3IVFA

Crystal structure of the talin head ferm domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
358
Chain Sequence
VALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title The Structure of the talin head reveals a novel extended conformation of the FERM domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 101
structure length 358
sequence length 368
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3ivfA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ivfA04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA02
4MH0E 2RGFA 3L17A 1W1GA 2IZVB 4W9KA 2BGFA 4GDKA 4KHBB 4WQOB 4CHJA 3L0WB 3V6EB 3HQCA 4EMOA 4IW0A 1U5GA 3NY5A 5IJMA 2NBWB 1Z5SB 2REXA 1WJNA 5JP4A 3MDBC 1V86A 1FHXA 3X23A 4W9EA 2AL3A 2HTHA 5JHAA 2BKFA 3X0WA 1UBIA 3W1YA 4KV2A 3VQIA 4LJOB 2G4SA 3ZTDA 2L2IA 3SV1A 3TVVA 4BKSD 1EF1A 3AU5A 3UZTA 3QWMA 3HM6X 2LASA 1X86A 2D9VA 1H10A 2FCNA 4IAPA 1YX6B 5IA7A 5LXIB 1SGHA 4TUUA 2N1VA 2RPQA 4KIKA 3KZ1A 5GMVA 3VAWA 5D3XA 4CHMA 3VTWA 3B08A 4KZCA 2CAYA 1XODA 1GC7A 2KGXB 2KTRA 1R4MI 3HM3A 1X1GA 2WX1A 1RAXA 3I3TB 3VFKA 3KUZA 2ZJDA 2M38A 3DOWA 2O2VA 1M7EA 2K6QA 3WA0A 3L13A 4KVGB 5FI1A 3QA8A 3V5WA 1DDWA 4HHVA 1P0RA 2L1CA 3CSFA 5J2RA 4GOCA 4K81A 1M94A 5C16A 4MDKE 5D27A 2XEWA 3VDZA 4AP4C 2OOBB 5C1ZA 3QC8B 1J8CA 3T06A 2D2QA 5C79A 3DBSA 3M95A 1M7RA 2JRIB 1OGWA 4EUTA 1SIFA 1NI2A 3EECA 2HE7A 1P9DU 2LYDA 2GS0A 2GBNA 2LWPA 2PE6B 1S1QB 1C1YB 2IO2B 1LW3A 1HB6A 2KOXA 2Z0EB 4IUMB 2DFKA 4AJWA 3ZO5B 2A4ZA 2JUOA 4HDOA 4TKNA 3NSUA 2KMAA 5TR5A 3SO6A 2ZCCA 2V4LA 2WX0A 1Q5WB 4HK2A 2DHIA 4KAXB 2IYDB 2N4FA 3RZFA 4HCPB 3AJ4A 1ST7A 3A9JB 1V88A 1WMHB 2FDQA 2LBBA 2MKRA 4B6WA 3KH0A 1GC6A 4K2PA 1EO6A 4GDLB 2CKHB 2MFQA 3ML4A 2KX0A 4ZYNA 3DPDA 2L7RA 4MM3A 3R66C 4DHJB 4FULA 1V5PA 4FADA 4LDTB 1E8ZA 5DHAB 2HRJA 4DX8A 3CF6E 1Y19B 1V49A 2KVRA 3EHVA 2QHOA 5IAAC 3L16A 3LJUX 2JVCA 2LGYA 3OAWA 4DXAB 3RUIB 2H7DA 1C3TA 3GYPA 4E74A 1I42A 4W9FA 2EC1A 2MP2A 2GBKA 4C0AA 1UNPA 4WSFA 4DK5A 1PFJA 1X11A 2K00A 3O96A 2KJRA 4AUQC 1Q1OA 1E7VA 2M1MA 3TIXA 1JRUA 3UGBB 5EFXA 2JZZA 3CXBB 1IP9A 1Y8RC 3OJ3A 5JHHA 3PLUA 1E8WA 3V61A 2LD9A 3DVNV 1WJ4A 3QIJA 3SHQA 2COCA 1MKEA 2MA9B 2OQBA 1WIAA 1YX5B 2HJ8A 3TJPA 4BFRA 4GMVA 1TTNA 2N23A 1KJTA 4EZJA 2GCJA 3H6NA 2CHWA 3KRWA 3PLVA 4GU2A 1P6SA 3ODOA 3SNHA 1SE9A 4A3OA 1WI0A 3HIZA 4CYEA 5FR6A 2EJ8A 2D3GA 1UGMA 2NBVB 4LCDE 4JLCA 5LOPB 2KQSA 2DAFA 2J0KA 2ELAA 5D3YA 2W9NA 1RFAA 3A9KA 4IG7B 4OVVA 4K7WA 2ZZPB 4Y94A 4N9F4 1UPRA 4F1SA 2O6VB 5AZHA 2CRFA 2ZPYA 4KZ0A 2DA0A 1WGHA 3H7PB 4HAVB 4F7GA 2J7QB 2KC1A 4XZ4A 4ZDVA 5C6RA 3K9OB 3L54A 1U5EA 4PS8A 4W9LA 5DPTA 4FHKA 4ANXA 2KQ7A 2JY6A 2R2QA 3N3KB 1WXSA 3SYXA 2KDBA 3Q3FA 1UNRA 2MX2A 4II2B 2N7DA 3TL5A 1WVHA 5BO4B 1V89A 2COFA 3ZVVA 1UZXB 4MY6A 2CB8A 2C7MB 3BJIA 2XK5B 2L05A 4ZRIA 2K2JA 2DZIA 2R2OA 1E8XA 2FAZA 4K7UA 1L7YA 1WJMA 2UWQA 1Z2MA 3N32A 4YONA 2RD0A 3QARA 2FUHB 1ZM0A 1WGGA 1E7UA 3DVGY 2N1WA 2GBRA 5KQ1A 5DPWA 5CTRC 4PS7A 3PHXB 2CODA 1YIWA 2ROVA 2KFKB 1WX7A 3PRMB 2GCLA 2J0MA 2C7NB 3VTVA 2CY4A 2DKQA 1WXMA 5CX3A 3QBVB 1WR1A 2LJ5A 3QJZA 2H7EA 2COPA 4A6HA 5J17A 2RNRB 4K7SA 5CHFA 4BBNF 2LXCA 1NU2A 1HE8A 4MJSA 1I35A 2AYOB 4G11A 1WGQA 2Y8GA 5DCNA 4K1RB 1ZKHA 1UD7A 2E2XA 3V62A 1V5MA 5D2MB 4ICVA 2FJ9A 4RM9A 4IM0A 2Z0OA 4FHJA 1V5TA 3PPAA 4HPMB 2FIFA 2K39A 3U7DA 2LRWA 3ZIMA 3M3JA 4A20A 4W9IA 5KCVA 3DXDA 2LUEA 3QQ8B 3ENEA 3ZKJC 3PHWB 1ZC3B 2DYOA 3C0RB 1TZ1A 2C9WB 1FGYA 3QWZB 5D3WA 5FI0A 4DHZE 2P0HA 3JW0X 3M63B 1EVHA 3UQBA 1MIXA 3KW5B 2VRRB 3TW1A 2C7HA 4IM3A 4WJQA 4ANVA 5D3VA 1EUVB 5JHGA 3ZRFA 2KFKA 4MGIE 3DBRI 1XR0B 3JSVA 1S3SG 4PQ0A 3Q3JA 5D7GA 3QX1A 3VVWB 1R4NI 3V60A 3PVLA 4G50A 1UPQA 3D8DA 1QZEA 3L10B 1WX9A 2BKRB 3PSEB 1FHWA 2KMCA 4B95A 1DBHA 4NNJB 1OEYJ 2OJRA 5E6OA 5LLIA 3RULA 4B6HA 4NQLB 4TV3A 3KYDD 4FJZA 1V80A 3DVNU 4H8SA 3IFWB 3RT3B 1XCGA 1PQSA 1XD3B 2UZSA 4EZLA 3O65B 1VCBA 2FCMA 3FSSA 3NHEB 3RYTA 3VUWA 1UBQA 2LOXA 3ZRCA 3PEGA 4KDLB 4WWOA 4MK0A 1J0WA 4BKTA 1LXDA 3PZDA 4E3CA 3PT2B 4WWPA 2RSUA 2V1YA 1H4RA 4IFSA 1HB8A 3PGEA 2N9PC 2GMIC 3M62B 3ZNHB 3D32A 2W2XC 3VXWA 3APDA 3HHMA 2KDIA 2DZJA 4PYUA 2A5UA 1Q67A 2DN6A 3DXEA 1WJ6A 4DX90 1FOEA 3ZNID 3ZDMC 5AEKB 2XBBC 3AXCA 2UYZB 4DHJD 1J0GA 3AULA 1I7AA 3NZSA 2CU1A 1NDDA 2D9ZA 2LRUA 3A1QB 2CQUA 1WYWB 2K8BA 4WJOA 3SUZA 1A5RA 2RR9A 2ZVOA 1X05A 3FLVA 3BINA 1T0YA 2D07B 1KZGA 1GNUA 5DPSA 1WI1A 4HAYB 1V81A 1FXTB 2PEAA 2IFSA 1XX0A 2LVQA 3FP5A 3PV1A 4DDGD 4EOYA 1GUAB 4IM2A 3L08A 4W9HA 1WG7A 1MK9B 2I5FA 4HWIB 5HE0A 3FEHA 3QAQA 4GPTB 3PP2A 2NBUA 4LJPB 2LULA 4NAWB 4W9GA 3ZVRA 3ONSA 3P2BA 2G4DB 3WYFB 1RRBA 1J19A 2UVMA 3TO1A 3PS6A 2YLMA 3TBLD 1DDMA 2CR5A 3KSYA 2L3ZA 1WZ3A 3DXCA 2ZPNA 3TCAA 1DROA 5DI9B 4HAUB 4CO7A 3IHPC 4NJ7A 3WIMA 2MQJA 3ULBA 1ZC4B 4WJNA 4F7HA 1TXDA 2MDXA 1WJ1A 1BWNA 4DDID 2K6DB 3ODWA 3KYCD 1D3ZA 3GZNI 3P7ZA 5EDSA 1WX8A 4GIVA 1WM3A 3ALBA 3LJ3A 2DAJA 2N0YA 5DH9B 2D9WA 1WGYA 1ZW7A 4MGYE 1UH6A 1U2BA 3F5RA 3KRXA 3P6AA 4GSWA 1WGUA 2CS4A 3T9LA 1LM8B 3CIKA 2QKMA 3ML9A 2ABDA 2BYEA 2JP2A 2YSZA 3A9JA 1WMHA 1DDVA 4MELA 2O6VD 3WAOA 3MPXA 2KZRA 3PVUA 3QCAA 2CHXA 2MWNB 3PRZA 4GDLA 2IY1B 2LKOA 3PRPB 4HATB 3DQVA 3NS8A 2P0DA 1FHOA 1NTYA 2LI5A 4DBBA 2K25A 2PPHA 2K8CA 2PJHA 3KVFB 1EAZA 3PREA 3IG3A 1MIZB 4KDIC 2AWTA 1ISNA 3PG7A 1WH3A 3M1IB 4HVBA 4NJ6A 1U4AA 1KZ7A 3WALA 4BVUC 1TQZA 2LVPA 2M4NA 3OJ4B 2DYMA 2LOZA 4XX5A 2BWFA 4FA6A 2IO0B 2VRWB 2BYVE 3DCGA 2JRHA 2NPTB 3V6CB 1RRPB 4DWFA 2YS1A 1P3QU 3RD2A 5LONB 2CY5A 1BT0A 2L0FA 1PLSA 4AJYB 4HB0B 3NZUA 4MSMB 1U5FA 5HE3A 4EJNA 2NMBA 4W9JA 4KSLC 4HB2B 1P5TA 1ACAA 1OY2A 3AI5A 4Z2MB 4JL9A 4BOSC 2KWCA 4A6FB 1V9JA 1OQNA 2KFJA 4KSKC 2KDFB 2KKCA 4EKUA 2NR2A 1H8CA 2RSGA 2KANA 4GN1A 4GDKB 4GXBA 4MGKE 4L6EA 3ECIA 2MBEA 1L2NA 4AWJA 2Y7BA 2WDTB 2NZ8B 4CHKA 4HAZB 2QKLA 5JHBA 3MHSD 1U27A 4F8CB 2WWZA 2HTHB 2LGDA 2KWVB 2O6VA 2GBJA 2GBMA 3K9PB 2BF8B 3H7PA 4P7IA 1WZ0A 3UF8A 1BTKA 2GJYA 2IO1B 2Y8FA 2KWUB 2B3AA 1MK7B 3N7CA 3VOQA 4A5KA 3NOBA 1KLVA 2I5CA 3CMMB 1YJ1A 2KX3A 4A6KA 5JH5C 3B0AA 4KIKB 3TFMA 2KLCA 2VSZA 4HXDA 1CMXB 3PSCA 5KHQA 4RM8A 4HAXB 1TGZB 1WE6A 4JGHB 3A4SC 1MAIA 4M0WB 2KTRB 4FJYA 1GJZA 2XK5A 3U30A 1WGDA 2KNBA 1AARA 3ZDTA 2M0XA 1FB8A 3IBEA 3DDCB 1FAOA 5D6JB 2ADZA 1E5WA 1K5GB 1UEFA 4A6FA 2DX5B 3APCA 2NCNA 5KQ4A 2O2VB 1OEYA 5CHWA 2V3SA 3IVFA 1XKEA 4GB9A 1KOTA 5L95C 4K17A 1WRDB 3H1UA 2M14A 1YQBA 3D8FA 1U29A 1AQCA 2KTFA 2HD5B 2G45B 1RJ2A 1IYFA 2BCJA 4HAWB 1Z87A 3R3MA 3D8EA 2UZRA 2D4QA 2MBHA 2LGXA 1EF5A 1K5DB 5C5BB 2YF0A 1SHCA 4PNKA 3UINB 2LVOA 2X18A 2VKIA 3EPYA 5JZEB 3VH3B 2JPHA 1BTNA 2XQNM 1W1HA 1FGZA 4JQWC 2RLOA 3VTUA 4X57B 1WGRA 5E6PA 2PZ1A 3SD5A 5CLQB 2I1JA 4MEMA 2V76A 4IC7B 3R7RA 4RMAA 2M8SA 5J3QA 4FBJB 3GYOA 4EEWA 3U8ZA 3RCPA 3F0WA 3ML8A 2ZEQA 4MT7A 5L81A 4JIOU 2KHWB 2AL6A 2DLWA 2IY0B 3HW2B 1LFDA 2MCNB 2KLGA 5CLLB 3GOEA 1UNQA 2BWES 1XQQA 4GGQA 1OMWA 2P0FA 2KXJA 3DBLI 3VUXA 1WE7A 1NVLA 2C5LC 2D9YA 3FM8C 2DX5A 2J59M 2KUPA 4WJPA 1NTVA 2RGNB 2Z59B 5JLJB 2DHKA 4NSWA 3ZNZB 3QK0A 4M8NA 2ROZB 1X1MA 2YVCA 2DYNA 2IO3B 5DHFB 1V2YA 2NS5A 4TYZA 2JF5A 1DYNA 3W1SC 1OQYA 1WY8A 2KCJA 2KD0A 4IWQA 1HBKA 2DENB 1U5DA 2FJLA 4LDTD 1XD4A 3UIPB 4M8MA 2MP2B 1MPHA 2JZ3B 2MBOA 3ULCA 5C5BA 2ZNVC 1X1FA 2DTCA 3A8QA 5J3YA 2JT4B 2FNJB 1WR6E 2YRYA 3HK0A 1I2HA 3ZLZA 2JWZA 3S2AA 3AU4A 4WAAA 1WF9A 1Q0WB 4A3PA 2LXAA 1N3HA 3UQAA 4HDQA 2L00B 4ZRKA 4ICUA 2R0DA 1WJUA 4MGZE 1MG8A 5GOWB 4W9CA 2L8JA 2M17A 1WFYA 4HPLB 2W2XD 2RVBB 3WAPA 2G35A 1V5UA 4F7ZA 1LB1A 1F9JA 4E71A 2DZKA 1WXVA 3WANA 4J6IA 2DHZA 1WXAA 2DHJA 2FIDA 4AOFA 3KUCB 4XWXA 1G6JA 1W1DA 2DKPA 2DYQA 4BKSA 3H7SA 3MJWA 2N7EA 2OTXA 1RLFA 3TMPB 3T8MA 3A9KB 5DPRA 2G3QB 1AWEA 2MSED 3ZW3A 4IOYX 1E8YA 1EGXA 5J3TA 4FJVB 1KI1B 4EZKA 2YT1A 1KM7A 2Y5BB 3A1QA 4F7UP 2R09A 2W2WA 2WH5A 5DIFB 5KHOA 2KO3A 3APFA 3KY9A 2COAA 3MTNB 1B55A 3H9DA 4ZRJA 2FCQA 4DBGA 2MRPA 1IPGA 3CSTA 5LXHA 5AZFA 3PVWA 5CHVC 2Z0QA 3JVZX 2K2UA 3QHTA 4I6LB 2ZNVB 4NAWA 1E90A 3G9WA 4DHZB 2RUKB 2DZMA 4II3B 1WM2A 4NPNA 4YL8A 3VH4B 1ZVRA 1VD2A 3N30A 2C60A 1V6EA 1ZGUB 4ANWA 4I6PA 3ZUNA 4MSQB 2I1KA 3OANA 3A4RA 4KHOA 5HE1A 4PYZA 4HJKA 1P3RA 2K1FA 2KJHB 4EFOA 1V5OA 2KK8A 1P98A 2D9XA 4G3XB 3VUYA 1K8RB 3KUDB 2YS5A 4NY0A 4PS3A 2D11A 2L76A 2IYBA 2MBQA 4MJSB 4IWPA 3ZNGC 3PTFC 5G2NA 1XT9B 1QQGA 3LDZE 2N9XA 4I6NB 4HB4B 4Z2NA 1GG3A 5E6NA 4BOZB 2J0JA 4XC2A 5G55A 2YS3A 3W1SA 2K8HA 2FCSA 2IBIB 5L83A 2BPSA 3WAMA 3OLMD 2YT0A 4W9DA 4GMXB 2MW5A 4GZUA 2RQ1A 3UIOB 2DYBA 3R7QA 4TQ0A 4BBNC 2EMSA 2EKEC 2MLBA 3A33B 1YD8U 1P1AA 1V61A 3ODXA 2NVUI 4IWOA 4K2OA 1BAKA 4BKGA 2GOWA 2KN5A 3EFUA 2ASQA 3B1LX 1Y5OA 1IRSA 4WWNA 1TJ6A 5AZGA 2DX1A 2KDEB 1QC6A 3BY4B 5HKHA 3DBHI 4HLEA 3JSVB 2LG1A 4D0NB 2AEHA 3SDLC 4KHAA 3RZWC 2ELBA 3A98B 2BYFA 3RCZA 4FLHA 4TQ1A 3EC8A 4ASWC 2NPTA 4WVFB 1ZSQA 2Q13A 2P8VA 2L0TA 2N9EB 3SU8X 5J18A 5C23A 4B9KA 4HB3B 2Z0PA 3ZTCA 2ZVNA 1NBFC 2KJ6A 4G0NB 2PE9A 2CHZA 2KC2A 2LZ6A 3VHTC 1OTRB 1TBEA 2Z0DB 3VIAA 2MWSB 5HE2A 1PMSA 4WJ7A 1UELA 3A8PA 2WYQA 2EMTA 4HCNB 4BBKA 4FN2A 3DVGX 1NTIA 2JXXA 4NQKE 2MBBB 2ZCBA 4OVUA 4ANUA 1LQBA 3JYUA 2D10A 5D94A 4URKA
chains in the Genus database with same CATH superfamily
4MH0E 3I9V1 1N6ZA 1SE2A 2RGFA 3L17A 1W1GA 2IZVB 3BVZA 4W9KA 2BGFA 1ZYIA 1D4BA 1XLOA 4GDKA 4KHBB 4WQOB 3E66A 4CHJA 3L0WB 3V6EB 3HQCA 4EMOA 3NY5A 1U5GA 4IW0A 4JKGB 3Q8FA 5IJMA 2NBWB 1Z5SB 2REXA 1WJNA 5JP4A 3BVMA 3MDBC 2VH2A 1V86A 1FHXA 1P7EA 1N61A 3X23A 4W9EA 3TEZA 4ZYSA 2V0GA 1ESFA 2AL3A 2SEBD 2HTHA 5JHAA 2BKFA 3X0WA 3MC9A 1UBIA 3W1YA 2WXNA 4KV2A 3VQIA 4LJOB 2G4SA 2GRIA 3ZTDA 1CK1A 2L2IA 3NW8A 2G1EA 3SV1A 3I5JC 3TVVA 4BKSD 1EF1A 1K53A 4ZHOA 3AU5A 3UZTA 1OFFA 3QWMA 1BUIC 2CJNA 3HM6X 1AW7A 2Z13A 2LASA 1X86A 2D9VA 1H10A 5BMHA 2FCNA 2KT7A 4IAPA 1YX6B 5IA7A 5LXIB 1SGHA 4TUUA 2N1VA 1KBLA 1AN8A 2RPQA 4KIKA 1KLUD 3KZ1A 1QF6A 5GMVA 3VAWA 5D3XA 4CHMA 3VTWA 1TY2A 1OQRA 3B08A 4KZCA 2V3PA 2CAYA 1I7HA 1XODA 5EE9A 4M0WA 1GC7A 5D3IB 2KGXB 2KTRA 3LYYA 1R4MI 1D5MC 3HM3A 1X1GA 2QJLA 2WX1A 1RAXA 3I3TB 3VFKA 3KUZA 2ZJDA 2M38A 1N5WA 3NVVA 2L32A 3DOWA 2O2VA 4JK9A 1M7EA 2K6QA 2K5PA 3WA0A 3L13A 4KVGB 5FI1A 3QA8A 3V5WA 1V1PA 1DDWA 4HHVA 1P0RA 4C00A 2L1CA 1FRDA 3CSFA 5J2RA 4GOCA 4K81A 1M94A 5C16A 5AUKA 4MDKE 1C77A 1VR9A 5D27A 2XEWA 3Q8AA 3VDZA 4AP4C 2OOBB 5C1ZA 2GLSA 3QC8B 1J8CA 4JKGA 2GUMA 1C4PA 2CU3A 3T06A 2D2QA 1JRPA 5C79A 2KQ4X 3DBSA 3M95A 1M7RA 2JRIB 2XN9C 2QCZA 1OGWA 4EUTA 1SIFA 1NI2A 3EECA 2HE7A 1P9DU 2LYDA 1EWYC 2GS0A 2GBNA 1FFUA 2LWPA 4ZOHC 4CQNA 2PE6B 3NVWA 1S1QB 1C1YB 2IO2B 1LW3A 1HB6A 2FE8A 2KOXA 2Z0EB 1C79A 3AE2B 1VBHA 3DBHB 4RH6A 4IUMB 2DFKA 4DQOC 4AJWA 3ZO5B 2A4ZA 2V3NA 2JUOA 1SJED 4HDOA 4TKNA 4MACA 3NSUA 2KMAA 5TR5A 3SO6A 4LNNA 2ZCCA 2V4LA 1FIQA 2WX0A 1Q5WB 4HK2A 2DHIA 4KAXB 2IYDB 3A58A 4RGNA 2N4FA 3RZFA 1L4DB 4HCPB 5MPOA 3AJ4A 3AE9B 3U2SC 1ST7A 3A9JB 3MHZA 1V88A 5FK9C 1WMHB 2FDQA 2LBBA 2MKRA 5E6JA 4B6WA 2YT2A 3SFDB 1DOIA 1MI1A 2N0SB 3KH0A 3AE7B 1GC6A 2JYTA 4K2PA 1EO6A 3Q2AC 4H2AA 2PTLA 4GDLB 5EE1A 2CKHB 2QILA 2MFQA 3ML4A 2KX0A 1B9RA 4A8XC 4RNAA 1E6EB 1K52A 1IGDA 1KF6B 3N20C 3TEWA 4ZYNA 1GPXA 3DPDA 2L7RA 5C3JB 2Z8LA 2IGDA 4MM3A 2ZW0A 3R66C 1CZPA 4DHJB 4US8A 2MEKA 2B76B 4FULA 1V5PA 3J9CA 4HKZE 1UUPA 4FADA 4LDTB 1E8ZA 5DHAB 3GS2A 2Z59A 2HRJA 4DX8A 1ET6A 3CF6E 4WH4A 1Y19B 1V49A 2BT6A 2KVRA 3EHVA 2QHOA 2AQ3B 5IAAC 3L16A 3LJUX 1PYWD 2JVCA 2LGYA 3OAWA 3PZ8A 1DOYA 3IT6B 4DXAB 4HRSA 3RUIB 4KGTA 2H7DA 1T6BX 1C3TA 1WWTA 3GYPA 4E74A 1I42A 4W9FA 4WURA 1SIJA 1YQ4B 2EC1A 2MP2A 2GBKA 3Q8EA 1Q10A 1I4QA 4C0AA 1RFKA 1UNPA 4WSFA 4DK5A 1PFJA 4S17A 1X11A 2R2YA 4ARCA 3BWUD 3CWIA 2K00A 3O96A 1ZE3D 2KJRA 1ZXIA 1VJKA 4AUQC 2KWDA 1Q1OA 1E7VA 2M1MA 2I2YA 3N1YC 3TIXA 1JRUA 3UGBB 5EFXA 5IKCM 2JZZA 1BXTA 2MHJA 3E9PA 3CXBB 4P1CC 2EKIA 4OZCA 1IP9A 1QOFA 4YSZB 2Y5PA 2WU2B 1Y8RC 2IGHA 3OJ3A 3DWGC 5JHHA 3PLUA 1E8WA 3V61A 2LD9A 3DVNV 2JU6X 1WJ4A 3QIJA 3E56A 3SHQA 2COCA 1MKEA 4RFBA 1ZXHA 2I38A 2MA9B 4O1NA 2ON8A 1QKZA 2OQBA 2MJEA 1WIAA 1YX5B 2HJ8A 2D5GA 3TJPA 4BFRA 4JKBA 4GMVA 1TTNA 2N23A 1KJTA 4EZJA 2GCJA 2VZKD 2N9KA 3H6NA 3IAM1 2CHWA 2QIEB 4LNFA 3KRWA 3AV8A 2WDQB 3PLVA 4GU2A 1P6SA 3ODOA 3SNHA 1K50A 1R4MB 1SE9A 4A3OA 1WI0A 3RNFC 3HIZA 2D3CA 4CYEA 5FR6A 2EJ8A 2W3RA 2D3GA 1UGMA 2KVZA 1QOBA 2NBVB 1LGRA 4LCDE 4JLCA 5LOPB 3L4PA 2KQSA 2DAFA 4GLSC 2J0KA 2ELAA 3P42A 2BTEA 5D3YA 2W9NA 2MJDA 3AE6B 3EFCA 1SBBB 3R8BA 1XLQA 1RFAA 3ZJTA 3A9KA 4IG7B 4OVVA 1XCTL 2WXHA 4K7WA 4JKFA 3KWVA 4YSXB 5HI1A 2ZZPB 4HROA 4Y94A 3I57A 4N9F4 1UPRA 1N5XA 4F1SA 2O6VB 1IUEA 4FXCA 5AZHA 2CRFA 2ZPYA 4KZ0A 2DA0A 4LNOA 1WGHA 3H7PB 4HAVB 2NMQA 4USAA 3GE3C 4F7GA 2J7QB 1DYQA 2KC1A 4YSYB 4XZ4A 3ABVB 4ZDVA 5C6RA 3K9OB 3N1XC 3L54A 1U5EA 4PS8A 3HSAA 2LMCA 1T3QA 2JXTA 4FHKA 2K22A 4W9LA 5DPTA 3E9LA 2WXGA 4ANXA 2KQ7A 2JY6A 2R2QA 4HJGE 3N3KB 1XF5L 1WXSA 3SYXA 2KDBA 3Q3FA 1UNRA 1VZ6A 4RGTA 2MX2A 4XWTA 3MFGA 1UF0A 4II2B 1T77A 2N7DA 3ENBA 3FC4A 3TL5A 1WVHA 3ZXRA 5BO4B 1V89A 2COFA 4N58A 3ZVVA 1UZXB 1C78A 2Y5CA 4MY6A 1ZDXA 2CB8A 1AYFA 3BJIA 1SB3C 2C7MB 2XK5B 3BYYB 2L05A 4OW0A 4ZRIA 2K2JA 3SFEB 2K3UA 2IPKD 2DZIA 3LXFA 2R2OA 2V9HA 1E8XA 3BYTB 2FAZA 4K7UA 3B77A 1C76A 1L7YA 1WJMA 1KTKA 2UWQA 4JX1C 1TJEA 1Z2MA 3N32A 4YONA 2RD0A 3QARA 2FUHB 1ZM0A 1IBXA 1WGGA 1E7UA 3DVGY 2N1WA 3RN9C 2GBRA 5KQ1A 5DPWA 3SEBA 1C4AA 5CTRC 4PS7A 2KDMA 3PHXB 2CODA 4JKAA 1YIWA 2IDYA 2ROVA 2KFKB 1WX7A 3NG0A 4OT1A 3PRMB 2BS3B 2KUQA 2GCLA 3Q8BA 2J0MA 2C7NB 3VTVA 2CY4A 5BMGA 3FILA 1PDXA 3PO0A 4M02A 4D6WA 2DKQA 1WXMA 5CX3A 3QBVB 1JROA 3AH7A 1DOXA 5EE0A 1WR1A 2LJ5A 3QJZA 4UDUC 4B0EA 2H7EA 2COPA 4A6HA 2AQ2B 2PVGC 5J17A 2RNRB 1VBGA 4WWMA 4K7SA 5CHFA 4BBNF 2LXCA 5C2TB 1NU2A 1HE8A 4MJSA 1WRIA 1YQ3B 5IOIA 2DIKA 1C4CA 1I35A 2AYOB 4G11A 1WGQA 2Y8GA 4ITKA 5DCNA 4K1RB 1ZKHA 1UD7A 2G9HD 1VLBA 2E2XA 3GB1A 1TYGB 3V62A 1V5MA 5D2MB 4ICVA 2FJ9A 4RM9A 4IM0A 2Z0OA 4FHJA 1V5TA 3PPAA 4HPMB 2FIFA 2K39A 3U7DA 2LRWA 3ZIMA 3M3JA 4A20A 2DNFA 4W9IA 5KCVA 1JW9D 3DXDA 2LUEA 1AWDA 3ENEA 3QQ8B 3ZKJC 3PHWB 1ZC3B 2DYOA 2LFIA 1STEA 3C0RB 1TZ1A 2C9WB 2JQRB 2WXMA 1FGYA 3QWZB 5D3WA 2AQ1B 5FI0A 1SF0A 4DHZE 2P0HA 3JW0X 3M63B 1EVHA 2WNMA 1PGAA 3UQBA 1MIXA 3KW5B 2VRRB 3T3NA 2DBYA 3TW1A 2L83A 2C7HA 2QSDA 4IM3A 3EUB2 4WJQA 4ANVA 1V1OA 3ETRA 1BMLC 1YN3A 1SE4A 2N9LA 5D3VA 2M56B 1EUVB 4ILGB 5JHGA 2KACA 2RPVA 3ZRFA 2KFKA 4MGIE 3DBRI 3DCXA 1XR0B 2IGGA 3JSVA 1S3SG 5BYQA 4PQ0A 3Q3JA 5D7GA 1N62A 3QX1A 3VVWB 1JALA 1KH0A 1R4NI 3V60A 3PVLA 4G50A 1UPQA 3D8DA 1UGJA 1QZEA 3L10B 1WX9A 2BKRB 3PSEB 4JE3B 4Q2JA 1FHWA 2KMCA 4B95A 1DBHA 4NNJB 1OEYJ 2OJRA 5E6OA 5LLIA 3RULA 4L1RA 4B6HA 4NQLB 4TV3A 1QILA 3KYDD 4FJZA 1V80A 3DVNU 2WXLA 4H8SA 2KIGA 3IFWB 4LLGM 3RT3B 3RI7C 1XCGA 2WDRB 1GGOA 1PQSA 2JZPA 2WXIA 1RYJA 1XD3B 2UZSA 4P1BC 4EZLA 5IP4D 1N60A 1VRAB 3P1MA 1FXIA 3O65B 1VCBA 2FCMA 3FSSA 3NHEB 3RYTA 3VUWA 1UBQA 2LOXA 3ZRCA 3PEGA 4KDLB 4WWOA 4MK0A 2EELA 1J0WA 3Q8CA 4BKTA 1LXDA 3PZDA 2PVOD 4E3CA 1FXAA 3PT2B 4WWPA 2RSUA 2V1YA 5LNK1 1H4RA 4IFSA 1HB8A 1FRRA 3PGEA 2VH1A 2N9PC 4JWSC 2GMIC 3E9SA 1L0VB 3M62B 3ZNHB 3D32A 2W2XC 4KHBA 3VXWA 4N6EB 3APDA 3HHMA 2PIAA 4LTUA 2KDIA 2DZJA 4ZRPA 3AE5B 4PYUA 4ILJA 1HXYD 2X38A 2A5UA 4OZBA 1Q67A 1FNUA 2DN6A 3DXEA 5G5GA 1WJ6A 4DX90 1FOEA 3ZNID 1FCCC 2H89B 3ZDMC 3N1ZC 2V4IB 2JSVX 4QAYA 5AEKB 2XBBC 2OHFA 1YJJA 3AXCA 4J3OD 2UYZB 4DHJD 1J0GA 3AULA 1I7AA 3NZSA 3V3XA 3AMZA 2CU1A 1QQRA 1NDDA 1JWUD 1R7SA 2D9ZA 2LRUA 3A1QB 2CQUA 1WYWB 2K8BA 4WJOA 1NVID 3SUZA 1A5RA 2RR9A 2ZVOA 1K51A 1X05A 4WIPA 4YXDB 3HUIA 3FLVA 4PT5A 3BINA 1LO5D 2PW9A 3OWEB 1T0YA 3GP7A 2D07B 3VR8B 1KZGA 1GNUA 3DHGC 1N63A 5DPSA 1WI1A 1TZOA 4HAYB 2XNAC 3NVYA 1V81A 1FXTB 2PEAA 3LB8C 2IFSA 1E0ZA 1XX0A 2LVQA 3FP5A 3PV1A 4DDGD 4KGRA 2HJ1A 2LGIA 4EOYA 1GUAB 4IM2A 3L08A 4W9HA 1WG7A 1MK9B 2I5FA 4HWIB 1JDEA 5HE0A 3FEHA 3QAQA 4GPTB 3PP2A 2NBUA 5FKAC 4LJPB 2PLPA 2LULA 1GB4A 4NAWB 4W9GA 3ZVRA 3ONSA 3P2BA 2G4DB 2J52A 3WYFB 1RRBA 1J19A 2UVMA 3TO1A 1HZ5A 4GNKB 3PS6A 2YLMA 3TBLD 1DDMA 2CR5A 3KSYA 3AEGB 2L3ZA 1F52A 1WZ3A 3DXCA 1FM0D 1ZPSA 2ZPNA 3BZDB 3TCAA 1DROA 5DI9B 4HAUB 4CO7A 1V8CA 1SSNA 4REZA 3IHPC 4NJ7A 1XEEA 3WIMA 4JK7A 2MQJA 3ULBA 1C9FA 1ZC4B 5G5HA 4WJNA 2KAJA 4L1BA 3ZJVA 4F7HA 5LG4B 1TXDA 2MDXA 1WJ1A 1TY0A 1BWNA 1E7PB 1F0ZA 4DDID 1FO4A 2KN4A 2K6DB 4XGAB 1FCLA 1J7AA 3ODWA 3KYCD 1D3ZA 3GZNI 3P7ZA 3R2IA 5EDSA 1WX8A 4GIVA 1L4ZB 1VDVA 1WM3A 3ALBA 4WAFA 3LJ3A 2WXRA 2DAJA 2N0YA 1M4VA 5DH9B 3DBRB 2BB5A 2D9WA 1WGYA 1ZW7A 4MGYE 1UH6A 1WGKA 1U2BA 1TS3A 3F5RA 3KRXA 3P6AA 2WXPA 4GSWA 1WGUA 2CS4A 1R4NB 1SJHD 2INDC 1KFYB 3T9LA 2R61A 1LM8B 1SE3A 3TUOA 1EWCA 3CIKA 2QKMA 3ML9A 5BMIA 3FKYA 2ABDA 2BYEA 2JP2A 2YSZA 3A9JA 1OQQA 1WMHA 1DDVA 4MELA 2O6VD 5BYRA 4EE2A 3WAOA 4A55A 3B2GA 3MPXA 4K3BA 1XO3A 1D6EC 1WXQA 4DXFA 2KZRA 3PVUA 3QCAA 3TEYA 4P16A 2FUG1 2CHXA 4C56C 2MWNB 3PRZA 4GDLA 1MVKA 2IY1B 5I4DA 2LKOA 3RNGC 2GI9A 3PRPB 4HATB 3AEDB 4A6QA 3DQVA 3NS8A 3SBGA 1TKGA 1I4HA 2P0DA 1FHOA 1NTYA 1YN5A 2NTSA 4BAXA 2LI5A 2DLBA 4DBBA 2K25A 2PPHA 5AUIA 3RNEC 2K8CA 2PJHA 2HDEA 3KVFB 1EAZA 3EGRA 3PREA 3IG3A 1MIZB 5IO9A 4KDIC 2AWTA 3U52E 1ISNA 3PG7A 2KMMA 1WH3A 2JWUA 2LHEA 3M1IB 3B2FA 4HVBA 1JWAD 1ET9A 5BYSA 4NJ6A 1U4AA 1KZ7A 2K49A 4RF1A 3WALA 5HHDG 4BVUC 3VRBB 1TQZA 2LVPA 2L52A 2M4NA 3OJ4B 2DYMA 4JKDA 1GB1A 4R3DA 1FMAD 2LOZA 1I4RA 4XX5A 1T0QC 2BWFA 4FA6A 2IO0B 2VRWB 2BYVE 3DCGA 4C4VB 1D5ZC 1PGXA 2JRHA 2NPTB 3V6CB 1RRPB 4DWFA 4RGMA 2YS1A 1P3QU 1PGBA 3V05A 3BVGA 3RD2A 5LONB 2W54A 5H8YE 2CY5A 1BT0A 2L0FA 1HEZE 1D5XC 1PLSA 2PKOA 2WXQA 4AJYB 4HB0B 3NZUA 4MSMB 4OHJA 1ENFA 1U5FA 5HE3A 4EJNA 1FFVA 4OZAA 2NMBA 3C19A 4W9JA 4KSLC 1T5XD 2SAKA 4HB2B 1P5TA 1ACAA 1OY2A 2KIEA 3AI5A 3VRAB 4Z2MB 3KWLA 4JL9A 4BOSC 2KWCA 4A6FB 1V9JA 3EA6A 1OQNA 1QOAA 2KFJA 3MJ5A 4KSKC 2KDFB 2QC8A 1L5PA 1NENB 2KKCA 1TIFA 4EKUA 2NR2A 1H8CA 4HPPA 4P6VF 4YWGG 2RSGA 2WU5B 2KANA 3VR9B 3DHIC 4GN1A 3TSSA 3BIID 5GXGB 4GDKB 3OG5A 4GXBA 1XCQL 2WS3B 3AE8B 4MGKE 4L6EA 3ECIA 1YN4A 4XYCA 3Q3MC 2MBEA 1L2NA 3U12A 2NBVA 2MJ3A 4AWJA 1YOVB 2Y7BA 2WDTB 2NZ8B 2WHIA 4CHKA 3N9YC 4HAZB 2QKLA 1L0XB 5JHBA 1VZ8A 1NYRA 1QLBB 1U27A 2K9XA 3MHSD 4XDCA 1HTOA 4F8CB 2WWZA 1I4XA 4JKHA 2HTHB 2LGDA 4S0RA 4QXAB 3NWDA 2KWVB 2O6VA 2GBJA 2GBMA 4KGSA 3K9PB 3E9OA 2BF8B 3H7PA 3HIEA 4LNKA 4P7IA 1WZ0A 2LHDA 3UF8A 1BTKA 3AE3B 2GJYA 1V97A 1TKYA 2IO1B 4AS1A 2MH7A 2Y8FA 2KWUB 2B3AA 2H88B 2W55A 1MK7B 3N7CA 3VOQA 4A5KA 3NOBA 1KLVA 1GOZA 5JVLA 2I5CA 3CMMB 3GZNB 1YJ1A 2LGSA 2WXKA 3MP9A 1F2RI 4N59A 1UWXA 1J7BA 2KX3A 2J42A 4IOIE 4L2YA 1FNVA 4A6KA 5JH5C 3B0AA 4KIKB 3TFMA 2KLCA 4AQ7A 1QOGA 2VSZA 4HXDA 3OHMB 1CMXB 3PSCA 2UU7A 5KHQA 4RM8A 3NVZA 4HAXB 1TGZB 1WE6A 4JGHB 4XDDA 3A4SC 1MAIA 4M0WB 2KTRB 4FJYA 1GJZA 3B9JA 4QJ4B 2XK5A 2AX5A 3U30A 1WGDA 4B0MA 3O13A 2KNBA 1AARA 4OVZA 3ZDTA 2M0XA 1FB8A 3IBEA 3DDCB 1FAOA 4JPSA 1KC7A 2ADZA 5D6JB 1E5WA 1JWSD 1K5GB 1UEFA 4A6FA 2DX5B 3APCA 2E6XA 5KQ4A 2NCNA 2O2VB 1MHHE 1OEYA 5CHWA 2V3SA 3IVFA 1XKEA 4GB9A 1KOTA 5L95C 4K17A 1WRDB 3H1UA 2K0PA 1J7CA 2M14A 1YQBA 3NZ3A 3D8FA 1U29A 1JWBD 1AQCA 2KTFA 2R82A 3W5VB 2HD5B 2G45B 1WSPA 1RJ2A 1IYFA 3UI3A 1KLGD 2BCJA 4HAWB 5D3DA 2X8XX 1Z87A 3R3MA 3D8EA 3P4SB 2QEJC 4GOUA 2UZRA 2QMTA 1TKEA 2D4QA 2MBHA 2LGXA 5T8IA 1F2RC 1EF5A 4OSNA 1K5DB 5IN7A 3P63A 2JX5A 1T0RC 5C5BB 1SXTA 2YF0A 1TT5B 2WXOA 1EU4A 1SHCA 4PNKA 3UINB 2LVOA 2X18A 2VKIA 3EPYA 5JZEB 1I4PA 1FPYA 3ZQ4A 1HQRD 3VH3B 2JPHA 2WP9B 1BTNA 3Q3OC 2XQNM 1W1HA 3NWFA 4NAMA 1FGZA 4JQWC 5I2SA 2RLOA 3VTUA 3AM9A 4X57B 4DXGA 1WGRA 5E6PA 2FBWB 2PZ1A 3SD5A 5CLQB 2I1JA 4MEMA 2V76A 2Y3AA 4IC7B 3R7RA 4BZAA 4RMAA 2L1AA 2M8SA 5J3QA 4FBJB 3IT4B 3GYOA 4EEWA 3ZYYX 2YEPB 3U8ZA 1MFWA 3RCPA 3F0WA 3ML8A 2INNE 2ZEQA 3C8YA 4MT7A 5L81A 4JIOU 2KHWB 2AL6A 2DLWA 1FNWA 2IY0B 3HW2B 1LFDA 3HRDD 2MCNB 2KLGA 5CLLB 2BS4B 3GOEA 1UNQA 2BWES 1XQQA 4GGQA 1OMWA 1HA5A 2P0FA 2ZW1A 2RRFA 3P4PB 1JCKB 4NJCA 4RCOA 4ZRQA 3RPFC 2KXJA 3DBLI 2J4XA 1ROEA 3VUXA 1WE7A 3RNAC 1KRHA 1NVLA 1MHXA 2C5LC 2D9YA 3FM8C 4YTMB 2DX5A 2J59M 1PUTA 1NI3A 2E3TA 4MM3B 1T0SC 3I63C 2WDVB 2KUPA 4WJPA 1NTVA 4KX6B 2RGNB 2Z59B 5JLJB 2N7JA 2DHKA 4NSWA 3ZNZB 2WXFA 3QK0A 4M8NA 3AE1B 2ROZB 4C80A 1X1MA 2YVCA 2DYNA 1EU3A 3AEEB 2RMMA 2ACZB 2IO3B 2OJWA 5DHFB 1V2YA 2NS5A 4TYZA 2JF5A 1DYNA 3NRZA 3W1SC 5HG2A 5JXVA 1OQYA 1WY8A 2KCJA 2KD0A 4IWQA 1HBKA 2DENB 1U5DA 2FJLA 4LDTD 3FVCA 1XD4A 3UIPB 4M8MA 2BS2B 1YNTE 2MP2B 1MPHA 3AB5A 2JZ3B 2LJIA 2MBOA 3ULCA 5I2MA 5C5BA 2ZNVC 1E10A 1X1FA 2DTCA 3RNBC 1YMHE 3A8QA 5J3YA 2OEDA 2JT4B 2FNJB 1WR6E 2YRYA 2HTME 3HK0A 2NTTA 1I2HA 3U7ZA 3ZLZA 2JWZA 2W82A 3S2AA 4WQMA 3AU4A 4WAAA 1WF9A 4RF0A 1Q0WB 1XXGA 2W3SA 2QDFA 1NYQA 1F1HA 4A3PA 2RDHA 4ZHPA 3MC8A 2LXAA 1N3HA 3UQAA 4HDQA 2L00B 4ZRKA 4ICUA 1ACCA 2R0DA 3W9CB 1WJUA 1B1ZA 4MGZE 1MG8A 5GOWB 4TSSA 1NEKB 4W9CA 2L8JA 2M17A 1ZOYB 1WFYA 4HKQA 4HPLB 3RMKC 2W2XD 2RVBB 2JYEA 1JMLA 3WAPA 2G35A 1V5UA 2BW2A 4F7ZA 1LB1A 2PMVA 1F9JA 4E71A 2DZKA 1SEBD 3NS1A 1WXVA 3WANA 4A9AA 1L0YB 4J6IA 1WYGA 2DHZA 1WXAA 3W5UB 2DHJA 2FIDA 3WCQA 4AOFA 3KUCB 4XWXA 1XLPA 1G6JA 1W1DA 2DKPA 2LUMA 3Q6BA 2DYQA 1CQVA 1MG4A 4HSIA 2RDBC 4BKSA 3H7SA 3MJWA 1RWSA 1GAQB 2N7EA 2OTXA 1RLFA 3TMPB 1FEHA 3T8MA 3A9KB 2X0SA 5DPRA 3GE8C 1HTQA 3SBTA 2G3QB 1AWEA 2MSED 5FR3A 3ZW3A 4IOYX 1E8YA 2IJ0A 1EGXA 4JWUC 4JKCA 4PK1A 5J3TA 4FJVB 1KI1B 4EZKA 2YT1A 1KM7A 2Y5BB 3A1QA 4F7UP 2R09A 2W2WA 3TEXA 2WH5A 5DIFB 3MC0B 4QJ5B 2KO3A 5KHOA 4MH8A 2WLBA 3APFA 3KY9A 3W2DA 2COAA 2WGSA 4US9A 4C7YA 3MTNB 1B55A 3H9DA 4ARIA 1MJDA 1ZDVA 2WQYB 4ZRJA 2WXJA 2FCQA 4DBGA 2MRPA 5IRSA 1IPGA 3CSTA 5LXHA 5AZFA 3PVWA 3ZGZA 5CHVC 2Q5WD 2M0AA 2Z0QA 3JVZX 2K2UA 3QHTA 4A90A 4I6LB 2ZNVB 4NAWA 1E90A 2J53A 1Y56A 4XE0A 1L6UA 3CIRB 3RNCC 3G9WA 3SR6A 1MPEA 4LK0M 4DHZB 2RUKB 2DZMA 4II3B 1TS2A 1WM2A 4NPNA 4YL8A 3VH4B 3Q69A 1ZVRA 3P4RB 3R2TA 1VD2A 3AEAB 3N30A 2C60A 1V6EA 1ZGUB 4ANWA 4I6PA 4QJ3B 3DBLB 3ZUNA 4MSQB 2I1KA 3NWAA 1HZ6A 3OANA 1IBXB 4YT0B 4HEA1 3A4RA 4KHOA 5HE1A 4PYZA 4CSQA 3Q14C 4HJKA 1P3RA 3NUHB 2K1FA 2KJHB 3DWMA 4EFOA 1JWMD 1V5OA 2KK8A 1P98A 2D9XA 4G3XB 3VUYA 1A70A 3FILB 4XWWA 1K8RB 3KUDB 4ILHA 4JKEA 2YS5A 4IDIA 3URYA 4NY0A 2ICIA 4PS3A 3ZXVA 3HVDA 2D11A 2L76A 2M19A 2IYBA 2MBQA 4YTNB 4MJSB 4IWPA 3ZNGC 3PTFC 2FJUB 1P7FA 2GB1A 5G2NA 1XT9B 1QQGA 3LDZE 2N9XA 1VZ7A 1ZP0B 4I6NB 2VZKB 4HB4B 4Z2NA 4LNIA 2LEKA 3AEBB 1GG3A 5E6NA 4BOZB 2J0JA 2Z14A 2K8EA 1F77A 4XC2A 5G55A 2YS3A 4M00A 3W1SA 2K8HA 2FCSA 4K3CA 2IBIB 3IAS1 5L83A 1EM7A 2BPSA 3WAMA 3OLMD 2YT0A 4W9DA 4L23A 4GMXB 1CJEA 1ZUD2 2MW5A 4GZUA 3KQ4A 1FD6A 2RQ1A 1PFDA 3UIOB 2DYBA 2RDGA 2TSSA 3R7QA 4TQ0A 1UNSA 2BQQA 1XLNA 3AECB 1DIKA 1DGJA 2EMSA 3HVZA 3U4EG 4BBNC 2EKEC 2MLBA 3A33B 2D3BA 1YD8U 1P1AA 1V61A 3ODXA 2NVUI 3Q3NC 2Z4DA 4IWOA 4K2OA 1BAKA 4BKGA 2GOWA 2KN5A 3NJTA 3EFUA 2ASQA 2D3AA 3B1LX 1Y5OA 1IRSA 2INPE 4WWNA 3FAHA 1TJ6A 3BK2A 4KKIA 5AZGA 4M01A 2DX1A 5TSSA 2KDEB 3T3OA 3ZJUA 5EE3A 3AEFB 1YJIA 1QC6A 3BY4B 5HKHA 3RFZB 3DBHI 4HLEA 1TS4A 2CJOA 4RGOS 4TMAB 1IGCA 3JSVB 2LG1A 3BK1A 4JK8A 4D0NB 4D2KA 2AEHA 2BB6A 3SDLC 1E9MA 3KLSX 4KHAA 3RZWC 2ELBA 3A98B 2BYFA 2KYWA 3P4QB 3RCZA 4FLHA 4TQ1A 4C4VA 3EC8A 4ASWC 5H92C 2NPTA 4WVFB 1ZSQA 2Q13A 2P8VA 2L0TA 2N9EB 3SU8X 5HFYA 5J18A 1RM6C 5C23A 2BYTA 4B9KA 4HB3B 2Z0PA 1TS5A 3ZTCA 1QT9A 2ZVNA 2KJ6A 4DIXA 1NBFC 2BVCA 1JQ4A 4G0NB 1UWMA 4YTPB 5M4YB 2PE9A 2CHZA 2KC2A 4NZLB 2LZ6A 2KR0A 3VHTC 3AE4B 1OTRB 1TBEA 2Z0DB 2DWQA 3VIAA 2MWSB 5HE2A 1PMSA 4WJ7A 1UELA 3A8PA 3DHHC 2YEPF 1I4GA 2WYQA 2EMTA 4HCNB 2BBCA 4BBKA 4FN2A 3DVGX 4IKGA 1NTIA 4C7ZA 2JXXA 4NQKE 2MBBB 2ZCBA 3AN1A 4OVUA 4ANUA 4ACFA 2ZKMX 3IXSA 1LQBA 3H8HA 4KKJA 3JYUA 4MT5A 2INCC 2D10A 2ONQA 1L6VA 1MI0A 1V1PB 5D94A 4URKA 3PZ7A
chains in the Genus database with same CATH topology
4MH0E 2RGFA 3L17A 1W1GA 2IZVB 4W9KA 2BGFA 4GDKA 4KHBB 4WQOB 3E66A 4CHJA 3L0WB 3V6EB 3HQCA 4EMOA 4IW0A 1U5GA 3NY5A 4JKGB 5IJMA 2NBWB 1Z5SB 2REXA 1WJNA 5JP4A 3MDBC 1V86A 1FHXA 3X23A 4W9EA 2AL3A 2HTHA 5JHAA 2BKFA 3X0WA 1UBIA 3W1YA 4KV2A 3VQIA 4LJOB 2G4SA 3ZTDA 2L2IA 3SV1A 3TVVA 4BKSD 1EF1A 3AU5A 3UZTA 3QWMA 3HM6X 2LASA 1X86A 2D9VA 1H10A 2FCNA 4IAPA 1YX6B 5IA7A 5LXIB 1SGHA 4TUUA 2N1VA 1KBLA 2RPQA 4KIKA 3KZ1A 5GMVA 3VAWA 5D3XA 4CHMA 3VTWA 3B08A 4KZCA 2CAYA 1XODA 1GC7A 2KGXB 2KTRA 1R4MI 3HM3A 1X1GA 2WX1A 1RAXA 3I3TB 3VFKA 3KUZA 2ZJDA 2M38A 3DOWA 2O2VA 4JK9A 1M7EA 2K6QA 3WA0A 3L13A 4KVGB 5FI1A 3QA8A 3V5WA 1DDWA 4HHVA 1P0RA 2L1CA 3CSFA 5J2RA 4GOCA 4K81A 1M94A 5C16A 4MDKE 5D27A 2XEWA 3VDZA 4AP4C 2OOBB 5C1ZA 3QC8B 1J8CA 4JKGA 3T06A 2D2QA 5C79A 3DBSA 3M95A 1M7RA 2JRIB 1OGWA 4EUTA 1SIFA 1NI2A 3EECA 2HE7A 1P9DU 2LYDA 2GS0A 2GBNA 2LWPA 2PE6B 1S1QB 1C1YB 2IO2B 1LW3A 1HB6A 2KOXA 2Z0EB 1VBHA 4IUMB 2DFKA 4AJWA 3ZO5B 2A4ZA 2JUOA 4HDOA 4TKNA 3NSUA 2KMAA 5TR5A 3SO6A 2ZCCA 2V4LA 2WX0A 1Q5WB 4HK2A 2DHIA 4KAXB 2IYDB 2N4FA 3RZFA 4HCPB 3AJ4A 1ST7A 3A9JB 1V88A 1WMHB 2FDQA 2LBBA 2MKRA 4B6WA 3KH0A 1GC6A 4K2PA 1EO6A 4GDLB 2CKHB 2MFQA 3ML4A 2KX0A 4ZYNA 3DPDA 2L7RA 4MM3A 3R66C 4DHJB 4FULA 1V5PA 4FADA 4LDTB 1E8ZA 5DHAB 2HRJA 4DX8A 3CF6E 1Y19B 1V49A 2KVRA 3EHVA 2QHOA 5IAAC 3L16A 3LJUX 2JVCA 2LGYA 3OAWA 4DXAB 3RUIB 2H7DA 1C3TA 3GYPA 4E74A 1I42A 4W9FA 2EC1A 2MP2A 2GBKA 4C0AA 1UNPA 4WSFA 4DK5A 1PFJA 1X11A 2K00A 3O96A 2KJRA 4AUQC 1Q1OA 1E7VA 2M1MA 3TIXA 1JRUA 3UGBB 5EFXA 2JZZA 3E9PA 3CXBB 1IP9A 1Y8RC 3OJ3A 5JHHA 3PLUA 1E8WA 3V61A 2LD9A 3DVNV 1WJ4A 3QIJA 3SHQA 2COCA 1MKEA 2MA9B 2OQBA 1WIAA 1YX5B 2HJ8A 3TJPA 4BFRA 4JKBA 4GMVA 1TTNA 2N23A 1KJTA 4EZJA 2GCJA 3H6NA 2CHWA 3KRWA 3PLVA 4GU2A 1P6SA 3ODOA 3SNHA 1SE9A 4A3OA 1WI0A 3HIZA 4CYEA 5FR6A 2EJ8A 2D3GA 1UGMA 2NBVB 4LCDE 4JLCA 5LOPB 2KQSA 2DAFA 2J0KA 2ELAA 5D3YA 2W9NA 1RFAA 3A9KA 4IG7B 4OVVA 4K7WA 4JKFA 2ZZPB 4Y94A 4N9F4 1UPRA 4F1SA 2O6VB 5AZHA 2CRFA 2ZPYA 4KZ0A 2DA0A 1WGHA 3H7PB 4HAVB 4F7GA 2J7QB 2KC1A 4XZ4A 4ZDVA 5C6RA 3K9OB 3L54A 1U5EA 4PS8A 4W9LA 5DPTA 4FHKA 3E9LA 4ANXA 2KQ7A 2JY6A 2R2QA 3N3KB 1WXSA 3SYXA 2KDBA 3Q3FA 1UNRA 2MX2A 4II2B 2N7DA 3ENBA 3TL5A 1WVHA 5BO4B 1V89A 2COFA 3ZVVA 1UZXB 4MY6A 2CB8A 2C7MB 3BJIA 2XK5B 2L05A 4ZRIA 2K2JA 2DZIA 2R2OA 1E8XA 2FAZA 4K7UA 1L7YA 1WJMA 2UWQA 1Z2MA 3N32A 4YONA 2RD0A 3QARA 2FUHB 1ZM0A 1WGGA 1E7UA 3DVGY 2N1WA 2GBRA 5KQ1A 5DPWA 5CTRC 4PS7A 3PHXB 2CODA 4JKAA 1YIWA 2ROVA 2KFKB 1WX7A 3PRMB 2GCLA 2J0MA 2C7NB 3VTVA 2CY4A 2DKQA 1WXMA 5CX3A 3QBVB 1WR1A 2LJ5A 3QJZA 2H7EA 2COPA 4A6HA 5J17A 2RNRB 1VBGA 4K7SA 5CHFA 4BBNF 2LXCA 1NU2A 1HE8A 4MJSA 2DIKA 1I35A 2AYOB 4G11A 1WGQA 2Y8GA 5DCNA 4K1RB 1ZKHA 1UD7A 2E2XA 3V62A 1V5MA 5D2MB 4ICVA 2FJ9A 4RM9A 4IM0A 2Z0OA 4FHJA 1V5TA 3PPAA 4HPMB 2FIFA 2K39A 3U7DA 2LRWA 3ZIMA 3M3JA 4A20A 4W9IA 5KCVA 3DXDA 2LUEA 3QQ8B 3ENEA 3ZKJC 3PHWB 1ZC3B 2DYOA 3C0RB 1TZ1A 2C9WB 1FGYA 3QWZB 5D3WA 5FI0A 4DHZE 2P0HA 3JW0X 3M63B 1EVHA 3UQBA 1MIXA 3KW5B 2VRRB 3TW1A 2C7HA 4IM3A 4WJQA 4ANVA 5D3VA 1EUVB 4ILGB 5JHGA 3ZRFA 2KFKA 4MGIE 3DBRI 1XR0B 3JSVA 1S3SG 4PQ0A 3Q3JA 5D7GA 3QX1A 3VVWB 1R4NI 3V60A 3PVLA 4G50A 1UPQA 3D8DA 1QZEA 3L10B 1WX9A 2BKRB 3PSEB 1FHWA 2KMCA 4B95A 1DBHA 4NNJB 1OEYJ 2OJRA 5E6OA 5LLIA 3RULA 4B6HA 4NQLB 4TV3A 3KYDD 4FJZA 1V80A 3DVNU 4H8SA 3IFWB 3RT3B 1XCGA 1GGOA 1PQSA 1XD3B 2UZSA 4EZLA 3O65B 1VCBA 2FCMA 3FSSA 3NHEB 3RYTA 3VUWA 1UBQA 2LOXA 3ZRCA 3PEGA 4KDLB 4WWOA 4MK0A 1J0WA 4BKTA 1LXDA 3PZDA 4E3CA 3PT2B 4WWPA 2RSUA 2V1YA 1H4RA 4IFSA 1HB8A 3PGEA 2N9PC 2GMIC 3M62B 3ZNHB 3D32A 2W2XC 3VXWA 3APDA 3HHMA 2KDIA 2DZJA 4PYUA 4ILJA 2A5UA 1Q67A 2DN6A 3DXEA 1WJ6A 4DX90 1FOEA 3ZNID 3ZDMC 5AEKB 2XBBC 3AXCA 2UYZB 4DHJD 1J0GA 3AULA 1I7AA 3NZSA 2CU1A 1NDDA 2D9ZA 2LRUA 3A1QB 2CQUA 1WYWB 2K8BA 4WJOA 3SUZA 1A5RA 2RR9A 2ZVOA 1X05A 3FLVA 3BINA 1T0YA 2D07B 1KZGA 1GNUA 5DPSA 1WI1A 4HAYB 1V81A 1FXTB 2PEAA 2IFSA 1XX0A 2LVQA 3FP5A 3PV1A 4DDGD 4EOYA 1GUAB 4IM2A 3L08A 4W9HA 1WG7A 1MK9B 2I5FA 4HWIB 1JDEA 5HE0A 3FEHA 3QAQA 4GPTB 3PP2A 2NBUA 4LJPB 2LULA 4NAWB 4W9GA 3ZVRA 3ONSA 3P2BA 2G4DB 3WYFB 1RRBA 1J19A 2UVMA 3TO1A 3PS6A 2YLMA 3TBLD 1DDMA 2CR5A 3KSYA 2L3ZA 1WZ3A 3DXCA 2ZPNA 3TCAA 1DROA 5DI9B 4HAUB 4CO7A 3IHPC 4NJ7A 3WIMA 4JK7A 2MQJA 3ULBA 1ZC4B 4WJNA 4F7HA 1TXDA 2MDXA 1WJ1A 1BWNA 4DDID 2K6DB 3ODWA 3KYCD 1D3ZA 3GZNI 3P7ZA 5EDSA 1WX8A 4GIVA 1WM3A 3ALBA 3LJ3A 2DAJA 2N0YA 5DH9B 2D9WA 1WGYA 1ZW7A 4MGYE 1UH6A 1U2BA 3F5RA 3KRXA 3P6AA 4GSWA 1WGUA 2CS4A 3T9LA 1LM8B 3CIKA 2QKMA 3ML9A 2ABDA 2BYEA 2JP2A 2YSZA 3A9JA 1WMHA 1DDVA 4MELA 2O6VD 3WAOA 3MPXA 2KZRA 3PVUA 3QCAA 2CHXA 2MWNB 3PRZA 4GDLA 2IY1B 2LKOA 3PRPB 4HATB 3DQVA 3NS8A 3SBGA 2P0DA 1FHOA 1NTYA 2LI5A 4DBBA 2K25A 2PPHA 2K8CA 2PJHA 3KVFB 1EAZA 3PREA 3IG3A 1MIZB 4KDIC 2AWTA 1ISNA 3PG7A 1WH3A 3M1IB 4HVBA 4NJ6A 1U4AA 1KZ7A 3WALA 4BVUC 1TQZA 2LVPA 2M4NA 3OJ4B 2DYMA 4JKDA 2LOZA 4XX5A 2BWFA 4FA6A 2IO0B 2VRWB 2BYVE 3DCGA 2JRHA 2NPTB 3V6CB 1RRPB 4DWFA 2YS1A 1P3QU 3RD2A 5LONB 2CY5A 1BT0A 2L0FA 1PLSA 4AJYB 4HB0B 3NZUA 4MSMB 1U5FA 5HE3A 4EJNA 2NMBA 4W9JA 4KSLC 4HB2B 1P5TA 1ACAA 1OY2A 3AI5A 4Z2MB 4JL9A 4BOSC 2KWCA 4A6FB 1V9JA 1OQNA 2KFJA 4KSKC 2KDFB 2KKCA 4EKUA 2NR2A 1H8CA 2RSGA 2KANA 4GN1A 4GDKB 4GXBA 4MGKE 4L6EA 3ECIA 2MBEA 1L2NA 4AWJA 2Y7BA 2WDTB 2NZ8B 4CHKA 4HAZB 2QKLA 5JHBA 3MHSD 1U27A 4F8CB 2WWZA 4JKHA 2HTHB 2LGDA 2KWVB 2O6VA 2GBJA 2GBMA 3K9PB 3E9OA 2BF8B 3H7PA 4P7IA 1WZ0A 3UF8A 1BTKA 2GJYA 2IO1B 2Y8FA 2KWUB 2B3AA 1MK7B 3N7CA 3VOQA 4A5KA 3NOBA 1KLVA 5JVLA 2I5CA 3CMMB 1YJ1A 2KX3A 4A6KA 5JH5C 3B0AA 4KIKB 3TFMA 2KLCA 2VSZA 4HXDA 1CMXB 3PSCA 5KHQA 4RM8A 4HAXB 1TGZB 1WE6A 4JGHB 3A4SC 1MAIA 4M0WB 2KTRB 4FJYA 1GJZA 2XK5A 3U30A 1WGDA 2KNBA 1AARA 3ZDTA 2M0XA 1FB8A 3IBEA 3DDCB 1FAOA 5D6JB 1KC7A 2ADZA 1E5WA 1K5GB 1UEFA 4A6FA 2DX5B 3APCA 2NCNA 5KQ4A 2O2VB 1OEYA 5CHWA 2V3SA 3IVFA 1XKEA 4GB9A 1KOTA 5L95C 4K17A 1WRDB 3H1UA 2M14A 1YQBA 3D8FA 1U29A 1AQCA 2KTFA 2R82A 2HD5B 2G45B 1RJ2A 1IYFA 2BCJA 4HAWB 1Z87A 3R3MA 3D8EA 2UZRA 2D4QA 2MBHA 2LGXA 1EF5A 1K5DB 5C5BB 2YF0A 1SHCA 4PNKA 3UINB 2LVOA 2X18A 2VKIA 3EPYA 5JZEB 3VH3B 2JPHA 1BTNA 2XQNM 1W1HA 1FGZA 4JQWC 2RLOA 3VTUA 4X57B 1WGRA 5E6PA 2PZ1A 3SD5A 5CLQB 2I1JA 4MEMA 2V76A 4IC7B 3R7RA 4RMAA 2M8SA 5J3QA 4FBJB 3GYOA 4EEWA 3U8ZA 3RCPA 3F0WA 3ML8A 2ZEQA 4MT7A 5L81A 4JIOU 2KHWB 2AL6A 2DLWA 2IY0B 3HW2B 1LFDA 2MCNB 2KLGA 5CLLB 3GOEA 1UNQA 2BWES 1XQQA 4GGQA 1OMWA 2P0FA 2KXJA 3DBLI 3VUXA 1WE7A 1NVLA 2C5LC 2D9YA 3FM8C 2DX5A 2J59M 2KUPA 4WJPA 1NTVA 2RGNB 2Z59B 5JLJB 2DHKA 4NSWA 3ZNZB 3QK0A 4M8NA 2ROZB 1X1MA 2YVCA 2DYNA 2IO3B 5DHFB 1V2YA 2NS5A 4TYZA 2JF5A 1DYNA 3W1SC 1OQYA 1WY8A 2KCJA 2KD0A 4IWQA 1HBKA 2DENB 1U5DA 2FJLA 4LDTD 1XD4A 3UIPB 4M8MA 2MP2B 1MPHA 2JZ3B 2MBOA 3ULCA 5C5BA 2ZNVC 1X1FA 2DTCA 3A8QA 5J3YA 2JT4B 2FNJB 1WR6E 2YRYA 3HK0A 1I2HA 3ZLZA 2JWZA 3S2AA 3AU4A 4WAAA 1WF9A 1Q0WB 4A3PA 2LXAA 1N3HA 3UQAA 4HDQA 2L00B 4ZRKA 4ICUA 2R0DA 1WJUA 4MGZE 1MG8A 5GOWB 4W9CA 2L8JA 2M17A 1WFYA 4HPLB 2W2XD 2RVBB 3WAPA 2G35A 1V5UA 4F7ZA 1LB1A 1F9JA 4E71A 2DZKA 1WXVA 3WANA 4J6IA 2DHZA 1WXAA 2DHJA 2FIDA 4AOFA 3KUCB 4XWXA 1G6JA 1W1DA 2DKPA 2DYQA 4BKSA 3H7SA 3MJWA 2N7EA 2OTXA 1RLFA 3TMPB 3T8MA 3A9KB 2X0SA 5DPRA 3SBTA 2G3QB 1AWEA 2MSED 3ZW3A 4IOYX 1E8YA 1EGXA 4JKCA 5J3TA 4FJVB 1KI1B 4EZKA 2YT1A 1KM7A 2Y5BB 3A1QA 4F7UP 2R09A 2W2WA 2WH5A 5DIFB 5KHOA 2KO3A 3APFA 3KY9A 2COAA 3MTNB 1B55A 3H9DA 4ZRJA 2FCQA 4DBGA 2MRPA 1IPGA 3CSTA 5LXHA 5AZFA 3PVWA 5CHVC 2Z0QA 3JVZX 2K2UA 3QHTA 4I6LB 2ZNVB 4NAWA 1E90A 3G9WA 4DHZB 2RUKB 2DZMA 4II3B 1WM2A 4NPNA 4YL8A 3VH4B 1ZVRA 1VD2A 3N30A 2C60A 1V6EA 1ZGUB 4ANWA 4I6PA 3ZUNA 4MSQB 2I1KA 3OANA 3A4RA 4KHOA 5HE1A 4PYZA 4HJKA 1P3RA 2K1FA 2KJHB 4EFOA 1V5OA 2KK8A 1P98A 2D9XA 4G3XB 3VUYA 1K8RB 3KUDB 4ILHA 4JKEA 2YS5A 4NY0A 4PS3A 2D11A 2L76A 2IYBA 2MBQA 4MJSB 4IWPA 3ZNGC 3PTFC 5G2NA 1XT9B 1QQGA 3LDZE 2N9XA 4I6NB 4HB4B 4Z2NA 1GG3A 5E6NA 4BOZB 2J0JA 4XC2A 5G55A 2YS3A 3W1SA 2K8HA 2FCSA 2IBIB 5L83A 2BPSA 3WAMA 3OLMD 2YT0A 4W9DA 4GMXB 2MW5A 4GZUA 2RQ1A 3UIOB 2DYBA 3R7QA 4TQ0A 1DIKA 4BBNC 2EMSA 2EKEC 2MLBA 3A33B 1YD8U 1P1AA 1V61A 3ODXA 2NVUI 4IWOA 4K2OA 1BAKA 4BKGA 2GOWA 2KN5A 3EFUA 2ASQA 3B1LX 1Y5OA 1IRSA 4WWNA 1TJ6A 5AZGA 2DX1A 2KDEB 1QC6A 3BY4B 5HKHA 3DBHI 4HLEA 3JSVB 2LG1A 4JK8A 4D0NB 2AEHA 3SDLC 4KHAA 3RZWC 2ELBA 3A98B 2BYFA 3RCZA 4FLHA 4TQ1A 3EC8A 4ASWC 2NPTA 4WVFB 1ZSQA 2Q13A 2P8VA 2L0TA 2N9EB 3SU8X 5J18A 5C23A 4B9KA 4HB3B 2Z0PA 3ZTCA 2ZVNA 1NBFC 2KJ6A 4G0NB 2PE9A 2CHZA 2KC2A 2LZ6A 3VHTC 1OTRB 1TBEA 2Z0DB 3VIAA 2MWSB 5HE2A 1PMSA 4WJ7A 1UELA 3A8PA 2WYQA 2EMTA 4HCNB 4BBKA 4FN2A 3DVGX 1NTIA 2JXXA 4NQKE 2MBBB 2ZCBA 4OVUA 4ANUA 1LQBA 3JYUA 2D10A 5D94A 4URKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH0 E;  2RGF A;  3L17 A;  1W1G A;  2IZV B;  4W9K A;  2BGF A;  4GDK A;  4KHB B;  4WQO B;  4CHJ A;  3L0W B;  3V6E B;  3HQC A;  4EMO A;  4IW0 A;  1U5G A;  3NY5 A;  5IJM A;  2NBW B;  1Z5S B;  2REX A;  1WJN A;  5JP4 A;  3MDB C;  1V86 A;  1FHX A;  3X23 A;  4W9E A;  2AL3 A;  2HTH A;  5JHA A;  2BKF A;  3X0W A;  1UBI A;  3W1Y A;  4KV2 A;  3VQI A;  4LJO B;  2G4S A;  3ZTD A;  2L2I A;  3SV1 A;  3TVV A;  4BKS D;  1EF1 A;  3AU5 A;  3UZT A;  3QWM A;  3HM6 X;  2LAS A;  1X86 A;  2D9V A;  1H10 A;  2FCN A;  4IAP A;  1YX6 B;  5IA7 A;  5LXI B;  1SGH A;  4TUU A;  2N1V A;  2RPQ A;  4KIK A;  3KZ1 A;  5GMV A;  3VAW A;  5D3X A;  4CHM A;  3VTW A;  3B08 A;  4KZC A;  2CAY A;  1XOD A;  1GC7 A;  2KGX B;  2KTR A;  1R4M I;  3HM3 A;  1X1G A;  2WX1 A;  1RAX A;  3I3T B;  3VFK A;  3KUZ A;  2ZJD A;  2M38 A;  3DOW A;  2O2V A;  1M7E A;  2K6Q A;  3WA0 A;  3L13 A;  4KVG B;  5FI1 A;  3QA8 A;  3V5W A;  1DDW A;  4HHV A;  1P0R A;  2L1C A;  3CSF A;  5J2R A;  4GOC A;  4K81 A;  1M94 A;  5C16 A;  4MDK E;  5D27 A;  2XEW A;  3VDZ A;  4AP4 C;  2OOB B;  5C1Z A;  3QC8 B;  1J8C A;  3T06 A;  2D2Q A;  5C79 A;  3DBS A;  3M95 A;  1M7R A;  2JRI B;  1OGW A;  4EUT A;  1SIF A;  1NI2 A;  3EEC A;  2HE7 A;  1P9D U;  2LYD A;  2GS0 A;  2GBN A;  2LWP A;  2PE6 B;  1S1Q B;  1C1Y B;  2IO2 B;  1LW3 A;  1HB6 A;  2KOX A;  2Z0E B;  4IUM B;  2DFK A;  4AJW A;  3ZO5 B;  2A4Z A;  2JUO A;  4HDO A;  4TKN A;  3NSU A;  2KMA A;  5TR5 A;  3SO6 A;  2ZCC A;  2V4L A;  2WX0 A;  1Q5W B;  4HK2 A;  2DHI A;  4KAX B;  2IYD B;  2N4F A;  3RZF A;  4HCP B;  3AJ4 A;  1ST7 A;  3A9J B;  1V88 A;  1WMH B;  2FDQ A;  2LBB A;  2MKR A;  4B6W A;  3KH0 A;  1GC6 A;  4K2P A;  1EO6 A;  4GDL B;  2CKH B;  2MFQ A;  3ML4 A;  2KX0 A;  4ZYN A;  3DPD A;  2L7R A;  4MM3 A;  3R66 C;  4DHJ B;  4FUL A;  1V5P A;  4FAD A;  4LDT B;  1E8Z A;  5DHA B;  2HRJ A;  4DX8 A;  3CF6 E;  1Y19 B;  1V49 A;  2KVR A;  3EHV A;  2QHO A;  5IAA C;  3L16 A;  3LJU X;  2JVC A;  2LGY A;  3OAW A;  4DXA B;  3RUI B;  2H7D A;  1C3T A;  3GYP A;  4E74 A;  1I42 A;  4W9F A;  2EC1 A;  2MP2 A;  2GBK A;  4C0A A;  1UNP A;  4WSF A;  4DK5 A;  1PFJ A;  1X11 A;  2K00 A;  3O96 A;  2KJR A;  4AUQ C;  1Q1O A;  1E7V A;  2M1M A;  3TIX A;  1JRU A;  3UGB B;  5EFX A;  2JZZ A;  3CXB B;  1IP9 A;  1Y8R C;  3OJ3 A;  5JHH A;  3PLU A;  1E8W A;  3V61 A;  2LD9 A;  3DVN V;  1WJ4 A;  3QIJ A;  3SHQ A;  2COC A;  1MKE A;  2MA9 B;  2OQB A;  1WIA A;  1YX5 B;  2HJ8 A;  3TJP A;  4BFR A;  4GMV A;  1TTN A;  2N23 A;  1KJT A;  4EZJ A;  2GCJ A;  3H6N A;  2CHW A;  3KRW A;  3PLV A;  4GU2 A;  1P6S A;  3ODO A;  3SNH A;  1SE9 A;  4A3O A;  1WI0 A;  3HIZ A;  4CYE A;  5FR6 A;  2EJ8 A;  2D3G A;  1UGM A;  2NBV B;  4LCD E;  4JLC A;  5LOP B;  2KQS A;  2DAF A;  2J0K A;  2ELA A;  5D3Y A;  2W9N A;  1RFA A;  3A9K A;  4IG7 B;  4OVV A;  4K7W A;  2ZZP B;  4Y94 A;  4N9F 4;  1UPR A;  4F1S A;  2O6V B;  5AZH A;  2CRF A;  2ZPY A;  4KZ0 A;  2DA0 A;  1WGH A;  3H7P B;  4HAV B;  4F7G A;  2J7Q B;  2KC1 A;  4XZ4 A;  4ZDV A;  5C6R A;  3K9O B;  3L54 A;  1U5E A;  4PS8 A;  4W9L A;  5DPT A;  4FHK A;  4ANX A;  2KQ7 A;  2JY6 A;  2R2Q A;  3N3K B;  1WXS A;  3SYX A;  2KDB A;  3Q3F A;  1UNR A;  2MX2 A;  4II2 B;  2N7D A;  3TL5 A;  1WVH A;  5BO4 B;  1V89 A;  2COF A;  3ZVV A;  1UZX B;  4MY6 A;  2CB8 A;  2C7M B;  3BJI A;  2XK5 B;  2L05 A;  4ZRI A;  2K2J A;  2DZI A;  2R2O A;  1E8X A;  2FAZ A;  4K7U A;  1L7Y A;  1WJM A;  2UWQ A;  1Z2M A;  3N32 A;  4YON A;  2RD0 A;  3QAR A;  2FUH B;  1ZM0 A;  1WGG A;  1E7U A;  3DVG Y;  2N1W A;  2GBR A;  5KQ1 A;  5DPW A;  5CTR C;  4PS7 A;  3PHX B;  2COD A;  1YIW A;  2ROV A;  2KFK B;  1WX7 A;  3PRM B;  2GCL A;  2J0M A;  2C7N B;  3VTV A;  2CY4 A;  2DKQ A;  1WXM A;  5CX3 A;  3QBV B;  1WR1 A;  2LJ5 A;  3QJZ A;  2H7E A;  2COP A;  4A6H A;  5J17 A;  2RNR B;  4K7S A;  5CHF A;  4BBN F;  2LXC A;  1NU2 A;  1HE8 A;  4MJS A;  1I35 A;  2AYO B;  4G11 A;  1WGQ A;  2Y8G A;  5DCN A;  4K1R B;  1ZKH A;  1UD7 A;  2E2X A;  3V62 A;  1V5M A;  5D2M B;  4ICV A;  2FJ9 A;  4RM9 A;  4IM0 A;  2Z0O A;  4FHJ A;  1V5T A;  3PPA A;  4HPM B;  2FIF A;  2K39 A;  3U7D A;  2LRW A;  3ZIM A;  3M3J A;  4A20 A;  4W9I A;  5KCV A;  3DXD A;  2LUE A;  3QQ8 B;  3ENE A;  3ZKJ C;  3PHW B;  1ZC3 B;  2DYO A;  3C0R B;  1TZ1 A;  2C9W B;  1FGY A;  3QWZ B;  5D3W A;  5FI0 A;  4DHZ E;  2P0H A;  3JW0 X;  3M63 B;  1EVH A;  3UQB A;  1MIX A;  3KW5 B;  2VRR B;  3TW1 A;  2C7H A;  4IM3 A;  4WJQ A;  4ANV A;  5D3V A;  1EUV B;  5JHG A;  3ZRF A;  2KFK A;  4MGI E;  3DBR I;  1XR0 B;  3JSV A;  1S3S G;  4PQ0 A;  3Q3J A;  5D7G A;  3QX1 A;  3VVW B;  1R4N I;  3V60 A;  3PVL A;  4G50 A;  1UPQ A;  3D8D A;  1QZE A;  3L10 B;  1WX9 A;  2BKR B;  3PSE B;  1FHW A;  2KMC A;  4B95 A;  1DBH A;  4NNJ B;  1OEY J;  2OJR A;  5E6O A;  5LLI A;  3RUL A;  4B6H A;  4NQL B;  4TV3 A;  3KYD D;  4FJZ A;  1V80 A;  3DVN U;  4H8S A;  3IFW B;  3RT3 B;  1XCG A;  1PQS A;  1XD3 B;  2UZS A;  4EZL A;  3O65 B;  1VCB A;  2FCM A;  3FSS A;  3NHE B;  3RYT A;  3VUW A;  1UBQ A;  2LOX A;  3ZRC A;  3PEG A;  4KDL B;  4WWO A;  4MK0 A;  1J0W A;  4BKT A;  1LXD A;  3PZD A;  4E3C A;  3PT2 B;  4WWP A;  2RSU A;  2V1Y A;  1H4R A;  4IFS A;  1HB8 A;  3PGE A;  2N9P C;  2GMI C;  3M62 B;  3ZNH B;  3D32 A;  2W2X C;  3VXW A;  3APD A;  3HHM A;  2KDI A;  2DZJ A;  4PYU A;  2A5U A;  1Q67 A;  2DN6 A;  3DXE A;  1WJ6 A;  4DX9 0;  1FOE A;  3ZNI D;  3ZDM C;  5AEK B;  2XBB C;  3AXC A;  2UYZ B;  4DHJ D;  1J0G A;  3AUL A;  1I7A A;  3NZS A;  2CU1 A;  1NDD A;  2D9Z A;  2LRU A;  3A1Q B;  2CQU A;  1WYW B;  2K8B A;  4WJO A;  3SUZ A;  1A5R A;  2RR9 A;  2ZVO A;  1X05 A;  3FLV A;  3BIN A;  1T0Y A;  2D07 B;  1KZG A;  1GNU A;  5DPS A;  1WI1 A;  4HAY B;  1V81 A;  1FXT B;  2PEA A;  2IFS A;  1XX0 A;  2LVQ A;  3FP5 A;  3PV1 A;  4DDG D;  4EOY A;  1GUA B;  4IM2 A;  3L08 A;  4W9H A;  1WG7 A;  1MK9 B;  2I5F A;  4HWI B;  5HE0 A;  3FEH A;  3QAQ A;  4GPT B;  3PP2 A;  2NBU A;  4LJP B;  2LUL A;  4NAW B;  4W9G A;  3ZVR A;  3ONS A;  3P2B A;  2G4D B;  3WYF B;  1RRB A;  1J19 A;  2UVM A;  3TO1 A;  3PS6 A;  2YLM A;  3TBL D;  1DDM A;  2CR5 A;  3KSY A;  2L3Z A;  1WZ3 A;  3DXC A;  2ZPN A;  3TCA A;  1DRO A;  5DI9 B;  4HAU B;  4CO7 A;  3IHP C;  4NJ7 A;  3WIM A;  2MQJ A;  3ULB A;  1ZC4 B;  4WJN A;  4F7H A;  1TXD A;  2MDX A;  1WJ1 A;  1BWN A;  4DDI D;  2K6D B;  3ODW A;  3KYC D;  1D3Z A;  3GZN I;  3P7Z A;  5EDS A;  1WX8 A;  4GIV A;  1WM3 A;  3ALB A;  3LJ3 A;  2DAJ A;  2N0Y A;  5DH9 B;  2D9W A;  1WGY A;  1ZW7 A;  4MGY E;  1UH6 A;  1U2B A;  3F5R A;  3KRX A;  3P6A A;  4GSW A;  1WGU A;  2CS4 A;  3T9L A;  1LM8 B;  3CIK A;  2QKM A;  3ML9 A;  2ABD A;  2BYE A;  2JP2 A;  2YSZ A;  3A9J A;  1WMH A;  1DDV A;  4MEL A;  2O6V D;  3WAO A;  3MPX A;  2KZR A;  3PVU A;  3QCA A;  2CHX A;  2MWN B;  3PRZ A;  4GDL A;  2IY1 B;  2LKO A;  3PRP B;  4HAT B;  3DQV A;  3NS8 A;  2P0D A;  1FHO A;  1NTY A;  2LI5 A;  4DBB A;  2K25 A;  2PPH A;  2K8C A;  2PJH A;  3KVF B;  1EAZ A;  3PRE A;  3IG3 A;  1MIZ B;  4KDI C;  2AWT A;  1ISN A;  3PG7 A;  1WH3 A;  3M1I B;  4HVB A;  4NJ6 A;  1U4A A;  1KZ7 A;  3WAL A;  4BVU C;  1TQZ A;  2LVP A;  2M4N A;  3OJ4 B;  2DYM A;  2LOZ A;  4XX5 A;  2BWF A;  4FA6 A;  2IO0 B;  2VRW B;  2BYV E;  3DCG A;  2JRH A;  2NPT B;  3V6C B;  1RRP B;  4DWF A;  2YS1 A;  1P3Q U;  3RD2 A;  5LON B;  2CY5 A;  1BT0 A;  2L0F A;  1PLS A;  4AJY B;  4HB0 B;  3NZU A;  4MSM B;  1U5F A;  5HE3 A;  4EJN A;  2NMB A;  4W9J A;  4KSL C;  4HB2 B;  1P5T A;  1ACA A;  1OY2 A;  3AI5 A;  4Z2M B;  4JL9 A;  4BOS C;  2KWC A;  4A6F B;  1V9J A;  1OQN A;  2KFJ A;  4KSK C;  2KDF B;  2KKC A;  4EKU A;  2NR2 A;  1H8C A;  2RSG A;  2KAN A;  4GN1 A;  4GDK B;  4GXB A;  4MGK E;  4L6E A;  3ECI A;  2MBE A;  1L2N A;  4AWJ A;  2Y7B A;  2WDT B;  2NZ8 B;  4CHK A;  4HAZ B;  2QKL A;  5JHB A;  3MHS D;  1U27 A;  4F8C B;  2WWZ A;  2HTH B;  2LGD A;  2KWV B;  2O6V A;  2GBJ A;  2GBM A;  3K9P B;  2BF8 B;  3H7P A;  4P7I A;  1WZ0 A;  3UF8 A;  1BTK A;  2GJY A;  2IO1 B;  2Y8F A;  2KWU B;  2B3A A;  1MK7 B;  3N7C A;  3VOQ A;  4A5K A;  3NOB A;  1KLV A;  2I5C A;  3CMM B;  1YJ1 A;  2KX3 A;  4A6K A;  5JH5 C;  3B0A A;  4KIK B;  3TFM A;  2KLC A;  2VSZ A;  4HXD A;  1CMX B;  3PSC A;  5KHQ A;  4RM8 A;  4HAX B;  1TGZ B;  1WE6 A;  4JGH B;  3A4S C;  1MAI A;  4M0W B;  2KTR B;  4FJY A;  1GJZ A;  2XK5 A;  3U30 A;  1WGD A;  2KNB A;  1AAR A;  3ZDT A;  2M0X A;  1FB8 A;  3IBE A;  3DDC B;  1FAO A;  5D6J B;  2ADZ A;  1E5W A;  1K5G B;  1UEF A;  4A6F A;  2DX5 B;  3APC A;  2NCN A;  5KQ4 A;  2O2V B;  1OEY A;  5CHW A;  2V3S A;  3IVF A;  1XKE A;  4GB9 A;  1KOT A;  5L95 C;  4K17 A;  1WRD B;  3H1U A;  2M14 A;  1YQB A;  3D8F A;  1U29 A;  1AQC A;  2KTF A;  2HD5 B;  2G45 B;  1RJ2 A;  1IYF A;  2BCJ A;  4HAW B;  1Z87 A;  3R3M A;  3D8E A;  2UZR A;  2D4Q A;  2MBH A;  2LGX A;  1EF5 A;  1K5D B;  5C5B B;  2YF0 A;  1SHC A;  4PNK A;  3UIN B;  2LVO A;  2X18 A;  2VKI A;  3EPY A;  5JZE B;  3VH3 B;  2JPH A;  1BTN A;  2XQN M;  1W1H A;  1FGZ A;  4JQW C;  2RLO A;  3VTU A;  4X57 B;  1WGR A;  5E6P A;  2PZ1 A;  3SD5 A;  5CLQ B;  2I1J A;  4MEM A;  2V76 A;  4IC7 B;  3R7R A;  4RMA A;  2M8S A;  5J3Q A;  4FBJ B;  3GYO A;  4EEW A;  3U8Z A;  3RCP A;  3F0W A;  3ML8 A;  2ZEQ A;  4MT7 A;  5L81 A;  4JIO U;  2KHW B;  2AL6 A;  2DLW A;  2IY0 B;  3HW2 B;  1LFD A;  2MCN B;  2KLG A;  5CLL B;  3GOE A;  1UNQ A;  2BWE S;  1XQQ A;  4GGQ A;  1OMW A;  2P0F A;  2KXJ A;  3DBL I;  3VUX A;  1WE7 A;  1NVL A;  2C5L C;  2D9Y A;  3FM8 C;  2DX5 A;  2J59 M;  2KUP A;  4WJP A;  1NTV A;  2RGN B;  2Z59 B;  5JLJ B;  2DHK A;  4NSW A;  3ZNZ B;  3QK0 A;  4M8N A;  2ROZ B;  1X1M A;  2YVC A;  2DYN A;  2IO3 B;  5DHF B;  1V2Y A;  2NS5 A;  4TYZ A;  2JF5 A;  1DYN A;  3W1S C;  1OQY A;  1WY8 A;  2KCJ A;  2KD0 A;  4IWQ A;  1HBK A;  2DEN B;  1U5D A;  2FJL A;  4LDT D;  1XD4 A;  3UIP B;  4M8M A;  2MP2 B;  1MPH A;  2JZ3 B;  2MBO A;  3ULC A;  5C5B A;  2ZNV C;  1X1F A;  2DTC A;  3A8Q A;  5J3Y A;  2JT4 B;  2FNJ B;  1WR6 E;  2YRY A;  3HK0 A;  1I2H A;  3ZLZ A;  2JWZ A;  3S2A A;  3AU4 A;  4WAA A;  1WF9 A;  1Q0W B;  4A3P A;  2LXA A;  1N3H A;  3UQA A;  4HDQ A;  2L00 B;  4ZRK A;  4ICU A;  2R0D A;  1WJU A;  4MGZ E;  1MG8 A;  5GOW B;  4W9C A;  2L8J A;  2M17 A;  1WFY A;  4HPL B;  2W2X D;  2RVB B;  3WAP A;  2G35 A;  1V5U A;  4F7Z A;  1LB1 A;  1F9J A;  4E71 A;  2DZK A;  1WXV A;  3WAN A;  4J6I A;  2DHZ A;  1WXA A;  2DHJ A;  2FID A;  4AOF A;  3KUC B;  4XWX A;  1G6J A;  1W1D A;  2DKP A;  2DYQ A;  4BKS A;  3H7S A;  3MJW A;  2N7E A;  2OTX A;  1RLF A;  3TMP B;  3T8M A;  3A9K B;  5DPR A;  2G3Q B;  1AWE A;  2MSE D;  3ZW3 A;  4IOY X;  1E8Y A;  1EGX A;  5J3T A;  4FJV B;  1KI1 B;  4EZK A;  2YT1 A;  1KM7 A;  2Y5B B;  3A1Q A;  4F7U P;  2R09 A;  2W2W A;  2WH5 A;  5DIF B;  5KHO A;  2KO3 A;  3APF A;  3KY9 A;  2COA A;  3MTN B;  1B55 A;  3H9D A;  4ZRJ A;  2FCQ A;  4DBG A;  2MRP A;  1IPG A;  3CST A;  5LXH A;  5AZF A;  3PVW A;  5CHV C;  2Z0Q A;  3JVZ X;  2K2U A;  3QHT A;  4I6L B;  2ZNV B;  4NAW A;  1E90 A;  3G9W A;  4DHZ B;  2RUK B;  2DZM A;  4II3 B;  1WM2 A;  4NPN A;  4YL8 A;  3VH4 B;  1ZVR A;  1VD2 A;  3N30 A;  2C60 A;  1V6E A;  1ZGU B;  4ANW A;  4I6P A;  3ZUN A;  4MSQ B;  2I1K A;  3OAN A;  3A4R A;  4KHO A;  5HE1 A;  4PYZ A;  4HJK A;  1P3R A;  2K1F A;  2KJH B;  4EFO A;  1V5O A;  2KK8 A;  1P98 A;  2D9X A;  4G3X B;  3VUY A;  1K8R B;  3KUD B;  2YS5 A;  4NY0 A;  4PS3 A;  2D11 A;  2L76 A;  2IYB A;  2MBQ A;  4MJS B;  4IWP A;  3ZNG C;  3PTF C;  5G2N A;  1XT9 B;  1QQG A;  3LDZ E;  2N9X A;  4I6N B;  4HB4 B;  4Z2N A;  1GG3 A;  5E6N A;  4BOZ B;  2J0J A;  4XC2 A;  5G55 A;  2YS3 A;  3W1S A;  2K8H A;  2FCS A;  2IBI B;  5L83 A;  2BPS A;  3WAM A;  3OLM D;  2YT0 A;  4W9D A;  4GMX B;  2MW5 A;  4GZU A;  2RQ1 A;  3UIO B;  2DYB A;  3R7Q A;  4TQ0 A;  4BBN C;  2EMS A;  2EKE C;  2MLB A;  3A33 B;  1YD8 U;  1P1A A;  1V61 A;  3ODX A;  2NVU I;  4IWO A;  4K2O A;  1BAK A;  4BKG A;  2GOW A;  2KN5 A;  3EFU A;  2ASQ A;  3B1L X;  1Y5O A;  1IRS A;  4WWN A;  1TJ6 A;  5AZG A;  2DX1 A;  2KDE B;  1QC6 A;  3BY4 B;  5HKH A;  3DBH I;  4HLE A;  3JSV B;  2LG1 A;  4D0N B;  2AEH A;  3SDL C;  4KHA A;  3RZW C;  2ELB A;  3A98 B;  2BYF A;  3RCZ A;  4FLH A;  4TQ1 A;  3EC8 A;  4ASW C;  2NPT A;  4WVF B;  1ZSQ A;  2Q13 A;  2P8V A;  2L0T A;  2N9E B;  3SU8 X;  5J18 A;  5C23 A;  4B9K A;  4HB3 B;  2Z0P A;  3ZTC A;  2ZVN A;  1NBF C;  2KJ6 A;  4G0N B;  2PE9 A;  2CHZ A;  2KC2 A;  2LZ6 A;  3VHT C;  1OTR B;  1TBE A;  2Z0D B;  3VIA A;  2MWS B;  5HE2 A;  1PMS A;  4WJ7 A;  1UEL A;  3A8P A;  2WYQ A;  2EMT A;  4HCN B;  4BBK A;  4FN2 A;  3DVG X;  1NTI A;  2JXX A;  4NQK E;  2MBB B;  2ZCB A;  4OVU A;  4ANU A;  1LQB A;  3JYU A;  2D10 A;  5D94 A;  4URK A; 
#chains in the Genus database with same CATH topology
 4MH0 E;  3I9V 1;  1N6Z A;  1SE2 A;  2RGF A;  3L17 A;  1W1G A;  2IZV B;  3BVZ A;  4W9K A;  2BGF A;  1ZYI A;  1D4B A;  1XLO A;  4GDK A;  4KHB B;  4WQO B;  3E66 A;  4CHJ A;  3L0W B;  3V6E B;  3HQC A;  4EMO A;  3NY5 A;  1U5G A;  4IW0 A;  4JKG B;  3Q8F A;  5IJM A;  2NBW B;  1Z5S B;  2REX A;  1WJN A;  5JP4 A;  3BVM A;  3MDB C;  2VH2 A;  1V86 A;  1FHX A;  1P7E A;  1N61 A;  3X23 A;  4W9E A;  3TEZ A;  4ZYS A;  2V0G A;  1ESF A;  2AL3 A;  2SEB D;  2HTH A;  5JHA A;  2BKF A;  3X0W A;  3MC9 A;  1UBI A;  3W1Y A;  2WXN A;  4KV2 A;  3VQI A;  4LJO B;  2G4S A;  2GRI A;  3ZTD A;  1CK1 A;  2L2I A;  3NW8 A;  2G1E A;  3SV1 A;  3I5J C;  3TVV A;  4BKS D;  1EF1 A;  1K53 A;  4ZHO A;  3AU5 A;  3UZT A;  1OFF A;  3QWM A;  1BUI C;  2CJN A;  3HM6 X;  1AW7 A;  2Z13 A;  2LAS A;  1X86 A;  2D9V A;  1H10 A;  5BMH A;  2FCN A;  2KT7 A;  4IAP A;  1YX6 B;  5IA7 A;  5LXI B;  1SGH A;  4TUU A;  2N1V A;  1KBL A;  1AN8 A;  2RPQ A;  4KIK A;  1KLU D;  3KZ1 A;  1QF6 A;  5GMV A;  3VAW A;  5D3X A;  4CHM A;  3VTW A;  1TY2 A;  1OQR A;  3B08 A;  4KZC A;  2V3P A;  2CAY A;  1I7H A;  1XOD A;  5EE9 A;  4M0W A;  1GC7 A;  5D3I B;  2KGX B;  2KTR A;  3LYY A;  1R4M I;  1D5M C;  3HM3 A;  1X1G A;  2QJL A;  2WX1 A;  1RAX A;  3I3T B;  3VFK A;  3KUZ A;  2ZJD A;  2M38 A;  1N5W A;  3NVV A;  2L32 A;  3DOW A;  2O2V A;  4JK9 A;  1M7E A;  2K6Q A;  2K5P A;  3WA0 A;  3L13 A;  4KVG B;  5FI1 A;  3QA8 A;  3V5W A;  1V1P A;  1DDW A;  4HHV A;  1P0R A;  4C00 A;  2L1C A;  1FRD A;  3CSF A;  5J2R A;  4GOC A;  4K81 A;  1M94 A;  5C16 A;  5AUK A;  4MDK E;  1C77 A;  1VR9 A;  5D27 A;  2XEW A;  3Q8A A;  3VDZ A;  4AP4 C;  2OOB B;  5C1Z A;  2GLS A;  3QC8 B;  1J8C A;  4JKG A;  2GUM A;  1C4P A;  2CU3 A;  3T06 A;  2D2Q A;  1JRP A;  5C79 A;  2KQ4 X;  3DBS A;  3M95 A;  1M7R A;  2JRI B;  2XN9 C;  2QCZ A;  1OGW A;  4EUT A;  1SIF A;  1NI2 A;  3EEC A;  2HE7 A;  1P9D U;  2LYD A;  1EWY C;  2GS0 A;  2GBN A;  1FFU A;  2LWP A;  4ZOH C;  4CQN A;  2PE6 B;  3NVW A;  1S1Q B;  1C1Y B;  2IO2 B;  1LW3 A;  1HB6 A;  2FE8 A;  2KOX A;  2Z0E B;  1C79 A;  3AE2 B;  1VBH A;  3DBH B;  4RH6 A;  4IUM B;  2DFK A;  4DQO C;  4AJW A;  3ZO5 B;  2A4Z A;  2V3N A;  2JUO A;  1SJE D;  4HDO A;  4TKN A;  4MAC A;  3NSU A;  2KMA A;  5TR5 A;  3SO6 A;  4LNN A;  2ZCC A;  2V4L A;  1FIQ A;  2WX0 A;  1Q5W B;  4HK2 A;  2DHI A;  4KAX B;  2IYD B;  3A58 A;  4RGN A;  2N4F A;  3RZF A;  1L4D B;  4HCP B;  5MPO A;  3AJ4 A;  3AE9 B;  3U2S C;  1ST7 A;  3A9J B;  3MHZ A;  1V88 A;  5FK9 C;  1WMH B;  2FDQ A;  2LBB A;  2MKR A;  5E6J A;  4B6W A;  2YT2 A;  3SFD B;  1DOI A;  1MI1 A;  2N0S B;  3KH0 A;  3AE7 B;  1GC6 A;  2JYT A;  4K2P A;  1EO6 A;  3Q2A C;  4H2A A;  2PTL A;  4GDL B;  5EE1 A;  2CKH B;  2QIL A;  2MFQ A;  3ML4 A;  2KX0 A;  1B9R A;  4A8X C;  4RNA A;  1E6E B;  1K52 A;  1IGD A;  1KF6 B;  3N20 C;  3TEW A;  4ZYN A;  1GPX A;  3DPD A;  2L7R A;  5C3J B;  2Z8L A;  2IGD A;  4MM3 A;  2ZW0 A;  3R66 C;  1CZP A;  4DHJ B;  4US8 A;  2MEK A;  2B76 B;  4FUL A;  1V5P A;  3J9C A;  4HKZ E;  1UUP A;  4FAD A;  4LDT B;  1E8Z A;  5DHA B;  3GS2 A;  2Z59 A;  2HRJ A;  4DX8 A;  1ET6 A;  3CF6 E;  4WH4 A;  1Y19 B;  1V49 A;  2BT6 A;  2KVR A;  3EHV A;  2QHO A;  2AQ3 B;  5IAA C;  3L16 A;  3LJU X;  1PYW D;  2JVC A;  2LGY A;  3OAW A;  3PZ8 A;  1DOY A;  3IT6 B;  4DXA B;  4HRS A;  3RUI B;  4KGT A;  2H7D A;  1T6B X;  1C3T A;  1WWT A;  3GYP A;  4E74 A;  1I42 A;  4W9F A;  4WUR A;  1SIJ A;  1YQ4 B;  2EC1 A;  2MP2 A;  2GBK A;  3Q8E A;  1Q10 A;  1I4Q A;  4C0A A;  1RFK A;  1UNP A;  4WSF A;  4DK5 A;  1PFJ A;  4S17 A;  1X11 A;  2R2Y A;  4ARC A;  3BWU D;  3CWI A;  2K00 A;  3O96 A;  1ZE3 D;  2KJR A;  1ZXI A;  1VJK A;  4AUQ C;  2KWD A;  1Q1O A;  1E7V A;  2M1M A;  2I2Y A;  3N1Y C;  3TIX A;  1JRU A;  3UGB B;  5EFX A;  5IKC M;  2JZZ A;  1BXT A;  2MHJ A;  3E9P A;  3CXB B;  4P1C C;  2EKI A;  4OZC A;  1IP9 A;  1QOF A;  4YSZ B;  2Y5P A;  2WU2 B;  1Y8R C;  2IGH A;  3OJ3 A;  3DWG C;  5JHH A;  3PLU A;  1E8W A;  3V61 A;  2LD9 A;  3DVN V;  2JU6 X;  1WJ4 A;  3QIJ A;  3E56 A;  3SHQ A;  2COC A;  1MKE A;  4RFB A;  1ZXH A;  2I38 A;  2MA9 B;  4O1N A;  2ON8 A;  1QKZ A;  2OQB A;  2MJE A;  1WIA A;  1YX5 B;  2HJ8 A;  2D5G A;  3TJP A;  4BFR A;  4JKB A;  4GMV A;  1TTN A;  2N23 A;  1KJT A;  4EZJ A;  2GCJ A;  2VZK D;  2N9K A;  3H6N A;  3IAM 1;  2CHW A;  2QIE B;  4LNF A;  3KRW A;  3AV8 A;  2WDQ B;  3PLV A;  4GU2 A;  1P6S A;  3ODO A;  3SNH A;  1K50 A;  1R4M B;  1SE9 A;  4A3O A;  1WI0 A;  3RNF C;  3HIZ A;  2D3C A;  4CYE A;  5FR6 A;  2EJ8 A;  2W3R A;  2D3G A;  1UGM A;  2KVZ A;  1QOB A;  2NBV B;  1LGR A;  4LCD E;  4JLC A;  5LOP B;  3L4P A;  2KQS A;  2DAF A;  4GLS C;  2J0K A;  2ELA A;  3P42 A;  2BTE A;  5D3Y A;  2W9N A;  2MJD A;  3AE6 B;  3EFC A;  1SBB B;  3R8B A;  1XLQ A;  1RFA A;  3ZJT A;  3A9K A;  4IG7 B;  4OVV A;  1XCT L;  2WXH A;  4K7W A;  4JKF A;  3KWV A;  4YSX B;  5HI1 A;  2ZZP B;  4HRO A;  4Y94 A;  3I57 A;  4N9F 4;  1UPR A;  1N5X A;  4F1S A;  2O6V B;  1IUE A;  4FXC A;  5AZH A;  2CRF A;  2ZPY A;  4KZ0 A;  2DA0 A;  4LNO A;  1WGH A;  3H7P B;  4HAV B;  2NMQ A;  4USA A;  3GE3 C;  4F7G A;  2J7Q B;  1DYQ A;  2KC1 A;  4YSY B;  4XZ4 A;  3ABV B;  4ZDV A;  5C6R A;  3K9O B;  3N1X C;  3L54 A;  1U5E A;  4PS8 A;  3HSA A;  2LMC A;  1T3Q A;  2JXT A;  4FHK A;  2K22 A;  4W9L A;  5DPT A;  3E9L A;  2WXG A;  4ANX A;  2KQ7 A;  2JY6 A;  2R2Q A;  4HJG E;  3N3K B;  1XF5 L;  1WXS A;  3SYX A;  2KDB A;  3Q3F A;  1UNR A;  1VZ6 A;  4RGT A;  2MX2 A;  4XWT A;  3MFG A;  1UF0 A;  4II2 B;  1T77 A;  2N7D A;  3ENB A;  3FC4 A;  3TL5 A;  1WVH A;  3ZXR A;  5BO4 B;  1V89 A;  2COF A;  4N58 A;  3ZVV A;  1UZX B;  1C78 A;  2Y5C A;  4MY6 A;  1ZDX A;  2CB8 A;  1AYF A;  3BJI A;  1SB3 C;  2C7M B;  2XK5 B;  3BYY B;  2L05 A;  4OW0 A;  4ZRI A;  2K2J A;  3SFE B;  2K3U A;  2IPK D;  2DZI A;  3LXF A;  2R2O A;  2V9H A;  1E8X A;  3BYT B;  2FAZ A;  4K7U A;  3B77 A;  1C76 A;  1L7Y A;  1WJM A;  1KTK A;  2UWQ A;  4JX1 C;  1TJE A;  1Z2M A;  3N32 A;  4YON A;  2RD0 A;  3QAR A;  2FUH B;  1ZM0 A;  1IBX A;  1WGG A;  1E7U A;  3DVG Y;  2N1W A;  3RN9 C;  2GBR A;  5KQ1 A;  5DPW A;  3SEB A;  1C4A A;  5CTR C;  4PS7 A;  2KDM A;  3PHX B;  2COD A;  4JKA A;  1YIW A;  2IDY A;  2ROV A;  2KFK B;  1WX7 A;  3NG0 A;  4OT1 A;  3PRM B;  2BS3 B;  2KUQ A;  2GCL A;  3Q8B A;  2J0M A;  2C7N B;  3VTV A;  2CY4 A;  5BMG A;  3FIL A;  1PDX A;  3PO0 A;  4M02 A;  4D6W A;  2DKQ A;  1WXM A;  5CX3 A;  3QBV B;  1JRO A;  3AH7 A;  1DOX A;  5EE0 A;  1WR1 A;  2LJ5 A;  3QJZ A;  4UDU C;  4B0E A;  2H7E A;  2COP A;  4A6H A;  2AQ2 B;  2PVG C;  5J17 A;  2RNR B;  1VBG A;  4WWM A;  4K7S A;  5CHF A;  4BBN F;  2LXC A;  5C2T B;  1NU2 A;  1HE8 A;  4MJS A;  1WRI A;  1YQ3 B;  5IOI A;  2DIK A;  1C4C A;  1I35 A;  2AYO B;  4G11 A;  1WGQ A;  2Y8G A;  4ITK A;  5DCN A;  4K1R B;  1ZKH A;  1UD7 A;  2G9H D;  1VLB A;  2E2X A;  3GB1 A;  1TYG B;  3V62 A;  1V5M A;  5D2M B;  4ICV A;  2FJ9 A;  4RM9 A;  4IM0 A;  2Z0O A;  4FHJ A;  1V5T A;  3PPA A;  4HPM B;  2FIF A;  2K39 A;  3U7D A;  2LRW A;  3ZIM A;  3M3J A;  4A20 A;  2DNF A;  4W9I A;  5KCV A;  1JW9 D;  3DXD A;  2LUE A;  1AWD A;  3ENE A;  3QQ8 B;  3ZKJ C;  3PHW B;  1ZC3 B;  2DYO A;  2LFI A;  1STE A;  3C0R B;  1TZ1 A;  2C9W B;  2JQR B;  2WXM A;  1FGY A;  3QWZ B;  5D3W A;  2AQ1 B;  5FI0 A;  1SF0 A;  4DHZ E;  2P0H A;  3JW0 X;  3M63 B;  1EVH A;  2WNM A;  1PGA A;  3UQB A;  1MIX A;  3KW5 B;  2VRR B;  3T3N A;  2DBY A;  3TW1 A;  2L83 A;  2C7H A;  2QSD A;  4IM3 A;  3EUB 2;  4WJQ A;  4ANV A;  1V1O A;  3ETR A;  1BML C;  1YN3 A;  1SE4 A;  2N9L A;  5D3V A;  2M56 B;  1EUV B;  4ILG B;  5JHG A;  2KAC A;  2RPV A;  3ZRF A;  2KFK A;  4MGI E;  3DBR I;  3DCX A;  1XR0 B;  2IGG A;  3JSV A;  1S3S G;  5BYQ A;  4PQ0 A;  3Q3J A;  5D7G A;  1N62 A;  3QX1 A;  3VVW B;  1JAL A;  1KH0 A;  1R4N I;  3V60 A;  3PVL A;  4G50 A;  1UPQ A;  3D8D A;  1UGJ A;  1QZE A;  3L10 B;  1WX9 A;  2BKR B;  3PSE B;  4JE3 B;  4Q2J A;  1FHW A;  2KMC A;  4B95 A;  1DBH A;  4NNJ B;  1OEY J;  2OJR A;  5E6O A;  5LLI A;  3RUL A;  4L1R A;  4B6H A;  4NQL B;  4TV3 A;  1QIL A;  3KYD D;  4FJZ A;  1V80 A;  3DVN U;  2WXL A;  4H8S A;  2KIG A;  3IFW B;  4LLG M;  3RT3 B;  3RI7 C;  1XCG A;  2WDR B;  1GGO A;  1PQS A;  2JZP A;  2WXI A;  1RYJ A;  1XD3 B;  2UZS A;  4P1B C;  4EZL A;  5IP4 D;  1N60 A;  1VRA B;  3P1M A;  1FXI A;  3O65 B;  1VCB A;  2FCM A;  3FSS A;  3NHE B;  3RYT A;  3VUW A;  1UBQ A;  2LOX A;  3ZRC A;  3PEG A;  4KDL B;  4WWO A;  4MK0 A;  2EEL A;  1J0W A;  3Q8C A;  4BKT A;  1LXD A;  3PZD A;  2PVO D;  4E3C A;  1FXA A;  3PT2 B;  4WWP A;  2RSU A;  2V1Y A;  5LNK 1;  1H4R A;  4IFS A;  1HB8 A;  1FRR A;  3PGE A;  2VH1 A;  2N9P C;  4JWS C;  2GMI C;  3E9S A;  1L0V B;  3M62 B;  3ZNH B;  3D32 A;  2W2X C;  4KHB A;  3VXW A;  4N6E B;  3APD A;  3HHM A;  2PIA A;  4LTU A;  2KDI A;  2DZJ A;  4ZRP A;  3AE5 B;  4PYU A;  4ILJ A;  1HXY D;  2X38 A;  2A5U A;  4OZB A;  1Q67 A;  1FNU A;  2DN6 A;  3DXE A;  5G5G A;  1WJ6 A;  4DX9 0;  1FOE A;  3ZNI D;  1FCC C;  2H89 B;  3ZDM C;  3N1Z C;  2V4I B;  2JSV X;  4QAY A;  5AEK B;  2XBB C;  2OHF A;  1YJJ A;  3AXC A;  4J3O D;  2UYZ B;  4DHJ D;  1J0G A;  3AUL A;  1I7A A;  3NZS A;  3V3X A;  3AMZ A;  2CU1 A;  1QQR A;  1NDD A;  1JWU D;  1R7S A;  2D9Z A;  2LRU A;  3A1Q B;  2CQU A;  1WYW B;  2K8B A;  4WJO A;  1NVI D;  3SUZ A;  1A5R A;  2RR9 A;  2ZVO A;  1K51 A;  1X05 A;  4WIP A;  4YXD B;  3HUI A;  3FLV A;  4PT5 A;  3BIN A;  1LO5 D;  2PW9 A;  3OWE B;  1T0Y A;  3GP7 A;  2D07 B;  3VR8 B;  1KZG A;  1GNU A;  3DHG C;  1N63 A;  5DPS A;  1WI1 A;  1TZO A;  4HAY B;  2XNA C;  3NVY A;  1V81 A;  1FXT B;  2PEA A;  3LB8 C;  2IFS A;  1E0Z A;  1XX0 A;  2LVQ A;  3FP5 A;  3PV1 A;  4DDG D;  4KGR A;  2HJ1 A;  2LGI A;  4EOY A;  1GUA B;  4IM2 A;  3L08 A;  4W9H A;  1WG7 A;  1MK9 B;  2I5F A;  4HWI B;  1JDE A;  5HE0 A;  3FEH A;  3QAQ A;  4GPT B;  3PP2 A;  2NBU A;  5FKA C;  4LJP B;  2PLP A;  2LUL A;  1GB4 A;  4NAW B;  4W9G A;  3ZVR A;  3ONS A;  3P2B A;  2G4D B;  2J52 A;  3WYF B;  1RRB A;  1J19 A;  2UVM A;  3TO1 A;  1HZ5 A;  4GNK B;  3PS6 A;  2YLM A;  3TBL D;  1DDM A;  2CR5 A;  3KSY A;  3AEG B;  2L3Z A;  1F52 A;  1WZ3 A;  3DXC A;  1FM0 D;  1ZPS A;  2ZPN A;  3BZD B;  3TCA A;  1DRO A;  5DI9 B;  4HAU B;  4CO7 A;  1V8C A;  1SSN A;  4REZ A;  3IHP C;  4NJ7 A;  1XEE A;  3WIM A;  4JK7 A;  2MQJ A;  3ULB A;  1C9F A;  1ZC4 B;  5G5H A;  4WJN A;  2KAJ A;  4L1B A;  3ZJV A;  4F7H A;  5LG4 B;  1TXD A;  2MDX A;  1WJ1 A;  1TY0 A;  1BWN A;  1E7P B;  1F0Z A;  4DDI D;  1FO4 A;  2KN4 A;  2K6D B;  4XGA B;  1FCL A;  1J7A A;  3ODW A;  3KYC D;  1D3Z A;  3GZN I;  3P7Z A;  3R2I A;  5EDS A;  1WX8 A;  4GIV A;  1L4Z B;  1VDV A;  1WM3 A;  3ALB A;  4WAF A;  3LJ3 A;  2WXR A;  2DAJ A;  2N0Y A;  1M4V A;  5DH9 B;  3DBR B;  2BB5 A;  2D9W A;  1WGY A;  1ZW7 A;  4MGY E;  1UH6 A;  1WGK A;  1U2B A;  1TS3 A;  3F5R A;  3KRX A;  3P6A A;  2WXP A;  4GSW A;  1WGU A;  2CS4 A;  1R4N B;  1SJH D;  2IND C;  1KFY B;  3T9L A;  2R61 A;  1LM8 B;  1SE3 A;  3TUO A;  1EWC A;  3CIK A;  2QKM A;  3ML9 A;  5BMI A;  3FKY A;  2ABD A;  2BYE A;  2JP2 A;  2YSZ A;  3A9J A;  1OQQ A;  1WMH A;  1DDV A;  4MEL A;  2O6V D;  5BYR A;  4EE2 A;  3WAO A;  4A55 A;  3B2G A;  3MPX A;  4K3B A;  1XO3 A;  1D6E C;  1WXQ A;  4DXF A;  2KZR A;  3PVU A;  3QCA A;  3TEY A;  4P16 A;  2FUG 1;  2CHX A;  4C56 C;  2MWN B;  3PRZ A;  4GDL A;  1MVK A;  2IY1 B;  5I4D A;  2LKO A;  3RNG C;  2GI9 A;  3PRP B;  4HAT B;  3AED B;  4A6Q A;  3DQV A;  3NS8 A;  3SBG A;  1TKG A;  1I4H A;  2P0D A;  1FHO A;  1NTY A;  1YN5 A;  2NTS A;  4BAX A;  2LI5 A;  2DLB A;  4DBB A;  2K25 A;  2PPH A;  5AUI A;  3RNE C;  2K8C A;  2PJH A;  2HDE A;  3KVF B;  1EAZ A;  3EGR A;  3PRE A;  3IG3 A;  1MIZ B;  5IO9 A;  4KDI C;  2AWT A;  3U52 E;  1ISN A;  3PG7 A;  2KMM A;  1WH3 A;  2JWU A;  2LHE A;  3M1I B;  3B2F A;  4HVB A;  1JWA D;  1ET9 A;  5BYS A;  4NJ6 A;  1U4A A;  1KZ7 A;  2K49 A;  4RF1 A;  3WAL A;  5HHD G;  4BVU C;  3VRB B;  1TQZ A;  2LVP A;  2L52 A;  2M4N A;  3OJ4 B;  2DYM A;  4JKD A;  1GB1 A;  4R3D A;  1FMA D;  2LOZ A;  1I4R A;  4XX5 A;  1T0Q C;  2BWF A;  4FA6 A;  2IO0 B;  2VRW B;  2BYV E;  3DCG A;  4C4V B;  1D5Z C;  1PGX A;  2JRH A;  2NPT B;  3V6C B;  1RRP B;  4DWF A;  4RGM A;  2YS1 A;  1P3Q U;  1PGB A;  3V05 A;  3BVG A;  3RD2 A;  5LON B;  2W54 A;  5H8Y E;  2CY5 A;  1BT0 A;  2L0F A;  1HEZ E;  1D5X C;  1PLS A;  2PKO A;  2WXQ A;  4AJY B;  4HB0 B;  3NZU A;  4MSM B;  4OHJ A;  1ENF A;  1U5F A;  5HE3 A;  4EJN A;  1FFV A;  4OZA A;  2NMB A;  3C19 A;  4W9J A;  4KSL C;  1T5X D;  2SAK A;  4HB2 B;  1P5T A;  1ACA A;  1OY2 A;  2KIE A;  3AI5 A;  3VRA B;  4Z2M B;  3KWL A;  4JL9 A;  4BOS C;  2KWC A;  4A6F B;  1V9J A;  3EA6 A;  1OQN A;  1QOA A;  2KFJ A;  3MJ5 A;  4KSK C;  2KDF B;  2QC8 A;  1L5P A;  1NEN B;  2KKC A;  1TIF A;  4EKU A;  2NR2 A;  1H8C A;  4HPP A;  4P6V F;  4YWG G;  2RSG A;  2WU5 B;  2KAN A;  3VR9 B;  3DHI C;  4GN1 A;  3TSS A;  3BII D;  5GXG B;  4GDK B;  3OG5 A;  4GXB A;  1XCQ L;  2WS3 B;  3AE8 B;  4MGK E;  4L6E A;  3ECI A;  1YN4 A;  4XYC A;  3Q3M C;  2MBE A;  1L2N A;  3U12 A;  2NBV A;  2MJ3 A;  4AWJ A;  1YOV B;  2Y7B A;  2WDT B;  2NZ8 B;  2WHI A;  4CHK A;  3N9Y C;  4HAZ B;  2QKL A;  1L0X B;  5JHB A;  1VZ8 A;  1NYR A;  1QLB B;  1U27 A;  2K9X A;  3MHS D;  4XDC A;  1HTO A;  4F8C B;  2WWZ A;  1I4X A;  4JKH A;  2HTH B;  2LGD A;  4S0R A;  4QXA B;  3NWD A;  2KWV B;  2O6V A;  2GBJ A;  2GBM A;  4KGS A;  3K9P B;  3E9O A;  2BF8 B;  3H7P A;  3HIE A;  4LNK A;  4P7I A;  1WZ0 A;  2LHD A;  3UF8 A;  1BTK A;  3AE3 B;  2GJY A;  1V97 A;  1TKY A;  2IO1 B;  4AS1 A;  2MH7 A;  2Y8F A;  2KWU B;  2B3A A;  2H88 B;  2W55 A;  1MK7 B;  3N7C A;  3VOQ A;  4A5K A;  3NOB A;  1KLV A;  1GOZ A;  5JVL A;  2I5C A;  3CMM B;  3GZN B;  1YJ1 A;  2LGS A;  2WXK A;  3MP9 A;  1F2R I;  4N59 A;  1UWX A;  1J7B A;  2KX3 A;  2J42 A;  4IOI E;  4L2Y A;  1FNV A;  4A6K A;  5JH5 C;  3B0A A;  4KIK B;  3TFM A;  2KLC A;  4AQ7 A;  1QOG A;  2VSZ A;  4HXD A;  3OHM B;  1CMX B;  3PSC A;  2UU7 A;  5KHQ A;  4RM8 A;  3NVZ A;  4HAX B;  1TGZ B;  1WE6 A;  4JGH B;  4XDD A;  3A4S C;  1MAI A;  4M0W B;  2KTR B;  4FJY A;  1GJZ A;  3B9J A;  4QJ4 B;  2XK5 A;  2AX5 A;  3U30 A;  1WGD A;  4B0M A;  3O13 A;  2KNB A;  1AAR A;  4OVZ A;  3ZDT A;  2M0X A;  1FB8 A;  3IBE A;  3DDC B;  1FAO A;  4JPS A;  1KC7 A;  2ADZ A;  5D6J B;  1E5W A;  1JWS D;  1K5G B;  1UEF A;  4A6F A;  2DX5 B;  3APC A;  2E6X A;  5KQ4 A;  2NCN A;  2O2V B;  1MHH E;  1OEY A;  5CHW A;  2V3S A;  3IVF A;  1XKE A;  4GB9 A;  1KOT A;  5L95 C;  4K17 A;  1WRD B;  3H1U A;  2K0P A;  1J7C A;  2M14 A;  1YQB A;  3NZ3 A;  3D8F A;  1U29 A;  1JWB D;  1AQC A;  2KTF A;  2R82 A;  3W5V B;  2HD5 B;  2G45 B;  1WSP A;  1RJ2 A;  1IYF A;  3UI3 A;  1KLG D;  2BCJ A;  4HAW B;  5D3D A;  2X8X X;  1Z87 A;  3R3M A;  3D8E A;  3P4S B;  2QEJ C;  4GOU A;  2UZR A;  2QMT A;  1TKE A;  2D4Q A;  2MBH A;  2LGX A;  5T8I A;  1F2R C;  1EF5 A;  4OSN A;  1K5D B;  5IN7 A;  3P63 A;  2JX5 A;  1T0R C;  5C5B B;  1SXT A;  2YF0 A;  1TT5 B;  2WXO A;  1EU4 A;  1SHC A;  4PNK A;  3UIN B;  2LVO A;  2X18 A;  2VKI A;  3EPY A;  5JZE B;  1I4P A;  1FPY A;  3ZQ4 A;  1HQR D;  3VH3 B;  2JPH A;  2WP9 B;  1BTN A;  3Q3O C;  2XQN M;  1W1H A;  3NWF A;  4NAM A;  1FGZ A;  4JQW C;  5I2S A;  2RLO A;  3VTU A;  3AM9 A;  4X57 B;  4DXG A;  1WGR A;  5E6P A;  2FBW B;  2PZ1 A;  3SD5 A;  5CLQ B;  2I1J A;  4MEM A;  2V76 A;  2Y3A A;  4IC7 B;  3R7R A;  4BZA A;  4RMA A;  2L1A A;  2M8S A;  5J3Q A;  4FBJ B;  3IT4 B;  3GYO A;  4EEW A;  3ZYY X;  2YEP B;  3U8Z A;  1MFW A;  3RCP A;  3F0W A;  3ML8 A;  2INN E;  2ZEQ A;  3C8Y A;  4MT7 A;  5L81 A;  4JIO U;  2KHW B;  2AL6 A;  2DLW A;  1FNW A;  2IY0 B;  3HW2 B;  1LFD A;  3HRD D;  2MCN B;  2KLG A;  5CLL B;  2BS4 B;  3GOE A;  1UNQ A;  2BWE S;  1XQQ A;  4GGQ A;  1OMW A;  1HA5 A;  2P0F A;  2ZW1 A;  2RRF A;  3P4P B;  1JCK B;  4NJC A;  4RCO A;  4ZRQ A;  3RPF C;  2KXJ A;  3DBL I;  2J4X A;  1ROE A;  3VUX A;  1WE7 A;  3RNA C;  1KRH A;  1NVL A;  1MHX A;  2C5L C;  2D9Y A;  3FM8 C;  4YTM B;  2DX5 A;  2J59 M;  1PUT A;  1NI3 A;  2E3T A;  4MM3 B;  1T0S C;  3I63 C;  2WDV B;  2KUP A;  4WJP A;  1NTV A;  4KX6 B;  2RGN B;  2Z59 B;  5JLJ B;  2N7J A;  2DHK A;  4NSW A;  3ZNZ B;  2WXF A;  3QK0 A;  4M8N A;  3AE1 B;  2ROZ B;  4C80 A;  1X1M A;  2YVC A;  2DYN A;  1EU3 A;  3AEE B;  2RMM A;  2ACZ B;  2IO3 B;  2OJW A;  5DHF B;  1V2Y A;  2NS5 A;  4TYZ A;  2JF5 A;  1DYN A;  3NRZ A;  3W1S C;  5HG2 A;  5JXV A;  1OQY A;  1WY8 A;  2KCJ A;  2KD0 A;  4IWQ A;  1HBK A;  2DEN B;  1U5D A;  2FJL A;  4LDT D;  3FVC A;  1XD4 A;  3UIP B;  4M8M A;  2BS2 B;  1YNT E;  2MP2 B;  1MPH A;  3AB5 A;  2JZ3 B;  2LJI A;  2MBO A;  3ULC A;  5I2M A;  5C5B A;  2ZNV C;  1E10 A;  1X1F A;  2DTC A;  3RNB C;  1YMH E;  3A8Q A;  5J3Y A;  2OED A;  2JT4 B;  2FNJ B;  1WR6 E;  2YRY A;  2HTM E;  3HK0 A;  2NTT A;  1I2H A;  3U7Z A;  3ZLZ A;  2JWZ A;  2W82 A;  3S2A A;  4WQM A;  3AU4 A;  4WAA A;  1WF9 A;  4RF0 A;  1Q0W B;  1XXG A;  2W3S A;  2QDF A;  1NYQ A;  1F1H A;  4A3P A;  2RDH A;  4ZHP A;  3MC8 A;  2LXA A;  1N3H A;  3UQA A;  4HDQ A;  2L00 B;  4ZRK A;  4ICU A;  1ACC A;  2R0D A;  3W9C B;  1WJU A;  1B1Z A;  4MGZ E;  1MG8 A;  5GOW B;  4TSS A;  1NEK B;  4W9C A;  2L8J A;  2M17 A;  1ZOY B;  1WFY A;  4HKQ A;  4HPL B;  3RMK C;  2W2X D;  2RVB B;  2JYE A;  1JML A;  3WAP A;  2G35 A;  1V5U A;  2BW2 A;  4F7Z A;  1LB1 A;  2PMV A;  1F9J A;  4E71 A;  2DZK A;  1SEB D;  3NS1 A;  1WXV A;  3WAN A;  4A9A A;  1L0Y B;  4J6I A;  1WYG A;  2DHZ A;  1WXA A;  3W5U B;  2DHJ A;  2FID A;  3WCQ A;  4AOF A;  3KUC B;  4XWX A;  1XLP A;  1G6J A;  1W1D A;  2DKP A;  2LUM A;  3Q6B A;  2DYQ A;  1CQV A;  1MG4 A;  4HSI A;  2RDB C;  4BKS A;  3H7S A;  3MJW A;  1RWS A;  1GAQ B;  2N7E A;  2OTX A;  1RLF A;  3TMP B;  1FEH A;  3T8M A;  3A9K B;  2X0S A;  5DPR A;  3GE8 C;  1HTQ A;  3SBT A;  2G3Q B;  1AWE A;  2MSE D;  5FR3 A;  3ZW3 A;  4IOY X;  1E8Y A;  2IJ0 A;  1EGX A;  4JWU C;  4JKC A;  4PK1 A;  5J3T A;  4FJV B;  1KI1 B;  4EZK A;  2YT1 A;  1KM7 A;  2Y5B B;  3A1Q A;  4F7U P;  2R09 A;  2W2W A;  3TEX A;  2WH5 A;  5DIF B;  3MC0 B;  4QJ5 B;  2KO3 A;  5KHO A;  4MH8 A;  2WLB A;  3APF A;  3KY9 A;  3W2D A;  2COA A;  2WGS A;  4US9 A;  4C7Y A;  3MTN B;  1B55 A;  3H9D A;  4ARI A;  1MJD A;  1ZDV A;  2WQY B;  4ZRJ A;  2WXJ A;  2FCQ A;  4DBG A;  2MRP A;  5IRS A;  1IPG A;  3CST A;  5LXH A;  5AZF A;  3PVW A;  3ZGZ A;  5CHV C;  2Q5W D;  2M0A A;  2Z0Q A;  3JVZ X;  2K2U A;  3QHT A;  4A90 A;  4I6L B;  2ZNV B;  4NAW A;  1E90 A;  2J53 A;  1Y56 A;  4XE0 A;  1L6U A;  3CIR B;  3RNC C;  3G9W A;  3SR6 A;  1MPE A;  4LK0 M;  4DHZ B;  2RUK B;  2DZM A;  4II3 B;  1TS2 A;  1WM2 A;  4NPN A;  4YL8 A;  3VH4 B;  3Q69 A;  1ZVR A;  3P4R B;  3R2T A;  1VD2 A;  3AEA B;  3N30 A;  2C60 A;  1V6E A;  1ZGU B;  4ANW A;  4I6P A;  4QJ3 B;  3DBL B;  3ZUN A;  4MSQ B;  2I1K A;  3NWA A;  1HZ6 A;  3OAN A;  1IBX B;  4YT0 B;  4HEA 1;  3A4R A;  4KHO A;  5HE1 A;  4PYZ A;  4CSQ A;  3Q14 C;  4HJK A;  1P3R A;  3NUH B;  2K1F A;  2KJH B;  3DWM A;  4EFO A;  1JWM D;  1V5O A;  2KK8 A;  1P98 A;  2D9X A;  4G3X B;  3VUY A;  1A70 A;  3FIL B;  4XWW A;  1K8R B;  3KUD B;  4ILH A;  4JKE A;  2YS5 A;  4IDI A;  3URY A;  4NY0 A;  2ICI A;  4PS3 A;  3ZXV A;  3HVD A;  2D11 A;  2L76 A;  2M19 A;  2IYB A;  2MBQ A;  4YTN B;  4MJS B;  4IWP A;  3ZNG C;  3PTF C;  2FJU B;  1P7F A;  2GB1 A;  5G2N A;  1XT9 B;  1QQG A;  3LDZ E;  2N9X A;  1VZ7 A;  1ZP0 B;  4I6N B;  2VZK B;  4HB4 B;  4Z2N A;  4LNI A;  2LEK A;  3AEB B;  1GG3 A;  5E6N A;  4BOZ B;  2J0J A;  2Z14 A;  2K8E A;  1F77 A;  4XC2 A;  5G55 A;  2YS3 A;  4M00 A;  3W1S A;  2K8H A;  2FCS A;  4K3C A;  2IBI B;  3IAS 1;  5L83 A;  1EM7 A;  2BPS A;  3WAM A;  3OLM D;  2YT0 A;  4W9D A;  4L23 A;  4GMX B;  1CJE A;  1ZUD 2;  2MW5 A;  4GZU A;  3KQ4 A;  1FD6 A;  2RQ1 A;  1PFD A;  3UIO B;  2DYB A;  2RDG A;  2TSS A;  3R7Q A;  4TQ0 A;  1UNS A;  2BQQ A;  1XLN A;  3AEC B;  1DIK A;  1DGJ A;  2EMS A;  3HVZ A;  3U4E G;  4BBN C;  2EKE C;  2MLB A;  3A33 B;  2D3B A;  1YD8 U;  1P1A A;  1V61 A;  3ODX A;  2NVU I;  3Q3N C;  2Z4D A;  4IWO A;  4K2O A;  1BAK A;  4BKG A;  2GOW A;  2KN5 A;  3NJT A;  3EFU A;  2ASQ A;  2D3A A;  3B1L X;  1Y5O A;  1IRS A;  2INP E;  4WWN A;  3FAH A;  1TJ6 A;  3BK2 A;  4KKI A;  5AZG A;  4M01 A;  2DX1 A;  5TSS A;  2KDE B;  3T3O A;  3ZJU A;  5EE3 A;  3AEF B;  1YJI A;  1QC6 A;  3BY4 B;  5HKH A;  3RFZ B;  3DBH I;  4HLE A;  1TS4 A;  2CJO A;  4RGO S;  4TMA B;  1IGC A;  3JSV B;  2LG1 A;  3BK1 A;  4JK8 A;  4D0N B;  4D2K A;  2AEH A;  2BB6 A;  3SDL C;  1E9M A;  3KLS X;  4KHA A;  3RZW C;  2ELB A;  3A98 B;  2BYF A;  2KYW A;  3P4Q B;  3RCZ A;  4FLH A;  4TQ1 A;  4C4V A;  3EC8 A;  4ASW C;  5H92 C;  2NPT A;  4WVF B;  1ZSQ A;  2Q13 A;  2P8V A;  2L0T A;  2N9E B;  3SU8 X;  5HFY A;  5J18 A;  1RM6 C;  5C23 A;  2BYT A;  4B9K A;  4HB3 B;  2Z0P A;  1TS5 A;  3ZTC A;  1QT9 A;  2ZVN A;  2KJ6 A;  4DIX A;  1NBF C;  2BVC A;  1JQ4 A;  4G0N B;  1UWM A;  4YTP B;  5M4Y B;  2PE9 A;  2CHZ A;  2KC2 A;  4NZL B;  2LZ6 A;  2KR0 A;  3VHT C;  3AE4 B;  1OTR B;  1TBE A;  2Z0D B;  2DWQ A;  3VIA A;  2MWS B;  5HE2 A;  1PMS A;  4WJ7 A;  1UEL A;  3A8P A;  3DHH C;  2YEP F;  1I4G A;  2WYQ A;  2EMT A;  4HCN B;  2BBC A;  4BBK A;  4FN2 A;  3DVG X;  4IKG A;  1NTI A;  4C7Z A;  2JXX A;  4NQK E;  2MBB B;  2ZCB A;  3AN1 A;  4OVU A;  4ANU A;  4ACF A;  2ZKM X;  3IXS A;  1LQB A;  3H8H A;  4KKJ A;  3JYU A;  4MT5 A;  2INC C;  2D10 A;  2ONQ A;  1L6V A;  1MI0 A;  1V1P B;  5D94 A;  4URK A;  3PZ7 A; 
#chains in the Genus database with same CATH homology
 4MH0 E;  2RGF A;  3L17 A;  1W1G A;  2IZV B;  4W9K A;  2BGF A;  4GDK A;  4KHB B;  4WQO B;  3E66 A;  4CHJ A;  3L0W B;  3V6E B;  3HQC A;  4EMO A;  4IW0 A;  1U5G A;  3NY5 A;  4JKG B;  5IJM A;  2NBW B;  1Z5S B;  2REX A;  1WJN A;  5JP4 A;  3MDB C;  1V86 A;  1FHX A;  3X23 A;  4W9E A;  2AL3 A;  2HTH A;  5JHA A;  2BKF A;  3X0W A;  1UBI A;  3W1Y A;  4KV2 A;  3VQI A;  4LJO B;  2G4S A;  3ZTD A;  2L2I A;  3SV1 A;  3TVV A;  4BKS D;  1EF1 A;  3AU5 A;  3UZT A;  3QWM A;  3HM6 X;  2LAS A;  1X86 A;  2D9V A;  1H10 A;  2FCN A;  4IAP A;  1YX6 B;  5IA7 A;  5LXI B;  1SGH A;  4TUU A;  2N1V A;  1KBL A;  2RPQ A;  4KIK A;  3KZ1 A;  5GMV A;  3VAW A;  5D3X A;  4CHM A;  3VTW A;  3B08 A;  4KZC A;  2CAY A;  1XOD A;  1GC7 A;  2KGX B;  2KTR A;  1R4M I;  3HM3 A;  1X1G A;  2WX1 A;  1RAX A;  3I3T B;  3VFK A;  3KUZ A;  2ZJD A;  2M38 A;  3DOW A;  2O2V A;  4JK9 A;  1M7E A;  2K6Q A;  3WA0 A;  3L13 A;  4KVG B;  5FI1 A;  3QA8 A;  3V5W A;  1DDW A;  4HHV A;  1P0R A;  2L1C A;  3CSF A;  5J2R A;  4GOC A;  4K81 A;  1M94 A;  5C16 A;  4MDK E;  5D27 A;  2XEW A;  3VDZ A;  4AP4 C;  2OOB B;  5C1Z A;  3QC8 B;  1J8C A;  4JKG A;  3T06 A;  2D2Q A;  5C79 A;  3DBS A;  3M95 A;  1M7R A;  2JRI B;  1OGW A;  4EUT A;  1SIF A;  1NI2 A;  3EEC A;  2HE7 A;  1P9D U;  2LYD A;  2GS0 A;  2GBN A;  2LWP A;  2PE6 B;  1S1Q B;  1C1Y B;  2IO2 B;  1LW3 A;  1HB6 A;  2KOX A;  2Z0E B;  1VBH A;  4IUM B;  2DFK A;  4AJW A;  3ZO5 B;  2A4Z A;  2JUO A;  4HDO A;  4TKN A;  3NSU A;  2KMA A;  5TR5 A;  3SO6 A;  2ZCC A;  2V4L A;  2WX0 A;  1Q5W B;  4HK2 A;  2DHI A;  4KAX B;  2IYD B;  2N4F A;  3RZF A;  4HCP B;  3AJ4 A;  1ST7 A;  3A9J B;  1V88 A;  1WMH B;  2FDQ A;  2LBB A;  2MKR A;  4B6W A;  3KH0 A;  1GC6 A;  4K2P A;  1EO6 A;  4GDL B;  2CKH B;  2MFQ A;  3ML4 A;  2KX0 A;  4ZYN A;  3DPD A;  2L7R A;  4MM3 A;  3R66 C;  4DHJ B;  4FUL A;  1V5P A;  4FAD A;  4LDT B;  1E8Z A;  5DHA B;  2HRJ A;  4DX8 A;  3CF6 E;  1Y19 B;  1V49 A;  2KVR A;  3EHV A;  2QHO A;  5IAA C;  3L16 A;  3LJU X;  2JVC A;  2LGY A;  3OAW A;  4DXA B;  3RUI B;  2H7D A;  1C3T A;  3GYP A;  4E74 A;  1I42 A;  4W9F A;  2EC1 A;  2MP2 A;  2GBK A;  4C0A A;  1UNP A;  4WSF A;  4DK5 A;  1PFJ A;  1X11 A;  2K00 A;  3O96 A;  2KJR A;  4AUQ C;  1Q1O A;  1E7V A;  2M1M A;  3TIX A;  1JRU A;  3UGB B;  5EFX A;  2JZZ A;  3E9P A;  3CXB B;  1IP9 A;  1Y8R C;  3OJ3 A;  5JHH A;  3PLU A;  1E8W A;  3V61 A;  2LD9 A;  3DVN V;  1WJ4 A;  3QIJ A;  3SHQ A;  2COC A;  1MKE A;  2MA9 B;  2OQB A;  1WIA A;  1YX5 B;  2HJ8 A;  3TJP A;  4BFR A;  4JKB A;  4GMV A;  1TTN A;  2N23 A;  1KJT A;  4EZJ A;  2GCJ A;  3H6N A;  2CHW A;  3KRW A;  3PLV A;  4GU2 A;  1P6S A;  3ODO A;  3SNH A;  1SE9 A;  4A3O A;  1WI0 A;  3HIZ A;  4CYE A;  5FR6 A;  2EJ8 A;  2D3G A;  1UGM A;  2NBV B;  4LCD E;  4JLC A;  5LOP B;  2KQS A;  2DAF A;  2J0K A;  2ELA A;  5D3Y A;  2W9N A;  1RFA A;  3A9K A;  4IG7 B;  4OVV A;  4K7W A;  4JKF A;  2ZZP B;  4Y94 A;  4N9F 4;  1UPR A;  4F1S A;  2O6V B;  5AZH A;  2CRF A;  2ZPY A;  4KZ0 A;  2DA0 A;  1WGH A;  3H7P B;  4HAV B;  4F7G A;  2J7Q B;  2KC1 A;  4XZ4 A;  4ZDV A;  5C6R A;  3K9O B;  3L54 A;  1U5E A;  4PS8 A;  4W9L A;  5DPT A;  4FHK A;  3E9L A;  4ANX A;  2KQ7 A;  2JY6 A;  2R2Q A;  3N3K B;  1WXS A;  3SYX A;  2KDB A;  3Q3F A;  1UNR A;  2MX2 A;  4II2 B;  2N7D A;  3ENB A;  3TL5 A;  1WVH A;  5BO4 B;  1V89 A;  2COF A;  3ZVV A;  1UZX B;  4MY6 A;  2CB8 A;  2C7M B;  3BJI A;  2XK5 B;  2L05 A;  4ZRI A;  2K2J A;  2DZI A;  2R2O A;  1E8X A;  2FAZ A;  4K7U A;  1L7Y A;  1WJM A;  2UWQ A;  1Z2M A;  3N32 A;  4YON A;  2RD0 A;  3QAR A;  2FUH B;  1ZM0 A;  1WGG A;  1E7U A;  3DVG Y;  2N1W A;  2GBR A;  5KQ1 A;  5DPW A;  5CTR C;  4PS7 A;  3PHX B;  2COD A;  4JKA A;  1YIW A;  2ROV A;  2KFK B;  1WX7 A;  3PRM B;  2GCL A;  2J0M A;  2C7N B;  3VTV A;  2CY4 A;  2DKQ A;  1WXM A;  5CX3 A;  3QBV B;  1WR1 A;  2LJ5 A;  3QJZ A;  2H7E A;  2COP A;  4A6H A;  5J17 A;  2RNR B;  1VBG A;  4K7S A;  5CHF A;  4BBN F;  2LXC A;  1NU2 A;  1HE8 A;  4MJS A;  2DIK A;  1I35 A;  2AYO B;  4G11 A;  1WGQ A;  2Y8G A;  5DCN A;  4K1R B;  1ZKH A;  1UD7 A;  2E2X A;  3V62 A;  1V5M A;  5D2M B;  4ICV A;  2FJ9 A;  4RM9 A;  4IM0 A;  2Z0O A;  4FHJ A;  1V5T A;  3PPA A;  4HPM B;  2FIF A;  2K39 A;  3U7D A;  2LRW A;  3ZIM A;  3M3J A;  4A20 A;  4W9I A;  5KCV A;  3DXD A;  2LUE A;  3QQ8 B;  3ENE A;  3ZKJ C;  3PHW B;  1ZC3 B;  2DYO A;  3C0R B;  1TZ1 A;  2C9W B;  1FGY A;  3QWZ B;  5D3W A;  5FI0 A;  4DHZ E;  2P0H A;  3JW0 X;  3M63 B;  1EVH A;  3UQB A;  1MIX A;  3KW5 B;  2VRR B;  3TW1 A;  2C7H A;  4IM3 A;  4WJQ A;  4ANV A;  5D3V A;  1EUV B;  4ILG B;  5JHG A;  3ZRF A;  2KFK A;  4MGI E;  3DBR I;  1XR0 B;  3JSV A;  1S3S G;  4PQ0 A;  3Q3J A;  5D7G A;  3QX1 A;  3VVW B;  1R4N I;  3V60 A;  3PVL A;  4G50 A;  1UPQ A;  3D8D A;  1QZE A;  3L10 B;  1WX9 A;  2BKR B;  3PSE B;  1FHW A;  2KMC A;  4B95 A;  1DBH A;  4NNJ B;  1OEY J;  2OJR A;  5E6O A;  5LLI A;  3RUL A;  4B6H A;  4NQL B;  4TV3 A;  3KYD D;  4FJZ A;  1V80 A;  3DVN U;  4H8S A;  3IFW B;  3RT3 B;  1XCG A;  1GGO A;  1PQS A;  1XD3 B;  2UZS A;  4EZL A;  3O65 B;  1VCB A;  2FCM A;  3FSS A;  3NHE B;  3RYT A;  3VUW A;  1UBQ A;  2LOX A;  3ZRC A;  3PEG A;  4KDL B;  4WWO A;  4MK0 A;  1J0W A;  4BKT A;  1LXD A;  3PZD A;  4E3C A;  3PT2 B;  4WWP A;  2RSU A;  2V1Y A;  1H4R A;  4IFS A;  1HB8 A;  3PGE A;  2N9P C;  2GMI C;  3M62 B;  3ZNH B;  3D32 A;  2W2X C;  3VXW A;  3APD A;  3HHM A;  2KDI A;  2DZJ A;  4PYU A;  4ILJ A;  2A5U A;  1Q67 A;  2DN6 A;  3DXE A;  1WJ6 A;  4DX9 0;  1FOE A;  3ZNI D;  3ZDM C;  5AEK B;  2XBB C;  3AXC A;  2UYZ B;  4DHJ D;  1J0G A;  3AUL A;  1I7A A;  3NZS A;  2CU1 A;  1NDD A;  2D9Z A;  2LRU A;  3A1Q B;  2CQU A;  1WYW B;  2K8B A;  4WJO A;  3SUZ A;  1A5R A;  2RR9 A;  2ZVO A;  1X05 A;  3FLV A;  3BIN A;  1T0Y A;  2D07 B;  1KZG A;  1GNU A;  5DPS A;  1WI1 A;  4HAY B;  1V81 A;  1FXT B;  2PEA A;  2IFS A;  1XX0 A;  2LVQ A;  3FP5 A;  3PV1 A;  4DDG D;  4EOY A;  1GUA B;  4IM2 A;  3L08 A;  4W9H A;  1WG7 A;  1MK9 B;  2I5F A;  4HWI B;  1JDE A;  5HE0 A;  3FEH A;  3QAQ A;  4GPT B;  3PP2 A;  2NBU A;  4LJP B;  2LUL A;  4NAW B;  4W9G A;  3ZVR A;  3ONS A;  3P2B A;  2G4D B;  3WYF B;  1RRB A;  1J19 A;  2UVM A;  3TO1 A;  3PS6 A;  2YLM A;  3TBL D;  1DDM A;  2CR5 A;  3KSY A;  2L3Z A;  1WZ3 A;  3DXC A;  2ZPN A;  3TCA A;  1DRO A;  5DI9 B;  4HAU B;  4CO7 A;  3IHP C;  4NJ7 A;  3WIM A;  4JK7 A;  2MQJ A;  3ULB A;  1ZC4 B;  4WJN A;  4F7H A;  1TXD A;  2MDX A;  1WJ1 A;  1BWN A;  4DDI D;  2K6D B;  3ODW A;  3KYC D;  1D3Z A;  3GZN I;  3P7Z A;  5EDS A;  1WX8 A;  4GIV A;  1WM3 A;  3ALB A;  3LJ3 A;  2DAJ A;  2N0Y A;  5DH9 B;  2D9W A;  1WGY A;  1ZW7 A;  4MGY E;  1UH6 A;  1U2B A;  3F5R A;  3KRX A;  3P6A A;  4GSW A;  1WGU A;  2CS4 A;  3T9L A;  1LM8 B;  3CIK A;  2QKM A;  3ML9 A;  2ABD A;  2BYE A;  2JP2 A;  2YSZ A;  3A9J A;  1WMH A;  1DDV A;  4MEL A;  2O6V D;  3WAO A;  3MPX A;  2KZR A;  3PVU A;  3QCA A;  2CHX A;  2MWN B;  3PRZ A;  4GDL A;  2IY1 B;  2LKO A;  3PRP B;  4HAT B;  3DQV A;  3NS8 A;  3SBG A;  2P0D A;  1FHO A;  1NTY A;  2LI5 A;  4DBB A;  2K25 A;  2PPH A;  2K8C A;  2PJH A;  3KVF B;  1EAZ A;  3PRE A;  3IG3 A;  1MIZ B;  4KDI C;  2AWT A;  1ISN A;  3PG7 A;  1WH3 A;  3M1I B;  4HVB A;  4NJ6 A;  1U4A A;  1KZ7 A;  3WAL A;  4BVU C;  1TQZ A;  2LVP A;  2M4N A;  3OJ4 B;  2DYM A;  4JKD A;  2LOZ A;  4XX5 A;  2BWF A;  4FA6 A;  2IO0 B;  2VRW B;  2BYV E;  3DCG A;  2JRH A;  2NPT B;  3V6C B;  1RRP B;  4DWF A;  2YS1 A;  1P3Q U;  3RD2 A;  5LON B;  2CY5 A;  1BT0 A;  2L0F A;  1PLS A;  4AJY B;  4HB0 B;  3NZU A;  4MSM B;  1U5F A;  5HE3 A;  4EJN A;  2NMB A;  4W9J A;  4KSL C;  4HB2 B;  1P5T A;  1ACA A;  1OY2 A;  3AI5 A;  4Z2M B;  4JL9 A;  4BOS C;  2KWC A;  4A6F B;  1V9J A;  1OQN A;  2KFJ A;  4KSK C;  2KDF B;  2KKC A;  4EKU A;  2NR2 A;  1H8C A;  2RSG A;  2KAN A;  4GN1 A;  4GDK B;  4GXB A;  4MGK E;  4L6E A;  3ECI A;  2MBE A;  1L2N A;  4AWJ A;  2Y7B A;  2WDT B;  2NZ8 B;  4CHK A;  4HAZ B;  2QKL A;  5JHB A;  3MHS D;  1U27 A;  4F8C B;  2WWZ A;  4JKH A;  2HTH B;  2LGD A;  2KWV B;  2O6V A;  2GBJ A;  2GBM A;  3K9P B;  3E9O A;  2BF8 B;  3H7P A;  4P7I A;  1WZ0 A;  3UF8 A;  1BTK A;  2GJY A;  2IO1 B;  2Y8F A;  2KWU B;  2B3A A;  1MK7 B;  3N7C A;  3VOQ A;  4A5K A;  3NOB A;  1KLV A;  5JVL A;  2I5C A;  3CMM B;  1YJ1 A;  2KX3 A;  4A6K A;  5JH5 C;  3B0A A;  4KIK B;  3TFM A;  2KLC A;  2VSZ A;  4HXD A;  1CMX B;  3PSC A;  5KHQ A;  4RM8 A;  4HAX B;  1TGZ B;  1WE6 A;  4JGH B;  3A4S C;  1MAI A;  4M0W B;  2KTR B;  4FJY A;  1GJZ A;  2XK5 A;  3U30 A;  1WGD A;  2KNB A;  1AAR A;  3ZDT A;  2M0X A;  1FB8 A;  3IBE A;  3DDC B;  1FAO A;  5D6J B;  1KC7 A;  2ADZ A;  1E5W A;  1K5G B;  1UEF A;  4A6F A;  2DX5 B;  3APC A;  2NCN A;  5KQ4 A;  2O2V B;  1OEY A;  5CHW A;  2V3S A;  3IVF A;  1XKE A;  4GB9 A;  1KOT A;  5L95 C;  4K17 A;  1WRD B;  3H1U A;  2M14 A;  1YQB A;  3D8F A;  1U29 A;  1AQC A;  2KTF A;  2R82 A;  2HD5 B;  2G45 B;  1RJ2 A;  1IYF A;  2BCJ A;  4HAW B;  1Z87 A;  3R3M A;  3D8E A;  2UZR A;  2D4Q A;  2MBH A;  2LGX A;  1EF5 A;  1K5D B;  5C5B B;  2YF0 A;  1SHC A;  4PNK A;  3UIN B;  2LVO A;  2X18 A;  2VKI A;  3EPY A;  5JZE B;  3VH3 B;  2JPH A;  1BTN A;  2XQN M;  1W1H A;  1FGZ A;  4JQW C;  2RLO A;  3VTU A;  4X57 B;  1WGR A;  5E6P A;  2PZ1 A;  3SD5 A;  5CLQ B;  2I1J A;  4MEM A;  2V76 A;  4IC7 B;  3R7R A;  4RMA A;  2M8S A;  5J3Q A;  4FBJ B;  3GYO A;  4EEW A;  3U8Z A;  3RCP A;  3F0W A;  3ML8 A;  2ZEQ A;  4MT7 A;  5L81 A;  4JIO U;  2KHW B;  2AL6 A;  2DLW A;  2IY0 B;  3HW2 B;  1LFD A;  2MCN B;  2KLG A;  5CLL B;  3GOE A;  1UNQ A;  2BWE S;  1XQQ A;  4GGQ A;  1OMW A;  2P0F A;  2KXJ A;  3DBL I;  3VUX A;  1WE7 A;  1NVL A;  2C5L C;  2D9Y A;  3FM8 C;  2DX5 A;  2J59 M;  2KUP A;  4WJP A;  1NTV A;  2RGN B;  2Z59 B;  5JLJ B;  2DHK A;  4NSW A;  3ZNZ B;  3QK0 A;  4M8N A;  2ROZ B;  1X1M A;  2YVC A;  2DYN A;  2IO3 B;  5DHF B;  1V2Y A;  2NS5 A;  4TYZ A;  2JF5 A;  1DYN A;  3W1S C;  1OQY A;  1WY8 A;  2KCJ A;  2KD0 A;  4IWQ A;  1HBK A;  2DEN B;  1U5D A;  2FJL A;  4LDT D;  1XD4 A;  3UIP B;  4M8M A;  2MP2 B;  1MPH A;  2JZ3 B;  2MBO A;  3ULC A;  5C5B A;  2ZNV C;  1X1F A;  2DTC A;  3A8Q A;  5J3Y A;  2JT4 B;  2FNJ B;  1WR6 E;  2YRY A;  3HK0 A;  1I2H A;  3ZLZ A;  2JWZ A;  3S2A A;  3AU4 A;  4WAA A;  1WF9 A;  1Q0W B;  4A3P A;  2LXA A;  1N3H A;  3UQA A;  4HDQ A;  2L00 B;  4ZRK A;  4ICU A;  2R0D A;  1WJU A;  4MGZ E;  1MG8 A;  5GOW B;  4W9C A;  2L8J A;  2M17 A;  1WFY A;  4HPL B;  2W2X D;  2RVB B;  3WAP A;  2G35 A;  1V5U A;  4F7Z A;  1LB1 A;  1F9J A;  4E71 A;  2DZK A;  1WXV A;  3WAN A;  4J6I A;  2DHZ A;  1WXA A;  2DHJ A;  2FID A;  4AOF A;  3KUC B;  4XWX A;  1G6J A;  1W1D A;  2DKP A;  2DYQ A;  4BKS A;  3H7S A;  3MJW A;  2N7E A;  2OTX A;  1RLF A;  3TMP B;  3T8M A;  3A9K B;  2X0S A;  5DPR A;  3SBT A;  2G3Q B;  1AWE A;  2MSE D;  3ZW3 A;  4IOY X;  1E8Y A;  1EGX A;  4JKC A;  5J3T A;  4FJV B;  1KI1 B;  4EZK A;  2YT1 A;  1KM7 A;  2Y5B B;  3A1Q A;  4F7U P;  2R09 A;  2W2W A;  2WH5 A;  5DIF B;  5KHO A;  2KO3 A;  3APF A;  3KY9 A;  2COA A;  3MTN B;  1B55 A;  3H9D A;  4ZRJ A;  2FCQ A;  4DBG A;  2MRP A;  1IPG A;  3CST A;  5LXH A;  5AZF A;  3PVW A;  5CHV C;  2Z0Q A;  3JVZ X;  2K2U A;  3QHT A;  4I6L B;  2ZNV B;  4NAW A;  1E90 A;  3G9W A;  4DHZ B;  2RUK B;  2DZM A;  4II3 B;  1WM2 A;  4NPN A;  4YL8 A;  3VH4 B;  1ZVR A;  1VD2 A;  3N30 A;  2C60 A;  1V6E A;  1ZGU B;  4ANW A;  4I6P A;  3ZUN A;  4MSQ B;  2I1K A;  3OAN A;  3A4R A;  4KHO A;  5HE1 A;  4PYZ A;  4HJK A;  1P3R A;  2K1F A;  2KJH B;  4EFO A;  1V5O A;  2KK8 A;  1P98 A;  2D9X A;  4G3X B;  3VUY A;  1K8R B;  3KUD B;  4ILH A;  4JKE A;  2YS5 A;  4NY0 A;  4PS3 A;  2D11 A;  2L76 A;  2IYB A;  2MBQ A;  4MJS B;  4IWP A;  3ZNG C;  3PTF C;  5G2N A;  1XT9 B;  1QQG A;  3LDZ E;  2N9X A;  4I6N B;  4HB4 B;  4Z2N A;  1GG3 A;  5E6N A;  4BOZ B;  2J0J A;  4XC2 A;  5G55 A;  2YS3 A;  3W1S A;  2K8H A;  2FCS A;  2IBI B;  5L83 A;  2BPS A;  3WAM A;  3OLM D;  2YT0 A;  4W9D A;  4GMX B;  2MW5 A;  4GZU A;  2RQ1 A;  3UIO B;  2DYB A;  3R7Q A;  4TQ0 A;  1DIK A;  4BBN C;  2EMS A;  2EKE C;  2MLB A;  3A33 B;  1YD8 U;  1P1A A;  1V61 A;  3ODX A;  2NVU I;  4IWO A;  4K2O A;  1BAK A;  4BKG A;  2GOW A;  2KN5 A;  3EFU A;  2ASQ A;  3B1L X;  1Y5O A;  1IRS A;  4WWN A;  1TJ6 A;  5AZG A;  2DX1 A;  2KDE B;  1QC6 A;  3BY4 B;  5HKH A;  3DBH I;  4HLE A;  3JSV B;  2LG1 A;  4JK8 A;  4D0N B;  2AEH A;  3SDL C;  4KHA A;  3RZW C;  2ELB A;  3A98 B;  2BYF A;  3RCZ A;  4FLH A;  4TQ1 A;  3EC8 A;  4ASW C;  2NPT A;  4WVF B;  1ZSQ A;  2Q13 A;  2P8V A;  2L0T A;  2N9E B;  3SU8 X;  5J18 A;  5C23 A;  4B9K A;  4HB3 B;  2Z0P A;  3ZTC A;  2ZVN A;  1NBF C;  2KJ6 A;  4G0N B;  2PE9 A;  2CHZ A;  2KC2 A;  2LZ6 A;  3VHT C;  1OTR B;  1TBE A;  2Z0D B;  3VIA A;  2MWS B;  5HE2 A;  1PMS A;  4WJ7 A;  1UEL A;  3A8P A;  2WYQ A;  2EMT A;  4HCN B;  4BBK A;  4FN2 A;  3DVG X;  1NTI A;  2JXX A;  4NQK E;  2MBB B;  2ZCB A;  4OVU A;  4ANU A;  1LQB A;  3JYU A;  2D10 A;  5D94 A;  4URK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...