4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine kinase 2-beta
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
1WF9A 3VUXA 2KVRA 1MK7B 4MDKE 1GC6A 3IBEA 3A1QB 2RUKB 3F5RA 2DZJA 4E71A 4BKSD 1ZM0A 3ECIA 3PHWB 4WSFA 5KQ4A 3A9KA 2MKRA 2UWQA 4IWPA 3PRPB 3V5WA 4H8SA 1WX9A 4EEWA 3KH0A 3FP5A 3MPXA 3MDBC 1V49A 3QQ8B 3S2AA 3WA0A 2FDQA 1MAIA 2DYQA 2RVBB 2CAYA 5G2NA 3BINA 2KWCA 5E6PA 3QIJA 4I6LB 2EKEC 3H7PB 2GOWA 5TR5A 5HKHA 1WR1A 1XT9B 2ROVA 2C7MB 4MGKE 2CODA 1X1MA 1V86A 3T8MA 2DX5B 2K1FA 2DZIA 3EECA 1E5WA 3UIOB 2KK8A 1V5PA 3TBLD 2EMTA 1J0WA 2R0DA 2L7RA 2N9PC 2RGFA 5KHOA 1RRBA 4HAXB 2WX0A 1U29A 1U4AA 3IHPC 2EMSA 1HBKA 5D94A 4II2B 3AULA 3FM8C 1DDVA 2YSZA 1WZ0A 4ICVA 1ZGUB 1EO6A 5KHQA 3HW2B 1UPQA 4F7HA 4EJNA 1WIAA 5LLIA 1E8WA 1KI1B 3FEHA 2DX1A 2KUPA 2RPQA 1U2BA 4HCNB 2OTXA 3F0WA 5KQ1A 2JF5A 4WWNA 5DCNA 4CHKA 3ODXA 2B3AA 2KLGA 3N3KB 2GBKA 1WGUA 1Q0WB 2BKFA 3DBRI 4PNKA 4DHZE 4NPNA 1U27A 1YD8U 4II3B 2GCLA 2ZVOA 2IO1B 2KJHB 3HHMA 3PVWA 3TL5A 4WJQA 4K17A 1V2YA 2KTFA 3QARA 2K39A 1S1QB 4IAPA 1FHOA 1WGRA 3SHQA 4DHZB 3NHEB 3WIMA 3SYXA 2CY5A 3AJ4A 2W2WA 4HB3B 4Y94A 1WJMA 2N7EA 2R2QA 4KSLC 3Q3FA 2JZ3B 5DPRA 2D9WA 1FHWA 4M0WB 3TW1A 2GBMA 2J0JA 4I6PA 4YONA 3LJUX 2MP2B 4OVVA 4TUUA 2H7EA 1WMHB 5D3XA 1YX6B 3K9OB 2LUEA 4KHBB 5IJMA 2KHWB 2WWZA 3TVVA 4C0AA 1EGXA 1TTNA 3VUYA 2DYNA 1X11A 3ML9A 3PS6A 2V4LA 2Y8FA 4ZYNA 3AU4A 1L2NA 1U5EA 4GGQA 2CKHB 4HPLB 5J2RA 1PLSA 5JLJB 1SGHA 4BOSC 2K2UA 2Y7BA 1FXTB 4GDKB 4IM0A 2CHWA 2P0HA 3A9JA 2CS4A 3ZVRA 2MX2A 3CSTA 1V5TA 1OTRB 3JSVA 4HDQA 3KW5B 3RZWC 2KQ7A 2GBRA 2K6QA 4XC2A 3ZW3A 1Q5WB 4WWPA 2Y5BB 2MBBB 4W9GA 2V1YA 2UZSA 3APCA 2CR5A 2BGFA 2XK5B 1V89A 1M94A 3R66C 5DPTA 2DHIA 3KUZA 2COPA 1WX7A 3QWZB 3QA8A 4ICUA 1DYNA 1UNQA 2NZ8B 3EHVA 4NQKE 4TV3A 3KY9A 4HB0B 1CMXB 1Y8RC 1V9JA 4DHJD 1MIXA 1Q67A 4BVUC 2YT1A 3R7QA 2OOBB 1S3SG 3UGBB 1GUAB 4E3CA 3UQBA 2WX1A 3VDZA 2A5UA 2R2OA 1WE6A 3P6AA 3DVNV 3PEGA 3CF6E 2L1CA 1WGYA 2LGYA 4GSWA 3IVFA 3TCAA 1WM2A 3M63B 1U5FA 2WDTB 3A4RA 3VQIA 1FOEA 1P3QU 2AWTA 3A4SC 1E8YA 3GYOA 2LXAA 3UINB 4ANVA 4KZCA 4P7IA 3QK0A 4MH0E 1TZ1A 2ASQA 4JLCA 1PQSA 1AARA 2DYOA 4MELA 2JWZA 3JVZX 4CO7A 4BKSA 3UQAA 4E74A 2J59M 2O2VA 1OEYA 3DOWA 1P6SA 3P7ZA 4PQ0A 5J3TA 4IW0A 4TQ0A 2NCNA 5DPWA 3FLVA 3L54A 1VCBA 2KDIA 2L3ZA 4WAAA 2ELAA 4HAVB 2M0XA 3AXCA 1V5MA 4WJ7A 1WJ4A 2COAA 2KMCA 3HM6X 4W9HA 3EPYA 1XX0A 4B6WA 2R09A 2IO2B 5L81A 3V61A 2KDBA 3HIZA 2EC1A 5CTRC 4DK5A 3KZ1A 4EZJA 4L6EA 1KOTA 4K81A 2L05A 4YL8A 4MSMB 2FNJB 2NBWB 2KKCA 4IWOA 4W9DA 5DHFB 1P5TA 4XWXA 2XEWA 2MCNB 2LRWA 4IFSA 1UGMA 4MGYE 4DDID 2IO0B 3QCAA 4KHOA 3DDCB 1KLVA 2VRRB 1Z87A 3NSUA 1L7YA 2KZRA 3T9LA 1UEFA 1NI2A 4KHAA 1YIWA 4KAXB 2IO3B 3B08A 3PRMB 3KYCD 2RNRB 2DHKA 4A6FA 1NTIA 3FSSA 2DAFA 1WI1A 2KN5A 2NMBA 2KX0A 3PT2B 3QC8B 2N7DA 3MJWA 3A9JB 2YRYA 2DTCA 2N1WA 3LJ3A 2A4ZA 4KDLB 2N1VA 2ZPNA 2PE9A 3EC8A 2ZJDA 5C5BA 3L13A 4PYZA 3ZDMC 3H1UA 2PPHA 3NZUA 2LI5A 2JRHA 3A98B 2L00B 1R4NI 2KD0A 4KV2A 3V62A 3ZNID 3PREA 4A6FB 2DHJA 2FCNA 4RM9A 2XBBC 3VTVA 4EZKA 4N9F4 4EOYA 2D07B 3VHTC 2KCJA 2ELBA 3TIXA 2KTRA 2MP2A 4MGIE 2KDFB 2MBEA 3CMMB 4EKUA 4GDLB 3ZNHB 3PP2A 2AL3A 3DVNU 2K8HA 2C7NB 2C9WB 1EF5A 1C3TA 4MK0A 1W1HA 3VIAA 4MJSA 2C7HA 1OQYA 1UELA 4BKTA 1I2HA 4JGHB 2DLWA 2MWSB 4ANUA 5D2MB 3A1QA 2BWES 1W1DA 3OLMD 4MJSB 5D27A 2W2XC 2FCSA 4IWQA 3TO1A 4LCDE 4HHVA 1E8ZA 2GBJA 4WJOA 2CQUA 1FAOA 2JVCA 1OQNA 4BBNC 3D8FA 1BTNA 5LONB 2LVOA 2NBVB 3PV1A 2YS1A 4W9IA 2G4SA 3L10B 4W9CA 5DHAB 1HB8A 2N9EB 1H4RA 3ZO5B 2LOZA 2BWFA 2BYFA 3NZSA 1WXMA 1EF1A 3ALBA 2GJYA 4K1RB 2DX5A 4K7WA 2J0MA 3M95A 1LB1A 3SDLC 3WAOA 4MEMA 1MPHA 3DXCA 4HAZB 4ZRKA 2QKLA 2K25A 2DFKA 2IY0B 2BYEA 2N4FA 4M8MA 3CXBB 1YJ1A 2ZVNA 3A9KB 4BKGA 3UIPB 1NU2A 1OGWA 3WALA 5IAAC 4EUTA 5L83A 2Z0PA 4TYZA 3PRZA 3ZKJC 5L95C 2V76A 2BF8B 1ST7A 1V61A 2Q13A 3U30A 1V88A 5KCVA 5C6RA 2G35A 3DBHI 3WAPA 5JP4A 2RSUA 3P2BA 4WVFB 2IZVB 3L17A 1BTKA 2PE6B 4HATB 1UZXB 3M1IB 2JT4B 2D11A 2NR2A 3APDA 4KIKA 4W9KA 3PSCA 4DBBA 1WRDB 2HTHA 2MA9B 2ZCCA 2KOXA 2JPHA 1X86A 4CHJA 4LDTD 3KSYA 3GOEA 3PLUA 4FULA 2G45B 2MLBA 4XX5A 3RULA 3DCGA 3NY5A 1UNRA 1M7RA 4DDGD 1V81A 2COFA 3X23A 1Q1OA 2KO3A 4X57B 2J7QB 2YT0A 3KVFB 1ZC3B 1WGGA 1NDDA 2LVPA 4LDTB 4NJ6A 3SD5A 3VH4B 3ZTCA 3ULBA 3QAQA 4G3XB 3HQCA 4JQWC 1J8CA 2DZKA 4GDLA 4GMVA 1WG7A 1VD2A 3C0RB 3ULCA 2JUOA 1UBIA 4J6IA 2DKQA 2QKMA 4Z2MB 3MTNB 4NNJB 3PVLA 2RGNB 3ZVVA 1WR6E 2D3GA 2KFKA 4GZUA 3B0AA 1I7AA 1RJ2A 2KWUB 4IOYX 2MBOA 1RRPB 2K00A 1J0GA 5D3VA 3AI5A 5EFXA 3HM3A 3OAWA 1T0YA 4GN1A 3QX1A 4EMOA 2L76A 4HLEA 2Z0OA 3VFKA 5HE1A 4MSQB 2M1MA 2Z59B 2IFSA 1UD7A 2LGXA 2O2VB 1FB8A 4BFRA 3PGEA 3W1SA 4FJYA 3SUZA 1WGHA 2G4DB 5DH9B 2C5LC 1XR0B 2CU1A 2LASA 2NPTB 1MIZB 3AU5A 2RD0A 3M3JA 1EAZA 4NJ7A 1PMSA 4W9LA 3L08A 2C60A 2Y8GA 5D6JB 1C1YB 1SE9A 2MBQA 2O6VB 2PJHA 3L16A 2HD5B 3VTUA 4NY0A 2MW5A 1ZVRA 4F7GA 2D9ZA 1X05A 1AQCA 2EJ8A 3SO6A 3ZLZA 4AJYB 4EFOA 3ENEA 2DHZA 4AJWA 4FBJB 1MK9B 3D8EA 1WGQA 1KJTA 2LGDA 1Z2MA 2O6VD 1K8RB 4FHJA 1XKEA 2KMAA 4JIOU 4LJPB 4OVUA 1Y5OA 3ZIMA 2YS3A 2I1JA 1K5GB 1UNPA 5FI0A 2HRJA 2LWPA 2NS5A 3VVWB 3ODWA 5JZEB 4F7UP 4K2PA 1YQBA 4K2OA 2VRWB 3V6EB 1BAKA 2KFKB 2MDXA 1R4MI 1LFDA 1WJUA 2IBIB 2MRPA 1LM8B 5AZHA 4ASWC 4B9KA 4F1SA 2DYMA 4HXDA 3DVGY 4FJZA 1H10A 3H6NA 4BOZB 4HAWB 1UH6A 3R7RA 1GC7A 3RCZA 3DVGX 1IPGA 2P8VA 1Y19B 2KDEB 2ZPYA 1EUVB 3G9WA 5J18A 2KANA 3O65B 5D3WA 1NBFC 1K5DB 1XQQA 1FGYA 3ML8A 4HPMB 4K7UA 4WJNA 1WH3A 4A20A 4ANWA 1TGZB 1SIFA 4B6HA 1KZGA 1PFJA 1NTVA 1W1GA 3KRXA 4IC7B 4LJOB 2D10A 2VSZA 4W9EA 3ZUNA 2K2JA 4ANXA 4HB4B 3I3TB 5JHBA 5LXHA 4XZ4A 3A8PA 1N3HA 1MKEA 5C23A 2ZZPB 3GYPA 3DBLI 2FCMA 3KUDB 4TQ1A 4AOFA 3A8QA 3JSVB 1LW3A 1NTYA 4FLHA 2MSED 4DBGA 5C1ZA 4DHJB 2WYQA 3JYUA 3VTWA 2L8JA 3ZRCA 1U5DA 1RLFA 3APFA 1ISNA 5CHVC 4A5KA 4AP4C 1G6JA 2CHXA 2DA0A 4URKA 2V3SA 1P9DU 4KSKC 2G3QB 4GB9A 1ACAA 4AUQC 4WWOA 3NOBA 2K6DB 1E7UA 4GOCA 2BCJA 1V5UA 4BBKA 2LG1A 2ZNVC 4IUMB 2E2XA 3B1LX 4JL9A 4K7SA 5C16A 3N30A 2NPTA 2L0TA 3EFUA 1XCGA 3KUCB 5AZFA 3RD2A 5EDSA 1BWNA 3U7DA 2UYZB 2CRFA 4FN2A 3PTFC 1QZEA 2N0YA 4ZRIA 3DXEA 2QHOA 3ZDTA 1DDMA 2KX3A 4MGZE 2LYDA 3MHSD 4PYUA 4AWJA 4TKNA 2MBHA 4WJPA 2CB8A 2LD9A 3SNHA 5C79A 3GZNI 3D8DA 2DENB 2N9XA 2YLMA 2LOXA 3R3MA 4HAYB 3RZFA 1WJ1A 1EVHA 4PS7A 2LJ5A 4DWFA 5JHHA 1B55A 3ZNZB 1SHCA 3SU8X 3VXWA 3W1SC 1DROA 1BT0A 1XD4A 4GXBA 2OJRA 2DKPA 4DXAB 2GS0A 2KXJA 4G11A 3VAWA 3IFWB 1I42A 2P0DA 2RLOA 5LOPB 1JRUA 3PHXB 4RM8A 4B95A 2UZRA 3QWMA 4A3OA 2HE7A 2KFJA 4FJVB 4DX8A 4KIKB 1AWEA 5AZGA 3QBVB 2LKOA 4IM2A 1QC6A 2JRIB 2JP2A 3PG7A 4I6NB 1WJ6A 4FA6A 2ADZA 3T06A 3RCPA 1U5GA 2I5CA 3L0WB 3ODOA 2M38A 2GMIC 1IP9A 2GBNA 4HJKA 1KZ7A 4GPTB 5CLLB 1J19A 5BO4B 5J3QA 1P98A 3H7PA 4Z2NA 3RT3B 1WVHA 3ZRFA 1TBEA 4NAWA 4F7ZA 2ZCBA 1IYFA 3JW0X 2LBBA 4HVBA 2AL6A 1ZSQA 2YF0A 2M4NA 2NVUI 2D2QA 1OY2A 1TQZA 3PVUA 2BKRB 3H7SA 3OJ4B 5CHWA 4M8NA 3QJZA 5FR6A 3N7CA 3BJIA 2L0FA 4KZ0A 4GMXB 3VH3B 1X1GA 1YX5B 2FIDA 2KNBA 4G50A 1WYWB 1QQGA 4A3PA 3U8ZA 2I1KA 2COCA 2K8BA 1P1AA 2JXXA 2RQ1A 2VKIA 1UBQA 1ZW7A 4NAWB 4CYEA 1MG8A 2D9XA 2XQNM 3K9PB 3PSEB 1D3ZA 2ABDA 2FUHB 3V60A 5LXIB 2L2IA 5D3YA 4A6HA 1FHXA 2JZZA 5JH5C 3NS8A 3KRWA 1GNUA 3WYFB 3DPDA 3ZTDA 3SV1A 4CHMA 4RMAA 4ZDVA 2ZNVB 1V5OA 4GDKA 1HE8A 1V6EA 5JHGA 5C5BB 4W9JA 5E6NA 2LRUA 2O6VA 3H9DA 4DX90 2MWNB 5HE3A 2HJ8A 5J17A 1TJ6A 2BYVE 2Z0EB 4FADA 4KDIC 4FHKA 1LQBA 2PEAA 3UZTA 1LXDA 3OJ3A 4KVGB 2N23A 3RYTA 5HE2A 3LDZE 4MY6A 3ML4A 1WE7A 1OEYJ 2K8CA 2Z0DB 3VUWA 5JHAA 3CSFA 1NVLA 4GU2A 1WXSA 3KYDD 2XK5A 2UVMA 4PS3A 2KQSA 3M62B 2P0FA 4HB2B 1WGDA 1WMHA 1E8XA 3HK0A 2FIFA 4G0NB 2YS5A 1XODA 3DXDA 4D0NB 1WXAA 2LVQA 4MM3A 2ROZB 5HE0A 2KTRB 2LXCA 5DIFB 2AEHA 4BBNF 2IYBA 3VOQA 2NBUA 3WAMA 3Q3JA 1TXDA 1WXVA 2KLCA 4NQLB 2FJ9A 2YVCA 3PZDA 4A6KA 2KJ6A 1Z5SB 2FCQA 2DN6A 2KJRA 2AYOB 2RR9A 5J3YA 3TFMA 3O96A 1P0RA 2IYDB 1X1FA 3A33B 1P3RA 3IG3A 4HK2A 5GMVA 3W1YA 3ZNGC 2BPSA 1I35A 4IG7B 3OANA 4F8CB 2FJLA 2KGXB 1OMWA 4MT7A 5IA7A 1IRSA 2REXA 4PS8A 3UF8A 2M8SA 2DYBA 5E6OA 2I5FA 3ONSA 1WJNA 2MFQA 2M17A 5CX3A 3N32A 2ZEQA 4NSWA 2RSGA 1WX8A 2LZ6A 3D32A 3TJPA 2LULA 1WZ3A 4GIVA 5CHFA 2WH5A 5AEKB 2X18A 1A5RA 3V6CB 5GOWB 2DAJA 1HB6A 4IM3A 1E90A 3CIKA 3DQVA 2IY1B 2KC2A 3PLVA 4W9FA 2D4QA 1XD3B 3QHTA 2KWVB 1DDWA 3RUIB 1V80A 3BY4B 1ZC4B 1RAXA 1UPRA 1F9JA 2J0KA 4HAUB 4HWIB 1ZKHA 2W9NA 1GG3A 2Z0QA 1E7VA 3X0WA 2M14A 2PZ1A 5D7GA 1RFAA 1KM7A 2DZMA 1WM3A 2CY4A 5CLQB 5G55A 2GCJA 4EZLA 3DBSA 1WY8A 4HDOA 2MQJA 4WQOB 1H8CA 5DPSA 1GJZA 1DBHA 2OQBA 2KC1A 1WI0A 3TMPB 4HCPB 3PPAA 1FGZA 1M7EA 2D9VA 2JY6A 1WFYA 2CHZA 2W2XD 5DI9B 2HTHB 5FI1A 2FAZA 3WANA 2D9YA 4ZRJA 2H7DA
chains in the Genus database with same CATH superfamily
1WF9A 1GC6A 4JWUC 1IBXB 1KRHA 4GLSC 1ZM0A 4A90A 3A9KA 4IWPA 3V5WA 1WX9A 1V49A 3NJTA 3QQ8B 3S2AA 3WA0A 2WXGA 2DYQA 1ZOYB 3BINA 5E6PA 3QIJA 2EKEC 3H7PB 3ZJTA 2ROVA 2CODA 2DZIA 5I2SA 4S0RA 2JX5A 2EMTA 1HZ6A 2N9PC 5KHOA 1RRBA 3DBHB 1U4AA 2EMSA 3FM8C 4P1CC 1ZGUB 2LGSA 1F2RI 1L4ZB 4F7HA 1WIAA 2G1EA 3T3NA 1QF6A 2KLGA 1V1PB 4C56C 1Q0WB 4II3B 3ZJVA 2KTFA 2PW9A 1FHOA 1WJMA 4ZRPA 1C76A 2D9WA 4M0WB 1E10A 4JE3B 2J0JA 3N1ZC 2MP2B 2MJDA 1WMHB 2LHDA 2LUEA 4KHBB 5IJMA 2KHWB 1ZDXA 3VRAB 1EGXA 4US9A 3ML9A 2V4LA 2WLBA 4A9AA 3E9OA 4GGQA 5J2RA 1PLSA 1CJEA 5JLJB 1SGHA 4GDKB 4IM0A 1ZP0B 1NYRA 2J42A 3RZWC 1YJIA 3FKYA 4L1RA 1E7PB 4W9GA 2V1YA 3APCA 2BGFA 2XK5B 2WXIA 1UNQA 4TV3A 1Y8RC 1SXTA 4DHJD 1MIXA 1GUAB 3UQBA 4JK9A 4D6WA 1FCCC 3DVNV 2L1CA 3AE4B 1TS4A 5FR3A 1QQRA 2WDRB 2JWZA 3JVZX 4BKSA 2J59M 1MFWA 4C00A 3P7ZA 3DBLB 4JKCA 5BMGA 1KF6B 2L3ZA 4WAAA 2M0XA 3AXCA 2COAA 1F52A 2IJ0A 4DK5A 1KOTA 4L6EA 2KKCA 4W9DA 5DHFB 2OEDA 1SJHD 1UGMA 4MGYE 1WYGA 3AE1B 4KHOA 2VRRB 5IRSA 4KAXB 1NTIA 2N7DA 3MJWA 3A9JB 4KDLB 2BB6A 2ZPNA 3ZDMC 5IN7A 4KV2A 1R4NI 2KD0A 1B9RA 4A6FB 5AUKA 4EOYA 5I4DA 1PYWD 2GLSA 3RN9C 4MK0A 3TUOA 1OQYA 1L0XB 1I2HA 2QC8A 1W1DA 2KUQA 1SJED 1T77A 4WJOA 1FAOA 1BTNA 2YS1A 2ACZB 1HB8A 3I5JC 1C78A 2Z59A 2BWFA 3NZSA 1WXMA 1EF1A 2DX5A 3LYYA 1MPHA 4HAZB 4ZRKA 2K25A 3OWEB 2BYEA 1JROA 3RNCC 1NU2A 3E66A 5L83A 2Z0PA 2LEKA 2K0PA 3Q8CA 1V88A 5C6RA 2PKOA 1FNUA 5TR5A 5CX3A 3APDA 2JT4B 3M1IB 4KIKA 2DIKA 3PSCA 1X86A 3KSYA 3GOEA 2J4XA 3DWGC 2MLBA 4FULA 5C2TB 1YNTE 3KVFB 1ZC3B 5J17A 4RCOA 1GB4A 1L5PA 1XF5L 1J8CA 3DHIC 1WG7A 2PVGC 2JUOA 3ZVVA 3B0AA 3AEFB 1HQRD 2K00A 2ZW0A 3AI5A 3HM3A 3OAWA 4JK7A 2M1MA 2K5PA 4JKHA 3MFGA 3W1SA 3SUZA 3AV8A 2CU1A 2RD0A 4NJ7A 1TKYA 3L08A 1HTOA 3HIEA 5D6JB 1C1YB 1SE9A 1ZXIA 2MBQA 3SR6A 4KX6B 1ZVRA 2EJ8A 3ZLZA 2BBCA 2DHZA 1MI1A 2O6VD 3ZIMA 4FXCA 4OVUA 2YS3A 1I4GA 4K2OA 4YSZB 4LNKA 4ASWC 3N20C 1LFDA 2MRPA 4DXFA 4F1SA 3DVGY 2WXLA 4HAWB 1FM0D 3G9WA 5D3WA 1K5DB 4K7UA 4A20A 1K53A 3KRXA 1C9FA 1W1GA 3NUHB 1A70A 5LXHA 5C23A 1MKEA 2IDYA 1NTYA 3VTWA 1U5DA 4AP4C 1ISNA 5CHVC 4A5KA 4URKA 4KSKC 1ACAA 4ARCA 3UI3A 4YSYB 5G5GA 2Y5CA 5G2NA 2E2XA 3AMZA 5EDSA 3EFUA 3KUCB 1XCGA 1ZUD2 3U7DA 4MGZE 1R4MB 4UDUC 4WJPA 3GZNI 3D8DA 1I4HA 2DENB 3R3MA 1WJ1A 2LJ5A 3VXWA 3AEDB 1BT0A 3RI7C 2DKPA 4DXAB 1UUPA 2KXJA 3R8BA 2Y3AA 4M00A 2RLOA 4B95A 2HE7A 4FJVB 1AWEA 4OZCA 4N59A 2JP2A 4KHBA 1DOXA 4FA6A 2ADZA 1T0SC 1T0QC 2KN4A 3KLSX 3ETRA 3E9PA 1IYFA 3FVCA 4HVBA 1ZSQA 2PTLA 1PUTA 2BKRB 5JXVA 2KNBA 1QQGA 2IGDA 4HKZE 2LMCA 1P1AA 1SBBB 3RNGC 3TEWA 4CYEA 1MG8A 1FNWA 3V60A 5LXIB 4A6HA 4JKDA 2JZZA 3NS8A 1QILA 2ZNVB 4GDKA 4JKFA 2MWNB 1TJ6A 4FADA 4KDIC 2RDHA 4FHKA 4B0MA 3LDZE 3AB5A 3FILA 3N9YC 5JHAA 4C7ZA 4GU2A 1GPXA 2XK5A 2UVMA 1E0ZA 2WHIA 1NEKB 2P0FA 3HK0A 2LXCA 2FJUB 4BBNF 2IYBA 3FAHA 2KJ6A 2KJRA 3P2BA 3W5UB 2AYOB 3IG3A 2IYDB 5BMHA 1I42A 4IG7B 2PVOD 2REXA 1SF0A 2K22A 4LNIA 3W5VB 3ONSA 1WJNA 1TS2A 2Q5WD 1A5RA 2X18A 5HHDG 2H89B 3SBTA 1C79A 1ZXHA 4IM3A 1PGAA 3CIKA 2KC2A 3PLVA 4W9FA 1UWXA 2J0KA 3EUB2 2WNMA 3RNAC 4HAUB 4HWIB 2W9NA 1GG3A 2Z0QA 1E7VA 2W3SA 2NMQA 1L0VB 1YMHE 5D7GA 2DZMA 4DXGA 5G55A 4NAMA 1DBHA 2OQBA 2KC1A 3IT6B 3TMPB 5EE0A 1M7EA 3NWAA 2D9VA 1UNSA 1WFYA 2CHZA 2W2XD 2FAZA 3Q8BA 4NZLB 4ILJA 2KVRA 2DZJA 1Y56A 4E71A 2UWQA 1XLQA 2K49A 3ENBA 3PRPB 4H8SA 1MVKA 3FP5A 3NS1A 2FDQA 3BYYB 5HKHA 1XT9B 1WSPA 1SE2A 2DX5B 2R61A 4ILHA 2KK8A 4RF1A 1TS3A 1FFUA 4JKEA 4ITKA 1DDVA 2YSZA 1WZ0A 3BVMA 4K3BA 1UPQA 1E8WA 4RGOS 2DX1A 2RPQA 4HCNB 2OTXA 3F0WA 5KQ1A 2JF5A 1TY0A 2V4IB 1TT5B 3NVVA 2GBKA 1WGUA 3DBRI 4NPNA 1U27A 2XN9C 3NWDA 1ACCA 2ZVOA 3PVWA 3TL5A 4LNNA 4K17A 1V2YA 1T0RC 2K39A 2DWQA 3NHEB 2CY5A 2EELA 2WXMA 2W2WA 4HB3B 1C77A 1SIJA 2KIGA 3TW1A 2V3NA 4OVVA 1F77A 4TUUA 2ICIA 1YX6B 5D3XA 1J7BA 4HPPA 3TVVA 1I4RA 4H2AA 4M0WA 1N63A 5HFYA 3BVGA 2CKHB 5IP4D 4JKGB 1K50A 1GGOA 3OG5A 2CS4A 2KDMA 2MX2A 3CSTA 1V5TA 1HA5A 2HJ1A 2GBRA 1EWCA 1TJEA 4WWPA 1ZYIA 2MBBB 2UZSA 2CR5A 1PFDA 4IKGA 3R66C 3KUZA 1C4PA 1DYNA 4XDDA 1KBLA 1FMAD 1V9JA 1HTQA 2NTSA 3DWMA 2DBYA 2YT1A 2VH2A 4BVUC 2OOBB 2K3UA 4E3CA 2PLPA 4OVZA 1DOIA 2R2OA 1WE6A 3L4PA 4GSWA 3M63B 1BXTA 1YQ3B 3A4RA 3VQIA 3A4SC 1E8YA 3GYOA 3QK0A 4MH0E 1TZ1A 4JLCA 3AM9A 1AARA 2DYOA 3BK1A 4E74A 2O2VA 1P6SA 1JRPA 1VCBA 1V5MA 3EPYA 4B6WA 3V61A 1UF0A 1TKEA 4LLGM 1SB3C 3KZ1A 2L05A 1JWSD 2FNJB 2NBWB 2MCNB 4XWXA 2XEWA 4IFSA 1L4DB 2IO0B 1Z87A 2KZRA 3U2SC 1NI2A 2RNRB 2KN5A 3FSSA 2DAFA 1PDXA 2Y5PA 4N6EB 3IT4B 2N1WA 1JMLA 2N1VA 1WRIA 4PYZA 3Q3MC 2INCC 2W82A 3ZNID 3HVDA 2XBBC 4QXAB 1E6EB 2ELBA 2D3BA 3TIXA 2MP2A 3MC9A 2AQ3B 3PP2A 3IAS1 4ZHPA 1EF5A 1W1HA 4MJSA 3Q14C 1UELA 5D2MB 3A1QA 4OZBA 4MM3B 2BWES 5D27A 2W2XC 4IWQA 3TO1A 1OQNA 3D8FA 2NBVB 3V05A 3AE8B 2G4SA 4W9CA 5HG2A 5BMIA 1H4RA 4L1BA 2BYFA 4K1RB 4K7WA 1QOGA 1JWAD 3M95A 3Q3NC 2IY0B 2HTME 2ZVNA 3A9KB 2KYWA 2W54A 3UIPB 1R7SA 3WALA 3PRZA 3ZKJC 3TEZA 4XGAB 3DBHI 2G35A 2QCZA 4HATB 3NZ3A 4DWFA 2D11A 4W9KA 4DBBA 1WRDB 2HTHA 2MA9B 1B1ZA 1XLOA 2JPHA 4CHJA 4LDTD 3RULA 3PLUA 1KC7A 2X38A 1IGCA 4ARIA 1UNRA 1M7RA 4DDGD 4B0EA 2COFA 4X57B 3SD5A 1WGGA 2LVPA 4G3XB 3HQCA 2DZKA 1XEEA 2W55A 1QOFA 3ULCA 3MTNB 3FILB 1NI3A 4IOYX 2MBOA 2J52A 1RRPB 5D3VA 4JX1C 1T0YA 5HE1A 4MSQB 2INNE 3P42A 1FB8A 1WGHA 2G4DB 5DH9B 2C5LC 1XR0B 2AX5A 2LASA 2NPTB 3AU5A 4W9LA 1PMSA 3HRDD 2C60A 2Y8GA 4D2KA 2O6VB 2PJHA 1N5WA 2HD5B 4NY0A 2JZPA 3VTUA 4F7GA 2D9ZA 1X05A 1AQCA 2RPVA 4AJWA 4HJGE 3AEBB 4JIOU 4XC2A 2FBWB 4US8A 1XKEA 1JQ4A 1TY2A 4S17A 5FI0A 2HRJA 1GAQB 1R4MI 2IBIB 5AZHA 4B9KA 1LM8B 1FEHA 3RFZB 2DYMA 3H6NA 1UH6A 3R7RA 1GC7A 2P8VA 2FUG1 5J18A 1FGYA 4ANWA 4LJOB 2INDC 4B6HA 1PFJA 4DDID 2VSZA 2K2JA 2ZZPB 4AOFA 2FCMA 5LG4B 1KLGD 1LW3A 2MSED 4DBGA 4WURA 3CWIA 5D3IB 2CHXA 2DA0A 2V3SA 1P9DU 4GB9A 4HSIA 3NOBA 2K6DB 3BWUD 5IKCM 4GOCA 2BCJA 3P4RB 2ZNVC 4JL9A 2NPTA 5AZFA 1BWNA 2PIAA 3PTFC 4WIPA 2QHOA 1DDMA 2KX3A 3J9CA 4PYUA 4AWJA 2ON8A 4TKNA 3AEEB 3Q2AC 5C79A 2D3AA 2N9XA 3RZFA 1EVHA 3SU8X 3KWVA 1QKZA 2OJRA 5EE9A 3TEXA 4OT1A 2P0DA 5EE3A 3GZNB 1XCQL 3PHXB 4RM8A 2WU5B 3AE5B 2UZRA 4KIKB 5AZGA 4IM2A 2LKOA 1TYGB 4DIXA 4I6NB 1FO4A 1U5GA 2I5CA 2GMIC 1D5XC 1KZ7A 5CLLB 1J19A 1P98A 3ZRFA 4NAWA 4F7ZA 2ZCBA 2AL6A 2YF0A 3H7SA 1OY2A 5CHWA 3BJIA 4KZ0A 1J7AA 1YX5B 4P6VF 1XXGA 2IPKD 2COCA 2JXXA 2VKIA 1UBQA 3E9LA 2YT2A 2ABDA 2L2IA 5D3YA 3AEAB 1FHXA 5JH5C 3RPFC 3SV1A 2L83A 1V5OA 5E6NA 2BQQA 4JKBA 2LRUA 2O6VA 2BTEA 4DX90 1AW7A 3IXSA 4XE0A 1FNVA 4KVGB 3KQ4A 5M4YB 3RYTA 1JWMD 2Z0DB 1OEYJ 3CSFA 1NVLA 1WXSA 3KYDD 3PZ7A 2KQSA 3M62B 1DOYA 1MJDA 5LNK1 1WGDA 1E8XA 2FIFA 3DXDA 2CJOA 2LVQA 4MM3A 3URYA 5JVLA 1L6UA 3VOQA 1ET6A 2KLCA 2FJ9A 2YVCA 3PZDA 4A6KA 1Z5SB 2FCQA 5J3YA 2NBVA 3TFMA 1XO3A 3ZUNA 3UQAA 4HK2A 2CU3A 2BPSA 4O1NA 4YXDB 4F8CB 1I4QA 2KGXB 1OMWA 4WWMA 5E6OA 1KH0A 4BZAA 2M17A 3N32A 4NSWA 4QJ4B 3D32A 2LULA 1WZ3A 3MC0B 4GIVA 5HI1A 5GOWB 1HB6A 1E90A 2D3CA 3DQVA 2WXKA 1XD3B 3QHTA 5BYRA 2KWVB 1DDWA 1ZC4B 4A8XC 2QDFA 3TEYA 3HSAA 1ZKHA 2M14A 2PZ1A 4ZHOA 2CY4A 5CLQB 2WXOA 2WGSA 4MH8A 4WQOB 1H8CA 2N0SB 1FGZA 3GB1A 2JY6A 2W3RA 2HTHB 3T3OA 1MK7B 3IBEA 3A1QB 2RUKB 3AECB 3O13A 4WSFA 5KQ4A 1MPEA 1IUEA 3MDBC 2ZW1A 3P1MA 3AEGB 2CAYA 2RVBB 4MACA 2KWCA 4HEA1 4I6LB 2C7MB 2KAJA 4MGKE 3T8MA 3EECA 3UIOB 3TBLD 4YTPB 2L7RA 4HAXB 1U29A 4HKQA 1HBKA 5D94A 3AULA 1EO6A 3E9SA 5KHQA 3HW2B 5MPOA 1RM6C 1WXQA 1KI1B 1U2BA 3ODXA 2B3AA 2BKFA 4M01A 2B76B 4PNKA 4DHZE 1YD8U 5BYSA 2GCLA 2IO1B 2KJHB 1HZ5A 2OHFA 1STEA 3QARA 1FIQA 4IAPA 1S1QB 3SHQA 4DHZB 3SYXA 3TSSA 2N7EA 4KSLC 2JZ3B 2GBMA 4I6PA 4YONA 1DYQA 1BMLC 3MJ5A 2WWZA 4C0AA 4ZYSA 3VUYA 2DYNA 1U5EA 3AE2B 4BOSC 1JWBD 1FXTB 2P0HA 3A9JA 3JSVA 3ZVRA 1OTRB 4HDQA 3MHZA 2IGGA 2KQ7A 3ZW3A 1VR9A 3RNFC 2Y5BB 4C7YA 1V89A 1M94A 4AQ7A 2DHIA 4KGTA 1V8CA 2COPA 3EHVA 1FXIA 3KY9A 2WP9B 4HB0B 1N6ZA 4EE2A 1Q67A 3R7QA 3UGBB 3Q8EA 2A5UA 2VH1A 3PEGA 3CF6E 1WGYA 1N61A 3TCAA 2WDTB 3ZXVA 1FOEA 4LNFA 1P3QU 2AWTA 4ANVA 1VBHA 2YEPB 4P7IA 4GOUA 1WWTA 4MELA 1OQRA 4CO7A 1OEYA 3DOWA 4PQ0A 1FFVA 3LXFA 4WAFA 4TQ0A 4C80A 5DPWA 4CQNA 3FLVA 1LO5D 2KDIA 4HAVB 4WJ7A 1WJ4A 2KMCA 4C4VB 4W9HA 1SSNA 3C8YA 2IO2B 2KDBA 2EC1A 5CTRC 3OHMB 2WXQA 4YL8A 4MSMB 3QCAA 3DDCB 1NYQA 3NSUA 2KQ4X 1UEFA 4KHAA 4DHJB 3ZRCA 3B08A 4N58A 4A6FA 2WDVB 3PT2B 1WI1A 2NMBA 2KX0A 3QC8B 2CJNA 2A4ZA 3LJ3A 3L13A 1XLPA 2PPHA 1XCTL 3NZUA 2LI5A 4RH6A 3A98B 2L00B 1CZPA 3V62A 4RM9A 2DHJA 2FCNA 3VTVA 2D07B 2XNAC 1SE4A 2R82A 2KDFB 2MBEA 3CMMB 3ZNHB 3DVNU 2K8HA 3VIAA 5D3DA 4JGHB 2MWSB 4ANUA 4MJSB 1D5ZC 3I57A 1PGXA 4GNKB 4HHVA 1E8ZA 4BBNC 5LONB 5BYQA 3L10B 5DHAB 2N9EB 1P7EA 2GJYA 2J0MA 1T3QA 2QKLA 2LJIA 3CXBB 4NJCA 4BKGA 2Z14A 2AQ2B 4EUTA 3NWFA 1BUIC 2BF8B 2EKIA 2JQRB 1ST7A 2Q13A 1T6BX 3W9CB 3ZYYX 5L95C 3WAPA 2RSUA 1BTKA 2NR2A 2NTTA 2ZCCA 2KOXA 3BIID 1JALA 1XLNA 1V81A 2KT7A 2J7QB 2YT0A 4LDTB 3ZTCA 4RFBA 3VH4B 1N5XA 3QAQA 2OJWA 5T8IA 4GMVA 3C0RB 1UBIA 4J6IA 2MJ3A 2QKMA 4NNJB 2D3GA 4USAA 2KWUB 2QJLA 1J0GA 2QMTA 1GOZA 4GN1A 1ZE3D 4EMOA 3QX1A 2L76A 3RMKC 4HLEA 3VFKA 1CK1A 2DNFA 1HXYD 2K9XA 2O2VB 4BFRA 3PGEA 2M0AA 1MIZB 3M3JA 1EAZA 1KTKA 5FKAC 3C19A 3L16A 3SO6A 1YN3A 4AJYB 4EFOA 4FBJB 3ENEA 1LGRA 1MK9B 3D8EA 2LGDA 1Z2MA 2L1AA 1K8RB 4Q2JA 4CSQA 1K5GB 1UNPA 2GB1A 2LWPA 4KGRA 2VRWB 1TS5A 2MDXA 1WJUA 2V3PA 1H10A 2JXTA 5C3JB 1F1HA 3RCZA 1IPGA 3N1XC 2WXNA 1EUVB 3LB8C 3O65B 2Z8LA 1KLVA 4HPMB 1WH3A 1SIFA 1NTVA 3NVYA 2D10A 4W9EA 1VZ7A 2MJEA 3I3TB 3A8PA 2SEBD 4RGMA 4YTMB 3DBLI 3KUDB 3JSVB 4FLHA 3E56A 4BAXA 5C1ZA 3JYUA 2L8JA 1RLFA 3APFA 2WXPA 3SEBA 2Z13A 4AUQC 2INPE 2MEKA 1TZOA 3FC4A 1I7HA 1V5UA 2LG1A 2WXFA 4ZRQA 5C16A 3N30A 5GXGB 1RFKA 2E3TA 2UYZB 1QZEA 2N0YA 4ZRIA 1J7CA 3ZDTA 2LYDA 4JPSA 1VDVA 2MBHA 2CB8A 2LD9A 1YN5A 2LOXA 4PS7A 4L23A 3B2FA 3ZNZB 1SHCA 1DROA 4GXBA 4JKAA 2GS0A 4G11A 3IFWB 5LOPB 2AQ1B 3IAM1 3AE9B 4A3OA 5I2MA 2LHEA 1QC6A 1WJ6A 3RCPA 3L0WB 2M38A 1IP9A 5AUIA 2JWUA 4GPTB 3RT3B 5J3QA 4Z2NA 2QEJC 2LBBA 2L32A 2M4NA 2D2QA 1TQZA 2NVUI 3PVUA 3U7ZA 5FR6A 3N7CA 3VH3B 4GMXB 2KVZA 2FIDA 2WQYB 1WYWB 3B9JA 3DCXA 3U8ZA 4DQOC 2I1KA 3PO0A 1ZW7A 1FPYA 3AN1A 2D9XA 2XQNM 3PSEB 1L0YB 4C4VA 2FUHB 3NRZA 3KRWA 3I9V1 3KWLA 2RDBC 4W9JA 1V6EA 1N60A 3H9DA 1EU3A 3EGRA 3VRBB 1LQBA 2PEAA 3UZTA 1LXDA 3OJ3A 2N23A 3AH7A 3ML4A 2KMMA 4PS3A 3NW8A 5TSSA 1V1PA 3BK2A 4G0NB 4D0NB 1XODA 3R2IA 1WXAA 4OHJA 2KTRB 2AEHA 2JYTA 2NBUA 1TXDA 2QSDA 4NQLB 1FD6A 1C4CA 2DN6A 5GMVA 3ZNGC 1P3RA 3OANA 1DIKA 3PZ8A 3AE3B 2N7JA 2FJLA 4MT7A 5IA7A 4PS8A 2M8SA 4JWSC 1F0ZA 2ZEQA 3TJPA 2LZ6A 5FK9C 1I4PA 3R2TA 5CHFA 3DHGC 2LFIA 3V6CB 3HUIA 1M4VA 2DAJA 1KLUD 1C4AA 2RDGA 3BY4B 1RAXA 3GP7A 1WY8A 4HDOA 2X0SA 1VLBA 2MQJA 1P7FA 1WI0A 2BB5A 3U4EG 4HCPB 2N9KA 5FI1A 2D9YA 2HJ8A 2YLMA 4JK8A 1MHXA 4WH4A 4MDKE 3F5RA 3ECIA 3PHWB 3EA6A 2MKRA 3MP9A 3KH0A 3MPXA 1MAIA 2LGIA 3VR8B 2GOWA 1WR1A 4OSNA 1X1MA 1V86A 2K1FA 4XWWA 1E5WA 1V5PA 1J0WA 2R0DA 2RGFA 5IOIA 4RF0A 3IHPC 2WX0A 4II2B 4ICVA 1YQ4B 1V1OA 4EJNA 5LLIA 3FEHA 2KUPA 4CHKA 4WWNA 1ENFA 5DCNA 1FXAA 3N3KB 1VZ8A 4QJ3B 3N1YC 3HHMA 4WJQA 1WGRA 1MHHE 1JDEA 3WIMA 3AJ4A 4Y94A 1AWDA 2R2QA 3Q3FA 5DPRA 1FHWA 3HVZA 3LJUX 2H7EA 4XYCA 3K9OB 2JYEA 1TTNA 1X11A 3PS6A 2Y8FA 4ZYNA 3AU4A 1L2NA 4HPLB 4RNAA 4A6QA 2K2UA 2Y7BA 1I4XA 3H8HA 2CHWA 1AN8A 1YOVB 3ZO5B 4AS1A 1T5XD 3ZXRA 3KW5B 3MC8A 1WGKA 1Q10A 2K6QA 1SEBD 2WS3B 1Q5WB 1VRAB 3GE3C 3B77A 4KKIA 1MI0A 3GE8C 2BVCA 5DPTA 5G5HA 4K3CA 3CIRB 3QWZB 1WX7A 3QA8A 4ICUA 4NQKE 2NZ8B 5H92C 2RMMA 1CMXB 1S3SG 3BVZA 2YEPF 3RNEC 2WX1A 1VBGA 3GS2A 3VDZA 3P6AA 2LGYA 3IVFA 1TKGA 1WM2A 1OQQA 1U5FA 2UU7A 2WDQB 3P4QB 2LXAA 3UINB 4KZCA 4YSXB 2ASQA 2GUMA 1PQSA 2PMVA 1HEZE 4ZOHC 1FRDA 4IW0A 5J3TA 2NCNA 3L54A 2ELAA 3HM6X 1XX0A 1MG4A 2KWDA 2R09A 3ABVB 5L81A 3HIZA 4EZJA 4K81A 1L6VA 4IWOA 1P5TA 2LRWA 1L7YA 3T9LA 2E6XA 2IO3B 1YIWA 3PRMB 3KYCD 2DHKA 2H88B 1D6EC 1V97A 5E6JA 1QOBA 2YRYA 2DTCA 1EM7A 2PE9A 3EC8A 2ZJDA 5C5BA 4L2YA 2G9HD 4A55A 3H1UA 1R4NB 2JRHA 1UGJA 3PREA 4EZKA 3I63C 4N9F4 3VHTC 2KCJA 2KIEA 2KTRA 2L52A 2VZKB 4R3DA 3DBRB 4GDLB 4EKUA 2AL3A 2C7NB 2C9WB 1C3TA 3Q69A 2C7HA 4BKTA 3A58A 2DLWA 3NVWA 2I2YA 4XDCA 2K8EA 3OLMD 4HROA 4P1BC 4YWGG 2FCSA 4LCDE 2GBJA 2CQUA 2JVCA 2LVOA 3PV1A 4W9IA 1GB1A 2LOZA 2M56B 3ALBA 1LB1A 4YT0B 3SDLC 3WAOA 4MEMA 3RNBC 3DXCA 2V0GA 4LNOA 2DFKA 2N4FA 4M8MA 1YJ1A 1F2RC 1OGWA 5IAAC 3ZQ4A 2BW2A 4TYZA 1ROEA 2V76A 4M02A 1V61A 4QAYA 3U30A 5KCVA 5JP4A 3BZDB 4WVFB 2IZVB 3L17A 4ANXA 2PE6B 3U12A 1UZXB 5EE1A 2G45B 4XX5A 4P16A 3DCGA 3NY5A 3Q8AA 1IBXA 3X23A 1Q1OA 2KO3A 4NJ6A 4LTUA 4EEWA 4KGSA 1NDDA 3ULBA 4JQWC 4GDLA 2RRFA 1VD2A 1RYJA 4PK1A 2DKQA 4Z2MB 3SFEB 3PVLA 2RGNB 1WR6E 2KFKA 4GZUA 1I7AA 1RJ2A 2J53A 4JKGA 1KFYB 5EFXA 2Z0OA 3P4PB 2Z59B 2WXHA 2IFSA 1UD7A 2LGXA 1QOAA 4FJYA 4MT5A 4TSSA 3ZGZA 3AE7B 2MW5A 3EFCA 1N62A 1WGQA 1KJTA 3Q6BA 2R2YA 4FHJA 1AYFA 1OFFA 3P63A 2KMAA 4LJPB 4MGIE 1Y5OA 2I1JA 3VVWB 1FCLA 2NS5A 3ODWA 5JZEB 4F7UP 4K2PA 1YJJA 1YQBA 3V6EB 1BAKA 2KFKB 4QJ5B 2VZKD 4J3OD 1QT9A 4HXDA 4FJZA 4PT5A 4BOZB 4KKJA 3DVGX 1Y19B 2KDEB 2ZPYA 2KR0A 1ZDVA 2KANA 1NBFC 1DGJA 1XQQA 2TSSA 3ML8A 2WXRA 4WJNA 1TGZB 1KZGA 4IC7B 3VR9B 3SBGA 2SAKA 4HB4B 3P4SB 5JHBA 4XZ4A 4WQMA 1N3HA 3GYPA 4TQ1A 3A8QA 2FE8A 4LK0M 2WYQA 4OW0A 1G6JA 2D5GA 1VJKA 2GRIA 2BT6A 2G3QB 3Q3OC 1K52A 4WWOA 4IDIA 1E7UA 4BBKA 4IUMB 3B1LX 4K7SA 3RD2A 1EWYC 1YN4A 2L0TA 1JW9D 2KACA 2CRFA 4FN2A 4RGTA 3DXEA 1UWMA 4REZA 3NG0A 3MHSD 2WU2B 3AE6B 2IGHA 3SNHA 1I35A 4HAYB 1PGBA 5JHHA 1B55A 3W1SC 1XD4A 3VAWA 1JRUA 3QWMA 2KFJA 4DX8A 2BS2B 3QBVB 2JRIB 2BS3B 3PG7A 1VZ6A 2X8XX 2WXJA 3T06A 4ILGB 3SFDB 3ODOA 2GBNA 4HJKA 4OZAA 1K51A 1NVID 5BO4B 3WCQA 3H7PA 1WVHA 1TBEA 3JW0X 4ACFA 3VUXA 3OJ4B 4M8NA 3QJZA 2L0FA 2QIEB 1X1GA 4G50A 2V9HA 1SE3A 2QILA 4YTNB 4A3PA 2K8BA 1FRRA 2RQ1A 4BKSD 4NAWB 3K9PB 1D3ZA 1TIFA 3DPDA 1GNUA 3WYFB 3ZTDA 2MHJA 4CHMA 4ZDVA 1HE8A 5JHGA 5C5BB 3B2GA 2Z4DA 3NVZA 5HE3A 5H8YE 2MH7A 2BYVE 2Z0EB 2ZKMX 1RWSA 5HE2A 4MY6A 1WE7A 4RGNA 2K8CA 3DHHC 3VUWA 2DLBA 4HB2B 1WMHA 1IGDA 2M19A 2YS5A 2HDEA 2ROZB 5HE0A 3U52E 5DIFB 1ESFA 3WAMA 3Q3JA 1WXVA 2I38A 2RR9A 4RMAA 3O96A 1P0RA 1X1FA 3A33B 3W1YA 1D4BA 1D5MC 4XWTA 1EU4A 1NENB 1IRSA 4TMAB 1CQVA 3UF8A 2DYBA 2I5FA 2MFQA 1ET9A 2RSGA 1WX8A 1ZPSA 2WH5A 5AEKB 4IOIE 3BYTB 2GI9A 2BS4B 1JWUD 3W2DA 2ONQA 2JU6X 2IY1B 2D4QA 3RUIB 1V80A 1UPRA 1F9JA 1QLBB 2N9LA 2BYTA 2LUMA 3X0WA 5IO9A 1RFAA 1KM7A 1WM3A 1E9MA 2GCJA 4EZLA 3DBSA 3V3XA 5DPSA 1GJZA 3ZJUA 1JCKB 2JSVX 3PPAA 3Q8FA 4HRSA 5DI9B 3WANA 4ZRJA 2H7DA
chains in the Genus database with same CATH topology
1WF9A 1GC6A 1ZM0A 3A9KA 4IWPA 3V5WA 1WX9A 1V49A 3QQ8B 3S2AA 3WA0A 2DYQA 3BINA 5E6PA 3QIJA 2EKEC 3H7PB 2ROVA 2CODA 2DZIA 2EMTA 2N9PC 5KHOA 1RRBA 1U4AA 2EMSA 3FM8C 1ZGUB 4F7HA 1WIAA 2KLGA 1Q0WB 4II3B 2KTFA 1FHOA 1WJMA 2D9WA 4M0WB 2J0JA 2MP2B 1WMHB 2LUEA 4KHBB 5IJMA 2KHWB 1EGXA 3ML9A 2V4LA 3E9OA 4GGQA 5J2RA 1PLSA 5JLJB 1SGHA 4GDKB 4IM0A 3RZWC 4W9GA 2V1YA 3APCA 2BGFA 2XK5B 1UNQA 4TV3A 1Y8RC 4DHJD 1MIXA 1GUAB 3UQBA 4JK9A 3DVNV 2L1CA 2JWZA 3JVZX 4BKSA 2J59M 3P7ZA 4JKCA 2L3ZA 4WAAA 2M0XA 3AXCA 2COAA 4DK5A 1KOTA 4L6EA 2KKCA 4W9DA 5DHFB 1UGMA 4MGYE 4KHOA 2VRRB 4KAXB 1NTIA 2N7DA 3MJWA 3A9JB 4KDLB 2ZPNA 3ZDMC 4KV2A 1R4NI 2KD0A 4A6FB 4EOYA 4MK0A 1OQYA 1I2HA 1W1DA 4WJOA 1FAOA 1BTNA 2YS1A 1HB8A 2BWFA 3NZSA 1WXMA 1EF1A 2DX5A 1MPHA 4HAZB 4ZRKA 2K25A 2BYEA 1NU2A 3E66A 5L83A 2Z0PA 1V88A 5C6RA 5TR5A 5CX3A 3APDA 2JT4B 3M1IB 4KIKA 2DIKA 3PSCA 1X86A 3KSYA 3GOEA 4FULA 2MLBA 3KVFB 1ZC3B 5J17A 1J8CA 1WG7A 2JUOA 3ZVVA 3B0AA 2K00A 3AI5A 3OAWA 3HM3A 4JK7A 2M1MA 4JKHA 3W1SA 3SUZA 2CU1A 2RD0A 4NJ7A 3L08A 5D6JB 1C1YB 1SE9A 2MBQA 1ZVRA 2EJ8A 3ZLZA 2DHZA 2O6VD 3ZIMA 4OVUA 2YS3A 4K2OA 4ASWC 1LFDA 2MRPA 4F1SA 3DVGY 4HAWB 3G9WA 5D3WA 1K5DB 4K7UA 4A20A 3KRXA 1W1GA 5LXHA 5C23A 1MKEA 1NTYA 3VTWA 1U5DA 4AP4C 1ISNA 5CHVC 4A5KA 4URKA 4KSKC 1ACAA 5G2NA 2E2XA 5EDSA 3EFUA 3KUCB 1XCGA 3U7DA 4MGZE 4WJPA 3GZNI 3D8DA 2DENB 3R3MA 1WJ1A 2LJ5A 3VXWA 1BT0A 2DKPA 4DXAB 2KXJA 2RLOA 4B95A 2HE7A 4FJVB 1AWEA 2JP2A 4FA6A 2ADZA 3E9PA 1IYFA 4HVBA 1ZSQA 2BKRB 2KNBA 1QQGA 1P1AA 4CYEA 1MG8A 3V60A 5LXIB 4A6HA 4JKDA 2JZZA 3NS8A 2ZNVB 4GDKA 4JKFA 2MWNB 1TJ6A 4FADA 4KDIC 4FHKA 3LDZE 5JHAA 4GU2A 2XK5A 2UVMA 2P0FA 3HK0A 2LXCA 4BBNF 2IYBA 3P2BA 2KJ6A 2KJRA 2AYOB 3IG3A 1I42A 2IYDB 4IG7B 2REXA 3ONSA 1WJNA 1A5RA 2X18A 3SBTA 4IM3A 3CIKA 2KC2A 3PLVA 4W9FA 2J0KA 4HAUB 4HWIB 2W9NA 1GG3A 2Z0QA 1E7VA 5D7GA 2DZMA 5G55A 1DBHA 2OQBA 2KC1A 3TMPB 1M7EA 2D9VA 1WFYA 2CHZA 2W2XD 2FAZA 4ILJA 2KVRA 2DZJA 4E71A 2UWQA 3ENBA 3PRPB 4H8SA 3FP5A 2FDQA 5HKHA 1XT9B 2DX5B 4ILHA 2KK8A 4JKEA 1DDVA 2YSZA 1WZ0A 1UPQA 1E8WA 2DX1A 2RPQA 4HCNB 2OTXA 3F0WA 5KQ1A 2JF5A 2GBKA 1WGUA 3DBRI 4NPNA 1U27A 2ZVOA 3PVWA 3TL5A 4K17A 1V2YA 2K39A 3NHEB 2CY5A 2W2WA 4HB3B 3TW1A 4OVVA 4TUUA 1YX6B 5D3XA 3TVVA 2CKHB 4JKGB 1GGOA 2CS4A 2MX2A 3CSTA 1V5TA 2GBRA 4WWPA 2MBBB 2UZSA 2CR5A 3R66C 3KUZA 1DYNA 1KBLA 1V9JA 4BVUC 2YT1A 2OOBB 4E3CA 2R2OA 1WE6A 4GSWA 3M63B 3A4RA 3VQIA 3A4SC 1E8YA 3GYOA 3QK0A 4MH0E 1TZ1A 4JLCA 1AARA 2DYOA 4E74A 2O2VA 1P6SA 1VCBA 1V5MA 3EPYA 4B6WA 3V61A 3KZ1A 2L05A 2FNJB 2NBWB 2MCNB 4XWXA 2XEWA 4IFSA 2IO0B 1Z87A 2KZRA 1NI2A 2RNRB 2KN5A 3FSSA 2DAFA 2N1WA 2N1VA 4PYZA 3ZNID 2XBBC 2ELBA 3TIXA 2MP2A 3PP2A 1EF5A 1W1HA 4MJSA 1UELA 5D2MB 3A1QA 2BWES 5D27A 2W2XC 4IWQA 3TO1A 1OQNA 3D8FA 2NBVB 2G4SA 4W9CA 1H4RA 2BYFA 4K1RB 4K7WA 3M95A 2IY0B 2ZVNA 3A9KB 3UIPB 3WALA 3PRZA 3ZKJC 3DBHI 2G35A 4HATB 4DWFA 2D11A 4W9KA 4DBBA 1WRDB 2HTHA 2MA9B 2JPHA 4CHJA 4LDTD 3RULA 3PLUA 1KC7A 1UNRA 1M7RA 4DDGD 2COFA 4X57B 3SD5A 1WGGA 2LVPA 4G3XB 3HQCA 2DZKA 3ULCA 3MTNB 4IOYX 2MBOA 1RRPB 5D3VA 1T0YA 5HE1A 4MSQB 1FB8A 1WGHA 2G4DB 5DH9B 2C5LC 1XR0B 2LASA 2NPTB 3AU5A 4W9LA 1PMSA 2C60A 2Y8GA 2O6VB 2PJHA 2HD5B 3VTUA 4NY0A 4F7GA 2D9ZA 1X05A 1AQCA 4AJWA 4XC2A 4JIOU 1XKEA 5FI0A 2HRJA 1R4MI 2IBIB 5AZHA 4B9KA 1LM8B 2DYMA 3H6NA 1UH6A 3R7RA 1GC7A 2P8VA 5J18A 1FGYA 4ANWA 4DDID 4LJOB 4B6HA 1PFJA 2VSZA 2K2JA 2ZZPB 4AOFA 2FCMA 1LW3A 2MSED 4DBGA 2CHXA 2DA0A 2V3SA 1P9DU 4GB9A 3NOBA 2K6DB 4GOCA 2BCJA 2ZNVC 4JL9A 2NPTA 5AZFA 1BWNA 3PTFC 2QHOA 1DDMA 2KX3A 4PYUA 4AWJA 4TKNA 5C79A 2N9XA 3RZFA 1EVHA 3SU8X 2OJRA 2P0DA 4RM8A 3PHXB 2UZRA 4KIKB 5AZGA 4IM2A 2LKOA 4I6NB 1U5GA 2I5CA 2GMIC 1KZ7A 5CLLB 1J19A 1P98A 3ZRFA 4NAWA 4F7ZA 2ZCBA 2AL6A 2YF0A 3H7SA 1OY2A 5CHWA 3BJIA 4KZ0A 1YX5B 2COCA 2JXXA 2VKIA 1UBQA 3E9LA 2ABDA 2L2IA 5JH5C 5D3YA 1FHXA 3SV1A 1V5OA 5E6NA 4JKBA 2LRUA 2O6VA 4DX90 4KVGB 3RYTA 2Z0DB 1OEYJ 3CSFA 1NVLA 1WXSA 3KYDD 2KQSA 3M62B 1WGDA 1E8XA 2FIFA 3DXDA 2LVQA 4MM3A 5JVLA 3VOQA 2KLCA 2FJ9A 2YVCA 3PZDA 4A6KA 1Z5SB 2FCQA 3ZUNA 3UQAA 5J3YA 3TFMA 4HK2A 2BPSA 4F8CB 2KGXB 1OMWA 5E6OA 2M17A 3N32A 4NSWA 3D32A 2LULA 1WZ3A 4GIVA 5GOWB 1HB6A 1E90A 3DQVA 1XD3B 3QHTA 2KWVB 1DDWA 1ZC4B 1ZKHA 2M14A 2PZ1A 2CY4A 5CLQB 4WQOB 1H8CA 1FGZA 2JY6A 2HTHB 1MK7B 3IBEA 3A1QB 2RUKB 4WSFA 5KQ4A 3MDBC 2CAYA 2RVBB 2KWCA 4I6LB 2C7MB 4MGKE 3T8MA 3EECA 3UIOB 3TBLD 2L7RA 4HAXB 1U29A 1HBKA 5D94A 3AULA 1EO6A 5KHQA 3HW2B 1KI1B 1U2BA 3ODXA 2B3AA 2BKFA 4PNKA 4DHZE 1YD8U 2GCLA 2IO1B 2KJHB 3QARA 1S1QB 4IAPA 3SHQA 4DHZB 3SYXA 2N7EA 4KSLC 2JZ3B 2GBMA 4I6PA 4YONA 2WWZA 4C0AA 3VUYA 2DYNA 1U5EA 4BOSC 1FXTB 2P0HA 3A9JA 3JSVA 3ZVRA 1OTRB 4HDQA 2KQ7A 3ZW3A 2Y5BB 1V89A 1M94A 2DHIA 2COPA 3EHVA 3KY9A 4HB0B 1Q67A 3R7QA 3UGBB 2A5UA 3PEGA 3CF6E 1WGYA 3TCAA 2WDTB 1FOEA 1P3QU 2AWTA 4ANVA 1VBHA 4P7IA 4MELA 4CO7A 1OEYA 3DOWA 4PQ0A 4TQ0A 5DPWA 3FLVA 2KDIA 4HAVB 4WJ7A 1WJ4A 2KMCA 4W9HA 2IO2B 2KDBA 2EC1A 5CTRC 4YL8A 4MSMB 3QCAA 3DDCB 3NSUA 1UEFA 4KHAA 4DHJB 3ZRCA 3B08A 4A6FA 3PT2B 1WI1A 2NMBA 2KX0A 3QC8B 3LJ3A 2A4ZA 3L13A 2PPHA 3NZUA 2LI5A 3A98B 2L00B 3V62A 4RM9A 2DHJA 2FCNA 3VTVA 2D07B 2R82A 2KDFB 2MBEA 3CMMB 3ZNHB 3DVNU 2K8HA 3VIAA 4JGHB 2MWSB 4ANUA 4MJSB 4HHVA 1E8ZA 4BBNC 5LONB 3L10B 5DHAB 2N9EB 2GJYA 2J0MA 2QKLA 3CXBB 4BKGA 4EUTA 5L95C 2BF8B 1ST7A 2Q13A 3WAPA 2RSUA 1BTKA 2NR2A 2ZCCA 2KOXA 1V81A 2J7QB 2YT0A 4LDTB 3ZTCA 3VH4B 3QAQA 4GMVA 3C0RB 1UBIA 4J6IA 2QKMA 4NNJB 2D3GA 2KWUB 1J0GA 4GN1A 3QX1A 4EMOA 2L76A 4HLEA 3VFKA 2O2VB 4BFRA 3PGEA 1MIZB 3M3JA 1EAZA 3L16A 3SO6A 4AJYB 4EFOA 4FBJB 3ENEA 1MK9B 3D8EA 2LGDA 1Z2MA 1K8RB 1K5GB 1UNPA 2LWPA 2VRWB 2MDXA 1WJUA 1H10A 3RCZA 1IPGA 1EUVB 3O65B 1KLVA 4HPMB 1WH3A 1SIFA 1NTVA 2D10A 4W9EA 3I3TB 3A8PA 3DBLI 3KUDB 3JSVB 4FLHA 5C1ZA 3JYUA 2L8JA 1RLFA 3APFA 4AUQC 1V5UA 2LG1A 5C16A 3N30A 2UYZB 1QZEA 2N0YA 4ZRIA 3ZDTA 2LYDA 2MBHA 2CB8A 2LD9A 2LOXA 4PS7A 3ZNZB 1SHCA 1DROA 4GXBA 4JKAA 2GS0A 4G11A 3IFWB 5LOPB 4A3OA 1QC6A 1WJ6A 3RCPA 3L0WB 2M38A 1IP9A 4GPTB 3RT3B 5J3QA 4Z2NA 2LBBA 2M4NA 2NVUI 2D2QA 1TQZA 3PVUA 5FR6A 3N7CA 3VH3B 4GMXB 2FIDA 1WYWB 3U8ZA 2I1KA 1ZW7A 3PSEB 2D9XA 2XQNM 2FUHB 3KRWA 4W9JA 1V6EA 3H9DA 1LQBA 2PEAA 3UZTA 1LXDA 3OJ3A 2N23A 3ML4A 4PS3A 4G0NB 4D0NB 1XODA 1WXAA 2KTRB 2AEHA 2NBUA 1TXDA 4NQLB 2DN6A 5GMVA 3ZNGC 1P3RA 3OANA 1DIKA 2FJLA 4MT7A 5IA7A 4PS8A 2M8SA 2ZEQA 3TJPA 2LZ6A 5CHFA 3V6CB 2DAJA 3BY4B 1RAXA 1WY8A 4HDOA 2X0SA 2MQJA 1WI0A 4HCPB 5FI1A 2D9YA 2YLMA 2HJ8A 4JK8A 4MDKE 3F5RA 3ECIA 3PHWB 2MKRA 3KH0A 3MPXA 1MAIA 2GOWA 1WR1A 1X1MA 1V86A 2K1FA 1E5WA 1V5PA 1J0WA 2R0DA 2RGFA 3IHPC 2WX0A 4II2B 4ICVA 4EJNA 5LLIA 3FEHA 2KUPA 4CHKA 4WWNA 5DCNA 3N3KB 3HHMA 4WJQA 1WGRA 1JDEA 3WIMA 3AJ4A 4Y94A 2R2QA 3Q3FA 5DPRA 1FHWA 3LJUX 2H7EA 3K9OB 1TTNA 1X11A 3PS6A 2Y8FA 4ZYNA 3AU4A 1L2NA 4HPLB 2K2UA 2Y7BA 2CHWA 3ZO5B 3KW5B 2K6QA 1Q5WB 5DPTA 3QWZB 1WX7A 3QA8A 4ICUA 4NQKE 2NZ8B 1CMXB 1S3SG 2WX1A 1VBGA 3VDZA 3P6AA 2LGYA 3IVFA 1WM2A 1U5FA 2LXAA 3UINB 4KZCA 2ASQA 1PQSA 4IW0A 5J3TA 2NCNA 3L54A 2ELAA 3HM6X 1XX0A 2R09A 5L81A 3HIZA 4EZJA 4K81A 4IWOA 1P5TA 2LRWA 1L7YA 3T9LA 2IO3B 1YIWA 3PRMB 3KYCD 2DHKA 2YRYA 2DTCA 2PE9A 3EC8A 2ZJDA 5C5BA 3H1UA 2JRHA 3PREA 4EZKA 4N9F4 3VHTC 2KCJA 2KTRA 4GDLB 4EKUA 2AL3A 2C7NB 2C9WB 1C3TA 2C7HA 4BKTA 2DLWA 3OLMD 2FCSA 4LCDE 2GBJA 2CQUA 2JVCA 2LVOA 3PV1A 4W9IA 2LOZA 3ALBA 1LB1A 3SDLC 3WAOA 4MEMA 3DXCA 2DFKA 2N4FA 4M8MA 1YJ1A 1OGWA 5IAAC 4TYZA 2V76A 1V61A 3U30A 5KCVA 5JP4A 4WVFB 2IZVB 3L17A 4ANXA 2PE6B 1UZXB 2G45B 4XX5A 3DCGA 3NY5A 3X23A 1Q1OA 2KO3A 4NJ6A 4EEWA 1NDDA 3ULBA 4JQWC 4GDLA 1VD2A 2DKQA 4Z2MB 3PVLA 2RGNB 1WR6E 2KFKA 4GZUA 1I7AA 1RJ2A 4JKGA 5EFXA 2Z0OA 2Z59B 2IFSA 1UD7A 2LGXA 4FJYA 2MW5A 4FHJA 1WGQA 4MGIE 1KJTA 2KMAA 4LJPB 1Y5OA 2I1JA 3VVWB 2NS5A 3ODWA 5JZEB 4F7UP 4K2PA 1YQBA 3V6EB 1BAKA 2KFKB 4HXDA 4FJZA 4BOZB 3DVGX 1Y19B 2KDEB 2ZPYA 2KANA 1NBFC 1XQQA 3ML8A 4WJNA 1TGZB 1KZGA 4IC7B 3SBGA 4HB4B 5JHBA 4XZ4A 1N3HA 3GYPA 4TQ1A 3A8QA 2WYQA 1G6JA 2G3QB 4WWOA 1E7UA 4BBKA 4IUMB 3B1LX 4K7SA 3RD2A 2L0TA 2CRFA 4FN2A 3DXEA 3MHSD 3SNHA 1I35A 4HAYB 5JHHA 1B55A 3W1SC 1XD4A 3VAWA 1JRUA 3QWMA 2KFJA 4DX8A 3QBVB 2JRIB 3PG7A 3T06A 4ILGB 3ODOA 2GBNA 4HJKA 5BO4B 3H7PA 1WVHA 1TBEA 3JW0X 3VUXA 3OJ4B 4M8NA 3QJZA 2L0FA 1X1GA 4G50A 4A3PA 2K8BA 4BKSD 2RQ1A 4NAWB 3K9PB 1D3ZA 3DPDA 1GNUA 3WYFB 3ZTDA 4ZDVA 4CHMA 1HE8A 5JHGA 5C5BB 5HE3A 2BYVE 2Z0EB 5HE2A 4MY6A 1WE7A 3VUWA 2K8CA 4HB2B 1WMHA 2YS5A 2ROZB 5HE0A 5DIFB 3WAMA 3Q3JA 1WXVA 2RR9A 4RMAA 3O96A 1P0RA 1X1FA 3A33B 3W1YA 1IRSA 3UF8A 2DYBA 2I5FA 2MFQA 2RSGA 1WX8A 2WH5A 5AEKB 2IY1B 2D4QA 3RUIB 1V80A 1UPRA 1F9JA 3X0WA 1RFAA 1KM7A 1WM3A 2GCJA 4EZLA 3DBSA 5DPSA 1GJZA 3PPAA 5DI9B 3WANA 4ZRJA 2H7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF9 A;  3VUX A;  2KVR A;  1MK7 B;  4MDK E;  1GC6 A;  3IBE A;  3A1Q B;  2RUK B;  3F5R A;  2DZJ A;  4E71 A;  4BKS D;  1ZM0 A;  3ECI A;  3PHW B;  4WSF A;  5KQ4 A;  3A9K A;  2MKR A;  2UWQ A;  4IWP A;  3PRP B;  3V5W A;  4H8S A;  1WX9 A;  4EEW A;  3KH0 A;  3FP5 A;  3MPX A;  3MDB C;  1V49 A;  3QQ8 B;  3S2A A;  3WA0 A;  2FDQ A;  1MAI A;  2DYQ A;  2RVB B;  2CAY A;  5G2N A;  3BIN A;  2KWC A;  5E6P A;  3QIJ A;  4I6L B;  2EKE C;  3H7P B;  2GOW A;  5TR5 A;  5HKH A;  1WR1 A;  1XT9 B;  2ROV A;  2C7M B;  4MGK E;  2COD A;  1X1M A;  1V86 A;  3T8M A;  2DX5 B;  2K1F A;  2DZI A;  3EEC A;  1E5W A;  3UIO B;  2KK8 A;  1V5P A;  3TBL D;  2EMT A;  1J0W A;  2R0D A;  2L7R A;  2N9P C;  2RGF A;  5KHO A;  1RRB A;  4HAX B;  2WX0 A;  1U29 A;  1U4A A;  3IHP C;  2EMS A;  1HBK A;  5D94 A;  4II2 B;  3AUL A;  3FM8 C;  1DDV A;  2YSZ A;  1WZ0 A;  4ICV A;  1ZGU B;  1EO6 A;  5KHQ A;  3HW2 B;  1UPQ A;  4F7H A;  4EJN A;  1WIA A;  5LLI A;  1E8W A;  1KI1 B;  3FEH A;  2DX1 A;  2KUP A;  2RPQ A;  1U2B A;  4HCN B;  2OTX A;  3F0W A;  5KQ1 A;  2JF5 A;  4WWN A;  5DCN A;  4CHK A;  3ODX A;  2B3A A;  2KLG A;  3N3K B;  2GBK A;  1WGU A;  1Q0W B;  2BKF A;  3DBR I;  4PNK A;  4DHZ E;  4NPN A;  1U27 A;  1YD8 U;  4II3 B;  2GCL A;  2ZVO A;  2IO1 B;  2KJH B;  3HHM A;  3PVW A;  3TL5 A;  4WJQ A;  4K17 A;  1V2Y A;  2KTF A;  3QAR A;  2K39 A;  1S1Q B;  4IAP A;  1FHO A;  1WGR A;  3SHQ A;  4DHZ B;  3NHE B;  3WIM A;  3SYX A;  2CY5 A;  3AJ4 A;  2W2W A;  4HB3 B;  4Y94 A;  1WJM A;  2N7E A;  2R2Q A;  4KSL C;  3Q3F A;  2JZ3 B;  5DPR A;  2D9W A;  1FHW A;  4M0W B;  3TW1 A;  2GBM A;  2J0J A;  4I6P A;  4YON A;  3LJU X;  2MP2 B;  4OVV A;  4TUU A;  2H7E A;  1WMH B;  5D3X A;  1YX6 B;  3K9O B;  2LUE A;  4KHB B;  5IJM A;  2KHW B;  2WWZ A;  3TVV A;  4C0A A;  1EGX A;  1TTN A;  3VUY A;  2DYN A;  1X11 A;  3ML9 A;  3PS6 A;  2V4L A;  2Y8F A;  4ZYN A;  3AU4 A;  1L2N A;  1U5E A;  4GGQ A;  2CKH B;  4HPL B;  5J2R A;  1PLS A;  5JLJ B;  1SGH A;  4BOS C;  2K2U A;  2Y7B A;  1FXT B;  4GDK B;  4IM0 A;  2CHW A;  2P0H A;  3A9J A;  2CS4 A;  3ZVR A;  2MX2 A;  3CST A;  1V5T A;  1OTR B;  3JSV A;  4HDQ A;  3KW5 B;  3RZW C;  2KQ7 A;  2GBR A;  2K6Q A;  4XC2 A;  3ZW3 A;  1Q5W B;  4WWP A;  2Y5B B;  2MBB B;  4W9G A;  2V1Y A;  2UZS A;  3APC A;  2CR5 A;  2BGF A;  2XK5 B;  1V89 A;  1M94 A;  3R66 C;  5DPT A;  2DHI A;  3KUZ A;  2COP A;  1WX7 A;  3QWZ B;  3QA8 A;  4ICU A;  1DYN A;  1UNQ A;  2NZ8 B;  3EHV A;  4NQK E;  4TV3 A;  3KY9 A;  4HB0 B;  1CMX B;  1Y8R C;  1V9J A;  4DHJ D;  1MIX A;  1Q67 A;  4BVU C;  2YT1 A;  3R7Q A;  2OOB B;  1S3S G;  3UGB B;  1GUA B;  4E3C A;  3UQB A;  2WX1 A;  3VDZ A;  2A5U A;  2R2O A;  1WE6 A;  3P6A A;  3DVN V;  3PEG A;  3CF6 E;  2L1C A;  1WGY A;  2LGY A;  4GSW A;  3IVF A;  3TCA A;  1WM2 A;  3M63 B;  1U5F A;  2WDT B;  3A4R A;  3VQI A;  1FOE A;  1P3Q U;  2AWT A;  3A4S C;  1E8Y A;  3GYO A;  2LXA A;  3UIN B;  4ANV A;  4KZC A;  4P7I A;  3QK0 A;  4MH0 E;  1TZ1 A;  2ASQ A;  4JLC A;  1PQS A;  1AAR A;  2DYO A;  4MEL A;  2JWZ A;  3JVZ X;  4CO7 A;  4BKS A;  3UQA A;  4E74 A;  2J59 M;  2O2V A;  1OEY A;  3DOW A;  1P6S A;  3P7Z A;  4PQ0 A;  5J3T A;  4IW0 A;  4TQ0 A;  2NCN A;  5DPW A;  3FLV A;  3L54 A;  1VCB A;  2KDI A;  2L3Z A;  4WAA A;  2ELA A;  4HAV B;  2M0X A;  3AXC A;  1V5M A;  4WJ7 A;  1WJ4 A;  2COA A;  2KMC A;  3HM6 X;  4W9H A;  3EPY A;  1XX0 A;  4B6W A;  2R09 A;  2IO2 B;  5L81 A;  3V61 A;  2KDB A;  3HIZ A;  2EC1 A;  5CTR C;  4DK5 A;  3KZ1 A;  4EZJ A;  4L6E A;  1KOT A;  4K81 A;  2L05 A;  4YL8 A;  4MSM B;  2FNJ B;  2NBW B;  2KKC A;  4IWO A;  4W9D A;  5DHF B;  1P5T A;  4XWX A;  2XEW A;  2MCN B;  2LRW A;  4IFS A;  1UGM A;  4MGY E;  4DDI D;  2IO0 B;  3QCA A;  4KHO A;  3DDC B;  1KLV A;  2VRR B;  1Z87 A;  3NSU A;  1L7Y A;  2KZR A;  3T9L A;  1UEF A;  1NI2 A;  4KHA A;  1YIW A;  4KAX B;  2IO3 B;  3B08 A;  3PRM B;  3KYC D;  2RNR B;  2DHK A;  4A6F A;  1NTI A;  3FSS A;  2DAF A;  1WI1 A;  2KN5 A;  2NMB A;  2KX0 A;  3PT2 B;  3QC8 B;  2N7D A;  3MJW A;  3A9J B;  2YRY A;  2DTC A;  2N1W A;  3LJ3 A;  2A4Z A;  4KDL B;  2N1V A;  2ZPN A;  2PE9 A;  3EC8 A;  2ZJD A;  5C5B A;  3L13 A;  4PYZ A;  3ZDM C;  3H1U A;  2PPH A;  3NZU A;  2LI5 A;  2JRH A;  3A98 B;  2L00 B;  1R4N I;  2KD0 A;  4KV2 A;  3V62 A;  3ZNI D;  3PRE A;  4A6F B;  2DHJ A;  2FCN A;  4RM9 A;  2XBB C;  3VTV A;  4EZK A;  4N9F 4;  4EOY A;  2D07 B;  3VHT C;  2KCJ A;  2ELB A;  3TIX A;  2KTR A;  2MP2 A;  4MGI E;  2KDF B;  2MBE A;  3CMM B;  4EKU A;  4GDL B;  3ZNH B;  3PP2 A;  2AL3 A;  3DVN U;  2K8H A;  2C7N B;  2C9W B;  1EF5 A;  1C3T A;  4MK0 A;  1W1H A;  3VIA A;  4MJS A;  2C7H A;  1OQY A;  1UEL A;  4BKT A;  1I2H A;  4JGH B;  2DLW A;  2MWS B;  4ANU A;  5D2M B;  3A1Q A;  2BWE S;  1W1D A;  3OLM D;  4MJS B;  5D27 A;  2W2X C;  2FCS A;  4IWQ A;  3TO1 A;  4LCD E;  4HHV A;  1E8Z A;  2GBJ A;  4WJO A;  2CQU A;  1FAO A;  2JVC A;  1OQN A;  4BBN C;  3D8F A;  1BTN A;  5LON B;  2LVO A;  2NBV B;  3PV1 A;  2YS1 A;  4W9I A;  2G4S A;  3L10 B;  4W9C A;  5DHA B;  1HB8 A;  2N9E B;  1H4R A;  3ZO5 B;  2LOZ A;  2BWF A;  2BYF A;  3NZS A;  1WXM A;  1EF1 A;  3ALB A;  2GJY A;  4K1R B;  2DX5 A;  4K7W A;  2J0M A;  3M95 A;  1LB1 A;  3SDL C;  3WAO A;  4MEM A;  1MPH A;  3DXC A;  4HAZ B;  4ZRK A;  2QKL A;  2K25 A;  2DFK A;  2IY0 B;  2BYE A;  2N4F A;  4M8M A;  3CXB B;  1YJ1 A;  2ZVN A;  3A9K B;  4BKG A;  3UIP B;  1NU2 A;  1OGW A;  3WAL A;  5IAA C;  4EUT A;  5L83 A;  2Z0P A;  4TYZ A;  3PRZ A;  3ZKJ C;  5L95 C;  2V76 A;  2BF8 B;  1ST7 A;  1V61 A;  2Q13 A;  3U30 A;  1V88 A;  5KCV A;  5C6R A;  2G35 A;  3DBH I;  3WAP A;  5JP4 A;  2RSU A;  3P2B A;  4WVF B;  2IZV B;  3L17 A;  1BTK A;  2PE6 B;  4HAT B;  1UZX B;  3M1I B;  2JT4 B;  2D11 A;  2NR2 A;  3APD A;  4KIK A;  4W9K A;  3PSC A;  4DBB A;  1WRD B;  2HTH A;  2MA9 B;  2ZCC A;  2KOX A;  2JPH A;  1X86 A;  4CHJ A;  4LDT D;  3KSY A;  3GOE A;  3PLU A;  4FUL A;  2G45 B;  2MLB A;  4XX5 A;  3RUL A;  3DCG A;  3NY5 A;  1UNR A;  1M7R A;  4DDG D;  1V81 A;  2COF A;  3X23 A;  1Q1O A;  2KO3 A;  4X57 B;  2J7Q B;  2YT0 A;  3KVF B;  1ZC3 B;  1WGG A;  1NDD A;  2LVP A;  4LDT B;  4NJ6 A;  3SD5 A;  3VH4 B;  3ZTC A;  3ULB A;  3QAQ A;  4G3X B;  3HQC A;  4JQW C;  1J8C A;  2DZK A;  4GDL A;  4GMV A;  1WG7 A;  1VD2 A;  3C0R B;  3ULC A;  2JUO A;  1UBI A;  4J6I A;  2DKQ A;  2QKM A;  4Z2M B;  3MTN B;  4NNJ B;  3PVL A;  2RGN B;  3ZVV A;  1WR6 E;  2D3G A;  2KFK A;  4GZU A;  3B0A A;  1I7A A;  1RJ2 A;  2KWU B;  4IOY X;  2MBO A;  1RRP B;  2K00 A;  1J0G A;  5D3V A;  3AI5 A;  5EFX A;  3HM3 A;  3OAW A;  1T0Y A;  4GN1 A;  3QX1 A;  4EMO A;  2L76 A;  4HLE A;  2Z0O A;  3VFK A;  5HE1 A;  4MSQ B;  2M1M A;  2Z59 B;  2IFS A;  1UD7 A;  2LGX A;  2O2V B;  1FB8 A;  4BFR A;  3PGE A;  3W1S A;  4FJY A;  3SUZ A;  1WGH A;  2G4D B;  5DH9 B;  2C5L C;  1XR0 B;  2CU1 A;  2LAS A;  2NPT B;  1MIZ B;  3AU5 A;  2RD0 A;  3M3J A;  1EAZ A;  4NJ7 A;  1PMS A;  4W9L A;  3L08 A;  2C60 A;  2Y8G A;  5D6J B;  1C1Y B;  1SE9 A;  2MBQ A;  2O6V B;  2PJH A;  3L16 A;  2HD5 B;  3VTU A;  4NY0 A;  2MW5 A;  1ZVR A;  4F7G A;  2D9Z A;  1X05 A;  1AQC A;  2EJ8 A;  3SO6 A;  3ZLZ A;  4AJY B;  4EFO A;  3ENE A;  2DHZ A;  4AJW A;  4FBJ B;  1MK9 B;  3D8E A;  1WGQ A;  1KJT A;  2LGD A;  1Z2M A;  2O6V D;  1K8R B;  4FHJ A;  1XKE A;  2KMA A;  4JIO U;  4LJP B;  4OVU A;  1Y5O A;  3ZIM A;  2YS3 A;  2I1J A;  1K5G B;  1UNP A;  5FI0 A;  2HRJ A;  2LWP A;  2NS5 A;  3VVW B;  3ODW A;  5JZE B;  4F7U P;  4K2P A;  1YQB A;  4K2O A;  2VRW B;  3V6E B;  1BAK A;  2KFK B;  2MDX A;  1R4M I;  1LFD A;  1WJU A;  2IBI B;  2MRP A;  1LM8 B;  5AZH A;  4ASW C;  4B9K A;  4F1S A;  2DYM A;  4HXD A;  3DVG Y;  4FJZ A;  1H10 A;  3H6N A;  4BOZ B;  4HAW B;  1UH6 A;  3R7R A;  1GC7 A;  3RCZ A;  3DVG X;  1IPG A;  2P8V A;  1Y19 B;  2KDE B;  2ZPY A;  1EUV B;  3G9W A;  5J18 A;  2KAN A;  3O65 B;  5D3W A;  1NBF C;  1K5D B;  1XQQ A;  1FGY A;  3ML8 A;  4HPM B;  4K7U A;  4WJN A;  1WH3 A;  4A20 A;  4ANW A;  1TGZ B;  1SIF A;  4B6H A;  1KZG A;  1PFJ A;  1NTV A;  1W1G A;  3KRX A;  4IC7 B;  4LJO B;  2D10 A;  2VSZ A;  4W9E A;  3ZUN A;  2K2J A;  4ANX A;  4HB4 B;  3I3T B;  5JHB A;  5LXH A;  4XZ4 A;  3A8P A;  1N3H A;  1MKE A;  5C23 A;  2ZZP B;  3GYP A;  3DBL I;  2FCM A;  3KUD B;  4TQ1 A;  4AOF A;  3A8Q A;  3JSV B;  1LW3 A;  1NTY A;  4FLH A;  2MSE D;  4DBG A;  5C1Z A;  4DHJ B;  2WYQ A;  3JYU A;  3VTW A;  2L8J A;  3ZRC A;  1U5D A;  1RLF A;  3APF A;  1ISN A;  5CHV C;  4A5K A;  4AP4 C;  1G6J A;  2CHX A;  2DA0 A;  4URK A;  2V3S A;  1P9D U;  4KSK C;  2G3Q B;  4GB9 A;  1ACA A;  4AUQ C;  4WWO A;  3NOB A;  2K6D B;  1E7U A;  4GOC A;  2BCJ A;  1V5U A;  4BBK A;  2LG1 A;  2ZNV C;  4IUM B;  2E2X A;  3B1L X;  4JL9 A;  4K7S A;  5C16 A;  3N30 A;  2NPT A;  2L0T A;  3EFU A;  1XCG A;  3KUC B;  5AZF A;  3RD2 A;  5EDS A;  1BWN A;  3U7D A;  2UYZ B;  2CRF A;  4FN2 A;  3PTF C;  1QZE A;  2N0Y A;  4ZRI A;  3DXE A;  2QHO A;  3ZDT A;  1DDM A;  2KX3 A;  4MGZ E;  2LYD A;  3MHS D;  4PYU A;  4AWJ A;  4TKN A;  2MBH A;  4WJP A;  2CB8 A;  2LD9 A;  3SNH A;  5C79 A;  3GZN I;  3D8D A;  2DEN B;  2N9X A;  2YLM A;  2LOX A;  3R3M A;  4HAY B;  3RZF A;  1WJ1 A;  1EVH A;  4PS7 A;  2LJ5 A;  4DWF A;  5JHH A;  1B55 A;  3ZNZ B;  1SHC A;  3SU8 X;  3VXW A;  3W1S C;  1DRO A;  1BT0 A;  1XD4 A;  4GXB A;  2OJR A;  2DKP A;  4DXA B;  2GS0 A;  2KXJ A;  4G11 A;  3VAW A;  3IFW B;  1I42 A;  2P0D A;  2RLO A;  5LOP B;  1JRU A;  3PHX B;  4RM8 A;  4B95 A;  2UZR A;  3QWM A;  4A3O A;  2HE7 A;  2KFJ A;  4FJV B;  4DX8 A;  4KIK B;  1AWE A;  5AZG A;  3QBV B;  2LKO A;  4IM2 A;  1QC6 A;  2JRI B;  2JP2 A;  3PG7 A;  4I6N B;  1WJ6 A;  4FA6 A;  2ADZ A;  3T06 A;  3RCP A;  1U5G A;  2I5C A;  3L0W B;  3ODO A;  2M38 A;  2GMI C;  1IP9 A;  2GBN A;  4HJK A;  1KZ7 A;  4GPT B;  5CLL B;  1J19 A;  5BO4 B;  5J3Q A;  1P98 A;  3H7P A;  4Z2N A;  3RT3 B;  1WVH A;  3ZRF A;  1TBE A;  4NAW A;  4F7Z A;  2ZCB A;  1IYF A;  3JW0 X;  2LBB A;  4HVB A;  2AL6 A;  1ZSQ A;  2YF0 A;  2M4N A;  2NVU I;  2D2Q A;  1OY2 A;  1TQZ A;  3PVU A;  2BKR B;  3H7S A;  3OJ4 B;  5CHW A;  4M8N A;  3QJZ A;  5FR6 A;  3N7C A;  3BJI A;  2L0F A;  4KZ0 A;  4GMX B;  3VH3 B;  1X1G A;  1YX5 B;  2FID A;  2KNB A;  4G50 A;  1WYW B;  1QQG A;  4A3P A;  3U8Z A;  2I1K A;  2COC A;  2K8B A;  1P1A A;  2JXX A;  2RQ1 A;  2VKI A;  1UBQ A;  1ZW7 A;  4NAW B;  4CYE A;  1MG8 A;  2D9X A;  2XQN M;  3K9P B;  3PSE B;  1D3Z A;  2ABD A;  2FUH B;  3V60 A;  5LXI B;  2L2I A;  5D3Y A;  4A6H A;  1FHX A;  2JZZ A;  5JH5 C;  3NS8 A;  3KRW A;  1GNU A;  3WYF B;  3DPD A;  3ZTD A;  3SV1 A;  4CHM A;  4RMA A;  4ZDV A;  2ZNV B;  1V5O A;  4GDK A;  1HE8 A;  1V6E A;  5JHG A;  5C5B B;  4W9J A;  5E6N A;  2LRU A;  2O6V A;  3H9D A;  4DX9 0;  2MWN B;  5HE3 A;  2HJ8 A;  5J17 A;  1TJ6 A;  2BYV E;  2Z0E B;  4FAD A;  4KDI C;  4FHK A;  1LQB A;  2PEA A;  3UZT A;  1LXD A;  3OJ3 A;  4KVG B;  2N23 A;  3RYT A;  5HE2 A;  3LDZ E;  4MY6 A;  3ML4 A;  1WE7 A;  1OEY J;  2K8C A;  2Z0D B;  3VUW A;  5JHA A;  3CSF A;  1NVL A;  4GU2 A;  1WXS A;  3KYD D;  2XK5 A;  2UVM A;  4PS3 A;  2KQS A;  3M62 B;  2P0F A;  4HB2 B;  1WGD A;  1WMH A;  1E8X A;  3HK0 A;  2FIF A;  4G0N B;  2YS5 A;  1XOD A;  3DXD A;  4D0N B;  1WXA A;  2LVQ A;  4MM3 A;  2ROZ B;  5HE0 A;  2KTR B;  2LXC A;  5DIF B;  2AEH A;  4BBN F;  2IYB A;  3VOQ A;  2NBU A;  3WAM A;  3Q3J A;  1TXD A;  1WXV A;  2KLC A;  4NQL B;  2FJ9 A;  2YVC A;  3PZD A;  4A6K A;  2KJ6 A;  1Z5S B;  2FCQ A;  2DN6 A;  2KJR A;  2AYO B;  2RR9 A;  5J3Y A;  3TFM A;  3O96 A;  1P0R A;  2IYD B;  1X1F A;  3A33 B;  1P3R A;  3IG3 A;  4HK2 A;  5GMV A;  3W1Y A;  3ZNG C;  2BPS A;  1I35 A;  4IG7 B;  3OAN A;  4F8C B;  2FJL A;  2KGX B;  1OMW A;  4MT7 A;  5IA7 A;  1IRS A;  2REX A;  4PS8 A;  3UF8 A;  2M8S A;  2DYB A;  5E6O A;  2I5F A;  3ONS A;  1WJN A;  2MFQ A;  2M17 A;  5CX3 A;  3N32 A;  2ZEQ A;  4NSW A;  2RSG A;  1WX8 A;  2LZ6 A;  3D32 A;  3TJP A;  2LUL A;  1WZ3 A;  4GIV A;  5CHF A;  2WH5 A;  5AEK B;  2X18 A;  1A5R A;  3V6C B;  5GOW B;  2DAJ A;  1HB6 A;  4IM3 A;  1E90 A;  3CIK A;  3DQV A;  2IY1 B;  2KC2 A;  3PLV A;  4W9F A;  2D4Q A;  1XD3 B;  3QHT A;  2KWV B;  1DDW A;  3RUI B;  1V80 A;  3BY4 B;  1ZC4 B;  1RAX A;  1UPR A;  1F9J A;  2J0K A;  4HAU B;  4HWI B;  1ZKH A;  2W9N A;  1GG3 A;  2Z0Q A;  1E7V A;  3X0W A;  2M14 A;  2PZ1 A;  5D7G A;  1RFA A;  1KM7 A;  2DZM A;  1WM3 A;  2CY4 A;  5CLQ B;  5G55 A;  2GCJ A;  4EZL A;  3DBS A;  1WY8 A;  4HDO A;  2MQJ A;  4WQO B;  1H8C A;  5DPS A;  1GJZ A;  1DBH A;  2OQB A;  2KC1 A;  1WI0 A;  3TMP B;  4HCP B;  3PPA A;  1FGZ A;  1M7E A;  2D9V A;  2JY6 A;  1WFY A;  2CHZ A;  2W2X D;  5DI9 B;  2HTH B;  5FI1 A;  2FAZ A;  3WAN A;  2D9Y A;  4ZRJ A;  2H7D A; 
#chains in the Genus database with same CATH topology
 1WF9 A;  1GC6 A;  4JWU C;  1IBX B;  1KRH A;  4GLS C;  1ZM0 A;  4A90 A;  3A9K A;  4IWP A;  3V5W A;  1WX9 A;  1V49 A;  3NJT A;  3QQ8 B;  3S2A A;  3WA0 A;  2WXG A;  2DYQ A;  1ZOY B;  3BIN A;  5E6P A;  3QIJ A;  2EKE C;  3H7P B;  3ZJT A;  2ROV A;  2COD A;  2DZI A;  5I2S A;  4S0R A;  2JX5 A;  2EMT A;  1HZ6 A;  2N9P C;  5KHO A;  1RRB A;  3DBH B;  1U4A A;  2EMS A;  3FM8 C;  4P1C C;  1ZGU B;  2LGS A;  1F2R I;  1L4Z B;  4F7H A;  1WIA A;  2G1E A;  3T3N A;  1QF6 A;  2KLG A;  1V1P B;  4C56 C;  1Q0W B;  4II3 B;  3ZJV A;  2KTF A;  2PW9 A;  1FHO A;  1WJM A;  4ZRP A;  1C76 A;  2D9W A;  4M0W B;  1E10 A;  4JE3 B;  2J0J A;  3N1Z C;  2MP2 B;  2MJD A;  1WMH B;  2LHD A;  2LUE A;  4KHB B;  5IJM A;  2KHW B;  1ZDX A;  3VRA B;  1EGX A;  4US9 A;  3ML9 A;  2V4L A;  2WLB A;  4A9A A;  3E9O A;  4GGQ A;  5J2R A;  1PLS A;  1CJE A;  5JLJ B;  1SGH A;  4GDK B;  4IM0 A;  1ZP0 B;  1NYR A;  2J42 A;  3RZW C;  1YJI A;  3FKY A;  4L1R A;  1E7P B;  4W9G A;  2V1Y A;  3APC A;  2BGF A;  2XK5 B;  2WXI A;  1UNQ A;  4TV3 A;  1Y8R C;  1SXT A;  4DHJ D;  1MIX A;  1GUA B;  3UQB A;  4JK9 A;  4D6W A;  1FCC C;  3DVN V;  2L1C A;  3AE4 B;  1TS4 A;  5FR3 A;  1QQR A;  2WDR B;  2JWZ A;  3JVZ X;  4BKS A;  2J59 M;  1MFW A;  4C00 A;  3P7Z A;  3DBL B;  4JKC A;  5BMG A;  1KF6 B;  2L3Z A;  4WAA A;  2M0X A;  3AXC A;  2COA A;  1F52 A;  2IJ0 A;  4DK5 A;  1KOT A;  4L6E A;  2KKC A;  4W9D A;  5DHF B;  2OED A;  1SJH D;  1UGM A;  4MGY E;  1WYG A;  3AE1 B;  4KHO A;  2VRR B;  5IRS A;  4KAX B;  1NTI A;  2N7D A;  3MJW A;  3A9J B;  4KDL B;  2BB6 A;  2ZPN A;  3ZDM C;  5IN7 A;  4KV2 A;  1R4N I;  2KD0 A;  1B9R A;  4A6F B;  5AUK A;  4EOY A;  5I4D A;  1PYW D;  2GLS A;  3RN9 C;  4MK0 A;  3TUO A;  1OQY A;  1L0X B;  1I2H A;  2QC8 A;  1W1D A;  2KUQ A;  1SJE D;  1T77 A;  4WJO A;  1FAO A;  1BTN A;  2YS1 A;  2ACZ B;  1HB8 A;  3I5J C;  1C78 A;  2Z59 A;  2BWF A;  3NZS A;  1WXM A;  1EF1 A;  2DX5 A;  3LYY A;  1MPH A;  4HAZ B;  4ZRK A;  2K25 A;  3OWE B;  2BYE A;  1JRO A;  3RNC C;  1NU2 A;  3E66 A;  5L83 A;  2Z0P A;  2LEK A;  2K0P A;  3Q8C A;  1V88 A;  5C6R A;  2PKO A;  1FNU A;  5TR5 A;  5CX3 A;  3APD A;  2JT4 B;  3M1I B;  4KIK A;  2DIK A;  3PSC A;  1X86 A;  3KSY A;  3GOE A;  2J4X A;  3DWG C;  2MLB A;  4FUL A;  5C2T B;  1YNT E;  3KVF B;  1ZC3 B;  5J17 A;  4RCO A;  1GB4 A;  1L5P A;  1XF5 L;  1J8C A;  3DHI C;  1WG7 A;  2PVG C;  2JUO A;  3ZVV A;  3B0A A;  3AEF B;  1HQR D;  2K00 A;  2ZW0 A;  3AI5 A;  3HM3 A;  3OAW A;  4JK7 A;  2M1M A;  2K5P A;  4JKH A;  3MFG A;  3W1S A;  3SUZ A;  3AV8 A;  2CU1 A;  2RD0 A;  4NJ7 A;  1TKY A;  3L08 A;  1HTO A;  3HIE A;  5D6J B;  1C1Y B;  1SE9 A;  1ZXI A;  2MBQ A;  3SR6 A;  4KX6 B;  1ZVR A;  2EJ8 A;  3ZLZ A;  2BBC A;  2DHZ A;  1MI1 A;  2O6V D;  3ZIM A;  4FXC A;  4OVU A;  2YS3 A;  1I4G A;  4K2O A;  4YSZ B;  4LNK A;  4ASW C;  3N20 C;  1LFD A;  2MRP A;  4DXF A;  4F1S A;  3DVG Y;  2WXL A;  4HAW B;  1FM0 D;  3G9W A;  5D3W A;  1K5D B;  4K7U A;  4A20 A;  1K53 A;  3KRX A;  1C9F A;  1W1G A;  3NUH B;  1A70 A;  5LXH A;  5C23 A;  1MKE A;  2IDY A;  1NTY A;  3VTW A;  1U5D A;  4AP4 C;  1ISN A;  5CHV C;  4A5K A;  4URK A;  4KSK C;  1ACA A;  4ARC A;  3UI3 A;  4YSY B;  5G5G A;  2Y5C A;  5G2N A;  2E2X A;  3AMZ A;  5EDS A;  3EFU A;  3KUC B;  1XCG A;  1ZUD 2;  3U7D A;  4MGZ E;  1R4M B;  4UDU C;  4WJP A;  3GZN I;  3D8D A;  1I4H A;  2DEN B;  3R3M A;  1WJ1 A;  2LJ5 A;  3VXW A;  3AED B;  1BT0 A;  3RI7 C;  2DKP A;  4DXA B;  1UUP A;  2KXJ A;  3R8B A;  2Y3A A;  4M00 A;  2RLO A;  4B95 A;  2HE7 A;  4FJV B;  1AWE A;  4OZC A;  4N59 A;  2JP2 A;  4KHB A;  1DOX A;  4FA6 A;  2ADZ A;  1T0S C;  1T0Q C;  2KN4 A;  3KLS X;  3ETR A;  3E9P A;  1IYF A;  3FVC A;  4HVB A;  1ZSQ A;  2PTL A;  1PUT A;  2BKR B;  5JXV A;  2KNB A;  1QQG A;  2IGD A;  4HKZ E;  2LMC A;  1P1A A;  1SBB B;  3RNG C;  3TEW A;  4CYE A;  1MG8 A;  1FNW A;  3V60 A;  5LXI B;  4A6H A;  4JKD A;  2JZZ A;  3NS8 A;  1QIL A;  2ZNV B;  4GDK A;  4JKF A;  2MWN B;  1TJ6 A;  4FAD A;  4KDI C;  2RDH A;  4FHK A;  4B0M A;  3LDZ E;  3AB5 A;  3FIL A;  3N9Y C;  5JHA A;  4C7Z A;  4GU2 A;  1GPX A;  2XK5 A;  2UVM A;  1E0Z A;  2WHI A;  1NEK B;  2P0F A;  3HK0 A;  2LXC A;  2FJU B;  4BBN F;  2IYB A;  3FAH A;  2KJ6 A;  2KJR A;  3P2B A;  3W5U B;  2AYO B;  3IG3 A;  2IYD B;  5BMH A;  1I42 A;  4IG7 B;  2PVO D;  2REX A;  1SF0 A;  2K22 A;  4LNI A;  3W5V B;  3ONS A;  1WJN A;  1TS2 A;  2Q5W D;  1A5R A;  2X18 A;  5HHD G;  2H89 B;  3SBT A;  1C79 A;  1ZXH A;  4IM3 A;  1PGA A;  3CIK A;  2KC2 A;  3PLV A;  4W9F A;  1UWX A;  2J0K A;  3EUB 2;  2WNM A;  3RNA C;  4HAU B;  4HWI B;  2W9N A;  1GG3 A;  2Z0Q A;  1E7V A;  2W3S A;  2NMQ A;  1L0V B;  1YMH E;  5D7G A;  2DZM A;  4DXG A;  5G55 A;  4NAM A;  1DBH A;  2OQB A;  2KC1 A;  3IT6 B;  3TMP B;  5EE0 A;  1M7E A;  3NWA A;  2D9V A;  1UNS A;  1WFY A;  2CHZ A;  2W2X D;  2FAZ A;  3Q8B A;  4NZL B;  4ILJ A;  2KVR A;  2DZJ A;  1Y56 A;  4E71 A;  2UWQ A;  1XLQ A;  2K49 A;  3ENB A;  3PRP B;  4H8S A;  1MVK A;  3FP5 A;  3NS1 A;  2FDQ A;  3BYY B;  5HKH A;  1XT9 B;  1WSP A;  1SE2 A;  2DX5 B;  2R61 A;  4ILH A;  2KK8 A;  4RF1 A;  1TS3 A;  1FFU A;  4JKE A;  4ITK A;  1DDV A;  2YSZ A;  1WZ0 A;  3BVM A;  4K3B A;  1UPQ A;  1E8W A;  4RGO S;  2DX1 A;  2RPQ A;  4HCN B;  2OTX A;  3F0W A;  5KQ1 A;  2JF5 A;  1TY0 A;  2V4I B;  1TT5 B;  3NVV A;  2GBK A;  1WGU A;  3DBR I;  4NPN A;  1U27 A;  2XN9 C;  3NWD A;  1ACC A;  2ZVO A;  3PVW A;  3TL5 A;  4LNN A;  4K17 A;  1V2Y A;  1T0R C;  2K39 A;  2DWQ A;  3NHE B;  2CY5 A;  2EEL A;  2WXM A;  2W2W A;  4HB3 B;  1C77 A;  1SIJ A;  2KIG A;  3TW1 A;  2V3N A;  4OVV A;  1F77 A;  4TUU A;  2ICI A;  1YX6 B;  5D3X A;  1J7B A;  4HPP A;  3TVV A;  1I4R A;  4H2A A;  4M0W A;  1N63 A;  5HFY A;  3BVG A;  2CKH B;  5IP4 D;  4JKG B;  1K50 A;  1GGO A;  3OG5 A;  2CS4 A;  2KDM A;  2MX2 A;  3CST A;  1V5T A;  1HA5 A;  2HJ1 A;  2GBR A;  1EWC A;  1TJE A;  4WWP A;  1ZYI A;  2MBB B;  2UZS A;  2CR5 A;  1PFD A;  4IKG A;  3R66 C;  3KUZ A;  1C4P A;  1DYN A;  4XDD A;  1KBL A;  1FMA D;  1V9J A;  1HTQ A;  2NTS A;  3DWM A;  2DBY A;  2YT1 A;  2VH2 A;  4BVU C;  2OOB B;  2K3U A;  4E3C A;  2PLP A;  4OVZ A;  1DOI A;  2R2O A;  1WE6 A;  3L4P A;  4GSW A;  3M63 B;  1BXT A;  1YQ3 B;  3A4R A;  3VQI A;  3A4S C;  1E8Y A;  3GYO A;  3QK0 A;  4MH0 E;  1TZ1 A;  4JLC A;  3AM9 A;  1AAR A;  2DYO A;  3BK1 A;  4E74 A;  2O2V A;  1P6S A;  1JRP A;  1VCB A;  1V5M A;  3EPY A;  4B6W A;  3V61 A;  1UF0 A;  1TKE A;  4LLG M;  1SB3 C;  3KZ1 A;  2L05 A;  1JWS D;  2FNJ B;  2NBW B;  2MCN B;  4XWX A;  2XEW A;  4IFS A;  1L4D B;  2IO0 B;  1Z87 A;  2KZR A;  3U2S C;  1NI2 A;  2RNR B;  2KN5 A;  3FSS A;  2DAF A;  1PDX A;  2Y5P A;  4N6E B;  3IT4 B;  2N1W A;  1JML A;  2N1V A;  1WRI A;  4PYZ A;  3Q3M C;  2INC C;  2W82 A;  3ZNI D;  3HVD A;  2XBB C;  4QXA B;  1E6E B;  2ELB A;  2D3B A;  3TIX A;  2MP2 A;  3MC9 A;  2AQ3 B;  3PP2 A;  3IAS 1;  4ZHP A;  1EF5 A;  1W1H A;  4MJS A;  3Q14 C;  1UEL A;  5D2M B;  3A1Q A;  4OZB A;  4MM3 B;  2BWE S;  5D27 A;  2W2X C;  4IWQ A;  3TO1 A;  1OQN A;  3D8F A;  2NBV B;  3V05 A;  3AE8 B;  2G4S A;  4W9C A;  5HG2 A;  5BMI A;  1H4R A;  4L1B A;  2BYF A;  4K1R B;  4K7W A;  1QOG A;  1JWA D;  3M95 A;  3Q3N C;  2IY0 B;  2HTM E;  2ZVN A;  3A9K B;  2KYW A;  2W54 A;  3UIP B;  1R7S A;  3WAL A;  3PRZ A;  3ZKJ C;  3TEZ A;  4XGA B;  3DBH I;  2G35 A;  2QCZ A;  4HAT B;  3NZ3 A;  4DWF A;  2D11 A;  4W9K A;  4DBB A;  1WRD B;  2HTH A;  2MA9 B;  1B1Z A;  1XLO A;  2JPH A;  4CHJ A;  4LDT D;  3RUL A;  3PLU A;  1KC7 A;  2X38 A;  1IGC A;  4ARI A;  1UNR A;  1M7R A;  4DDG D;  4B0E A;  2COF A;  4X57 B;  3SD5 A;  1WGG A;  2LVP A;  4G3X B;  3HQC A;  2DZK A;  1XEE A;  2W55 A;  1QOF A;  3ULC A;  3MTN B;  3FIL B;  1NI3 A;  4IOY X;  2MBO A;  2J52 A;  1RRP B;  5D3V A;  4JX1 C;  1T0Y A;  5HE1 A;  4MSQ B;  2INN E;  3P42 A;  1FB8 A;  1WGH A;  2G4D B;  5DH9 B;  2C5L C;  1XR0 B;  2AX5 A;  2LAS A;  2NPT B;  3AU5 A;  4W9L A;  1PMS A;  3HRD D;  2C60 A;  2Y8G A;  4D2K A;  2O6V B;  2PJH A;  1N5W A;  2HD5 B;  4NY0 A;  2JZP A;  3VTU A;  4F7G A;  2D9Z A;  1X05 A;  1AQC A;  2RPV A;  4AJW A;  4HJG E;  3AEB B;  4JIO U;  4XC2 A;  2FBW B;  4US8 A;  1XKE A;  1JQ4 A;  1TY2 A;  4S17 A;  5FI0 A;  2HRJ A;  1GAQ B;  1R4M I;  2IBI B;  5AZH A;  4B9K A;  1LM8 B;  1FEH A;  3RFZ B;  2DYM A;  3H6N A;  1UH6 A;  3R7R A;  1GC7 A;  2P8V A;  2FUG 1;  5J18 A;  1FGY A;  4ANW A;  4LJO B;  2IND C;  4B6H A;  1PFJ A;  4DDI D;  2VSZ A;  2K2J A;  2ZZP B;  4AOF A;  2FCM A;  5LG4 B;  1KLG D;  1LW3 A;  2MSE D;  4DBG A;  4WUR A;  3CWI A;  5D3I B;  2CHX A;  2DA0 A;  2V3S A;  1P9D U;  4GB9 A;  4HSI A;  3NOB A;  2K6D B;  3BWU D;  5IKC M;  4GOC A;  2BCJ A;  3P4R B;  2ZNV C;  4JL9 A;  2NPT A;  5AZF A;  1BWN A;  2PIA A;  3PTF C;  4WIP A;  2QHO A;  1DDM A;  2KX3 A;  3J9C A;  4PYU A;  4AWJ A;  2ON8 A;  4TKN A;  3AEE B;  3Q2A C;  5C79 A;  2D3A A;  2N9X A;  3RZF A;  1EVH A;  3SU8 X;  3KWV A;  1QKZ A;  2OJR A;  5EE9 A;  3TEX A;  4OT1 A;  2P0D A;  5EE3 A;  3GZN B;  1XCQ L;  3PHX B;  4RM8 A;  2WU5 B;  3AE5 B;  2UZR A;  4KIK B;  5AZG A;  4IM2 A;  2LKO A;  1TYG B;  4DIX A;  4I6N B;  1FO4 A;  1U5G A;  2I5C A;  2GMI C;  1D5X C;  1KZ7 A;  5CLL B;  1J19 A;  1P98 A;  3ZRF A;  4NAW A;  4F7Z A;  2ZCB A;  2AL6 A;  2YF0 A;  3H7S A;  1OY2 A;  5CHW A;  3BJI A;  4KZ0 A;  1J7A A;  1YX5 B;  4P6V F;  1XXG A;  2IPK D;  2COC A;  2JXX A;  2VKI A;  1UBQ A;  3E9L A;  2YT2 A;  2ABD A;  2L2I A;  5D3Y A;  3AEA B;  1FHX A;  5JH5 C;  3RPF C;  3SV1 A;  2L83 A;  1V5O A;  5E6N A;  2BQQ A;  4JKB A;  2LRU A;  2O6V A;  2BTE A;  4DX9 0;  1AW7 A;  3IXS A;  4XE0 A;  1FNV A;  4KVG B;  3KQ4 A;  5M4Y B;  3RYT A;  1JWM D;  2Z0D B;  1OEY J;  3CSF A;  1NVL A;  1WXS A;  3KYD D;  3PZ7 A;  2KQS A;  3M62 B;  1DOY A;  1MJD A;  5LNK 1;  1WGD A;  1E8X A;  2FIF A;  3DXD A;  2CJO A;  2LVQ A;  4MM3 A;  3URY A;  5JVL A;  1L6U A;  3VOQ A;  1ET6 A;  2KLC A;  2FJ9 A;  2YVC A;  3PZD A;  4A6K A;  1Z5S B;  2FCQ A;  5J3Y A;  2NBV A;  3TFM A;  1XO3 A;  3ZUN A;  3UQA A;  4HK2 A;  2CU3 A;  2BPS A;  4O1N A;  4YXD B;  4F8C B;  1I4Q A;  2KGX B;  1OMW A;  4WWM A;  5E6O A;  1KH0 A;  4BZA A;  2M17 A;  3N32 A;  4NSW A;  4QJ4 B;  3D32 A;  2LUL A;  1WZ3 A;  3MC0 B;  4GIV A;  5HI1 A;  5GOW B;  1HB6 A;  1E90 A;  2D3C A;  3DQV A;  2WXK A;  1XD3 B;  3QHT A;  5BYR A;  2KWV B;  1DDW A;  1ZC4 B;  4A8X C;  2QDF A;  3TEY A;  3HSA A;  1ZKH A;  2M14 A;  2PZ1 A;  4ZHO A;  2CY4 A;  5CLQ B;  2WXO A;  2WGS A;  4MH8 A;  4WQO B;  1H8C A;  2N0S B;  1FGZ A;  3GB1 A;  2JY6 A;  2W3R A;  2HTH B;  3T3O A;  1MK7 B;  3IBE A;  3A1Q B;  2RUK B;  3AEC B;  3O13 A;  4WSF A;  5KQ4 A;  1MPE A;  1IUE A;  3MDB C;  2ZW1 A;  3P1M A;  3AEG B;  2CAY A;  2RVB B;  4MAC A;  2KWC A;  4HEA 1;  4I6L B;  2C7M B;  2KAJ A;  4MGK E;  3T8M A;  3EEC A;  3UIO B;  3TBL D;  4YTP B;  2L7R A;  4HAX B;  1U29 A;  4HKQ A;  1HBK A;  5D94 A;  3AUL A;  1EO6 A;  3E9S A;  5KHQ A;  3HW2 B;  5MPO A;  1RM6 C;  1WXQ A;  1KI1 B;  1U2B A;  3ODX A;  2B3A A;  2BKF A;  4M01 A;  2B76 B;  4PNK A;  4DHZ E;  1YD8 U;  5BYS A;  2GCL A;  2IO1 B;  2KJH B;  1HZ5 A;  2OHF A;  1STE A;  3QAR A;  1FIQ A;  4IAP A;  1S1Q B;  3SHQ A;  4DHZ B;  3SYX A;  3TSS A;  2N7E A;  4KSL C;  2JZ3 B;  2GBM A;  4I6P A;  4YON A;  1DYQ A;  1BML C;  3MJ5 A;  2WWZ A;  4C0A A;  4ZYS A;  3VUY A;  2DYN A;  1U5E A;  3AE2 B;  4BOS C;  1JWB D;  1FXT B;  2P0H A;  3A9J A;  3JSV A;  3ZVR A;  1OTR B;  4HDQ A;  3MHZ A;  2IGG A;  2KQ7 A;  3ZW3 A;  1VR9 A;  3RNF C;  2Y5B B;  4C7Y A;  1V89 A;  1M94 A;  4AQ7 A;  2DHI A;  4KGT A;  1V8C A;  2COP A;  3EHV A;  1FXI A;  3KY9 A;  2WP9 B;  4HB0 B;  1N6Z A;  4EE2 A;  1Q67 A;  3R7Q A;  3UGB B;  3Q8E A;  2A5U A;  2VH1 A;  3PEG A;  3CF6 E;  1WGY A;  1N61 A;  3TCA A;  2WDT B;  3ZXV A;  1FOE A;  4LNF A;  1P3Q U;  2AWT A;  4ANV A;  1VBH A;  2YEP B;  4P7I A;  4GOU A;  1WWT A;  4MEL A;  1OQR A;  4CO7 A;  1OEY A;  3DOW A;  4PQ0 A;  1FFV A;  3LXF A;  4WAF A;  4TQ0 A;  4C80 A;  5DPW A;  4CQN A;  3FLV A;  1LO5 D;  2KDI A;  4HAV B;  4WJ7 A;  1WJ4 A;  2KMC A;  4C4V B;  4W9H A;  1SSN A;  3C8Y A;  2IO2 B;  2KDB A;  2EC1 A;  5CTR C;  3OHM B;  2WXQ A;  4YL8 A;  4MSM B;  3QCA A;  3DDC B;  1NYQ A;  3NSU A;  2KQ4 X;  1UEF A;  4KHA A;  4DHJ B;  3ZRC A;  3B08 A;  4N58 A;  4A6F A;  2WDV B;  3PT2 B;  1WI1 A;  2NMB A;  2KX0 A;  3QC8 B;  2CJN A;  2A4Z A;  3LJ3 A;  3L13 A;  1XLP A;  2PPH A;  1XCT L;  3NZU A;  2LI5 A;  4RH6 A;  3A98 B;  2L00 B;  1CZP A;  3V62 A;  4RM9 A;  2DHJ A;  2FCN A;  3VTV A;  2D07 B;  2XNA C;  1SE4 A;  2R82 A;  2KDF B;  2MBE A;  3CMM B;  3ZNH B;  3DVN U;  2K8H A;  3VIA A;  5D3D A;  4JGH B;  2MWS B;  4ANU A;  4MJS B;  1D5Z C;  3I57 A;  1PGX A;  4GNK B;  4HHV A;  1E8Z A;  4BBN C;  5LON B;  5BYQ A;  3L10 B;  5DHA B;  2N9E B;  1P7E A;  2GJY A;  2J0M A;  1T3Q A;  2QKL A;  2LJI A;  3CXB B;  4NJC A;  4BKG A;  2Z14 A;  2AQ2 B;  4EUT A;  3NWF A;  1BUI C;  2BF8 B;  2EKI A;  2JQR B;  1ST7 A;  2Q13 A;  1T6B X;  3W9C B;  3ZYY X;  5L95 C;  3WAP A;  2RSU A;  1BTK A;  2NR2 A;  2NTT A;  2ZCC A;  2KOX A;  3BII D;  1JAL A;  1XLN A;  1V81 A;  2KT7 A;  2J7Q B;  2YT0 A;  4LDT B;  3ZTC A;  4RFB A;  3VH4 B;  1N5X A;  3QAQ A;  2OJW A;  5T8I A;  4GMV A;  3C0R B;  1UBI A;  4J6I A;  2MJ3 A;  2QKM A;  4NNJ B;  2D3G A;  4USA A;  2KWU B;  2QJL A;  1J0G A;  2QMT A;  1GOZ A;  4GN1 A;  1ZE3 D;  4EMO A;  3QX1 A;  2L76 A;  3RMK C;  4HLE A;  3VFK A;  1CK1 A;  2DNF A;  1HXY D;  2K9X A;  2O2V B;  4BFR A;  3PGE A;  2M0A A;  1MIZ B;  3M3J A;  1EAZ A;  1KTK A;  5FKA C;  3C19 A;  3L16 A;  3SO6 A;  1YN3 A;  4AJY B;  4EFO A;  4FBJ B;  3ENE A;  1LGR A;  1MK9 B;  3D8E A;  2LGD A;  1Z2M A;  2L1A A;  1K8R B;  4Q2J A;  4CSQ A;  1K5G B;  1UNP A;  2GB1 A;  2LWP A;  4KGR A;  2VRW B;  1TS5 A;  2MDX A;  1WJU A;  2V3P A;  1H10 A;  2JXT A;  5C3J B;  1F1H A;  3RCZ A;  1IPG A;  3N1X C;  2WXN A;  1EUV B;  3LB8 C;  3O65 B;  2Z8L A;  1KLV A;  4HPM B;  1WH3 A;  1SIF A;  1NTV A;  3NVY A;  2D10 A;  4W9E A;  1VZ7 A;  2MJE A;  3I3T B;  3A8P A;  2SEB D;  4RGM A;  4YTM B;  3DBL I;  3KUD B;  3JSV B;  4FLH A;  3E56 A;  4BAX A;  5C1Z A;  3JYU A;  2L8J A;  1RLF A;  3APF A;  2WXP A;  3SEB A;  2Z13 A;  4AUQ C;  2INP E;  2MEK A;  1TZO A;  3FC4 A;  1I7H A;  1V5U A;  2LG1 A;  2WXF A;  4ZRQ A;  5C16 A;  3N30 A;  5GXG B;  1RFK A;  2E3T A;  2UYZ B;  1QZE A;  2N0Y A;  4ZRI A;  1J7C A;  3ZDT A;  2LYD A;  4JPS A;  1VDV A;  2MBH A;  2CB8 A;  2LD9 A;  1YN5 A;  2LOX A;  4PS7 A;  4L23 A;  3B2F A;  3ZNZ B;  1SHC A;  1DRO A;  4GXB A;  4JKA A;  2GS0 A;  4G11 A;  3IFW B;  5LOP B;  2AQ1 B;  3IAM 1;  3AE9 B;  4A3O A;  5I2M A;  2LHE A;  1QC6 A;  1WJ6 A;  3RCP A;  3L0W B;  2M38 A;  1IP9 A;  5AUI A;  2JWU A;  4GPT B;  3RT3 B;  5J3Q A;  4Z2N A;  2QEJ C;  2LBB A;  2L32 A;  2M4N A;  2D2Q A;  1TQZ A;  2NVU I;  3PVU A;  3U7Z A;  5FR6 A;  3N7C A;  3VH3 B;  4GMX B;  2KVZ A;  2FID A;  2WQY B;  1WYW B;  3B9J A;  3DCX A;  3U8Z A;  4DQO C;  2I1K A;  3PO0 A;  1ZW7 A;  1FPY A;  3AN1 A;  2D9X A;  2XQN M;  3PSE B;  1L0Y B;  4C4V A;  2FUH B;  3NRZ A;  3KRW A;  3I9V 1;  3KWL A;  2RDB C;  4W9J A;  1V6E A;  1N60 A;  3H9D A;  1EU3 A;  3EGR A;  3VRB B;  1LQB A;  2PEA A;  3UZT A;  1LXD A;  3OJ3 A;  2N23 A;  3AH7 A;  3ML4 A;  2KMM A;  4PS3 A;  3NW8 A;  5TSS A;  1V1P A;  3BK2 A;  4G0N B;  4D0N B;  1XOD A;  3R2I A;  1WXA A;  4OHJ A;  2KTR B;  2AEH A;  2JYT A;  2NBU A;  1TXD A;  2QSD A;  4NQL B;  1FD6 A;  1C4C A;  2DN6 A;  5GMV A;  3ZNG C;  1P3R A;  3OAN A;  1DIK A;  3PZ8 A;  3AE3 B;  2N7J A;  2FJL A;  4MT7 A;  5IA7 A;  4PS8 A;  2M8S A;  4JWS C;  1F0Z A;  2ZEQ A;  3TJP A;  2LZ6 A;  5FK9 C;  1I4P A;  3R2T A;  5CHF A;  3DHG C;  2LFI A;  3V6C B;  3HUI A;  1M4V A;  2DAJ A;  1KLU D;  1C4A A;  2RDG A;  3BY4 B;  1RAX A;  3GP7 A;  1WY8 A;  4HDO A;  2X0S A;  1VLB A;  2MQJ A;  1P7F A;  1WI0 A;  2BB5 A;  3U4E G;  4HCP B;  2N9K A;  5FI1 A;  2D9Y A;  2HJ8 A;  2YLM A;  4JK8 A;  1MHX A;  4WH4 A;  4MDK E;  3F5R A;  3ECI A;  3PHW B;  3EA6 A;  2MKR A;  3MP9 A;  3KH0 A;  3MPX A;  1MAI A;  2LGI A;  3VR8 B;  2GOW A;  1WR1 A;  4OSN A;  1X1M A;  1V86 A;  2K1F A;  4XWW A;  1E5W A;  1V5P A;  1J0W A;  2R0D A;  2RGF A;  5IOI A;  4RF0 A;  3IHP C;  2WX0 A;  4II2 B;  4ICV A;  1YQ4 B;  1V1O A;  4EJN A;  5LLI A;  3FEH A;  2KUP A;  4CHK A;  4WWN A;  1ENF A;  5DCN A;  1FXA A;  3N3K B;  1VZ8 A;  4QJ3 B;  3N1Y C;  3HHM A;  4WJQ A;  1WGR A;  1MHH E;  1JDE A;  3WIM A;  3AJ4 A;  4Y94 A;  1AWD A;  2R2Q A;  3Q3F A;  5DPR A;  1FHW A;  3HVZ A;  3LJU X;  2H7E A;  4XYC A;  3K9O B;  2JYE A;  1TTN A;  1X11 A;  3PS6 A;  2Y8F A;  4ZYN A;  3AU4 A;  1L2N A;  4HPL B;  4RNA A;  4A6Q A;  2K2U A;  2Y7B A;  1I4X A;  3H8H A;  2CHW A;  1AN8 A;  1YOV B;  3ZO5 B;  4AS1 A;  1T5X D;  3ZXR A;  3KW5 B;  3MC8 A;  1WGK A;  1Q10 A;  2K6Q A;  1SEB D;  2WS3 B;  1Q5W B;  1VRA B;  3GE3 C;  3B77 A;  4KKI A;  1MI0 A;  3GE8 C;  2BVC A;  5DPT A;  5G5H A;  4K3C A;  3CIR B;  3QWZ B;  1WX7 A;  3QA8 A;  4ICU A;  4NQK E;  2NZ8 B;  5H92 C;  2RMM A;  1CMX B;  1S3S G;  3BVZ A;  2YEP F;  3RNE C;  2WX1 A;  1VBG A;  3GS2 A;  3VDZ A;  3P6A A;  2LGY A;  3IVF A;  1TKG A;  1WM2 A;  1OQQ A;  1U5F A;  2UU7 A;  2WDQ B;  3P4Q B;  2LXA A;  3UIN B;  4KZC A;  4YSX B;  2ASQ A;  2GUM A;  1PQS A;  2PMV A;  1HEZ E;  4ZOH C;  1FRD A;  4IW0 A;  5J3T A;  2NCN A;  3L54 A;  2ELA A;  3HM6 X;  1XX0 A;  1MG4 A;  2KWD A;  2R09 A;  3ABV B;  5L81 A;  3HIZ A;  4EZJ A;  4K81 A;  1L6V A;  4IWO A;  1P5T A;  2LRW A;  1L7Y A;  3T9L A;  2E6X A;  2IO3 B;  1YIW A;  3PRM B;  3KYC D;  2DHK A;  2H88 B;  1D6E C;  1V97 A;  5E6J A;  1QOB A;  2YRY A;  2DTC A;  1EM7 A;  2PE9 A;  3EC8 A;  2ZJD A;  5C5B A;  4L2Y A;  2G9H D;  4A55 A;  3H1U A;  1R4N B;  2JRH A;  1UGJ A;  3PRE A;  4EZK A;  3I63 C;  4N9F 4;  3VHT C;  2KCJ A;  2KIE A;  2KTR A;  2L52 A;  2VZK B;  4R3D A;  3DBR B;  4GDL B;  4EKU A;  2AL3 A;  2C7N B;  2C9W B;  1C3T A;  3Q69 A;  2C7H A;  4BKT A;  3A58 A;  2DLW A;  3NVW A;  2I2Y A;  4XDC A;  2K8E A;  3OLM D;  4HRO A;  4P1B C;  4YWG G;  2FCS A;  4LCD E;  2GBJ A;  2CQU A;  2JVC A;  2LVO A;  3PV1 A;  4W9I A;  1GB1 A;  2LOZ A;  2M56 B;  3ALB A;  1LB1 A;  4YT0 B;  3SDL C;  3WAO A;  4MEM A;  3RNB C;  3DXC A;  2V0G A;  4LNO A;  2DFK A;  2N4F A;  4M8M A;  1YJ1 A;  1F2R C;  1OGW A;  5IAA C;  3ZQ4 A;  2BW2 A;  4TYZ A;  1ROE A;  2V76 A;  4M02 A;  1V61 A;  4QAY A;  3U30 A;  5KCV A;  5JP4 A;  3BZD B;  4WVF B;  2IZV B;  3L17 A;  4ANX A;  2PE6 B;  3U12 A;  1UZX B;  5EE1 A;  2G45 B;  4XX5 A;  4P16 A;  3DCG A;  3NY5 A;  3Q8A A;  1IBX A;  3X23 A;  1Q1O A;  2KO3 A;  4NJ6 A;  4LTU A;  4EEW A;  4KGS A;  1NDD A;  3ULB A;  4JQW C;  4GDL A;  2RRF A;  1VD2 A;  1RYJ A;  4PK1 A;  2DKQ A;  4Z2M B;  3SFE B;  3PVL A;  2RGN B;  1WR6 E;  2KFK A;  4GZU A;  1I7A A;  1RJ2 A;  2J53 A;  4JKG A;  1KFY B;  5EFX A;  2Z0O A;  3P4P B;  2Z59 B;  2WXH A;  2IFS A;  1UD7 A;  2LGX A;  1QOA A;  4FJY A;  4MT5 A;  4TSS A;  3ZGZ A;  3AE7 B;  2MW5 A;  3EFC A;  1N62 A;  1WGQ A;  1KJT A;  3Q6B A;  2R2Y A;  4FHJ A;  1AYF A;  1OFF A;  3P63 A;  2KMA A;  4LJP B;  4MGI E;  1Y5O A;  2I1J A;  3VVW B;  1FCL A;  2NS5 A;  3ODW A;  5JZE B;  4F7U P;  4K2P A;  1YJJ A;  1YQB A;  3V6E B;  1BAK A;  2KFK B;  4QJ5 B;  2VZK D;  4J3O D;  1QT9 A;  4HXD A;  4FJZ A;  4PT5 A;  4BOZ B;  4KKJ A;  3DVG X;  1Y19 B;  2KDE B;  2ZPY A;  2KR0 A;  1ZDV A;  2KAN A;  1NBF C;  1DGJ A;  1XQQ A;  2TSS A;  3ML8 A;  2WXR A;  4WJN A;  1TGZ B;  1KZG A;  4IC7 B;  3VR9 B;  3SBG A;  2SAK A;  4HB4 B;  3P4S B;  5JHB A;  4XZ4 A;  4WQM A;  1N3H A;  3GYP A;  4TQ1 A;  3A8Q A;  2FE8 A;  4LK0 M;  2WYQ A;  4OW0 A;  1G6J A;  2D5G A;  1VJK A;  2GRI A;  2BT6 A;  2G3Q B;  3Q3O C;  1K52 A;  4WWO A;  4IDI A;  1E7U A;  4BBK A;  4IUM B;  3B1L X;  4K7S A;  3RD2 A;  1EWY C;  1YN4 A;  2L0T A;  1JW9 D;  2KAC A;  2CRF A;  4FN2 A;  4RGT A;  3DXE A;  1UWM A;  4REZ A;  3NG0 A;  3MHS D;  2WU2 B;  3AE6 B;  2IGH A;  3SNH A;  1I35 A;  4HAY B;  1PGB A;  5JHH A;  1B55 A;  3W1S C;  1XD4 A;  3VAW A;  1JRU A;  3QWM A;  2KFJ A;  4DX8 A;  2BS2 B;  3QBV B;  2JRI B;  2BS3 B;  3PG7 A;  1VZ6 A;  2X8X X;  2WXJ A;  3T06 A;  4ILG B;  3SFD B;  3ODO A;  2GBN A;  4HJK A;  4OZA A;  1K51 A;  1NVI D;  5BO4 B;  3WCQ A;  3H7P A;  1WVH A;  1TBE A;  3JW0 X;  4ACF A;  3VUX A;  3OJ4 B;  4M8N A;  3QJZ A;  2L0F A;  2QIE B;  1X1G A;  4G50 A;  2V9H A;  1SE3 A;  2QIL A;  4YTN B;  4A3P A;  2K8B A;  1FRR A;  2RQ1 A;  4BKS D;  4NAW B;  3K9P B;  1D3Z A;  1TIF A;  3DPD A;  1GNU A;  3WYF B;  3ZTD A;  2MHJ A;  4CHM A;  4ZDV A;  1HE8 A;  5JHG A;  5C5B B;  3B2G A;  2Z4D A;  3NVZ A;  5HE3 A;  5H8Y E;  2MH7 A;  2BYV E;  2Z0E B;  2ZKM X;  1RWS A;  5HE2 A;  4MY6 A;  1WE7 A;  4RGN A;  2K8C A;  3DHH C;  3VUW A;  2DLB A;  4HB2 B;  1WMH A;  1IGD A;  2M19 A;  2YS5 A;  2HDE A;  2ROZ B;  5HE0 A;  3U52 E;  5DIF B;  1ESF A;  3WAM A;  3Q3J A;  1WXV A;  2I38 A;  2RR9 A;  4RMA A;  3O96 A;  1P0R A;  1X1F A;  3A33 B;  3W1Y A;  1D4B A;  1D5M C;  4XWT A;  1EU4 A;  1NEN B;  1IRS A;  4TMA B;  1CQV A;  3UF8 A;  2DYB A;  2I5F A;  2MFQ A;  1ET9 A;  2RSG A;  1WX8 A;  1ZPS A;  2WH5 A;  5AEK B;  4IOI E;  3BYT B;  2GI9 A;  2BS4 B;  1JWU D;  3W2D A;  2ONQ A;  2JU6 X;  2IY1 B;  2D4Q A;  3RUI B;  1V80 A;  1UPR A;  1F9J A;  1QLB B;  2N9L A;  2BYT A;  2LUM A;  3X0W A;  5IO9 A;  1RFA A;  1KM7 A;  1WM3 A;  1E9M A;  2GCJ A;  4EZL A;  3DBS A;  3V3X A;  5DPS A;  1GJZ A;  3ZJU A;  1JCK B;  2JSV X;  3PPA A;  3Q8F A;  4HRS A;  5DI9 B;  3WAN A;  4ZRJ A;  2H7D A; 
#chains in the Genus database with same CATH homology
 1WF9 A;  1GC6 A;  1ZM0 A;  3A9K A;  4IWP A;  3V5W A;  1WX9 A;  1V49 A;  3QQ8 B;  3S2A A;  3WA0 A;  2DYQ A;  3BIN A;  5E6P A;  3QIJ A;  2EKE C;  3H7P B;  2ROV A;  2COD A;  2DZI A;  2EMT A;  2N9P C;  5KHO A;  1RRB A;  1U4A A;  2EMS A;  3FM8 C;  1ZGU B;  4F7H A;  1WIA A;  2KLG A;  1Q0W B;  4II3 B;  2KTF A;  1FHO A;  1WJM A;  2D9W A;  4M0W B;  2J0J A;  2MP2 B;  1WMH B;  2LUE A;  4KHB B;  5IJM A;  2KHW B;  1EGX A;  3ML9 A;  2V4L A;  3E9O A;  4GGQ A;  5J2R A;  1PLS A;  5JLJ B;  1SGH A;  4GDK B;  4IM0 A;  3RZW C;  4W9G A;  2V1Y A;  3APC A;  2BGF A;  2XK5 B;  1UNQ A;  4TV3 A;  1Y8R C;  4DHJ D;  1MIX A;  1GUA B;  3UQB A;  4JK9 A;  3DVN V;  2L1C A;  2JWZ A;  3JVZ X;  4BKS A;  2J59 M;  3P7Z A;  4JKC A;  2L3Z A;  4WAA A;  2M0X A;  3AXC A;  2COA A;  4DK5 A;  1KOT A;  4L6E A;  2KKC A;  4W9D A;  5DHF B;  1UGM A;  4MGY E;  4KHO A;  2VRR B;  4KAX B;  1NTI A;  2N7D A;  3MJW A;  3A9J B;  4KDL B;  2ZPN A;  3ZDM C;  4KV2 A;  1R4N I;  2KD0 A;  4A6F B;  4EOY A;  4MK0 A;  1OQY A;  1I2H A;  1W1D A;  4WJO A;  1FAO A;  1BTN A;  2YS1 A;  1HB8 A;  2BWF A;  3NZS A;  1WXM A;  1EF1 A;  2DX5 A;  1MPH A;  4HAZ B;  4ZRK A;  2K25 A;  2BYE A;  1NU2 A;  3E66 A;  5L83 A;  2Z0P A;  1V88 A;  5C6R A;  5TR5 A;  5CX3 A;  3APD A;  2JT4 B;  3M1I B;  4KIK A;  2DIK A;  3PSC A;  1X86 A;  3KSY A;  3GOE A;  4FUL A;  2MLB A;  3KVF B;  1ZC3 B;  5J17 A;  1J8C A;  1WG7 A;  2JUO A;  3ZVV A;  3B0A A;  2K00 A;  3AI5 A;  3OAW A;  3HM3 A;  4JK7 A;  2M1M A;  4JKH A;  3W1S A;  3SUZ A;  2CU1 A;  2RD0 A;  4NJ7 A;  3L08 A;  5D6J B;  1C1Y B;  1SE9 A;  2MBQ A;  1ZVR A;  2EJ8 A;  3ZLZ A;  2DHZ A;  2O6V D;  3ZIM A;  4OVU A;  2YS3 A;  4K2O A;  4ASW C;  1LFD A;  2MRP A;  4F1S A;  3DVG Y;  4HAW B;  3G9W A;  5D3W A;  1K5D B;  4K7U A;  4A20 A;  3KRX A;  1W1G A;  5LXH A;  5C23 A;  1MKE A;  1NTY A;  3VTW A;  1U5D A;  4AP4 C;  1ISN A;  5CHV C;  4A5K A;  4URK A;  4KSK C;  1ACA A;  5G2N A;  2E2X A;  5EDS A;  3EFU A;  3KUC B;  1XCG A;  3U7D A;  4MGZ E;  4WJP A;  3GZN I;  3D8D A;  2DEN B;  3R3M A;  1WJ1 A;  2LJ5 A;  3VXW A;  1BT0 A;  2DKP A;  4DXA B;  2KXJ A;  2RLO A;  4B95 A;  2HE7 A;  4FJV B;  1AWE A;  2JP2 A;  4FA6 A;  2ADZ A;  3E9P A;  1IYF A;  4HVB A;  1ZSQ A;  2BKR B;  2KNB A;  1QQG A;  1P1A A;  4CYE A;  1MG8 A;  3V60 A;  5LXI B;  4A6H A;  4JKD A;  2JZZ A;  3NS8 A;  2ZNV B;  4GDK A;  4JKF A;  2MWN B;  1TJ6 A;  4FAD A;  4KDI C;  4FHK A;  3LDZ E;  5JHA A;  4GU2 A;  2XK5 A;  2UVM A;  2P0F A;  3HK0 A;  2LXC A;  4BBN F;  2IYB A;  3P2B A;  2KJ6 A;  2KJR A;  2AYO B;  3IG3 A;  1I42 A;  2IYD B;  4IG7 B;  2REX A;  3ONS A;  1WJN A;  1A5R A;  2X18 A;  3SBT A;  4IM3 A;  3CIK A;  2KC2 A;  3PLV A;  4W9F A;  2J0K A;  4HAU B;  4HWI B;  2W9N A;  1GG3 A;  2Z0Q A;  1E7V A;  5D7G A;  2DZM A;  5G55 A;  1DBH A;  2OQB A;  2KC1 A;  3TMP B;  1M7E A;  2D9V A;  1WFY A;  2CHZ A;  2W2X D;  2FAZ A;  4ILJ A;  2KVR A;  2DZJ A;  4E71 A;  2UWQ A;  3ENB A;  3PRP B;  4H8S A;  3FP5 A;  2FDQ A;  5HKH A;  1XT9 B;  2DX5 B;  4ILH A;  2KK8 A;  4JKE A;  1DDV A;  2YSZ A;  1WZ0 A;  1UPQ A;  1E8W A;  2DX1 A;  2RPQ A;  4HCN B;  2OTX A;  3F0W A;  5KQ1 A;  2JF5 A;  2GBK A;  1WGU A;  3DBR I;  4NPN A;  1U27 A;  2ZVO A;  3PVW A;  3TL5 A;  4K17 A;  1V2Y A;  2K39 A;  3NHE B;  2CY5 A;  2W2W A;  4HB3 B;  3TW1 A;  4OVV A;  4TUU A;  1YX6 B;  5D3X A;  3TVV A;  2CKH B;  4JKG B;  1GGO A;  2CS4 A;  2MX2 A;  3CST A;  1V5T A;  2GBR A;  4WWP A;  2MBB B;  2UZS A;  2CR5 A;  3R66 C;  3KUZ A;  1DYN A;  1KBL A;  1V9J A;  4BVU C;  2YT1 A;  2OOB B;  4E3C A;  2R2O A;  1WE6 A;  4GSW A;  3M63 B;  3A4R A;  3VQI A;  3A4S C;  1E8Y A;  3GYO A;  3QK0 A;  4MH0 E;  1TZ1 A;  4JLC A;  1AAR A;  2DYO A;  4E74 A;  2O2V A;  1P6S A;  1VCB A;  1V5M A;  3EPY A;  4B6W A;  3V61 A;  3KZ1 A;  2L05 A;  2FNJ B;  2NBW B;  2MCN B;  4XWX A;  2XEW A;  4IFS A;  2IO0 B;  1Z87 A;  2KZR A;  1NI2 A;  2RNR B;  2KN5 A;  3FSS A;  2DAF A;  2N1W A;  2N1V A;  4PYZ A;  3ZNI D;  2XBB C;  2ELB A;  3TIX A;  2MP2 A;  3PP2 A;  1EF5 A;  1W1H A;  4MJS A;  1UEL A;  5D2M B;  3A1Q A;  2BWE S;  5D27 A;  2W2X C;  4IWQ A;  3TO1 A;  1OQN A;  3D8F A;  2NBV B;  2G4S A;  4W9C A;  1H4R A;  2BYF A;  4K1R B;  4K7W A;  3M95 A;  2IY0 B;  2ZVN A;  3A9K B;  3UIP B;  3WAL A;  3PRZ A;  3ZKJ C;  3DBH I;  2G35 A;  4HAT B;  4DWF A;  2D11 A;  4W9K A;  4DBB A;  1WRD B;  2HTH A;  2MA9 B;  2JPH A;  4CHJ A;  4LDT D;  3RUL A;  3PLU A;  1KC7 A;  1UNR A;  1M7R A;  4DDG D;  2COF A;  4X57 B;  3SD5 A;  1WGG A;  2LVP A;  4G3X B;  3HQC A;  2DZK A;  3ULC A;  3MTN B;  4IOY X;  2MBO A;  1RRP B;  5D3V A;  1T0Y A;  5HE1 A;  4MSQ B;  1FB8 A;  1WGH A;  2G4D B;  5DH9 B;  2C5L C;  1XR0 B;  2LAS A;  2NPT B;  3AU5 A;  4W9L A;  1PMS A;  2C60 A;  2Y8G A;  2O6V B;  2PJH A;  2HD5 B;  3VTU A;  4NY0 A;  4F7G A;  2D9Z A;  1X05 A;  1AQC A;  4AJW A;  4XC2 A;  4JIO U;  1XKE A;  5FI0 A;  2HRJ A;  1R4M I;  2IBI B;  5AZH A;  4B9K A;  1LM8 B;  2DYM A;  3H6N A;  1UH6 A;  3R7R A;  1GC7 A;  2P8V A;  5J18 A;  1FGY A;  4ANW A;  4DDI D;  4LJO B;  4B6H A;  1PFJ A;  2VSZ A;  2K2J A;  2ZZP B;  4AOF A;  2FCM A;  1LW3 A;  2MSE D;  4DBG A;  2CHX A;  2DA0 A;  2V3S A;  1P9D U;  4GB9 A;  3NOB A;  2K6D B;  4GOC A;  2BCJ A;  2ZNV C;  4JL9 A;  2NPT A;  5AZF A;  1BWN A;  3PTF C;  2QHO A;  1DDM A;  2KX3 A;  4PYU A;  4AWJ A;  4TKN A;  5C79 A;  2N9X A;  3RZF A;  1EVH A;  3SU8 X;  2OJR A;  2P0D A;  4RM8 A;  3PHX B;  2UZR A;  4KIK B;  5AZG A;  4IM2 A;  2LKO A;  4I6N B;  1U5G A;  2I5C A;  2GMI C;  1KZ7 A;  5CLL B;  1J19 A;  1P98 A;  3ZRF A;  4NAW A;  4F7Z A;  2ZCB A;  2AL6 A;  2YF0 A;  3H7S A;  1OY2 A;  5CHW A;  3BJI A;  4KZ0 A;  1YX5 B;  2COC A;  2JXX A;  2VKI A;  1UBQ A;  3E9L A;  2ABD A;  2L2I A;  5JH5 C;  5D3Y A;  1FHX A;  3SV1 A;  1V5O A;  5E6N A;  4JKB A;  2LRU A;  2O6V A;  4DX9 0;  4KVG B;  3RYT A;  2Z0D B;  1OEY J;  3CSF A;  1NVL A;  1WXS A;  3KYD D;  2KQS A;  3M62 B;  1WGD A;  1E8X A;  2FIF A;  3DXD A;  2LVQ A;  4MM3 A;  5JVL A;  3VOQ A;  2KLC A;  2FJ9 A;  2YVC A;  3PZD A;  4A6K A;  1Z5S B;  2FCQ A;  3ZUN A;  3UQA A;  5J3Y A;  3TFM A;  4HK2 A;  2BPS A;  4F8C B;  2KGX B;  1OMW A;  5E6O A;  2M17 A;  3N32 A;  4NSW A;  3D32 A;  2LUL A;  1WZ3 A;  4GIV A;  5GOW B;  1HB6 A;  1E90 A;  3DQV A;  1XD3 B;  3QHT A;  2KWV B;  1DDW A;  1ZC4 B;  1ZKH A;  2M14 A;  2PZ1 A;  2CY4 A;  5CLQ B;  4WQO B;  1H8C A;  1FGZ A;  2JY6 A;  2HTH B;  1MK7 B;  3IBE A;  3A1Q B;  2RUK B;  4WSF A;  5KQ4 A;  3MDB C;  2CAY A;  2RVB B;  2KWC A;  4I6L B;  2C7M B;  4MGK E;  3T8M A;  3EEC A;  3UIO B;  3TBL D;  2L7R A;  4HAX B;  1U29 A;  1HBK A;  5D94 A;  3AUL A;  1EO6 A;  5KHQ A;  3HW2 B;  1KI1 B;  1U2B A;  3ODX A;  2B3A A;  2BKF A;  4PNK A;  4DHZ E;  1YD8 U;  2GCL A;  2IO1 B;  2KJH B;  3QAR A;  1S1Q B;  4IAP A;  3SHQ A;  4DHZ B;  3SYX A;  2N7E A;  4KSL C;  2JZ3 B;  2GBM A;  4I6P A;  4YON A;  2WWZ A;  4C0A A;  3VUY A;  2DYN A;  1U5E A;  4BOS C;  1FXT B;  2P0H A;  3A9J A;  3JSV A;  3ZVR A;  1OTR B;  4HDQ A;  2KQ7 A;  3ZW3 A;  2Y5B B;  1V89 A;  1M94 A;  2DHI A;  2COP A;  3EHV A;  3KY9 A;  4HB0 B;  1Q67 A;  3R7Q A;  3UGB B;  2A5U A;  3PEG A;  3CF6 E;  1WGY A;  3TCA A;  2WDT B;  1FOE A;  1P3Q U;  2AWT A;  4ANV A;  1VBH A;  4P7I A;  4MEL A;  4CO7 A;  1OEY A;  3DOW A;  4PQ0 A;  4TQ0 A;  5DPW A;  3FLV A;  2KDI A;  4HAV B;  4WJ7 A;  1WJ4 A;  2KMC A;  4W9H A;  2IO2 B;  2KDB A;  2EC1 A;  5CTR C;  4YL8 A;  4MSM B;  3QCA A;  3DDC B;  3NSU A;  1UEF A;  4KHA A;  4DHJ B;  3ZRC A;  3B08 A;  4A6F A;  3PT2 B;  1WI1 A;  2NMB A;  2KX0 A;  3QC8 B;  3LJ3 A;  2A4Z A;  3L13 A;  2PPH A;  3NZU A;  2LI5 A;  3A98 B;  2L00 B;  3V62 A;  4RM9 A;  2DHJ A;  2FCN A;  3VTV A;  2D07 B;  2R82 A;  2KDF B;  2MBE A;  3CMM B;  3ZNH B;  3DVN U;  2K8H A;  3VIA A;  4JGH B;  2MWS B;  4ANU A;  4MJS B;  4HHV A;  1E8Z A;  4BBN C;  5LON B;  3L10 B;  5DHA B;  2N9E B;  2GJY A;  2J0M A;  2QKL A;  3CXB B;  4BKG A;  4EUT A;  5L95 C;  2BF8 B;  1ST7 A;  2Q13 A;  3WAP A;  2RSU A;  1BTK A;  2NR2 A;  2ZCC A;  2KOX A;  1V81 A;  2J7Q B;  2YT0 A;  4LDT B;  3ZTC A;  3VH4 B;  3QAQ A;  4GMV A;  3C0R B;  1UBI A;  4J6I A;  2QKM A;  4NNJ B;  2D3G A;  2KWU B;  1J0G A;  4GN1 A;  3QX1 A;  4EMO A;  2L76 A;  4HLE A;  3VFK A;  2O2V B;  4BFR A;  3PGE A;  1MIZ B;  3M3J A;  1EAZ A;  3L16 A;  3SO6 A;  4AJY B;  4EFO A;  4FBJ B;  3ENE A;  1MK9 B;  3D8E A;  2LGD A;  1Z2M A;  1K8R B;  1K5G B;  1UNP A;  2LWP A;  2VRW B;  2MDX A;  1WJU A;  1H10 A;  3RCZ A;  1IPG A;  1EUV B;  3O65 B;  1KLV A;  4HPM B;  1WH3 A;  1SIF A;  1NTV A;  2D10 A;  4W9E A;  3I3T B;  3A8P A;  3DBL I;  3KUD B;  3JSV B;  4FLH A;  5C1Z A;  3JYU A;  2L8J A;  1RLF A;  3APF A;  4AUQ C;  1V5U A;  2LG1 A;  5C16 A;  3N30 A;  2UYZ B;  1QZE A;  2N0Y A;  4ZRI A;  3ZDT A;  2LYD A;  2MBH A;  2CB8 A;  2LD9 A;  2LOX A;  4PS7 A;  3ZNZ B;  1SHC A;  1DRO A;  4GXB A;  4JKA A;  2GS0 A;  4G11 A;  3IFW B;  5LOP B;  4A3O A;  1QC6 A;  1WJ6 A;  3RCP A;  3L0W B;  2M38 A;  1IP9 A;  4GPT B;  3RT3 B;  5J3Q A;  4Z2N A;  2LBB A;  2M4N A;  2NVU I;  2D2Q A;  1TQZ A;  3PVU A;  5FR6 A;  3N7C A;  3VH3 B;  4GMX B;  2FID A;  1WYW B;  3U8Z A;  2I1K A;  1ZW7 A;  3PSE B;  2D9X A;  2XQN M;  2FUH B;  3KRW A;  4W9J A;  1V6E A;  3H9D A;  1LQB A;  2PEA A;  3UZT A;  1LXD A;  3OJ3 A;  2N23 A;  3ML4 A;  4PS3 A;  4G0N B;  4D0N B;  1XOD A;  1WXA A;  2KTR B;  2AEH A;  2NBU A;  1TXD A;  4NQL B;  2DN6 A;  5GMV A;  3ZNG C;  1P3R A;  3OAN A;  1DIK A;  2FJL A;  4MT7 A;  5IA7 A;  4PS8 A;  2M8S A;  2ZEQ A;  3TJP A;  2LZ6 A;  5CHF A;  3V6C B;  2DAJ A;  3BY4 B;  1RAX A;  1WY8 A;  4HDO A;  2X0S A;  2MQJ A;  1WI0 A;  4HCP B;  5FI1 A;  2D9Y A;  2YLM A;  2HJ8 A;  4JK8 A;  4MDK E;  3F5R A;  3ECI A;  3PHW B;  2MKR A;  3KH0 A;  3MPX A;  1MAI A;  2GOW A;  1WR1 A;  1X1M A;  1V86 A;  2K1F A;  1E5W A;  1V5P A;  1J0W A;  2R0D A;  2RGF A;  3IHP C;  2WX0 A;  4II2 B;  4ICV A;  4EJN A;  5LLI A;  3FEH A;  2KUP A;  4CHK A;  4WWN A;  5DCN A;  3N3K B;  3HHM A;  4WJQ A;  1WGR A;  1JDE A;  3WIM A;  3AJ4 A;  4Y94 A;  2R2Q A;  3Q3F A;  5DPR A;  1FHW A;  3LJU X;  2H7E A;  3K9O B;  1TTN A;  1X11 A;  3PS6 A;  2Y8F A;  4ZYN A;  3AU4 A;  1L2N A;  4HPL B;  2K2U A;  2Y7B A;  2CHW A;  3ZO5 B;  3KW5 B;  2K6Q A;  1Q5W B;  5DPT A;  3QWZ B;  1WX7 A;  3QA8 A;  4ICU A;  4NQK E;  2NZ8 B;  1CMX B;  1S3S G;  2WX1 A;  1VBG A;  3VDZ A;  3P6A A;  2LGY A;  3IVF A;  1WM2 A;  1U5F A;  2LXA A;  3UIN B;  4KZC A;  2ASQ A;  1PQS A;  4IW0 A;  5J3T A;  2NCN A;  3L54 A;  2ELA A;  3HM6 X;  1XX0 A;  2R09 A;  5L81 A;  3HIZ A;  4EZJ A;  4K81 A;  4IWO A;  1P5T A;  2LRW A;  1L7Y A;  3T9L A;  2IO3 B;  1YIW A;  3PRM B;  3KYC D;  2DHK A;  2YRY A;  2DTC A;  2PE9 A;  3EC8 A;  2ZJD A;  5C5B A;  3H1U A;  2JRH A;  3PRE A;  4EZK A;  4N9F 4;  3VHT C;  2KCJ A;  2KTR A;  4GDL B;  4EKU A;  2AL3 A;  2C7N B;  2C9W B;  1C3T A;  2C7H A;  4BKT A;  2DLW A;  3OLM D;  2FCS A;  4LCD E;  2GBJ A;  2CQU A;  2JVC A;  2LVO A;  3PV1 A;  4W9I A;  2LOZ A;  3ALB A;  1LB1 A;  3SDL C;  3WAO A;  4MEM A;  3DXC A;  2DFK A;  2N4F A;  4M8M A;  1YJ1 A;  1OGW A;  5IAA C;  4TYZ A;  2V76 A;  1V61 A;  3U30 A;  5KCV A;  5JP4 A;  4WVF B;  2IZV B;  3L17 A;  4ANX A;  2PE6 B;  1UZX B;  2G45 B;  4XX5 A;  3DCG A;  3NY5 A;  3X23 A;  1Q1O A;  2KO3 A;  4NJ6 A;  4EEW A;  1NDD A;  3ULB A;  4JQW C;  4GDL A;  1VD2 A;  2DKQ A;  4Z2M B;  3PVL A;  2RGN B;  1WR6 E;  2KFK A;  4GZU A;  1I7A A;  1RJ2 A;  4JKG A;  5EFX A;  2Z0O A;  2Z59 B;  2IFS A;  1UD7 A;  2LGX A;  4FJY A;  2MW5 A;  4FHJ A;  1WGQ A;  4MGI E;  1KJT A;  2KMA A;  4LJP B;  1Y5O A;  2I1J A;  3VVW B;  2NS5 A;  3ODW A;  5JZE B;  4F7U P;  4K2P A;  1YQB A;  3V6E B;  1BAK A;  2KFK B;  4HXD A;  4FJZ A;  4BOZ B;  3DVG X;  1Y19 B;  2KDE B;  2ZPY A;  2KAN A;  1NBF C;  1XQQ A;  3ML8 A;  4WJN A;  1TGZ B;  1KZG A;  4IC7 B;  3SBG A;  4HB4 B;  5JHB A;  4XZ4 A;  1N3H A;  3GYP A;  4TQ1 A;  3A8Q A;  2WYQ A;  1G6J A;  2G3Q B;  4WWO A;  1E7U A;  4BBK A;  4IUM B;  3B1L X;  4K7S A;  3RD2 A;  2L0T A;  2CRF A;  4FN2 A;  3DXE A;  3MHS D;  3SNH A;  1I35 A;  4HAY B;  5JHH A;  1B55 A;  3W1S C;  1XD4 A;  3VAW A;  1JRU A;  3QWM A;  2KFJ A;  4DX8 A;  3QBV B;  2JRI B;  3PG7 A;  3T06 A;  4ILG B;  3ODO A;  2GBN A;  4HJK A;  5BO4 B;  3H7P A;  1WVH A;  1TBE A;  3JW0 X;  3VUX A;  3OJ4 B;  4M8N A;  3QJZ A;  2L0F A;  1X1G A;  4G50 A;  4A3P A;  2K8B A;  4BKS D;  2RQ1 A;  4NAW B;  3K9P B;  1D3Z A;  3DPD A;  1GNU A;  3WYF B;  3ZTD A;  4ZDV A;  4CHM A;  1HE8 A;  5JHG A;  5C5B B;  5HE3 A;  2BYV E;  2Z0E B;  5HE2 A;  4MY6 A;  1WE7 A;  3VUW A;  2K8C A;  4HB2 B;  1WMH A;  2YS5 A;  2ROZ B;  5HE0 A;  5DIF B;  3WAM A;  3Q3J A;  1WXV A;  2RR9 A;  4RMA A;  3O96 A;  1P0R A;  1X1F A;  3A33 B;  3W1Y A;  1IRS A;  3UF8 A;  2DYB A;  2I5F A;  2MFQ A;  2RSG A;  1WX8 A;  2WH5 A;  5AEK B;  2IY1 B;  2D4Q A;  3RUI B;  1V80 A;  1UPR A;  1F9J A;  3X0W A;  1RFA A;  1KM7 A;  1WM3 A;  2GCJ A;  4EZL A;  3DBS A;  5DPS A;  1GJZ A;  3PPA A;  5DI9 B;  3WAN A;  4ZRJ A;  2H7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...