3IVFA

Crystal structure of the talin head ferm domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
358
Chain Sequence
VALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title The Structure of the talin head reveals a novel extended conformation of the FERM domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 101
structure length 358
sequence length 368
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3ivfA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ivfA04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA02
2LKOA 2W2WA 3F0WA 2M8SA 2LASA 1WJ4A 3DBRI 3L08A 2KUPA 3ZLZA 5HE2A 3AXCA 3U7DA 1JRUA 1FHWA 2YF0A 1DBHA 2DN6A 2RQ1A 5J17A 1Q67A 3B1LX 1WYWB 4DHZB 2MRPA 2KX0A 4G0NB 1WIAA 4FULA 2KCJA 4HATB 1C3TA 1KZ7A 5BO4B 2DKPA 3HK0A 4WJPA 4FHKA 3QQ8B 2M14A 1WE6A 4AJWA 3PPAA 4FJVB 4WVFB 1WFYA 1WRDB 2N7DA 4IAPA 4FHJA 2RLOA 1E8XA 2LWPA 2QHOA 3ML8A 3PS6A 2M0XA 5J3YA 4MT7A 5TR5A 4K17A 1X1MA 4HB4B 1M7RA 4XZ4A 1V89A 3T9LA 3WA0A 3W1SA 2NBVB 3V6CB 4BVUC 1WGQA 1X86A 2ASQA 3L0WB 4K1RB 3VUXA 2G3QB 4LJOB 2J59M 2ZZPB 2K39A 3ALBA 2EMTA 2FDQA 2R2QA 2RSUA 3U30A 1K8RB 1E5WA 2CQUA 1WX7A 1XD3B 3HQCA 4BOSC 4XC2A 4K7SA 4MJSB 4F1SA 1L7YA 2C60A 1V80A 1P0RA 2IY1B 2YS1A 2UWQA 4MEMA 4RMAA 1KI1B 3MJWA 5E6PA 3PTFC 3R66C 2DX5A 1IPGA 1KZGA 4XX5A 1N3HA 4B95A 2MBHA 2UZRA 4LJPB 1OY2A 1H8CA 2CHXA 5D94A 3A33B 2MP2B 3KW5B 2KHWB 5CX3A 3JSVB 4M8MA 2K6QA 3BINA 2FNJB 2RR9A 4F7ZA 2Y8GA 3O96A 2PE6B 1WXSA 2NBWB 4BKTA 5C6RA 3VXWA 4RM8A 3VTUA 3KYCD 4GDLA 2FIFA 1YJ1A 2L7RA 2O6VD 2GBKA 4WJQA 4A5KA 2D9YA 1V6EA 3NZSA 2OJRA 5FI0A 2FJ9A 1R4MI 1ST7A 5FR6A 2N7EA 2KXJA 2C7HA 1RAXA 2BYEA 1EUVB 1Y5OA 4CYEA 2LYDA 3SV1A 1WH3A 1WJ6A 2KGXB 3JYUA 1L2NA 1QQGA 4MDKE 1RFAA 2JVCA 3PV1A 1QC6A 3DDCB 2CAYA 2L00B 2A5UA 5IJMA 4A6FB 2KDEB 2ZPYA 3WYFB 3EHVA 1XX0A 4FN2A 2GBNA 1FB8A 2COFA 2DYQA 4EZLA 1NVLA 3N3KB 4HPLB 5C16A 2RD0A 1ACAA 3FSSA 1GC7A 3KVFB 2GCLA 3X23A 3KUDB 1RJ2A 3P2BA 3TBLD 2DX1A 3V5WA 2K00A 2GJYA 3RZFA 5C79A 1WGDA 4EZKA 3ZIMA 3PLUA 3ZO5B 2KX3A 4WJNA 3ZTCA 3DXDA 5JZEB 5C1ZA 3AU4A 2M4NA 3M95A 3TCAA 4MM3A 1M7EA 1DDWA 2UZSA 4FADA 1WMHB 2CU1A 3DBLI 3QARA 3IFWB 2IYBA 2FCSA 4L6EA 2I1KA 3NHEB 3PREA 1UNQA 1J0GA 4IC7B 3ONSA 4ASWC 5IAAC 2DX5B 1UBQA 1V5UA 3K9OB 2L3ZA 3APFA 3RCPA 2FIDA 2AWTA 3SUZA 1ZKHA 1ZGUB 4HAZB 2HD5B 2HE7A 3M63B 3KRWA 3Q3FA 2IO1B 2MQJA 1XCGA 2P0HA 3JW0X 4EZJA 2KD0A 1U4AA 2BGFA 3QC8B 2NCNA 1NTYA 2LVPA 2LBBA 1W1GA 3RULA 1OEYA 3RZWC 4EFOA 4ANVA 2H7DA 2DYNA 3RYTA 4CO7A 1J8CA 1FGYA 1V5TA 4KSKC 2K6DB 2KNBA 1U2BA 2K8BA 4MGYE 1WJUA 2N4FA 4ANUA 5CHFA 1MG8A 5HE1A 4DX90 3ULBA 4IM2A 4IG7B 4HVBA 2CS4A 1SIFA 4KAXB 3DQVA 2IZVB 4IWPA 2ABDA 4CHMA 4LDTB 3TW1A 2NPTA 4PYZA 5D3VA 2D4QA 2BWFA 3FP5A 2AEHA 2EJ8A 1UD7A 3PZDA 3KUCB 2DZIA 4DBGA 4DWFA 1D3ZA 1ZW7A 4EJNA 4A3PA 4BKSD 2CHWA 4W9CA 3SYXA 2C9WB 3WAOA 2JY6A 3T8MA 4RM9A 2WX0A 2KWVB 2COPA 1WXVA 2M17A 2IO0B 4MSMB 1UBIA 2N0YA 2VKIA 4B9KA 3X0WA 4K2PA 1R4NI 3QCAA 2JZZA 4A6KA 3A98B 3MTNB 2UYZB 1TJ6A 2DTCA 1K5DB 3B08A 2C7NB 1UGMA 5L81A 4K81A 4WWPA 5E6OA 4GXBA 2YRYA 4NNJB 1WJ1A 1RLFA 3CMMB 4G3XB 2M1MA 1NDDA 4DHZE 2RGFA 2GS0A 4KDLB 4NY0A 3QBVB 2XQNM 5JHAA 2G4SA 3OLMD 2D9WA 1EF5A 1P3QU 4URKA 4NJ6A 3SDLC 3ZNZB 4HXDA 2GBMA 2KC1A 4WWNA 2KK8A 4PS8A 4IWOA 1FOEA 1RRBA 4MY6A 1NBFC 4A3OA 1WGUA 2KJHB 3ZDTA 4CHKA 1ISNA 2FUHB 3A8QA 3M62B 1W1HA 2MW5A 2KLGA 2EC1A 2CRFA 4HB3B 2CHZA 3ZNHB 4NAWB 4BBKA 1UZXB 2KWUB 4F7UP 1GJZA 4YONA 4W9HA 4HK2A 3QA8A 3QJZA 2ADZA 4FJYA 1XD4A 4A6FA 2MWNB 3D8DA 1V86A 1EO6A 2DLWA 3APCA 4HAYB 4FLHA 3UQAA 4W9DA 3VAWA 5DPWA 3PRMB 2W2XC 4IW0A 4D0NB 2NPTB 2DAJA 2REXA 3PVLA 3PRZA 3VIAA 5D7GA 2FCQA 3ZNID 5EFXA 1YX6B 2Q13A 5J3QA 2KFKB 2MKRA 2XK5B 2ELBA 2ZNVB 2NBUA 4JL9A 2BCJA 3TO1A 2COAA 4WQOB 1UPRA 4Z2NA 3DVGX 1AWEA 3TVVA 1OQNA 5JP4A 1TXDA 2Z0PA 3IVFA 1WMHA 2KVRA 3ZRFA 4WWOA 1J19A 3K9PB 2YVCA 3ZVVA 3N7CA 4GMVA 5AZGA 2DENB 1GNUA 2JRHA 5D6JB 4E3CA 4ZDVA 4J6IA 2L76A 1I7AA 2OOBB 3ZKJC 4CHJA 4KDIC 2N23A 2V76A 3M1IB 3CSTA 2N1WA 3QK0A 5C23A 1LB1A 2V1YA 2K2JA 1MK9B 2FJLA 1ZC4B 2AL3A 4MH0E 1WM2A 2YT1A 2D3GA 3OAWA 1Q0WB 4TYZA 2IFSA 4EOYA 4B6WA 5EDSA 2AL6A 2R09A 2GOWA 4GN1A 3UF8A 3ZW3A 2I5FA 1ZC3B 2LVOA 5DPTA 5G2NA 2MDXA 1TTNA 4GOCA 1PQSA 1KOTA 2JT4B 4LDTD 3H6NA 4P7IA 4F7HA 2LXCA 3VHTC 1NI2A 4JIOU 1K5GB 5DCNA 4DHJD 4F7GA 4K2OA 3T06A 1ZSQA 1WX8A 1CMXB 5DIFB 1WG7A 3D8FA 2KZRA 2NMBA 1I42A 3H7SA 2JF5A 4KHAA 1FAOA 3DBHI 1WXMA 3TMPB 4EEWA 1LM8B 2O6VA 3ZTDA 2LGDA 2OTXA 2N1VA 4HB0B 3A1QA 1V81A 2DA0A 1QZEA 3L16A 3IBEA 2V3SA 2RGNB 1B55A 4HHVA 4NPNA 1P98A 2IO3B 3HIZA 3P7ZA 1E7VA 2BKRB 5JH5C 4DX8A 2Z0OA 2I5CA 3AI5A 3PEGA 4I6PA 1U5FA 1GC6A 2MX2A 1GG3A 1LXDA 2KMCA 3SO6A 2MCNB 4HAUB 1C1YB 3AULA 2YS5A 4A6HA 3VQIA 2D07B 1FHOA 3C0RB 5KHOA 1HB6A 2PEAA 3EC8A 2LRUA 3CXBB 2LG1A 4II2B 3B0AA 4YL8A 1HE8A 1MAIA 4GB9A 1WF9A 3TFMA 2CR5A 1WVHA 4XWXA 3VDZA 3BJIA 1DDMA 4HAXB 4W9IA 4N9F4 3W1SC 4GGQA 1WX9A 3WANA 3IHPC 1IP9A 3CF6E 3UIOB 3ZNGC 2DHJA 5GMVA 2CB8A 1V5OA 3NSUA 4W9GA 4AJYB 4GMXB 5CTRC 3SHQA 2LI5A 1YX5B 3A9JB 4I6NB 1Y19B 2JZ3B 1E8WA 4E74A 1YIWA 2R0DA 1E90A 4HDOA 3QWMA 4IWQA 1U5GA 2YT0A 1EVHA 3DVNU 3DVNV 3PHWB 3ODWA 1W1DA 2Y5BB 4W9JA 4C0AA 2LOZA 4NQKE 2LJ5A 1U29A 1S1QB 3ENEA 5DPRA 1F9JA 2KTRA 3VH3B 4GU2A 3O65B 4MSQB 4BBNF 3APDA 2I1JA 4NAWA 3R7RA 2Z59B 2B3AA 3ML4A 3M3JA 2MBBB 3PVUA 3QHTA 1YD8U 3TL5A 1WJMA 1KJTA 1V5MA 1MK7B 2P0FA 2ZVNA 2RVBB 2DYMA 4AP4C 1SGHA 2HTHA 3PT2B 4LCDE 4H8SA 2PJHA 1I2HA 3A9KB 1Z2MA 3F5RA 1IYFA 2QKMA 4B6HA 2IY0B 3I3TB 2KWCA 1BT0A 1X1GA 2LRWA 4FA6A 2N9PC 4K7UA 1E7UA 2YSZA 2O6VB 2R2OA 2KFKA 2JWZA 4NQLB 3A1QB 2MBEA 4G50A 1KM7A 4BOZB 5JHHA 4DDGD 1X05A 3L54A 4EKUA 2JXXA 2XK5A 5E6NA 4ZRJA 5CHWA 1XODA 1WI0A 4AUQC 2JPHA 2MFQA 2K25A 1HB8A 4BKGA 2L1CA 4PS3A 2DZMA 3ML9A 2KANA 2NR2A 3SNHA 2MLBA 1XT9B 4KIKA 3FLVA 4PS7A 1UELA 3ECIA 2P8VA 2DHZA 3L10B 3H9DA 2RSGA 3IG3A 4BBNC 2J0KA 2C5LC 4MELA 2K1FA 1LQBA 4HCNB 1ZVRA 2LULA 2DKQA 2DAFA 4PNKA 2KDIA 4HLEA 2K8HA 5D3YA 3JVZX 2DYOA 1UH6A 1VCBA 4ZYNA 2ZCBA 3DOWA 1WI1A 1V61A 2KDFB 5CLLB 2JUOA 3KZ1A 1ZM0A 5LONB 2J0JA 1WGRA 2J7QB 2KKCA 4HB2B 3VTWA 3WAPA 3QX1A 2X18A 3ZDMC 2KFJA 3KUZA 2MWSB 3KRXA 2KQ7A 3VTVA 5J3TA 2IYDB 3DXCA 2DZJA 3G9WA 1SE9A 4GDKA 1FGZA 4MGKE 1WGHA 1T0YA 3VVWB 4IM0A 3H1UA 3S2AA 3PHXB 4TQ1A 4OVUA 1V2YA 1SHCA 2D2QA 1WY8A 2KTRB 1P1AA 4DBBA 1P3RA 4WJOA 1PMSA 2LD9A 1PLSA 3RD2A 5LLIA 2CY4A 2L0FA 2L05A 4K7WA 2KQSA 2BYVE 2D10A 5G55A 3QWZB 3HW2B 4JGHB 3GZNI 4AOFA 1X11A 3FEHA 4IFSA 3BY4B 2BYFA 2L0TA 2HTHB 3UIPB 2N9EB 1VD2A 1P9DU 3WAMA 4Y94A 3RT3B 3AU5A 3KYDD 5C5BB 1BTKA 1BAKA 1Q1OA 3EFUA 4OVVA 4PQ0A 1OEYJ 2FAZA 3NOBA 5J18A 3TIXA 4W9FA 1OMWA 5KQ4A 4ICVA 2KJ6A 2BKFA 1E8ZA 1EAZA 4Z2MB 2XEWA 4KZCA 3V62A 4TUUA 2G45B 1WJNA 2BF8B 1OQYA 4EMOA 3ZVRA 4JQWC 1DYNA 3A4RA 3R3MA 4FJZA 3CIKA 1BWNA 2EKEC 2KN5A 3PGEA 4KVGB 4KIKB 2ZNVC 1PFJA 2ZEQA 5AZFA 1FHXA 1LFDA 2ZVOA 3V60A 4GZUA 2KO3A 2J0MA 3QAQA 3L13A 3GYOA 3A9JA 3PG7A 3LJUX 3UQBA 4DK5A 2H7EA 2ZPNA 2LUEA 1DDVA 2Z0EB 4HPMB 5KCVA 4M0WB 1DROA 2JRIB 3VOQA 2KDBA 2PPHA 1WGGA 3W1YA 3PRPB 2L2IA 3HHMA 2PE9A 4HJKA 3UGBB 3U8ZA 4AWJA 3H7PB 1TQZA 4I6LB 5JLJB 2KOXA 4GDKB 4WSFA 1WR1A 4NJ7A 4W9KA 2QKLA 1WR6E 3AJ4A 1WE7A 2MSED 2IBIB 3MPXA 2XBBC 3A9KA 5IA7A 2WDTB 1NTVA 5HKHA 2K8CA 2FCMA 3FM8C 2MBQA 2GMIC 3DCGA 4GPTB 2Y7BA 1S3SG 3KH0A 5D3WA 1E8YA 2HJ8A 2NZ8B 2Z0DB 5D3XA 1WZ3A 3ODOA 1IRSA 3N30A 4IUMB 4PYUA 4EUTA 3PSCA 1P6SA 1BTNA 2YS3A 3DPDA 2Y8FA 1UNPA 1YQBA 4KZ0A 2GBJA 2VSZA 1WZ0A 5AZHA 3KY9A 5D27A 5DHFB 2CODA 1Z5SB 1M94A 1FXTB 3LDZE 2W9NA 3PLVA 3ODXA 3KSYA 3D8EA 5HE0A 3VUYA 1G6JA 3Q3JA 1TBEA 2MA9B 3WALA 3SD5A 2WH5A 5J2RA 3GOEA 3EPYA 2LZ6A 1HBKA 2O2VA 3NZUA 5L95C 2P0DA 2ROVA 1AQCA 4TKNA 4M8NA 2ZJDA 4MK0A 1MIXA 2D9XA 4MGIE 2LVQA 1U5DA 2BPSA 4DDID 3WIMA 1KLVA 2CKHB 3VH4B 2COCA 2WX1A 4HDQA 2N9XA 4TV3A 3OJ4B 3PP2A 3DVGY 4IM3A 1AARA 2LOXA 3P6AA 3NS8A 1I35A 3RCZA 1U27A 2BWES 5LXHA 3OJ3A 2DHKA 1Z87A 4A20A 3V61A 3ZRCA 2CY5A 3LJ3A 4KSLC 2LGYA 1UPQA 1XKEA 3VUWA 1EGXA 5L83A 2ZCCA 1WGYA 1GUAB 3DBSA 2JP2A 3OANA 1V49A 1H10A 2E2XA 3DXEA 2W2XD 5JHBA 4FBJB 2DZKA 5LOPB 3VFKA 2KJRA 3PSEB 2DFKA 1UNRA 1V9JA 4TQ0A 5FI1A 5LXIB 1V5PA 4GDLB 4HCPB 3MDBC 2ELAA 2G4DB 1NU2A 4KV2A 2A4ZA 5DPSA 4BFRA 1Q5WB 1XQQA 2L8JA 4JLCA 3SU8X 3NY5A 1J0WA 5GOWB 5C5BA 5DHAB 4E71A 2MBOA 1WM3A 1P5TA 5KQ1A 4NSWA 4GIVA 4KHBB 2KTFA 3L17A 2C7MB 4DHJB 3GYPA 3HM6X 2RNRB 4G11A 2ROZB 4HAVB 4X57B 4WAAA 1RRPB 2YLMA 4II3B 2FCNA 3A8PA 1TGZB 1U5EA 1EF1A 3RUIB 5DI9B 4BKSA 1OTRB 1LW3A 3A4SC 1TZ1A 2VRRB 4F8CB 1V88A 1MKEA 2DHIA 2GBRA 2HRJA 4ANXA 3TJPA 1XR0B 4ICUA 4MJSA 2D9VA 2RPQA 3MHSD 2O2VB 5CLQB 2KLCA 1NTIA 2V4LA 4W9EA 1OGWA 2LGXA 2VRWB 2D9ZA 4KHOA 3N32A 5D2MB 1Y8RC 4ANWA 5AEKB 2KMAA 5DH9B 2NVUI 2Z0QA 2LXAA 5HE3A 1H4RA 2IO2B 2D11A 3R7QA 2PZ1A 3CSFA 3PVWA 4MGZE 2K2UA 4IOYX 4W9LA 3UINB 3D32A 3V6EB 2MP2A 1MPHA 3EECA 3JSVA 4HAWB 2EMSA 2KC2A 4ZRKA 3ULCA 2GCJA 5KHQA 3H7PA 4GSWA 2G35A 2UVMA 3ZUNA 3HM3A 1X1FA 2WYQA 2WWZA 2DYBA 1UEFA 4DXAB 2M38A 1MIZB 5CHVC 3QIJA 2AYOB 2NS5A 1A5RA 3UZTA 1WXAA 4ZRIA 4WJ7A 4HWIB 2OQBA 2RUKB 5JHGA
chains in the Genus database with same CATH superfamily
2LKOA 2W2WA 3F0WA 2M8SA 2LASA 3U4EG 1WJ4A 3DBRI 3GB1A 3L08A 4ARIA 2KUPA 2WDRB 3ZLZA 5HE2A 3AXCA 3U7DA 1FFUA 1JRUA 2RPVA 1FHWA 2YF0A 1DBHA 4ARCA 4AS1A 2DN6A 3VR8B 1HXYD 2RQ1A 5J17A 1Q67A 1L4DB 2W54A 1NENB 3B1LX 1XXGA 1WYWB 2K3UA 4DHZB 2MRPA 2KX0A 4G0NB 1WIAA 1I4XA 4FULA 1VBGA 2KCJA 4HATB 1C3TA 4IDIA 5HHDG 2CU3A 1KZ7A 3MJ5A 2BB5A 4ITKA 5BO4B 2DKPA 3HK0A 4WJPA 4FHKA 1WGKA 3IT4B 3QQ8B 2M14A 1WE6A 4AJWA 3PPAA 5JXVA 4FJVB 1K52A 4WVFB 1WFYA 5FKAC 1WRDB 2N7DA 4IAPA 4FHJA 2RLOA 4NAMA 1K53A 3AEEB 1E8XA 2LWPA 1XF5L 2IPKD 2QHOA 3ML8A 3PS6A 2M0XA 3TEXA 4ZYSA 3P4QB 5J3YA 3NUHB 4MT7A 5TR5A 3O13A 3BIID 4K17A 1X1MA 4HB4B 1JROA 1L5PA 4TSSA 1ZYIA 1M7RA 4XZ4A 1V89A 3T9LA 3WA0A 3W1SA 2NBVB 1DGJA 3V6CB 4BVUC 1WGQA 1X86A 1N61A 3CIRB 3Q3OC 2ASQA 3L0WB 4K1RB 1DOYA 2RRFA 3SR6A 2G3QB 3VUXA 4LJOB 2J59M 2ZZPB 2K39A 1WYGA 3ALBA 2EMTA 2FDQA 2R2QA 2RSUA 3U30A 1K8RB 4IKGA 1E5WA 2CQUA 2YEPB 1WX7A 3BYTB 1KTKA 1XD3B 3HQCA 4BOSC 3P4RB 4MT5A 2XN9C 1IGDA 4XC2A 4K7SA 4ZHOA 4ZOHC 4MJSB 4F1SA 1L7YA 1B9RA 3T3NA 1XCQL 3AE9B 1N60A 4C00A 2C60A 5HI1A 1V80A 3RN9C 1P0RA 2IY1B 2YS1A 2UWQA 4MEMA 3KWLA 5IN7A 2PVOD 4QXAB 1MG4A 1KI1B 3MJWA 4RMAA 5E6PA 4JKEA 3PTFC 3R66C 4IOIE 1I4QA 2DX5A 2BTEA 1IPGA 1KZGA 4XE0A 5BYSA 1GB1A 4XX5A 1N3HA 4M02A 4B95A 2MBHA 2H88B 2UZRA 1SSNA 4LJPB 1SE4A 2Z14A 1D5ZC 1ZOYB 1OY2A 1H8CA 2CHXA 5D94A 3A33B 2MP2B 3KW5B 1T0RC 2KHWB 1TKGA 2LFIA 4JKHA 5CX3A 3JSVB 1SJED 1MHXA 1XLQA 4M8MA 2K6QA 3BINA 2FNJB 2RR9A 3NWAA 4F7ZA 2Y8GA 3E9PA 2AQ2B 3O96A 2PE6B 1WXSA 4LNIA 4JK9A 2NBWB 4BKTA 5C6RA 3VXWA 4RM8A 1WSPA 3NRZA 3VTUA 2BYTA 3KYCD 3MFGA 4ILGB 4GDLA 2FIFA 1YJ1A 2L7RA 2O6VD 2GBKA 1DIKA 4S0RA 1DOIA 4WJQA 1ENFA 3BVGA 4A5KA 2D9YA 2FE8A 4US8A 4L2YA 3RFZB 1UUPA 2FUG1 2SAKA 5BMIA 1V6EA 1MJDA 5IP4D 2WP9B 3NZSA 3EFCA 3HIEA 2OJRA 3AECB 5FI0A 2FJ9A 1R4MI 4WAFA 1ST7A 2MEKA 1D5XC 3AEGB 5FR6A 2Z13A 2KXJA 2N7EA 4FXCA 5I4DA 2C7HA 1RAXA 2BYEA 1EUVB 4B0MA 1Y5OA 5MPOA 2KWDA 4CYEA 2LYDA 1HTOA 3SV1A 1WH3A 1WJ6A 2PIAA 2KGXB 1C4PA 3JYUA 1L2NA 2INPE 1QQGA 4MDKE 1RFAA 2JZPA 2JVCA 3PV1A 1QC6A 3DDCB 1F2RC 5I2MA 2CAYA 2L00B 2A5UA 2M56B 5IJMA 4A6FB 2KDEB 2ZPYA 3R2TA 3WYFB 3EHVA 1XX0A 2UU7A 2GBNA 1FB8A 2COFA 4FN2A 2DYQA 4EZLA 1NVLA 3N3KB 1NYRA 5EE0A 4HPLB 5C16A 2RD0A 4ZRQA 4HROA 1ACAA 3FSSA 3KQ4A 1JWSD 3AEFB 5I2SA 5HG2A 1GC7A 2WXJA 3BWUD 3KVFB 1AYFA 2GCLA 2J52A 4LLGM 3X23A 2ZKMX 2WXFA 3KUDB 1RJ2A 3P2BA 4M00A 3TBLD 3U7ZA 3AE1B 2LHEA 2DLBA 2DX1A 3V5WA 2K00A 2GJYA 1P7FA 1YQ4B 3GE3C 4JE3B 1J7BA 3RZFA 5C79A 1WGDA 1YJJA 4EZKA 2MJDA 3ZIMA 3PLUA 3ZO5B 2KX3A 4WJNA 3ZTCA 3DXDA 1C78A 5JZEB 5C1ZA 3DBLB 3AU4A 2M4NA 3M95A 3TCAA 4MM3A 1M7EA 1DDWA 2UZSA 4FADA 1WMHB 2CU1A 4QJ3B 1N63A 3DBLI 3QARA 4RGMA 3IFWB 2IYBA 2FCSA 1GPXA 1N62A 4L6EA 2QJLA 2I2YA 2I1KA 3NHEB 3PREA 1UNQA 1EU3A 1J0GA 4IC7B 3ONSA 4ASWC 5IAAC 1V1PB 2DX5B 1TKYA 1UBQA 1V5UA 2G9HD 2L3ZA 3K9OB 3APFA 3RCPA 2FIDA 2WU2B 1FNUA 2AWTA 3SUZA 1ZKHA 1ZGUB 4HAZB 3HRDD 2HD5B 2ZW1A 4BAXA 2HE7A 3M63B 3KRWA 1E6EB 3Q3FA 2IO1B 2MQJA 1XCGA 2P0HA 3JW0X 4EZJA 2KD0A 1U4AA 2BGFA 3QC8B 3U52E 2NCNA 1NTYA 3UI3A 1ZXIA 2LVPA 3AE2B 2LBBA 1W1GA 1VR9A 2WXIA 4JKCA 3RULA 1OEYA 4HSIA 3RZWC 4EFOA 4ANVA 2H7DA 2VH1A 2LGSA 2DYNA 3RYTA 4CO7A 3Q3MC 2L32A 1J8CA 1FGYA 1V5TA 3LXFA 4KSKC 2VH2A 2K6DB 2KNBA 1ACCA 2N0SB 1U2BA 1F52A 2JQRB 2K8BA 4MGYE 1WJUA 2N4FA 3TUOA 4ANUA 5CHFA 1MG8A 5HE1A 4DX90 4K3BA 1T0QC 3ULBA 4IM2A 4IG7B 2LUMA 4HVBA 1AWDA 2NTSA 3DWGC 3OG5A 2CS4A 1SIFA 1VLBA 4KAXB 1UNSA 3AV8A 3DQVA 1ZUD2 2IZVB 1IUEA 4K3CA 4IWPA 2ABDA 4JX1C 1FXIA 3ZYYX 1SIJA 4CHMA 4LDTB 3TW1A 2NPTA 4PYZA 5D3VA 2D4QA 2BWFA 3FP5A 2AEHA 2EJ8A 1JDEA 1UD7A 1JMLA 3PZDA 3KUCB 2DZIA 2QSDA 4DBGA 4DWFA 1D3ZA 3W9CB 4KKIA 1ZW7A 4EJNA 4A3PA 4BKSD 2CHWA 5C2TB 2K0PA 1PDXA 2INNE 1XLOA 4W9CA 3SYXA 2C9WB 1QOBA 3WAOA 4XDDA 2JY6A 2WXPA 3T8MA 4RM9A 2WX0A 1PYWD 2KWVB 3E56A 4JKAA 2COPA 1WXVA 2M17A 2IO0B 4MSMB 1RWSA 1UBIA 2N0YA 2VKIA 2R82A 4B9KA 3W2DA 1R4NB 4Q2JA 3X0WA 1C77A 2BB6A 4K2PA 5BYQA 1SF0A 1R4NI 3QCAA 2JZZA 4A6KA 1GAQB 3A98B 4OZCA 1EWYC 3MTNB 4LK0M 4A6QA 3Q2AC 2UYZB 3TEYA 1TJ6A 4RGTA 2DTCA 1I4HA 4L23A 1K5DB 3B08A 5LG4B 2QCZA 2C7NB 1UGMA 5L81A 4K81A 4WWPA 5E6OA 4GXBA 2YRYA 4NNJB 1WJ1A 1RLFA 1FO4A 3I9V1 3CMMB 4G3XB 2JYEA 4WH4A 2M1MA 1NDDA 1PGXA 4DHZE 1TS3A 1ZP0B 2RGFA 2GS0A 4KDLB 4NY0A 3QBVB 2XQNM 3AB5A 1FEHA 5JHAA 3ZQ4A 2G4SA 2KACA 3OLMD 1VZ7A 2AQ3B 1QQRA 2D9WA 1EF5A 2WXHA 2WXNA 1P3QU 4LNNA 4URKA 5D3DA 4NJ6A 3LB8C 3SDLC 3ZNZB 1IBXB 4HXDA 2GBMA 2KC1A 4WWNA 4GNKB 2WQYB 1EWCA 3SFEB 3T3OA 4JKGB 2KK8A 4PS8A 3H8HA 1HEZE 4IWOA 3DBRB 1FOEA 1RRBA 4MY6A 1NBFC 4A3OA 1WGUA 2KJHB 3ZDTA 3ZJUA 5D3IB 4CHKA 1ISNA 4A9AA 5H92C 4D6WA 4YXDB 2FUHB 2JYTA 2JXTA 3A8QA 3M62B 3MC0B 1QF6A 1W1HA 2MW5A 2KR0A 2KLGA 2EC1A 2CRFA 4HB3B 2CHZA 3ZNHB 4NAWB 4BBKA 1UZXB 2KWUB 1KBLA 4F7UP 1ZXHA 1GJZA 4YONA 4W9HA 1C9FA 4HK2A 3QA8A 3AE7B 3QJZA 2K5PA 5HFYA 3AN1A 2ADZA 4FJYA 1XD4A 2ZW0A 3AMZA 4A6FA 2MWNB 4YTPB 3D8DA 1V86A 1EO6A 4WWMA 2DLWA 3APCA 4KGTA 4HAYB 4FLHA 3UQAA 4W9DA 1D5MC 3VAWA 5DPWA 4PT5A 3PRMB 2W2XC 4IW0A 4D0NB 2NPTB 2DAJA 2REXA 3PVLA 2GUMA 3PRZA 3VIAA 4US9A 4JWUC 5D7GA 2RDHA 2FCQA 3ETRA 3ZNID 5EFXA 2GLSA 1YX6B 3Q6BA 2Q13A 5J3QA 1L6VA 2KFKB 1C76A 3Q8AA 2MKRA 2EKIA 4XDCA 3NVZA 1CK1A 1KLUD 2XK5B 1YQ3B 3NS1A 2ELBA 3W5UB 1TY0A 2ZNVB 2NBUA 1VZ8A 4KGRA 2PVGC 4JL9A 2KIEA 4P16A 2BCJA 3TO1A 2COAA 1PUTA 4WQOB 1ET9A 1UPRA 4Z2NA 3DVGX 2RMMA 1AWEA 3Q8FA 3TVVA 1OQNA 5JP4A 1TXDA 2Z0PA 5TSSA 3RI7C 1GOZA 3IVFA 1WMHA 2KVRA 1YOVB 3ZRFA 1YJIA 2WHIA 4WWOA 1J19A 1ET6A 1D4BA 3K9PB 2YVCA 3ZXRA 3ZVVA 1FD6A 4LTUA 4YSYB 3N7CA 4GMVA 5AZGA 2DENB 1GNUA 2JRHA 2ICIA 2WXQA 5D6JB 4E3CA 4ZDVA 4ZRPA 2PMVA 2VZKD 5EE9A 2LGIA 2M0AA 4J6IA 2L76A 1V1PA 1I7AA 2OOBB 3ZKJC 4CHJA 4UDUC 4OT1A 4KDIC 4XGAB 2N23A 2V76A 3M1IB 1ZPSA 3RNBC 4C7ZA 1TS4A 3CSTA 4MH8A 1ESFA 3SEBA 1AN8A 1GB4A 2N1WA 4O1NA 2Q5WD 3QK0A 2DIKA 5C23A 1LB1A 1EM7A 2K2JA 2V1YA 4A8XC 1MK9B 2FJLA 1T6BX 1TKEA 1ZC4B 3ZJVA 2AL3A 4MH0E 1WM2A 3A58A 1B1ZA 2YT1A 2D3GA 2D3AA 3OAWA 4JKFA 1Q0WB 4TYZA 2IFSA 3RNCC 4EOYA 4B6WA 5EDSA 2KVZA 3RPFC 3Q14C 2AL6A 3HVZA 2R09A 2GOWA 4GN1A 3UF8A 5IRSA 2I5FA 3ZW3A 2HJ1A 1ZC3B 2LVOA 5DPTA 5G2NA 2OHFA 2MDXA 1TTNA 5BYRA 4GOCA 2DBYA 1PQSA 1KOTA 2JT4B 4LDTD 2KIGA 3H6NA 4P7IA 4F7HA 1R4MB 2X8XX 2LXCA 3VHTC 1NI2A 4JIOU 4C4VA 1K5GB 2N9LA 3MC8A 5DCNA 4DHJD 4F7GA 4K2OA 1OQQA 1R7SA 3T06A 1ZSQA 1WX8A 4HKZE 1CMXB 4LNKA 3DBHB 5DIFB 1WG7A 3D8FA 2KZRA 1YN5A 2NMBA 1I42A 3H7SA 2JF5A 4KHAA 1FAOA 3DBHI 1WXMA 1XEEA 1JCKB 1DYQA 3TMPB 4EEWA 1VRAB 1LM8B 3N1XC 2O6VA 2WXOA 3ZTDA 1QT9A 2LGDA 2OTXA 2N1VA 3Q69A 4HB0B 3A1QA 1V81A 2DA0A 1QZEA 3L16A 5T8IA 3IBEA 2V3SA 1OQRA 2RGNB 1F2RI 1B55A 2OEDA 4HHVA 4NPNA 1P98A 2IO3B 4YT0B 3HIZA 3P7ZA 1E7VA 2INDC 2BKRB 5JH5C 4DX8A 2Z0OA 2I5CA 3AI5A 1JALA 3PEGA 4I6PA 1U5FA 1GC6A 2MX2A 1GG3A 1LXDA 2KMCA 3SO6A 2Z4DA 2MCNB 4HAUB 2OJWA 1C1YB 3AULA 5E6JA 2YS5A 4A6HA 3VQIA 3VR9B 4RCOA 2FJUB 2D07B 2H89B 4KKJA 1KC7A 1FHOA 1CZPA 2WDVB 3C0RB 5KHOA 1HB6A 3P42A 1WWTA 2PEAA 3NVVA 3EC8A 1FXAA 2LRUA 1C79A 1PFDA 3CXBB 2LG1A 4II2B 3B0AA 4YL8A 1N5WA 1HE8A 4USAA 1FCLA 1MAIA 3FAHA 3MC9A 4GB9A 1WF9A 3TFMA 2BVCA 2DWQA 2CR5A 2WS3B 1WVHA 4XWXA 3VDZA 3BJIA 1DDMA 4HAXB 3IAS1 3GP7A 4W9IA 4N9F4 3NWDA 3Q8CA 3W1SC 4OZAA 2KDMA 4GGQA 3MHZA 4XWTA 1L0VB 1WX9A 4N59A 3WANA 3IHPC 1IP9A 1L0XB 2MJ3A 3CF6E 3UIOB 3IXSA 3ZNGC 2DHJA 3ENBA 3AE6B 5GMVA 1MI0A 2V0GA 2CB8A 2EELA 1V5OA 3NSUA 4W9GA 2GB1A 4AJYB 4YTNB 4OVZA 4GMXB 5CTRC 3N20C 3SHQA 2TSSA 2KT7A 2G1EA 4D2KA 2E6XA 3U2SC 4JK7A 4HPPA 3PZ8A 1TY2A 2LI5A 1IBXA 1YX5B 3A9JB 4I6NB 1Y19B 3AE4B 2JZ3B 1E8WA 4E74A 1YIWA 2R0DA 1QOFA 1E90A 3AEAB 4JKGA 4HDOA 3QWMA 3SBTA 4R3DA 4IWQA 1U5GA 2YT0A 1EVHA 3DVNU 3DVNV 3PHWB 3ODWA 1W1DA 2Y5BB 4W9JA 1ZE3D 2IGHA 4WQMA 2HDEA 4C0AA 1SE2A 2R2YA 4RGNA 2ONQA 3ZXVA 2LOZA 4NQKE 2LJ5A 1U29A 1S1QB 1N6ZA 3ENEA 5DPRA 4DXGA 1F9JA 2KTRA 2M19A 3VH3B 4GU2A 3O65B 4MSQB 4BBNF 1L6UA 3APDA 2I1JA 4KGSA 1J7AA 4NAWA 1E10A 1QKZA 2WLBA 3R7RA 2ACZB 2FBWB 2Z59B 4GOUA 2B3AA 3ML4A 1TIFA 1WXQA 3AM9A 5LNK1 3M3JA 2MBBB 3PVUA 2HTME 3QHTA 1YD8U 3TL5A 3OHMB 1WJMA 2GRIA 1KJTA 1V5MA 1MK7B 2JX5A 2P0FA 2WXLA 3R2IA 2ZVNA 2RVBB 4C4VB 2DYMA 3B77A 4AP4C 1SGHA 2HTHA 3PT2B 4LCDE 2E3TA 4H8SA 2PJHA 1I2HA 2GI9A 3DWMA 2KN4A 3A9KB 3I57A 1Z2MA 3F5RA 1IYFA 2QKMA 4B6HA 2IY0B 3I3TB 3E9OA 2KWCA 1RYJA 1QILA 4AQ7A 1BT0A 1X1GA 2KUQA 2LRWA 4FA6A 2N9PC 4K7UA 1E7UA 2YSZA 2O6VB 2R2OA 1JQ4A 2KFKA 2JWZA 2QIEB 4NQLB 3A1QB 2MBEA 4G50A 1KM7A 3SFDB 4BOZB 5JHHA 3HVDA 4DDGD 1X05A 3L54A 3Q8BA 3NVWA 4EKUA 2JXXA 3RNFC 4A55A 1LGRA 2XK5A 5E6NA 4ZRJA 1SBBB 5CHWA 2MHJA 1XODA 1WI0A 3DHHC 1JW9D 2NMQA 1KF6B 4AUQC 3OWEB 2JPHA 1UGJA 2MFQA 2K25A 1HB8A 4BKGA 2L1CA 1FCCC 4PS3A 5BMHA 3NWFA 2DZMA 3ML9A 4C7YA 1AW7A 3FC4A 2W3RA 2KANA 2NR2A 2LEKA 2W3SA 3SNHA 2MLBA 3CWIA 1XT9B 4KIKA 3FLVA 4PS7A 1UELA 3ECIA 2RDGA 2P8VA 2DHZA 1RM6C 1TS2A 3L10B 3H9DA 2RSGA 2V9HA 3IG3A 3V05A 4BBNC 2J0KA 2C5LC 4MELA 2K1FA 1LQBA 1T5XD 2L52A 4HCNB 3B9JA 4BZAA 1ZVRA 2LULA 2DKQA 2DAFA 3NW8A 4PNKA 2KDIA 4HLEA 2K8HA 1TYGB 4NZLB 5D3YA 2QDFA 1JWUD 3JVZX 2DYOA 3E9SA 3RNGC 1UH6A 1VCBA 4ZYNA 2ZCBA 3DOWA 1WI1A 1V61A 2KDFB 5CLLB 1Y56A 2J53A 4JWSC 4JK8A 2XNAC 3C19A 4M0WA 1VZ6A 5AUKA 1JWMD 2KAJA 2V3NA 2JUOA 3KZ1A 4JKBA 1ZM0A 4QJ4B 5LONB 4PK1A 2J0JA 1WGRA 2J7QB 3AE8B 1DOXA 2KKCA 4HB2B 1UF0A 3VTWA 4WIPA 1LO5D 3WAPA 3QX1A 1MHHE 2IJ0A 2X18A 2CJNA 3ZDMC 2KFJA 3KUZA 2MWSB 3KRXA 2KQ7A 1N5XA 4OW0A 3VTVA 5J3TA 2IYDB 3DXCA 2WU5B 3AEBB 5M4YB 1A70A 2DZJA 3G9WA 1SE9A 4GDKA 1FGZA 4MGKE 1WGHA 1T0YA 3VVWB 4IM0A 3H1UA 3S2AA 3AE3B 4OSNA 3PHXB 4TQ1A 3J9CA 3N1ZC 4OVUA 1V2YA 4N58A 1SHCA 2D2QA 1WY8A 3RNEC 3N1YC 1YNTE 2IGDA 4JPSA 2AX5A 1FM0D 2KTRB 4P1CC 1P1AA 4DBBA 1P3RA 4WJOA 1PMSA 2YEPF 2LD9A 1PLSA 1FIQA 5G5HA 3RD2A 1FNVA 5LLIA 2CY4A 2L0FA 2L05A 2QEJC 1OFFA 2J42A 4K7WA 4QJ5B 4REZA 1XCTL 2KQSA 3TEWA 3GZNB 2BYVE 2K8EA 2WGSA 2D10A 5G55A 3QWZB 4DXFA 3HW2B 4JGHB 3GZNI 1NVID 4TMAB 4AOFA 1X11A 3NJTA 3FEHA 2MJEA 4IFSA 4B0EA 3BY4B 2BYFA 2L0TA 2HTHB 1NYQA 4J3OD 3BVMA 5AUIA 4M01A 3UIPB 2N9EB 1VDVA 1VD2A 1P9DU 2I38A 2SEBD 3WAMA 4Y94A 3RT3B 3AU5A 3KYDD 3BVZA 1TZOA 4WURA 3TEZA 5C5BB 1BTKA 1D6EC 2AQ1B 1BAKA 3SBGA 2X0SA 1Q1OA 3EFUA 4OVVA 3EUB2 4PQ0A 1OEYJ 2FAZA 3NOBA 5J18A 1SE3A 3P4PB 3TIXA 2WDQB 4W9FA 1YMHE 1OMWA 5KQ4A 4ICVA 2KJ6A 2BKFA 5BMGA 1E8ZA 1EAZA 4Z2MB 1FRRA 2XEWA 4KZCA 1SXTA 3I63C 3R8BA 3V62A 3Q3NC 4TUUA 2G45B 1WJNA 2BF8B 1F0ZA 2L83A 3EA6A 1OQYA 4EMOA 3ZVRA 4JQWC 1DYNA 3A4RA 3R3MA 4FJZA 3CIKA 1BWNA 2EKEC 3AEDB 1MI1A 3FILA 1KH0A 4L1BA 2KN5A 3PGEA 2Y3AA 4ACFA 3EGRA 4KVGB 4KIKB 1T3QA 2PTLA 2ZNVC 4EE2A 1PFJA 2ZEQA 5EE1A 5AZFA 1FHXA 1UWMA 1LFDA 1KFYB 2ZVOA 2D5GA 4CSQA 2QMTA 1TJEA 3V60A 2KO3A 4GZUA 2J0MA 4ILHA 3FKYA 3QAQA 3L13A 4NJCA 3GYOA 3A9JA 3HUIA 1HZ5A 3PG7A 3LJUX 3UQBA 4DK5A 2H7EA 2ZPNA 2LUEA 1DDVA 2Z0EB 4HPMB 5KCVA 4M0WB 1NEKB 1DROA 3Q8EA 2JRIB 3VOQA 2KDBA 1RFKA 4MACA 1HQRD 2PPHA 2PLPA 1JRPA 4LNFA 1BUIC 2CJOA 3TSSA 1WGGA 2BW2A 3BZDB 2BS3B 3IT6B 2WXMA 1V97A 3W1YA 3PRPB 1GGOA 4LNOA 2L2IA 3HHMA 2PE9A 3L4PA 4HJKA 3UGBB 3U8ZA 2Z59A 4DQOC 4AWJA 4C56C 1E0ZA 4RFBA 3H7PB 1TQZA 4I6LB 5JLJB 2KOXA 4GDKB 3ABVB 4WSFA 1WR1A 2ON8A 4YTMB 1C4AA 4NJ7A 4W9KA 2QKLA 4KX6B 1WR6E 3AJ4A 1YN3A 2BQQA 1WE7A 3AE5B 2MSED 3PZ7A 4RF1A 2K22A 2N7JA 2IBIB 3E66A 3MPXA 2XBBC 3A9KA 5IA7A 1QLBB 2WDTB 3WCQA 1NTVA 5HKHA 2K8CA 2D3BA 2FCMA 3FM8C 2MBQA 1IGCA 1QOGA 2GMIC 1HZ6A 1EU4A 1M4VA 1ZDXA 3URYA 3DCGA 1F1HA 4GPTB 2Y7BA 4JKDA 1S3SG 2JWUA 3KH0A 5D3WA 1FNWA 1Q10A 1E8YA 2DNFA 2HJ8A 5FK9C 2NZ8B 2QC8A 4KHBA 2Z0DB 5D3XA 1WZ3A 3ODOA 2LJIA 1IRSA 3N30A 4IUMB 2R61A 4PYUA 5FR3A 4EUTA 5IKCM 3PSCA 2K49A 2K9XA 1P6SA 2KQ4X 3E9LA 3NVYA 1BTNA 2YS3A 3NG0A 3DPDA 2Y8FA 1UNPA 3BYYB 1YQBA 4KZ0A 2GBJA 2LMCA 2VSZA 2JU6X 1WZ0A 5IO9A 4ZHPA 5AZHA 5C3JB 3KY9A 5D27A 5DHFB 2CODA 1Z5SB 1M94A 1FXTB 4A90A 4CQNA 3LDZE 2W9NA 3PLVA 2V3PA 4HKQA 3ODXA 3KSYA 3D8EA 5HE0A 3VUYA 4P1BC 1G6JA 3ZGZA 3B2FA 2Z8LA 3Q3JA 1V1OA 4RH6A 4L1RA 1TBEA 2MA9B 3WALA 3SD5A 2WH5A 3MP9A 5J2RA 3GOEA 3FVCA 3EPYA 4RNAA 3P4SB 2LZ6A 2V4IB 1HBKA 2O2VA 3NZUA 5L95C 2P0DA 1I4PA 2ROVA 1CJEA 2LHDA 1AQCA 4TKNA 4M8NA 2X38A 4MK0A 1MIXA 1XLNA 2ZJDA 1CQVA 2D9XA 1WRIA 3FILB 4MGIE 3RNAC 2KMMA 1U5DA 2LVQA 4XWWA 4S17A 2L1AA 2BPSA 3I5JC 4HEA1 4DDID 3WIMA 3B2GA 1KLVA 4DIXA 2CKHB 2W55A 3VH4B 1SB3C 2COCA 2WX1A 1I7HA 4HDQA 2JSVX 2BT6A 2N9XA 2W82A 4TV3A 2RDBC 3OJ4B 3PP2A 3DVGY 1HTQA 4IM3A 5H8YE 1AARA 3DHIC 2IGGA 2LOXA 3P6AA 2NTTA 3KLSX 3NS8A 1I35A 4XYCA 3RCZA 1U27A 1L4ZB 2BWES 5LXHA 3U12A 3OJ3A 2DHKA 1Z87A 4A20A 1L0YB 1SJHD 3V61A 3P1MA 3ZRCA 2CY5A 2IDYA 3LJ3A 4KSLC 2LGYA 2QILA 1UPQA 1XKEA 3VUWA 1EGXA 5L83A 2ZCCA 1WGYA 1VJKA 2WXRA 1GUAB 3DHGC 5GXGB 2VZKB 3DBSA 2JP2A 1ROEA 3OANA 1V49A 1T0SC 3BK2A 1SEBD 1H10A 2E2XA 1F77A 3DXEA 2W2XD 5JHBA 3VRAB 2BBCA 4FBJB 1JWBD 1P7EA 5JVLA 2DZKA 5LOPB 3VFKA 2INCC 4OHJA 2KJRA 3PSEB 3V3XA 2DFKA 1BXTA 1UNRA 1V9JA 1YN4A 4TQ0A 5FI1A 5LXIB 1V5PA 4GDLB 4H2AA 4HCPB 3AH7A 1FFVA 3LYYA 2WXKA 3MDBC 2ELAA 1MPEA 2G4DB 1BMLC 1NU2A 4KV2A 2A4ZA 1ZDVA 5DPSA 4BFRA 1XLPA 1Q5WB 1XQQA 2L8JA 4JLCA 1MVKA 3SU8X 1I4RA 3NY5A 2B76B 1J0WA 5GOWB 5C5BA 2J4XA 1C4CA 5DHAB 4E71A 2MBOA 4N6EB 1WM3A 1P5TA 1I4GA 5KQ1A 4OZBA 4NSWA 1MFWA 2N9KA 4GIVA 4KHBB 2MH7A 4RGOS 2KTFA 3L17A 1JWAD 2C7MB 2Y5CA 4DHJB 3GYPA 3VRBB 3HM6X 2RNRB 2WNMA 4G11A 2NBVA 2ROZB 4HAVB 4X57B 1K50A 4WAAA 1RRPB 2YLMA 1KLGD 4II3B 2FCNA 3A8PA 1TGZB 1V8CA 4HJGE 3HSAA 3W5VB 1NI3A 1U5EA 4GLSC 1EF1A 3RUIB 5DI9B 5G5GA 4BKSA 1OTRB 1LW3A 1J7CA 3A4SC 3C8YA 1TZ1A 2VRRB 4F8CB 1V88A 1MKEA 2DHIA 4P6VF 2GBRA 2HRJA 4ANXA 3TJPA 1XR0B 4ICUA 4MJSA 2D9VA 3ZJTA 3PO0A 2RPQA 3MHSD 2O2VB 5CLQB 2KLCA 1NTIA 1TS5A 1PGAA 2V4LA 4ILJA 1T77A 4W9EA 1OGWA 1PGBA 1UWXA 1E7PB 2LGXA 2VRWB 2D9ZA 4KHOA 3N32A 5D2MB 1E9MA 1Y8RC 4ANWA 5AEKB 4YWGG 2KMAA 5DH9B 2NVUI 2Z0QA 2LXAA 3GE8C 5HE3A 2Y5PA 1H4RA 2IO2B 3GS2A 4C80A 2D11A 2PKOA 3R7QA 3NZ3A 2PZ1A 3KWVA 2D3CA 3CSFA 3PVWA 4MGZE 2K2UA 3DCXA 3N9YC 4IOYX 4MM3B 4W9LA 3UINB 3D32A 3V6EB 2MP2A 1KRHA 1MPHA 3EECA 3BK1A 2BS4B 5EE3A 3JSVA 4HAWB 1VBHA 1FRDA 2YT2A 2EMSA 2KC2A 5IOIA 4ZRKA 3ULCA 2PW9A 2GCJA 4HRSA 5KHQA 3H7PA 4GSWA 2G35A 2UVMA 1K51A 3IAM1 2BS2B 3HM3A 3ZUNA 1X1FA 2WXGA 2WYQA 2WWZA 4RF0A 1HA5A 2DYBA 1UEFA 4DXAB 2M38A 1QOAA 1TT5B 3P63A 1MIZB 5CHVC 3QIJA 2AYOB 2NS5A 1FPYA 1A5RA 3UZTA 4YSXB 1WXAA 3RMKC 4ZRIA 4WJ7A 1STEA 4HWIB 1XO3A 2OQBA 2RUKB 2KYWA 4QAYA 5JHGA 4YSZB 1FMAD
chains in the Genus database with same CATH topology
2LKOA 2W2WA 3F0WA 2M8SA 2LASA 1WJ4A 3DBRI 3L08A 2KUPA 3ZLZA 5HE2A 3AXCA 3U7DA 1JRUA 1FHWA 2YF0A 1DBHA 2DN6A 2RQ1A 5J17A 1Q67A 3B1LX 1WYWB 4DHZB 2MRPA 2KX0A 4G0NB 1WIAA 4FULA 1VBGA 2KCJA 4HATB 1C3TA 1KZ7A 5BO4B 2DKPA 3HK0A 4WJPA 4FHKA 3QQ8B 2M14A 1WE6A 4AJWA 3PPAA 4FJVB 4WVFB 1WFYA 1WRDB 2N7DA 4IAPA 4FHJA 2RLOA 1E8XA 2LWPA 2QHOA 3ML8A 3PS6A 2M0XA 5J3YA 4MT7A 5TR5A 4K17A 1X1MA 4HB4B 1M7RA 4XZ4A 1V89A 3T9LA 3WA0A 3W1SA 2NBVB 3V6CB 4BVUC 1WGQA 1X86A 2ASQA 3L0WB 4K1RB 3VUXA 2G3QB 4LJOB 2J59M 2ZZPB 2K39A 3ALBA 2EMTA 2FDQA 2R2QA 2RSUA 3U30A 1K8RB 1E5WA 2CQUA 1WX7A 1XD3B 3HQCA 4BOSC 4XC2A 4K7SA 4MJSB 4F1SA 1L7YA 2C60A 1V80A 1P0RA 2IY1B 2YS1A 2UWQA 4MEMA 4RMAA 1KI1B 3MJWA 5E6PA 4JKEA 3PTFC 3R66C 2DX5A 1IPGA 1KZGA 4XX5A 1N3HA 4B95A 2MBHA 2UZRA 4LJPB 1OY2A 1H8CA 2CHXA 5D94A 3A33B 2MP2B 3KW5B 2KHWB 5CX3A 4JKHA 3JSVB 4M8MA 2K6QA 3BINA 2FNJB 2RR9A 4F7ZA 2Y8GA 3E9PA 3O96A 2PE6B 1WXSA 4JK9A 2NBWB 4BKTA 5C6RA 3VXWA 4RM8A 3VTUA 3KYCD 4GDLA 4ILGB 2FIFA 1YJ1A 2L7RA 2O6VD 2GBKA 1DIKA 4WJQA 4A5KA 2D9YA 1V6EA 3NZSA 2OJRA 5FI0A 2FJ9A 1R4MI 1ST7A 5FR6A 2N7EA 2KXJA 2C7HA 1RAXA 2BYEA 1EUVB 1Y5OA 4CYEA 2LYDA 3SV1A 1WH3A 1WJ6A 2KGXB 3JYUA 1L2NA 1QQGA 4MDKE 1RFAA 2JVCA 3PV1A 1QC6A 3DDCB 2CAYA 2L00B 2A5UA 5IJMA 4A6FB 2KDEB 2ZPYA 3WYFB 3EHVA 1XX0A 4FN2A 2GBNA 1FB8A 2COFA 2DYQA 4EZLA 1NVLA 3N3KB 4HPLB 5C16A 2RD0A 1ACAA 3FSSA 1GC7A 3KVFB 2GCLA 3X23A 3KUDB 1RJ2A 3P2BA 3TBLD 2DX1A 3V5WA 2K00A 2GJYA 3RZFA 5C79A 1WGDA 4EZKA 3ZIMA 3PLUA 3ZO5B 2KX3A 4WJNA 3ZTCA 3DXDA 5JZEB 5C1ZA 3AU4A 2M4NA 3M95A 3TCAA 4MM3A 1M7EA 1DDWA 2UZSA 4FADA 1WMHB 2CU1A 3DBLI 3QARA 3IFWB 2IYBA 2FCSA 4L6EA 2I1KA 3NHEB 3PREA 1UNQA 1J0GA 4IC7B 3ONSA 4ASWC 5IAAC 2DX5B 1UBQA 1V5UA 3K9OB 2L3ZA 3APFA 3RCPA 2FIDA 2AWTA 3SUZA 1ZKHA 1ZGUB 4HAZB 2HD5B 2HE7A 3M63B 3KRWA 3Q3FA 2IO1B 2MQJA 1XCGA 2P0HA 3JW0X 4EZJA 2KD0A 1U4AA 2BGFA 3QC8B 2NCNA 1NTYA 2LVPA 2LBBA 1W1GA 4JKCA 3RULA 1OEYA 3RZWC 4EFOA 4ANVA 2H7DA 2DYNA 3RYTA 4CO7A 1J8CA 1FGYA 1V5TA 4KSKC 2K6DB 2KNBA 1U2BA 2K8BA 4MGYE 1WJUA 2N4FA 4ANUA 5CHFA 1MG8A 5HE1A 4DX90 3ULBA 4IM2A 4IG7B 4HVBA 2CS4A 1SIFA 4KAXB 3DQVA 2IZVB 4IWPA 2ABDA 4CHMA 4LDTB 3TW1A 2NPTA 4PYZA 5D3VA 2D4QA 2BWFA 3FP5A 2AEHA 2EJ8A 1JDEA 1UD7A 3PZDA 3KUCB 2DZIA 4DBGA 4DWFA 1D3ZA 1ZW7A 4EJNA 4A3PA 4BKSD 2CHWA 4W9CA 3SYXA 2C9WB 3WAOA 2JY6A 3T8MA 4RM9A 2WX0A 2KWVB 4JKAA 2COPA 1WXVA 2M17A 2IO0B 4MSMB 1UBIA 2N0YA 2VKIA 2R82A 4B9KA 3X0WA 4K2PA 1R4NI 3QCAA 2JZZA 4A6KA 3A98B 3MTNB 2UYZB 1TJ6A 2DTCA 1K5DB 3B08A 2C7NB 1UGMA 5L81A 4K81A 4WWPA 5E6OA 4GXBA 2YRYA 4NNJB 1WJ1A 1RLFA 3CMMB 4G3XB 2M1MA 1NDDA 4DHZE 2RGFA 2GS0A 4KDLB 4NY0A 3QBVB 2XQNM 5JHAA 2G4SA 3OLMD 2D9WA 1EF5A 1P3QU 4URKA 4NJ6A 3SDLC 3ZNZB 4HXDA 2GBMA 2KC1A 4WWNA 4JKGB 2KK8A 4PS8A 4IWOA 1FOEA 1RRBA 4MY6A 1NBFC 4A3OA 1WGUA 2KJHB 3ZDTA 4CHKA 1ISNA 2FUHB 3A8QA 3M62B 1W1HA 2MW5A 2KLGA 2EC1A 2CRFA 4HB3B 2CHZA 3ZNHB 4NAWB 4BBKA 1UZXB 2KWUB 1KBLA 4F7UP 1GJZA 4YONA 4W9HA 4HK2A 3QA8A 3QJZA 2ADZA 4FJYA 1XD4A 4A6FA 2MWNB 3D8DA 1V86A 1EO6A 2DLWA 3APCA 4HAYB 4FLHA 3UQAA 4W9DA 3VAWA 5DPWA 3PRMB 2W2XC 4IW0A 4D0NB 2NPTB 2DAJA 2REXA 3PVLA 3PRZA 3VIAA 5D7GA 2FCQA 3ZNID 5EFXA 1YX6B 2Q13A 5J3QA 2KFKB 2MKRA 2XK5B 2ELBA 2ZNVB 2NBUA 4JL9A 2BCJA 3TO1A 2COAA 4WQOB 1UPRA 4Z2NA 3DVGX 1AWEA 3TVVA 1OQNA 5JP4A 1TXDA 2Z0PA 3IVFA 1WMHA 2KVRA 3ZRFA 4WWOA 1J19A 3K9PB 2YVCA 3ZVVA 3N7CA 4GMVA 5AZGA 2DENB 1GNUA 2JRHA 5D6JB 4E3CA 4ZDVA 4J6IA 2L76A 1I7AA 2OOBB 3ZKJC 4CHJA 4KDIC 2N23A 2V76A 3M1IB 3CSTA 2N1WA 3QK0A 2DIKA 5C23A 1LB1A 2V1YA 2K2JA 1MK9B 2FJLA 1ZC4B 2AL3A 4MH0E 1WM2A 2YT1A 2D3GA 3OAWA 4JKFA 1Q0WB 4TYZA 2IFSA 4EOYA 4B6WA 5EDSA 2AL6A 2R09A 2GOWA 4GN1A 3UF8A 3ZW3A 2I5FA 1ZC3B 2LVOA 5DPTA 5G2NA 2MDXA 1TTNA 4GOCA 1PQSA 1KOTA 2JT4B 4LDTD 3H6NA 4P7IA 4F7HA 2LXCA 3VHTC 1NI2A 4JIOU 1K5GB 5DCNA 4DHJD 4F7GA 4K2OA 3T06A 1ZSQA 1WX8A 1CMXB 5DIFB 1WG7A 3D8FA 2KZRA 2NMBA 1I42A 3H7SA 2JF5A 4KHAA 1FAOA 3DBHI 1WXMA 3TMPB 4EEWA 1LM8B 2O6VA 3ZTDA 2LGDA 2OTXA 2N1VA 4HB0B 3A1QA 1V81A 2DA0A 1QZEA 3L16A 3IBEA 2V3SA 2RGNB 1B55A 4HHVA 4NPNA 1P98A 2IO3B 3HIZA 3P7ZA 1E7VA 2BKRB 5JH5C 4DX8A 2Z0OA 2I5CA 3AI5A 3PEGA 4I6PA 1U5FA 1GC6A 2MX2A 1GG3A 1LXDA 2KMCA 3SO6A 2MCNB 4HAUB 1C1YB 3AULA 2YS5A 4A6HA 3VQIA 2D07B 1KC7A 1FHOA 3C0RB 5KHOA 1HB6A 2PEAA 3EC8A 2LRUA 3CXBB 2LG1A 4II2B 3B0AA 4YL8A 1HE8A 1MAIA 4GB9A 1WF9A 3TFMA 2CR5A 1WVHA 4XWXA 3VDZA 3BJIA 1DDMA 4HAXB 4W9IA 4N9F4 3W1SC 4GGQA 1WX9A 3WANA 3IHPC 1IP9A 3CF6E 3UIOB 3ZNGC 2DHJA 3ENBA 5GMVA 2CB8A 1V5OA 3NSUA 4W9GA 4AJYB 4GMXB 5CTRC 3SHQA 4JK7A 2LI5A 1YX5B 3A9JB 4I6NB 1Y19B 2JZ3B 1E8WA 4E74A 1YIWA 2R0DA 1E90A 4JKGA 4HDOA 3QWMA 3SBTA 4IWQA 1U5GA 2YT0A 1EVHA 3DVNU 3DVNV 3PHWB 3ODWA 1W1DA 2Y5BB 4W9JA 4C0AA 2LOZA 4NQKE 2LJ5A 1U29A 1S1QB 3ENEA 5DPRA 1F9JA 2KTRA 3VH3B 4GU2A 3O65B 4MSQB 4BBNF 3APDA 2I1JA 4NAWA 3R7RA 2Z59B 2B3AA 3ML4A 3M3JA 2MBBB 3PVUA 3QHTA 1YD8U 3TL5A 1WJMA 1KJTA 1V5MA 1MK7B 2P0FA 2ZVNA 2RVBB 2DYMA 4AP4C 1SGHA 2HTHA 3PT2B 4LCDE 4H8SA 2PJHA 1I2HA 3A9KB 1Z2MA 3F5RA 1IYFA 2QKMA 4B6HA 2IY0B 3I3TB 3E9OA 2KWCA 1BT0A 1X1GA 2LRWA 4FA6A 2N9PC 4K7UA 1E7UA 2YSZA 2O6VB 2R2OA 2KFKA 2JWZA 4NQLB 3A1QB 2MBEA 4G50A 1KM7A 4BOZB 5JHHA 4DDGD 1X05A 3L54A 4EKUA 2JXXA 2XK5A 5E6NA 4ZRJA 5CHWA 1XODA 1WI0A 4AUQC 2JPHA 2MFQA 2K25A 1HB8A 4BKGA 2L1CA 4PS3A 2DZMA 3ML9A 2KANA 2NR2A 3SNHA 2MLBA 1XT9B 4KIKA 3FLVA 4PS7A 1UELA 3ECIA 2P8VA 2DHZA 3L10B 3H9DA 2RSGA 3IG3A 4BBNC 2J0KA 2C5LC 4MELA 2K1FA 1LQBA 4HCNB 1ZVRA 2LULA 2DKQA 2DAFA 4PNKA 2KDIA 4HLEA 2K8HA 5D3YA 3JVZX 2DYOA 1UH6A 1VCBA 4ZYNA 2ZCBA 3DOWA 1WI1A 1V61A 2KDFB 5CLLB 4JK8A 2JUOA 3KZ1A 4JKBA 1ZM0A 5LONB 2J0JA 1WGRA 2J7QB 2KKCA 4HB2B 3VTWA 3WAPA 3QX1A 2X18A 3ZDMC 2KFJA 3KUZA 2MWSB 3KRXA 2KQ7A 3VTVA 5J3TA 2IYDB 3DXCA 2DZJA 3G9WA 1SE9A 4GDKA 1FGZA 4MGKE 1WGHA 1T0YA 3VVWB 4IM0A 3H1UA 3S2AA 3PHXB 4TQ1A 4OVUA 1V2YA 1SHCA 2D2QA 1WY8A 2KTRB 1P1AA 4DBBA 1P3RA 4WJOA 1PMSA 2LD9A 1PLSA 3RD2A 5LLIA 2CY4A 2L0FA 2L05A 4K7WA 2KQSA 2BYVE 2D10A 5G55A 3QWZB 3HW2B 4JGHB 3GZNI 4AOFA 1X11A 3FEHA 4IFSA 3BY4B 2BYFA 2L0TA 2HTHB 3UIPB 2N9EB 1VD2A 1P9DU 3WAMA 4Y94A 3RT3B 3AU5A 3KYDD 5C5BB 1BTKA 1BAKA 3SBGA 2X0SA 1Q1OA 3EFUA 4OVVA 4PQ0A 1OEYJ 2FAZA 3NOBA 5J18A 3TIXA 4W9FA 1OMWA 5KQ4A 4ICVA 2KJ6A 2BKFA 1E8ZA 1EAZA 4Z2MB 2XEWA 4KZCA 3V62A 4TUUA 2G45B 1WJNA 2BF8B 1OQYA 4EMOA 3ZVRA 4JQWC 1DYNA 3A4RA 3R3MA 4FJZA 3CIKA 1BWNA 2EKEC 2KN5A 3PGEA 4KVGB 4KIKB 2ZNVC 1PFJA 2ZEQA 5AZFA 1FHXA 1LFDA 2ZVOA 3V60A 4GZUA 2KO3A 2J0MA 4ILHA 3QAQA 3L13A 3GYOA 3A9JA 3PG7A 3LJUX 3UQBA 4DK5A 2H7EA 2ZPNA 2LUEA 1DDVA 2Z0EB 4HPMB 5KCVA 4M0WB 1DROA 2JRIB 3VOQA 2KDBA 2PPHA 1WGGA 3W1YA 3PRPB 1GGOA 2L2IA 3HHMA 2PE9A 4HJKA 3UGBB 3U8ZA 4AWJA 3H7PB 1TQZA 4I6LB 5JLJB 2KOXA 4GDKB 4WSFA 1WR1A 4NJ7A 4W9KA 2QKLA 1WR6E 3AJ4A 1WE7A 2MSED 2IBIB 3E66A 3MPXA 2XBBC 3A9KA 5IA7A 2WDTB 1NTVA 5HKHA 2K8CA 2FCMA 3FM8C 2MBQA 2GMIC 3DCGA 4GPTB 2Y7BA 4JKDA 1S3SG 3KH0A 5D3WA 1E8YA 2HJ8A 2NZ8B 2Z0DB 5D3XA 1WZ3A 3ODOA 1IRSA 3N30A 4IUMB 4PYUA 4EUTA 3PSCA 1P6SA 3E9LA 1BTNA 2YS3A 3DPDA 2Y8FA 1UNPA 1YQBA 4KZ0A 2GBJA 2VSZA 1WZ0A 5AZHA 3KY9A 5D27A 5DHFB 2CODA 1Z5SB 1M94A 1FXTB 3LDZE 2W9NA 3PLVA 3ODXA 3KSYA 3D8EA 5HE0A 3VUYA 1G6JA 3Q3JA 1TBEA 2MA9B 3WALA 3SD5A 2WH5A 5J2RA 3GOEA 3EPYA 2LZ6A 1HBKA 2O2VA 3NZUA 5L95C 2P0DA 2ROVA 1AQCA 4TKNA 4M8NA 2ZJDA 4MK0A 1MIXA 2D9XA 4MGIE 2LVQA 1U5DA 2BPSA 4DDID 3WIMA 1KLVA 2CKHB 3VH4B 2COCA 2WX1A 4HDQA 2N9XA 4TV3A 3OJ4B 3PP2A 3DVGY 4IM3A 1AARA 2LOXA 3P6AA 3NS8A 1I35A 3RCZA 1U27A 2BWES 5LXHA 3OJ3A 2DHKA 1Z87A 4A20A 3V61A 3ZRCA 2CY5A 3LJ3A 4KSLC 2LGYA 1UPQA 1XKEA 3VUWA 1EGXA 5L83A 2ZCCA 1WGYA 1GUAB 3DBSA 2JP2A 3OANA 1V49A 1H10A 2E2XA 3DXEA 2W2XD 5JHBA 4FBJB 5JVLA 2DZKA 5LOPB 3VFKA 2KJRA 3PSEB 2DFKA 1UNRA 1V9JA 4TQ0A 5FI1A 5LXIB 1V5PA 4GDLB 4HCPB 3MDBC 2ELAA 2G4DB 1NU2A 4KV2A 2A4ZA 5DPSA 4BFRA 1Q5WB 1XQQA 2L8JA 4JLCA 3SU8X 3NY5A 1J0WA 5GOWB 5C5BA 5DHAB 4E71A 2MBOA 1WM3A 1P5TA 5KQ1A 4NSWA 4GIVA 4KHBB 2KTFA 3L17A 2C7MB 4DHJB 3GYPA 3HM6X 2RNRB 4G11A 2ROZB 4HAVB 4X57B 4WAAA 1RRPB 2YLMA 4II3B 2FCNA 3A8PA 1TGZB 1U5EA 1EF1A 3RUIB 5DI9B 4BKSA 1OTRB 1LW3A 3A4SC 1TZ1A 2VRRB 4F8CB 1V88A 1MKEA 2DHIA 2GBRA 2HRJA 4ANXA 3TJPA 1XR0B 4ICUA 4MJSA 2D9VA 2RPQA 3MHSD 2O2VB 5CLQB 2KLCA 1NTIA 2V4LA 4ILJA 4W9EA 1OGWA 2LGXA 2VRWB 2D9ZA 4KHOA 3N32A 5D2MB 1Y8RC 4ANWA 5AEKB 2KMAA 5DH9B 2NVUI 2Z0QA 2LXAA 5HE3A 1H4RA 2IO2B 2D11A 3R7QA 2PZ1A 3CSFA 3PVWA 4MGZE 2K2UA 4IOYX 4W9LA 3UINB 3D32A 3V6EB 2MP2A 1MPHA 3EECA 3JSVA 4HAWB 1VBHA 2EMSA 2KC2A 4ZRKA 3ULCA 2GCJA 5KHQA 3H7PA 4GSWA 2G35A 2UVMA 3ZUNA 3HM3A 1X1FA 2WYQA 2WWZA 2DYBA 1UEFA 4DXAB 2M38A 1MIZB 5CHVC 3QIJA 2AYOB 2NS5A 1A5RA 3UZTA 1WXAA 4ZRIA 4WJ7A 4HWIB 2OQBA 2RUKB 5JHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKO A;  2W2W A;  3F0W A;  2M8S A;  2LAS A;  1WJ4 A;  3DBR I;  3L08 A;  2KUP A;  3ZLZ A;  5HE2 A;  3AXC A;  3U7D A;  1JRU A;  1FHW A;  2YF0 A;  1DBH A;  2DN6 A;  2RQ1 A;  5J17 A;  1Q67 A;  3B1L X;  1WYW B;  4DHZ B;  2MRP A;  2KX0 A;  4G0N B;  1WIA A;  4FUL A;  2KCJ A;  4HAT B;  1C3T A;  1KZ7 A;  5BO4 B;  2DKP A;  3HK0 A;  4WJP A;  4FHK A;  3QQ8 B;  2M14 A;  1WE6 A;  4AJW A;  3PPA A;  4FJV B;  4WVF B;  1WFY A;  1WRD B;  2N7D A;  4IAP A;  4FHJ A;  2RLO A;  1E8X A;  2LWP A;  2QHO A;  3ML8 A;  3PS6 A;  2M0X A;  5J3Y A;  4MT7 A;  5TR5 A;  4K17 A;  1X1M A;  4HB4 B;  1M7R A;  4XZ4 A;  1V89 A;  3T9L A;  3WA0 A;  3W1S A;  2NBV B;  3V6C B;  4BVU C;  1WGQ A;  1X86 A;  2ASQ A;  3L0W B;  4K1R B;  3VUX A;  2G3Q B;  4LJO B;  2J59 M;  2ZZP B;  2K39 A;  3ALB A;  2EMT A;  2FDQ A;  2R2Q A;  2RSU A;  3U30 A;  1K8R B;  1E5W A;  2CQU A;  1WX7 A;  1XD3 B;  3HQC A;  4BOS C;  4XC2 A;  4K7S A;  4MJS B;  4F1S A;  1L7Y A;  2C60 A;  1V80 A;  1P0R A;  2IY1 B;  2YS1 A;  2UWQ A;  4MEM A;  4RMA A;  1KI1 B;  3MJW A;  5E6P A;  3PTF C;  3R66 C;  2DX5 A;  1IPG A;  1KZG A;  4XX5 A;  1N3H A;  4B95 A;  2MBH A;  2UZR A;  4LJP B;  1OY2 A;  1H8C A;  2CHX A;  5D94 A;  3A33 B;  2MP2 B;  3KW5 B;  2KHW B;  5CX3 A;  3JSV B;  4M8M A;  2K6Q A;  3BIN A;  2FNJ B;  2RR9 A;  4F7Z A;  2Y8G A;  3O96 A;  2PE6 B;  1WXS A;  2NBW B;  4BKT A;  5C6R A;  3VXW A;  4RM8 A;  3VTU A;  3KYC D;  4GDL A;  2FIF A;  1YJ1 A;  2L7R A;  2O6V D;  2GBK A;  4WJQ A;  4A5K A;  2D9Y A;  1V6E A;  3NZS A;  2OJR A;  5FI0 A;  2FJ9 A;  1R4M I;  1ST7 A;  5FR6 A;  2N7E A;  2KXJ A;  2C7H A;  1RAX A;  2BYE A;  1EUV B;  1Y5O A;  4CYE A;  2LYD A;  3SV1 A;  1WH3 A;  1WJ6 A;  2KGX B;  3JYU A;  1L2N A;  1QQG A;  4MDK E;  1RFA A;  2JVC A;  3PV1 A;  1QC6 A;  3DDC B;  2CAY A;  2L00 B;  2A5U A;  5IJM A;  4A6F B;  2KDE B;  2ZPY A;  3WYF B;  3EHV A;  1XX0 A;  4FN2 A;  2GBN A;  1FB8 A;  2COF A;  2DYQ A;  4EZL A;  1NVL A;  3N3K B;  4HPL B;  5C16 A;  2RD0 A;  1ACA A;  3FSS A;  1GC7 A;  3KVF B;  2GCL A;  3X23 A;  3KUD B;  1RJ2 A;  3P2B A;  3TBL D;  2DX1 A;  3V5W A;  2K00 A;  2GJY A;  3RZF A;  5C79 A;  1WGD A;  4EZK A;  3ZIM A;  3PLU A;  3ZO5 B;  2KX3 A;  4WJN A;  3ZTC A;  3DXD A;  5JZE B;  5C1Z A;  3AU4 A;  2M4N A;  3M95 A;  3TCA A;  4MM3 A;  1M7E A;  1DDW A;  2UZS A;  4FAD A;  1WMH B;  2CU1 A;  3DBL I;  3QAR A;  3IFW B;  2IYB A;  2FCS A;  4L6E A;  2I1K A;  3NHE B;  3PRE A;  1UNQ A;  1J0G A;  4IC7 B;  3ONS A;  4ASW C;  5IAA C;  2DX5 B;  1UBQ A;  1V5U A;  3K9O B;  2L3Z A;  3APF A;  3RCP A;  2FID A;  2AWT A;  3SUZ A;  1ZKH A;  1ZGU B;  4HAZ B;  2HD5 B;  2HE7 A;  3M63 B;  3KRW A;  3Q3F A;  2IO1 B;  2MQJ A;  1XCG A;  2P0H A;  3JW0 X;  4EZJ A;  2KD0 A;  1U4A A;  2BGF A;  3QC8 B;  2NCN A;  1NTY A;  2LVP A;  2LBB A;  1W1G A;  3RUL A;  1OEY A;  3RZW C;  4EFO A;  4ANV A;  2H7D A;  2DYN A;  3RYT A;  4CO7 A;  1J8C A;  1FGY A;  1V5T A;  4KSK C;  2K6D B;  2KNB A;  1U2B A;  2K8B A;  4MGY E;  1WJU A;  2N4F A;  4ANU A;  5CHF A;  1MG8 A;  5HE1 A;  4DX9 0;  3ULB A;  4IM2 A;  4IG7 B;  4HVB A;  2CS4 A;  1SIF A;  4KAX B;  3DQV A;  2IZV B;  4IWP A;  2ABD A;  4CHM A;  4LDT B;  3TW1 A;  2NPT A;  4PYZ A;  5D3V A;  2D4Q A;  2BWF A;  3FP5 A;  2AEH A;  2EJ8 A;  1UD7 A;  3PZD A;  3KUC B;  2DZI A;  4DBG A;  4DWF A;  1D3Z A;  1ZW7 A;  4EJN A;  4A3P A;  4BKS D;  2CHW A;  4W9C A;  3SYX A;  2C9W B;  3WAO A;  2JY6 A;  3T8M A;  4RM9 A;  2WX0 A;  2KWV B;  2COP A;  1WXV A;  2M17 A;  2IO0 B;  4MSM B;  1UBI A;  2N0Y A;  2VKI A;  4B9K A;  3X0W A;  4K2P A;  1R4N I;  3QCA A;  2JZZ A;  4A6K A;  3A98 B;  3MTN B;  2UYZ B;  1TJ6 A;  2DTC A;  1K5D B;  3B08 A;  2C7N B;  1UGM A;  5L81 A;  4K81 A;  4WWP A;  5E6O A;  4GXB A;  2YRY A;  4NNJ B;  1WJ1 A;  1RLF A;  3CMM B;  4G3X B;  2M1M A;  1NDD A;  4DHZ E;  2RGF A;  2GS0 A;  4KDL B;  4NY0 A;  3QBV B;  2XQN M;  5JHA A;  2G4S A;  3OLM D;  2D9W A;  1EF5 A;  1P3Q U;  4URK A;  4NJ6 A;  3SDL C;  3ZNZ B;  4HXD A;  2GBM A;  2KC1 A;  4WWN A;  2KK8 A;  4PS8 A;  4IWO A;  1FOE A;  1RRB A;  4MY6 A;  1NBF C;  4A3O A;  1WGU A;  2KJH B;  3ZDT A;  4CHK A;  1ISN A;  2FUH B;  3A8Q A;  3M62 B;  1W1H A;  2MW5 A;  2KLG A;  2EC1 A;  2CRF A;  4HB3 B;  2CHZ A;  3ZNH B;  4NAW B;  4BBK A;  1UZX B;  2KWU B;  4F7U P;  1GJZ A;  4YON A;  4W9H A;  4HK2 A;  3QA8 A;  3QJZ A;  2ADZ A;  4FJY A;  1XD4 A;  4A6F A;  2MWN B;  3D8D A;  1V86 A;  1EO6 A;  2DLW A;  3APC A;  4HAY B;  4FLH A;  3UQA A;  4W9D A;  3VAW A;  5DPW A;  3PRM B;  2W2X C;  4IW0 A;  4D0N B;  2NPT B;  2DAJ A;  2REX A;  3PVL A;  3PRZ A;  3VIA A;  5D7G A;  2FCQ A;  3ZNI D;  5EFX A;  1YX6 B;  2Q13 A;  5J3Q A;  2KFK B;  2MKR A;  2XK5 B;  2ELB A;  2ZNV B;  2NBU A;  4JL9 A;  2BCJ A;  3TO1 A;  2COA A;  4WQO B;  1UPR A;  4Z2N A;  3DVG X;  1AWE A;  3TVV A;  1OQN A;  5JP4 A;  1TXD A;  2Z0P A;  3IVF A;  1WMH A;  2KVR A;  3ZRF A;  4WWO A;  1J19 A;  3K9P B;  2YVC A;  3ZVV A;  3N7C A;  4GMV A;  5AZG A;  2DEN B;  1GNU A;  2JRH A;  5D6J B;  4E3C A;  4ZDV A;  4J6I A;  2L76 A;  1I7A A;  2OOB B;  3ZKJ C;  4CHJ A;  4KDI C;  2N23 A;  2V76 A;  3M1I B;  3CST A;  2N1W A;  3QK0 A;  5C23 A;  1LB1 A;  2V1Y A;  2K2J A;  1MK9 B;  2FJL A;  1ZC4 B;  2AL3 A;  4MH0 E;  1WM2 A;  2YT1 A;  2D3G A;  3OAW A;  1Q0W B;  4TYZ A;  2IFS A;  4EOY A;  4B6W A;  5EDS A;  2AL6 A;  2R09 A;  2GOW A;  4GN1 A;  3UF8 A;  3ZW3 A;  2I5F A;  1ZC3 B;  2LVO A;  5DPT A;  5G2N A;  2MDX A;  1TTN A;  4GOC A;  1PQS A;  1KOT A;  2JT4 B;  4LDT D;  3H6N A;  4P7I A;  4F7H A;  2LXC A;  3VHT C;  1NI2 A;  4JIO U;  1K5G B;  5DCN A;  4DHJ D;  4F7G A;  4K2O A;  3T06 A;  1ZSQ A;  1WX8 A;  1CMX B;  5DIF B;  1WG7 A;  3D8F A;  2KZR A;  2NMB A;  1I42 A;  3H7S A;  2JF5 A;  4KHA A;  1FAO A;  3DBH I;  1WXM A;  3TMP B;  4EEW A;  1LM8 B;  2O6V A;  3ZTD A;  2LGD A;  2OTX A;  2N1V A;  4HB0 B;  3A1Q A;  1V81 A;  2DA0 A;  1QZE A;  3L16 A;  3IBE A;  2V3S A;  2RGN B;  1B55 A;  4HHV A;  4NPN A;  1P98 A;  2IO3 B;  3HIZ A;  3P7Z A;  1E7V A;  2BKR B;  5JH5 C;  4DX8 A;  2Z0O A;  2I5C A;  3AI5 A;  3PEG A;  4I6P A;  1U5F A;  1GC6 A;  2MX2 A;  1GG3 A;  1LXD A;  2KMC A;  3SO6 A;  2MCN B;  4HAU B;  1C1Y B;  3AUL A;  2YS5 A;  4A6H A;  3VQI A;  2D07 B;  1FHO A;  3C0R B;  5KHO A;  1HB6 A;  2PEA A;  3EC8 A;  2LRU A;  3CXB B;  2LG1 A;  4II2 B;  3B0A A;  4YL8 A;  1HE8 A;  1MAI A;  4GB9 A;  1WF9 A;  3TFM A;  2CR5 A;  1WVH A;  4XWX A;  3VDZ A;  3BJI A;  1DDM A;  4HAX B;  4W9I A;  4N9F 4;  3W1S C;  4GGQ A;  1WX9 A;  3WAN A;  3IHP C;  1IP9 A;  3CF6 E;  3UIO B;  3ZNG C;  2DHJ A;  5GMV A;  2CB8 A;  1V5O A;  3NSU A;  4W9G A;  4AJY B;  4GMX B;  5CTR C;  3SHQ A;  2LI5 A;  1YX5 B;  3A9J B;  4I6N B;  1Y19 B;  2JZ3 B;  1E8W A;  4E74 A;  1YIW A;  2R0D A;  1E90 A;  4HDO A;  3QWM A;  4IWQ A;  1U5G A;  2YT0 A;  1EVH A;  3DVN U;  3DVN V;  3PHW B;  3ODW A;  1W1D A;  2Y5B B;  4W9J A;  4C0A A;  2LOZ A;  4NQK E;  2LJ5 A;  1U29 A;  1S1Q B;  3ENE A;  5DPR A;  1F9J A;  2KTR A;  3VH3 B;  4GU2 A;  3O65 B;  4MSQ B;  4BBN F;  3APD A;  2I1J A;  4NAW A;  3R7R A;  2Z59 B;  2B3A A;  3ML4 A;  3M3J A;  2MBB B;  3PVU A;  3QHT A;  1YD8 U;  3TL5 A;  1WJM A;  1KJT A;  1V5M A;  1MK7 B;  2P0F A;  2ZVN A;  2RVB B;  2DYM A;  4AP4 C;  1SGH A;  2HTH A;  3PT2 B;  4LCD E;  4H8S A;  2PJH A;  1I2H A;  3A9K B;  1Z2M A;  3F5R A;  1IYF A;  2QKM A;  4B6H A;  2IY0 B;  3I3T B;  2KWC A;  1BT0 A;  1X1G A;  2LRW A;  4FA6 A;  2N9P C;  4K7U A;  1E7U A;  2YSZ A;  2O6V B;  2R2O A;  2KFK A;  2JWZ A;  4NQL B;  3A1Q B;  2MBE A;  4G50 A;  1KM7 A;  4BOZ B;  5JHH A;  4DDG D;  1X05 A;  3L54 A;  4EKU A;  2JXX A;  2XK5 A;  5E6N A;  4ZRJ A;  5CHW A;  1XOD A;  1WI0 A;  4AUQ C;  2JPH A;  2MFQ A;  2K25 A;  1HB8 A;  4BKG A;  2L1C A;  4PS3 A;  2DZM A;  3ML9 A;  2KAN A;  2NR2 A;  3SNH A;  2MLB A;  1XT9 B;  4KIK A;  3FLV A;  4PS7 A;  1UEL A;  3ECI A;  2P8V A;  2DHZ A;  3L10 B;  3H9D A;  2RSG A;  3IG3 A;  4BBN C;  2J0K A;  2C5L C;  4MEL A;  2K1F A;  1LQB A;  4HCN B;  1ZVR A;  2LUL A;  2DKQ A;  2DAF A;  4PNK A;  2KDI A;  4HLE A;  2K8H A;  5D3Y A;  3JVZ X;  2DYO A;  1UH6 A;  1VCB A;  4ZYN A;  2ZCB A;  3DOW A;  1WI1 A;  1V61 A;  2KDF B;  5CLL B;  2JUO A;  3KZ1 A;  1ZM0 A;  5LON B;  2J0J A;  1WGR A;  2J7Q B;  2KKC A;  4HB2 B;  3VTW A;  3WAP A;  3QX1 A;  2X18 A;  3ZDM C;  2KFJ A;  3KUZ A;  2MWS B;  3KRX A;  2KQ7 A;  3VTV A;  5J3T A;  2IYD B;  3DXC A;  2DZJ A;  3G9W A;  1SE9 A;  4GDK A;  1FGZ A;  4MGK E;  1WGH A;  1T0Y A;  3VVW B;  4IM0 A;  3H1U A;  3S2A A;  3PHX B;  4TQ1 A;  4OVU A;  1V2Y A;  1SHC A;  2D2Q A;  1WY8 A;  2KTR B;  1P1A A;  4DBB A;  1P3R A;  4WJO A;  1PMS A;  2LD9 A;  1PLS A;  3RD2 A;  5LLI A;  2CY4 A;  2L0F A;  2L05 A;  4K7W A;  2KQS A;  2BYV E;  2D10 A;  5G55 A;  3QWZ B;  3HW2 B;  4JGH B;  3GZN I;  4AOF A;  1X11 A;  3FEH A;  4IFS A;  3BY4 B;  2BYF A;  2L0T A;  2HTH B;  3UIP B;  2N9E B;  1VD2 A;  1P9D U;  3WAM A;  4Y94 A;  3RT3 B;  3AU5 A;  3KYD D;  5C5B B;  1BTK A;  1BAK A;  1Q1O A;  3EFU A;  4OVV A;  4PQ0 A;  1OEY J;  2FAZ A;  3NOB A;  5J18 A;  3TIX A;  4W9F A;  1OMW A;  5KQ4 A;  4ICV A;  2KJ6 A;  2BKF A;  1E8Z A;  1EAZ A;  4Z2M B;  2XEW A;  4KZC A;  3V62 A;  4TUU A;  2G45 B;  1WJN A;  2BF8 B;  1OQY A;  4EMO A;  3ZVR A;  4JQW C;  1DYN A;  3A4R A;  3R3M A;  4FJZ A;  3CIK A;  1BWN A;  2EKE C;  2KN5 A;  3PGE A;  4KVG B;  4KIK B;  2ZNV C;  1PFJ A;  2ZEQ A;  5AZF A;  1FHX A;  1LFD A;  2ZVO A;  3V60 A;  4GZU A;  2KO3 A;  2J0M A;  3QAQ A;  3L13 A;  3GYO A;  3A9J A;  3PG7 A;  3LJU X;  3UQB A;  4DK5 A;  2H7E A;  2ZPN A;  2LUE A;  1DDV A;  2Z0E B;  4HPM B;  5KCV A;  4M0W B;  1DRO A;  2JRI B;  3VOQ A;  2KDB A;  2PPH A;  1WGG A;  3W1Y A;  3PRP B;  2L2I A;  3HHM A;  2PE9 A;  4HJK A;  3UGB B;  3U8Z A;  4AWJ A;  3H7P B;  1TQZ A;  4I6L B;  5JLJ B;  2KOX A;  4GDK B;  4WSF A;  1WR1 A;  4NJ7 A;  4W9K A;  2QKL A;  1WR6 E;  3AJ4 A;  1WE7 A;  2MSE D;  2IBI B;  3MPX A;  2XBB C;  3A9K A;  5IA7 A;  2WDT B;  1NTV A;  5HKH A;  2K8C A;  2FCM A;  3FM8 C;  2MBQ A;  2GMI C;  3DCG A;  4GPT B;  2Y7B A;  1S3S G;  3KH0 A;  5D3W A;  1E8Y A;  2HJ8 A;  2NZ8 B;  2Z0D B;  5D3X A;  1WZ3 A;  3ODO A;  1IRS A;  3N30 A;  4IUM B;  4PYU A;  4EUT A;  3PSC A;  1P6S A;  1BTN A;  2YS3 A;  3DPD A;  2Y8F A;  1UNP A;  1YQB A;  4KZ0 A;  2GBJ A;  2VSZ A;  1WZ0 A;  5AZH A;  3KY9 A;  5D27 A;  5DHF B;  2COD A;  1Z5S B;  1M94 A;  1FXT B;  3LDZ E;  2W9N A;  3PLV A;  3ODX A;  3KSY A;  3D8E A;  5HE0 A;  3VUY A;  1G6J A;  3Q3J A;  1TBE A;  2MA9 B;  3WAL A;  3SD5 A;  2WH5 A;  5J2R A;  3GOE A;  3EPY A;  2LZ6 A;  1HBK A;  2O2V A;  3NZU A;  5L95 C;  2P0D A;  2ROV A;  1AQC A;  4TKN A;  4M8N A;  2ZJD A;  4MK0 A;  1MIX A;  2D9X A;  4MGI E;  2LVQ A;  1U5D A;  2BPS A;  4DDI D;  3WIM A;  1KLV A;  2CKH B;  3VH4 B;  2COC A;  2WX1 A;  4HDQ A;  2N9X A;  4TV3 A;  3OJ4 B;  3PP2 A;  3DVG Y;  4IM3 A;  1AAR A;  2LOX A;  3P6A A;  3NS8 A;  1I35 A;  3RCZ A;  1U27 A;  2BWE S;  5LXH A;  3OJ3 A;  2DHK A;  1Z87 A;  4A20 A;  3V61 A;  3ZRC A;  2CY5 A;  3LJ3 A;  4KSL C;  2LGY A;  1UPQ A;  1XKE A;  3VUW A;  1EGX A;  5L83 A;  2ZCC A;  1WGY A;  1GUA B;  3DBS A;  2JP2 A;  3OAN A;  1V49 A;  1H10 A;  2E2X A;  3DXE A;  2W2X D;  5JHB A;  4FBJ B;  2DZK A;  5LOP B;  3VFK A;  2KJR A;  3PSE B;  2DFK A;  1UNR A;  1V9J A;  4TQ0 A;  5FI1 A;  5LXI B;  1V5P A;  4GDL B;  4HCP B;  3MDB C;  2ELA A;  2G4D B;  1NU2 A;  4KV2 A;  2A4Z A;  5DPS A;  4BFR A;  1Q5W B;  1XQQ A;  2L8J A;  4JLC A;  3SU8 X;  3NY5 A;  1J0W A;  5GOW B;  5C5B A;  5DHA B;  4E71 A;  2MBO A;  1WM3 A;  1P5T A;  5KQ1 A;  4NSW A;  4GIV A;  4KHB B;  2KTF A;  3L17 A;  2C7M B;  4DHJ B;  3GYP A;  3HM6 X;  2RNR B;  4G11 A;  2ROZ B;  4HAV B;  4X57 B;  4WAA A;  1RRP B;  2YLM A;  4II3 B;  2FCN A;  3A8P A;  1TGZ B;  1U5E A;  1EF1 A;  3RUI B;  5DI9 B;  4BKS A;  1OTR B;  1LW3 A;  3A4S C;  1TZ1 A;  2VRR B;  4F8C B;  1V88 A;  1MKE A;  2DHI A;  2GBR A;  2HRJ A;  4ANX A;  3TJP A;  1XR0 B;  4ICU A;  4MJS A;  2D9V A;  2RPQ A;  3MHS D;  2O2V B;  5CLQ B;  2KLC A;  1NTI A;  2V4L A;  4W9E A;  1OGW A;  2LGX A;  2VRW B;  2D9Z A;  4KHO A;  3N32 A;  5D2M B;  1Y8R C;  4ANW A;  5AEK B;  2KMA A;  5DH9 B;  2NVU I;  2Z0Q A;  2LXA A;  5HE3 A;  1H4R A;  2IO2 B;  2D11 A;  3R7Q A;  2PZ1 A;  3CSF A;  3PVW A;  4MGZ E;  2K2U A;  4IOY X;  4W9L A;  3UIN B;  3D32 A;  3V6E B;  2MP2 A;  1MPH A;  3EEC A;  3JSV A;  4HAW B;  2EMS A;  2KC2 A;  4ZRK A;  3ULC A;  2GCJ A;  5KHQ A;  3H7P A;  4GSW A;  2G35 A;  2UVM A;  3ZUN A;  3HM3 A;  1X1F A;  2WYQ A;  2WWZ A;  2DYB A;  1UEF A;  4DXA B;  2M38 A;  1MIZ B;  5CHV C;  3QIJ A;  2AYO B;  2NS5 A;  1A5R A;  3UZT A;  1WXA A;  4ZRI A;  4WJ7 A;  4HWI B;  2OQB A;  2RUK B;  5JHG A; 
#chains in the Genus database with same CATH topology
 2LKO A;  2W2W A;  3F0W A;  2M8S A;  2LAS A;  3U4E G;  1WJ4 A;  3DBR I;  3GB1 A;  3L08 A;  4ARI A;  2KUP A;  2WDR B;  3ZLZ A;  5HE2 A;  3AXC A;  3U7D A;  1FFU A;  1JRU A;  2RPV A;  1FHW A;  2YF0 A;  1DBH A;  4ARC A;  4AS1 A;  2DN6 A;  3VR8 B;  1HXY D;  2RQ1 A;  5J17 A;  1Q67 A;  1L4D B;  2W54 A;  1NEN B;  3B1L X;  1XXG A;  1WYW B;  2K3U A;  4DHZ B;  2MRP A;  2KX0 A;  4G0N B;  1WIA A;  1I4X A;  4FUL A;  1VBG A;  2KCJ A;  4HAT B;  1C3T A;  4IDI A;  5HHD G;  2CU3 A;  1KZ7 A;  3MJ5 A;  2BB5 A;  4ITK A;  5BO4 B;  2DKP A;  3HK0 A;  4WJP A;  4FHK A;  1WGK A;  3IT4 B;  3QQ8 B;  2M14 A;  1WE6 A;  4AJW A;  3PPA A;  5JXV A;  4FJV B;  1K52 A;  4WVF B;  1WFY A;  5FKA C;  1WRD B;  2N7D A;  4IAP A;  4FHJ A;  2RLO A;  4NAM A;  1K53 A;  3AEE B;  1E8X A;  2LWP A;  1XF5 L;  2IPK D;  2QHO A;  3ML8 A;  3PS6 A;  2M0X A;  3TEX A;  4ZYS A;  3P4Q B;  5J3Y A;  3NUH B;  4MT7 A;  5TR5 A;  3O13 A;  3BII D;  4K17 A;  1X1M A;  4HB4 B;  1JRO A;  1L5P A;  4TSS A;  1ZYI A;  1M7R A;  4XZ4 A;  1V89 A;  3T9L A;  3WA0 A;  3W1S A;  2NBV B;  1DGJ A;  3V6C B;  4BVU C;  1WGQ A;  1X86 A;  1N61 A;  3CIR B;  3Q3O C;  2ASQ A;  3L0W B;  4K1R B;  1DOY A;  2RRF A;  3SR6 A;  2G3Q B;  3VUX A;  4LJO B;  2J59 M;  2ZZP B;  2K39 A;  1WYG A;  3ALB A;  2EMT A;  2FDQ A;  2R2Q A;  2RSU A;  3U30 A;  1K8R B;  4IKG A;  1E5W A;  2CQU A;  2YEP B;  1WX7 A;  3BYT B;  1KTK A;  1XD3 B;  3HQC A;  4BOS C;  3P4R B;  4MT5 A;  2XN9 C;  1IGD A;  4XC2 A;  4K7S A;  4ZHO A;  4ZOH C;  4MJS B;  4F1S A;  1L7Y A;  1B9R A;  3T3N A;  1XCQ L;  3AE9 B;  1N60 A;  4C00 A;  2C60 A;  5HI1 A;  1V80 A;  3RN9 C;  1P0R A;  2IY1 B;  2YS1 A;  2UWQ A;  4MEM A;  3KWL A;  5IN7 A;  2PVO D;  4QXA B;  1MG4 A;  1KI1 B;  3MJW A;  4RMA A;  5E6P A;  4JKE A;  3PTF C;  3R66 C;  4IOI E;  1I4Q A;  2DX5 A;  2BTE A;  1IPG A;  1KZG A;  4XE0 A;  5BYS A;  1GB1 A;  4XX5 A;  1N3H A;  4M02 A;  4B95 A;  2MBH A;  2H88 B;  2UZR A;  1SSN A;  4LJP B;  1SE4 A;  2Z14 A;  1D5Z C;  1ZOY B;  1OY2 A;  1H8C A;  2CHX A;  5D94 A;  3A33 B;  2MP2 B;  3KW5 B;  1T0R C;  2KHW B;  1TKG A;  2LFI A;  4JKH A;  5CX3 A;  3JSV B;  1SJE D;  1MHX A;  1XLQ A;  4M8M A;  2K6Q A;  3BIN A;  2FNJ B;  2RR9 A;  3NWA A;  4F7Z A;  2Y8G A;  3E9P A;  2AQ2 B;  3O96 A;  2PE6 B;  1WXS A;  4LNI A;  4JK9 A;  2NBW B;  4BKT A;  5C6R A;  3VXW A;  4RM8 A;  1WSP A;  3NRZ A;  3VTU A;  2BYT A;  3KYC D;  3MFG A;  4ILG B;  4GDL A;  2FIF A;  1YJ1 A;  2L7R A;  2O6V D;  2GBK A;  1DIK A;  4S0R A;  1DOI A;  4WJQ A;  1ENF A;  3BVG A;  4A5K A;  2D9Y A;  2FE8 A;  4US8 A;  4L2Y A;  3RFZ B;  1UUP A;  2FUG 1;  2SAK A;  5BMI A;  1V6E A;  1MJD A;  5IP4 D;  2WP9 B;  3NZS A;  3EFC A;  3HIE A;  2OJR A;  3AEC B;  5FI0 A;  2FJ9 A;  1R4M I;  4WAF A;  1ST7 A;  2MEK A;  1D5X C;  3AEG B;  5FR6 A;  2Z13 A;  2KXJ A;  2N7E A;  4FXC A;  5I4D A;  2C7H A;  1RAX A;  2BYE A;  1EUV B;  4B0M A;  1Y5O A;  5MPO A;  2KWD A;  4CYE A;  2LYD A;  1HTO A;  3SV1 A;  1WH3 A;  1WJ6 A;  2PIA A;  2KGX B;  1C4P A;  3JYU A;  1L2N A;  2INP E;  1QQG A;  4MDK E;  1RFA A;  2JZP A;  2JVC A;  3PV1 A;  1QC6 A;  3DDC B;  1F2R C;  5I2M A;  2CAY A;  2L00 B;  2A5U A;  2M56 B;  5IJM A;  4A6F B;  2KDE B;  2ZPY A;  3R2T A;  3WYF B;  3EHV A;  1XX0 A;  2UU7 A;  2GBN A;  1FB8 A;  2COF A;  4FN2 A;  2DYQ A;  4EZL A;  1NVL A;  3N3K B;  1NYR A;  5EE0 A;  4HPL B;  5C16 A;  2RD0 A;  4ZRQ A;  4HRO A;  1ACA A;  3FSS A;  3KQ4 A;  1JWS D;  3AEF B;  5I2S A;  5HG2 A;  1GC7 A;  2WXJ A;  3BWU D;  3KVF B;  1AYF A;  2GCL A;  2J52 A;  4LLG M;  3X23 A;  2ZKM X;  2WXF A;  3KUD B;  1RJ2 A;  3P2B A;  4M00 A;  3TBL D;  3U7Z A;  3AE1 B;  2LHE A;  2DLB A;  2DX1 A;  3V5W A;  2K00 A;  2GJY A;  1P7F A;  1YQ4 B;  3GE3 C;  4JE3 B;  1J7B A;  3RZF A;  5C79 A;  1WGD A;  1YJJ A;  4EZK A;  2MJD A;  3ZIM A;  3PLU A;  3ZO5 B;  2KX3 A;  4WJN A;  3ZTC A;  3DXD A;  1C78 A;  5JZE B;  5C1Z A;  3DBL B;  3AU4 A;  2M4N A;  3M95 A;  3TCA A;  4MM3 A;  1M7E A;  1DDW A;  2UZS A;  4FAD A;  1WMH B;  2CU1 A;  4QJ3 B;  1N63 A;  3DBL I;  3QAR A;  4RGM A;  3IFW B;  2IYB A;  2FCS A;  1GPX A;  1N62 A;  4L6E A;  2QJL A;  2I2Y A;  2I1K A;  3NHE B;  3PRE A;  1UNQ A;  1EU3 A;  1J0G A;  4IC7 B;  3ONS A;  4ASW C;  5IAA C;  1V1P B;  2DX5 B;  1TKY A;  1UBQ A;  1V5U A;  2G9H D;  2L3Z A;  3K9O B;  3APF A;  3RCP A;  2FID A;  2WU2 B;  1FNU A;  2AWT A;  3SUZ A;  1ZKH A;  1ZGU B;  4HAZ B;  3HRD D;  2HD5 B;  2ZW1 A;  4BAX A;  2HE7 A;  3M63 B;  3KRW A;  1E6E B;  3Q3F A;  2IO1 B;  2MQJ A;  1XCG A;  2P0H A;  3JW0 X;  4EZJ A;  2KD0 A;  1U4A A;  2BGF A;  3QC8 B;  3U52 E;  2NCN A;  1NTY A;  3UI3 A;  1ZXI A;  2LVP A;  3AE2 B;  2LBB A;  1W1G A;  1VR9 A;  2WXI A;  4JKC A;  3RUL A;  1OEY A;  4HSI A;  3RZW C;  4EFO A;  4ANV A;  2H7D A;  2VH1 A;  2LGS A;  2DYN A;  3RYT A;  4CO7 A;  3Q3M C;  2L32 A;  1J8C A;  1FGY A;  1V5T A;  3LXF A;  4KSK C;  2VH2 A;  2K6D B;  2KNB A;  1ACC A;  2N0S B;  1U2B A;  1F52 A;  2JQR B;  2K8B A;  4MGY E;  1WJU A;  2N4F A;  3TUO A;  4ANU A;  5CHF A;  1MG8 A;  5HE1 A;  4DX9 0;  4K3B A;  1T0Q C;  3ULB A;  4IM2 A;  4IG7 B;  2LUM A;  4HVB A;  1AWD A;  2NTS A;  3DWG C;  3OG5 A;  2CS4 A;  1SIF A;  1VLB A;  4KAX B;  1UNS A;  3AV8 A;  3DQV A;  1ZUD 2;  2IZV B;  1IUE A;  4K3C A;  4IWP A;  2ABD A;  4JX1 C;  1FXI A;  3ZYY X;  1SIJ A;  4CHM A;  4LDT B;  3TW1 A;  2NPT A;  4PYZ A;  5D3V A;  2D4Q A;  2BWF A;  3FP5 A;  2AEH A;  2EJ8 A;  1JDE A;  1UD7 A;  1JML A;  3PZD A;  3KUC B;  2DZI A;  2QSD A;  4DBG A;  4DWF A;  1D3Z A;  3W9C B;  4KKI A;  1ZW7 A;  4EJN A;  4A3P A;  4BKS D;  2CHW A;  5C2T B;  2K0P A;  1PDX A;  2INN E;  1XLO A;  4W9C A;  3SYX A;  2C9W B;  1QOB A;  3WAO A;  4XDD A;  2JY6 A;  2WXP A;  3T8M A;  4RM9 A;  2WX0 A;  1PYW D;  2KWV B;  3E56 A;  4JKA A;  2COP A;  1WXV A;  2M17 A;  2IO0 B;  4MSM B;  1RWS A;  1UBI A;  2N0Y A;  2VKI A;  2R82 A;  4B9K A;  3W2D A;  1R4N B;  4Q2J A;  3X0W A;  1C77 A;  2BB6 A;  4K2P A;  5BYQ A;  1SF0 A;  1R4N I;  3QCA A;  2JZZ A;  4A6K A;  1GAQ B;  3A98 B;  4OZC A;  1EWY C;  3MTN B;  4LK0 M;  4A6Q A;  3Q2A C;  2UYZ B;  3TEY A;  1TJ6 A;  4RGT A;  2DTC A;  1I4H A;  4L23 A;  1K5D B;  3B08 A;  5LG4 B;  2QCZ A;  2C7N B;  1UGM A;  5L81 A;  4K81 A;  4WWP A;  5E6O A;  4GXB A;  2YRY A;  4NNJ B;  1WJ1 A;  1RLF A;  1FO4 A;  3I9V 1;  3CMM B;  4G3X B;  2JYE A;  4WH4 A;  2M1M A;  1NDD A;  1PGX A;  4DHZ E;  1TS3 A;  1ZP0 B;  2RGF A;  2GS0 A;  4KDL B;  4NY0 A;  3QBV B;  2XQN M;  3AB5 A;  1FEH A;  5JHA A;  3ZQ4 A;  2G4S A;  2KAC A;  3OLM D;  1VZ7 A;  2AQ3 B;  1QQR A;  2D9W A;  1EF5 A;  2WXH A;  2WXN A;  1P3Q U;  4LNN A;  4URK A;  5D3D A;  4NJ6 A;  3LB8 C;  3SDL C;  3ZNZ B;  1IBX B;  4HXD A;  2GBM A;  2KC1 A;  4WWN A;  4GNK B;  2WQY B;  1EWC A;  3SFE B;  3T3O A;  4JKG B;  2KK8 A;  4PS8 A;  3H8H A;  1HEZ E;  4IWO A;  3DBR B;  1FOE A;  1RRB A;  4MY6 A;  1NBF C;  4A3O A;  1WGU A;  2KJH B;  3ZDT A;  3ZJU A;  5D3I B;  4CHK A;  1ISN A;  4A9A A;  5H92 C;  4D6W A;  4YXD B;  2FUH B;  2JYT A;  2JXT A;  3A8Q A;  3M62 B;  3MC0 B;  1QF6 A;  1W1H A;  2MW5 A;  2KR0 A;  2KLG A;  2EC1 A;  2CRF A;  4HB3 B;  2CHZ A;  3ZNH B;  4NAW B;  4BBK A;  1UZX B;  2KWU B;  1KBL A;  4F7U P;  1ZXH A;  1GJZ A;  4YON A;  4W9H A;  1C9F A;  4HK2 A;  3QA8 A;  3AE7 B;  3QJZ A;  2K5P A;  5HFY A;  3AN1 A;  2ADZ A;  4FJY A;  1XD4 A;  2ZW0 A;  3AMZ A;  4A6F A;  2MWN B;  4YTP B;  3D8D A;  1V86 A;  1EO6 A;  4WWM A;  2DLW A;  3APC A;  4KGT A;  4HAY B;  4FLH A;  3UQA A;  4W9D A;  1D5M C;  3VAW A;  5DPW A;  4PT5 A;  3PRM B;  2W2X C;  4IW0 A;  4D0N B;  2NPT B;  2DAJ A;  2REX A;  3PVL A;  2GUM A;  3PRZ A;  3VIA A;  4US9 A;  4JWU C;  5D7G A;  2RDH A;  2FCQ A;  3ETR A;  3ZNI D;  5EFX A;  2GLS A;  1YX6 B;  3Q6B A;  2Q13 A;  5J3Q A;  1L6V A;  2KFK B;  1C76 A;  3Q8A A;  2MKR A;  2EKI A;  4XDC A;  3NVZ A;  1CK1 A;  1KLU D;  2XK5 B;  1YQ3 B;  3NS1 A;  2ELB A;  3W5U B;  1TY0 A;  2ZNV B;  2NBU A;  1VZ8 A;  4KGR A;  2PVG C;  4JL9 A;  2KIE A;  4P16 A;  2BCJ A;  3TO1 A;  2COA A;  1PUT A;  4WQO B;  1ET9 A;  1UPR A;  4Z2N A;  3DVG X;  2RMM A;  1AWE A;  3Q8F A;  3TVV A;  1OQN A;  5JP4 A;  1TXD A;  2Z0P A;  5TSS A;  3RI7 C;  1GOZ A;  3IVF A;  1WMH A;  2KVR A;  1YOV B;  3ZRF A;  1YJI A;  2WHI A;  4WWO A;  1J19 A;  1ET6 A;  1D4B A;  3K9P B;  2YVC A;  3ZXR A;  3ZVV A;  1FD6 A;  4LTU A;  4YSY B;  3N7C A;  4GMV A;  5AZG A;  2DEN B;  1GNU A;  2JRH A;  2ICI A;  2WXQ A;  5D6J B;  4E3C A;  4ZDV A;  4ZRP A;  2PMV A;  2VZK D;  5EE9 A;  2LGI A;  2M0A A;  4J6I A;  2L76 A;  1V1P A;  1I7A A;  2OOB B;  3ZKJ C;  4CHJ A;  4UDU C;  4OT1 A;  4KDI C;  4XGA B;  2N23 A;  2V76 A;  3M1I B;  1ZPS A;  3RNB C;  4C7Z A;  1TS4 A;  3CST A;  4MH8 A;  1ESF A;  3SEB A;  1AN8 A;  1GB4 A;  2N1W A;  4O1N A;  2Q5W D;  3QK0 A;  2DIK A;  5C23 A;  1LB1 A;  1EM7 A;  2K2J A;  2V1Y A;  4A8X C;  1MK9 B;  2FJL A;  1T6B X;  1TKE A;  1ZC4 B;  3ZJV A;  2AL3 A;  4MH0 E;  1WM2 A;  3A58 A;  1B1Z A;  2YT1 A;  2D3G A;  2D3A A;  3OAW A;  4JKF A;  1Q0W B;  4TYZ A;  2IFS A;  3RNC C;  4EOY A;  4B6W A;  5EDS A;  2KVZ A;  3RPF C;  3Q14 C;  2AL6 A;  3HVZ A;  2R09 A;  2GOW A;  4GN1 A;  3UF8 A;  5IRS A;  2I5F A;  3ZW3 A;  2HJ1 A;  1ZC3 B;  2LVO A;  5DPT A;  5G2N A;  2OHF A;  2MDX A;  1TTN A;  5BYR A;  4GOC A;  2DBY A;  1PQS A;  1KOT A;  2JT4 B;  4LDT D;  2KIG A;  3H6N A;  4P7I A;  4F7H A;  1R4M B;  2X8X X;  2LXC A;  3VHT C;  1NI2 A;  4JIO U;  4C4V A;  1K5G B;  2N9L A;  3MC8 A;  5DCN A;  4DHJ D;  4F7G A;  4K2O A;  1OQQ A;  1R7S A;  3T06 A;  1ZSQ A;  1WX8 A;  4HKZ E;  1CMX B;  4LNK A;  3DBH B;  5DIF B;  1WG7 A;  3D8F A;  2KZR A;  1YN5 A;  2NMB A;  1I42 A;  3H7S A;  2JF5 A;  4KHA A;  1FAO A;  3DBH I;  1WXM A;  1XEE A;  1JCK B;  1DYQ A;  3TMP B;  4EEW A;  1VRA B;  1LM8 B;  3N1X C;  2O6V A;  2WXO A;  3ZTD A;  1QT9 A;  2LGD A;  2OTX A;  2N1V A;  3Q69 A;  4HB0 B;  3A1Q A;  1V81 A;  2DA0 A;  1QZE A;  3L16 A;  5T8I A;  3IBE A;  2V3S A;  1OQR A;  2RGN B;  1F2R I;  1B55 A;  2OED A;  4HHV A;  4NPN A;  1P98 A;  2IO3 B;  4YT0 B;  3HIZ A;  3P7Z A;  1E7V A;  2IND C;  2BKR B;  5JH5 C;  4DX8 A;  2Z0O A;  2I5C A;  3AI5 A;  1JAL A;  3PEG A;  4I6P A;  1U5F A;  1GC6 A;  2MX2 A;  1GG3 A;  1LXD A;  2KMC A;  3SO6 A;  2Z4D A;  2MCN B;  4HAU B;  2OJW A;  1C1Y B;  3AUL A;  5E6J A;  2YS5 A;  4A6H A;  3VQI A;  3VR9 B;  4RCO A;  2FJU B;  2D07 B;  2H89 B;  4KKJ A;  1KC7 A;  1FHO A;  1CZP A;  2WDV B;  3C0R B;  5KHO A;  1HB6 A;  3P42 A;  1WWT A;  2PEA A;  3NVV A;  3EC8 A;  1FXA A;  2LRU A;  1C79 A;  1PFD A;  3CXB B;  2LG1 A;  4II2 B;  3B0A A;  4YL8 A;  1N5W A;  1HE8 A;  4USA A;  1FCL A;  1MAI A;  3FAH A;  3MC9 A;  4GB9 A;  1WF9 A;  3TFM A;  2BVC A;  2DWQ A;  2CR5 A;  2WS3 B;  1WVH A;  4XWX A;  3VDZ A;  3BJI A;  1DDM A;  4HAX B;  3IAS 1;  3GP7 A;  4W9I A;  4N9F 4;  3NWD A;  3Q8C A;  3W1S C;  4OZA A;  2KDM A;  4GGQ A;  3MHZ A;  4XWT A;  1L0V B;  1WX9 A;  4N59 A;  3WAN A;  3IHP C;  1IP9 A;  1L0X B;  2MJ3 A;  3CF6 E;  3UIO B;  3IXS A;  3ZNG C;  2DHJ A;  3ENB A;  3AE6 B;  5GMV A;  1MI0 A;  2V0G A;  2CB8 A;  2EEL A;  1V5O A;  3NSU A;  4W9G A;  2GB1 A;  4AJY B;  4YTN B;  4OVZ A;  4GMX B;  5CTR C;  3N20 C;  3SHQ A;  2TSS A;  2KT7 A;  2G1E A;  4D2K A;  2E6X A;  3U2S C;  4JK7 A;  4HPP A;  3PZ8 A;  1TY2 A;  2LI5 A;  1IBX A;  1YX5 B;  3A9J B;  4I6N B;  1Y19 B;  3AE4 B;  2JZ3 B;  1E8W A;  4E74 A;  1YIW A;  2R0D A;  1QOF A;  1E90 A;  3AEA B;  4JKG A;  4HDO A;  3QWM A;  3SBT A;  4R3D A;  4IWQ A;  1U5G A;  2YT0 A;  1EVH A;  3DVN U;  3DVN V;  3PHW B;  3ODW A;  1W1D A;  2Y5B B;  4W9J A;  1ZE3 D;  2IGH A;  4WQM A;  2HDE A;  4C0A A;  1SE2 A;  2R2Y A;  4RGN A;  2ONQ A;  3ZXV A;  2LOZ A;  4NQK E;  2LJ5 A;  1U29 A;  1S1Q B;  1N6Z A;  3ENE A;  5DPR A;  4DXG A;  1F9J A;  2KTR A;  2M19 A;  3VH3 B;  4GU2 A;  3O65 B;  4MSQ B;  4BBN F;  1L6U A;  3APD A;  2I1J A;  4KGS A;  1J7A A;  4NAW A;  1E10 A;  1QKZ A;  2WLB A;  3R7R A;  2ACZ B;  2FBW B;  2Z59 B;  4GOU A;  2B3A A;  3ML4 A;  1TIF A;  1WXQ A;  3AM9 A;  5LNK 1;  3M3J A;  2MBB B;  3PVU A;  2HTM E;  3QHT A;  1YD8 U;  3TL5 A;  3OHM B;  1WJM A;  2GRI A;  1KJT A;  1V5M A;  1MK7 B;  2JX5 A;  2P0F A;  2WXL A;  3R2I A;  2ZVN A;  2RVB B;  4C4V B;  2DYM A;  3B77 A;  4AP4 C;  1SGH A;  2HTH A;  3PT2 B;  4LCD E;  2E3T A;  4H8S A;  2PJH A;  1I2H A;  2GI9 A;  3DWM A;  2KN4 A;  3A9K B;  3I57 A;  1Z2M A;  3F5R A;  1IYF A;  2QKM A;  4B6H A;  2IY0 B;  3I3T B;  3E9O A;  2KWC A;  1RYJ A;  1QIL A;  4AQ7 A;  1BT0 A;  1X1G A;  2KUQ A;  2LRW A;  4FA6 A;  2N9P C;  4K7U A;  1E7U A;  2YSZ A;  2O6V B;  2R2O A;  1JQ4 A;  2KFK A;  2JWZ A;  2QIE B;  4NQL B;  3A1Q B;  2MBE A;  4G50 A;  1KM7 A;  3SFD B;  4BOZ B;  5JHH A;  3HVD A;  4DDG D;  1X05 A;  3L54 A;  3Q8B A;  3NVW A;  4EKU A;  2JXX A;  3RNF C;  4A55 A;  1LGR A;  2XK5 A;  5E6N A;  4ZRJ A;  1SBB B;  5CHW A;  2MHJ A;  1XOD A;  1WI0 A;  3DHH C;  1JW9 D;  2NMQ A;  1KF6 B;  4AUQ C;  3OWE B;  2JPH A;  1UGJ A;  2MFQ A;  2K25 A;  1HB8 A;  4BKG A;  2L1C A;  1FCC C;  4PS3 A;  5BMH A;  3NWF A;  2DZM A;  3ML9 A;  4C7Y A;  1AW7 A;  3FC4 A;  2W3R A;  2KAN A;  2NR2 A;  2LEK A;  2W3S A;  3SNH A;  2MLB A;  3CWI A;  1XT9 B;  4KIK A;  3FLV A;  4PS7 A;  1UEL A;  3ECI A;  2RDG A;  2P8V A;  2DHZ A;  1RM6 C;  1TS2 A;  3L10 B;  3H9D A;  2RSG A;  2V9H A;  3IG3 A;  3V05 A;  4BBN C;  2J0K A;  2C5L C;  4MEL A;  2K1F A;  1LQB A;  1T5X D;  2L52 A;  4HCN B;  3B9J A;  4BZA A;  1ZVR A;  2LUL A;  2DKQ A;  2DAF A;  3NW8 A;  4PNK A;  2KDI A;  4HLE A;  2K8H A;  1TYG B;  4NZL B;  5D3Y A;  2QDF A;  1JWU D;  3JVZ X;  2DYO A;  3E9S A;  3RNG C;  1UH6 A;  1VCB A;  4ZYN A;  2ZCB A;  3DOW A;  1WI1 A;  1V61 A;  2KDF B;  5CLL B;  1Y56 A;  2J53 A;  4JWS C;  4JK8 A;  2XNA C;  3C19 A;  4M0W A;  1VZ6 A;  5AUK A;  1JWM D;  2KAJ A;  2V3N A;  2JUO A;  3KZ1 A;  4JKB A;  1ZM0 A;  4QJ4 B;  5LON B;  4PK1 A;  2J0J A;  1WGR A;  2J7Q B;  3AE8 B;  1DOX A;  2KKC A;  4HB2 B;  1UF0 A;  3VTW A;  4WIP A;  1LO5 D;  3WAP A;  3QX1 A;  1MHH E;  2IJ0 A;  2X18 A;  2CJN A;  3ZDM C;  2KFJ A;  3KUZ A;  2MWS B;  3KRX A;  2KQ7 A;  1N5X A;  4OW0 A;  3VTV A;  5J3T A;  2IYD B;  3DXC A;  2WU5 B;  3AEB B;  5M4Y B;  1A70 A;  2DZJ A;  3G9W A;  1SE9 A;  4GDK A;  1FGZ A;  4MGK E;  1WGH A;  1T0Y A;  3VVW B;  4IM0 A;  3H1U A;  3S2A A;  3AE3 B;  4OSN A;  3PHX B;  4TQ1 A;  3J9C A;  3N1Z C;  4OVU A;  1V2Y A;  4N58 A;  1SHC A;  2D2Q A;  1WY8 A;  3RNE C;  3N1Y C;  1YNT E;  2IGD A;  4JPS A;  2AX5 A;  1FM0 D;  2KTR B;  4P1C C;  1P1A A;  4DBB A;  1P3R A;  4WJO A;  1PMS A;  2YEP F;  2LD9 A;  1PLS A;  1FIQ A;  5G5H A;  3RD2 A;  1FNV A;  5LLI A;  2CY4 A;  2L0F A;  2L05 A;  2QEJ C;  1OFF A;  2J42 A;  4K7W A;  4QJ5 B;  4REZ A;  1XCT L;  2KQS A;  3TEW A;  3GZN B;  2BYV E;  2K8E A;  2WGS A;  2D10 A;  5G55 A;  3QWZ B;  4DXF A;  3HW2 B;  4JGH B;  3GZN I;  1NVI D;  4TMA B;  4AOF A;  1X11 A;  3NJT A;  3FEH A;  2MJE A;  4IFS A;  4B0E A;  3BY4 B;  2BYF A;  2L0T A;  2HTH B;  1NYQ A;  4J3O D;  3BVM A;  5AUI A;  4M01 A;  3UIP B;  2N9E B;  1VDV A;  1VD2 A;  1P9D U;  2I38 A;  2SEB D;  3WAM A;  4Y94 A;  3RT3 B;  3AU5 A;  3KYD D;  3BVZ A;  1TZO A;  4WUR A;  3TEZ A;  5C5B B;  1BTK A;  1D6E C;  2AQ1 B;  1BAK A;  3SBG A;  2X0S A;  1Q1O A;  3EFU A;  4OVV A;  3EUB 2;  4PQ0 A;  1OEY J;  2FAZ A;  3NOB A;  5J18 A;  1SE3 A;  3P4P B;  3TIX A;  2WDQ B;  4W9F A;  1YMH E;  1OMW A;  5KQ4 A;  4ICV A;  2KJ6 A;  2BKF A;  5BMG A;  1E8Z A;  1EAZ A;  4Z2M B;  1FRR A;  2XEW A;  4KZC A;  1SXT A;  3I63 C;  3R8B A;  3V62 A;  3Q3N C;  4TUU A;  2G45 B;  1WJN A;  2BF8 B;  1F0Z A;  2L83 A;  3EA6 A;  1OQY A;  4EMO A;  3ZVR A;  4JQW C;  1DYN A;  3A4R A;  3R3M A;  4FJZ A;  3CIK A;  1BWN A;  2EKE C;  3AED B;  1MI1 A;  3FIL A;  1KH0 A;  4L1B A;  2KN5 A;  3PGE A;  2Y3A A;  4ACF A;  3EGR A;  4KVG B;  4KIK B;  1T3Q A;  2PTL A;  2ZNV C;  4EE2 A;  1PFJ A;  2ZEQ A;  5EE1 A;  5AZF A;  1FHX A;  1UWM A;  1LFD A;  1KFY B;  2ZVO A;  2D5G A;  4CSQ A;  2QMT A;  1TJE A;  3V60 A;  2KO3 A;  4GZU A;  2J0M A;  4ILH A;  3FKY A;  3QAQ A;  3L13 A;  4NJC A;  3GYO A;  3A9J A;  3HUI A;  1HZ5 A;  3PG7 A;  3LJU X;  3UQB A;  4DK5 A;  2H7E A;  2ZPN A;  2LUE A;  1DDV A;  2Z0E B;  4HPM B;  5KCV A;  4M0W B;  1NEK B;  1DRO A;  3Q8E A;  2JRI B;  3VOQ A;  2KDB A;  1RFK A;  4MAC A;  1HQR D;  2PPH A;  2PLP A;  1JRP A;  4LNF A;  1BUI C;  2CJO A;  3TSS A;  1WGG A;  2BW2 A;  3BZD B;  2BS3 B;  3IT6 B;  2WXM A;  1V97 A;  3W1Y A;  3PRP B;  1GGO A;  4LNO A;  2L2I A;  3HHM A;  2PE9 A;  3L4P A;  4HJK A;  3UGB B;  3U8Z A;  2Z59 A;  4DQO C;  4AWJ A;  4C56 C;  1E0Z A;  4RFB A;  3H7P B;  1TQZ A;  4I6L B;  5JLJ B;  2KOX A;  4GDK B;  3ABV B;  4WSF A;  1WR1 A;  2ON8 A;  4YTM B;  1C4A A;  4NJ7 A;  4W9K A;  2QKL A;  4KX6 B;  1WR6 E;  3AJ4 A;  1YN3 A;  2BQQ A;  1WE7 A;  3AE5 B;  2MSE D;  3PZ7 A;  4RF1 A;  2K22 A;  2N7J A;  2IBI B;  3E66 A;  3MPX A;  2XBB C;  3A9K A;  5IA7 A;  1QLB B;  2WDT B;  3WCQ A;  1NTV A;  5HKH A;  2K8C A;  2D3B A;  2FCM A;  3FM8 C;  2MBQ A;  1IGC A;  1QOG A;  2GMI C;  1HZ6 A;  1EU4 A;  1M4V A;  1ZDX A;  3URY A;  3DCG A;  1F1H A;  4GPT B;  2Y7B A;  4JKD A;  1S3S G;  2JWU A;  3KH0 A;  5D3W A;  1FNW A;  1Q10 A;  1E8Y A;  2DNF A;  2HJ8 A;  5FK9 C;  2NZ8 B;  2QC8 A;  4KHB A;  2Z0D B;  5D3X A;  1WZ3 A;  3ODO A;  2LJI A;  1IRS A;  3N30 A;  4IUM B;  2R61 A;  4PYU A;  5FR3 A;  4EUT A;  5IKC M;  3PSC A;  2K49 A;  2K9X A;  1P6S A;  2KQ4 X;  3E9L A;  3NVY A;  1BTN A;  2YS3 A;  3NG0 A;  3DPD A;  2Y8F A;  1UNP A;  3BYY B;  1YQB A;  4KZ0 A;  2GBJ A;  2LMC A;  2VSZ A;  2JU6 X;  1WZ0 A;  5IO9 A;  4ZHP A;  5AZH A;  5C3J B;  3KY9 A;  5D27 A;  5DHF B;  2COD A;  1Z5S B;  1M94 A;  1FXT B;  4A90 A;  4CQN A;  3LDZ E;  2W9N A;  3PLV A;  2V3P A;  4HKQ A;  3ODX A;  3KSY A;  3D8E A;  5HE0 A;  3VUY A;  4P1B C;  1G6J A;  3ZGZ A;  3B2F A;  2Z8L A;  3Q3J A;  1V1O A;  4RH6 A;  4L1R A;  1TBE A;  2MA9 B;  3WAL A;  3SD5 A;  2WH5 A;  3MP9 A;  5J2R A;  3GOE A;  3FVC A;  3EPY A;  4RNA A;  3P4S B;  2LZ6 A;  2V4I B;  1HBK A;  2O2V A;  3NZU A;  5L95 C;  2P0D A;  1I4P A;  2ROV A;  1CJE A;  2LHD A;  1AQC A;  4TKN A;  4M8N A;  2X38 A;  4MK0 A;  1MIX A;  1XLN A;  2ZJD A;  1CQV A;  2D9X A;  1WRI A;  3FIL B;  4MGI E;  3RNA C;  2KMM A;  1U5D A;  2LVQ A;  4XWW A;  4S17 A;  2L1A A;  2BPS A;  3I5J C;  4HEA 1;  4DDI D;  3WIM A;  3B2G A;  1KLV A;  4DIX A;  2CKH B;  2W55 A;  3VH4 B;  1SB3 C;  2COC A;  2WX1 A;  1I7H A;  4HDQ A;  2JSV X;  2BT6 A;  2N9X A;  2W82 A;  4TV3 A;  2RDB C;  3OJ4 B;  3PP2 A;  3DVG Y;  1HTQ A;  4IM3 A;  5H8Y E;  1AAR A;  3DHI C;  2IGG A;  2LOX A;  3P6A A;  2NTT A;  3KLS X;  3NS8 A;  1I35 A;  4XYC A;  3RCZ A;  1U27 A;  1L4Z B;  2BWE S;  5LXH A;  3U12 A;  3OJ3 A;  2DHK A;  1Z87 A;  4A20 A;  1L0Y B;  1SJH D;  3V61 A;  3P1M A;  3ZRC A;  2CY5 A;  2IDY A;  3LJ3 A;  4KSL C;  2LGY A;  2QIL A;  1UPQ A;  1XKE A;  3VUW A;  1EGX A;  5L83 A;  2ZCC A;  1WGY A;  1VJK A;  2WXR A;  1GUA B;  3DHG C;  5GXG B;  2VZK B;  3DBS A;  2JP2 A;  1ROE A;  3OAN A;  1V49 A;  1T0S C;  3BK2 A;  1SEB D;  1H10 A;  2E2X A;  1F77 A;  3DXE A;  2W2X D;  5JHB A;  3VRA B;  2BBC A;  4FBJ B;  1JWB D;  1P7E A;  5JVL A;  2DZK A;  5LOP B;  3VFK A;  2INC C;  4OHJ A;  2KJR A;  3PSE B;  3V3X A;  2DFK A;  1BXT A;  1UNR A;  1V9J A;  1YN4 A;  4TQ0 A;  5FI1 A;  5LXI B;  1V5P A;  4GDL B;  4H2A A;  4HCP B;  3AH7 A;  1FFV A;  3LYY A;  2WXK A;  3MDB C;  2ELA A;  1MPE A;  2G4D B;  1BML C;  1NU2 A;  4KV2 A;  2A4Z A;  1ZDV A;  5DPS A;  4BFR A;  1XLP A;  1Q5W B;  1XQQ A;  2L8J A;  4JLC A;  1MVK A;  3SU8 X;  1I4R A;  3NY5 A;  2B76 B;  1J0W A;  5GOW B;  5C5B A;  2J4X A;  1C4C A;  5DHA B;  4E71 A;  2MBO A;  4N6E B;  1WM3 A;  1P5T A;  1I4G A;  5KQ1 A;  4OZB A;  4NSW A;  1MFW A;  2N9K A;  4GIV A;  4KHB B;  2MH7 A;  4RGO S;  2KTF A;  3L17 A;  1JWA D;  2C7M B;  2Y5C A;  4DHJ B;  3GYP A;  3VRB B;  3HM6 X;  2RNR B;  2WNM A;  4G11 A;  2NBV A;  2ROZ B;  4HAV B;  4X57 B;  1K50 A;  4WAA A;  1RRP B;  2YLM A;  1KLG D;  4II3 B;  2FCN A;  3A8P A;  1TGZ B;  1V8C A;  4HJG E;  3HSA A;  3W5V B;  1NI3 A;  1U5E A;  4GLS C;  1EF1 A;  3RUI B;  5DI9 B;  5G5G A;  4BKS A;  1OTR B;  1LW3 A;  1J7C A;  3A4S C;  3C8Y A;  1TZ1 A;  2VRR B;  4F8C B;  1V88 A;  1MKE A;  2DHI A;  4P6V F;  2GBR A;  2HRJ A;  4ANX A;  3TJP A;  1XR0 B;  4ICU A;  4MJS A;  2D9V A;  3ZJT A;  3PO0 A;  2RPQ A;  3MHS D;  2O2V B;  5CLQ B;  2KLC A;  1NTI A;  1TS5 A;  1PGA A;  2V4L A;  4ILJ A;  1T77 A;  4W9E A;  1OGW A;  1PGB A;  1UWX A;  1E7P B;  2LGX A;  2VRW B;  2D9Z A;  4KHO A;  3N32 A;  5D2M B;  1E9M A;  1Y8R C;  4ANW A;  5AEK B;  4YWG G;  2KMA A;  5DH9 B;  2NVU I;  2Z0Q A;  2LXA A;  3GE8 C;  5HE3 A;  2Y5P A;  1H4R A;  2IO2 B;  3GS2 A;  4C80 A;  2D11 A;  2PKO A;  3R7Q A;  3NZ3 A;  2PZ1 A;  3KWV A;  2D3C A;  3CSF A;  3PVW A;  4MGZ E;  2K2U A;  3DCX A;  3N9Y C;  4IOY X;  4MM3 B;  4W9L A;  3UIN B;  3D32 A;  3V6E B;  2MP2 A;  1KRH A;  1MPH A;  3EEC A;  3BK1 A;  2BS4 B;  5EE3 A;  3JSV A;  4HAW B;  1VBH A;  1FRD A;  2YT2 A;  2EMS A;  2KC2 A;  5IOI A;  4ZRK A;  3ULC A;  2PW9 A;  2GCJ A;  4HRS A;  5KHQ A;  3H7P A;  4GSW A;  2G35 A;  2UVM A;  1K51 A;  3IAM 1;  2BS2 B;  3HM3 A;  3ZUN A;  1X1F A;  2WXG A;  2WYQ A;  2WWZ A;  4RF0 A;  1HA5 A;  2DYB A;  1UEF A;  4DXA B;  2M38 A;  1QOA A;  1TT5 B;  3P63 A;  1MIZ B;  5CHV C;  3QIJ A;  2AYO B;  2NS5 A;  1FPY A;  1A5R A;  3UZT A;  4YSX B;  1WXA A;  3RMK C;  4ZRI A;  4WJ7 A;  1STE A;  4HWI B;  1XO3 A;  2OQB A;  2RUK B;  2KYW A;  4QAY A;  5JHG A;  4YSZ B;  1FMA D; 
#chains in the Genus database with same CATH homology
 2LKO A;  2W2W A;  3F0W A;  2M8S A;  2LAS A;  1WJ4 A;  3DBR I;  3L08 A;  2KUP A;  3ZLZ A;  5HE2 A;  3AXC A;  3U7D A;  1JRU A;  1FHW A;  2YF0 A;  1DBH A;  2DN6 A;  2RQ1 A;  5J17 A;  1Q67 A;  3B1L X;  1WYW B;  4DHZ B;  2MRP A;  2KX0 A;  4G0N B;  1WIA A;  4FUL A;  1VBG A;  2KCJ A;  4HAT B;  1C3T A;  1KZ7 A;  5BO4 B;  2DKP A;  3HK0 A;  4WJP A;  4FHK A;  3QQ8 B;  2M14 A;  1WE6 A;  4AJW A;  3PPA A;  4FJV B;  4WVF B;  1WFY A;  1WRD B;  2N7D A;  4IAP A;  4FHJ A;  2RLO A;  1E8X A;  2LWP A;  2QHO A;  3ML8 A;  3PS6 A;  2M0X A;  5J3Y A;  4MT7 A;  5TR5 A;  4K17 A;  1X1M A;  4HB4 B;  1M7R A;  4XZ4 A;  1V89 A;  3T9L A;  3WA0 A;  3W1S A;  2NBV B;  3V6C B;  4BVU C;  1WGQ A;  1X86 A;  2ASQ A;  3L0W B;  4K1R B;  3VUX A;  2G3Q B;  4LJO B;  2J59 M;  2ZZP B;  2K39 A;  3ALB A;  2EMT A;  2FDQ A;  2R2Q A;  2RSU A;  3U30 A;  1K8R B;  1E5W A;  2CQU A;  1WX7 A;  1XD3 B;  3HQC A;  4BOS C;  4XC2 A;  4K7S A;  4MJS B;  4F1S A;  1L7Y A;  2C60 A;  1V80 A;  1P0R A;  2IY1 B;  2YS1 A;  2UWQ A;  4MEM A;  4RMA A;  1KI1 B;  3MJW A;  5E6P A;  4JKE A;  3PTF C;  3R66 C;  2DX5 A;  1IPG A;  1KZG A;  4XX5 A;  1N3H A;  4B95 A;  2MBH A;  2UZR A;  4LJP B;  1OY2 A;  1H8C A;  2CHX A;  5D94 A;  3A33 B;  2MP2 B;  3KW5 B;  2KHW B;  5CX3 A;  4JKH A;  3JSV B;  4M8M A;  2K6Q A;  3BIN A;  2FNJ B;  2RR9 A;  4F7Z A;  2Y8G A;  3E9P A;  3O96 A;  2PE6 B;  1WXS A;  4JK9 A;  2NBW B;  4BKT A;  5C6R A;  3VXW A;  4RM8 A;  3VTU A;  3KYC D;  4GDL A;  4ILG B;  2FIF A;  1YJ1 A;  2L7R A;  2O6V D;  2GBK A;  1DIK A;  4WJQ A;  4A5K A;  2D9Y A;  1V6E A;  3NZS A;  2OJR A;  5FI0 A;  2FJ9 A;  1R4M I;  1ST7 A;  5FR6 A;  2N7E A;  2KXJ A;  2C7H A;  1RAX A;  2BYE A;  1EUV B;  1Y5O A;  4CYE A;  2LYD A;  3SV1 A;  1WH3 A;  1WJ6 A;  2KGX B;  3JYU A;  1L2N A;  1QQG A;  4MDK E;  1RFA A;  2JVC A;  3PV1 A;  1QC6 A;  3DDC B;  2CAY A;  2L00 B;  2A5U A;  5IJM A;  4A6F B;  2KDE B;  2ZPY A;  3WYF B;  3EHV A;  1XX0 A;  4FN2 A;  2GBN A;  1FB8 A;  2COF A;  2DYQ A;  4EZL A;  1NVL A;  3N3K B;  4HPL B;  5C16 A;  2RD0 A;  1ACA A;  3FSS A;  1GC7 A;  3KVF B;  2GCL A;  3X23 A;  3KUD B;  1RJ2 A;  3P2B A;  3TBL D;  2DX1 A;  3V5W A;  2K00 A;  2GJY A;  3RZF A;  5C79 A;  1WGD A;  4EZK A;  3ZIM A;  3PLU A;  3ZO5 B;  2KX3 A;  4WJN A;  3ZTC A;  3DXD A;  5JZE B;  5C1Z A;  3AU4 A;  2M4N A;  3M95 A;  3TCA A;  4MM3 A;  1M7E A;  1DDW A;  2UZS A;  4FAD A;  1WMH B;  2CU1 A;  3DBL I;  3QAR A;  3IFW B;  2IYB A;  2FCS A;  4L6E A;  2I1K A;  3NHE B;  3PRE A;  1UNQ A;  1J0G A;  4IC7 B;  3ONS A;  4ASW C;  5IAA C;  2DX5 B;  1UBQ A;  1V5U A;  3K9O B;  2L3Z A;  3APF A;  3RCP A;  2FID A;  2AWT A;  3SUZ A;  1ZKH A;  1ZGU B;  4HAZ B;  2HD5 B;  2HE7 A;  3M63 B;  3KRW A;  3Q3F A;  2IO1 B;  2MQJ A;  1XCG A;  2P0H A;  3JW0 X;  4EZJ A;  2KD0 A;  1U4A A;  2BGF A;  3QC8 B;  2NCN A;  1NTY A;  2LVP A;  2LBB A;  1W1G A;  4JKC A;  3RUL A;  1OEY A;  3RZW C;  4EFO A;  4ANV A;  2H7D A;  2DYN A;  3RYT A;  4CO7 A;  1J8C A;  1FGY A;  1V5T A;  4KSK C;  2K6D B;  2KNB A;  1U2B A;  2K8B A;  4MGY E;  1WJU A;  2N4F A;  4ANU A;  5CHF A;  1MG8 A;  5HE1 A;  4DX9 0;  3ULB A;  4IM2 A;  4IG7 B;  4HVB A;  2CS4 A;  1SIF A;  4KAX B;  3DQV A;  2IZV B;  4IWP A;  2ABD A;  4CHM A;  4LDT B;  3TW1 A;  2NPT A;  4PYZ A;  5D3V A;  2D4Q A;  2BWF A;  3FP5 A;  2AEH A;  2EJ8 A;  1JDE A;  1UD7 A;  3PZD A;  3KUC B;  2DZI A;  4DBG A;  4DWF A;  1D3Z A;  1ZW7 A;  4EJN A;  4A3P A;  4BKS D;  2CHW A;  4W9C A;  3SYX A;  2C9W B;  3WAO A;  2JY6 A;  3T8M A;  4RM9 A;  2WX0 A;  2KWV B;  4JKA A;  2COP A;  1WXV A;  2M17 A;  2IO0 B;  4MSM B;  1UBI A;  2N0Y A;  2VKI A;  2R82 A;  4B9K A;  3X0W A;  4K2P A;  1R4N I;  3QCA A;  2JZZ A;  4A6K A;  3A98 B;  3MTN B;  2UYZ B;  1TJ6 A;  2DTC A;  1K5D B;  3B08 A;  2C7N B;  1UGM A;  5L81 A;  4K81 A;  4WWP A;  5E6O A;  4GXB A;  2YRY A;  4NNJ B;  1WJ1 A;  1RLF A;  3CMM B;  4G3X B;  2M1M A;  1NDD A;  4DHZ E;  2RGF A;  2GS0 A;  4KDL B;  4NY0 A;  3QBV B;  2XQN M;  5JHA A;  2G4S A;  3OLM D;  2D9W A;  1EF5 A;  1P3Q U;  4URK A;  4NJ6 A;  3SDL C;  3ZNZ B;  4HXD A;  2GBM A;  2KC1 A;  4WWN A;  4JKG B;  2KK8 A;  4PS8 A;  4IWO A;  1FOE A;  1RRB A;  4MY6 A;  1NBF C;  4A3O A;  1WGU A;  2KJH B;  3ZDT A;  4CHK A;  1ISN A;  2FUH B;  3A8Q A;  3M62 B;  1W1H A;  2MW5 A;  2KLG A;  2EC1 A;  2CRF A;  4HB3 B;  2CHZ A;  3ZNH B;  4NAW B;  4BBK A;  1UZX B;  2KWU B;  1KBL A;  4F7U P;  1GJZ A;  4YON A;  4W9H A;  4HK2 A;  3QA8 A;  3QJZ A;  2ADZ A;  4FJY A;  1XD4 A;  4A6F A;  2MWN B;  3D8D A;  1V86 A;  1EO6 A;  2DLW A;  3APC A;  4HAY B;  4FLH A;  3UQA A;  4W9D A;  3VAW A;  5DPW A;  3PRM B;  2W2X C;  4IW0 A;  4D0N B;  2NPT B;  2DAJ A;  2REX A;  3PVL A;  3PRZ A;  3VIA A;  5D7G A;  2FCQ A;  3ZNI D;  5EFX A;  1YX6 B;  2Q13 A;  5J3Q A;  2KFK B;  2MKR A;  2XK5 B;  2ELB A;  2ZNV B;  2NBU A;  4JL9 A;  2BCJ A;  3TO1 A;  2COA A;  4WQO B;  1UPR A;  4Z2N A;  3DVG X;  1AWE A;  3TVV A;  1OQN A;  5JP4 A;  1TXD A;  2Z0P A;  3IVF A;  1WMH A;  2KVR A;  3ZRF A;  4WWO A;  1J19 A;  3K9P B;  2YVC A;  3ZVV A;  3N7C A;  4GMV A;  5AZG A;  2DEN B;  1GNU A;  2JRH A;  5D6J B;  4E3C A;  4ZDV A;  4J6I A;  2L76 A;  1I7A A;  2OOB B;  3ZKJ C;  4CHJ A;  4KDI C;  2N23 A;  2V76 A;  3M1I B;  3CST A;  2N1W A;  3QK0 A;  2DIK A;  5C23 A;  1LB1 A;  2V1Y A;  2K2J A;  1MK9 B;  2FJL A;  1ZC4 B;  2AL3 A;  4MH0 E;  1WM2 A;  2YT1 A;  2D3G A;  3OAW A;  4JKF A;  1Q0W B;  4TYZ A;  2IFS A;  4EOY A;  4B6W A;  5EDS A;  2AL6 A;  2R09 A;  2GOW A;  4GN1 A;  3UF8 A;  3ZW3 A;  2I5F A;  1ZC3 B;  2LVO A;  5DPT A;  5G2N A;  2MDX A;  1TTN A;  4GOC A;  1PQS A;  1KOT A;  2JT4 B;  4LDT D;  3H6N A;  4P7I A;  4F7H A;  2LXC A;  3VHT C;  1NI2 A;  4JIO U;  1K5G B;  5DCN A;  4DHJ D;  4F7G A;  4K2O A;  3T06 A;  1ZSQ A;  1WX8 A;  1CMX B;  5DIF B;  1WG7 A;  3D8F A;  2KZR A;  2NMB A;  1I42 A;  3H7S A;  2JF5 A;  4KHA A;  1FAO A;  3DBH I;  1WXM A;  3TMP B;  4EEW A;  1LM8 B;  2O6V A;  3ZTD A;  2LGD A;  2OTX A;  2N1V A;  4HB0 B;  3A1Q A;  1V81 A;  2DA0 A;  1QZE A;  3L16 A;  3IBE A;  2V3S A;  2RGN B;  1B55 A;  4HHV A;  4NPN A;  1P98 A;  2IO3 B;  3HIZ A;  3P7Z A;  1E7V A;  2BKR B;  5JH5 C;  4DX8 A;  2Z0O A;  2I5C A;  3AI5 A;  3PEG A;  4I6P A;  1U5F A;  1GC6 A;  2MX2 A;  1GG3 A;  1LXD A;  2KMC A;  3SO6 A;  2MCN B;  4HAU B;  1C1Y B;  3AUL A;  2YS5 A;  4A6H A;  3VQI A;  2D07 B;  1KC7 A;  1FHO A;  3C0R B;  5KHO A;  1HB6 A;  2PEA A;  3EC8 A;  2LRU A;  3CXB B;  2LG1 A;  4II2 B;  3B0A A;  4YL8 A;  1HE8 A;  1MAI A;  4GB9 A;  1WF9 A;  3TFM A;  2CR5 A;  1WVH A;  4XWX A;  3VDZ A;  3BJI A;  1DDM A;  4HAX B;  4W9I A;  4N9F 4;  3W1S C;  4GGQ A;  1WX9 A;  3WAN A;  3IHP C;  1IP9 A;  3CF6 E;  3UIO B;  3ZNG C;  2DHJ A;  3ENB A;  5GMV A;  2CB8 A;  1V5O A;  3NSU A;  4W9G A;  4AJY B;  4GMX B;  5CTR C;  3SHQ A;  4JK7 A;  2LI5 A;  1YX5 B;  3A9J B;  4I6N B;  1Y19 B;  2JZ3 B;  1E8W A;  4E74 A;  1YIW A;  2R0D A;  1E90 A;  4JKG A;  4HDO A;  3QWM A;  3SBT A;  4IWQ A;  1U5G A;  2YT0 A;  1EVH A;  3DVN U;  3DVN V;  3PHW B;  3ODW A;  1W1D A;  2Y5B B;  4W9J A;  4C0A A;  2LOZ A;  4NQK E;  2LJ5 A;  1U29 A;  1S1Q B;  3ENE A;  5DPR A;  1F9J A;  2KTR A;  3VH3 B;  4GU2 A;  3O65 B;  4MSQ B;  4BBN F;  3APD A;  2I1J A;  4NAW A;  3R7R A;  2Z59 B;  2B3A A;  3ML4 A;  3M3J A;  2MBB B;  3PVU A;  3QHT A;  1YD8 U;  3TL5 A;  1WJM A;  1KJT A;  1V5M A;  1MK7 B;  2P0F A;  2ZVN A;  2RVB B;  2DYM A;  4AP4 C;  1SGH A;  2HTH A;  3PT2 B;  4LCD E;  4H8S A;  2PJH A;  1I2H A;  3A9K B;  1Z2M A;  3F5R A;  1IYF A;  2QKM A;  4B6H A;  2IY0 B;  3I3T B;  3E9O A;  2KWC A;  1BT0 A;  1X1G A;  2LRW A;  4FA6 A;  2N9P C;  4K7U A;  1E7U A;  2YSZ A;  2O6V B;  2R2O A;  2KFK A;  2JWZ A;  4NQL B;  3A1Q B;  2MBE A;  4G50 A;  1KM7 A;  4BOZ B;  5JHH A;  4DDG D;  1X05 A;  3L54 A;  4EKU A;  2JXX A;  2XK5 A;  5E6N A;  4ZRJ A;  5CHW A;  1XOD A;  1WI0 A;  4AUQ C;  2JPH A;  2MFQ A;  2K25 A;  1HB8 A;  4BKG A;  2L1C A;  4PS3 A;  2DZM A;  3ML9 A;  2KAN A;  2NR2 A;  3SNH A;  2MLB A;  1XT9 B;  4KIK A;  3FLV A;  4PS7 A;  1UEL A;  3ECI A;  2P8V A;  2DHZ A;  3L10 B;  3H9D A;  2RSG A;  3IG3 A;  4BBN C;  2J0K A;  2C5L C;  4MEL A;  2K1F A;  1LQB A;  4HCN B;  1ZVR A;  2LUL A;  2DKQ A;  2DAF A;  4PNK A;  2KDI A;  4HLE A;  2K8H A;  5D3Y A;  3JVZ X;  2DYO A;  1UH6 A;  1VCB A;  4ZYN A;  2ZCB A;  3DOW A;  1WI1 A;  1V61 A;  2KDF B;  5CLL B;  4JK8 A;  2JUO A;  3KZ1 A;  4JKB A;  1ZM0 A;  5LON B;  2J0J A;  1WGR A;  2J7Q B;  2KKC A;  4HB2 B;  3VTW A;  3WAP A;  3QX1 A;  2X18 A;  3ZDM C;  2KFJ A;  3KUZ A;  2MWS B;  3KRX A;  2KQ7 A;  3VTV A;  5J3T A;  2IYD B;  3DXC A;  2DZJ A;  3G9W A;  1SE9 A;  4GDK A;  1FGZ A;  4MGK E;  1WGH A;  1T0Y A;  3VVW B;  4IM0 A;  3H1U A;  3S2A A;  3PHX B;  4TQ1 A;  4OVU A;  1V2Y A;  1SHC A;  2D2Q A;  1WY8 A;  2KTR B;  1P1A A;  4DBB A;  1P3R A;  4WJO A;  1PMS A;  2LD9 A;  1PLS A;  3RD2 A;  5LLI A;  2CY4 A;  2L0F A;  2L05 A;  4K7W A;  2KQS A;  2BYV E;  2D10 A;  5G55 A;  3QWZ B;  3HW2 B;  4JGH B;  3GZN I;  4AOF A;  1X11 A;  3FEH A;  4IFS A;  3BY4 B;  2BYF A;  2L0T A;  2HTH B;  3UIP B;  2N9E B;  1VD2 A;  1P9D U;  3WAM A;  4Y94 A;  3RT3 B;  3AU5 A;  3KYD D;  5C5B B;  1BTK A;  1BAK A;  3SBG A;  2X0S A;  1Q1O A;  3EFU A;  4OVV A;  4PQ0 A;  1OEY J;  2FAZ A;  3NOB A;  5J18 A;  3TIX A;  4W9F A;  1OMW A;  5KQ4 A;  4ICV A;  2KJ6 A;  2BKF A;  1E8Z A;  1EAZ A;  4Z2M B;  2XEW A;  4KZC A;  3V62 A;  4TUU A;  2G45 B;  1WJN A;  2BF8 B;  1OQY A;  4EMO A;  3ZVR A;  4JQW C;  1DYN A;  3A4R A;  3R3M A;  4FJZ A;  3CIK A;  1BWN A;  2EKE C;  2KN5 A;  3PGE A;  4KVG B;  4KIK B;  2ZNV C;  1PFJ A;  2ZEQ A;  5AZF A;  1FHX A;  1LFD A;  2ZVO A;  3V60 A;  4GZU A;  2KO3 A;  2J0M A;  4ILH A;  3QAQ A;  3L13 A;  3GYO A;  3A9J A;  3PG7 A;  3LJU X;  3UQB A;  4DK5 A;  2H7E A;  2ZPN A;  2LUE A;  1DDV A;  2Z0E B;  4HPM B;  5KCV A;  4M0W B;  1DRO A;  2JRI B;  3VOQ A;  2KDB A;  2PPH A;  1WGG A;  3W1Y A;  3PRP B;  1GGO A;  2L2I A;  3HHM A;  2PE9 A;  4HJK A;  3UGB B;  3U8Z A;  4AWJ A;  3H7P B;  1TQZ A;  4I6L B;  5JLJ B;  2KOX A;  4GDK B;  4WSF A;  1WR1 A;  4NJ7 A;  4W9K A;  2QKL A;  1WR6 E;  3AJ4 A;  1WE7 A;  2MSE D;  2IBI B;  3E66 A;  3MPX A;  2XBB C;  3A9K A;  5IA7 A;  2WDT B;  1NTV A;  5HKH A;  2K8C A;  2FCM A;  3FM8 C;  2MBQ A;  2GMI C;  3DCG A;  4GPT B;  2Y7B A;  4JKD A;  1S3S G;  3KH0 A;  5D3W A;  1E8Y A;  2HJ8 A;  2NZ8 B;  2Z0D B;  5D3X A;  1WZ3 A;  3ODO A;  1IRS A;  3N30 A;  4IUM B;  4PYU A;  4EUT A;  3PSC A;  1P6S A;  3E9L A;  1BTN A;  2YS3 A;  3DPD A;  2Y8F A;  1UNP A;  1YQB A;  4KZ0 A;  2GBJ A;  2VSZ A;  1WZ0 A;  5AZH A;  3KY9 A;  5D27 A;  5DHF B;  2COD A;  1Z5S B;  1M94 A;  1FXT B;  3LDZ E;  2W9N A;  3PLV A;  3ODX A;  3KSY A;  3D8E A;  5HE0 A;  3VUY A;  1G6J A;  3Q3J A;  1TBE A;  2MA9 B;  3WAL A;  3SD5 A;  2WH5 A;  5J2R A;  3GOE A;  3EPY A;  2LZ6 A;  1HBK A;  2O2V A;  3NZU A;  5L95 C;  2P0D A;  2ROV A;  1AQC A;  4TKN A;  4M8N A;  2ZJD A;  4MK0 A;  1MIX A;  2D9X A;  4MGI E;  2LVQ A;  1U5D A;  2BPS A;  4DDI D;  3WIM A;  1KLV A;  2CKH B;  3VH4 B;  2COC A;  2WX1 A;  4HDQ A;  2N9X A;  4TV3 A;  3OJ4 B;  3PP2 A;  3DVG Y;  4IM3 A;  1AAR A;  2LOX A;  3P6A A;  3NS8 A;  1I35 A;  3RCZ A;  1U27 A;  2BWE S;  5LXH A;  3OJ3 A;  2DHK A;  1Z87 A;  4A20 A;  3V61 A;  3ZRC A;  2CY5 A;  3LJ3 A;  4KSL C;  2LGY A;  1UPQ A;  1XKE A;  3VUW A;  1EGX A;  5L83 A;  2ZCC A;  1WGY A;  1GUA B;  3DBS A;  2JP2 A;  3OAN A;  1V49 A;  1H10 A;  2E2X A;  3DXE A;  2W2X D;  5JHB A;  4FBJ B;  5JVL A;  2DZK A;  5LOP B;  3VFK A;  2KJR A;  3PSE B;  2DFK A;  1UNR A;  1V9J A;  4TQ0 A;  5FI1 A;  5LXI B;  1V5P A;  4GDL B;  4HCP B;  3MDB C;  2ELA A;  2G4D B;  1NU2 A;  4KV2 A;  2A4Z A;  5DPS A;  4BFR A;  1Q5W B;  1XQQ A;  2L8J A;  4JLC A;  3SU8 X;  3NY5 A;  1J0W A;  5GOW B;  5C5B A;  5DHA B;  4E71 A;  2MBO A;  1WM3 A;  1P5T A;  5KQ1 A;  4NSW A;  4GIV A;  4KHB B;  2KTF A;  3L17 A;  2C7M B;  4DHJ B;  3GYP A;  3HM6 X;  2RNR B;  4G11 A;  2ROZ B;  4HAV B;  4X57 B;  4WAA A;  1RRP B;  2YLM A;  4II3 B;  2FCN A;  3A8P A;  1TGZ B;  1U5E A;  1EF1 A;  3RUI B;  5DI9 B;  4BKS A;  1OTR B;  1LW3 A;  3A4S C;  1TZ1 A;  2VRR B;  4F8C B;  1V88 A;  1MKE A;  2DHI A;  2GBR A;  2HRJ A;  4ANX A;  3TJP A;  1XR0 B;  4ICU A;  4MJS A;  2D9V A;  2RPQ A;  3MHS D;  2O2V B;  5CLQ B;  2KLC A;  1NTI A;  2V4L A;  4ILJ A;  4W9E A;  1OGW A;  2LGX A;  2VRW B;  2D9Z A;  4KHO A;  3N32 A;  5D2M B;  1Y8R C;  4ANW A;  5AEK B;  2KMA A;  5DH9 B;  2NVU I;  2Z0Q A;  2LXA A;  5HE3 A;  1H4R A;  2IO2 B;  2D11 A;  3R7Q A;  2PZ1 A;  3CSF A;  3PVW A;  4MGZ E;  2K2U A;  4IOY X;  4W9L A;  3UIN B;  3D32 A;  3V6E B;  2MP2 A;  1MPH A;  3EEC A;  3JSV A;  4HAW B;  1VBH A;  2EMS A;  2KC2 A;  4ZRK A;  3ULC A;  2GCJ A;  5KHQ A;  3H7P A;  4GSW A;  2G35 A;  2UVM A;  3ZUN A;  3HM3 A;  1X1F A;  2WYQ A;  2WWZ A;  2DYB A;  1UEF A;  4DXA B;  2M38 A;  1MIZ B;  5CHV C;  3QIJ A;  2AYO B;  2NS5 A;  1A5R A;  3UZT A;  1WXA A;  4ZRI A;  4WJ7 A;  4HWI B;  2OQB A;  2RUK B;  5JHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...