6 A;  2K00 A;  1V5O A;  2N9P C;  2O6V A;  3ZKJ C;  4HHV A;  5C16 A;  2ASQ A;  4A3P A;  2H7D A;  1WRD B;  2KDI A;  2UWQ A;  3PV1 A;  3QBV B;  2AYO B;  2HTH B;  1V9J A;  4NY0 A;  2KTF A;  4P7I A;  1OMW A;  3L08 A;  2O6V B;  4MDK E;  3VUY A;  4Z2M B;  3ONS A;  5D7G A;  1GC7 A;  1ZVR A;  3ODO A;  2ZCB A;  2J7Q B;  3OLM D;  3BJI A;  4YON A;  4N9F 4;  3UZT A;  3JSV B;  2CHX A;  5IJM A;  1K5G B;  1WGU A;  2D9Y A;  3QWM A;  3SUZ A;  2DHK A;  2IY0 B;  4LCD E;  3RCZ A;  3WAN A;  2HE7 A;  2RLO A;  4BKS A;  2EC1 A;  1H10 A;  2N7E A;  2K25 A;  2JF5 A;  3RT3 B;  4B6W A;  4FA6 A;  5JLJ B;  4PQ0 A;  2NPT B;  4KHB B;  3H7S A;  1N3H A;  1V5M A;  3R3M A;  2D10 A;  4LJO B;  2N4F A;  2NVU I;  4MK0 A;  4ZRJ A;  2CHW A;  2I5F A;  4PYU A;  1R4M I;  2G3Q B;  4TV3 A;  1WGY A;  4KSL C;  4ZDV A;  3SHQ A;  4URK A;  2Y5B B;  2LGY A;  2KC2 A;  2YLM A;  2XBB C;  3N32 A;  4HXD A;  2PE6 B;  2D3G A;  2LXA A;  2EMS A;  4F7Z A;  1PFJ A;  2J0M A;  4YL8 A;  1V5U A;  5G2N A;  2DAJ A;  2FJ9 A;  1WXM A;  2BF8 B;  3QWZ B;  3ZDM C;  1YD8 U;  4AUQ C;  4BOS C;  3NY5 A;  2K2U A;  2BWF A;  2D9V A;  3CXB B;  2RGF A;  3L10 B;  5JHB A;  4FJY A;  5HE3 A;  4F7G A;  3AI5 A;  3KUC B;  3L54 A;  1FB8 A;  4HDO A;  4ANW A;  3P6A A;  3PG7 A;  4GDK A;  3PRZ A;  1OQN A;  3ODX A;  2DHZ A;  2JY6 A;  2JWZ A;  2L0T A;  1YX6 B;  3OAW A;  2EMT A;  1ZKH A;  3DPD A;  5CHV C;  2G45 B;  1UPR A;  2N9E B;  4GOC A;  1KZ7 A;  3ZRF A;  2A4Z A;  3APD A;  1UEL A;  2R2Q A;  2G4D B;  3D8F A;  2KHW B;  4WSF A;  2IYB A;  4GMV A;  1BAK A;  3PPA A;  2D9Z A;  3VVW B;  5DPT A;  1J0G A;  2LD9 A;  3V6C B;  3WA0 A;  2KJH B;  1WM3 A;  3A9J A;  1KOT A;  4EZK A;  4IAP A;  4TYZ A;  2K1F A;  3A4S C;  4PNK A;  1MK9 B;  2X18 A;  1X11 A;  3NSU A;  2BPS A;  2BWE S;  2FIF A;  2K6Q A;  1TJ6 A;  2YS3 A;  2DX5 B;  4BOZ B;  1TXD A;  2KOX A;  1YQB A;  3HW2 B;  3GYO A;  2DYN A;  4NPN A;  2OJR A;  3X0W A;  2MCN B;  2I5C A;  4W9I A;  2DHI A;  3EHV A;  5AZH A;  5FI0 A;  3QC8 B;  1FOE A;  1V88 A;  3KUZ A;  1IPG A;  3RYT A;  2RUK B;  1E8Z A;  2ELA A;  3FSS A;  2UYZ B;  3DXD A;  4II2 B;  4DXA B;  2QKM A;  2MP2 A;  4EEW A;  1NTI A;  1WJ6 A;  1PMS A;  2KX0 A;  1RAX A;  2ZJD A;  3R7Q A;  3VXW A;  2MDX A;  1TQZ A;  2ZNV B;  2JXX A;  1C1Y B;  1LXD A;  1LM8 B;  4IM3 A;  2RNR B;  1V49 A;  3SDL C;  1VCB A;  5L83 A;  3ZIM A;  4DBB A;  1MIZ B;  2OQB A;  3KH0 A;  4K7U A;  2MP2 B;  2FCM A;  2NBU A;  1BTK A;  5DHA B;  3VH4 B;  4IC7 B;  1ZGU B;  5HKH A;  1WX8 A;  3ZLZ A;  2UZR A;  1P0R A;  3TCA A;  3P7Z A;  2KMC A;  2M0X A;  1L2N A;  5DI9 B;  2DZJ A;  4GDL B;  2B3A A;  1I42 A;  3PVU A;  2MBB B;  1XX0 A;  2M38 A;  4KV2 A;  2BCJ A;  4ZRI A;  1RRP B;  3TVV A;  1LQB A;  4JLC A;  2WX0 A;  2J0K A;  4HAT B;  3DQV A;  4W9E A;  4BBN C;  4NNJ B;  4CHM A;  1P3R A;  5KQ1 A;  2FCS A;  4W9J A;  3ENE A;  1EAZ A;  1UD7 A;  2N23 A;  5D3W A;  4TQ1 A;  2LGX A;  4IUM B;  2KTR B;  2D07 B;  1OTR B;  3V61 A;  1FHX A;  1WX9 A;  3UF8 A;  2QHO A;  4W9K A;  3O96 A;  1E8W A;  3FEH A;  4WJN A;  4W9C A;  4GZU A;  4AOF A;  4TQ0 A;  2LYD A;  2DZI A;  1UH6 A;  2IO1 B;  2MQJ A;  4IM2 A;  1WI1 A;  4WWO A;  3S2A A;  1FHW A;  3UIN B;  2DX1 A;  1WJ1 A;  2G35 A;  1E90 A;  2NMB A;  1WJM A;  1EUV B;  4K2P A;  2BKR B;  5HE1 A;  1WMH A;  2GBK A;  2LJ5 A;  2LVQ A;  3NS8 A;  5CHF A;  3VHT C;  4GU2 A;  5AZG A;  1Q67 A;  4DHJ D;  2VKI A;  4KIK B;  4W9D A;  4BKT A;  4I6N B;  3QCA A;  5DHF B;  1WR1 A;  2AWT A;  2NS5 A;  5CX3 A;  2N9X A;  4MGI E;  3BIN A;  2KZR A;  2D2Q A;  3PSE B;  4A5K A;  1OEY J;  3L17 A;  4II3 B;  4RMA A;  1SHC A;  4NSW A;  1WMH B;  5L81 A;  3DBL I;  2LXC A;  3QAR A;  1WXV A;  2KQS A;  2RPQ A;  1TBE A;  2MBQ A;  3HQC A;  2KVR A;  1P98 A;  1MIX A;  3ZW3 A;  1Q1O A;  1U5F A;  5DPR A;  3F5R A;  4JGH B;  1NTY A;  2G4S A;  2L8J A;  3ECI A;  1W1G A;  2GBN A;  2WH5 A;  2MSE D;  3QIJ A;  2KCJ A;  3ZDT A;  2BYE A;  4MGK E;  1UNQ A;  3G9W A;  1X05 A;  4GPT B;  1WGH A;  3EFU A;  3VUX A;  1G6J A;  1H4R A;  1Y8R C;  4RM9 A;  3UIO B;  3TL5 A;  3AU5 A;  4BKS D;  2KK8 A;  4FHJ A;  2L1C A;  1PLS A;  2COA A;  3W1Y A;  4HAX B;  5C79 A;  2HD5 B;  1HB6 A;  2KFK B;  2XEW A;  4AJY B;  4NAW B;  5BO4 B;  2EJ8 A;  4HAU B;  5J3Q A;  5J3Y A;  2Y8F A;  1Q5W B;  2KFJ A;  1Q0W B;  2ZVN A;  3DOW A;  3VTV A;  4G11 A;  3ML4 A;  4MY6 A;  2YT0 A;  4ANU A;  3IG3 A;  4K1R B;  3LJU X;  3NOB A;  4X57 B;  4IM0 A;  1WZ3 A;  1DDW A;  2Z0O A;  2L00 B;  3T8M A;  1MK7 B;  3WIM A;  1UPQ A;  4IFS A;  2O6V D;  4HAV B;  4MT7 A;  2JT4 B;  3A4R A;  2CR5 A;  3CSF A;  4CYE A;  4HPM B;  5JHH A;  1W1D A;  5L95 C;  1WGR A;  1HB8 A;  1S3S G;  5AZF A;  4IOY X;  5IA7 A;  3PVW A;  1FGZ A;  2P0D A;  2FJL A;  4NAW A;  3UQB A;  3A8P A;  2L7R A;  1M94 A;  2MX2 A;  1RJ2 A;  5IAA C;  3HM3 A;  1ACA A;  4DHZ E;  4XWX A;  3N7C A;  5G55 A;  2Z0P A;  1NTV A;  2KLC A;  4M8N A;  5EDS A;  2DYO A;  4K17 A;  3PSC A;  2RSG A;  3DVN V;  3PEG A;  1X86 A;  3H6N A;  4GSW A;  3TO1 A;  3KYC D;  3U8Z A;  4ICU A;  4MEL A;  5C23 A;  4DBG A;  3ZUN A;  2CY4 A;  1DRO A;  2N0Y A;  2JPH A;  3A98 B;  4GXB A;  2KNB A;  3O65 B;  1CMX B;  3PHW B;  5TR5 A;  3PVL A;  1UZX B;  4W9H A;  1ZW7 A;  1FAO A;  2CB8 A;  2J59 M;  1WJN A;  2ABD A;  3CMM B;  3IBE A;  4ZRK A;  1V80 A;  1B55 A;  4MEM A;  3UGB B;  2KMA A;  1NI2 A;  3ZTD A;  2XK5 B;  2OOB B;  3UIP B;  4RM8 A;  4E3C A;  4IW0 A;  2FCN A;  2BYV E;  2MRP A;  1MKE A;  4HCN B;  4IWP A;  3SD5 A;  4B95 A;  1YX5 B;  2CQU A;  2CRF A;  3QK0 A;  4FBJ B;  1I35 A;  4MJS B;  3ODW A;  4EZL A;  2C9W B;  4BVU C;  4EJN A;  2FAZ A;  3JSV A;  3RD2 A;  1GG3 A;  2MWS B;  2FCQ A;  1DDV A;  4A6F A;  4AJW A;  4FJZ A;  2C7M B;  3MPX A;  3A9K A;  4FJV B;  1RLF A;  1AAR A;  4KHO A;  2DYB A;  2JRI B;  2W9N A;  3NZS A;  3FM8 C;  4G50 A;  2GJY A;  3B0A A;  5DPW A;  1XT9 B;  3DVG X;  4LDT B;  1SGH A;  2COC A;  4G3X B;  1DBH A;  3SNH A;  2O2V A;  2XK5 A;  2ZCC A;  4HVB A;  4DK5 A;  1XQQ A;  1E7V A;  2CHZ A;  2I1J A;  2CY5 A;  2DLW A;  4Z2N A;  3A9J B;  3HIZ A;  3H7P B;  1U4A A;  5E6P A;  1XR0 B;  2NBW B;  4CO7 A;  3P2B A;  4MJS A;  2LZ6 A;  3OJ3 A;  2WWZ A;  4HCP B;  3DVN U;  1WJ4 A;  3KY9 A;  5JH5 C;  2O2V B;  2N7D A;  2VRR B;  1KLV A;  3ZVR A;  1BT0 A;  5HE2 A;  2MBH A;  3VTW A;  2KJR A;  2DAF A;  4FHK A;  1FHO A;  2UZS A;  1TGZ B;  1X1M A;  3IVF A;  2ADZ A;  2YT1 A;  2RSU A;  3PLU A;  3LDZ E;  3HHM A;  1U29 A;  1U5D A;  1ZM0 A;  2C60 A;  2RD0 A;  1XKE A;  2XQN M;  1F9J A;  2M17 A;  3MHS D;  5JHA A;  4KAX B;  1KM7 A;  3D8D A;  3AUL A;  4EUT A;  1A5R A;  5J17 A;  1Y19 B;  4JIO U;  2JZ3 B;  2K8B A;  3AXC A;  3SU8 X;  3QHT A;  2YRY A;  1ISN A;  3PS6 A;  4OVU A;  2DA0 A;  1T0Y A;  4TUU A;  2D4Q A;  1V5T A;  3KVF B;  1K8R B;  4F1S A;  2ELB A;  4A6H A;  2D9W A;  3PRE A;  4A20 A;  1YJ1 A;  4BKG A;  2CU1 A;  4MM3 A;  1UGM A;  1U5E A;  5D2M B;  2LWP A;  4JL9 A;  4I6L B;  1ST7 A;  1GC6 A;  2BYF A;  2V3S A;  2V1Y A;  1P1A A;  3A1Q B;  3OJ4 B;  3TMP B;  3PZD A;  4ASW C;  3RZF A;  2DYQ A;  3KUD B;  2DX5 A;  2W2W A;  2GOW A;  4MH0 E;  4WJP A;  5KCV A;  2QKL A;  4L6E A;  2JVC A;  1EF1 A;  5D6J B;  2FNJ B;  5GOW B;  2Z0D B;  1W1H A;  3SO6 A;  5KQ4 A;  4KHA A;  2DZM A;  2Z59 B;  4ICV A;  4E71 A;  3U7D A;  2M1M A;  2V4L A;  4ANV A;  2KWV B;  3V6E B;  3FLV A;  4HWI B;  3DCG A;  1I2H A;  3QQ8 B;  2MKR A;  4WAA A;  2LG1 A;  4M8M A;  3SV1 A;  3EPY A;  2Z0E B;  3JVZ X;  1E8X A;  4HAW B;  2KAN A;  1WJU A;  2ZZP B;  3B08 A;  1U2B A;  3IHP C;  3L13 A;  1WXA A;  2L05 A;  5LXH A;  1WYW B;  2R2O A;  3A1Q A;  2YS1 A;  4GMX B;  2RVB B;  3PLV A;  2LOZ A;  2KFK A;  1NVL A;  2ZVO A;  4NJ6 A;  1E7U A;  1Z5S B;  2ZPY A;  2WYQ A;  1KZG A;  2N1W A;  2HTH A;  3V60 A;  4BFR A;  2ROZ B;  1QZE A;  4W9F A;  5CLL B;  1HE8 A;  2IO3 B;  2R09 A;  1XD3 B;  3GOE A;  1WZ0 A;  5GMV A;  5JHG A;  1JRU A;  3RCP A;  1R4N I;  4DWF A;  1WGG A;  1BTN A;  2L3Z A;  3KZ1 A;  4W9L A;  5KHO A;  2IBI B;  2KN5 A;  4F8C B;  5LOP B;  1OY2 A;  4HLE A;  2Z0Q A;  4NQL B;  4M0W B;  2LGD A;  4A6F B;  4GB9 A;  3H1U A;  4KSK C;  1V6E A;  2COP A;  1LW3 A;  1V61 A;  4KDL B;  3NZU A;  2W2X D;  5DPS A;  5LLI A;  5HE0 A;  3V62 A;  3ZNG C;  5E6O A;  1C3T A;  3T9L A;  1L7Y A;  4KDI C;  2NPT A;  3FP5 A;  4PS3 A;  4IG7 B;  1EGX A;  5EFX A;  4CHJ A;  4FUL A;  4PYZ A;  3TIX A;  4DHZ B;  3BY4 B;  3M1I B;  4WVF B;  4OVV A;  4HAZ B;  4DX9 0;  2LOX A;  2DEN B;  1V86 A;  2IO0 B;  3KYD D;  3WAP A;  4F7H A;  3PT2 B;  4KZC A;  2MW5 A;  2PPH A;  4KVG B;  3VH3 B;  4GIV A;  2DFK A;  1OEY A;  4F7U P;  4MGZ E;  3U30 A;  3WAO A;  1M7R A;  2COF A;  3QJZ A;  2M4N A;  4HB2 B;  4K2O A;  3RUI B;  3UQA A;  4BBN F;  4NJ7 A;  1YIW A;  3D32 A;  1LB1 A;  1S1Q B;  2VSZ A;  4WWP A;  2L76 A;  3DBR I;  1WM2 A;  3Q3F A;  2L0F A;  3TBL D;  1WGD A;  2EKE C;  3LJ3 A;  2IZV B;  2RQ1 A;  1M7E A;  2KC1 A;  3MTN B;  1BWN A;  2LKO A;  3HK0 A;  4IWQ A;  5C5B B;  2MA9 B;  4DX8 A;  2HJ8 A;  1NDD A;  1XOD A;  3RUL A;  2I1K A;  2CKH B;  2KKC A;  1P5T A;  1J8C A;  3PRP B;  1XCG A;  3DBH I;  3JYU A;  2DZK A;  4WJO A;  1E5W A;  2KDE B;  1UBQ A;  2GBR A;  3DBS A;  4CHK A;  3T06 A;  3A9K B;  4G0N B;  1V89 A;  1EVH A;  2W2X C;  2J0J A;  1MG8 A;  3A8Q A;  2Y8G A;  2GBJ A;  2KXJ A;  2ZEQ A;  4B9K A;  2UVM A;  1H8C A;  4MSQ B;  4EZJ A;  3PRM B;  5C1Z A;  1WXS A;  3PP2 A;  1RFA A;  1OGW A;  1V5P A;  4BBK A;  4WJQ A;  4K7W A;  3APF A;  3EEC A;  3ZVV A;  2DYM A;  3A33 B;  1GNU A;  1IYF A;  2NCN A;  3VOQ A;  2GBM A;  2COD A;  1MAI A;  5FI1 A;  2MLB A;  1AQC A;  3NHE B;  2JUO A;  4LJP B;  1J19 A;  2AEH A;  3KRX A;  4HB3 B;  2D11 A;  5C6R A;  3PGE A;  4LDT D;  3VUW A;  2DN6 A;  4HB4 B;  1WFY A;  2IO2 B;  3VIA A;  2M8S A;  2GCJ A;  2WX1 A;  2NR2 A;  3OAN A;  3N30 A;  3R7R A;  1V81 A;  1J0W A;  2D9X A;  3Q3J A;  3JW0 X;  3GYP A;  4WJ7 A;  3R66 C;  4EMO A;  5FR6 A;  3K9O B;  4HK2 A;  5J2R A;  3MJW A;  1U27 A;  2GS0 A;  2AL6 A;  1P3Q U;  1IRS A;  3ULB A;  3DDC B;  3H9D A;  3HM6 X;  4IWO A;  3ZTC A;  2PZ1 A;  1MPH A;  2CAY A;  3ML8 A;  4K7S A;  4DDG D;  2KUP A; 
#chains in the Genus database with same CATH topology
 3ZNI D;  1PGX A;  1AYF A;  4Q2J A;  3IFW B;  3IHP C;  2IY1 B;  2KO3 A;  3NS1 A;  4LNN A;  3RZW C;  2WQY B;  2IFS A;  5CLQ B;  2WS3 B;  1WG7 A;  2P0F A;  2RGN B;  4PS7 A;  3TJP A;  3A58 A;  1QC6 A;  2A5U A;  2J42 A;  3DHI C;  1Z2M A;  2FUH B;  2DKQ A;  2LAS A;  4JWU C;  4HDQ A;  2KD0 A;  2GMI C;  1P6S A;  1QQG A;  3GP7 A;  4N58 A;  1KI1 B;  1ZDX A;  4HPL B;  4A55 A;  1RYJ A;  2W55 A;  2K8C A;  5D3X A;  3WAL A;  4FAD A;  1SE9 A;  3B2F A;  1WX7 A;  2KTR A;  1AWD A;  3QAQ A;  3CST A;  3O13 A;  2K8H A;  4WWM A;  3X23 A;  2MWN B;  2RDB C;  2MHJ A;  2KWC A;  5C5B A;  1D4B A;  4ILJ A;  4I6P A;  1EM7 A;  1UNR A;  1D3Z A;  3GZN I;  2K6D B;  5J3T A;  3AE2 B;  4JK9 A;  2ROV A;  2MBO A;  4DDI D;  4C0A A;  1WY8 A;  1YN4 A;  3ZO5 B;  5D3V A;  1ZYI A;  4OT1 A;  5DIF B;  2C7H A;  4C4V A;  5EE1 A;  1K51 A;  1TKY A;  4ANX A;  2KDF B;  1DOI A;  2NMQ A;  2KQ7 A;  4MSM B;  3ZRC A;  2G9H D;  2M14 A;  2VRW B;  3TFM A;  1E8Y A;  3AM9 A;  3APC A;  1R7S A;  2GCL A;  3M62 B;  5AEK B;  2AL3 A;  1EU3 A;  3SFD B;  1ZC4 B;  2B76 B;  4JKD A;  4QJ5 B;  4A3P A;  1NYQ A;  2INC C;  2KDI A;  3R2I A;  3QBV B;  1V9J A;  3VRB B;  3URY A;  2O6V B;  4MDK E;  3ODO A;  1NVI D;  1F2R I;  1UWM A;  3KWV A;  4C56 C;  1T5X D;  1QLB B;  5IJM A;  2D9Y A;  2QCZ A;  4LCD E;  2HE7 A;  2RLO A;  1KTK A;  1H10 A;  2JF5 A;  2L1A A;  1E10 A;  1FM0 D;  4KHB B;  3H7S A;  2NVU I;  2IND C;  5I2M A;  2WU2 B;  1CZP A;  2HDE A;  4URK A;  2Y5B B;  1T0Q C;  1ET9 A;  2J0M A;  2DAJ A;  3QWZ B;  1WXM A;  2BF8 B;  3NWF A;  1RWS A;  1RFK A;  3CXB B;  5JHB A;  3AI5 A;  1SE2 A;  4DXF A;  4L23 A;  4GDK A;  3RPF C;  1XCQ L;  2PTL A;  4O1N A;  3ZRF A;  1KZ7 A;  3HSA A;  3APD A;  2R2Q A;  4MAC A;  3D8F A;  2KHW B;  4WSF A;  2PVO D;  1J0G A;  2LD9 A;  4M01 A;  1KOT A;  4IAP A;  4TYZ A;  2JU6 X;  3A4S C;  2X18 A;  2BWE S;  4JKE A;  2V4I B;  2KOX A;  1TXD A;  2BBC A;  2I5C A;  2LJI A;  4W9I A;  5JVL A;  1SXT A;  2RUK B;  3AED B;  2ELA A;  3FSS A;  1VJK A;  4II2 B;  4UDU C;  1JDE A;  1ENF A;  1XF5 L;  3C19 A;  1NTI A;  2GI9 A;  1PMS A;  3R7Q A;  3VXW A;  1LXD A;  1LM8 B;  4IM3 A;  2YT2 A;  1SSN A;  3ZIM A;  3HUI A;  2OQB A;  2WLB A;  4NZL B;  2PW9 A;  5DHA B;  1FNW A;  1RM6 C;  1WX8 A;  3ZLZ A;  2KMC A;  3P7Z A;  2DZJ A;  1I42 A;  4KV2 A;  2MBB B;  2LGS A;  2BCJ A;  1LQB A;  3VAW A;  4LNK A;  4HAT B;  1P3R A;  5KQ1 A;  1EAZ A;  5D3W A;  4IUM B;  2D07 B;  1WX9 A;  2QHO A;  3FEH A;  1I4P A;  4W9C A;  4AOF A;  3PO0 A;  4WWO A;  2IGD A;  2DX1 A;  2G35 A;  2ZNV B;  4JWS C;  5HE1 A;  5AZG A;  4DHJ D;  1FXI A;  4W9D A;  3QCA A;  3L4P A;  2N9X A;  2KZR A;  1WRI A;  3PSE B;  4L1R A;  2H88 B;  1OEY J;  4II3 B;  4NSW A;  3AH7 A;  4P1C C;  2QIE B;  1FFU A;  4C80 A;  1TBE A;  3HQC A;  3DBL B;  1U5F A;  2OJW A;  4JGH B;  1NTY A;  3AE8 B;  3RNF C;  1C77 A;  1WXQ A;  3QIJ A;  3TEZ A;  1MG4 A;  2BYE A;  4GPT B;  3VUX A;  1G6J A;  1N63 A;  3AU5 A;  2COA A;  1J7C A;  3W1Y A;  1TS2 A;  2XEW A;  5BO4 B;  2BT6 A;  2JYE A;  2ZVN A;  4OZC A;  2IGG A;  3TEW A;  3ETR A;  1KFY B;  2X38 A;  2KWD A;  4IM0 A;  3T8M A;  1UPQ A;  2O6V D;  4HPM B;  1W1D A;  1S3S G;  4RNA A;  4IOY X;  2FJL A;  2WXM A;  2L7R A;  1RJ2 A;  5IAA C;  4C4V B;  3HM3 A;  2JX5 A;  4DHZ E;  4XWX A;  1VRA B;  4M8N A;  2DYO A;  1X86 A;  1E9M A;  3ZUN A;  4K3B A;  2N0Y A;  2JPH A;  2KNB A;  1CMX B;  4W9H A;  1FAO A;  2CB8 A;  2KUQ A;  1WJN A;  3SBT A;  4ZRK A;  1L5P A;  4NAM A;  4IWP A;  4B95 A;  2R82 A;  1XXG A;  3JSV A;  1GG3 A;  2FCQ A;  4J3O D;  4FJZ A;  3MPX A;  2Y5P A;  5MPO A;  1AAR A;  3NZS A;  5EE3 A;  3FIL A;  4G50 A;  3B0A A;  1OQR A;  3IXS A;  4LDT B;  2COC A;  3SNH A;  2D3A A;  1YQ3 B;  3DBR B;  1XQQ A;  2I1J A;  1K53 A;  3AV8 A;  3H7P B;  1U4A A;  1A70 A;  4MJS A;  4HCP B;  3EA6 A;  1QOA A;  1BT0 A;  2X0S A;  1T3Q A;  1X1M A;  4QXA B;  1KLG D;  2ADZ A;  2YT1 A;  1TGZ B;  2RSU A;  3RNA C;  3LDZ E;  3HHM A;  1ZM0 A;  1ESF A;  5HHD G;  3AUL A;  1Y19 B;  1C4P A;  4JIO U;  5AUK A;  4TUU A;  3BWU D;  3NZ3 A;  1K8R B;  2EEL A;  1JRO A;  3PRE A;  4A6H A;  2D9W A;  3AEF B;  4IOI E;  1YJ1 A;  1TS4 A;  2CU1 A;  3BZD B;  2NTS A;  1ST7 A;  3OJ4 B;  1I4X A;  4M02 A;  3TMP B;  3PZD A;  3ZYY X;  3RZF A;  2DYQ A;  2DX5 A;  2GOW A;  2PVG C;  5KCV A;  2FNJ B;  4E71 A;  2Z59 B;  3ZJT A;  1JWA D;  1ZE3 D;  3V6E B;  3V05 A;  2MKR A;  4WAA A;  1DGJ A;  2LG1 A;  4WUR A;  1TZO A;  3Q14 C;  2ZZP B;  4BAX A;  1U2B A;  3MC0 B;  5IRS A;  2DIK A;  1UNS A;  4GMX B;  3PLV A;  3LB8 C;  2KFK A;  2WDV B;  2ZVO A;  1Z5S B;  3Q6B A;  3U7Z A;  3V60 A;  4M0W A;  4LTU A;  2RDG A;  2R09 A;  1XD3 B;  3GOE A;  1R4N I;  1HZ5 A;  2PMV A;  2KN5 A;  4F8C B;  4HLE A;  2K9X A;  4A6F B;  4GB9 A;  1V6E A;  1LW3 A;  1V61 A;  1ET6 A;  5DPS A;  2PIA A;  1L7Y A;  2NPT A;  4IG7 B;  4CHJ A;  1MPE A;  3BY4 B;  3M1I B;  1E6E B;  4HAZ B;  1V86 A;  4F7H A;  4XWT A;  4GIV A;  2DFK A;  3U4E G;  3U30 A;  2M4N A;  3UQA A;  3D32 A;  1DOY A;  2L0F A;  1WGD A;  2EKE C;  3LJ3 A;  4P16 A;  5H92 C;  2IZV B;  1XLQ A;  2HJ8 A;  2I1K A;  1FPY A;  2WXK A;  5HFY A;  3DBH I;  3DBS A;  1IGC A;  3A9K B;  1WGK A;  2J0J A;  2KXJ A;  2Y8G A;  2UVM A;  4MSQ B;  2LMC A;  1RFA A;  4WJQ A;  1V5P A;  4BBK A;  3FAH A;  3NJT A;  1Q10 A;  1FRD A;  2MLB A;  2COD A;  1AQC A;  4W9K A;  4LDT D;  5C6R A;  2R61 A;  1FNU A;  2BQQ A;  1WFY A;  4L2Y A;  3LXF A;  2Z13 A;  2M8S A;  4BZA A;  3NWA A;  3Q3J A;  3RI7 C;  3JW0 X;  3U12 A;  5FR6 A;  1U27 A;  1MPH A;  3E9L A;  4HKQ A;  4K7S A;  1P0R A;  3AJ4 A;  2E2X A;  4GGQ A;  1D5M C;  3ALB A;  5LON B;  2GLS A;  1JWM D;  1F0Z A;  2LRU A;  3CF6 E;  1L0Y B;  2Q13 A;  2PE9 A;  3T3O A;  1I7A A;  2WXQ A;  4M00 A;  4B6H A;  4KIK A;  1ACC A;  4KGT A;  1PQS A;  2NZ8 B;  1K52 A;  2PJH A;  3KW5 B;  1YOV B;  2KX3 A;  4JQW C;  4K3C A;  3DWM A;  1V2Y A;  2VH2 A;  3TW1 A;  3ZGZ A;  3I3T B;  3I9V 1;  3ABV B;  2PEA A;  1WF9 A;  1I4Q A;  4HEA 1;  4HSI A;  1GUA B;  2LBB A;  5LG4 B;  1DDM A;  3H8H A;  4E74 A;  4XX5 A;  2H7E A;  1WR6 E;  1P9D U;  3Q8C A;  2ZNV C;  3B1L X;  1FO4 A;  2K49 A;  2MBE A;  2K2J A;  4K81 A;  1I7H A;  1MI0 A;  3J9C A;  4JE3 B;  4GDL A;  1PUT A;  3AU4 A;  2DHJ A;  1N6Z A;  1UWX A;  1LFD A;  1SJE D;  3W1S A;  4KZ0 A;  1HBK A;  1UBI A;  2KLG A;  1VZ6 A;  4HB0 B;  2RR9 A;  2LGI A;  3ULC A;  3KRW A;  4DHJ B;  2REX A;  2Y7B A;  3P4R B;  1CK1 A;  3VQI A;  1ROE A;  2Z4D A;  2C7N B;  3EC8 A;  3QX1 A;  5DCN A;  2BKF A;  4TKN A;  1GJZ A;  2C5L C;  1V5O A;  2N9P C;  3ZKJ C;  4HHV A;  1PYW D;  2IJ0 A;  1JAL A;  1WWT A;  2AYO B;  1C79 A;  3FC4 A;  4NY0 A;  5BMI A;  4P7I A;  1L6V A;  2WU5 B;  2BS3 B;  3VUY A;  3BJI A;  1GGO A;  2K8E A;  4N9F 4;  3ZJV A;  1WGU A;  3IT6 B;  3WAN A;  3SUZ A;  1V97 A;  2ZKM X;  4BKS A;  2N7E A;  1SJH D;  5JLJ B;  2AQ2 B;  4LJO B;  4ILH A;  2CHW A;  1R4M I;  2G3Q B;  3MC9 A;  1F1H A;  2PLP A;  3AEA B;  1R4N B;  5IKC M;  4HXD A;  3N32 A;  2XBB C;  2KAJ A;  2D3G A;  2LXA A;  2RDH A;  4AUQ C;  3NY5 A;  2ACZ B;  2BWF A;  1B9R A;  3L54 A;  1HQR D;  1FB8 A;  3PG7 A;  2JY6 A;  2JWZ A;  2ONQ A;  3OAW A;  2K5P A;  2EMT A;  2BB5 A;  2IYB A;  4A90 A;  3A9J A;  4EZK A;  1QQR A;  4MGZ E;  4YTP B;  2KDM A;  4PNK A;  2K6Q A;  1X11 A;  1IGD A;  2RPV A;  4BOZ B;  1TJ6 A;  1YN3 A;  3HW2 B;  2N9L A;  3KUZ A;  3N1Z C;  3RYT A;  2QKM A;  4EEW A;  3IAM 1;  2KX0 A;  1TQZ A;  1C1Y B;  1SBB B;  1YJI A;  2RNR B;  4DBB A;  1MIZ B;  3KH0 A;  2MP2 B;  2FCM A;  1M4V A;  1ZGU B;  1N60 A;  2M0X A;  2BTE A;  1L2N A;  4N6E B;  3PVU A;  3TVV A;  4W9E A;  5AZH A;  3DQV A;  4YXD B;  1TKE A;  3MJ5 A;  2N23 A;  2LGX A;  3HRD D;  1FHX A;  1DOX A;  1YNT E;  3O96 A;  5C2T B;  4IM2 A;  1UH6 A;  2IO1 B;  2MQJ A;  1WI1 A;  1FHW A;  1E90 A;  1WJM A;  1EUV B;  2LJ5 A;  1WMH A;  3B2G A;  3NS8 A;  3VHT C;  4A6Q A;  1Q67 A;  2VKI A;  1GB1 A;  4BKT A;  3DBH B;  4I6N B;  5DHF B;  1WR1 A;  2AWT A;  4MGI E;  2D2Q A;  4A5K A;  4ZRP A;  2FBW B;  4RMA A;  1WXV A;  2KQS A;  3Q2A C;  1MIX A;  2K0P A;  4WQM A;  2GBN A;  2BW2 A;  2KCJ A;  3EFU A;  3AMZ A;  1JML A;  1H4R A;  1TT5 B;  4RM9 A;  3UIO B;  3TL5 A;  1MVK A;  4FHJ A;  4ZRQ A;  4R3D A;  2HD5 B;  1HB6 A;  2N7J A;  1HXY D;  1FNV A;  3DOW A;  2KFJ A;  3WCQ A;  1Q0W B;  4MY6 A;  2YT0 A;  3IG3 A;  4K1R B;  5IO9 A;  3NOB A;  3TEX A;  1WZ3 A;  1DDW A;  5I2S A;  3WIM A;  1MK7 B;  4HAV B;  4MT7 A;  3NG0 A;  5JHH A;  1WGR A;  1BXT A;  5AZF A;  3RN9 C;  3PVW A;  2P0D A;  1MJD A;  2YEP F;  2UU7 A;  3BYY B;  2WXO A;  3N7C A;  5G55 A;  2KLC A;  2V9H A;  3PEG A;  5C23 A;  3AE1 B;  2CY4 A;  4GXB A;  3A98 B;  3PHW B;  3N20 C;  3PVL A;  2NTT A;  5BYQ A;  1ZW7 A;  1KF6 B;  2J59 M;  3CMM B;  2ABD A;  1V80 A;  4MEM A;  3DWG C;  2K22 A;  2XK5 B;  2BYV E;  2MRP A;  3SD5 A;  4A9A A;  2CRF A;  2QIL A;  4EZL A;  4BVU C;  2FAZ A;  3NVV A;  2DYB A;  2W9N A;  1JW9 D;  3HIE A;  1T0R C;  1SGH A;  1DBH A;  2WXP A;  2ZCC A;  5BYS A;  1SEB D;  1E7V A;  2CY5 A;  2DLW A;  1Y56 A;  4CO7 A;  1KC7 A;  1XR0 B;  1WYG A;  1V8C A;  4JX1 C;  2O2V B;  2N7D A;  4D6W A;  1KLV A;  3E9S A;  3Q3N C;  5HE2 A;  2KJR A;  3EFC A;  1XCT L;  4LNO A;  1XEE A;  3PLU A;  1XKE A;  2XQN M;  1F9J A;  4KAX B;  2JZ3 B;  3AXC A;  2YRY A;  2DA0 A;  3RFZ B;  5FK9 C;  2V3N A;  3AEG B;  4MM3 A;  5D2M B;  2BYF A;  2V3S A;  4LK0 M;  5IA7 A;  4GLS C;  2XN9 C;  4MT5 A;  4L6E A;  2JVC A;  5GOW B;  5KQ4 A;  2KWV B;  4HWI B;  1I2H A;  2QJL A;  1L0X B;  3EPY A;  3JVZ X;  4RF1 A;  3L13 A;  2L05 A;  5BMG A;  1OFF A;  2YS1 A;  3HVD A;  4NJ6 A;  1E7U A;  1KZG A;  2IO3 B;  5GMV A;  4KGS A;  3BK2 A;  1VBH A;  4W9L A;  5KHO A;  2COP A;  1JQ4 A;  3NZU A;  2W2X D;  5LLI A;  1CJE A;  3MC8 A;  5EFX A;  3TIX A;  4GNK B;  4KZC A;  2MW5 A;  3VH3 B;  1I4R A;  3WAO A;  5D3I B;  2COF A;  3QJZ A;  4HB2 B;  1GAQ B;  4ZYS A;  1YIW A;  3BYT B;  3R2T A;  3Q3M C;  2VSZ A;  4WWP A;  4YSY B;  3DBR I;  3TBL D;  1YN5 A;  3B77 A;  2RQ1 A;  1BWN A;  3OG5 A;  5C5B B;  3OWE B;  1V1O A;  2NBV A;  4WJO A;  2DZK A;  4KKI A;  1D6E C;  2KDE B;  2GBR A;  4XE0 A;  2Z14 A;  3UI3 A;  3T06 A;  3OHM B;  1MG8 A;  2JYT A;  4B9K A;  2ZEQ A;  4XDC A;  4EZJ A;  3PRM B;  5C1Z A;  2QSD A;  1OGW A;  3ZVV A;  3APF A;  3EEC A;  2LHD A;  2DYM A;  1MHH E;  5HG2 A;  3VOQ A;  4LJP B;  1MAI A;  3VUW A;  5JHA A;  2AEH A;  2D11 A;  4HB4 B;  3P42 A;  2GCJ A;  2WX1 A;  2NR2 A;  3OAN A;  4MH8 A;  3R7R A;  1V81 A;  1J0W A;  4P6V F;  2GS0 A;  1P3Q U;  1IRS A;  3ULB A;  3DDC B;  5C3J B;  3ML8 A;  4DDG D;  3C8Y A;  3D8E A;  3V5W A;  3CIK A;  1RRB A;  4WQO B;  1L6U A;  2YSZ A;  1EO6 A;  1Z87 A;  3WYF B;  2BGF A;  2LVO A;  1TZ1 A;  4MGY E;  4FN2 A;  4XC2 A;  1I35 A;  1SIF A;  1WE7 A;  2K39 A;  3VTV A;  5LXI B;  1DYN A;  2LRW A;  1Y5O A;  4HAY B;  1X1F A;  1KJT A;  1QOF A;  1FCL A;  2YS5 A;  4AP4 C;  4A8X C;  2L2I A;  3ZNH B;  4EOY A;  4EFO A;  5CTR C;  3GE3 C;  4NQK E;  1D5X C;  1J7B A;  3VDZ A;  2HRJ A;  2JRH A;  2K3U A;  3DVG Y;  2YF0 A;  4ZYN A;  1UNP A;  2Z8L A;  1ZPS A;  4C00 A;  1ZC3 B;  1FXT B;  3PZ8 A;  4HPP A;  1XLN A;  2LVP A;  4GN1 A;  2FID A;  2DTC A;  5CHW A;  5G5G A;  4PK1 A;  4A6K A;  2KDB A;  4D0N B;  1VD2 A;  2V76 A;  5DH9 B;  1BML C;  3L16 A;  4GDK B;  2KGX B;  1XO3 A;  2DKP A;  3F0W A;  4J6I A;  2J53 A;  1WIA A;  3C0R B;  2KVZ A;  3M3J A;  1LO5 D;  3DXE A;  2LI5 A;  4W9G A;  2IYD B;  4CSQ A;  3NVZ A;  1HTQ A;  2J4X A;  2MJE A;  4ZHO A;  1U5G A;  2ZPN A;  2FDQ A;  2P0H A;  1ZXH A;  2LUL A;  1WVH A;  4WH4 A;  5D3Y A;  1UEF A;  2WDR B;  3VRA B;  2GUM A;  1MHX A;  1VZ7 A;  4JKF A;  2K00 A;  2O6V A;  2YEP B;  2H7D A;  3PV1 A;  1PGB A;  2HTH B;  2KTF A;  4Z2M B;  3ONS A;  1ZVR A;  3IAS 1;  4OVZ A;  2ZCB A;  3UZT A;  1V1P B;  2CHX A;  1K5G B;  1GPX A;  3W5U B;  2IPK D;  4NJC A;  2EC1 A;  4B6W A;  4H2A A;  5FR3 A;  4PQ0 A;  2D3C A;  2NPT B;  1N3H A;  2N4F A;  2I5F A;  4TV3 A;  2KR0 A;  4LLG M;  1WGY A;  3SHQ A;  3AE6 B;  2W3R A;  2PE6 B;  1KLU D;  4YL8 A;  1V5U A;  2HJ1 A;  3SEB A;  1YD8 U;  2K2U A;  1T6B X;  2G1E A;  3L10 B;  3NW8 A;  4F7G A;  4PT5 A;  3P6A A;  2DWQ A;  3PRZ A;  1OQN A;  3ODX A;  2CU3 A;  2DHZ A;  2KAC A;  2L0T A;  1YX6 B;  1ZKH A;  2D5G A;  3DPD A;  2N9E B;  4GOC A;  1UEL A;  1E0Z A;  5JXV A;  1BAK A;  4GMV A;  3PPA A;  3VVW B;  2D9Z A;  3I57 A;  3P4Q B;  5DPT A;  2M56 B;  2KJH B;  4YSX B;  2VZK B;  4A3O A;  2BPS A;  2WX0 A;  3NSU A;  2WXI A;  2WDQ B;  3VR9 B;  2DX5 B;  4JKA A;  4NPN A;  2OJR A;  5GXG B;  2MCN B;  2LHE A;  2DHI A;  3EHV A;  5FI0 A;  3QC8 B;  1FOE A;  3RNG C;  1IPG A;  1EU4 A;  1E8Z A;  3KQ4 A;  2L52 A;  2RRF A;  2UYZ B;  4DXA B;  1STE A;  2MP2 A;  4OW0 A;  1XLP A;  4RGO S;  2ZJD A;  2EKI A;  2JXX A;  5AUI A;  1V49 A;  3SDL C;  3FIL B;  2NBU A;  1BTK A;  3VH4 B;  5HKH A;  2UZR A;  2BS2 B;  5DI9 B;  1F77 A;  2B3A A;  1PDX A;  1XX0 A;  2M38 A;  3SFE B;  4ZRI A;  4JPS A;  4JLC A;  3W5V B;  4NNJ B;  4CHM A;  4W9J A;  4YTN B;  3ENE A;  1UD7 A;  4TQ1 A;  2QEJ C;  3N9Y C;  3V61 A;  3UF8 A;  4TQ0 A;  4GZU A;  1KH0 A;  4LNF A;  3S2A A;  5IN7 A;  3UIN B;  1QF6 A;  1WJ1 A;  2BKR B;  2WXL A;  4HKZ E;  3LYY A;  1I4H A;  4KIK B;  2J52 A;  3BIN A;  1PFD A;  1PGA A;  1SHC A;  3DBL I;  2RPQ A;  4JKG A;  1P98 A;  3BVZ A;  4RH6 A;  3ZW3 A;  5DPR A;  3F5R A;  2Z59 A;  2L8J A;  1N61 A;  3AE7 B;  1W1G A;  1FIQ A;  2MSE D;  3ZDT A;  1UNQ A;  3G9W A;  1UUP A;  3TSS A;  1T0S C;  4AQ7 A;  4OHJ A;  4BKS D;  2KK8 A;  1PLS A;  4HAX B;  3AN1 A;  4NAW B;  2CJN A;  2EJ8 A;  4HAU B;  5J3Q A;  2Y8F A;  1JWB D;  4ANU A;  1B1Z A;  4X57 B;  4ZHP A;  1N5X A;  2L00 B;  5BMH A;  2JT4 B;  3A4R A;  2CR5 A;  3CSF A;  4CYE A;  2DNF A;  5FKA C;  5L95 C;  4KX6 B;  4AS1 A;  1FGZ A;  4NAW A;  4JKC A;  2MX2 A;  1M94 A;  1ZP0 B;  4WIP A;  1ACA A;  2Z0P A;  1NTV A;  5EDS A;  3W9C B;  3PSC A;  3H6N A;  4ICU A;  4GSW A;  3TO1 A;  4KHB A;  3U8Z A;  4MEL A;  4DBG A;  1HA5 A;  3O65 B;  2OHF A;  1SIJ A;  4LNI A;  2KN4 A;  2M0A A;  1B55 A;  3UGB B;  4US9 A;  5EE0 A;  3UIP B;  4RM8 A;  4E3C A;  1MKE A;  2WXH A;  3QK0 A;  1FMA D;  2C9W B;  1I4G A;  3RD2 A;  1DDV A;  3NVY A;  5E6O A;  2C7M B;  3A9K A;  4OVU A;  1RLF A;  2JRI B;  4B0E A;  3EGR A;  5DPW A;  1TKG A;  3DVG X;  2O2V A;  2XK5 A;  4RGT A;  4DK5 A;  4ITK A;  2CHZ A;  4Z2N A;  5E6P A;  4XWW A;  3P2B A;  3OJ3 A;  2WWZ A;  2XNA C;  1WJ4 A;  1EWC A;  1IUE A;  4JKH A;  1XLO A;  2SEB D;  2OED A;  3DHG C;  1ZOY B;  1U29 A;  1U5D A;  2C60 A;  1JCK B;  3MHS D;  3NVW A;  3Q8E A;  4CQN A;  2LUM A;  3GS2 A;  2K8B A;  3SU8 X;  1ISN A;  2IGH A;  3PS6 A;  5EE9 A;  1T0Y A;  1UF0 A;  1V5T A;  2FUG 1;  1VDV A;  3GE8 C;  1FFV A;  2L32 A;  1U5E A;  5M4Y B;  2LWP A;  4JL9 A;  4I6L B;  3A1Q B;  3BVM A;  2BS4 B;  4WJP A;  2W2W A;  1OQQ A;  3AEB B;  1EF1 A;  2INP E;  1W1H A;  2DZM A;  4ICV A;  2INN E;  2M1M A;  1HTO A;  2V4L A;  4ANV A;  2QC8 A;  3DCG A;  2BVC A;  1P7F A;  4M8M A;  5LXH A;  3PZ7 A;  1WYW B;  2LOZ A;  2W3S A;  2WYQ A;  4BFR A;  1V1P A;  2ROZ B;  4W9F A;  5CLL B;  1WZ0 A;  3RCP A;  4DWF A;  1BTN A;  2L3Z A;  5LOP B;  1OY2 A;  2Z0Q A;  4M0W B;  3Q3O C;  3H1U A;  4QAY A;  1TS5 A;  2DLB A;  3ZNG C;  2JZP A;  4DXG A;  4ILG B;  1C3T A;  2KT7 A;  3KLS X;  4PS3 A;  3FP5 A;  4L1B A;  2WP9 B;  1EGX A;  4FUL A;  1AW7 A;  4PYZ A;  4DHZ B;  4OVV A;  3KYD D;  4DX9 0;  2LOX A;  2DEN B;  2IO0 B;  3PT2 B;  2DBY A;  3Q8F A;  4F7U P;  1M7R A;  3IT4 B;  4K2O A;  3DHH C;  3FVC A;  1LB1 A;  3Q3F A;  4ZOH C;  3RNE C;  1VZ8 A;  3MTN B;  2KC1 A;  4QJ3 B;  2LKO A;  4IWQ A;  2MA9 B;  1XOD A;  1P7E A;  1DYQ A;  2KKC A;  3PRP B;  1E5W A;  1UBQ A;  4CHK A;  4MM3 B;  4G0N B;  1V89 A;  2AQ3 B;  1EVH A;  2GBJ A;  3EUB 2;  1F52 A;  4HRS A;  4OZA A;  3PP2 A;  4K7W A;  3A33 B;  1GOZ A;  2MEK A;  1ZXI A;  5FI1 A;  1NYR A;  3NHE B;  2JUO A;  1J19 A;  3KRX A;  4HB3 B;  3PGE A;  2DN6 A;  2IO2 B;  3VIA A;  3N30 A;  3ENB A;  3GYP A;  3R66 C;  3K9O B;  4DQO C;  5IP4 D;  4IWO A;  2AL6 A;  3HM6 X;  4XDD A;  1VR9 A;  2WXG A;  3ZTC A;  1EWY C;  2JXT A;  2KUP A;  2LUE A;  2WXJ A;  1TY2 A;  4WAF A;  1AWE A;  1FGY A;  1OQY A;  4ZDV A;  1HZ6 A;  2N1V A;  3P1M A;  3NUH B;  2MFQ A;  4QJ4 B;  5BYR A;  5JZE B;  4PS8 A;  1C9F A;  2E6X A;  3H7P A;  3KWL A;  1C4A A;  2WDT B;  2WHI A;  3VTU A;  4XZ4 A;  4EKU A;  3M95 A;  3BII D;  3QA8 A;  4FLH A;  3K9P B;  3DXC A;  2P8V A;  1WE6 A;  1VLB A;  2JZZ A;  3ML9 A;  1X1G A;  5J18 A;  3KSY A;  1IP9 A;  2QDF A;  5E6N A;  3TUO A;  2KWU B;  5HI1 A;  1WH3 A;  4WWN A;  2M19 A;  1CQV A;  2WXN A;  3MDB C;  2CS4 A;  2OTX A;  3PTF C;  3ZNZ B;  2JP2 A;  5LNK 1;  3I63 C;  4ARC A;  5JP4 A;  5KHQ A;  1WGQ A;  2BB6 A;  3NWD A;  1EF5 A;  3L0W B;  4RGM A;  2VZK D;  1ZSQ A;  1TYG B;  5D27 A;  3VR8 B;  1WI0 A;  3AE3 B;  2V3P A;  1TIF A;  4AWJ A;  4H8S A;  3WAM A;  3M63 B;  3N3K B;  2WNM A;  2YVC A;  2HTM E;  3W1S C;  4Y94 A;  1JWS D;  3SYX A;  2L83 A;  1YJJ A;  3PHX B;  3AE5 B;  3E66 A;  1NU2 A;  1TTN A;  1ZDV A;  3VFK A;  2KIG A;  2NBV B;  5D3D A;  1NBF C;  5D94 A;  1XD4 A;  2RMM A;  2R0D A;  5T8I A;  3ZQ4 A;  1K5D B;  2KJ6 A;  1UGJ A;  5C16 A;  2ASQ A;  1WRD B;  2UWQ A;  5IOI A;  2JSV X;  4ACF A;  1OMW A;  3L08 A;  5D7G A;  1GC7 A;  3V3X A;  2J7Q B;  3OLM D;  4YON A;  3JSV B;  2IY0 B;  3QWM A;  3RCZ A;  2DHK A;  3RT3 B;  2K25 A;  4FA6 A;  2N0S B;  1V5M A;  2E3T A;  2D10 A;  3R3M A;  4C7Y A;  4MK0 A;  4ZRJ A;  1J8C A;  4PYU A;  4KSL C;  3CIR B;  1L0V B;  4IKG A;  4C7Z A;  2LGY A;  2KC2 A;  2YLM A;  4JKG B;  2EMS A;  4F7Z A;  1PFJ A;  5G2N A;  2FJ9 A;  4BOS C;  3ZDM C;  1FCC C;  2ZW1 A;  3FKY A;  2D9V A;  1NI3 A;  2RGF A;  4JKB A;  4FJY A;  5HE3 A;  3KUC B;  4ANW A;  4HDO A;  1YMH E;  2CJO A;  2G45 B;  1UPR A;  4TMA B;  1HEZ E;  2A4Z A;  4REZ A;  2G4D B;  3ZXR A;  3V6C B;  3WA0 A;  1WM3 A;  1J7A A;  2K1F A;  1MK9 B;  5CHV C;  2FIF A;  2YS3 A;  1MI1 A;  1YQB A;  4RFB A;  3GYO A;  2DYN A;  3X0W A;  2LFI A;  2TSS A;  2GRI A;  1SE4 A;  1V88 A;  3DXD A;  3GZN B;  1WJ6 A;  1RAX A;  2MDX A;  1E7P B;  2N9K A;  4HRO A;  5L83 A;  1VCB A;  2ON8 A;  4K7U A;  3U2S C;  4IC7 B;  1JRP A;  4ARI A;  3TCA A;  4GDL B;  4RGN A;  4XGA B;  1RRP B;  4YSZ B;  2J0K A;  4BBN C;  1GB4 A;  2FCS A;  3P63 A;  2KTR B;  1OTR B;  4WJN A;  2PKO A;  1E8W A;  2LYD A;  1FEH A;  2DZI A;  2ICI A;  2NMB A;  2GBK A;  4K2P A;  1SF0 A;  2LVQ A;  5CHF A;  1F2R C;  4YWG G;  4GU2 A;  1NEN B;  2MH7 A;  3RMK C;  5CX3 A;  2NS5 A;  4FXC A;  1WSP A;  1SB3 C;  2MJD A;  3L17 A;  1WMH B;  5L81 A;  2LXC A;  4JK8 A;  2R2Y A;  4P1B C;  1YQ4 B;  3QAR A;  2MBQ A;  4HJG E;  2KVR A;  3AEE B;  1FD6 A;  1Q1O A;  4D2K A;  1ZUD 2;  2AX5 A;  2G4S A;  3HVZ A;  3ECI A;  2WH5 A;  2GB1 A;  4MGK E;  1X05 A;  1WGH A;  1R4M B;  5I4D A;  5G5H A;  1Y8R C;  3ZXV A;  4YTM B;  4KGR A;  1LGR A;  3U52 E;  2L1C A;  4IDI A;  5C79 A;  2KFK B;  4AJY B;  3N1Y C;  1Q5W B;  2FJU B;  5J3Y A;  3P4S B;  4G11 A;  3ML4 A;  4DIX A;  1QOG A;  3LJU X;  4RF0 A;  2Z0O A;  4IFS A;  1HB8 A;  4XYC A;  3A8P A;  3UQB A;  3GB1 A;  3Q8B A;  3CWI A;  2W82 A;  3BVG A;  4K17 A;  2RSG A;  2KMM A;  3DVN V;  3KYC D;  1DRO A;  1KBL A;  5TR5 A;  1T77 A;  1UZX B;  3N1X C;  3IBE A;  2WXF A;  5E6J A;  3ZJU A;  2KMA A;  1NI2 A;  3ZTD A;  3I5J C;  2OOB B;  4IW0 A;  2FCN A;  4HCN B;  1YX5 B;  3NRZ A;  2CQU A;  4FBJ B;  4MJS B;  3ODW A;  4EJN A;  2MWS B;  1C76 A;  2IDY A;  4A6F A;  4AJW A;  4FJV B;  4HJK A;  4S0R A;  4KHO A;  3FM8 C;  2GJY A;  2JWU A;  2D3B A;  1XT9 B;  2Q5W D;  4G3X B;  2I2Y A;  4JK7 A;  4HVB A;  4OZB A;  3Q8A A;  3HIZ A;  3A9J B;  2NBW B;  2LZ6 A;  3DVN U;  5JH5 C;  3KY9 A;  3DCX A;  2VRR B;  3ZVR A;  2MBH A;  2WXR A;  3R8B A;  3VTW A;  1BUI C;  2DAF A;  4FHK A;  1FHO A;  2UZS A;  3IVF A;  4S17 A;  2RD0 A;  5TSS A;  2M17 A;  1KM7 A;  4EUT A;  3D8D A;  1A5R A;  5J17 A;  3RNC C;  3QHT A;  2D4Q A;  2I38 A;  3KVF B;  1IBX A;  1C4C A;  4F1S A;  2ELB A;  4A20 A;  1C78 A;  4RCO A;  2QMT A;  4BKG A;  2Y3A A;  1UGM A;  1GC6 A;  2VH1 A;  2V1Y A;  1P1A A;  4ASW C;  3E9P A;  3KUD B;  4MH0 E;  5D6J B;  3Q69 A;  2QKL A;  2Z0D B;  3SO6 A;  3BK1 A;  4KHA A;  3U7D A;  2X8X X;  3W2D A;  1TJE A;  3FLV A;  1IBX B;  3QQ8 B;  3SV1 A;  1L4Z B;  2Z0E B;  1E8X A;  4HAW B;  2KAN A;  1WJU A;  3B08 A;  1WXA A;  4YT0 B;  2KIE A;  2R2O A;  3A1Q A;  2RVB B;  4N59 A;  3SR6 A;  1NVL A;  2ZPY A;  2N1W A;  3AE4 B;  2HTH A;  1QZE A;  3RUL A;  3E9O A;  1HE8 A;  5JHG A;  1JRU A;  1K50 A;  1DIK A;  1FRR A;  1WGG A;  3KZ1 A;  2IBI B;  3B9J A;  2H89 B;  4TSS A;  4NQL B;  2SAK A;  2LGD A;  1QT9 A;  1NEK B;  2FE8 A;  4KSK C;  1TY0 A;  4KDL B;  3V62 A;  1N62 A;  5HE0 A;  1SE3 A;  3T9L A;  4KDI C;  3P4P B;  3AB5 A;  3MFG A;  2ZW0 A;  4WVF B;  5H8Y E;  1QIL A;  2KQ4 X;  3WAP A;  1QOB A;  2KYW A;  4KVG B;  2PPH A;  1OEY A;  3AEC B;  2V0G A;  1N5W A;  3RUI B;  4OSN A;  4BBN F;  4NJ7 A;  3MHZ A;  1S1Q B;  2L76 A;  1L4D B;  1WM2 A;  2JQR B;  4US8 A;  1M7E A;  4KKJ A;  3HK0 A;  4DX8 A;  3TEY A;  1NDD A;  1VBG A;  2LEK A;  2CKH B;  1P5T A;  1FXA A;  2W54 A;  1XCG A;  1D5Z C;  3JYU A;  1QKZ A;  2W2X C;  4EE2 A;  3A8Q A;  2WGS A;  3SBG A;  1H8C A;  2MJ3 A;  4GOU A;  3AE9 B;  3E56 A;  4B0M A;  1WXS A;  2Y5C A;  1IYF A;  1GNU A;  2NCN A;  1KRH A;  2GBM A;  2BYT A;  3MP9 A;  3RNB C;  1AN8 A;  2AQ1 B;  2D9X A;  4WJ7 A;  4EMO A;  5J2R A;  4HK2 A;  3MJW A;  1TS3 A;  3H9D A;  1MFW A;  1JWU D;  4USA A;  3T3N A;  2PZ1 A;  2CAY A; 
#chains in the Genus database with same CATH homology
 3ZNI D;  3IFW B;  3IHP C;  2IY1 B;  2KO3 A;  3RZW C;  2IFS A;  5CLQ B;  1WG7 A;  2P0F A;  2RGN B;  4PS7 A;  3TJP A;  1QC6 A;  2A5U A;  1Z2M A;  2FUH B;  2DKQ A;  2LAS A;  4HDQ A;  2KD0 A;  2GMI C;  1P6S A;  1QQG A;  1KI1 B;  4HPL B;  2K8C A;  5D3X A;  3WAL A;  4FAD A;  1SE9 A;  1WX7 A;  2KTR A;  3QAQ A;  3CST A;  2K8H A;  3X23 A;  2MWN B;  2KWC A;  5C5B A;  4ILJ A;  4I6P A;  1UNR A;  1D3Z A;  3GZN I;  2K6D B;  5J3T A;  4JK9 A;  2ROV A;  2MBO A;  4DDI D;  4C0A A;  1WY8 A;  3ZO5 B;  5D3V A;  5DIF B;  2C7H A;  4ANX A;  2KDF B;  4MSM B;  2KQ7 A;  3ZRC A;  2M14 A;  2VRW B;  3TFM A;  1E8Y A;  3APC A;  2GCL A;  3M62 B;  5AEK B;  2AL3 A;  1ZC4 B;  4JKD A;  4A3P A;  2KDI A;  3QBV B;  1V9J A;  2O6V B;  4MDK E;  3ODO A;  5IJM A;  2D9Y A;  4LCD E;  2HE7 A;  2RLO A;  1H10 A;  2JF5 A;  4KHB B;  3H7S A;  2NVU I;  4URK A;  2Y5B B;  2J0M A;  2DAJ A;  3QWZ B;  1WXM A;  2BF8 B;  3CXB B;  5JHB A;  3AI5 A;  4GDK A;  3ZRF A;  1KZ7 A;  3APD A;  2R2Q A;  3D8F A;  2KHW B;  4WSF A;  1J0G A;  2LD9 A;  1KOT A;  4IAP A;  4TYZ A;  3A4S C;  2X18 A;  2BWE S;  4JKE A;  1TXD A;  2KOX A;  2I5C A;  4W9I A;  5JVL A;  2RUK B;  2ELA A;  3FSS A;  4II2 B;  1JDE A;  1NTI A;  1PMS A;  3R7Q A;  3VXW A;  1LXD A;  1LM8 B;  4IM3 A;  3ZIM A;  2OQB A;  5DHA B;  1WX8 A;  3ZLZ A;  2KMC A;  3P7Z A;  2DZJ A;  1I42 A;  4KV2 A;  2MBB B;  2BCJ A;  3VAW A;  1LQB A;  4HAT B;  1P3R A;  5KQ1 A;  1EAZ A;  5D3W A;  4IUM B;  2D07 B;  1WX9 A;  2QHO A;  3FEH A;  4W9C A;  4AOF A;  4WWO A;  2DX1 A;  2G35 A;  2ZNV B;  5HE1 A;  5AZG A;  4DHJ D;  4W9D A;  3QCA A;  2N9X A;  2KZR A;  3PSE B;  4II3 B;  1OEY J;  4NSW A;  1TBE A;  3HQC A;  1U5F A;  4JGH B;  1NTY A;  3QIJ A;  2BYE A;  4GPT B;  3VUX A;  1G6J A;  3AU5 A;  2COA A;  3W1Y A;  2XEW A;  5BO4 B;  2ZVN A;  4IM0 A;  3T8M A;  1UPQ A;  2O6V D;  4HPM B;  1W1D A;  1S3S G;  4IOY X;  2FJL A;  2L7R A;  1RJ2 A;  5IAA C;  3HM3 A;  4DHZ E;  4XWX A;  4M8N A;  2DYO A;  1X86 A;  3ZUN A;  2N0Y A;  2JPH A;  2KNB A;  1CMX B;  4W9H A;  1FAO A;  2CB8 A;  1WJN A;  3SBT A;  4ZRK A;  4IWP A;  4B95 A;  2R82 A;  3JSV A;  1GG3 A;  2FCQ A;  4FJZ A;  3MPX A;  1AAR A;  3NZS A;  4G50 A;  3B0A A;  4LDT B;  2COC A;  3SNH A;  1XQQ A;  2I1J A;  3H7P B;  1U4A A;  4MJS A;  4HCP B;  1BT0 A;  2X0S A;  1X1M A;  1TGZ B;  2RSU A;  2ADZ A;  2YT1 A;  3LDZ E;  3HHM A;  1ZM0 A;  3AUL A;  1Y19 B;  4JIO U;  4TUU A;  1K8R B;  3PRE A;  4A6H A;  2D9W A;  1YJ1 A;  2CU1 A;  1ST7 A;  3OJ4 B;  3TMP B;  3PZD A;  3RZF A;  2DYQ A;  2DX5 A;  2GOW A;  5KCV A;  2FNJ B;  4E71 A;  2Z59 B;  3V6E B;  2MKR A;  4WAA A;  2LG1 A;  2ZZP B;  1U2B A;  2DIK A;  4GMX B;  3PLV A;  2KFK A;  2ZVO A;  1Z5S B;  3V60 A;  2R09 A;  1XD3 B;  3GOE A;  1R4N I;  2KN5 A;  4F8C B;  4HLE A;  4A6F B;  4GB9 A;  1V6E A;  1LW3 A;  1V61 A;  5DPS A;  1L7Y A;  2NPT A;  4IG7 B;  4CHJ A;  3BY4 B;  3M1I B;  4HAZ B;  1V86 A;  4F7H A;  4GIV A;  2DFK A;  3U30 A;  2M4N A;  3UQA A;  3D32 A;  2L0F A;  1WGD A;  2EKE C;  3LJ3 A;  2IZV B;  2HJ8 A;  2I1K A;  3DBH I;  3DBS A;  3A9K B;  2J0J A;  2KXJ A;  2Y8G A;  2UVM A;  4MSQ B;  1RFA A;  4WJQ A;  1V5P A;  4BBK A;  2COD A;  2MLB A;  1AQC A;  4W9K A;  4LDT D;  5C6R A;  1WFY A;  2M8S A;  3Q3J A;  3JW0 X;  5FR6 A;  1U27 A;  1MPH A;  3E9L A;  4K7S A;  1P0R A;  3AJ4 A;  2E2X A;  4GGQ A;  3ALB A;  5LON B;  2LRU A;  3CF6 E;  2Q13 A;  2PE9 A;  1I7A A;  4B6H A;  4KIK A;  1PQS A;  2NZ8 B;  2PJH A;  3KW5 B;  2KX3 A;  4JQW C;  1V2Y A;  3TW1 A;  3I3T B;  2PEA A;  1WF9 A;  1GUA B;  2LBB A;  1DDM A;  4E74 A;  4XX5 A;  2H7E A;  1WR6 E;  1P9D U;  2ZNV C;  3B1L X;  2MBE A;  2K2J A;  4K81 A;  4GDL A;  3AU4 A;  2DHJ A;  1LFD A;  3W1S A;  4KZ0 A;  1HBK A;  1UBI A;  2KLG A;  2RR9 A;  4HB0 B;  3ULC A;  3KRW A;  4DHJ B;  2REX A;  2Y7B A;  3VQI A;  2C7N B;  3EC8 A;  3QX1 A;  5DCN A;  2BKF A;  4TKN A;  1GJZ A;  2C5L C;  1V5O A;  2N9P C;  3ZKJ C;  4HHV A;  2AYO B;  4NY0 A;  4P7I A;  3VUY A;  3BJI A;  1GGO A;  4N9F 4;  1WGU A;  3WAN A;  3SUZ A;  4BKS A;  2N7E A;  5JLJ B;  4LJO B;  4ILH A;  2CHW A;  1R4M I;  2G3Q B;  4HXD A;  3N32 A;  2XBB C;  2D3G A;  2LXA A;  4AUQ C;  3NY5 A;  2BWF A;  3L54 A;  1FB8 A;  3PG7 A;  2JY6 A;  2JWZ A;  3OAW A;  2EMT A;  2IYB A;  3A9J A;  4EZK A;  4MGZ E;  4PNK A;  2K6Q A;  1X11 A;  4BOZ B;  1TJ6 A;  3HW2 B;  3KUZ A;  3RYT A;  2QKM A;  4EEW A;  2KX0 A;  1TQZ A;  1C1Y B;  2RNR B;  4DBB A;  1MIZ B;  3KH0 A;  2MP2 B;  2FCM A;  1ZGU B;  2M0X A;  1L2N A;  3PVU A;  5AZH A;  3TVV A;  4W9E A;  3DQV A;  2N23 A;  2LGX A;  1FHX A;  3O96 A;  4IM2 A;  1UH6 A;  2IO1 B;  2MQJ A;  1WI1 A;  1FHW A;  1E90 A;  1WJM A;  1EUV B;  2LJ5 A;  1WMH A;  3NS8 A;  3VHT C;  1Q67 A;  2VKI A;  4BKT A;  4I6N B;  5DHF B;  1WR1 A;  2AWT A;  4MGI E;  2D2Q A;  4A5K A;  4RMA A;  1WXV A;  2KQS A;  1MIX A;  2GBN A;  2KCJ A;  3EFU A;  1H4R A;  4RM9 A;  3UIO B;  3TL5 A;  4FHJ A;  2HD5 B;  1HB6 A;  3DOW A;  2KFJ A;  1Q0W B;  4MY6 A;  2YT0 A;  3IG3 A;  4K1R B;  3NOB A;  1WZ3 A;  1DDW A;  3WIM A;  1MK7 B;  4HAV B;  4MT7 A;  5JHH A;  1WGR A;  5AZF A;  3PVW A;  2P0D A;  3N7C A;  5G55 A;  2KLC A;  3PEG A;  5C23 A;  2CY4 A;  4GXB A;  3A98 B;  3PHW B;  3PVL A;  1ZW7 A;  2J59 M;  3CMM B;  2ABD A;  1V80 A;  4MEM A;  2XK5 B;  2BYV E;  2MRP A;  3SD5 A;  2CRF A;  4EZL A;  4BVU C;  2FAZ A;  2DYB A;  2W9N A;  1SGH A;  1DBH A;  2ZCC A;  1E7V A;  2CY5 A;  2DLW A;  4CO7 A;  1KC7 A;  1XR0 B;  2O2V B;  2N7D A;  1KLV A;  5HE2 A;  2KJR A;  3PLU A;  1XKE A;  2XQN M;  1F9J A;  4KAX B;  2JZ3 B;  3AXC A;  2YRY A;  2DA0 A;  4MM3 A;  5D2M B;  2BYF A;  2V3S A;  5IA7 A;  4L6E A;  2JVC A;  5GOW B;  5KQ4 A;  2KWV B;  4HWI B;  1I2H A;  3EPY A;  3JVZ X;  3L13 A;  2L05 A;  2YS1 A;  4NJ6 A;  1E7U A;  1KZG A;  5GMV A;  2IO3 B;  1VBH A;  4W9L A;  5KHO A;  2COP A;  3NZU A;  2W2X D;  5LLI A;  5EFX A;  3TIX A;  4KZC A;  2MW5 A;  3VH3 B;  3WAO A;  2COF A;  3QJZ A;  4HB2 B;  1YIW A;  2VSZ A;  4WWP A;  3DBR I;  3TBL D;  2RQ1 A;  1BWN A;  5C5B B;  4WJO A;  2DZK A;  2KDE B;  2GBR A;  3T06 A;  1MG8 A;  4B9K A;  2ZEQ A;  4EZJ A;  3PRM B;  5C1Z A;  1OGW A;  3ZVV A;  3APF A;  3EEC A;  2DYM A;  3VOQ A;  4LJP B;  1MAI A;  3VUW A;  5JHA A;  2AEH A;  2D11 A;  4HB4 B;  2GCJ A;  2WX1 A;  2NR2 A;  3OAN A;  3R7R A;  1V81 A;  1J0W A;  2GS0 A;  1P3Q U;  1IRS A;  3ULB A;  3DDC B;  3ML8 A;  4DDG D;  3D8E A;  3V5W A;  3CIK A;  1RRB A;  4WQO B;  2YSZ A;  1EO6 A;  1Z87 A;  3WYF B;  2BGF A;  2LVO A;  1TZ1 A;  4MGY E;  4FN2 A;  4XC2 A;  1I35 A;  1SIF A;  1WE7 A;  2K39 A;  3VTV A;  5LXI B;  1DYN A;  2LRW A;  1Y5O A;  4HAY B;  1X1F A;  1KJT A;  2YS5 A;  4AP4 C;  2L2I A;  3ZNH B;  4EOY A;  4EFO A;  5CTR C;  4NQK E;  3VDZ A;  2HRJ A;  2JRH A;  3DVG Y;  2YF0 A;  4ZYN A;  1UNP A;  1ZC3 B;  1FXT B;  2LVP A;  4GN1 A;  2FID A;  2DTC A;  5CHW A;  4A6K A;  2KDB A;  4D0N B;  1VD2 A;  2V76 A;  5DH9 B;  3L16 A;  4GDK B;  2KGX B;  2DKP A;  3F0W A;  4J6I A;  1WIA A;  3C0R B;  3M3J A;  3DXE A;  2LI5 A;  4W9G A;  2IYD B;  1U5G A;  2ZPN A;  2FDQ A;  2P0H A;  2LUL A;  1WVH A;  5D3Y A;  1UEF A;  4JKF A;  2K00 A;  2O6V A;  2H7D A;  3PV1 A;  2HTH B;  2KTF A;  4Z2M B;  3ONS A;  1ZVR A;  2ZCB A;  3UZT A;  2CHX A;  1K5G B;  2EC1 A;  4B6W A;  4PQ0 A;  2NPT B;  1N3H A;  2N4F A;  2I5F A;  4TV3 A;  1WGY A;  3SHQ A;  2PE6 B;  4YL8 A;  1V5U A;  1YD8 U;  2K2U A;  3L10 B;  4F7G A;  3P6A A;  3PRZ A;  1OQN A;  3ODX A;  2DHZ A;  2L0T A;  1YX6 B;  1ZKH A;  3DPD A;  2N9E B;  4GOC A;  1UEL A;  1BAK A;  4GMV A;  3PPA A;  3VVW B;  2D9Z A;  5DPT A;  2KJH B;  4A3O A;  2BPS A;  2WX0 A;  3NSU A;  2DX5 B;  4JKA A;  4NPN A;  2OJR A;  2MCN B;  2DHI A;  3EHV A;  5FI0 A;  3QC8 B;  1FOE A;  1IPG A;  1E8Z A;  2UYZ B;  4DXA B;  2MP2 A;  2ZJD A;  2JXX A;  1V49 A;  3SDL C;  2NBU A;  1BTK A;  3VH4 B;  5HKH A;  2UZR A;  5DI9 B;  2B3A A;  1XX0 A;  2M38 A;  4ZRI A;  4JLC A;  4NNJ B;  4CHM A;  4W9J A;  3ENE A;  1UD7 A;  4TQ1 A;  3V61 A;  3UF8 A;  4TQ0 A;  4GZU A;  3S2A A;  3UIN B;  1WJ1 A;  2BKR B;  4KIK B;  3BIN A;  1SHC A;  3DBL I;  2RPQ A;  4JKG A;  1P98 A;  3ZW3 A;  5DPR A;  3F5R A;  2L8J A;  1W1G A;  2MSE D;  3ZDT A;  1UNQ A;  3G9W A;  4BKS D;  2KK8 A;  1PLS A;  4HAX B;  4NAW B;  2EJ8 A;  4HAU B;  5J3Q A;  2Y8F A;  4ANU A;  4X57 B;  2L00 B;  2JT4 B;  3A4R A;  2CR5 A;  3CSF A;  4CYE A;  5L95 C;  1FGZ A;  4NAW A;  4JKC A;  2MX2 A;  1M94 A;  1ACA A;  2Z0P A;  1NTV A;  5EDS A;  3PSC A;  3H6N A;  4ICU A;  4GSW A;  3TO1 A;  4MEL A;  3U8Z A;  4DBG A;  3O65 B;  1B55 A;  3UGB B;  3UIP B;  4RM8 A;  4E3C A;  1MKE A;  3QK0 A;  2C9W B;  3RD2 A;  1DDV A;  5E6O A;  2C7M B;  3A9K A;  4OVU A;  1RLF A;  2JRI B;  5DPW A;  3DVG X;  2O2V A;  2XK5 A;  4DK5 A;  2CHZ A;  4Z2N A;  5E6P A;  3P2B A;  3OJ3 A;  2WWZ A;  1WJ4 A;  4JKH A;  1U29 A;  1U5D A;  2C60 A;  3MHS D;  2K8B A;  3SU8 X;  1ISN A;  3PS6 A;  1T0Y A;  1V5T A;  1U5E A;  2LWP A;  4JL9 A;  4I6L B;  3A1Q B;  4WJP A;  2W2W A;  1EF1 A;  1W1H A;  2DZM A;  4ICV A;  2M1M A;  2V4L A;  4ANV A;  3DCG A;  4M8M A;  5LXH A;  1WYW B;  2LOZ A;  2WYQ A;  4BFR A;  2ROZ B;  4W9F A;  5CLL B;  1WZ0 A;  3RCP A;  4DWF A;  1BTN A;  2L3Z A;  5LOP B;  1OY2 A;  2Z0Q A;  4M0W B;  3H1U A;  3ZNG C;  4ILG B;  1C3T A;  4PS3 A;  3FP5 A;  4PYZ A;  1EGX A;  4FUL A;  4DHZ B;  4OVV A;  3KYD D;  4DX9 0;  2LOX A;  2DEN B;  2IO0 B;  3PT2 B;  4F7U P;  1M7R A;  4K2O A;  1LB1 A;  3Q3F A;  3MTN B;  2KC1 A;  2LKO A;  4IWQ A;  2MA9 B;  1XOD A;  2KKC A;  3PRP B;  1E5W A;  1UBQ A;  4CHK A;  4G0N B;  1V89 A;  1EVH A;  2GBJ A;  3PP2 A;  4K7W A;  3A33 B;  5FI1 A;  3NHE B;  2JUO A;  1J19 A;  3KRX A;  4HB3 B;  3PGE A;  2DN6 A;  2IO2 B;  3VIA A;  3N30 A;  3ENB A;  3GYP A;  3R66 C;  3K9O B;  4IWO A;  2AL6 A;  3HM6 X;  3ZTC A;  2KUP A;  2LUE A;  1AWE A;  1FGY A;  1OQY A;  4ZDV A;  2N1V A;  2MFQ A;  5JZE B;  4PS8 A;  3H7P A;  2WDT B;  3VTU A;  4XZ4 A;  4EKU A;  3M95 A;  3QA8 A;  4FLH A;  3K9P B;  3DXC A;  2P8V A;  1WE6 A;  2JZZ A;  3ML9 A;  1X1G A;  5J18 A;  3KSY A;  1IP9 A;  5E6N A;  2KWU B;  1WH3 A;  4WWN A;  3MDB C;  2CS4 A;  2OTX A;  3PTF C;  3ZNZ B;  2JP2 A;  5JP4 A;  5KHQ A;  1WGQ A;  1EF5 A;  3L0W B;  1ZSQ A;  5D27 A;  1WI0 A;  4AWJ A;  4H8S A;  3WAM A;  3M63 B;  3N3K B;  2YVC A;  3W1S C;  4Y94 A;  3SYX A;  3PHX B;  3E66 A;  1NU2 A;  1TTN A;  3VFK A;  2NBV B;  1NBF C;  5D94 A;  1XD4 A;  2R0D A;  1K5D B;  2KJ6 A;  5C16 A;  2ASQ A;  1WRD B;  2UWQ A;  1OMW A;  3L08 A;  5D7G A;  1GC7 A;  2J7Q B;  3OLM D;  4YON A;  3JSV B;  2IY0 B;  3QWM A;  3RCZ A;  2DHK A;  3RT3 B;  2K25 A;  4FA6 A;  1V5M A;  3R3M A;  2D10 A;  4MK0 A;  4ZRJ A;  1J8C A;  4PYU A;  4KSL C;  2LGY A;  2KC2 A;  2YLM A;  4JKG B;  2EMS A;  4F7Z A;  1PFJ A;  5G2N A;  2FJ9 A;  4BOS C;  3ZDM C;  2D9V A;  2RGF A;  4JKB A;  4FJY A;  5HE3 A;  3KUC B;  4ANW A;  4HDO A;  2G45 B;  1UPR A;  2A4Z A;  2G4D B;  3V6C B;  3WA0 A;  1WM3 A;  2K1F A;  5CHV C;  1MK9 B;  2FIF A;  2YS3 A;  1YQB A;  3X0W A;  3GYO A;  2DYN A;  1V88 A;  3DXD A;  1WJ6 A;  1RAX A;  2MDX A;  5L83 A;  1VCB A;  4K7U A;  4IC7 B;  3TCA A;  4GDL B;  1RRP B;  2J0K A;  4BBN C;  2FCS A;  2KTR B;  1OTR B;  4WJN A;  1E8W A;  2LYD A;  2DZI A;  2NMB A;  2GBK A;  4K2P A;  2LVQ A;  5CHF A;  4GU2 A;  5CX3 A;  2NS5 A;  3L17 A;  1WMH B;  5L81 A;  2LXC A;  4JK8 A;  3QAR A;  2MBQ A;  2KVR A;  1Q1O A;  2G4S A;  3ECI A;  2WH5 A;  4MGK E;  1X05 A;  1WGH A;  1Y8R C;  2L1C A;  5C79 A;  2KFK B;  4AJY B;  1Q5W B;  5J3Y A;  4G11 A;  3ML4 A;  3LJU X;  2Z0O A;  4IFS A;  1HB8 A;  3UQB A;  3A8P A;  4K17 A;  2RSG A;  3DVN V;  3KYC D;  1DRO A;  1KBL A;  5TR5 A;  1UZX B;  3IBE A;  2KMA A;  1NI2 A;  3ZTD A;  2OOB B;  4IW0 A;  2FCN A;  4HCN B;  1YX5 B;  2CQU A;  4FBJ B;  4MJS B;  3ODW A;  4EJN A;  2MWS B;  4A6F A;  4AJW A;  4FJV B;  4HJK A;  4KHO A;  3FM8 C;  2GJY A;  1XT9 B;  4G3X B;  4JK7 A;  4HVB A;  3HIZ A;  3A9J B;  2NBW B;  2LZ6 A;  3DVN U;  5JH5 C;  3KY9 A;  2VRR B;  3ZVR A;  2MBH A;  3VTW A;  2DAF A;  4FHK A;  1FHO A;  2UZS A;  3IVF A;  2RD0 A;  2M17 A;  1KM7 A;  4EUT A;  3D8D A;  1A5R A;  5J17 A;  3QHT A;  2D4Q A;  3KVF B;  4F1S A;  2ELB A;  4A20 A;  4BKG A;  1UGM A;  1GC6 A;  2V1Y A;  1P1A A;  4ASW C;  3E9P A;  3KUD B;  4MH0 E;  5D6J B;  2QKL A;  2Z0D B;  3SO6 A;  4KHA A;  3U7D A;  3FLV A;  3QQ8 B;  3SV1 A;  2Z0E B;  1E8X A;  4HAW B;  2KAN A;  1WJU A;  3B08 A;  1WXA A;  2R2O A;  3A1Q A;  2RVB B;  1NVL A;  2ZPY A;  2N1W A;  2HTH A;  1QZE A;  3RUL A;  3E9O A;  1HE8 A;  5JHG A;  1JRU A;  1DIK A;  1WGG A;  3KZ1 A;  2IBI B;  4NQL B;  2LGD A;  4KSK C;  4KDL B;  3V62 A;  5HE0 A;  3T9L A;  4KDI C;  4WVF B;  3WAP A;  2PPH A;  4KVG B;  1OEY A;  3RUI B;  4BBN F;  4NJ7 A;  1S1Q B;  2L76 A;  1WM2 A;  1M7E A;  3HK0 A;  4DX8 A;  1NDD A;  1VBG A;  2CKH B;  1P5T A;  1XCG A;  3JYU A;  2W2X C;  3A8Q A;  3SBG A;  1H8C A;  1WXS A;  1IYF A;  1GNU A;  2NCN A;  2GBM A;  2D9X A;  4WJ7 A;  4EMO A;  5J2R A;  4HK2 A;  3MJW A;  3H9D A;  2PZ1 A;  2CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...