4EKUA

Crystal structure of ferm domain of proline-rich tyrosine kinase 2
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
348
Chain Sequence
ELGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine kinase 2-beta
publication title Crystal Structure of the Ferm Domain of Proline-rich Tyrosine Kinase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 348
sequence length 348
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ekuA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ekuA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ekuA01
2B3AA 4EEWA 2ZVOA 4CHJA 2AWTA 2O6VB 2KJRA 2DX5A 5L81A 3K9PB 2CHXA 1MIZB 3ODXA 2DLWA 3IBEA 1FB8A 1X86A 5J2RA 4KDIC 2D2QA 1LQBA 5L95C 2N7DA 1UH6A 4BBKA 1I35A 5LONB 5IA7A 1M94A 1E8WA 1Z2MA 3FLVA 4HAUB 2MA9B 3UQBA 1V61A 3NHEB 3QA8A 4HK2A 3SUZA 5E6PA 3DQVA 3L16A 2J0KA 1UD7A 2C60A 2YS5A 4IWQA 3R7QA 1P5TA 2D9WA 1NDDA 3ML9A 4K17A 4G11A 4KHOA 1WF9A 4NSWA 1WVHA 2JPHA 1MPHA 4MEMA 3TFMA 3O65B 1P98A 3VUXA 3TCAA 1WM2A 2KFKB 3KUCB 1MIXA 3A9JA 4W9FA 3PLVA 2WX1A 2BPSA 4IWOA 1EGXA 2M0XA 2BF8B 2WWZA 3JSVB 4HHVA 2N1WA 2L0FA 4MSQB 2GMIC 2JRIB 1GG3A 1UNQA 1FXTB 2DZJA 3SHQA 2FCNA 2OOBB 5D3WA 1YQBA 1X1GA 2YT1A 1WJMA 1WYWB 1Y19B 3LJ3A 2D9ZA 1J0GA 1J19A 3PS6A 2NZ8B 2LGDA 3VH3B 2CS4A 1WE6A 2BCJA 4IC7B 2L2IA 3ZNGC 2BWES 2FIFA 2JVCA 2D9VA 4FA6A 3V6CB 5GMVA 1FGYA 2LOXA 1DBHA 2VRWB 3N30A 5DPSA 4G3XB 1WZ0A 1WXSA 2KC2A 1WG7A 2KFJA 5AZHA 2IY0B 1EAZA 3CSFA 2J0MA 2N7EA 4NY0A 4FHJA 4WJNA 5EDSA 4DDGD 3B0AA 1FHOA 3NOBA 1H10A 4JL9A 5E6OA 5D6JB 3KYDD 3B08A 2O6VD 3M1IB 3QBVB 1K5GB 1TGZB 3OAWA 1BTNA 1EUVB 3WALA 1MK9B 2Z59B 1GJZA 2N4FA 5C1ZA 2O6VA 3LJUX 2ZJDA 1E8XA 3ZTDA 4MT7A 4K7WA 2MKRA 3TO1A 4NJ6A 2MQJA 4MDKE 2MRPA 1SHCA 2KGXB 1TTNA 4GN1A 1WGYA 1KZGA 3QHTA 4CYEA 4MSMB 4WWNA 3WA0A 4GMXB 3RT3B 5FR6A 2FJ9A 2NBVB 2D9XA 1NU2A 4WJQA 4BFRA 1YX5B 3OANA 1IYFA 3KRXA 4ZDVA 4KIKB 2JWZA 2LASA 3K9OB 4E3CA 5HE1A 3WANA 3GYPA 3PG7A 4K1RB 2C7HA 2KFKA 2GJYA 3VTWA 2NCNA 2V76A 1OGWA 2IO1B 3QX1A 4K7SA 3T9LA 4AOFA 4KZCA 4GB9A 1F9JA 4XZ4A 4WWPA 3JSVA 2NMBA 2ABDA 1ZKHA 2FCQA 3PVWA 2YS1A 3ALBA 1V9JA 1WGRA 3DVGX 2GCLA 4EOYA 2NPTB 4DHZB 1WX7A 3HM3A 2PE6B 2KOXA 4JLCA 2R09A 1BAKA 5CHFA 2ZNVC 3M95A 5LLIA 2LBBA 3N7CA 2L7RA 3VHTC 3FM8C 2RVBB 3KH0A 1WH3A 4I6NB 3P6AA 3PZDA 3QWMA 4RMAA 2MWNB 2IO2B 4Z2NA 1OTRB 3KYCD 5C6RA 5J3TA 2Z0EB 2ADZA 2GBRA 1PQSA 3X23A 3NY5A 2KTFA 2IO0B 1IPGA 3L54A 2N9PC 1WMHB 4CO7A 4HAYB 4BKGA 2IYBA 2BWFA 3ZNHB 2KDEB 1M7EA 1V5MA 2MFQA 1WZ3A 4GGQA 4ICUA 4PYZA 1FAOA 2UVMA 2LJ5A 4WVFB 5J17A 3FSSA 2LRWA 1Y8RC 4B6HA 2J7QB 1NI2A 2BYVE 3PP2A 2MCNB 2V1YA 3MHSD 3FP5A 2LOZA 1WJUA 1ST7A 1I2HA 3D8DA 2LUEA 3V6EB 4KVGB 1NVLA 2OJRA 1ZC3B 1ZC4B 5FI1A 1XODA 4FJYA 3SD5A 4F7GA 4CHKA 4EJNA 3SDLC 4MGYE 2Z0QA 3NSUA 3OJ4B 4RM8A 3S2AA 2L76A 3H7PA 4KIKA 5GOWB 1E90A 1WX9A 2ZPNA 5D2MB 5C23A 2FAZA 1WM3A 4TYZA 2CODA 3W1SA 1U5GA 1T0YA 4DBGA 2ELBA 4KZ0A 2R0DA 1FGZA 1HB6A 1NTYA 2P8VA 2LYDA 1S3SG 1OY2A 1I7AA 4XWXA 3ODOA 4HPMB 1X11A 2D11A 4IM2A 2CRFA 4MGZE 2KWUB 3VOQA 2LI5A 2NPTA 1P3RA 3ECIA 3VQIA 3JYUA 1S1QB 2H7EA 2GBJA 2A5UA 2MBOA 2EC1A 3DPDA 4W9HA 3ZIMA 2LGYA 3PREA 2I1JA 5HE3A 2RR9A 3T8MA 5D3YA 3DDCB 3ONSA 4GMVA 1V5UA 3ZLZA 3V62A 3U7DA 2L1CA 1KM7A 5CLQB 4PS8A 1V5OA 2EKEC 4FJVB 1EVHA 3PT2B 3HW2B 5HE2A 2W2XC 1K5DB 1WXMA 2RGFA 3SV1A 2OQBA 5EFXA 2M8SA 4DX90 4DX8A 2C9WB 2L8JA 5DPTA 2MBQA 3PSEB 2LULA 5IJMA 3PV1A 3GZNI 4ANXA 1FOEA 4W9KA 1RRPB 2P0FA 2LVQA 1DDWA 4TV3A 3UIOB 1WJ1A 4PYUA 2PE9A 2DTCA 3X0WA 5DPRA 1H8CA 1YD8U 2Z0OA 4E74A 4WJOA 1TZ1A 1Z87A 4MK0A 4YL8A 3DOWA 3KW5B 4GDKB 4CHMA 3DVGY 2YF0A 2KC1A 2ZEQA 4PS3A 2DZIA 2KMAA 3ULBA 2CY5A 1YX6B 4KDLB 3PPAA 3TVVA 3ZW3A 1D3ZA 1ZGUB 5E6NA 4WQOB 4TQ1A 2DHZA 3UZTA 1TQZA 1K8RB 2N23A 5FI0A 1KLVA 2MLBA 2MBHA 5LXHA 3NZUA 1ZVRA 2XK5B 4II3B 3M3JA 4EUTA 4WJ7A 1LXDA 4DWFA 3RYTA 1B55A 1OQNA 5C16A 2L05A 4NNJB 1LW3A 4BOSC 4URKA 2GBKA 3UINB 5J3QA 5D3VA 2N9XA 3PRPB 2ZPYA 1YJ1A 3RZWC 3SNHA 2CU1A 3ZRCA 2A4ZA 4LCDE 2LWPA 1WGDA 3VTVA 2K6DB 4WJPA 2NR2A 3BY4B 4HPLB 5CX3A 1UEFA 4ZRJA 5JHBA 3UF8A 1XD4A 4MGKE 1U27A 1ACAA 4IM0A 2V4LA 4MH0E 3TL5A 3VFKA 2KLGA 1V5PA 3PSCA 5JLJB 3Q3FA 3VIAA 3ZO5B 1UBQA 3ZUNA 5TR5A 2DFKA 4F7UP 4DBBA 1OEYA 4BBNC 1HB8A 3PVLA 5CHVC 2ELAA 4EZJA 1R4MI 1N3HA 1FHWA 2LGXA 3A33B 4TKNA 2COAA 3RD2A 4ANWA 3QCAA 4W9IA 3PEGA 2D10A 2K6QA 3KRWA 2BYEA 1KI1B 1RFAA 4FULA 2Y8GA 3VTUA 4Y94A 4NQLB 1WI0A 2XBBC 3N3KB 4KSLC 2MBEA 2ZCCA 1WXVA 3WIMA 3ODWA 4GDLB 4HB3B 2GCJA 4GDKA 3VUWA 4LJOB 2M1MA 3F5RA 4KSKC 2JP2A 1WGGA 1WJ4A 3AULA 3PVUA 4HB2B 2N1VA 2REXA 3APFA 1P3QU 1WIAA 2V3SA 2KQSA 4A5KA 3H7PB 1WY8A 3QIJA 1XCGA 3LDZE 5KHOA 2DHJA 2M17A 4MY6A 2KK8A 3ZNID 4FN2A 5KCVA 2XK5A 2OTXA 3PRMB 1LB1A 2MX2A 1VCBA 2YT0A 4HCPB 2BYFA 3ZDTA 1E8ZA 2KX3A 1OEYJ 2DENB 5DH9B 3NZSA 4K7UA 3A8QA 2K8HA 2UZRA 4GSWA 1WJ6A 2K2JA 3UGBB 3DXCA 1MG8A 3DBRI 2IYDB 3U8ZA 4I6PA 1X05A 2XEWA 2DX1A 4GZUA 2ZVNA 3UQAA 3APCA 4MJSA 3ULCA 1DDVA 2LVPA 2O2VB 2M38A 5AZGA 3PTFC 5D94A 2COFA 2I5CA 4DXAB 2CKHB 4JGHB 2NS5A 3F0WA 3D32A 2Y5BB 1MK7B 4ZRIA 1WR6E 3MTNB 2MP2B 1MAIA 3EHVA 2CAYA 4G50A 4BKSD 4HB4B 2HJ8A 1OQYA 1U5EA 4HAWB 1V86A 4HCNB 2AL6A 4HDOA 3DXDA 4IM3A 2DA0A 1RLFA 3HK0A 4BKSA 2EMSA 1WRDB 1UNRA 5LOPB 4D0NB 4HVBA 5JZEB 4EMOA 1RAXA 4W9EA 2X18A 4A6KA 2AEHA 2XQNM 1XT9B 4M0WB 2DYMA 3EC8A 2KQ7A 4ASWC 3JW0X 1EO6A 2UWQA 3VXWA 4DK5A 4EFOA 3L10B 4FBJB 2C5LC 5D3XA 1DYNA 5J18A 4WAAA 3EECA 1QC6A 3SU8X 4GDLA 2DYNA 1PFJA 4WSFA 1BWNA 2K2UA 1V81A 3CSTA 2DYOA 4B95A 3D8EA 2P0DA 1W1GA 2JZ3B 2KNBA 3APDA 4HWIB 2ZCBA 2NVUI 3BINA 3TIXA 2FUHB 4DHJD 3ML8A 5KQ4A 4PNKA 3M63B 1X1MA 4A20A 5JHGA 2K39A 2K8BA 2RNRB 2FJLA 2VRRB 2EMTA 3PHXB 4G0NB 3AU5A 4HAVB 2GBMA 3VVWB 1KJTA 2JT4B 1J0WA 1JRUA 4XC2A 1PLSA 5CLLB 4AJYB 4NPNA 2DKPA 1XQQA 2KDFB 1WX8A 4PS7A 1Q67A 1G6JA 1GC6A 1TBEA 1YIWA 3ZDMC 1HBKA 2BKRB 4ZYNA 2L00B 1EF1A 3I3TB 3DBSA 2K1FA 2GBNA 1QZEA 2K8CA 1UNPA 2G3QB 2UYZB 2O2VA 2NBUA 4W9DA 2LRUA 3N32A 2PPHA 4PQ0A 3ZNZB 2KZRA 2D4QA 1XR0B 2COPA 2MP2A 3HM6X 5DHFB 1U4AA 2M4NA 5LXIB 2DYBA 1WJNA 3DBLI 2MBBB 4GOCA 2DKQA 4K81A 3A1QB 3CMMB 3IFWB 5DI9B 2KWVB 3DVNV 2LD9A 3VDZA 1Z5SB 2IFSA 2G45B 1L7YA 3HHMA 1V49A 2RQ1A 4F8CB 3EPYA 4F1SA 4LDTB 2RLOA 1QQGA 1WXAA 4MGIE 3TMPB 2YSZA 2PEAA 1TJ6A 3WAOA 3GOEA 1FHXA 4NQKE 5CHWA 1KZ7A 2KUPA 3CF6E 3C0RB 4RM9A 2RSGA 1DDMA 1IRSA 1WGUA 2FIDA 1ZM0A 3QJZA 1GC7A 3B1LX 1WFYA 4W9LA 4L6EA 4A3PA 3ZRFA 2RGNB 1U5FA 5D7GA 2KKCA 4TQ0A 1HE8A 5CTRC 3HQCA 2M14A 2HRJA 2CY4A 1RJ2A 2DZMA 2J0JA 4B9KA 2DN6A 4EKUA 4MELA 1ZSQA 4FADA 2QKLA 3A8PA 1ZW7A 2W9NA 3AI5A 5DIFB 3L08A 1R4NI 2KMCA 4XX5A 3RULA 2YRYA 3P2BA 3MDBC 2ASQA 2C7MB 2IBIB 5G2NA 4HJKA 1DROA 4MM3A 2KWCA 3MPXA 4F7HA 1U5DA 4ZRKA 2WX0A 1NTVA 2L3ZA 1IP9A 3Q3JA 1L2NA 2Y7BA 1UPRA 4HAZB 1WE7A 3R3MA 2N9EB 4MJSB 2MSED 1P9DU 2JF5A 2LXAA 2QKMA 4DHZE 3PHWB 2HE7A 1MKEA 3KSYA 4A6HA 1VD2A 3H6NA 2P0HA 2ZNVB 2I5FA 4EZLA 1V6EA 2W2WA 2KCJA 4AUQC 4HDQA 4TUUA 1EF5A 2RUKB 3RZFA 2L0TA 3AJ4A 3M62B 3WYFB 5JHHA 2FNJB 3A1QA 1PMSA 3A98B 3H7SA 1Q5WB 4IFSA 4LDTD 1W1DA 1AQCA 3W1YA 3FEHA 3JVZX 4JQWC 1WI1A 3G9WA 4A6FA 2KHWB 1CMXB 1H4RA 4IAPA 4AJWA 3SO6A 3D8FA 3QARA 1Y5OA 2K25A 1ISNA 3OJ3A 1SIFA 1AWEA 2H7DA 3DXEA 4ICVA 2WYQA 3IHPC 2AL3A 3L0WB 1RRBA 3VUYA 3IVFA 1AARA 3VH4B 2CHWA 2KLCA 3ZTCA 2DZKA 3A9KB 2VSZA 2R2OA 3T06A 4K2OA 2GOWA 1E7VA 3DVNU 2FCSA 3BJIA 1U2BA 1GUAB 1LM8B 4E71A 1I42A 1M7RA 3V60A 2BKFA 5G55A 4WWOA 3GYOA 1OMWA 2DYQA 1W1HA 4DHJB 4YONA 3OLMD 3ZVRA 3QQ8B 4KV2A 4JIOU 4GXBA 2DHIA 5DCNA 2AYOB 5AEKB 4F7ZA 2QHOA 4EZKA 4OVVA 2RSUA 1V89A 2D9YA 3AXCA 4KHAA 2DHKA 3ZKJC 5KQ1A 3PRZA 3PGEA 4NJ7A 2CR5A 5JH5C 4IW0A 3TW1A 1KOTA 5J3YA 3KZ1A 5IAAC 2JRHA 4H8SA 3QC8B 3NS8A 2JY6A 1NTIA 5C79A 4HXDA 2RPQA 4DDID 2KTRB 2MWSB 4KAXB 4GIVA 2IZVB 2LG1A 4IUMB 2LVOA 1BTKA 1TXDA 3WAMA 4IOYX 1U29A 1UZXB 3IG3A 2UZSA 4M8MA 5C5BB 4NAWB 1V80A 3O96A 2KXJA 1X1FA 4FLHA 2CHZA 2KDIA 2ROZB 2G35A 2HTHB 2KN5A 4I6LB 3KY9A 2D3GA 2JXXA 5AZFA 2D07B 1Q1OA 4OVUA 2KDBA 4BVUC 3AU4A 3R66C 2FDQA 3HIZA 3R7RA 2EJ8A 2KVRA 1P6SA 2CQUA 2ROVA 2YVCA 2DAJA 2DX5B 4BOZB 2LXCA 3KVFB 1LFDA 1C3TA 5L83A 3TBLD 2Y8FA 3QK0A 4GU2A 1J8CA 2KJHB 1SGHA 1Q0WB 4P7IA 1SE9A 4BBNF 3A9KA 2YS3A 3EFUA 2BGFA 3VAWA 3PLUA 2KJ6A 3DBHI 2G4SA 4J6IA 5BO4B 3KUDB 2E2XA 4LJPB 3ML4A 3V5WA 3RCPA 3CIKA 4HLEA 2NBWB 1XX0A 5HE0A 2I1KA 3SYXA 1XKEA 4A3OA 3L17A 2YLMA 2PJHA 3W1SC 3A4RA 3P7ZA 5KHQA 1UPQA 2Z0PA 2MDXA 4KHBB 3MJWA 1P0RA 4HAXB 2KANA 3A9JB 1NBFC 2COCA 2CB8A 5HKHA 3QWZB 1UGMA 1E8YA 2KD0A 4FHKA 2LKOA 3TJPA 3L13A 3RCZA 3ENEA 2ZZPB 3WAPA 4FJZA 2PZ1A 2FCMA 4ANVA 4W9GA 2VKIA 4IG7B 1A5RA 3QAQA 4IWPA 1P1AA 1V88A 4N9F4 3ZVVA 2JUOA 4Z2MB 4X57B 3CXBB 2KO3A 1V2YA 5JP4A 3UIPB 4HB0B 2KTRA 2K00A 3A4SC 2Q13A 2WH5A 1WR1A 4B6WA 3RUIB 1WGHA 4AWJA 1UBIA 1XD3B 2IO3B 2WDTB 2J59M 4AP4C 5DPWA 2JZZA 1V5TA 4W9CA 2R2QA 4BKTA 1GNUA 3H1UA 3DCGA 4ANUA 4GPTB 5JHAA 5C5BA 4NAWA 1WGQA 3U30A 3V61A 1E7UA 4II2B 5D27A 2IY1B 2GS0A 2KX0A 2RD0A 2HD5B 2HTHA 1E5WA 1BT0A 2C7NB 4K2PA 1C1YB 3KUZA 2W2XD 2N0YA 2DAFA 2LZ6A 4HATB 4C0AA 2G4DB 4W9JA 4M8NA 4A6FB 2Z0DB 2MW5A 3H9DA 1WMHA 1UELA 5DHAB
chains in the Genus database with same CATH superfamily
2ZKMX 1BMLC 1SF0A 3AE3B 2B3AA 2QSDA 3AE7B 4EEWA 2ZVOA 4CHJA 4C56C 2AWTA 2O6VB 4RF1A 2KJRA 2DX5A 1JDEA 5L81A 1R4MB 3K9PB 2CHXA 1SB3C 4RGTA 1JWAD 1MIZB 3C8YA 4HKZE 2KUQA 3DHIC 4ILHA 1L4DB 1JROA 3ODXA 2DLWA 3IBEA 3AE2B 4HROA 1FB8A 1X86A 2INPE 5J2RA 4KDIC 1I7HA 2D2QA 3ZYYX 2ZW0A 1FM0D 4JKFA 1LQBA 5L95C 1T3QA 2N7DA 1UH6A 4BBKA 1I35A 5LONB 5G5HA 1YN4A 4A55A 5IA7A 1M94A 3U7ZA 1E8WA 1Z2MA 3FLVA 1AW7A 4KGRA 1ZXIA 3TSSA 3Q69A 4HAUB 4C7ZA 1ZDVA 3R2TA 2MA9B 1SE4A 1V61A 3UQBA 1JALA 3NHEB 3QA8A 4HK2A 3SUZA 5E6PA 4GOUA 3DQVA 3L16A 2J0KA 1UD7A 5GXGB 2C60A 2YS5A 4IWQA 3R7QA 1P5TA 2D9WA 1NDDA 2WP9B 2WLBA 3ML9A 4K17A 2QDFA 4G11A 4KHOA 3B77A 3AE4B 3NWAA 1WF9A 1WYGA 4NSWA 1WVHA 1JCKB 3UI3A 2JPHA 1MPHA 4UDUC 1NVID 4MEMA 3TFMA 2JZPA 3O65B 1P98A 3VUXA 1SE2A 3RNAC 3TCAA 1WM2A 1VDVA 2KFKB 1B1ZA 2R82A 3KUCB 3AMZA 2K49A 1MIXA 3A9JA 1IGCA 4LTUA 2KACA 3DHGC 4TSSA 4W9FA 3PLVA 3GS2A 1CQVA 2WX1A 2BPSA 4IWOA 1EGXA 3Q8EA 2M0XA 2BF8B 2WWZA 4YT0B 4US9A 3W5UB 2BT6A 3JSVB 1KRHA 4HHVA 1CK1A 2N1WA 2WHIA 3RNFC 3LXFA 2L0FA 3EGRA 4MSQB 2GMIC 1L0VB 2WXIA 2JRIB 1GG3A 1UNQA 1FXTB 2DZJA 3SHQA 2FCNA 2OOBB 4ILGB 1UGJA 5D3WA 3DHHC 1YQBA 3KLSX 1X1GA 2YT1A 5C2TB 1KH0A 1WJMA 1WYWB 1QF6A 2K3UA 1Y19B 3LJ3A 5D3DA 2D9ZA 1J0GA 1YOVB 1J19A 3PS6A 2NZ8B 1D6EC 1HXYD 2LGDA 4ZOHC 3VH3B 2CS4A 1UWXA 1YN3A 1WE6A 2BCJA 4IC7B 2L2IA 1UUPA 3ZNGC 1WRIA 2BWES 3DBRB 2FIFA 2JVCA 2D9VA 4FA6A 3V6CB 5GMVA 1FGYA 2LOXA 1DBHA 2VRWB 1FNWA 3N30A 5DPSA 4G3XB 4ZYSA 1WZ0A 1WXSA 2KC2A 1WG7A 2KFJA 5AZHA 2IY0B 1EAZA 3CSFA 3AN1A 1ESFA 2J0MA 2N7EA 4NY0A 4FHJA 4WJNA 2L32A 2LJIA 5EDSA 4DDGD 3B0AA 1FHOA 2IGGA 3NOBA 1H10A 1HA5A 4JL9A 5E6OA 5D6JB 3KYDD 3B08A 2O6VD 3M1IB 3QBVB 1K5GB 1TGZB 3OAWA 1DOYA 1BTNA 1EUVB 3WALA 3AEEB 4KKIA 1MK9B 2Z59B 4OZBA 1GJZA 2N4FA 3KQ4A 5C1ZA 1N62A 2O6VA 3LJUX 2ZJDA 1E8XA 3ZTDA 4MT7A 4K7WA 2D3BA 2KT7A 3B2FA 1VR9A 3VRAB 2MKRA 1MI1A 3TO1A 3ENBA 1WGKA 4HRSA 1V1PB 4NJ6A 1SJED 4L23A 3TEXA 2MQJA 4HEA1 4MDKE 2MRPA 1SHCA 1MHXA 3A58A 2YEPF 2KGXB 1D5XC 1TTNA 4GN1A 1WGYA 1XLQA 1KZGA 1I4PA 3QHTA 4CYEA 4MSMB 4WWNA 3WA0A 4GMXB 2Y3AA 3RT3B 3SEBA 4DQOC 2Z13A 1E7PB 1VZ8A 4GNKB 4LNFA 5FR6A 2FJ9A 2NBVB 5BYSA 2QC8A 5HFYA 3TEWA 2D9XA 1NU2A 4WJQA 4BFRA 1YX5B 5EE3A 3OANA 3T3NA 1K52A 3KRXA 4ZDVA 1IYFA 2IGHA 3AE9B 4KIKB 2JWZA 2LASA 1EU3A 3K9OB 5D3IB 4E3CA 5HE1A 3MC8A 3WANA 3GYPA 3PG7A 1M4VA 2EELA 4K1RB 4H2AA 2C7HA 2KFKA 5FKAC 2QJLA 2GJYA 3VTWA 2NCNA 2YT2A 4KKJA 2V76A 2PIAA 4NZLB 1FRDA 1OGWA 1LGRA 2IO1B 2WXHA 3QX1A 4K7SA 3T9LA 4AOFA 3NZ3A 4K3BA 4KZCA 4GB9A 1F9JA 4XZ4A 4WWPA 3JSVA 1RM6C 1SIJA 2NMBA 2ABDA 1ZKHA 3RNEC 1C4CA 2FCQA 3PVWA 2YS1A 1RYJA 2LGIA 4CQNA 3ALBA 1V9JA 1WGRA 1I4HA 3DVGX 2NTTA 2GCLA 4EOYA 3W9CB 2NPTB 1FXIA 4ARIA 4DHZB 1WX7A 1KTKA 3Q8AA 3HM3A 2PE6B 1I4RA 2KOXA 4JLCA 2R09A 1BAKA 5CHFA 2ZNVC 3M95A 5LLIA 3RN9C 3P63A 2LBBA 3N7CA 2L7RA 3DWMA 2MJDA 3VHTC 3W5VB 3FM8C 1QQRA 4LNNA 2RVBB 3KH0A 1WH3A 4I6NB 3P6AA 3PZDA 3QWMA 4OHJA 4RMAA 2MWNB 2IO2B 4Z2NA 1ZYIA 4ZHPA 1OTRB 3KYCD 5C6RA 5J3TA 1P7FA 2RMMA 2Z0EB 2ADZA 2GBRA 1PQSA 3X23A 4LLGM 1KC7A 4WH4A 1FCCC 4B0MA 3NY5A 2KTFA 2N9KA 2IO0B 1IPGA 3L54A 2KN4A 2N9PC 2V9HA 5IN7A 1WXQA 2AQ2B 1WMHB 4CO7A 4HAYB 4BKGA 2Z59A 2IYBA 2BWFA 3ZNHB 1TKGA 1TYGB 2KDEB 1M7EA 3DBLB 2DLBA 1V5MA 2MFQA 1WZ3A 3IT4B 4GGQA 4ICUA 4PYZA 3E9LA 1FAOA 3KWVA 2UVMA 2LJ5A 4ILJA 2W3RA 3SBGA 3N9YC 4WVFB 5J17A 3FSSA 2BYTA 2LRWA 1Y8RC 4B6HA 2J7QB 2RDGA 4WWMA 1E6EB 1NI2A 2BYVE 1ZOYB 4RH6A 5EE0A 3PP2A 2MCNB 2V3PA 2X8XX 2V1YA 3MHSD 3FP5A 2LOZA 5BYRA 1WJUA 1MVKA 1ST7A 1I2HA 3D8DA 2LUEA 3V6EB 1J7CA 4KVGB 1NVLA 2OJRA 3BYYB 1AYFA 1ZC3B 1ZC4B 5FI1A 3NG0A 1XODA 4FJYA 3SD5A 4F7GA 2X38A 4CHKA 4EJNA 2FUG1 3SDLC 3ZJTA 4Q2JA 4MGYE 3SBTA 1N60A 1MFWA 2L1AA 2Z0QA 3E56A 3V05A 3NSUA 3OJ4B 4RM8A 2K22A 2KIGA 2LUMA 3S2AA 2L76A 3H7PA 4KIKA 5GOWB 1E90A 1VZ6A 1WX9A 3BK1A 2ZPNA 2BS3B 4AQ7A 1TIFA 1Y56A 5D2MB 3RMKC 2L52A 5C23A 2INNE 2FAZA 2M0AA 1WM3A 4TYZA 5G5GA 3SFEB 2CODA 3ABVB 1FFVA 3NVZA 3W1SA 3GE8C 4FXCA 1U5GA 1T0YA 4DBGA 2ELBA 3AB5A 1DIKA 4KZ0A 2R0DA 1FGZA 4ITKA 1HB6A 1NTYA 2P8VA 4ZRQA 1C4PA 3MJ5A 2LYDA 1S3SG 1OY2A 1I7AA 1KBLA 2FE8A 1MI0A 4XWXA 3ODOA 1T0RC 1J7BA 4HPMB 2BW2A 1X11A 2D11A 4IM2A 2CRFA 4MGZE 2KWUB 3VOQA 2ON8A 2LI5A 2NPTA 5I4DA 1P3RA 3ECIA 3VQIA 3JYUA 1S1QB 2H7EA 2GBJA 2A5UA 3PO0A 2MBOA 1CJEA 2EC1A 2GRIA 3DPDA 4W9HA 3ZIMA 2LGYA 3PREA 2I1JA 1RWSA 1SJHD 5E6JA 4S17A 4C80A 5HE3A 2RR9A 3T8MA 1AWDA 5D3YA 2Z8LA 4AS1A 5I2MA 2Y5PA 2INDC 1C78A 3DDCB 1KFYB 3MHZA 1SE3A 3ONSA 3MC0B 4GMVA 1YQ3B 2HDEA 1V5UA 3ZLZA 3V62A 3AEGB 3U7DA 3CWIA 2L1CA 5AUKA 4D6WA 4JK7A 4JPSA 1KM7A 3I63C 5CLQB 1VJKA 4PS8A 4KX6B 1V5OA 3OWEB 2EKEC 4FJVB 4GLSC 1ZDXA 1EVHA 1OFFA 1F77A 1CZPA 3PT2B 1E10A 3HW2B 5HE2A 4QJ5B 2W2XC 1K5DB 1WXMA 2RGFA 3SV1A 2OQBA 5EFXA 2M8SA 4DX90 4DX8A 1K51A 1F1HA 2C9WB 2IJ0A 2L8JA 1TS4A 5DPTA 2XNAC 2MBQA 3PSEB 1TS3A 1GAQB 2LULA 5IJMA 3PV1A 3GZNI 4OVZA 4ANXA 1FOEA 4W9KA 4NJCA 2PVOD 4C4VB 3EA6A 4M0WA 1RRPB 2P0FA 2LVQA 1V1OA 2V0GA 1DDWA 4TV3A 3UIOB 1WJ1A 1FEHA 4PYUA 4RGNA 2PE9A 2DTCA 3X0WA 2M56B 3HSAA 5DPRA 1I4GA 1H8CA 1YD8U 2Z0OA 4E74A 4WJOA 1TZ1A 1Z87A 4MK0A 4LNOA 2B76B 2IGDA 2J42A 4YL8A 4CSQA 3DOWA 1E9MA 2J53A 4US8A 3KW5B 3IT6B 4GDKB 1YNTE 4CHMA 3DVGY 1STEA 3NVWA 2YF0A 2KC1A 2QILA 2ZEQA 2PLPA 4QJ3B 4PS3A 2DZIA 3Q3OC 2KMAA 3ULBA 4JKBA 3AE8B 3URYA 3P4RB 2CY5A 1YX6B 4KDLB 3PPAA 3TVVA 1D5MC 3ZW3A 2WXOA 1DYQA 1D3ZA 1ZGUB 2AX5A 5E6NA 4WQOB 1TY2A 3AE5B 2INCC 2MJ3A 4TQ1A 2DHZA 3UZTA 4XDDA 2Z4DA 1TQZA 5C3JB 1K8RB 2N23A 5FI0A 1KLVA 2MLBA 2MBHA 5LXHA 3NZUA 1ZVRA 1QOGA 5FK9C 2WXKA 2XK5B 4II3B 5HI1A 1UNSA 3E66A 1ENFA 3M3JA 4EUTA 4WJ7A 2W82A 1LXDA 4DWFA 3RYTA 4RCOA 1B55A 1OQNA 5C16A 2L05A 4NNJB 1TS2A 1LW3A 2LEKA 4BOSC 4URKA 2GBKA 3UINB 5J3QA 4IOIE 5D3VA 2N9XA 3GE3C 2IDYA 3PRPB 2ZPYA 1YJ1A 3RZWC 3SNHA 2CU1A 3CIRB 3ZRCA 2A4ZA 4LCDE 2LWPA 1WGDA 3VTVA 2K6DB 4WJPA 2NR2A 3BY4B 4HPLB 5CX3A 1UEFA 4ZRJA 1D5ZC 3FVCA 1PGAA 3AEDB 5AUIA 3NJTA 3ZJVA 5JHBA 3UF8A 1FCLA 1XD4A 4USAA 2XN9C 4XWTA 4MGKE 1U27A 1ACAA 4IM0A 2V4LA 4MH0E 1J7AA 3TL5A 4OSNA 3VFKA 2KLGA 4IKGA 1V5PA 3PSCA 5JLJB 3Q3FA 3VIAA 3ZO5B 1UBQA 3ZUNA 1ROEA 5TR5A 2DFKA 1QILA 1SBBB 4F7UP 4DBBA 1N5XA 1OEYA 4BBNC 1HB8A 3PVLA 3C19A 5CHVC 2ELAA 1LO5D 2LHDA 2RRFA 3OHMB 1R4MI 4EZJA 1N3HA 1FHWA 2LGXA 3A33B 4TKNA 2COAA 3RD2A 4ANWA 3FC4A 3QCAA 3NUHB 1FMAD 4W9IA 4OW0A 1D4BA 3PEGA 2D10A 2K6QA 4LK0M 3KRWA 2BYEA 2D3CA 1XCTL 2RPVA 2WDQB 1KLUD 1KI1B 2W55A 1RFAA 4FULA 3ZXRA 1JRPA 4C4VA 3Q8CA 2Y8GA 3VTUA 4Y94A 4NQLB 2K5PA 3P42A 3TEZA 1WI0A 2XBBC 3N3KB 4KSLC 4P16A 1ZXHA 4HJGE 3TUOA 3V3XA 2NTSA 4JWUC 1QOAA 1VZ7A 1XO3A 2MBEA 2ZCCA 4L1BA 2UU7A 1WXVA 3LB8C 3WIMA 3ODWA 4GDLB 4HB3B 2GCJA 4GDKA 4WIPA 3VUWA 4LJOB 2M1MA 3F5RA 2D5GA 2QMTA 4KSKC 3Q6BA 2JP2A 1WGGA 1WJ4A 2PKOA 2H88B 3AULA 3PVUA 4HB2B 2N1VA 2REXA 5H8YE 3APFA 1P3QU 1WIAA 2V3SA 2KQSA 2JYEA 2JWUA 4A5KA 5LNK1 1GOZA 3H7PB 1YN5A 2J52A 1WY8A 2BS2B 1C79A 3QIJA 1XCGA 2WNMA 3MFGA 3DBHB 3LDZE 1JQ4A 5KHOA 2DHJA 3HRDD 2MHJA 2M17A 2AQ1B 3BYTB 1SSNA 1L6VA 4MY6A 2PVGC 2KK8A 1I4XA 3ZNID 1T5XD 4FN2A 5KCVA 2XK5A 2OTXA 3PRMB 1LB1A 2MX2A 1VCBA 2YT0A 4HCPB 1YQ4B 2BYFA 3ZDTA 1E8ZA 4WAFA 1ZP0B 3VRBB 2KX3A 1OEYJ 1DGJA 1MPEA 2DENB 5DH9B 5BMIA 3NZSA 4K7UA 1YJIA 5IO9A 3A8QA 4TMAB 1L4ZB 2K8HA 4JE3B 3BK2A 2UZRA 4GSWA 1WJ6A 2K2JA 3UGBB 3DXCA 1MG8A 1GGOA 3DBRI 2IYDB 3U8ZA 2CJOA 4I6PA 1X05A 2XEWA 2DX1A 4GZUA 2ZVNA 4XGAB 2RDHA 3UQAA 3APCA 3J9CA 4MJSA 3ULCA 2FJUB 5IOIA 5JVLA 1GB1A 1DDVA 2LVPA 2O2VB 2M38A 5AZGA 1SEBD 3PTFC 5D94A 2COFA 3FKYA 2I5CA 3H8HA 4DXAB 2CKHB 4JGHB 2NS5A 3F0WA 4R3DA 3D32A 1XLPA 1HZ6A 4XDCA 2Y5BB 2N0SB 1MK7B 4ZRIA 1WR6E 3MTNB 4M02A 2MP2B 1MAIA 4M01A 4L1RA 3EHVA 4DIXA 3IXSA 2CAYA 4G50A 1UWMA 4BKSD 1PDXA 4HB4B 2HJ8A 1OQYA 1U5EA 4HAWB 1V86A 4HCNB 2AL6A 2V3NA 1HEZE 4HDOA 3DXDA 5HG2A 4IM3A 2DA0A 1RLFA 3HK0A 4BKSA 2EMSA 1ZPSA 1WRDB 4IDIA 1UNRA 5LOPB 4D0NB 4HVBA 4KGSA 2ICIA 5JZEB 4EMOA 1NI3A 1K53A 1RAXA 3B9JA 1PFDA 3EUB2 3Q3MC 5BMGA 2QIEB 3E9OA 4W9EA 2X18A 1F0ZA 4A6KA 2AEHA 2XQNM 2LFIA 1QT9A 3N1YC 1XT9B 1TKEA 4M00A 4M0WB 2DYMA 1WWTA 3EC8A 1IBXA 3U52E 2KQ7A 4ASWC 2G9HD 2PTLA 1EO6A 3JW0X 1F52A 2UWQA 3VXWA 4BAXA 1HTOA 4DK5A 4EFOA 3L10B 4FBJB 1N61A 3AE1B 2C5LC 5D3XA 1DYNA 5TSSA 5J18A 4WAAA 3EECA 1QC6A 3SU8X 4GDLA 2DYNA 1PFJA 3FILA 1B9RA 4WSFA 3R2IA 3AEBB 3NVVA 1BWNA 2K2UA 1V81A 3CSTA 3GP7A 2DYOA 2Y5CA 4B95A 3E9SA 3MC9A 1FFUA 2KAJA 4YWGG 2JQRB 3D8EA 2P0DA 1W1GA 2JZ3B 3P4PB 2KNBA 3APDA 4HWIB 2ZCBA 1QOFA 2NVUI 3BINA 2MH7A 3TIXA 2FUHB 1N5WA 4DHJD 2MJEA 3ML8A 1HZ5A 5KQ4A 4YSZB 4O1NA 4PNKA 3Q3NC 5M4YB 1NYQA 3M63B 1XCQL 1X1MA 4A20A 5JHGA 3AV8A 2K39A 2K8BA 2RNRB 1OQQA 2FJLA 3U2SC 4JWSC 2VRRB 2EMTA 1N6ZA 3DCXA 2KIEA 3PHXB 4G0NB 3AU5A 1ET6A 4HAVB 1FPYA 2GBMA 3VVWB 1KJTA 2I38A 2JT4B 1J0WA 1JRUA 4JKHA 4XC2A 1PLSA 5CLLB 4AJYB 3B2GA 4NPNA 4LNKA 1PUTA 4C7YA 2DKPA 1XQQA 1T0SC 2KDFB 1OQRA 4DXGA 1PGBA 1WX8A 4N6EB 4PS7A 1Q67A 1G6JA 1GC6A 1TBEA 1YIWA 3ZDMC 1HBKA 1VBGA 2BKRB 2LHEA 4MM3B 4ZYNA 2L00B 1EF1A 1FNVA 1XEEA 4QAYA 2CJNA 3BVMA 3I3TB 3DBSA 2K1FA 4A9AA 3AEAB 2GBNA 1QZEA 2K8CA 1UNPA 1VLBA 2G3QB 2ZW1A 2UYZB 5EE1A 4HSIA 2O2VA 2NBUA 1C4AA 4W9DA 2LRUA 3VR9B 3N32A 2PMVA 2PPHA 4B0EA 4PQ0A 3ZNZB 2KZRA 2D4QA 1XR0B 2COPA 4JX1C 4REZA 2WXFA 4PT5A 2MP2A 3HM6X 3ZXVA 5DHFB 1UF0A 4DXFA 1TT5B 1PYWD 3OG5A 3AE6B 1U4AA 1VRAB 2M4NA 3P4QB 5LXIB 2DYBA 2BB6A 3NVYA 1WJNA 1XXGA 2KYWA 3IAS1 1DOIA 1C9FA 3DBLI 2MBBB 4GOCA 3RNCC 2DKQA 3U4EG 4K81A 3A1QB 1BUIC 3CMMB 3IFWB 5DI9B 2WGSA 2KWVB 3DVNV 2LD9A 2R61A 3VDZA 3BVGA 1Z5SB 1IUEA 2IFSA 3U12A 2G45B 1L7YA 3DWGC 4JKCA 3HHMA 1V49A 2RQ1A 3LYYA 3EPYA 4LNIA 4F8CB 1FXAA 4F1SA 4LDTB 2RLOA 1QQGA 1WXAA 4MGIE 1VBHA 3TMPB 2YSZA 2PEAA 1TJ6A 4A90A 1F2RI 3WAOA 3GOEA 1FHXA 2WXPA 4NQKE 4WQMA 5CHWA 1KZ7A 2KUPA 1RFKA 3CF6E 2AQ3B 3C0RB 4RM9A 2RSGA 1DDMA 1IRSA 1F2RC 1WGUA 2IPKD 3EFCA 2FIDA 4HKQA 5BYQA 1ZM0A 3QJZA 1GC7A 3B1LX 1NENB 4K3CA 1WFYA 4W9LA 4L6EA 4A3PA 4S0RA 3ZRFA 5HHDG 2RGNB 3SFDB 1U5FA 5D7GA 2KKCA 3I5JC 4YTNB 4TQ0A 3N20C 1XLOA 1ET9A 3Q8FA 1HE8A 5CTRC 2ACZB 1BXTA 3HQCA 3ZQ4A 2M14A 1T6BX 2HRJA 2CY4A 1RJ2A 1QOBA 2DZMA 2VH1A 2J0JA 1YJJA 4B9KA 2DN6A 4EKUA 4MELA 4KHBA 1ZSQA 3ZJUA 5BMHA 4FADA 2QKLA 3A8PA 1ZW7A 3BZDB 1MJDA 2W9NA 3AI5A 1FO4A 5DIFB 1L5PA 4XWWA 1HQRD 3L08A 1T0QC 1R4NI 2KMCA 2N9LA 2GUMA 2DWQA 2LMCA 4XX5A 3RULA 3N1XC 2YRYA 3P2BA 3MDBC 2ASQA 2C7MB 3HIEA 2W54A 2IBIB 5G2NA 2GLSA 4HJKA 1DROA 4MM3A 1ZE3D 2KWCA 3MPXA 3PZ8A 4RNAA 2KR0A 4F7HA 1K50A 1U5DA 2DIKA 4ZRKA 2WX0A 4OT1A 3HUIA 1NTVA 1TKYA 2L3ZA 1IP9A 3Q3JA 1TJEA 1JWMD 1L2NA 2Y7BA 1UPRA 4HAZB 1TS5A 1WE7A 1Q10A 2N9EB 3R3MA 4MJSB 2MSED 1P9DU 2JF5A 2LXAA 2QKMA 4DHZE 3PHWB 3KWLA 2HE7A 1MKEA 4P1CC 3KSYA 2I2YA 4A6HA 1VD2A 3H6NA 3BIID 4PK1A 2GB1A 2LGSA 2P0HA 2ZNVB 2I5FA 4EZLA 1V6EA 2W2WA 2KWDA 2KCJA 2SEBD 3I9V1 4AUQC 1JW9D 4HDQA 4TUUA 1EF5A 2QCZA 1A70A 2RUKB 3BWUD 2WU5B 2OEDA 3RZFA 2ONQA 2WXRA 2L0TA 3AJ4A 3M62B 3NS1A 4A6QA 2V4IB 1JWSD 3WYFB 5JHHA 3T3OA 2FNJB 3ZGZA 4YTMB 3A1QA 1PMSA 5MPOA 3A98B 3H7SA 1Q5WB 2WXQA 4IFSA 4LDTD 1W1DA 1AQCA 3W2DA 3W1YA 3FEHA 3JVZX 1WSPA 4JQWC 1WI1A 3G9WA 4A6FA 2KHWB 1CMXB 1H4RA 4IAPA 4AJWA 3N1ZC 1L6UA 3SO6A 3D8FA 2E3TA 1IBXB 3QARA 1Y5OA 2K25A 1ISNA 2BBCA 3AM9A 3OJ3A 1SIFA 4JKDA 1AWEA 2WXJA 2H7DA 3DXEA 4ICVA 2WYQA 3IHPC 2AL3A 1FD6A 3Q2AC 3L0WB 1AN8A 1RRBA 3RNGC 5IP4D 3VUYA 3IVFA 1AARA 3FILB 3VH4B 2CHWA 2KLCA 3ZTCA 1JWUD 2L83A 2DZKA 1FIQA 4RGOS 5EE9A 3A9KB 2VSZA 2R2OA 1XF5L 3ETRA 4ZHOA 3T06A 4K2OA 1SXTA 2GOWA 1E7VA 3BVZA 1DOXA 3DVNU 2FCSA 3BJIA 4MT5A 1U2BA 1JWBD 1GUAB 1LM8B 4E71A 1I42A 1M7RA 3AEFB 3V60A 2BKFA 4MH8A 5G55A 1NYRA 1V97A 3GYOA 1OMWA 4WWOA 4HPPA 3RNBC 2DYQA 3E9PA 1W1HA 2G1EA 4DHJB 4YONA 3OLMD 3ZVRA 2RDBC 3Q8BA 2WXGA 3QQ8B 1I4QA 4KV2A 1QKZA 4JIOU 1HTQA 4GXBA 2DHIA 2WXMA 5DCNA 2AYOB 5AEKB 1GPXA 4F7ZA 2QHOA 4EZKA 4OVVA 2RSUA 2VZKB 2NMQA 1KF6B 1V89A 2J4XA 2D9YA 1R7SA 3AXCA 4KHAA 2DHKA 3ZKJC 5KQ1A 2CU3A 3PRZA 3PGEA 4NJ7A 2CR5A 5JH5C 3P1MA 3PZ7A 4IW0A 3TW1A 1KOTA 1P7EA 5J3YA 3KZ1A 2N7JA 2MEKA 4P6VF 5IAAC 2JRHA 4H8SA 3QC8B 3NS8A 2JY6A 1NTIA 3NW8A 2OJWA 5C79A 4P1BC 4HXDA 2RPQA 4DDID 2KTRB 3FAHA 4XE0A 2MWSB 2E6XA 4KAXB 4GIVA 2IZVB 2BQQA 2LG1A 3AECB 1JMLA 4IUMB 2LVOA 2HJ1A 1BTKA 1TXDA 3WAMA 5H92C 4IOYX 3RPFC 1U29A 2KQ4X 1UZXB 3IG3A 2UZSA 4M8MA 5C5BB 4NAWB 3HVDA 1V80A 2WDRB 3O96A 1N63A 2KXJA 3HVZA 1X1FA 5LG4B 3VR8B 3R8BA 4FLHA 2CHZA 2KDIA 4EE2A 5I2SA 2JX5A 2ROZB 2WDVB 1C77A 5FR3A 2G35A 2HTHB 3P4SB 2KN5A 4I6LB 3KY9A 2D3GA 2K0PA 2JXXA 2DNFA 5IRSA 3WCQA 5AZFA 4RF0A 1FNUA 2D07B 1Q1OA 4OVUA 2KDBA 4BVUC 3AU4A 1MG4A 2M19A 3R66C 4MACA 2K9XA 2VH2A 3MP9A 2FDQA 1L0XB 2YEPB 3HIZA 4JKGB 1KLGD 4WURA 3R7RA 2EJ8A 2KVRA 1TY0A 1P6SA 2X0SA 2CQUA 4ARCA 2ROVA 1NEKB 2YVCA 2DBYA 2DAJA 2DX5B 4BOZB 2LXCA 2Z14A 1L0YB 3KVFB 1LFDA 1C3TA 5L83A 2WXLA 3TBLD 3NWDA 2Y8FA 3QK0A 4GU2A 1J8CA 4BZAA 2KJHB 1SGHA 1EU4A 1V1PA 1Q0WB 4P7IA 3GZNB 2Q5WD 1SE9A 4BBNF 3A9KA 2YS3A 3EFUA 2BGFA 4QXAB 4N58A 3VAWA 2BS4B 3PLUA 2KJ6A 3DBHI 2G4SA 4NAMA 2WS3B 4J6IA 5BO4B 2JU6X 4QJ4B 5IKCM 3KUDB 4YSYB 4YSXB 2E2XA 4LJPB 3ML4A 2BTEA 3V5WA 4N59A 3RCPA 3CIKA 4HLEA 2NBWB 1XX0A 1ACCA 2NBVA 5HE0A 2I1KA 3SYXA 1XKEA 4A3OA 3L17A 2YLMA 4C00A 2PJHA 3AH7A 3NRZA 3W1SC 4ACFA 3A4RA 3P7ZA 3NWFA 5KHQA 4JKEA 1UPQA 2Z0PA 2MDXA 2VZKD 4ZRPA 4KHBB 3MJWA 3TEYA 4JK9A 1T77A 1EM7A 4YXDB 2W3SA 2EKIA 4RFBA 1P0RA 4HAXB 2KANA 3A9JB 1NBFC 1ZUD2 2KMMA 1E0ZA 2BVCA 5JXVA 2COCA 1XLNA 2CB8A 2WU2B 5HKHA 3QWZB 2TSSA 1QLBB 1UGMA 1E8YA 5T8IA 2KD0A 4FHKA 2LKOA 3TJPA 3L13A 3RCZA 1FRRA 3ENEA 2ZZPB 3WAPA 4FJZA 2PZ1A 2FCMA 4J3OD 1EWYC 4ANVA 4W9GA 2VKIA 3IAM1 4IG7B 1A5RA 2H89B 3QAQA 4IWPA 1P1AA 2BB5A 1V88A 1C76A 4N9F4 3ZVVA 2KVZA 2JUOA 4Z2MB 4OZCA 3I57A 4X57B 3CXBB 2KO3A 1V2YA 2R2YA 1GB4A 3L4PA 5JP4A 4OZAA 3RFZB 3UIPB 4HB0B 2KTRA 2K00A 3A4SC 4JK8A 2Q13A 2WH5A 1WR1A 1R4NB 4B6WA 1WGHA 3RUIB 2WQYB 1UBIA 4AWJA 2WXNA 1XD3B 1TZOA 2IO3B 2WDTB 2J59M 2JSVX 4AP4C 4YTPB 5DPWA 2JZZA 1V5TA 4W9CA 4KGTA 2R2QA 4BKTA 4L2YA 1GNUA 3H1UA 3DCGA 2JXTA 4ANUA 3GB1A 4XYCA 4GPTB 5JHAA 2K8EA 5C5BA 4NAWA 1WGQA 1MHHE 3U30A 3V61A 1E7UA 1IGDA 3RI7C 4II2B 5D27A 2IY1B 2KDMA 2GS0A 4RGMA 1PGXA 2KX0A 2RD0A 2HD5B 2HTME 2HTHA 4A8XC 1E5WA 1BT0A 2C7NB 3Q14C 4K2PA 1C1YB 3KUZA 2D3AA 2SAKA 2W2XD 2QEJC 3O13A 2N0YA 2DAFA 2GI9A 4JKAA 2JYTA 2LZ6A 4HATB 4C0AA 2G4DB 4W9JA 1V8CA 3SR6A 1YMHE 4M8NA 4A6FB 2Z0DB 2MW5A 2OHFA 3H9DA 4D2KA 2FBWB 4JKGA 2PW9A 1WMHA 1EWCA 1UELA 5DHAB
chains in the Genus database with same CATH topology
2B3AA 4EEWA 2ZVOA 4CHJA 2AWTA 2O6VB 2KJRA 2DX5A 1JDEA 5L81A 3K9PB 2CHXA 1MIZB 4ILHA 3ODXA 2DLWA 3IBEA 1FB8A 1X86A 5J2RA 4KDIC 2D2QA 4JKFA 1LQBA 5L95C 2N7DA 1UH6A 4BBKA 1I35A 5LONB 5IA7A 1M94A 1E8WA 1Z2MA 3FLVA 4HAUB 2MA9B 3UQBA 1V61A 3NHEB 3QA8A 4HK2A 3SUZA 5E6PA 3DQVA 3L16A 2J0KA 1UD7A 2C60A 2YS5A 4IWQA 3R7QA 1P5TA 2D9WA 1NDDA 3ML9A 4K17A 4G11A 4KHOA 1WF9A 4NSWA 1WVHA 2JPHA 1MPHA 4MEMA 3TFMA 3O65B 1P98A 3VUXA 3TCAA 1WM2A 2KFKB 2R82A 3KUCB 1MIXA 3A9JA 4W9FA 3PLVA 2WX1A 2BPSA 4IWOA 1EGXA 2M0XA 2BF8B 2WWZA 3JSVB 4HHVA 2N1WA 2L0FA 4MSQB 2GMIC 2JRIB 1GG3A 1UNQA 1FXTB 2DZJA 3SHQA 2FCNA 2OOBB 4ILGB 5D3WA 1YQBA 1X1GA 2YT1A 1WJMA 1WYWB 1Y19B 3LJ3A 2D9ZA 1J0GA 1J19A 3PS6A 2NZ8B 2LGDA 3VH3B 2CS4A 1WE6A 2BCJA 4IC7B 2L2IA 3ZNGC 2BWES 2FIFA 2JVCA 2D9VA 4FA6A 3V6CB 5GMVA 1FGYA 2LOXA 1DBHA 2VRWB 3N30A 5DPSA 4G3XB 1WZ0A 1WXSA 2KC2A 1WG7A 2KFJA 5AZHA 2IY0B 1EAZA 3CSFA 2J0MA 2N7EA 4NY0A 4FHJA 4WJNA 5EDSA 4DDGD 3B0AA 1FHOA 3NOBA 1H10A 4JL9A 5E6OA 5D6JB 3KYDD 3B08A 2O6VD 3M1IB 3QBVB 1K5GB 1TGZB 3OAWA 1BTNA 1EUVB 3WALA 1MK9B 2Z59B 1GJZA 2N4FA 5C1ZA 2O6VA 3LJUX 2ZJDA 1E8XA 3ZTDA 4MT7A 4K7WA 2MKRA 3TO1A 3ENBA 4NJ6A 2MQJA 4MDKE 2MRPA 1SHCA 2KGXB 1TTNA 4GN1A 1WGYA 1KZGA 3QHTA 4CYEA 4MSMB 4WWNA 3WA0A 4GMXB 3RT3B 5FR6A 2FJ9A 2NBVB 2D9XA 1NU2A 4WJQA 4BFRA 1YX5B 3OANA 1IYFA 3KRXA 4ZDVA 4KIKB 2JWZA 2LASA 3K9OB 4E3CA 5HE1A 3WANA 3GYPA 3PG7A 4K1RB 2C7HA 2KFKA 2GJYA 3VTWA 2NCNA 2V76A 1OGWA 2IO1B 3QX1A 4K7SA 3T9LA 4AOFA 4KZCA 4GB9A 1F9JA 4XZ4A 4WWPA 3JSVA 2NMBA 2ABDA 1ZKHA 2FCQA 3PVWA 2YS1A 3ALBA 1V9JA 1WGRA 3DVGX 2GCLA 4EOYA 2NPTB 4DHZB 1WX7A 3HM3A 2PE6B 2KOXA 4JLCA 2R09A 1BAKA 5CHFA 2ZNVC 3M95A 5LLIA 2LBBA 3N7CA 2L7RA 3VHTC 3FM8C 2RVBB 3KH0A 1WH3A 4I6NB 3P6AA 3PZDA 3QWMA 4RMAA 2MWNB 2IO2B 4Z2NA 1OTRB 3KYCD 5C6RA 5J3TA 2Z0EB 2ADZA 2GBRA 1PQSA 3X23A 1KC7A 3NY5A 2KTFA 2IO0B 1IPGA 3L54A 2N9PC 1WMHB 4CO7A 4HAYB 4BKGA 2IYBA 2BWFA 3ZNHB 2KDEB 1M7EA 1V5MA 2MFQA 1WZ3A 4GGQA 4ICUA 4PYZA 3E9LA 1FAOA 2UVMA 2LJ5A 4ILJA 3SBGA 4WVFB 5J17A 3FSSA 2LRWA 1Y8RC 4B6HA 2J7QB 1NI2A 2BYVE 3PP2A 2MCNB 2V1YA 3MHSD 3FP5A 2LOZA 1WJUA 1ST7A 1I2HA 3D8DA 2LUEA 3V6EB 4KVGB 1NVLA 2OJRA 1ZC3B 1ZC4B 5FI1A 1XODA 4FJYA 3SD5A 4F7GA 4CHKA 4EJNA 3SDLC 4MGYE 3SBTA 2Z0QA 3NSUA 3OJ4B 4RM8A 3S2AA 2L76A 3H7PA 4KIKA 5GOWB 1E90A 1WX9A 2ZPNA 5D2MB 5C23A 2FAZA 1WM3A 4TYZA 2CODA 3W1SA 1U5GA 1T0YA 4DBGA 2ELBA 1DIKA 4KZ0A 2R0DA 1FGZA 1HB6A 1NTYA 2P8VA 2LYDA 1S3SG 1OY2A 1I7AA 1KBLA 4XWXA 3ODOA 4HPMB 1X11A 2D11A 4IM2A 2CRFA 4MGZE 2KWUB 3VOQA 2LI5A 2NPTA 1P3RA 3ECIA 3VQIA 3JYUA 1S1QB 2H7EA 2GBJA 2A5UA 2MBOA 2EC1A 3DPDA 4W9HA 3ZIMA 2LGYA 3PREA 2I1JA 5HE3A 2RR9A 3T8MA 5D3YA 3DDCB 3ONSA 4GMVA 1V5UA 3ZLZA 3V62A 3U7DA 2L1CA 4JK7A 1KM7A 5CLQB 4PS8A 1V5OA 2EKEC 4FJVB 1EVHA 3PT2B 3HW2B 5HE2A 2W2XC 1K5DB 1WXMA 2RGFA 3SV1A 2OQBA 5EFXA 2M8SA 4DX90 4DX8A 2C9WB 2L8JA 5DPTA 2MBQA 3PSEB 2LULA 5IJMA 3PV1A 3GZNI 4ANXA 1FOEA 4W9KA 1RRPB 2P0FA 2LVQA 1DDWA 4TV3A 3UIOB 1WJ1A 4PYUA 2PE9A 2DTCA 3X0WA 5DPRA 1H8CA 1YD8U 2Z0OA 4E74A 4WJOA 1TZ1A 1Z87A 4MK0A 4YL8A 3DOWA 3KW5B 4GDKB 4CHMA 3DVGY 2YF0A 2KC1A 2ZEQA 4PS3A 2DZIA 2KMAA 3ULBA 4JKBA 2CY5A 1YX6B 4KDLB 3PPAA 3TVVA 3ZW3A 1D3ZA 1ZGUB 5E6NA 4WQOB 4TQ1A 2DHZA 3UZTA 1TQZA 1K8RB 2N23A 5FI0A 1KLVA 2MLBA 2MBHA 5LXHA 3NZUA 1ZVRA 2XK5B 4II3B 3E66A 3M3JA 4EUTA 4WJ7A 1LXDA 4DWFA 3RYTA 1B55A 1OQNA 5C16A 2L05A 4NNJB 1LW3A 4BOSC 4URKA 2GBKA 3UINB 5J3QA 5D3VA 2N9XA 3PRPB 2ZPYA 1YJ1A 3RZWC 3SNHA 2CU1A 3ZRCA 2A4ZA 4LCDE 2LWPA 1WGDA 3VTVA 2K6DB 4WJPA 2NR2A 3BY4B 4HPLB 5CX3A 1UEFA 4ZRJA 5JHBA 3UF8A 1XD4A 4MGKE 1U27A 1ACAA 4IM0A 2V4LA 4MH0E 3TL5A 3VFKA 2KLGA 1V5PA 3PSCA 5JLJB 3Q3FA 3VIAA 3ZO5B 1UBQA 3ZUNA 5TR5A 2DFKA 4F7UP 4DBBA 1OEYA 4BBNC 1HB8A 3PVLA 5CHVC 2ELAA 4EZJA 1R4MI 1N3HA 1FHWA 2LGXA 3A33B 4TKNA 2COAA 3RD2A 4ANWA 3QCAA 4W9IA 3PEGA 2D10A 2K6QA 3KRWA 2BYEA 1KI1B 1RFAA 4FULA 2Y8GA 3VTUA 4Y94A 4NQLB 1WI0A 2XBBC 3N3KB 4KSLC 2MBEA 2ZCCA 1WXVA 3WIMA 3ODWA 4GDLB 4HB3B 2GCJA 4GDKA 3VUWA 4LJOB 2M1MA 3F5RA 4KSKC 2JP2A 1WGGA 1WJ4A 3AULA 3PVUA 4HB2B 2N1VA 2REXA 3APFA 1P3QU 1WIAA 2V3SA 2KQSA 4A5KA 3H7PB 1WY8A 3QIJA 1XCGA 3LDZE 5KHOA 2DHJA 2M17A 4MY6A 2KK8A 3ZNID 4FN2A 5KCVA 2XK5A 2OTXA 3PRMB 1LB1A 2MX2A 1VCBA 2YT0A 4HCPB 2BYFA 3ZDTA 1E8ZA 2KX3A 1OEYJ 2DENB 5DH9B 3NZSA 4K7UA 3A8QA 2K8HA 2UZRA 4GSWA 1WJ6A 2K2JA 3UGBB 3DXCA 1MG8A 1GGOA 3DBRI 2IYDB 3U8ZA 4I6PA 1X05A 2XEWA 2DX1A 4GZUA 2ZVNA 3UQAA 3APCA 4MJSA 3ULCA 5JVLA 1DDVA 2LVPA 2O2VB 2M38A 5AZGA 3PTFC 5D94A 2COFA 2I5CA 4DXAB 2CKHB 4JGHB 2NS5A 3F0WA 3D32A 2Y5BB 1MK7B 4ZRIA 1WR6E 3MTNB 2MP2B 1MAIA 3EHVA 2CAYA 4G50A 4BKSD 4HB4B 2HJ8A 1OQYA 1U5EA 4HAWB 1V86A 4HCNB 2AL6A 4HDOA 3DXDA 4IM3A 2DA0A 1RLFA 3HK0A 4BKSA 2EMSA 1WRDB 1UNRA 5LOPB 4D0NB 4HVBA 5JZEB 4EMOA 1RAXA 3E9OA 4W9EA 2X18A 4A6KA 2AEHA 2XQNM 1XT9B 4M0WB 2DYMA 3EC8A 2KQ7A 4ASWC 3JW0X 1EO6A 2UWQA 3VXWA 4DK5A 4EFOA 3L10B 4FBJB 2C5LC 5D3XA 1DYNA 5J18A 4WAAA 3EECA 1QC6A 3SU8X 4GDLA 2DYNA 1PFJA 4WSFA 1BWNA 2K2UA 1V81A 3CSTA 2DYOA 4B95A 3D8EA 2P0DA 1W1GA 2JZ3B 2KNBA 3APDA 4HWIB 2ZCBA 2NVUI 3BINA 3TIXA 2FUHB 4DHJD 3ML8A 5KQ4A 4PNKA 3M63B 1X1MA 4A20A 5JHGA 2K39A 2K8BA 2RNRB 2FJLA 2VRRB 2EMTA 3PHXB 4G0NB 3AU5A 4HAVB 2GBMA 3VVWB 1KJTA 2JT4B 1J0WA 1JRUA 4JKHA 4XC2A 1PLSA 5CLLB 4AJYB 4NPNA 2DKPA 1XQQA 2KDFB 1WX8A 4PS7A 1Q67A 1G6JA 1GC6A 1TBEA 1YIWA 3ZDMC 1HBKA 1VBGA 2BKRB 4ZYNA 2L00B 1EF1A 3I3TB 3DBSA 2K1FA 2GBNA 1QZEA 2K8CA 1UNPA 2G3QB 2UYZB 2O2VA 2NBUA 4W9DA 2LRUA 3N32A 2PPHA 4PQ0A 3ZNZB 2KZRA 2D4QA 1XR0B 2COPA 2MP2A 3HM6X 5DHFB 1U4AA 2M4NA 5LXIB 2DYBA 1WJNA 3DBLI 2MBBB 4GOCA 2DKQA 4K81A 3A1QB 3CMMB 3IFWB 5DI9B 2KWVB 3DVNV 2LD9A 3VDZA 1Z5SB 2IFSA 2G45B 1L7YA 4JKCA 3HHMA 1V49A 2RQ1A 4F8CB 3EPYA 4F1SA 4LDTB 2RLOA 1QQGA 1WXAA 4MGIE 1VBHA 3TMPB 2YSZA 2PEAA 1TJ6A 3WAOA 3GOEA 1FHXA 4NQKE 5CHWA 1KZ7A 2KUPA 3CF6E 3C0RB 4RM9A 2RSGA 1DDMA 1IRSA 1WGUA 2FIDA 1ZM0A 3QJZA 1GC7A 3B1LX 1WFYA 4W9LA 4L6EA 4A3PA 3ZRFA 2RGNB 1U5FA 5D7GA 2KKCA 4TQ0A 1HE8A 5CTRC 3HQCA 2M14A 2HRJA 2CY4A 1RJ2A 2DZMA 2J0JA 4B9KA 2DN6A 4EKUA 4MELA 1ZSQA 4FADA 2QKLA 3A8PA 1ZW7A 2W9NA 3AI5A 5DIFB 3L08A 1R4NI 2KMCA 4XX5A 3RULA 2YRYA 3P2BA 3MDBC 2ASQA 2C7MB 2IBIB 5G2NA 4HJKA 1DROA 4MM3A 2KWCA 3MPXA 4F7HA 1U5DA 2DIKA 4ZRKA 2WX0A 1NTVA 2L3ZA 1IP9A 3Q3JA 1L2NA 2Y7BA 1UPRA 4HAZB 1WE7A 3R3MA 2N9EB 4MJSB 2MSED 1P9DU 2JF5A 2LXAA 2QKMA 4DHZE 3PHWB 2HE7A 1MKEA 3KSYA 4A6HA 1VD2A 3H6NA 2P0HA 2ZNVB 2I5FA 4EZLA 1V6EA 2W2WA 2KCJA 4AUQC 4HDQA 4TUUA 1EF5A 2RUKB 3RZFA 2L0TA 3AJ4A 3M62B 3WYFB 5JHHA 2FNJB 3A1QA 1PMSA 3A98B 3H7SA 1Q5WB 4IFSA 4LDTD 1W1DA 1AQCA 3W1YA 3FEHA 3JVZX 4JQWC 1WI1A 3G9WA 4A6FA 2KHWB 1CMXB 1H4RA 4IAPA 4AJWA 3SO6A 3D8FA 3QARA 1Y5OA 2K25A 1ISNA 3OJ3A 1SIFA 4JKDA 1AWEA 2H7DA 3DXEA 4ICVA 2WYQA 3IHPC 2AL3A 3L0WB 1RRBA 3VUYA 3IVFA 1AARA 3VH4B 2CHWA 2KLCA 3ZTCA 2DZKA 3A9KB 2VSZA 2R2OA 3T06A 4K2OA 2GOWA 1E7VA 3DVNU 2FCSA 3BJIA 1U2BA 1GUAB 1LM8B 4E71A 1I42A 1M7RA 3V60A 2BKFA 5G55A 4WWOA 3GYOA 1OMWA 2DYQA 3E9PA 1W1HA 4DHJB 4YONA 3OLMD 3ZVRA 3QQ8B 4KV2A 4JIOU 4GXBA 2DHIA 5DCNA 2AYOB 5AEKB 4F7ZA 2QHOA 4EZKA 4OVVA 2RSUA 1V89A 2D9YA 3AXCA 4KHAA 2DHKA 3ZKJC 5KQ1A 3PRZA 3PGEA 4NJ7A 2CR5A 5JH5C 4IW0A 3TW1A 1KOTA 5J3YA 3KZ1A 5IAAC 2JRHA 4H8SA 3QC8B 3NS8A 2JY6A 1NTIA 5C79A 4HXDA 2RPQA 4DDID 2KTRB 2MWSB 4KAXB 4GIVA 2IZVB 2LG1A 4IUMB 2LVOA 1BTKA 1TXDA 3WAMA 4IOYX 1U29A 1UZXB 3IG3A 2UZSA 4M8MA 5C5BB 4NAWB 1V80A 3O96A 2KXJA 1X1FA 4FLHA 2CHZA 2KDIA 2ROZB 2G35A 2HTHB 2KN5A 4I6LB 3KY9A 2D3GA 2JXXA 5AZFA 2D07B 1Q1OA 4OVUA 2KDBA 4BVUC 3AU4A 3R66C 2FDQA 3HIZA 4JKGB 3R7RA 2EJ8A 2KVRA 1P6SA 2X0SA 2CQUA 2ROVA 2YVCA 2DAJA 2DX5B 4BOZB 2LXCA 3KVFB 1LFDA 1C3TA 5L83A 3TBLD 2Y8FA 3QK0A 4GU2A 1J8CA 2KJHB 1SGHA 1Q0WB 4P7IA 1SE9A 4BBNF 3A9KA 2YS3A 3EFUA 2BGFA 3VAWA 3PLUA 2KJ6A 3DBHI 2G4SA 4J6IA 5BO4B 3KUDB 2E2XA 4LJPB 3ML4A 3V5WA 3RCPA 3CIKA 4HLEA 2NBWB 1XX0A 5HE0A 2I1KA 3SYXA 1XKEA 4A3OA 3L17A 2YLMA 2PJHA 3W1SC 3A4RA 3P7ZA 5KHQA 4JKEA 1UPQA 2Z0PA 2MDXA 4KHBB 3MJWA 4JK9A 1P0RA 4HAXB 2KANA 3A9JB 1NBFC 2COCA 2CB8A 5HKHA 3QWZB 1UGMA 1E8YA 2KD0A 4FHKA 2LKOA 3TJPA 3L13A 3RCZA 3ENEA 2ZZPB 3WAPA 4FJZA 2PZ1A 2FCMA 4ANVA 4W9GA 2VKIA 4IG7B 1A5RA 3QAQA 4IWPA 1P1AA 1V88A 4N9F4 3ZVVA 2JUOA 4Z2MB 4X57B 3CXBB 2KO3A 1V2YA 5JP4A 3UIPB 4HB0B 2KTRA 2K00A 3A4SC 4JK8A 2Q13A 2WH5A 1WR1A 4B6WA 3RUIB 1WGHA 4AWJA 1UBIA 1XD3B 2IO3B 2WDTB 2J59M 4AP4C 5DPWA 2JZZA 1V5TA 4W9CA 2R2QA 4BKTA 1GNUA 3H1UA 3DCGA 4ANUA 4GPTB 5JHAA 5C5BA 4NAWA 1WGQA 3U30A 3V61A 1E7UA 4II2B 5D27A 2IY1B 2GS0A 2KX0A 2RD0A 2HD5B 2HTHA 1E5WA 1BT0A 2C7NB 4K2PA 1C1YB 3KUZA 2W2XD 2N0YA 2DAFA 4JKAA 2LZ6A 4HATB 4C0AA 2G4DB 4W9JA 4M8NA 4A6FB 2Z0DB 2MW5A 3H9DA 4JKGA 1WMHA 1UELA 5DHAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3A A;  4EEW A;  2ZVO A;  4CHJ A;  2AWT A;  2O6V B;  2KJR A;  2DX5 A;  5L81 A;  3K9P B;  2CHX A;  1MIZ B;  3ODX A;  2DLW A;  3IBE A;  1FB8 A;  1X86 A;  5J2R A;  4KDI C;  2D2Q A;  1LQB A;  5L95 C;  2N7D A;  1UH6 A;  4BBK A;  1I35 A;  5LON B;  5IA7 A;  1M94 A;  1E8W A;  1Z2M A;  3FLV A;  4HAU B;  2MA9 B;  3UQB A;  1V61 A;  3NHE B;  3QA8 A;  4HK2 A;  3SUZ A;  5E6P A;  3DQV A;  3L16 A;  2J0K A;  1UD7 A;  2C60 A;  2YS5 A;  4IWQ A;  3R7Q A;  1P5T A;  2D9W A;  1NDD A;  3ML9 A;  4K17 A;  4G11 A;  4KHO A;  1WF9 A;  4NSW A;  1WVH A;  2JPH A;  1MPH A;  4MEM A;  3TFM A;  3O65 B;  1P98 A;  3VUX A;  3TCA A;  1WM2 A;  2KFK B;  3KUC B;  1MIX A;  3A9J A;  4W9F A;  3PLV A;  2WX1 A;  2BPS A;  4IWO A;  1EGX A;  2M0X A;  2BF8 B;  2WWZ A;  3JSV B;  4HHV A;  2N1W A;  2L0F A;  4MSQ B;  2GMI C;  2JRI B;  1GG3 A;  1UNQ A;  1FXT B;  2DZJ A;  3SHQ A;  2FCN A;  2OOB B;  5D3W A;  1YQB A;  1X1G A;  2YT1 A;  1WJM A;  1WYW B;  1Y19 B;  3LJ3 A;  2D9Z A;  1J0G A;  1J19 A;  3PS6 A;  2NZ8 B;  2LGD A;  3VH3 B;  2CS4 A;  1WE6 A;  2BCJ A;  4IC7 B;  2L2I A;  3ZNG C;  2BWE S;  2FIF A;  2JVC A;  2D9V A;  4FA6 A;  3V6C B;  5GMV A;  1FGY A;  2LOX A;  1DBH A;  2VRW B;  3N30 A;  5DPS A;  4G3X B;  1WZ0 A;  1WXS A;  2KC2 A;  1WG7 A;  2KFJ A;  5AZH A;  2IY0 B;  1EAZ A;  3CSF A;  2J0M A;  2N7E A;  4NY0 A;  4FHJ A;  4WJN A;  5EDS A;  4DDG D;  3B0A A;  1FHO A;  3NOB A;  1H10 A;  4JL9 A;  5E6O A;  5D6J B;  3KYD D;  3B08 A;  2O6V D;  3M1I B;  3QBV B;  1K5G B;  1TGZ B;  3OAW A;  1BTN A;  1EUV B;  3WAL A;  1MK9 B;  2Z59 B;  1GJZ A;  2N4F A;  5C1Z A;  2O6V A;  3LJU X;  2ZJD A;  1E8X A;  3ZTD A;  4MT7 A;  4K7W A;  2MKR A;  3TO1 A;  4NJ6 A;  2MQJ A;  4MDK E;  2MRP A;  1SHC A;  2KGX B;  1TTN A;  4GN1 A;  1WGY A;  1KZG A;  3QHT A;  4CYE A;  4MSM B;  4WWN A;  3WA0 A;  4GMX B;  3RT3 B;  5FR6 A;  2FJ9 A;  2NBV B;  2D9X A;  1NU2 A;  4WJQ A;  4BFR A;  1YX5 B;  3OAN A;  1IYF A;  3KRX A;  4ZDV A;  4KIK B;  2JWZ A;  2LAS A;  3K9O B;  4E3C A;  5HE1 A;  3WAN A;  3GYP A;  3PG7 A;  4K1R B;  2C7H A;  2KFK A;  2GJY A;  3VTW A;  2NCN A;  2V76 A;  1OGW A;  2IO1 B;  3QX1 A;  4K7S A;  3T9L A;  4AOF A;  4KZC A;  4GB9 A;  1F9J A;  4XZ4 A;  4WWP A;  3JSV A;  2NMB A;  2ABD A;  1ZKH A;  2FCQ A;  3PVW A;  2YS1 A;  3ALB A;  1V9J A;  1WGR A;  3DVG X;  2GCL A;  4EOY A;  2NPT B;  4DHZ B;  1WX7 A;  3HM3 A;  2PE6 B;  2KOX A;  4JLC A;  2R09 A;  1BAK A;  5CHF A;  2ZNV C;  3M95 A;  5LLI A;  2LBB A;  3N7C A;  2L7R A;  3VHT C;  3FM8 C;  2RVB B;  3KH0 A;  1WH3 A;  4I6N B;  3P6A A;  3PZD A;  3QWM A;  4RMA A;  2MWN B;  2IO2 B;  4Z2N A;  1OTR B;  3KYC D;  5C6R A;  5J3T A;  2Z0E B;  2ADZ A;  2GBR A;  1PQS A;  3X23 A;  3NY5 A;  2KTF A;  2IO0 B;  1IPG A;  3L54 A;  2N9P C;  1WMH B;  4CO7 A;  4HAY B;  4BKG A;  2IYB A;  2BWF A;  3ZNH B;  2KDE B;  1M7E A;  1V5M A;  2MFQ A;  1WZ3 A;  4GGQ A;  4ICU A;  4PYZ A;  1FAO A;  2UVM A;  2LJ5 A;  4WVF B;  5J17 A;  3FSS A;  2LRW A;  1Y8R C;  4B6H A;  2J7Q B;  1NI2 A;  2BYV E;  3PP2 A;  2MCN B;  2V1Y A;  3MHS D;  3FP5 A;  2LOZ A;  1WJU A;  1ST7 A;  1I2H A;  3D8D A;  2LUE A;  3V6E B;  4KVG B;  1NVL A;  2OJR A;  1ZC3 B;  1ZC4 B;  5FI1 A;  1XOD A;  4FJY A;  3SD5 A;  4F7G A;  4CHK A;  4EJN A;  3SDL C;  4MGY E;  2Z0Q A;  3NSU A;  3OJ4 B;  4RM8 A;  3S2A A;  2L76 A;  3H7P A;  4KIK A;  5GOW B;  1E90 A;  1WX9 A;  2ZPN A;  5D2M B;  5C23 A;  2FAZ A;  1WM3 A;  4TYZ A;  2COD A;  3W1S A;  1U5G A;  1T0Y A;  4DBG A;  2ELB A;  4KZ0 A;  2R0D A;  1FGZ A;  1HB6 A;  1NTY A;  2P8V A;  2LYD A;  1S3S G;  1OY2 A;  1I7A A;  4XWX A;  3ODO A;  4HPM B;  1X11 A;  2D11 A;  4IM2 A;  2CRF A;  4MGZ E;  2KWU B;  3VOQ A;  2LI5 A;  2NPT A;  1P3R A;  3ECI A;  3VQI A;  3JYU A;  1S1Q B;  2H7E A;  2GBJ A;  2A5U A;  2MBO A;  2EC1 A;  3DPD A;  4W9H A;  3ZIM A;  2LGY A;  3PRE A;  2I1J A;  5HE3 A;  2RR9 A;  3T8M A;  5D3Y A;  3DDC B;  3ONS A;  4GMV A;  1V5U A;  3ZLZ A;  3V62 A;  3U7D A;  2L1C A;  1KM7 A;  5CLQ B;  4PS8 A;  1V5O A;  2EKE C;  4FJV B;  1EVH A;  3PT2 B;  3HW2 B;  5HE2 A;  2W2X C;  1K5D B;  1WXM A;  2RGF A;  3SV1 A;  2OQB A;  5EFX A;  2M8S A;  4DX9 0;  4DX8 A;  2C9W B;  2L8J A;  5DPT A;  2MBQ A;  3PSE B;  2LUL A;  5IJM A;  3PV1 A;  3GZN I;  4ANX A;  1FOE A;  4W9K A;  1RRP B;  2P0F A;  2LVQ A;  1DDW A;  4TV3 A;  3UIO B;  1WJ1 A;  4PYU A;  2PE9 A;  2DTC A;  3X0W A;  5DPR A;  1H8C A;  1YD8 U;  2Z0O A;  4E74 A;  4WJO A;  1TZ1 A;  1Z87 A;  4MK0 A;  4YL8 A;  3DOW A;  3KW5 B;  4GDK B;  4CHM A;  3DVG Y;  2YF0 A;  2KC1 A;  2ZEQ A;  4PS3 A;  2DZI A;  2KMA A;  3ULB A;  2CY5 A;  1YX6 B;  4KDL B;  3PPA A;  3TVV A;  3ZW3 A;  1D3Z A;  1ZGU B;  5E6N A;  4WQO B;  4TQ1 A;  2DHZ A;  3UZT A;  1TQZ A;  1K8R B;  2N23 A;  5FI0 A;  1KLV A;  2MLB A;  2MBH A;  5LXH A;  3NZU A;  1ZVR A;  2XK5 B;  4II3 B;  3M3J A;  4EUT A;  4WJ7 A;  1LXD A;  4DWF A;  3RYT A;  1B55 A;  1OQN A;  5C16 A;  2L05 A;  4NNJ B;  1LW3 A;  4BOS C;  4URK A;  2GBK A;  3UIN B;  5J3Q A;  5D3V A;  2N9X A;  3PRP B;  2ZPY A;  1YJ1 A;  3RZW C;  3SNH A;  2CU1 A;  3ZRC A;  2A4Z A;  4LCD E;  2LWP A;  1WGD A;  3VTV A;  2K6D B;  4WJP A;  2NR2 A;  3BY4 B;  4HPL B;  5CX3 A;  1UEF A;  4ZRJ A;  5JHB A;  3UF8 A;  1XD4 A;  4MGK E;  1U27 A;  1ACA A;  4IM0 A;  2V4L A;  4MH0 E;  3TL5 A;  3VFK A;  2KLG A;  1V5P A;  3PSC A;  5JLJ B;  3Q3F A;  3VIA A;  3ZO5 B;  1UBQ A;  3ZUN A;  5TR5 A;  2DFK A;  4F7U P;  4DBB A;  1OEY A;  4BBN C;  1HB8 A;  3PVL A;  5CHV C;  2ELA A;  4EZJ A;  1R4M I;  1N3H A;  1FHW A;  2LGX A;  3A33 B;  4TKN A;  2COA A;  3RD2 A;  4ANW A;  3QCA A;  4W9I A;  3PEG A;  2D10 A;  2K6Q A;  3KRW A;  2BYE A;  1KI1 B;  1RFA A;  4FUL A;  2Y8G A;  3VTU A;  4Y94 A;  4NQL B;  1WI0 A;  2XBB C;  3N3K B;  4KSL C;  2MBE A;  2ZCC A;  1WXV A;  3WIM A;  3ODW A;  4GDL B;  4HB3 B;  2GCJ A;  4GDK A;  3VUW A;  4LJO B;  2M1M A;  3F5R A;  4KSK C;  2JP2 A;  1WGG A;  1WJ4 A;  3AUL A;  3PVU A;  4HB2 B;  2N1V A;  2REX A;  3APF A;  1P3Q U;  1WIA A;  2V3S A;  2KQS A;  4A5K A;  3H7P B;  1WY8 A;  3QIJ A;  1XCG A;  3LDZ E;  5KHO A;  2DHJ A;  2M17 A;  4MY6 A;  2KK8 A;  3ZNI D;  4FN2 A;  5KCV A;  2XK5 A;  2OTX A;  3PRM B;  1LB1 A;  2MX2 A;  1VCB A;  2YT0 A;  4HCP B;  2BYF A;  3ZDT A;  1E8Z A;  2KX3 A;  1OEY J;  2DEN B;  5DH9 B;  3NZS A;  4K7U A;  3A8Q A;  2K8H A;  2UZR A;  4GSW A;  1WJ6 A;  2K2J A;  3UGB B;  3DXC A;  1MG8 A;  3DBR I;  2IYD B;  3U8Z A;  4I6P A;  1X05 A;  2XEW A;  2DX1 A;  4GZU A;  2ZVN A;  3UQA A;  3APC A;  4MJS A;  3ULC A;  1DDV A;  2LVP A;  2O2V B;  2M38 A;  5AZG A;  3PTF C;  5D94 A;  2COF A;  2I5C A;  4DXA B;  2CKH B;  4JGH B;  2NS5 A;  3F0W A;  3D32 A;  2Y5B B;  1MK7 B;  4ZRI A;  1WR6 E;  3MTN B;  2MP2 B;  1MAI A;  3EHV A;  2CAY A;  4G50 A;  4BKS D;  4HB4 B;  2HJ8 A;  1OQY A;  1U5E A;  4HAW B;  1V86 A;  4HCN B;  2AL6 A;  4HDO A;  3DXD A;  4IM3 A;  2DA0 A;  1RLF A;  3HK0 A;  4BKS A;  2EMS A;  1WRD B;  1UNR A;  5LOP B;  4D0N B;  4HVB A;  5JZE B;  4EMO A;  1RAX A;  4W9E A;  2X18 A;  4A6K A;  2AEH A;  2XQN M;  1XT9 B;  4M0W B;  2DYM A;  3EC8 A;  2KQ7 A;  4ASW C;  3JW0 X;  1EO6 A;  2UWQ A;  3VXW A;  4DK5 A;  4EFO A;  3L10 B;  4FBJ B;  2C5L C;  5D3X A;  1DYN A;  5J18 A;  4WAA A;  3EEC A;  1QC6 A;  3SU8 X;  4GDL A;  2DYN A;  1PFJ A;  4WSF A;  1BWN A;  2K2U A;  1V81 A;  3CST A;  2DYO A;  4B95 A;  3D8E A;  2P0D A;  1W1G A;  2JZ3 B;  2KNB A;  3APD A;  4HWI B;  2ZCB A;  2NVU I;  3BIN A;  3TIX A;  2FUH B;  4DHJ D;  3ML8 A;  5KQ4 A;  4PNK A;  3M63 B;  1X1M A;  4A20 A;  5JHG A;  2K39 A;  2K8B A;  2RNR B;  2FJL A;  2VRR B;  2EMT A;  3PHX B;  4G0N B;  3AU5 A;  4HAV B;  2GBM A;  3VVW B;  1KJT A;  2JT4 B;  1J0W A;  1JRU A;  4XC2 A;  1PLS A;  5CLL B;  4AJY B;  4NPN A;  2DKP A;  1XQQ A;  2KDF B;  1WX8 A;  4PS7 A;  1Q67 A;  1G6J A;  1GC6 A;  1TBE A;  1YIW A;  3ZDM C;  1HBK A;  2BKR B;  4ZYN A;  2L00 B;  1EF1 A;  3I3T B;  3DBS A;  2K1F A;  2GBN A;  1QZE A;  2K8C A;  1UNP A;  2G3Q B;  2UYZ B;  2O2V A;  2NBU A;  4W9D A;  2LRU A;  3N32 A;  2PPH A;  4PQ0 A;  3ZNZ B;  2KZR A;  2D4Q A;  1XR0 B;  2COP A;  2MP2 A;  3HM6 X;  5DHF B;  1U4A A;  2M4N A;  5LXI B;  2DYB A;  1WJN A;  3DBL I;  2MBB B;  4GOC A;  2DKQ A;  4K81 A;  3A1Q B;  3CMM B;  3IFW B;  5DI9 B;  2KWV B;  3DVN V;  2LD9 A;  3VDZ A;  1Z5S B;  2IFS A;  2G45 B;  1L7Y A;  3HHM A;  1V49 A;  2RQ1 A;  4F8C B;  3EPY A;  4F1S A;  4LDT B;  2RLO A;  1QQG A;  1WXA A;  4MGI E;  3TMP B;  2YSZ A;  2PEA A;  1TJ6 A;  3WAO A;  3GOE A;  1FHX A;  4NQK E;  5CHW A;  1KZ7 A;  2KUP A;  3CF6 E;  3C0R B;  4RM9 A;  2RSG A;  1DDM A;  1IRS A;  1WGU A;  2FID A;  1ZM0 A;  3QJZ A;  1GC7 A;  3B1L X;  1WFY A;  4W9L A;  4L6E A;  4A3P A;  3ZRF A;  2RGN B;  1U5F A;  5D7G A;  2KKC A;  4TQ0 A;  1HE8 A;  5CTR C;  3HQC A;  2M14 A;  2HRJ A;  2CY4 A;  1RJ2 A;  2DZM A;  2J0J A;  4B9K A;  2DN6 A;  4EKU A;  4MEL A;  1ZSQ A;  4FAD A;  2QKL A;  3A8P A;  1ZW7 A;  2W9N A;  3AI5 A;  5DIF B;  3L08 A;  1R4N I;  2KMC A;  4XX5 A;  3RUL A;  2YRY A;  3P2B A;  3MDB C;  2ASQ A;  2C7M B;  2IBI B;  5G2N A;  4HJK A;  1DRO A;  4MM3 A;  2KWC A;  3MPX A;  4F7H A;  1U5D A;  4ZRK A;  2WX0 A;  1NTV A;  2L3Z A;  1IP9 A;  3Q3J A;  1L2N A;  2Y7B A;  1UPR A;  4HAZ B;  1WE7 A;  3R3M A;  2N9E B;  4MJS B;  2MSE D;  1P9D U;  2JF5 A;  2LXA A;  2QKM A;  4DHZ E;  3PHW B;  2HE7 A;  1MKE A;  3KSY A;  4A6H A;  1VD2 A;  3H6N A;  2P0H A;  2ZNV B;  2I5F A;  4EZL A;  1V6E A;  2W2W A;  2KCJ A;  4AUQ C;  4HDQ A;  4TUU A;  1EF5 A;  2RUK B;  3RZF A;  2L0T A;  3AJ4 A;  3M62 B;  3WYF B;  5JHH A;  2FNJ B;  3A1Q A;  1PMS A;  3A98 B;  3H7S A;  1Q5W B;  4IFS A;  4LDT D;  1W1D A;  1AQC A;  3W1Y A;  3FEH A;  3JVZ X;  4JQW C;  1WI1 A;  3G9W A;  4A6F A;  2KHW B;  1CMX B;  1H4R A;  4IAP A;  4AJW A;  3SO6 A;  3D8F A;  3QAR A;  1Y5O A;  2K25 A;  1ISN A;  3OJ3 A;  1SIF A;  1AWE A;  2H7D A;  3DXE A;  4ICV A;  2WYQ A;  3IHP C;  2AL3 A;  3L0W B;  1RRB A;  3VUY A;  3IVF A;  1AAR A;  3VH4 B;  2CHW A;  2KLC A;  3ZTC A;  2DZK A;  3A9K B;  2VSZ A;  2R2O A;  3T06 A;  4K2O A;  2GOW A;  1E7V A;  3DVN U;  2FCS A;  3BJI A;  1U2B A;  1GUA B;  1LM8 B;  4E71 A;  1I42 A;  1M7R A;  3V60 A;  2BKF A;  5G55 A;  4WWO A;  3GYO A;  1OMW A;  2DYQ A;  1W1H A;  4DHJ B;  4YON A;  3OLM D;  3ZVR A;  3QQ8 B;  4KV2 A;  4JIO U;  4GXB A;  2DHI A;  5DCN A;  2AYO B;  5AEK B;  4F7Z A;  2QHO A;  4EZK A;  4OVV A;  2RSU A;  1V89 A;  2D9Y A;  3AXC A;  4KHA A;  2DHK A;  3ZKJ C;  5KQ1 A;  3PRZ A;  3PGE A;  4NJ7 A;  2CR5 A;  5JH5 C;  4IW0 A;  3TW1 A;  1KOT A;  5J3Y A;  3KZ1 A;  5IAA C;  2JRH A;  4H8S A;  3QC8 B;  3NS8 A;  2JY6 A;  1NTI A;  5C79 A;  4HXD A;  2RPQ A;  4DDI D;  2KTR B;  2MWS B;  4KAX B;  4GIV A;  2IZV B;  2LG1 A;  4IUM B;  2LVO A;  1BTK A;  1TXD A;  3WAM A;  4IOY X;  1U29 A;  1UZX B;  3IG3 A;  2UZS A;  4M8M A;  5C5B B;  4NAW B;  1V80 A;  3O96 A;  2KXJ A;  1X1F A;  4FLH A;  2CHZ A;  2KDI A;  2ROZ B;  2G35 A;  2HTH B;  2KN5 A;  4I6L B;  3KY9 A;  2D3G A;  2JXX A;  5AZF A;  2D07 B;  1Q1O A;  4OVU A;  2KDB A;  4BVU C;  3AU4 A;  3R66 C;  2FDQ A;  3HIZ A;  3R7R A;  2EJ8 A;  2KVR A;  1P6S A;  2CQU A;  2ROV A;  2YVC A;  2DAJ A;  2DX5 B;  4BOZ B;  2LXC A;  3KVF B;  1LFD A;  1C3T A;  5L83 A;  3TBL D;  2Y8F A;  3QK0 A;  4GU2 A;  1J8C A;  2KJH B;  1SGH A;  1Q0W B;  4P7I A;  1SE9 A;  4BBN F;  3A9K A;  2YS3 A;  3EFU A;  2BGF A;  3VAW A;  3PLU A;  2KJ6 A;  3DBH I;  2G4S A;  4J6I A;  5BO4 B;  3KUD B;  2E2X A;  4LJP B;  3ML4 A;  3V5W A;  3RCP A;  3CIK A;  4HLE A;  2NBW B;  1XX0 A;  5HE0 A;  2I1K A;  3SYX A;  1XKE A;  4A3O A;  3L17 A;  2YLM A;  2PJH A;  3W1S C;  3A4R A;  3P7Z A;  5KHQ A;  1UPQ A;  2Z0P A;  2MDX A;  4KHB B;  3MJW A;  1P0R A;  4HAX B;  2KAN A;  3A9J B;  1NBF C;  2COC A;  2CB8 A;  5HKH A;  3QWZ B;  1UGM A;  1E8Y A;  2KD0 A;  4FHK A;  2LKO A;  3TJP A;  3L13 A;  3RCZ A;  3ENE A;  2ZZP B;  3WAP A;  4FJZ A;  2PZ1 A;  2FCM A;  4ANV A;  4W9G A;  2VKI A;  4IG7 B;  1A5R A;  3QAQ A;  4IWP A;  1P1A A;  1V88 A;  4N9F 4;  3ZVV A;  2JUO A;  4Z2M B;  4X57 B;  3CXB B;  2KO3 A;  1V2Y A;  5JP4 A;  3UIP B;  4HB0 B;  2KTR A;  2K00 A;  3A4S C;  2Q13 A;  2WH5 A;  1WR1 A;  4B6W A;  3RUI B;  1WGH A;  4AWJ A;  1UBI A;  1XD3 B;  2IO3 B;  2WDT B;  2J59 M;  4AP4 C;  5DPW A;  2JZZ A;  1V5T A;  4W9C A;  2R2Q A;  4BKT A;  1GNU A;  3H1U A;  3DCG A;  4ANU A;  4GPT B;  5JHA A;  5C5B A;  4NAW A;  1WGQ A;  3U30 A;  3V61 A;  1E7U A;  4II2 B;  5D27 A;  2IY1 B;  2GS0 A;  2KX0 A;  2RD0 A;  2HD5 B;  2HTH A;  1E5W A;  1BT0 A;  2C7N B;  4K2P A;  1C1Y B;  3KUZ A;  2W2X D;  2N0Y A;  2DAF A;  2LZ6 A;  4HAT B;  4C0A A;  2G4D B;  4W9J A;  4M8N A;  4A6F B;  2Z0D B;  2MW5 A;  3H9D A;  1WMH A;  1UEL A;  5DHA B; 
#chains in the Genus database with same CATH topology
 2ZKM X;  1BML C;  1SF0 A;  3AE3 B;  2B3A A;  2QSD A;  3AE7 B;  4EEW A;  2ZVO A;  4CHJ A;  4C56 C;  2AWT A;  2O6V B;  4RF1 A;  2KJR A;  2DX5 A;  1JDE A;  5L81 A;  1R4M B;  3K9P B;  2CHX A;  1SB3 C;  4RGT A;  1JWA D;  1MIZ B;  3C8Y A;  4HKZ E;  2KUQ A;  3DHI C;  4ILH A;  1L4D B;  1JRO A;  3ODX A;  2DLW A;  3IBE A;  3AE2 B;  4HRO A;  1FB8 A;  1X86 A;  2INP E;  5J2R A;  4KDI C;  1I7H A;  2D2Q A;  3ZYY X;  2ZW0 A;  1FM0 D;  4JKF A;  1LQB A;  5L95 C;  1T3Q A;  2N7D A;  1UH6 A;  4BBK A;  1I35 A;  5LON B;  5G5H A;  1YN4 A;  4A55 A;  5IA7 A;  1M94 A;  3U7Z A;  1E8W A;  1Z2M A;  3FLV A;  1AW7 A;  4KGR A;  1ZXI A;  3TSS A;  3Q69 A;  4HAU B;  4C7Z A;  1ZDV A;  3R2T A;  2MA9 B;  1SE4 A;  1V61 A;  3UQB A;  1JAL A;  3NHE B;  3QA8 A;  4HK2 A;  3SUZ A;  5E6P A;  4GOU A;  3DQV A;  3L16 A;  2J0K A;  1UD7 A;  5GXG B;  2C60 A;  2YS5 A;  4IWQ A;  3R7Q A;  1P5T A;  2D9W A;  1NDD A;  2WP9 B;  2WLB A;  3ML9 A;  4K17 A;  2QDF A;  4G11 A;  4KHO A;  3B77 A;  3AE4 B;  3NWA A;  1WF9 A;  1WYG A;  4NSW A;  1WVH A;  1JCK B;  3UI3 A;  2JPH A;  1MPH A;  4UDU C;  1NVI D;  4MEM A;  3TFM A;  2JZP A;  3O65 B;  1P98 A;  3VUX A;  1SE2 A;  3RNA C;  3TCA A;  1WM2 A;  1VDV A;  2KFK B;  1B1Z A;  2R82 A;  3KUC B;  3AMZ A;  2K49 A;  1MIX A;  3A9J A;  1IGC A;  4LTU A;  2KAC A;  3DHG C;  4TSS A;  4W9F A;  3PLV A;  3GS2 A;  1CQV A;  2WX1 A;  2BPS A;  4IWO A;  1EGX A;  3Q8E A;  2M0X A;  2BF8 B;  2WWZ A;  4YT0 B;  4US9 A;  3W5U B;  2BT6 A;  3JSV B;  1KRH A;  4HHV A;  1CK1 A;  2N1W A;  2WHI A;  3RNF C;  3LXF A;  2L0F A;  3EGR A;  4MSQ B;  2GMI C;  1L0V B;  2WXI A;  2JRI B;  1GG3 A;  1UNQ A;  1FXT B;  2DZJ A;  3SHQ A;  2FCN A;  2OOB B;  4ILG B;  1UGJ A;  5D3W A;  3DHH C;  1YQB A;  3KLS X;  1X1G A;  2YT1 A;  5C2T B;  1KH0 A;  1WJM A;  1WYW B;  1QF6 A;  2K3U A;  1Y19 B;  3LJ3 A;  5D3D A;  2D9Z A;  1J0G A;  1YOV B;  1J19 A;  3PS6 A;  2NZ8 B;  1D6E C;  1HXY D;  2LGD A;  4ZOH C;  3VH3 B;  2CS4 A;  1UWX A;  1YN3 A;  1WE6 A;  2BCJ A;  4IC7 B;  2L2I A;  1UUP A;  3ZNG C;  1WRI A;  2BWE S;  3DBR B;  2FIF A;  2JVC A;  2D9V A;  4FA6 A;  3V6C B;  5GMV A;  1FGY A;  2LOX A;  1DBH A;  2VRW B;  1FNW A;  3N30 A;  5DPS A;  4G3X B;  4ZYS A;  1WZ0 A;  1WXS A;  2KC2 A;  1WG7 A;  2KFJ A;  5AZH A;  2IY0 B;  1EAZ A;  3CSF A;  3AN1 A;  1ESF A;  2J0M A;  2N7E A;  4NY0 A;  4FHJ A;  4WJN A;  2L32 A;  2LJI A;  5EDS A;  4DDG D;  3B0A A;  1FHO A;  2IGG A;  3NOB A;  1H10 A;  1HA5 A;  4JL9 A;  5E6O A;  5D6J B;  3KYD D;  3B08 A;  2O6V D;  3M1I B;  3QBV B;  1K5G B;  1TGZ B;  3OAW A;  1DOY A;  1BTN A;  1EUV B;  3WAL A;  3AEE B;  4KKI A;  1MK9 B;  2Z59 B;  4OZB A;  1GJZ A;  2N4F A;  3KQ4 A;  5C1Z A;  1N62 A;  2O6V A;  3LJU X;  2ZJD A;  1E8X A;  3ZTD A;  4MT7 A;  4K7W A;  2D3B A;  2KT7 A;  3B2F A;  1VR9 A;  3VRA B;  2MKR A;  1MI1 A;  3TO1 A;  3ENB A;  1WGK A;  4HRS A;  1V1P B;  4NJ6 A;  1SJE D;  4L23 A;  3TEX A;  2MQJ A;  4HEA 1;  4MDK E;  2MRP A;  1SHC A;  1MHX A;  3A58 A;  2YEP F;  2KGX B;  1D5X C;  1TTN A;  4GN1 A;  1WGY A;  1XLQ A;  1KZG A;  1I4P A;  3QHT A;  4CYE A;  4MSM B;  4WWN A;  3WA0 A;  4GMX B;  2Y3A A;  3RT3 B;  3SEB A;  4DQO C;  2Z13 A;  1E7P B;  1VZ8 A;  4GNK B;  4LNF A;  5FR6 A;  2FJ9 A;  2NBV B;  5BYS A;  2QC8 A;  5HFY A;  3TEW A;  2D9X A;  1NU2 A;  4WJQ A;  4BFR A;  1YX5 B;  5EE3 A;  3OAN A;  3T3N A;  1K52 A;  3KRX A;  4ZDV A;  1IYF A;  2IGH A;  3AE9 B;  4KIK B;  2JWZ A;  2LAS A;  1EU3 A;  3K9O B;  5D3I B;  4E3C A;  5HE1 A;  3MC8 A;  3WAN A;  3GYP A;  3PG7 A;  1M4V A;  2EEL A;  4K1R B;  4H2A A;  2C7H A;  2KFK A;  5FKA C;  2QJL A;  2GJY A;  3VTW A;  2NCN A;  2YT2 A;  4KKJ A;  2V76 A;  2PIA A;  4NZL B;  1FRD A;  1OGW A;  1LGR A;  2IO1 B;  2WXH A;  3QX1 A;  4K7S A;  3T9L A;  4AOF A;  3NZ3 A;  4K3B A;  4KZC A;  4GB9 A;  1F9J A;  4XZ4 A;  4WWP A;  3JSV A;  1RM6 C;  1SIJ A;  2NMB A;  2ABD A;  1ZKH A;  3RNE C;  1C4C A;  2FCQ A;  3PVW A;  2YS1 A;  1RYJ A;  2LGI A;  4CQN A;  3ALB A;  1V9J A;  1WGR A;  1I4H A;  3DVG X;  2NTT A;  2GCL A;  4EOY A;  3W9C B;  2NPT B;  1FXI A;  4ARI A;  4DHZ B;  1WX7 A;  1KTK A;  3Q8A A;  3HM3 A;  2PE6 B;  1I4R A;  2KOX A;  4JLC A;  2R09 A;  1BAK A;  5CHF A;  2ZNV C;  3M95 A;  5LLI A;  3RN9 C;  3P63 A;  2LBB A;  3N7C A;  2L7R A;  3DWM A;  2MJD A;  3VHT C;  3W5V B;  3FM8 C;  1QQR A;  4LNN A;  2RVB B;  3KH0 A;  1WH3 A;  4I6N B;  3P6A A;  3PZD A;  3QWM A;  4OHJ A;  4RMA A;  2MWN B;  2IO2 B;  4Z2N A;  1ZYI A;  4ZHP A;  1OTR B;  3KYC D;  5C6R A;  5J3T A;  1P7F A;  2RMM A;  2Z0E B;  2ADZ A;  2GBR A;  1PQS A;  3X23 A;  4LLG M;  1KC7 A;  4WH4 A;  1FCC C;  4B0M A;  3NY5 A;  2KTF A;  2N9K A;  2IO0 B;  1IPG A;  3L54 A;  2KN4 A;  2N9P C;  2V9H A;  5IN7 A;  1WXQ A;  2AQ2 B;  1WMH B;  4CO7 A;  4HAY B;  4BKG A;  2Z59 A;  2IYB A;  2BWF A;  3ZNH B;  1TKG A;  1TYG B;  2KDE B;  1M7E A;  3DBL B;  2DLB A;  1V5M A;  2MFQ A;  1WZ3 A;  3IT4 B;  4GGQ A;  4ICU A;  4PYZ A;  3E9L A;  1FAO A;  3KWV A;  2UVM A;  2LJ5 A;  4ILJ A;  2W3R A;  3SBG A;  3N9Y C;  4WVF B;  5J17 A;  3FSS A;  2BYT A;  2LRW A;  1Y8R C;  4B6H A;  2J7Q B;  2RDG A;  4WWM A;  1E6E B;  1NI2 A;  2BYV E;  1ZOY B;  4RH6 A;  5EE0 A;  3PP2 A;  2MCN B;  2V3P A;  2X8X X;  2V1Y A;  3MHS D;  3FP5 A;  2LOZ A;  5BYR A;  1WJU A;  1MVK A;  1ST7 A;  1I2H A;  3D8D A;  2LUE A;  3V6E B;  1J7C A;  4KVG B;  1NVL A;  2OJR A;  3BYY B;  1AYF A;  1ZC3 B;  1ZC4 B;  5FI1 A;  3NG0 A;  1XOD A;  4FJY A;  3SD5 A;  4F7G A;  2X38 A;  4CHK A;  4EJN A;  2FUG 1;  3SDL C;  3ZJT A;  4Q2J A;  4MGY E;  3SBT A;  1N60 A;  1MFW A;  2L1A A;  2Z0Q A;  3E56 A;  3V05 A;  3NSU A;  3OJ4 B;  4RM8 A;  2K22 A;  2KIG A;  2LUM A;  3S2A A;  2L76 A;  3H7P A;  4KIK A;  5GOW B;  1E90 A;  1VZ6 A;  1WX9 A;  3BK1 A;  2ZPN A;  2BS3 B;  4AQ7 A;  1TIF A;  1Y56 A;  5D2M B;  3RMK C;  2L52 A;  5C23 A;  2INN E;  2FAZ A;  2M0A A;  1WM3 A;  4TYZ A;  5G5G A;  3SFE B;  2COD A;  3ABV B;  1FFV A;  3NVZ A;  3W1S A;  3GE8 C;  4FXC A;  1U5G A;  1T0Y A;  4DBG A;  2ELB A;  3AB5 A;  1DIK A;  4KZ0 A;  2R0D A;  1FGZ A;  4ITK A;  1HB6 A;  1NTY A;  2P8V A;  4ZRQ A;  1C4P A;  3MJ5 A;  2LYD A;  1S3S G;  1OY2 A;  1I7A A;  1KBL A;  2FE8 A;  1MI0 A;  4XWX A;  3ODO A;  1T0R C;  1J7B A;  4HPM B;  2BW2 A;  1X11 A;  2D11 A;  4IM2 A;  2CRF A;  4MGZ E;  2KWU B;  3VOQ A;  2ON8 A;  2LI5 A;  2NPT A;  5I4D A;  1P3R A;  3ECI A;  3VQI A;  3JYU A;  1S1Q B;  2H7E A;  2GBJ A;  2A5U A;  3PO0 A;  2MBO A;  1CJE A;  2EC1 A;  2GRI A;  3DPD A;  4W9H A;  3ZIM A;  2LGY A;  3PRE A;  2I1J A;  1RWS A;  1SJH D;  5E6J A;  4S17 A;  4C80 A;  5HE3 A;  2RR9 A;  3T8M A;  1AWD A;  5D3Y A;  2Z8L A;  4AS1 A;  5I2M A;  2Y5P A;  2IND C;  1C78 A;  3DDC B;  1KFY B;  3MHZ A;  1SE3 A;  3ONS A;  3MC0 B;  4GMV A;  1YQ3 B;  2HDE A;  1V5U A;  3ZLZ A;  3V62 A;  3AEG B;  3U7D A;  3CWI A;  2L1C A;  5AUK A;  4D6W A;  4JK7 A;  4JPS A;  1KM7 A;  3I63 C;  5CLQ B;  1VJK A;  4PS8 A;  4KX6 B;  1V5O A;  3OWE B;  2EKE C;  4FJV B;  4GLS C;  1ZDX A;  1EVH A;  1OFF A;  1F77 A;  1CZP A;  3PT2 B;  1E10 A;  3HW2 B;  5HE2 A;  4QJ5 B;  2W2X C;  1K5D B;  1WXM A;  2RGF A;  3SV1 A;  2OQB A;  5EFX A;  2M8S A;  4DX9 0;  4DX8 A;  1K51 A;  1F1H A;  2C9W B;  2IJ0 A;  2L8J A;  1TS4 A;  5DPT A;  2XNA C;  2MBQ A;  3PSE B;  1TS3 A;  1GAQ B;  2LUL A;  5IJM A;  3PV1 A;  3GZN I;  4OVZ A;  4ANX A;  1FOE A;  4W9K A;  4NJC A;  2PVO D;  4C4V B;  3EA6 A;  4M0W A;  1RRP B;  2P0F A;  2LVQ A;  1V1O A;  2V0G A;  1DDW A;  4TV3 A;  3UIO B;  1WJ1 A;  1FEH A;  4PYU A;  4RGN A;  2PE9 A;  2DTC A;  3X0W A;  2M56 B;  3HSA A;  5DPR A;  1I4G A;  1H8C A;  1YD8 U;  2Z0O A;  4E74 A;  4WJO A;  1TZ1 A;  1Z87 A;  4MK0 A;  4LNO A;  2B76 B;  2IGD A;  2J42 A;  4YL8 A;  4CSQ A;  3DOW A;  1E9M A;  2J53 A;  4US8 A;  3KW5 B;  3IT6 B;  4GDK B;  1YNT E;  4CHM A;  3DVG Y;  1STE A;  3NVW A;  2YF0 A;  2KC1 A;  2QIL A;  2ZEQ A;  2PLP A;  4QJ3 B;  4PS3 A;  2DZI A;  3Q3O C;  2KMA A;  3ULB A;  4JKB A;  3AE8 B;  3URY A;  3P4R B;  2CY5 A;  1YX6 B;  4KDL B;  3PPA A;  3TVV A;  1D5M C;  3ZW3 A;  2WXO A;  1DYQ A;  1D3Z A;  1ZGU B;  2AX5 A;  5E6N A;  4WQO B;  1TY2 A;  3AE5 B;  2INC C;  2MJ3 A;  4TQ1 A;  2DHZ A;  3UZT A;  4XDD A;  2Z4D A;  1TQZ A;  5C3J B;  1K8R B;  2N23 A;  5FI0 A;  1KLV A;  2MLB A;  2MBH A;  5LXH A;  3NZU A;  1ZVR A;  1QOG A;  5FK9 C;  2WXK A;  2XK5 B;  4II3 B;  5HI1 A;  1UNS A;  3E66 A;  1ENF A;  3M3J A;  4EUT A;  4WJ7 A;  2W82 A;  1LXD A;  4DWF A;  3RYT A;  4RCO A;  1B55 A;  1OQN A;  5C16 A;  2L05 A;  4NNJ B;  1TS2 A;  1LW3 A;  2LEK A;  4BOS C;  4URK A;  2GBK A;  3UIN B;  5J3Q A;  4IOI E;  5D3V A;  2N9X A;  3GE3 C;  2IDY A;  3PRP B;  2ZPY A;  1YJ1 A;  3RZW C;  3SNH A;  2CU1 A;  3CIR B;  3ZRC A;  2A4Z A;  4LCD E;  2LWP A;  1WGD A;  3VTV A;  2K6D B;  4WJP A;  2NR2 A;  3BY4 B;  4HPL B;  5CX3 A;  1UEF A;  4ZRJ A;  1D5Z C;  3FVC A;  1PGA A;  3AED B;  5AUI A;  3NJT A;  3ZJV A;  5JHB A;  3UF8 A;  1FCL A;  1XD4 A;  4USA A;  2XN9 C;  4XWT A;  4MGK E;  1U27 A;  1ACA A;  4IM0 A;  2V4L A;  4MH0 E;  1J7A A;  3TL5 A;  4OSN A;  3VFK A;  2KLG A;  4IKG A;  1V5P A;  3PSC A;  5JLJ B;  3Q3F A;  3VIA A;  3ZO5 B;  1UBQ A;  3ZUN A;  1ROE A;  5TR5 A;  2DFK A;  1QIL A;  1SBB B;  4F7U P;  4DBB A;  1N5X A;  1OEY A;  4BBN C;  1HB8 A;  3PVL A;  3C19 A;  5CHV C;  2ELA A;  1LO5 D;  2LHD A;  2RRF A;  3OHM B;  1R4M I;  4EZJ A;  1N3H A;  1FHW A;  2LGX A;  3A33 B;  4TKN A;  2COA A;  3RD2 A;  4ANW A;  3FC4 A;  3QCA A;  3NUH B;  1FMA D;  4W9I A;  4OW0 A;  1D4B A;  3PEG A;  2D10 A;  2K6Q A;  4LK0 M;  3KRW A;  2BYE A;  2D3C A;  1XCT L;  2RPV A;  2WDQ B;  1KLU D;  1KI1 B;  2W55 A;  1RFA A;  4FUL A;  3ZXR A;  1JRP A;  4C4V A;  3Q8C A;  2Y8G A;  3VTU A;  4Y94 A;  4NQL B;  2K5P A;  3P42 A;  3TEZ A;  1WI0 A;  2XBB C;  3N3K B;  4KSL C;  4P16 A;  1ZXH A;  4HJG E;  3TUO A;  3V3X A;  2NTS A;  4JWU C;  1QOA A;  1VZ7 A;  1XO3 A;  2MBE A;  2ZCC A;  4L1B A;  2UU7 A;  1WXV A;  3LB8 C;  3WIM A;  3ODW A;  4GDL B;  4HB3 B;  2GCJ A;  4GDK A;  4WIP A;  3VUW A;  4LJO B;  2M1M A;  3F5R A;  2D5G A;  2QMT A;  4KSK C;  3Q6B A;  2JP2 A;  1WGG A;  1WJ4 A;  2PKO A;  2H88 B;  3AUL A;  3PVU A;  4HB2 B;  2N1V A;  2REX A;  5H8Y E;  3APF A;  1P3Q U;  1WIA A;  2V3S A;  2KQS A;  2JYE A;  2JWU A;  4A5K A;  5LNK 1;  1GOZ A;  3H7P B;  1YN5 A;  2J52 A;  1WY8 A;  2BS2 B;  1C79 A;  3QIJ A;  1XCG A;  2WNM A;  3MFG A;  3DBH B;  3LDZ E;  1JQ4 A;  5KHO A;  2DHJ A;  3HRD D;  2MHJ A;  2M17 A;  2AQ1 B;  3BYT B;  1SSN A;  1L6V A;  4MY6 A;  2PVG C;  2KK8 A;  1I4X A;  3ZNI D;  1T5X D;  4FN2 A;  5KCV A;  2XK5 A;  2OTX A;  3PRM B;  1LB1 A;  2MX2 A;  1VCB A;  2YT0 A;  4HCP B;  1YQ4 B;  2BYF A;  3ZDT A;  1E8Z A;  4WAF A;  1ZP0 B;  3VRB B;  2KX3 A;  1OEY J;  1DGJ A;  1MPE A;  2DEN B;  5DH9 B;  5BMI A;  3NZS A;  4K7U A;  1YJI A;  5IO9 A;  3A8Q A;  4TMA B;  1L4Z B;  2K8H A;  4JE3 B;  3BK2 A;  2UZR A;  4GSW A;  1WJ6 A;  2K2J A;  3UGB B;  3DXC A;  1MG8 A;  1GGO A;  3DBR I;  2IYD B;  3U8Z A;  2CJO A;  4I6P A;  1X05 A;  2XEW A;  2DX1 A;  4GZU A;  2ZVN A;  4XGA B;  2RDH A;  3UQA A;  3APC A;  3J9C A;  4MJS A;  3ULC A;  2FJU B;  5IOI A;  5JVL A;  1GB1 A;  1DDV A;  2LVP A;  2O2V B;  2M38 A;  5AZG A;  1SEB D;  3PTF C;  5D94 A;  2COF A;  3FKY A;  2I5C A;  3H8H A;  4DXA B;  2CKH B;  4JGH B;  2NS5 A;  3F0W A;  4R3D A;  3D32 A;  1XLP A;  1HZ6 A;  4XDC A;  2Y5B B;  2N0S B;  1MK7 B;  4ZRI A;  1WR6 E;  3MTN B;  4M02 A;  2MP2 B;  1MAI A;  4M01 A;  4L1R A;  3EHV A;  4DIX A;  3IXS A;  2CAY A;  4G50 A;  1UWM A;  4BKS D;  1PDX A;  4HB4 B;  2HJ8 A;  1OQY A;  1U5E A;  4HAW B;  1V86 A;  4HCN B;  2AL6 A;  2V3N A;  1HEZ E;  4HDO A;  3DXD A;  5HG2 A;  4IM3 A;  2DA0 A;  1RLF A;  3HK0 A;  4BKS A;  2EMS A;  1ZPS A;  1WRD B;  4IDI A;  1UNR A;  5LOP B;  4D0N B;  4HVB A;  4KGS A;  2ICI A;  5JZE B;  4EMO A;  1NI3 A;  1K53 A;  1RAX A;  3B9J A;  1PFD A;  3EUB 2;  3Q3M C;  5BMG A;  2QIE B;  3E9O A;  4W9E A;  2X18 A;  1F0Z A;  4A6K A;  2AEH A;  2XQN M;  2LFI A;  1QT9 A;  3N1Y C;  1XT9 B;  1TKE A;  4M00 A;  4M0W B;  2DYM A;  1WWT A;  3EC8 A;  1IBX A;  3U52 E;  2KQ7 A;  4ASW C;  2G9H D;  2PTL A;  1EO6 A;  3JW0 X;  1F52 A;  2UWQ A;  3VXW A;  4BAX A;  1HTO A;  4DK5 A;  4EFO A;  3L10 B;  4FBJ B;  1N61 A;  3AE1 B;  2C5L C;  5D3X A;  1DYN A;  5TSS A;  5J18 A;  4WAA A;  3EEC A;  1QC6 A;  3SU8 X;  4GDL A;  2DYN A;  1PFJ A;  3FIL A;  1B9R A;  4WSF A;  3R2I A;  3AEB B;  3NVV A;  1BWN A;  2K2U A;  1V81 A;  3CST A;  3GP7 A;  2DYO A;  2Y5C A;  4B95 A;  3E9S A;  3MC9 A;  1FFU A;  2KAJ A;  4YWG G;  2JQR B;  3D8E A;  2P0D A;  1W1G A;  2JZ3 B;  3P4P B;  2KNB A;  3APD A;  4HWI B;  2ZCB A;  1QOF A;  2NVU I;  3BIN A;  2MH7 A;  3TIX A;  2FUH B;  1N5W A;  4DHJ D;  2MJE A;  3ML8 A;  1HZ5 A;  5KQ4 A;  4YSZ B;  4O1N A;  4PNK A;  3Q3N C;  5M4Y B;  1NYQ A;  3M63 B;  1XCQ L;  1X1M A;  4A20 A;  5JHG A;  3AV8 A;  2K39 A;  2K8B A;  2RNR B;  1OQQ A;  2FJL A;  3U2S C;  4JWS C;  2VRR B;  2EMT A;  1N6Z A;  3DCX A;  2KIE A;  3PHX B;  4G0N B;  3AU5 A;  1ET6 A;  4HAV B;  1FPY A;  2GBM A;  3VVW B;  1KJT A;  2I38 A;  2JT4 B;  1J0W A;  1JRU A;  4JKH A;  4XC2 A;  1PLS A;  5CLL B;  4AJY B;  3B2G A;  4NPN A;  4LNK A;  1PUT A;  4C7Y A;  2DKP A;  1XQQ A;  1T0S C;  2KDF B;  1OQR A;  4DXG A;  1PGB A;  1WX8 A;  4N6E B;  4PS7 A;  1Q67 A;  1G6J A;  1GC6 A;  1TBE A;  1YIW A;  3ZDM C;  1HBK A;  1VBG A;  2BKR B;  2LHE A;  4MM3 B;  4ZYN A;  2L00 B;  1EF1 A;  1FNV A;  1XEE A;  4QAY A;  2CJN A;  3BVM A;  3I3T B;  3DBS A;  2K1F A;  4A9A A;  3AEA B;  2GBN A;  1QZE A;  2K8C A;  1UNP A;  1VLB A;  2G3Q B;  2ZW1 A;  2UYZ B;  5EE1 A;  4HSI A;  2O2V A;  2NBU A;  1C4A A;  4W9D A;  2LRU A;  3VR9 B;  3N32 A;  2PMV A;  2PPH A;  4B0E A;  4PQ0 A;  3ZNZ B;  2KZR A;  2D4Q A;  1XR0 B;  2COP A;  4JX1 C;  4REZ A;  2WXF A;  4PT5 A;  2MP2 A;  3HM6 X;  3ZXV A;  5DHF B;  1UF0 A;  4DXF A;  1TT5 B;  1PYW D;  3OG5 A;  3AE6 B;  1U4A A;  1VRA B;  2M4N A;  3P4Q B;  5LXI B;  2DYB A;  2BB6 A;  3NVY A;  1WJN A;  1XXG A;  2KYW A;  3IAS 1;  1DOI A;  1C9F A;  3DBL I;  2MBB B;  4GOC A;  3RNC C;  2DKQ A;  3U4E G;  4K81 A;  3A1Q B;  1BUI C;  3CMM B;  3IFW B;  5DI9 B;  2WGS A;  2KWV B;  3DVN V;  2LD9 A;  2R61 A;  3VDZ A;  3BVG A;  1Z5S B;  1IUE A;  2IFS A;  3U12 A;  2G45 B;  1L7Y A;  3DWG C;  4JKC A;  3HHM A;  1V49 A;  2RQ1 A;  3LYY A;  3EPY A;  4LNI A;  4F8C B;  1FXA A;  4F1S A;  4LDT B;  2RLO A;  1QQG A;  1WXA A;  4MGI E;  1VBH A;  3TMP B;  2YSZ A;  2PEA A;  1TJ6 A;  4A90 A;  1F2R I;  3WAO A;  3GOE A;  1FHX A;  2WXP A;  4NQK E;  4WQM A;  5CHW A;  1KZ7 A;  2KUP A;  1RFK A;  3CF6 E;  2AQ3 B;  3C0R B;  4RM9 A;  2RSG A;  1DDM A;  1IRS A;  1F2R C;  1WGU A;  2IPK D;  3EFC A;  2FID A;  4HKQ A;  5BYQ A;  1ZM0 A;  3QJZ A;  1GC7 A;  3B1L X;  1NEN B;  4K3C A;  1WFY A;  4W9L A;  4L6E A;  4A3P A;  4S0R A;  3ZRF A;  5HHD G;  2RGN B;  3SFD B;  1U5F A;  5D7G A;  2KKC A;  3I5J C;  4YTN B;  4TQ0 A;  3N20 C;  1XLO A;  1ET9 A;  3Q8F A;  1HE8 A;  5CTR C;  2ACZ B;  1BXT A;  3HQC A;  3ZQ4 A;  2M14 A;  1T6B X;  2HRJ A;  2CY4 A;  1RJ2 A;  1QOB A;  2DZM A;  2VH1 A;  2J0J A;  1YJJ A;  4B9K A;  2DN6 A;  4EKU A;  4MEL A;  4KHB A;  1ZSQ A;  3ZJU A;  5BMH A;  4FAD A;  2QKL A;  3A8P A;  1ZW7 A;  3BZD B;  1MJD A;  2W9N A;  3AI5 A;  1FO4 A;  5DIF B;  1L5P A;  4XWW A;  1HQR D;  3L08 A;  1T0Q C;  1R4N I;  2KMC A;  2N9L A;  2GUM A;  2DWQ A;  2LMC A;  4XX5 A;  3RUL A;  3N1X C;  2YRY A;  3P2B A;  3MDB C;  2ASQ A;  2C7M B;  3HIE A;  2W54 A;  2IBI B;  5G2N A;  2GLS A;  4HJK A;  1DRO A;  4MM3 A;  1ZE3 D;  2KWC A;  3MPX A;  3PZ8 A;  4RNA A;  2KR0 A;  4F7H A;  1K50 A;  1U5D A;  2DIK A;  4ZRK A;  2WX0 A;  4OT1 A;  3HUI A;  1NTV A;  1TKY A;  2L3Z A;  1IP9 A;  3Q3J A;  1TJE A;  1JWM D;  1L2N A;  2Y7B A;  1UPR A;  4HAZ B;  1TS5 A;  1WE7 A;  1Q10 A;  2N9E B;  3R3M A;  4MJS B;  2MSE D;  1P9D U;  2JF5 A;  2LXA A;  2QKM A;  4DHZ E;  3PHW B;  3KWL A;  2HE7 A;  1MKE A;  4P1C C;  3KSY A;  2I2Y A;  4A6H A;  1VD2 A;  3H6N A;  3BII D;  4PK1 A;  2GB1 A;  2LGS A;  2P0H A;  2ZNV B;  2I5F A;  4EZL A;  1V6E A;  2W2W A;  2KWD A;  2KCJ A;  2SEB D;  3I9V 1;  4AUQ C;  1JW9 D;  4HDQ A;  4TUU A;  1EF5 A;  2QCZ A;  1A70 A;  2RUK B;  3BWU D;  2WU5 B;  2OED A;  3RZF A;  2ONQ A;  2WXR A;  2L0T A;  3AJ4 A;  3M62 B;  3NS1 A;  4A6Q A;  2V4I B;  1JWS D;  3WYF B;  5JHH A;  3T3O A;  2FNJ B;  3ZGZ A;  4YTM B;  3A1Q A;  1PMS A;  5MPO A;  3A98 B;  3H7S A;  1Q5W B;  2WXQ A;  4IFS A;  4LDT D;  1W1D A;  1AQC A;  3W2D A;  3W1Y A;  3FEH A;  3JVZ X;  1WSP A;  4JQW C;  1WI1 A;  3G9W A;  4A6F A;  2KHW B;  1CMX B;  1H4R A;  4IAP A;  4AJW A;  3N1Z C;  1L6U A;  3SO6 A;  3D8F A;  2E3T A;  1IBX B;  3QAR A;  1Y5O A;  2K25 A;  1ISN A;  2BBC A;  3AM9 A;  3OJ3 A;  1SIF A;  4JKD A;  1AWE A;  2WXJ A;  2H7D A;  3DXE A;  4ICV A;  2WYQ A;  3IHP C;  2AL3 A;  1FD6 A;  3Q2A C;  3L0W B;  1AN8 A;  1RRB A;  3RNG C;  5IP4 D;  3VUY A;  3IVF A;  1AAR A;  3FIL B;  3VH4 B;  2CHW A;  2KLC A;  3ZTC A;  1JWU D;  2L83 A;  2DZK A;  1FIQ A;  4RGO S;  5EE9 A;  3A9K B;  2VSZ A;  2R2O A;  1XF5 L;  3ETR A;  4ZHO A;  3T06 A;  4K2O A;  1SXT A;  2GOW A;  1E7V A;  3BVZ A;  1DOX A;  3DVN U;  2FCS A;  3BJI A;  4MT5 A;  1U2B A;  1JWB D;  1GUA B;  1LM8 B;  4E71 A;  1I42 A;  1M7R A;  3AEF B;  3V60 A;  2BKF A;  4MH8 A;  5G55 A;  1NYR A;  1V97 A;  3GYO A;  1OMW A;  4WWO A;  4HPP A;  3RNB C;  2DYQ A;  3E9P A;  1W1H A;  2G1E A;  4DHJ B;  4YON A;  3OLM D;  3ZVR A;  2RDB C;  3Q8B A;  2WXG A;  3QQ8 B;  1I4Q A;  4KV2 A;  1QKZ A;  4JIO U;  1HTQ A;  4GXB A;  2DHI A;  2WXM A;  5DCN A;  2AYO B;  5AEK B;  1GPX A;  4F7Z A;  2QHO A;  4EZK A;  4OVV A;  2RSU A;  2VZK B;  2NMQ A;  1KF6 B;  1V89 A;  2J4X A;  2D9Y A;  1R7S A;  3AXC A;  4KHA A;  2DHK A;  3ZKJ C;  5KQ1 A;  2CU3 A;  3PRZ A;  3PGE A;  4NJ7 A;  2CR5 A;  5JH5 C;  3P1M A;  3PZ7 A;  4IW0 A;  3TW1 A;  1KOT A;  1P7E A;  5J3Y A;  3KZ1 A;  2N7J A;  2MEK A;  4P6V F;  5IAA C;  2JRH A;  4H8S A;  3QC8 B;  3NS8 A;  2JY6 A;  1NTI A;  3NW8 A;  2OJW A;  5C79 A;  4P1B C;  4HXD A;  2RPQ A;  4DDI D;  2KTR B;  3FAH A;  4XE0 A;  2MWS B;  2E6X A;  4KAX B;  4GIV A;  2IZV B;  2BQQ A;  2LG1 A;  3AEC B;  1JML A;  4IUM B;  2LVO A;  2HJ1 A;  1BTK A;  1TXD A;  3WAM A;  5H92 C;  4IOY X;  3RPF C;  1U29 A;  2KQ4 X;  1UZX B;  3IG3 A;  2UZS A;  4M8M A;  5C5B B;  4NAW B;  3HVD A;  1V80 A;  2WDR B;  3O96 A;  1N63 A;  2KXJ A;  3HVZ A;  1X1F A;  5LG4 B;  3VR8 B;  3R8B A;  4FLH A;  2CHZ A;  2KDI A;  4EE2 A;  5I2S A;  2JX5 A;  2ROZ B;  2WDV B;  1C77 A;  5FR3 A;  2G35 A;  2HTH B;  3P4S B;  2KN5 A;  4I6L B;  3KY9 A;  2D3G A;  2K0P A;  2JXX A;  2DNF A;  5IRS A;  3WCQ A;  5AZF A;  4RF0 A;  1FNU A;  2D07 B;  1Q1O A;  4OVU A;  2KDB A;  4BVU C;  3AU4 A;  1MG4 A;  2M19 A;  3R66 C;  4MAC A;  2K9X A;  2VH2 A;  3MP9 A;  2FDQ A;  1L0X B;  2YEP B;  3HIZ A;  4JKG B;  1KLG D;  4WUR A;  3R7R A;  2EJ8 A;  2KVR A;  1TY0 A;  1P6S A;  2X0S A;  2CQU A;  4ARC A;  2ROV A;  1NEK B;  2YVC A;  2DBY A;  2DAJ A;  2DX5 B;  4BOZ B;  2LXC A;  2Z14 A;  1L0Y B;  3KVF B;  1LFD A;  1C3T A;  5L83 A;  2WXL A;  3TBL D;  3NWD A;  2Y8F A;  3QK0 A;  4GU2 A;  1J8C A;  4BZA A;  2KJH B;  1SGH A;  1EU4 A;  1V1P A;  1Q0W B;  4P7I A;  3GZN B;  2Q5W D;  1SE9 A;  4BBN F;  3A9K A;  2YS3 A;  3EFU A;  2BGF A;  4QXA B;  4N58 A;  3VAW A;  2BS4 B;  3PLU A;  2KJ6 A;  3DBH I;  2G4S A;  4NAM A;  2WS3 B;  4J6I A;  5BO4 B;  2JU6 X;  4QJ4 B;  5IKC M;  3KUD B;  4YSY B;  4YSX B;  2E2X A;  4LJP B;  3ML4 A;  2BTE A;  3V5W A;  4N59 A;  3RCP A;  3CIK A;  4HLE A;  2NBW B;  1XX0 A;  1ACC A;  2NBV A;  5HE0 A;  2I1K A;  3SYX A;  1XKE A;  4A3O A;  3L17 A;  2YLM A;  4C00 A;  2PJH A;  3AH7 A;  3NRZ A;  3W1S C;  4ACF A;  3A4R A;  3P7Z A;  3NWF A;  5KHQ A;  4JKE A;  1UPQ A;  2Z0P A;  2MDX A;  2VZK D;  4ZRP A;  4KHB B;  3MJW A;  3TEY A;  4JK9 A;  1T77 A;  1EM7 A;  4YXD B;  2W3S A;  2EKI A;  4RFB A;  1P0R A;  4HAX B;  2KAN A;  3A9J B;  1NBF C;  1ZUD 2;  2KMM A;  1E0Z A;  2BVC A;  5JXV A;  2COC A;  1XLN A;  2CB8 A;  2WU2 B;  5HKH A;  3QWZ B;  2TSS A;  1QLB B;  1UGM A;  1E8Y A;  5T8I A;  2KD0 A;  4FHK A;  2LKO A;  3TJP A;  3L13 A;  3RCZ A;  1FRR A;  3ENE A;  2ZZP B;  3WAP A;  4FJZ A;  2PZ1 A;  2FCM A;  4J3O D;  1EWY C;  4ANV A;  4W9G A;  2VKI A;  3IAM 1;  4IG7 B;  1A5R A;  2H89 B;  3QAQ A;  4IWP A;  1P1A A;  2BB5 A;  1V88 A;  1C76 A;  4N9F 4;  3ZVV A;  2KVZ A;  2JUO A;  4Z2M B;  4OZC A;  3I57 A;  4X57 B;  3CXB B;  2KO3 A;  1V2Y A;  2R2Y A;  1GB4 A;  3L4P A;  5JP4 A;  4OZA A;  3RFZ B;  3UIP B;  4HB0 B;  2KTR A;  2K00 A;  3A4S C;  4JK8 A;  2Q13 A;  2WH5 A;  1WR1 A;  1R4N B;  4B6W A;  1WGH A;  3RUI B;  2WQY B;  1UBI A;  4AWJ A;  2WXN A;  1XD3 B;  1TZO A;  2IO3 B;  2WDT B;  2J59 M;  2JSV X;  4AP4 C;  4YTP B;  5DPW A;  2JZZ A;  1V5T A;  4W9C A;  4KGT A;  2R2Q A;  4BKT A;  4L2Y A;  1GNU A;  3H1U A;  3DCG A;  2JXT A;  4ANU A;  3GB1 A;  4XYC A;  4GPT B;  5JHA A;  2K8E A;  5C5B A;  4NAW A;  1WGQ A;  1MHH E;  3U30 A;  3V61 A;  1E7U A;  1IGD A;  3RI7 C;  4II2 B;  5D27 A;  2IY1 B;  2KDM A;  2GS0 A;  4RGM A;  1PGX A;  2KX0 A;  2RD0 A;  2HD5 B;  2HTM E;  2HTH A;  4A8X C;  1E5W A;  1BT0 A;  2C7N B;  3Q14 C;  4K2P A;  1C1Y B;  3KUZ A;  2D3A A;  2SAK A;  2W2X D;  2QEJ C;  3O13 A;  2N0Y A;  2DAF A;  2GI9 A;  4JKA A;  2JYT A;  2LZ6 A;  4HAT B;  4C0A A;  2G4D B;  4W9J A;  1V8C A;  3SR6 A;  1YMH E;  4M8N A;  4A6F B;  2Z0D B;  2MW5 A;  2OHF A;  3H9D A;  4D2K A;  2FBW B;  4JKG A;  2PW9 A;  1WMH A;  1EWC A;  1UEL A;  5DHA B; 
#chains in the Genus database with same CATH homology
 2B3A A;  4EEW A;  2ZVO A;  4CHJ A;  2AWT A;  2O6V B;  2KJR A;  2DX5 A;  1JDE A;  5L81 A;  3K9P B;  2CHX A;  1MIZ B;  4ILH A;  3ODX A;  2DLW A;  3IBE A;  1FB8 A;  1X86 A;  5J2R A;  4KDI C;  2D2Q A;  4JKF A;  1LQB A;  5L95 C;  2N7D A;  1UH6 A;  4BBK A;  1I35 A;  5LON B;  5IA7 A;  1M94 A;  1E8W A;  1Z2M A;  3FLV A;  4HAU B;  2MA9 B;  3UQB A;  1V61 A;  3NHE B;  3QA8 A;  4HK2 A;  3SUZ A;  5E6P A;  3DQV A;  3L16 A;  2J0K A;  1UD7 A;  2C60 A;  2YS5 A;  4IWQ A;  3R7Q A;  1P5T A;  2D9W A;  1NDD A;  3ML9 A;  4K17 A;  4G11 A;  4KHO A;  1WF9 A;  4NSW A;  1WVH A;  2JPH A;  1MPH A;  4MEM A;  3TFM A;  3O65 B;  1P98 A;  3VUX A;  3TCA A;  1WM2 A;  2KFK B;  2R82 A;  3KUC B;  1MIX A;  3A9J A;  4W9F A;  3PLV A;  2WX1 A;  2BPS A;  4IWO A;  1EGX A;  2M0X A;  2BF8 B;  2WWZ A;  3JSV B;  4HHV A;  2N1W A;  2L0F A;  4MSQ B;  2GMI C;  2JRI B;  1GG3 A;  1UNQ A;  1FXT B;  2DZJ A;  3SHQ A;  2FCN A;  2OOB B;  4ILG B;  5D3W A;  1YQB A;  1X1G A;  2YT1 A;  1WJM A;  1WYW B;  1Y19 B;  3LJ3 A;  2D9Z A;  1J0G A;  1J19 A;  3PS6 A;  2NZ8 B;  2LGD A;  3VH3 B;  2CS4 A;  1WE6 A;  2BCJ A;  4IC7 B;  2L2I A;  3ZNG C;  2BWE S;  2FIF A;  2JVC A;  2D9V A;  4FA6 A;  3V6C B;  5GMV A;  1FGY A;  2LOX A;  1DBH A;  2VRW B;  3N30 A;  5DPS A;  4G3X B;  1WZ0 A;  1WXS A;  2KC2 A;  1WG7 A;  2KFJ A;  5AZH A;  2IY0 B;  1EAZ A;  3CSF A;  2J0M A;  2N7E A;  4NY0 A;  4FHJ A;  4WJN A;  5EDS A;  4DDG D;  3B0A A;  1FHO A;  3NOB A;  1H10 A;  4JL9 A;  5E6O A;  5D6J B;  3KYD D;  3B08 A;  2O6V D;  3M1I B;  3QBV B;  1K5G B;  1TGZ B;  3OAW A;  1BTN A;  1EUV B;  3WAL A;  1MK9 B;  2Z59 B;  1GJZ A;  2N4F A;  5C1Z A;  2O6V A;  3LJU X;  2ZJD A;  1E8X A;  3ZTD A;  4MT7 A;  4K7W A;  2MKR A;  3TO1 A;  3ENB A;  4NJ6 A;  2MQJ A;  4MDK E;  2MRP A;  1SHC A;  2KGX B;  1TTN A;  4GN1 A;  1WGY A;  1KZG A;  3QHT A;  4CYE A;  4MSM B;  4WWN A;  3WA0 A;  4GMX B;  3RT3 B;  5FR6 A;  2FJ9 A;  2NBV B;  2D9X A;  1NU2 A;  4WJQ A;  4BFR A;  1YX5 B;  3OAN A;  1IYF A;  3KRX A;  4ZDV A;  4KIK B;  2JWZ A;  2LAS A;  3K9O B;  4E3C A;  5HE1 A;  3WAN A;  3GYP A;  3PG7 A;  4K1R B;  2C7H A;  2KFK A;  2GJY A;  3VTW A;  2NCN A;  2V76 A;  1OGW A;  2IO1 B;  3QX1 A;  4K7S A;  3T9L A;  4AOF A;  4KZC A;  4GB9 A;  1F9J A;  4XZ4 A;  4WWP A;  3JSV A;  2NMB A;  2ABD A;  1ZKH A;  2FCQ A;  3PVW A;  2YS1 A;  3ALB A;  1V9J A;  1WGR A;  3DVG X;  2GCL A;  4EOY A;  2NPT B;  4DHZ B;  1WX7 A;  3HM3 A;  2PE6 B;  2KOX A;  4JLC A;  2R09 A;  1BAK A;  5CHF A;  2ZNV C;  3M95 A;  5LLI A;  2LBB A;  3N7C A;  2L7R A;  3VHT C;  3FM8 C;  2RVB B;  3KH0 A;  1WH3 A;  4I6N B;  3P6A A;  3PZD A;  3QWM A;  4RMA A;  2MWN B;  2IO2 B;  4Z2N A;  1OTR B;  3KYC D;  5C6R A;  5J3T A;  2Z0E B;  2ADZ A;  2GBR A;  1PQS A;  3X23 A;  1KC7 A;  3NY5 A;  2KTF A;  2IO0 B;  1IPG A;  3L54 A;  2N9P C;  1WMH B;  4CO7 A;  4HAY B;  4BKG A;  2IYB A;  2BWF A;  3ZNH B;  2KDE B;  1M7E A;  1V5M A;  2MFQ A;  1WZ3 A;  4GGQ A;  4ICU A;  4PYZ A;  3E9L A;  1FAO A;  2UVM A;  2LJ5 A;  4ILJ A;  3SBG A;  4WVF B;  5J17 A;  3FSS A;  2LRW A;  1Y8R C;  4B6H A;  2J7Q B;  1NI2 A;  2BYV E;  3PP2 A;  2MCN B;  2V1Y A;  3MHS D;  3FP5 A;  2LOZ A;  1WJU A;  1ST7 A;  1I2H A;  3D8D A;  2LUE A;  3V6E B;  4KVG B;  1NVL A;  2OJR A;  1ZC3 B;  1ZC4 B;  5FI1 A;  1XOD A;  4FJY A;  3SD5 A;  4F7G A;  4CHK A;  4EJN A;  3SDL C;  4MGY E;  3SBT A;  2Z0Q A;  3NSU A;  3OJ4 B;  4RM8 A;  3S2A A;  2L76 A;  3H7P A;  4KIK A;  5GOW B;  1E90 A;  1WX9 A;  2ZPN A;  5D2M B;  5C23 A;  2FAZ A;  1WM3 A;  4TYZ A;  2COD A;  3W1S A;  1U5G A;  1T0Y A;  4DBG A;  2ELB A;  1DIK A;  4KZ0 A;  2R0D A;  1FGZ A;  1HB6 A;  1NTY A;  2P8V A;  2LYD A;  1S3S G;  1OY2 A;  1I7A A;  1KBL A;  4XWX A;  3ODO A;  4HPM B;  1X11 A;  2D11 A;  4IM2 A;  2CRF A;  4MGZ E;  2KWU B;  3VOQ A;  2LI5 A;  2NPT A;  1P3R A;  3ECI A;  3VQI A;  3JYU A;  1S1Q B;  2H7E A;  2GBJ A;  2A5U A;  2MBO A;  2EC1 A;  3DPD A;  4W9H A;  3ZIM A;  2LGY A;  3PRE A;  2I1J A;  5HE3 A;  2RR9 A;  3T8M A;  5D3Y A;  3DDC B;  3ONS A;  4GMV A;  1V5U A;  3ZLZ A;  3V62 A;  3U7D A;  2L1C A;  4JK7 A;  1KM7 A;  5CLQ B;  4PS8 A;  1V5O A;  2EKE C;  4FJV B;  1EVH A;  3PT2 B;  3HW2 B;  5HE2 A;  2W2X C;  1K5D B;  1WXM A;  2RGF A;  3SV1 A;  2OQB A;  5EFX A;  2M8S A;  4DX9 0;  4DX8 A;  2C9W B;  2L8J A;  5DPT A;  2MBQ A;  3PSE B;  2LUL A;  5IJM A;  3PV1 A;  3GZN I;  4ANX A;  1FOE A;  4W9K A;  1RRP B;  2P0F A;  2LVQ A;  1DDW A;  4TV3 A;  3UIO B;  1WJ1 A;  4PYU A;  2PE9 A;  2DTC A;  3X0W A;  5DPR A;  1H8C A;  1YD8 U;  2Z0O A;  4E74 A;  4WJO A;  1TZ1 A;  1Z87 A;  4MK0 A;  4YL8 A;  3DOW A;  3KW5 B;  4GDK B;  4CHM A;  3DVG Y;  2YF0 A;  2KC1 A;  2ZEQ A;  4PS3 A;  2DZI A;  2KMA A;  3ULB A;  4JKB A;  2CY5 A;  1YX6 B;  4KDL B;  3PPA A;  3TVV A;  3ZW3 A;  1D3Z A;  1ZGU B;  5E6N A;  4WQO B;  4TQ1 A;  2DHZ A;  3UZT A;  1TQZ A;  1K8R B;  2N23 A;  5FI0 A;  1KLV A;  2MLB A;  2MBH A;  5LXH A;  3NZU A;  1ZVR A;  2XK5 B;  4II3 B;  3E66 A;  3M3J A;  4EUT A;  4WJ7 A;  1LXD A;  4DWF A;  3RYT A;  1B55 A;  1OQN A;  5C16 A;  2L05 A;  4NNJ B;  1LW3 A;  4BOS C;  4URK A;  2GBK A;  3UIN B;  5J3Q A;  5D3V A;  2N9X A;  3PRP B;  2ZPY A;  1YJ1 A;  3RZW C;  3SNH A;  2CU1 A;  3ZRC A;  2A4Z A;  4LCD E;  2LWP A;  1WGD A;  3VTV A;  2K6D B;  4WJP A;  2NR2 A;  3BY4 B;  4HPL B;  5CX3 A;  1UEF A;  4ZRJ A;  5JHB A;  3UF8 A;  1XD4 A;  4MGK E;  1U27 A;  1ACA A;  4IM0 A;  2V4L A;  4MH0 E;  3TL5 A;  3VFK A;  2KLG A;  1V5P A;  3PSC A;  5JLJ B;  3Q3F A;  3VIA A;  3ZO5 B;  1UBQ A;  3ZUN A;  5TR5 A;  2DFK A;  4F7U P;  4DBB A;  1OEY A;  4BBN C;  1HB8 A;  3PVL A;  5CHV C;  2ELA A;  4EZJ A;  1R4M I;  1N3H A;  1FHW A;  2LGX A;  3A33 B;  4TKN A;  2COA A;  3RD2 A;  4ANW A;  3QCA A;  4W9I A;  3PEG A;  2D10 A;  2K6Q A;  3KRW A;  2BYE A;  1KI1 B;  1RFA A;  4FUL A;  2Y8G A;  3VTU A;  4Y94 A;  4NQL B;  1WI0 A;  2XBB C;  3N3K B;  4KSL C;  2MBE A;  2ZCC A;  1WXV A;  3WIM A;  3ODW A;  4GDL B;  4HB3 B;  2GCJ A;  4GDK A;  3VUW A;  4LJO B;  2M1M A;  3F5R A;  4KSK C;  2JP2 A;  1WGG A;  1WJ4 A;  3AUL A;  3PVU A;  4HB2 B;  2N1V A;  2REX A;  3APF A;  1P3Q U;  1WIA A;  2V3S A;  2KQS A;  4A5K A;  3H7P B;  1WY8 A;  3QIJ A;  1XCG A;  3LDZ E;  5KHO A;  2DHJ A;  2M17 A;  4MY6 A;  2KK8 A;  3ZNI D;  4FN2 A;  5KCV A;  2XK5 A;  2OTX A;  3PRM B;  1LB1 A;  2MX2 A;  1VCB A;  2YT0 A;  4HCP B;  2BYF A;  3ZDT A;  1E8Z A;  2KX3 A;  1OEY J;  2DEN B;  5DH9 B;  3NZS A;  4K7U A;  3A8Q A;  2K8H A;  2UZR A;  4GSW A;  1WJ6 A;  2K2J A;  3UGB B;  3DXC A;  1MG8 A;  1GGO A;  3DBR I;  2IYD B;  3U8Z A;  4I6P A;  1X05 A;  2XEW A;  2DX1 A;  4GZU A;  2ZVN A;  3UQA A;  3APC A;  4MJS A;  3ULC A;  5JVL A;  1DDV A;  2LVP A;  2O2V B;  2M38 A;  5AZG A;  3PTF C;  5D94 A;  2COF A;  2I5C A;  4DXA B;  2CKH B;  4JGH B;  2NS5 A;  3F0W A;  3D32 A;  2Y5B B;  1MK7 B;  4ZRI A;  1WR6 E;  3MTN B;  2MP2 B;  1MAI A;  3EHV A;  2CAY A;  4G50 A;  4BKS D;  4HB4 B;  2HJ8 A;  1OQY A;  1U5E A;  4HAW B;  1V86 A;  4HCN B;  2AL6 A;  4HDO A;  3DXD A;  4IM3 A;  2DA0 A;  1RLF A;  3HK0 A;  4BKS A;  2EMS A;  1WRD B;  1UNR A;  5LOP B;  4D0N B;  4HVB A;  5JZE B;  4EMO A;  1RAX A;  3E9O A;  4W9E A;  2X18 A;  4A6K A;  2AEH A;  2XQN M;  1XT9 B;  4M0W B;  2DYM A;  3EC8 A;  2KQ7 A;  4ASW C;  3JW0 X;  1EO6 A;  2UWQ A;  3VXW A;  4DK5 A;  4EFO A;  3L10 B;  4FBJ B;  2C5L C;  5D3X A;  1DYN A;  5J18 A;  4WAA A;  3EEC A;  1QC6 A;  3SU8 X;  4GDL A;  2DYN A;  1PFJ A;  4WSF A;  1BWN A;  2K2U A;  1V81 A;  3CST A;  2DYO A;  4B95 A;  3D8E A;  2P0D A;  1W1G A;  2JZ3 B;  2KNB A;  3APD A;  4HWI B;  2ZCB A;  2NVU I;  3BIN A;  3TIX A;  2FUH B;  4DHJ D;  3ML8 A;  5KQ4 A;  4PNK A;  3M63 B;  1X1M A;  4A20 A;  5JHG A;  2K39 A;  2K8B A;  2RNR B;  2FJL A;  2VRR B;  2EMT A;  3PHX B;  4G0N B;  3AU5 A;  4HAV B;  2GBM A;  3VVW B;  1KJT A;  2JT4 B;  1J0W A;  1JRU A;  4JKH A;  4XC2 A;  1PLS A;  5CLL B;  4AJY B;  4NPN A;  2DKP A;  1XQQ A;  2KDF B;  1WX8 A;  4PS7 A;  1Q67 A;  1G6J A;  1GC6 A;  1TBE A;  1YIW A;  3ZDM C;  1HBK A;  1VBG A;  2BKR B;  4ZYN A;  2L00 B;  1EF1 A;  3I3T B;  3DBS A;  2K1F A;  2GBN A;  1QZE A;  2K8C A;  1UNP A;  2G3Q B;  2UYZ B;  2O2V A;  2NBU A;  4W9D A;  2LRU A;  3N32 A;  2PPH A;  4PQ0 A;  3ZNZ B;  2KZR A;  2D4Q A;  1XR0 B;  2COP A;  2MP2 A;  3HM6 X;  5DHF B;  1U4A A;  2M4N A;  5LXI B;  2DYB A;  1WJN A;  3DBL I;  2MBB B;  4GOC A;  2DKQ A;  4K81 A;  3A1Q B;  3CMM B;  3IFW B;  5DI9 B;  2KWV B;  3DVN V;  2LD9 A;  3VDZ A;  1Z5S B;  2IFS A;  2G45 B;  1L7Y A;  4JKC A;  3HHM A;  1V49 A;  2RQ1 A;  4F8C B;  3EPY A;  4F1S A;  4LDT B;  2RLO A;  1QQG A;  1WXA A;  4MGI E;  1VBH A;  3TMP B;  2YSZ A;  2PEA A;  1TJ6 A;  3WAO A;  3GOE A;  1FHX A;  4NQK E;  5CHW A;  1KZ7 A;  2KUP A;  3CF6 E;  3C0R B;  4RM9 A;  2RSG A;  1DDM A;  1IRS A;  1WGU A;  2FID A;  1ZM0 A;  3QJZ A;  1GC7 A;  3B1L X;  1WFY A;  4W9L A;  4L6E A;  4A3P A;  3ZRF A;  2RGN B;  1U5F A;  5D7G A;  2KKC A;  4TQ0 A;  1HE8 A;  5CTR C;  3HQC A;  2M14 A;  2HRJ A;  2CY4 A;  1RJ2 A;  2DZM A;  2J0J A;  4B9K A;  2DN6 A;  4EKU A;  4MEL A;  1ZSQ A;  4FAD A;  2QKL A;  3A8P A;  1ZW7 A;  2W9N A;  3AI5 A;  5DIF B;  3L08 A;  1R4N I;  2KMC A;  4XX5 A;  3RUL A;  2YRY A;  3P2B A;  3MDB C;  2ASQ A;  2C7M B;  2IBI B;  5G2N A;  4HJK A;  1DRO A;  4MM3 A;  2KWC A;  3MPX A;  4F7H A;  1U5D A;  2DIK A;  4ZRK A;  2WX0 A;  1NTV A;  2L3Z A;  1IP9 A;  3Q3J A;  1L2N A;  2Y7B A;  1UPR A;  4HAZ B;  1WE7 A;  3R3M A;  2N9E B;  4MJS B;  2MSE D;  1P9D U;  2JF5 A;  2LXA A;  2QKM A;  4DHZ E;  3PHW B;  2HE7 A;  1MKE A;  3KSY A;  4A6H A;  1VD2 A;  3H6N A;  2P0H A;  2ZNV B;  2I5F A;  4EZL A;  1V6E A;  2W2W A;  2KCJ A;  4AUQ C;  4HDQ A;  4TUU A;  1EF5 A;  2RUK B;  3RZF A;  2L0T A;  3AJ4 A;  3M62 B;  3WYF B;  5JHH A;  2FNJ B;  3A1Q A;  1PMS A;  3A98 B;  3H7S A;  1Q5W B;  4IFS A;  4LDT D;  1W1D A;  1AQC A;  3W1Y A;  3FEH A;  3JVZ X;  4JQW C;  1WI1 A;  3G9W A;  4A6F A;  2KHW B;  1CMX B;  1H4R A;  4IAP A;  4AJW A;  3SO6 A;  3D8F A;  3QAR A;  1Y5O A;  2K25 A;  1ISN A;  3OJ3 A;  1SIF A;  4JKD A;  1AWE A;  2H7D A;  3DXE A;  4ICV A;  2WYQ A;  3IHP C;  2AL3 A;  3L0W B;  1RRB A;  3VUY A;  3IVF A;  1AAR A;  3VH4 B;  2CHW A;  2KLC A;  3ZTC A;  2DZK A;  3A9K B;  2VSZ A;  2R2O A;  3T06 A;  4K2O A;  2GOW A;  1E7V A;  3DVN U;  2FCS A;  3BJI A;  1U2B A;  1GUA B;  1LM8 B;  4E71 A;  1I42 A;  1M7R A;  3V60 A;  2BKF A;  5G55 A;  4WWO A;  3GYO A;  1OMW A;  2DYQ A;  3E9P A;  1W1H A;  4DHJ B;  4YON A;  3OLM D;  3ZVR A;  3QQ8 B;  4KV2 A;  4JIO U;  4GXB A;  2DHI A;  5DCN A;  2AYO B;  5AEK B;  4F7Z A;  2QHO A;  4EZK A;  4OVV A;  2RSU A;  1V89 A;  2D9Y A;  3AXC A;  4KHA A;  2DHK A;  3ZKJ C;  5KQ1 A;  3PRZ A;  3PGE A;  4NJ7 A;  2CR5 A;  5JH5 C;  4IW0 A;  3TW1 A;  1KOT A;  5J3Y A;  3KZ1 A;  5IAA C;  2JRH A;  4H8S A;  3QC8 B;  3NS8 A;  2JY6 A;  1NTI A;  5C79 A;  4HXD A;  2RPQ A;  4DDI D;  2KTR B;  2MWS B;  4KAX B;  4GIV A;  2IZV B;  2LG1 A;  4IUM B;  2LVO A;  1BTK A;  1TXD A;  3WAM A;  4IOY X;  1U29 A;  1UZX B;  3IG3 A;  2UZS A;  4M8M A;  5C5B B;  4NAW B;  1V80 A;  3O96 A;  2KXJ A;  1X1F A;  4FLH A;  2CHZ A;  2KDI A;  2ROZ B;  2G35 A;  2HTH B;  2KN5 A;  4I6L B;  3KY9 A;  2D3G A;  2JXX A;  5AZF A;  2D07 B;  1Q1O A;  4OVU A;  2KDB A;  4BVU C;  3AU4 A;  3R66 C;  2FDQ A;  3HIZ A;  4JKG B;  3R7R A;  2EJ8 A;  2KVR A;  1P6S A;  2X0S A;  2CQU A;  2ROV A;  2YVC A;  2DAJ A;  2DX5 B;  4BOZ B;  2LXC A;  3KVF B;  1LFD A;  1C3T A;  5L83 A;  3TBL D;  2Y8F A;  3QK0 A;  4GU2 A;  1J8C A;  2KJH B;  1SGH A;  1Q0W B;  4P7I A;  1SE9 A;  4BBN F;  3A9K A;  2YS3 A;  3EFU A;  2BGF A;  3VAW A;  3PLU A;  2KJ6 A;  3DBH I;  2G4S A;  4J6I A;  5BO4 B;  3KUD B;  2E2X A;  4LJP B;  3ML4 A;  3V5W A;  3RCP A;  3CIK A;  4HLE A;  2NBW B;  1XX0 A;  5HE0 A;  2I1K A;  3SYX A;  1XKE A;  4A3O A;  3L17 A;  2YLM A;  2PJH A;  3W1S C;  3A4R A;  3P7Z A;  5KHQ A;  4JKE A;  1UPQ A;  2Z0P A;  2MDX A;  4KHB B;  3MJW A;  4JK9 A;  1P0R A;  4HAX B;  2KAN A;  3A9J B;  1NBF C;  2COC A;  2CB8 A;  5HKH A;  3QWZ B;  1UGM A;  1E8Y A;  2KD0 A;  4FHK A;  2LKO A;  3TJP A;  3L13 A;  3RCZ A;  3ENE A;  2ZZP B;  3WAP A;  4FJZ A;  2PZ1 A;  2FCM A;  4ANV A;  4W9G A;  2VKI A;  4IG7 B;  1A5R A;  3QAQ A;  4IWP A;  1P1A A;  1V88 A;  4N9F 4;  3ZVV A;  2JUO A;  4Z2M B;  4X57 B;  3CXB B;  2KO3 A;  1V2Y A;  5JP4 A;  3UIP B;  4HB0 B;  2KTR A;  2K00 A;  3A4S C;  4JK8 A;  2Q13 A;  2WH5 A;  1WR1 A;  4B6W A;  3RUI B;  1WGH A;  4AWJ A;  1UBI A;  1XD3 B;  2IO3 B;  2WDT B;  2J59 M;  4AP4 C;  5DPW A;  2JZZ A;  1V5T A;  4W9C A;  2R2Q A;  4BKT A;  1GNU A;  3H1U A;  3DCG A;  4ANU A;  4GPT B;  5JHA A;  5C5B A;  4NAW A;  1WGQ A;  3U30 A;  3V61 A;  1E7U A;  4II2 B;  5D27 A;  2IY1 B;  2GS0 A;  2KX0 A;  2RD0 A;  2HD5 B;  2HTH A;  1E5W A;  1BT0 A;  2C7N B;  4K2P A;  1C1Y B;  3KUZ A;  2W2X D;  2N0Y A;  2DAF A;  4JKA A;  2LZ6 A;  4HAT B;  4C0A A;  2G4D B;  4W9J A;  4M8N A;  4A6F B;  2Z0D B;  2MW5 A;  3H9D A;  4JKG A;  1WMH A;  1UEL A;  5DHA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...