3IVFA

Crystal structure of the talin head ferm domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
358
Chain Sequence
VALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Talin-1
publication title The Structure of the talin head reveals a novel extended conformation of the FERM domain
pubmed doi rcsb
source organism Mus musculus
total genus 101
structure length 358
sequence length 368
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3ivfA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ivfA04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA02
2DHIA 3VQIA 3ZNGC 1WXAA 4EJNA 2KTRB 2BKRB 5JHGA 1WMHB 3VOQA 1WH3A 3DVNU 2EKEC 2RPQA 4BOZB 2KDEB 1FGZA 2D10A 3NS8A 3O96A 3M1IB 1U2BA 3RZWC 1WI1A 3APDA 2EMSA 2KJ6A 2IO2B 3TBLD 3V5WA 2GBRA 2K00A 1UPQA 1LW3A 4WJOA 2AEHA 2CY4A 1MIZB 2FAZA 4MGKE 3A8PA 3A4SC 1ZC4B 2I1KA 3FSSA 1DDMA 2RGFA 4EZLA 3U30A 1N3HA 2XQNM 4Z2MB 4MJSB 1Z87A 1WJ6A 5GMVA 2LWPA 2UZSA 2WYQA 4DHZE 5CLLB 2LOXA 4W9HA 3GOEA 2DYNA 5AZGA 3H9DA 2ADZA 5L81A 1S3SG 2DYOA 4TUUA 3EPYA 1XD3B 2UZRA 3L13A 2Z0EB 2ZNVC 4PS3A 4KAXB 1WIAA 3T9LA 1TZ1A 2FNJB 1PFJA 5CTRC 2J59M 2LUEA 3N32A 5AEKB 2N4FA 4NNJB 2YT0A 3IG3A 5C6RA 2KD0A 2KQ7A 3QC8B 5LXIB 5LLIA 4TQ0A 1FGYA 2O6VD 3SYXA 4BFRA 2ZNVB 2FIFA 1V5TA 3PSEB 2I5CA 3H7PA 4GIVA 3RZFA 2NBVB 4MGZE 3S2AA 4A6FB 2WH5A 4GSWA 3ZNID 2O2VB 3EC8A 4CO7A 2N7DA 4IG7B 2NPTB 2MX2A 4M8MA 1WXSA 1I42A 4K17A 4JIOU 2RUKB 4K2OA 2GOWA 1UH6A 4DDGD 2OQBA 2K25A 2CR5A 1E5WA 3WALA 2ZEQA 3NOBA 1TJ6A 2XK5A 1W1DA 1J0GA 1TTNA 3HK0A 2KHWB 4NQKE 4I6LB 4HAVB 3M3JA 3BJIA 3R66C 2E2XA 4G3XB 2LKOA 3R3MA 2B3AA 2G4DB 4F7HA 4II3B 1WMHA 5D3XA 1EUVB 2L7RA 3KSYA 1DDVA 4F7UP 4K1RB 3MHSD 2CKHB 2KX3A 1KLVA 1WG7A 4E74A 1WGRA 3VTWA 3FP5A 4HAWB 1HB6A 3K9OB 2BCJA 4DDID 2FIDA 4DBBA 5C16A 1RAXA 2MWNB 2RNRB 2LZ6A 1WX9A 4DHJB 5TR5A 3ZTDA 5D6JB 4BBNC 1X11A 4ZRJA 2DHKA 2L0FA 5DH9B 3WAMA 4MJSA 2NVUI 1P5TA 3ZW3A 3IVFA 5GOWB 5LONB 1WXMA 2KANA 2A5UA 2YSZA 4HDOA 2ELAA 4WWPA 2FUHB 4ZDVA 3P6AA 3CXBB 3PEGA 2LXAA 5J3TA 3DXCA 4ANWA 2ROVA 3ZRCA 1UNPA 3R7QA 1UGMA 5J17A 3PTFC 5D3VA 2L76A 3MPXA 5JLJB 4F8CB 2UWQA 1OGWA 5L95C 4X57B 1QQGA 4EMOA 2DFKA 2MBBB 2KCJA 1P0RA 2FCNA 3WIMA 2P8VA 3DXDA 2QKMA 4DBGA 5C5BB 4J6IA 4KDLB 5FI1A 4W9LA 2NBUA 4B6WA 5E6NA 3TFMA 3HQCA 1WF9A 2KLGA 5DCNA 1WGDA 4ZYNA 4A6FA 2N7EA 2D9YA 2KWUB 1K5DB 1GG3A 3QAQA 1NI2A 2O2VA 1E8WA 2FJ9A 1MKEA 3PVLA 2NPTA 4MGYE 1IRSA 2C5LC 3QA8A 1TGZB 2K39A 1BAKA 3L08A 4A20A 1U29A 4NY0A 2MDXA 1YIWA 4KV2A 2PJHA 3W1SC 2DN6A 1U27A 2AYOB 1B55A 3PREA 1TQZA 3L54A 3PS6A 1V5PA 3PG7A 1UELA 1NTYA 3ZDMC 2I1JA 1FAOA 1UNRA 3NHEB 1BTKA 2O6VB 3QK0A 1LM8B 1XT9B 3AU4A 1YQBA 3V6EB 2DTCA 1WGUA 1WM2A 1ZM0A 1X05A 2K2UA 1ISNA 1X1FA 2JT4B 1MK9B 1DROA 2KFKB 2LGXA 2J0KA 3ONSA 5C23A 3QWZB 4WWNA 2M1MA 2K6DB 2DAFA 2BGFA 4RM8A 1E8XA 4W9CA 1OTRB 3F5RA 2FCSA 2KXJA 1EGXA 2KDBA 5DI9B 3D8EA 3H1UA 4P7IA 4B9KA 4IAPA 3ZUNA 3QHTA 2Z0PA 2M4NA 2CRFA 2COCA 3RCZA 4WSFA 3H7PB 1NVLA 2GBJA 2WWZA 3W1YA 2J7QB 4FN2A 3R7RA 2D9ZA 1V49A 3ECIA 4ICVA 5G2NA 1OQYA 4EZKA 2BPSA 2KN5A 1K5GB 4WWOA 2M17A 1GUAB 3RD2A 1KOTA 5JP4A 3QJZA 2XEWA 1YJ1A 5DPTA 1RLFA 3FLVA 1WRDB 4XC2A 2DZIA 1A5RA 5HKHA 2MSED 1E7VA 4ANXA 1BWNA 3DVNV 2LULA 2COPA 3VIAA 4NJ6A 5KHQA 4HB4B 4EOYA 2C9WB 1J8CA 3KYCD 1W1HA 3WA0A 3KW5B 3M63B 1KJTA 1OY2A 1U5DA 1NTVA 1ZGUB 2COAA 2JUOA 2DAJA 1OEYJ 3ZTCA 1DDWA 2HD5B 2KQSA 1P3RA 4XX5A 5C5BA 3VUXA 2YS1A 3IBEA 2HTHA 5D94A 4LJOB 1I35A 4JL9A 3RUIB 1C3TA 4N9F4 4TKNA 2BKFA 4W9DA 3L10B 3X0WA 1UNQA 2N9XA 2NZ8B 3V61A 3GYPA 2YS3A 2DX1A 1KZ7A 3BY4B 1E8ZA 4W9EA 2LBBA 2MQJA 2D4QA 1PLSA 5KHOA 4ANUA 3PV1A 2P0HA 4HLEA 1UPRA 1U5EA 3VTUA 2G4SA 3P2BA 1I7AA 4BVUC 1WX7A 4W9GA 2D11A 2ZPNA 4RMAA 3X23A 1FXTB 2AL3A 4HAZB 2JY6A 5DPWA 3M95A 1WY8A 1UD7A 2ZCBA 1MIXA 2O6VA 4L6EA 4I6PA 1SGHA 3D8FA 4CHJA 4OVUA 5DPSA 1YX6B 4HAXB 3DBSA 2L00B 1J19A 2PE6B 2X18A 4MSMB 2BF8B 2KFKA 3W1SA 2D2QA 4KSKC 2LJ5A 3ZNHB 3TJPA 2MCNB 4WQOB 3DBRI 1MK7B 3ZO5B 1E8YA 3CSTA 4HPLB 3OLMD 1ZKHA 3D8DA 4FJZA 2YLMA 4IWOA 1LQBA 2GCJA 2V1YA 4NSWA 3IFWB 4HVBA 4WAAA 4NJ7A 4C0AA 3V62A 1V6EA 4PYZA 4AJWA 2N23A 3NSUA 2LI5A 4EEWA 2DLWA 3SNHA 2JXXA 2ELBA 1R4NI 5C1ZA 3TO1A 1C1YB 4E3CA 1FOEA 3B0AA 1PQSA 2IY1B 3LJ3A 3OAWA 3A4RA 4YL8A 4HB3B 2XBBC 2DZJA 3PRPB 4KSLC 4NQLB 2ZJDA 3KRXA 4HXDA 2KMCA 2M8SA 3PRMB 3SUZA 2IY0B 3V6CB 1HE8A 3VFKA 1TXDA 1BT0A 1YD8U 5J3YA 1V5MA 2RLOA 1DBHA 1VCBA 1D3ZA 2DX5A 3ODOA 3AXCA 5DPRA 5CHWA 3L16A 5DHFB 4HK2A 4IOYX 3T06A 1ACAA 2A4ZA 1FHWA 5IAAC 2ZVNA 1OQNA 1P6SA 5D7GA 4HAYB 3WAPA 2L3ZA 1XR0B 1R4MI 4Z2NA 2MBHA 2IZVB 4AJYB 3ULBA 2JP2A 2DZKA 3KYDD 1OMWA 3O65B 4IWPA 4FBJB 1W1GA 2WX0A 3ODWA 4K81A 3MTNB 2JRIB 4K7UA 1Y5OA 5HE2A 1ZSQA 5CHVC 3CMMB 3Q3FA 2CB8A 5D27A 1ZW7A 4HDQA 3DBLI 2FCMA 2RD0A 3CIKA 2YS5A 3KY9A 5AZFA 4EZJA 3A1QA 1WGQA 4G0NB 2MBOA 4G50A 3ZRFA 2IO1B 2MW5A 3NY5A 2IO3B 4DXAB 4MELA 4F7GA 3L0WB 3F0WA 2K1FA 3QIJA 3JSVA 2LGYA 3SHQA 2QHOA 2J0MA 4ZRKA 3WANA 3JW0X 4KZCA 2ZCCA 4A6KA 1CMXB 4HHVA 3EFUA 4BKGA 3KUZA 1V2YA 2D07B 1WGYA 2GS0A 1XODA 4WJPA 4CHKA 1WJMA 2LVOA 1WGGA 1H4RA 2NBWB 4LDTD 1GC6A 2FDQA 4DX90 1WM3A 2VSZA 3PZDA 2MA9B 3GYOA 3UQAA 4GXBA 2CHZA 3KH0A 1V86A 4BBKA 3ENEA 3KZ1A 3SD5A 3HW2B 1AQCA 2HTHB 1QZEA 2JZZA 1IYFA 3DCGA 5KQ4A 4PS8A 2EC1A 1WXVA 2Y5BB 4MK0A 2MRPA 4F1SA 2KKCA 5D3WA 4JQWC 3UQBA 1I2HA 2Y8FA 3PSCA 2IYDB 2D9XA 4GDLB 3U7DA 1KZGA 2V4LA 2YT1A 1KI1B 5LOPB 1WYWB 5KCVA 2MBQA 4II2B 2JRHA 2OJRA 4GMXB 2KFJA 2LRWA 4W9IA 4NAWA 3A9KB 1Y19B 2W2XD 4AUQC 2LXCA 2WX1A 3NZSA 2M38A 1WJUA 2D3GA 1LB1A 2RR9A 4CHMA 2N9EB 3DBHI 4W9KA 1EF5A 4KHOA 1UEFA 5HE0A 2HJ8A 2GJYA 3PRZA 1V5UA 2JZ3B 2N1VA 1GC7A 4OVVA 4GN1A 3RCPA 4GB9A 2VKIA 2CU1A 1P3QU 4NPNA 4BOSC 4M8NA 2K8BA 4HJKA 4E71A 1FHOA 2MP2B 2KC2A 1J0WA 2P0DA 2IO0B 1VD2A 2H7DA 2NMBA 2VRRB 4D0NB 2C7NB 2L8JA 3SDLC 1UZXB 1XQQA 1WR6E 4IWQA 1Q0WB 2EJ8A 3T8MA 1EAZA 3PVUA 1L7YA 3ML8A 5FR6A 1V61A 2MFQA 2LVPA 2OOBB 4YONA 4IW0A 4DHZB 3PP2A 4XWXA 1OEYA 1U4AA 3AJ4A 2W9NA 3TCAA 3VUYA 4BBNF 2LOZA 1IPGA 2DKQA 4LJPB 3JYUA 1M7RA 3N30A 3PT2B 5JHAA 1P1AA 1H10A 2PZ1A 3DVGY 2KWCA 4MM3A 2COFA 4HAUB 1X1GA 3WAOA 1FB8A 4TYZA 2DYBA 4B95A 4K2PA 3A9JA 3OANA 2DX5B 3GZNI 3PPAA 5CLQB 3MJWA 4MSQB 3RT3B 2DHZA 2KZRA 3UIOB 4AP4C 2GMIC 3ML4A 3AULA 2NS5A 5EDSA 2G3QB 2KMAA 2Z0DB 2CAYA 3ZVVA 2KLCA 2LG1A 3TW1A 4A3OA 2UVMA 3DVGX 1AWEA 2N1WA 2IFSA 3HM3A 2KGXB 3FEHA 4A6HA 4RM9A 4DWFA 2KX0A 2FJLA 4FJYA 1MAIA 2KUPA 1RRPB 2OTXA 2V3SA 1HBKA 3KVFB 3UIPB 1WE6A 2DA0A 4KVGB 1T0YA 4GDLA 3APCA 3D32A 3A33B 1WR1A 2MKRA 3ULCA 2UYZB 4BKTA 2C7MB 3WYFB 1XX0A 2KJRA 1K8RB 1IP9A 3A1QB 4LDTB 2AL6A 3KUCB 2K6QA 3A9KA 2ZVOA 3CSFA 2M0XA 3VAWA 3JSVB 4KIKA 5C79A 1GNUA 4DX8A 3QBVB 4MY6A 1BTNA 3DOWA 2JPHA 3UZTA 4K7WA 5L83A 5J2RA 2LYDA 5IA7A 1WI0A 2AWTA 3Q3JA 3OJ3A 2RSUA 1PMSA 3VH3B 4ZRIA 2EMTA 1EVHA 4ASWC 2KVRA 2W2XC 2NCNA 1ZVRA 1F9JA 1WZ0A 1E90A 2YF0A 2YVCA 4URKA 5J18A 2R2QA 1V89A 1WVHA 2Z59B 5DIFB 4ICUA 2MP2A 3B08A 4HWIB 1WJ4A 3H7SA 2HE7A 2LGDA 2REXA 2KNBA 3DQVA 4PQ0A 4GDKA 3SO6A 3PLVA 2R09A 5IJMA 2FCQA 2IYBA 4DK5A 2Z0QA 4TQ1A 2CY5A 2VRWB 1V9JA 1M7EA 1RFAA 2ASQA 2ZZPB 4KZ0A 1XKEA 3KUDB 1U5GA 4IC7B 1UBQA 3VTVA 3U8ZA 4Y94A 1AARA 1NU2A 2IBIB 2M14A 2R0DA 1SIFA 1X86A 3TVVA 1V5OA 4EUTA 2KO3A 1V88A 1H8CA 1L2NA 2ABDA 1WGHA 5D3YA 2PEAA 2C7HA 1XCGA 2KJHB 3N7CA 1KM7A 4NAWB 2N0YA 2C60A 1Q67A 3IHPC 4IFSA 2L0TA 2DKPA 3LDZE 1X1MA 3QX1A 2BWFA 3ODXA 2LD9A 5J3QA 1RJ2A 5EFXA 3JVZX 3PVWA 2BYEA 4B6HA 5FI0A 2H7EA 2KDFB 1HB8A 4AOFA 2KTRA 2CS4A 4HB2B 3ALBA 3TIXA 2MLBA 4PS7A 2GBMA 5JHBA 2R2OA 4IM0A 3QQ8B 5BO4B 3VXWA 2RSGA 2K2JA 4A5KA 2D9WA 4TV3A 3M62B 4FA6A 4FADA 4HCNB 4XZ4A 4EKUA 3G9WA 4MEMA 2JF5A 2KWVB 4WJQA 2I5FA 2BWES 5JHHA 1JRUA 5KQ1A 1NTIA 5DHAB 3MDBC 2DYMA 4CYEA 3SU8X 4BKSA 3A9JB 4ANVA 4IM3A 3HHMA 3A98B 2KDIA 3HIZA 1DYNA 2RGNB 2ROZB 3PLUA 1Q5WB 3QWMA 3A8QA 3ML9A 3EHVA 2ZPYA 1MG8A 2L2IA 3VUWA 1WE7A 4I6NB 4GPTB 5JH5C 4FJVB 5HE3A 2DHJA 2Y7BA 5CX3A 3TL5A 4MGIE 4HATB 4G11A 3BINA 1LFDA 3OJ4B 1S1QB 1Z5SB 4K7SA 3V60A 3ZKJC 4BKSD 1WZ3A 2CHWA 4PYUA 3AI5A 4FLHA 1V80A 3CF6E 2KOXA 4FHKA 5D2MB 2Y8GA 2J0JA 3KRWA 3APFA 1EF1A 4IUMB 1GJZA 4LCDE 4MH0E 1RRBA 4W9JA 1SHCA 3LJUX 1E7UA 1LXDA 3UINB 5AZHA 1G6JA 4GMVA 3DDCB 2GBNA 3QCAA 2Z0OA 4HPMB 4FULA 4W9FA 4KIKB 3AU5A 2WDTB 1EO6A 4GU2A 5HE1A 1ZC3B 4WJ7A 4F7ZA 1XD4A 4GZUA 3HM6X 2G45B 2BYFA 3L17A 2KK8A 2GBKA 3H6NA 2Q13A 2P0FA 4M0WB 1ST7A 3PHWB 3TMPB 1WX8A 2LASA 3UGBB 1FHXA 3ZLZA 3P7ZA 3K9PB 3I3TB 2DENB 4HCPB 4IM2A 2GCLA 2PPHA 3PHXB 3DXEA 3VHTC 4A3PA 5LXHA 4MDKE 4MT7A 1NDDA 2L05A 3ZDTA 1UBIA 3FM8C 3N3KB 2RQ1A 2YRYA 4JGHB 5E6OA 2L1CA 2BYVE 1WJ1A 2DZMA 2MWSB 1P9DU 4AWJA 4GDKB 2K8HA 1SE9A 1Q1OA 1NBFC 1TBEA 3B1LX 2MBEA 2HRJA 3NZUA 1P98A 1WFYA 2LVQA 4EFOA 1Z2MA 3UF8A 4GGQA 2RVBB 4PNKA 4GOCA 1QC6A 1U5FA 2CQUA 2JWZA 2QKLA 4KHAA 5JZEB 4H8SA 1M94A 3RULA 3SV1A 3ZVRA 2KTFA 3VDZA 4FHJA 2K8CA 1V81A 3C0RB 3EECA 2DYQA 2D9VA 1YX5B 2CHXA 3QARA 5CHFA 4JLCA 4WJNA 3RYTA 1WJNA 2CODA 3PGEA 4KHBB 2KC1A 3VVWB 2LRUA 4DHJD 2N9PC 2JVCA 1Y8RC 2PE9A 4HB0B 4KDIC 3DPDA 3ZIMA 3ZNZB 3VH4B 4WVFB 5G55A 2G35A 2V76A 2XK5B 2NR2A 5E6PA 2W2WA 1MPHA
chains in the Genus database with same CATH superfamily
2WS3B 1KFYB 2DHIA 2PKOA 1XF5L 3VQIA 3ZNGC 1WXAA 4EJNA 1UF0A 4M01A 4ZRQA 1PGBA 2KTRB 2KWDA 2BKRB 5JHGA 1WMHB 3VOQA 1WH3A 3DVNU 3ZYYX 1IBXB 2E3TA 2EKEC 2WU5B 2RPQA 4BOZB 2KDEB 1FGZA 2D10A 3NS8A 3AE4B 2BBCA 3O96A 3M1IB 1U2BA 2PVOD 3RZWC 1FCLA 1WI1A 3APDA 2EMSA 2Z14A 2KJ6A 2IO2B 3TBLD 3V5WA 2GBRA 2K00A 1UPQA 1LW3A 2NTSA 4WJOA 1HZ5A 2AEHA 4LNNA 2CY4A 2OEDA 2RDGA 1MIZB 2FAZA 4MGKE 3A8PA 3A4SC 1ZC4B 2I1KA 3FSSA 1FMAD 1DDMA 2RGFA 4EZLA 2DLBA 4H2AA 4D2KA 3U30A 2IJ0A 1N3HA 3FKYA 2W3RA 2XQNM 4Z2MB 4MJSB 3N1XC 1Z87A 1WJ6A 5I2MA 5GMVA 4JK7A 5IO9A 2LWPA 5MPOA 4YXDB 1AW7A 2UZSA 2WYQA 4DHZE 3P4RB 5CLLB 2WDVB 4XWTA 2LOXA 4M0WA 3MP9A 4W9HA 3GOEA 1SE3A 1B9RA 2DYNA 5AZGA 5H8YE 3H9DA 2ADZA 1T0RC 3BVMA 5L81A 1S3SG 2DYOA 4TUUA 2NTTA 3EPYA 1JWBD 1XD3B 1K52A 2UZRA 3L13A 2Z0EB 2ZNVC 2D5GA 4PS3A 4KAXB 3GB1A 1WIAA 3T9LA 1TZ1A 2X38A 3BIID 2FNJB 1PFJA 2JWUA 5CTRC 2J59M 4YSZB 1PFDA 3BVZA 1MHHE 2KDMA 2LUEA 3N32A 5AEKB 1FNVA 2N4FA 3AEAB 2L32A 4NNJB 1FNWA 2YT0A 3KQ4A 3NVVA 2FBWB 3IG3A 1TIFA 4PT5A 5C6RA 2KD0A 2KQ7A 3QC8B 5LXIB 1JWUD 5LLIA 4TQ0A 1FGYA 2O6VD 1GPXA 3SYXA 3I57A 4BFRA 2ZNVB 2FIFA 1YNTE 1V5TA 4C00A 2INCC 1HXYD 4ARCA 3PSEB 2I5CA 3H7PA 3FILB 3V3XA 4GIVA 3RZFA 3AN1A 2NBVB 1IGCA 4C56C 4MGZE 3DBRB 3S2AA 4A6FB 2N0SB 2WH5A 1TS5A 3TSSA 3R2TA 1TKEA 4GSWA 2K8EA 3NWAA 4JKFA 1QILA 1EU3A 3ZNID 2O2VB 3EC8A 4CO7A 2N7DA 3NWDA 4IG7B 1RWSA 2NPTB 2MX2A 3DHIC 3EUB2 4M8MA 1QF6A 1WXSA 1I42A 4K17A 4JIOU 2RUKB 4RH6A 2ZW1A 4K2OA 3Q8EA 2GOWA 2R61A 3I5JC 1UH6A 2QEJC 4DDGD 4RNAA 4KHBA 2OQBA 2K25A 1R4NB 4WIPA 5HI1A 1UWMA 3RN9C 1C78A 3HIEA 1RFKA 2CR5A 4R3DA 1E5WA 3P42A 4OVZA 3WALA 2B76B 2WXFA 1QOGA 2ZEQA 4HSIA 3NOBA 2WXPA 1TJ6A 2XK5A 1W1DA 1J0GA 1TTNA 4OZBA 4RGNA 3HK0A 2KHWB 4NQKE 4I6LB 4QJ3B 4HAVB 3M3JA 1HEZE 3BJIA 3R66C 2BVCA 2E2XA 4G3XB 2LKOA 3R3MA 4A8XC 2B3AA 2G4DB 1E7PB 2L52A 4F7HA 4II3B 1WMHA 5D3XA 4US9A 1EUVB 2L7RA 4YWGG 3KSYA 3AV8A 3HRDD 1DDVA 4F7UP 1N62A 4K1RB 3MHSD 1FFVA 2CKHB 2KX3A 3EGRA 1WG7A 1I4RA 1KLVA 4E74A 1WGRA 2KACA 3VTWA 3FP5A 4HAWB 2IGHA 1HB6A 3K9OB 1UNSA 2BCJA 2YEPB 2W54A 2MJ3A 4DDID 4QJ4B 2FIDA 2M56B 2RDHA 4DBBA 5C16A 1RAXA 2MWNB 3MJ5A 1R4MB 1WSPA 2RNRB 2WXMA 1JALA 2LZ6A 2PW9A 1WX9A 4XDDA 2MEKA 4DHJB 5TR5A 3ZTDA 1D5XC 3IXSA 1DGJA 2H88B 5D6JB 4BBNC 4GNKB 2LMCA 1X11A 3N20C 4ZRJA 1FRRA 2DHKA 2L0FA 5DH9B 3WAMA 4MJSA 2NVUI 1P5TA 3ZW3A 3IVFA 5GOWB 5LONB 3WCQA 1WXMA 2KANA 3P1MA 2A5UA 1EWYC 1DYQA 3P4SB 2YSZA 4HDOA 2ELAA 4WWPA 2YT2A 2FUHB 4ZDVA 3P6AA 3CXBB 3PEGA 3AE6B 3DBLB 2LXAA 5J3TA 4ILGB 3DXCA 4ANWA 2ROVA 3ZRCA 1UNPA 3R7QA 5HFYA 2LHDA 1UGMA 5J17A 1TS2A 2XN9C 3AE5B 3DWGC 4JKHA 3PTFC 5D3VA 1Y56A 1L0VB 2QILA 2L76A 3MPXA 5JLJB 3ZJVA 4F8CB 2UWQA 1OGWA 2MJDA 2LEKA 1ZUD2 5L95C 5I4DA 3AE7B 4X57B 4YSXB 4RF0A 1QQGA 4OSNA 3TEXA 4OT1A 4EMOA 2DFKA 2PMVA 4USAA 4WAFA 3UI3A 2MBBB 1KLUD 4IOIE 2KCJA 1P0RA 1HTOA 2FCNA 3Q69A 2QC8A 2P8VA 3DXDA 3WIMA 2QKMA 2I38A 5EE1A 5C5BB 4DBGA 4J6IA 4KDLB 5FI1A 1FEHA 4W9LA 4YTNB 2NBUA 4B6WA 4ZYSA 3FILA 5E6NA 3TFMA 2OJWA 3HQCA 1WF9A 3NG0A 2KLGA 3GE8C 2NBVA 5DCNA 2BS2B 1WGDA 1JWSD 4A6FA 1IGDA 4ZYNA 1YN3A 2KQ4X 4LNIA 2N7EA 3AEFB 3Q8CA 2D9YA 2KWUB 1T0SC 4A9AA 1K5DB 2SEBD 1GG3A 3QAQA 1NI2A 2O2VA 1E8WA 2FJ9A 1MKEA 3PVLA 3SBTA 2NPTA 4MGYE 1GGOA 1TY0A 3RMKC 2DBYA 1IRSA 2C5LC 3QA8A 5T8IA 1TGZB 2K39A 1BAKA 3L08A 4A20A 2R2YA 1U29A 4NY0A 2MDXA 1YIWA 4KV2A 2PJHA 4LTUA 4Q2JA 3W1SC 1XEEA 1FFUA 2DN6A 1SJHD 1U27A 4A55A 2AYOB 1B55A 3Q8FA 3PREA 3AEDB 1TQZA 3J9CA 3L54A 3PS6A 1V5PA 3PG7A 1UELA 1NTYA 3ZDMC 3HVZA 2I1JA 1FAOA 3IAS1 1KRHA 1UNRA 1SE4A 3NHEB 1FNUA 1BTKA 1QKZA 2H89B 2O6VB 3QK0A 2V0GA 4P6VF 1LM8B 3L4PA 1JROA 1XT9B 3AU4A 1HA5A 1YQBA 3V6EB 2DTCA 1WGUA 1WM2A 4OZCA 1ZM0A 1X05A 2K2UA 1ISNA 1X1FA 2JT4B 1MK9B 3ZGZA 1DROA 2KFKB 3E9SA 2LGXA 3PO0A 2J0KA 2V3NA 3ONSA 5IN7A 3Q6BA 5C23A 3QWZB 2QCZA 4WWNA 2M1MA 2KT7A 4JK9A 2K6DB 2DAFA 2BGFA 4RM8A 1E8XA 1OTRB 3F5RA 4W9CA 2FCSA 2KXJA 1QQRA 3MC8A 5HG2A 2V3PA 1EGXA 2KDBA 2R82A 5DI9B 1LO5D 4LNKA 3AEBB 3D8EA 3H1UA 3I63C 4P7IA 4B9KA 4IAPA 1F2RI 3ZUNA 3PZ8A 3ENBA 3QHTA 2Z0PA 2M4NA 2ZKMX 3DBHB 2CRFA 2COCA 3RCZA 1L5PA 4WSFA 3H7PB 1NVLA 2GBJA 2WWZA 5I2SA 3W1YA 5G5GA 2J7QB 3BZDB 4FN2A 5G5HA 3R7RA 2D9ZA 1V49A 3ECIA 4ICVA 5G2NA 4JPSA 4KX6B 1OQYA 4EZKA 2LHEA 2BPSA 3DHHC 5BMGA 2KN5A 3U2SC 1K5GB 4WWOA 2M17A 3MC9A 1VDVA 1GUAB 3RD2A 1KOTA 3VRBB 4N6EB 5JP4A 3QJZA 1I4XA 1JCKB 1ESFA 2XEWA 1YJ1A 5DPTA 2KR0A 1RLFA 3FLVA 1WRDB 4XC2A 2DZIA 1A5RA 5HKHA 1V97A 4JX1C 2MSED 1E7VA 1MHXA 4ANXA 1BWNA 3DVNV 3B9JA 1C9FA 2LULA 2COPA 3VIAA 4NJ6A 5KHQA 4HB4B 4EOYA 2C9WB 1J8CA 3KYCD 1W1HA 3WA0A 3KW5B 3M63B 1KJTA 1OY2A 4ILJA 1U5DA 4CQNA 1NTVA 1ZGUB 1ENFA 2COAA 2JUOA 2DAJA 4B0MA 1OEYJ 3ZTCA 1DDWA 2HD5B 3RPFC 2W3SA 2KQSA 1L0XB 1P3RA 4XX5A 5C5BA 3VUXA 3URYA 2YS1A 3IBEA 2HTHA 5D94A 4LJOB 1I35A 4JL9A 2JYTA 3RUIB 1F52A 1N60A 1C3TA 4N59A 4N9F4 4TKNA 2BKFA 4W9DA 2D3AA 3DCXA 3L10B 3X0WA 1FO4A 1UNQA 3PZ7A 2N9XA 2NZ8B 3V61A 3GYPA 2YS3A 2DX1A 1NI3A 1KZ7A 1I4HA 3BY4B 4QAYA 4QXAB 1E8ZA 1V1PA 4W9EA 1OQQA 2LBBA 2MQJA 2D4QA 1HTQA 1PLSA 3Q3OC 5KHOA 4ANUA 3PV1A 2P0HA 2RMMA 4C4VB 4HLEA 1UPRA 1XLOA 3ZQ4A 1U5EA 3VTUA 2G4SA 3P2BA 1I7AA 4JKBA 4BVUC 1WX7A 4W9GA 4YTMB 2D11A 3N1ZC 2ZPNA 4RMAA 1C79A 3X23A 1FXTB 2AL3A 3B77A 4AS1A 1DIKA 4HAZB 1LGRA 2JY6A 5DPWA 3M95A 4KKJA 1WY8A 1UD7A 2ZCBA 4BZAA 1MIXA 3TUOA 2O6VA 4L6EA 4I6PA 1SGHA 3D8FA 4CHJA 4OVUA 1JDEA 5DPSA 3VRAB 3BK2A 3SEBA 1YX6B 4HAXB 1L4DB 1N61A 1QOFA 5AUKA 3DBSA 2L00B 1J19A 4L23A 2PE6B 2X18A 4MSMB 2M0AA 2BF8B 1QOBA 2KFKA 3W1SA 1ZDVA 2D2QA 4KSKC 4C7ZA 2LJ5A 3ZNHB 1SJED 3TJPA 2JSVX 2MCNB 4WQOB 3DBRI 1MK7B 3ZO5B 1E8YA 3CSTA 1L6UA 4HPLB 3OLMD 1ZKHA 3D8DA 3TEYA 4FJZA 2YLMA 1SEBD 2JU6X 4IWOA 1LQBA 2GCJA 2GLSA 3W2DA 2V1YA 4NSWA 3IFWB 4HVBA 1YN5A 4WAAA 4NJ7A 4C0AA 4REZA 3V62A 1FXIA 1Q10A 4LNOA 1KC7A 1V6EA 2INNE 3EFCA 4PYZA 1AN8A 2N23A 2GRIA 4AJWA 2GB1A 1ET6A 3NSUA 2LI5A 2K9XA 2Z13A 4EEWA 2KAJA 2DLWA 3SNHA 3U4EG 2JXXA 2PTLA 2ELBA 1R4NI 4XGAB 5C1ZA 3TO1A 1C1YB 4HROA 4E3CA 1FOEA 4WURA 3B0AA 2AQ1B 2PVGC 1D4BA 1PQSA 1ROEA 2IY1B 1K51A 5EE3A 1UGJA 2WDQB 3LJ3A 3Q8BA 3OAWA 3A4RA 4P16A 1ZP0B 4YL8A 4HB3B 2XBBC 2BW2A 4RF1A 2DZJA 4BAXA 3PRPB 4KSLC 2QSDA 4NQLB 1MI0A 2ZJDA 2CU3A 3KRXA 4HXDA 2KMCA 2M8SA 3PRMB 3SUZA 2WXNA 2IY0B 3Q8AA 1HE8A 3V6CB 3VFKA 1TXDA 3W9CB 1BT0A 1YD8U 5J3YA 1V5MA 2RLOA 1DBHA 1E0ZA 1VCBA 1D3ZA 2DX5A 1T0QC 1VBHA 3ODOA 2N7JA 3AXCA 5DPRA 5CHWA 1N5XA 3L16A 1VZ6A 1EU4A 2HJ1A 5DHFB 4HK2A 4IOYX 3T06A 1ACAA 2A4ZA 3AM9A 1FHWA 4NAMA 3N9YC 5IAAC 3HSAA 2WXIA 2ZVNA 2QMTA 2VH2A 4A90A 1OQNA 1P6SA 1ZYIA 5D7GA 3KWLA 2WXLA 4HAYB 3WAPA 2L3ZA 1XR0B 1R4MI 3B2GA 3AE9B 4Z2NA 2MBHA 2IZVB 4AJYB 1TS4A 3ULBA 2JP2A 2DZKA 2MJEA 2LUMA 1V1OA 3KYDD 1OMWA 3O65B 3E66A 4IWPA 4FBJB 4C7YA 1W1GA 2WX0A 3ODWA 4ZOHC 4K81A 3MTNB 2JRIB 3B2FA 4K7UA 1Y5OA 5HE2A 1ZSQA 4YT0B 5CHVC 1NVID 1E6EB 3CMMB 1T6BX 3Q3FA 4C4VA 2CB8A 5D27A 1ZW7A 4HDQA 3DBLI 2FCMA 2JYEA 2RD0A 3ZXVA 3CIKA 4D6WA 2WLBA 2YS5A 3KY9A 5AZFA 1D5ZC 4EZJA 3A1QA 1B1ZA 4S0RA 5JXVA 3E9LA 1WGQA 4RGOS 5FK9C 4G0NB 2MBOA 4G50A 4MT5A 3ZRFA 2IO1B 1F0ZA 2MW5A 3NVZA 3NY5A 3O13A 2IO3B 4DXAB 4MELA 5TSSA 2WHIA 4F7GA 3L0WB 3F0WA 5BYSA 1C77A 2Z8LA 2K1FA 3QIJA 3JSVA 2LGYA 3SHQA 1JRPA 4OHJA 3LYYA 2BT6A 2QHOA 2J0MA 4ZRKA 4N58A 4EE2A 2JXTA 3C19A 3WANA 3JW0X 2INDC 4KZCA 2ZCCA 4A6KA 1CMXB 4HHVA 3EFUA 4BKGA 3KUZA 1V2YA 2D07B 1WGYA 3FAHA 2GS0A 1XODA 3C8YA 1T3QA 4WJPA 4CHKA 5AUIA 1WJMA 2LVOA 1WGGA 4M00A 1H4RA 2NBWB 1I4QA 1CK1A 4LDTD 1TY2A 1GC6A 2FDQA 1XCTL 4HKQA 3HVDA 4DX90 1WM3A 2AQ2B 2VSZA 3PZDA 2MA9B 3GYOA 5FKAC 3UQAA 1MVKA 1YN4A 3LB8C 1ZDXA 4PK1A 4GXBA 2EELA 2CHZA 3KH0A 2JX5A 1V86A 4BBKA 2WGSA 2ICIA 3ENEA 1KH0A 3KZ1A 3IAM1 4XYCA 2GI9A 2IGGA 3SD5A 1FPYA 3HW2B 1AQCA 1WWTA 2HTHB 1QZEA 3EA6A 2JZZA 1IYFA 3DCGA 5KQ4A 4PS8A 2EC1A 1TKYA 1WXVA 2JQRB 2Y5BB 4MK0A 2MRPA 4F1SA 2KKCA 5D3WA 4JQWC 5BYRA 3UQBA 1I2HA 3AB5A 1KBLA 2Y8FA 4GOUA 3PSCA 1VLBA 1V1PB 2IYDB 2D9XA 1EM7A 4GDLB 3U7DA 1SB3C 1DOIA 1KZGA 2WP9B 2V4LA 3R8BA 2YT1A 2J4XA 3ZJTA 3RNGC 4TSSA 1KI1B 1STEA 5LOPB 1WYWB 5KCVA 2MBQA 2BQQA 4II2B 2JRHA 2OJRA 4GMXB 2KFJA 2LRWA 2OHFA 4W9IA 4NAWA 3CWIA 4HEA1 3A9KB 1Y19B 2W2XD 2J42A 1L0YB 4AUQC 3T3OA 2LXCA 2TSSA 4DXGA 4ACFA 1KTKA 2WX1A 3Q2AC 3NZSA 4KGRA 3Q3NC 2M38A 1P7FA 1WJUA 3OG5A 2D3GA 1LB1A 5FR3A 2BYTA 1K53A 2RR9A 5EE9A 4CHMA 2N9EB 3DBHI 3E9OA 4W9KA 3ETRA 1EF5A 2KVZA 4KHOA 1UEFA 4CSQA 5HE0A 2HJ8A 2GJYA 2YEPF 1JWMD 3BWUD 3IT6B 4TMAB 3PRZA 2IPKD 4WWMA 1V5UA 3SBGA 2JZ3B 2N1VA 3NRZA 4XDCA 1GC7A 4OVVA 4GN1A 3RCPA 3FC4A 4GB9A 2VKIA 2CU1A 2L83A 2QIEB 1P3QU 4NPNA 4BOSC 4HKZE 4M8NA 2K8BA 5IP4D 4HJKA 4E71A 1FHOA 2MP2B 1SBBB 2KC2A 1J0WA 1QOAA 2P0DA 2IO0B 1ZE3D 1VD2A 2H7DA 2NMBA 2VRRB 2BB6A 4D0NB 1JW9D 2C7NB 2L8JA 2DIKA 3SDLC 1UZXB 1XQQA 1WR6E 2WXGA 4IWQA 2W55A 1Q0WB 2EJ8A 3T8MA 1EAZA 3DWMA 3PVUA 2KMMA 1FIQA 2J52A 4NJCA 2AX5A 1L7YA 3ML8A 5FR6A 2QDFA 1V61A 2MFQA 2LVPA 2OOBB 4YONA 4JWSC 4IW0A 4DHZB 3PP2A 3W5VB 3ZJUA 4XWXA 1OEYA 1U4AA 3AJ4A 2W9NA 3TCAA 3VUYA 4BBNF 1R7SA 2LOZA 1IPGA 2DKQA 4LJPB 2G9HD 3JYUA 1M7RA 2K22A 3N30A 3PT2B 5JHAA 1P1AA 4O1NA 1H10A 3R2IA 2PZ1A 3AE1B 2WNMA 5C3JB 3DVGY 2KWCA 1YJJA 4MM3A 2COFA 3U12A 4HAUB 3RNCC 1X1GA 3WAOA 1FD6A 1FB8A 1WGKA 4TYZA 2DYBA 4B95A 2IGDA 4K2PA 4JKAA 3A9JA 4JWUC 3OANA 2DX5B 1D5MC 3GZNI 3PPAA 3NJTA 3MFGA 4DQOC 5CLQB 1UWXA 1AYFA 3MJWA 3Q14C 1TKGA 4MSQB 3RT3B 2DHZA 2KZRA 4NZLB 3UIOB 3MC0B 4AP4C 2GMIC 3NVWA 1GAQB 3ML4A 2Z4DA 1EWCA 3AULA 2NS5A 5EDSA 2G3QB 2KMAA 2Z0DB 2CAYA 3ZVVA 4ILHA 2KLCA 3AMZA 3NS1A 2LG1A 2XNAC 3TW1A 4A3OA 1N6ZA 2N9LA 2UVMA 1SSNA 1V8CA 1YQ4B 3DVGX 4OW0A 1AWEA 2N1WA 2N9KA 2IFSA 3HM3A 3GZNB 2KGXB 3U52E 3FEHA 2EKIA 2V9HA 4A6HA 3Q3MC 2K49A 4WQMA 4RM9A 3ABVB 2Q5WD 2PLPA 4DWFA 2KX0A 2FJLA 4FJYA 1MAIA 2KUPA 1RRPB 2OTXA 2V3SA 1HBKA 2CJNA 2MH7A 1TZOA 3KVFB 3UIPB 1BUIC 1WE6A 1ZPSA 1NEKB 2DA0A 4KVGB 1T0YA 1XLQA 4GDLA 1VRAB 3APCA 3D32A 2Y3AA 3VR8B 3A33B 1XLPA 2Y5PA 1WR1A 1K50A 2WXHA 2MKRA 1HQRD 3ULCA 2UYZB 4BKTA 3AEGB 2C7MB 3WYFB 1XX0A 2KJRA 1MG4A 1K8RB 2ACZB 1IP9A 3A1QB 1YMHE 4LDTB 2AL6A 1ZXIA 3KUCB 4C80A 2JZPA 2K6QA 1WRIA 3AH7A 3A9KA 2ZVOA 3CSFA 1C4PA 3P63A 2J53A 2M0XA 3BYTB 3GE3C 4P1BC 2IDYA 3VAWA 3JSVB 4KIKA 1KF6B 5C79A 1GNUA 4DX8A 3QBVB 1J7CA 1VR9A 4MY6A 4DXFA 1P7EA 1BTNA 3DOWA 1DOYA 2JPHA 1FM0D 1MI1A 4ZRPA 3UZTA 4K7WA 5L83A 5J2RA 3A58A 2LYDA 5IA7A 1WI0A 2AWTA 3Q3JA 3OJ3A 2RSUA 2AQ3B 1PMSA 1GB1A 3VH3B 4ZRIA 2ON8A 2LJIA 2EMTA 1EVHA 4ASWC 2KVRA 4MH8A 2W2XC 2NCNA 1ZVRA 1F9JA 1WZ0A 1I7HA 1E90A 1N5WA 2YF0A 2YVCA 4ITKA 4L1BA 3MHZA 3AE2B 4URKA 1NYRA 5J18A 2D3CA 2R2QA 4IDIA 1XLNA 1SXTA 1V89A 3FVCA 1WVHA 2Z59B 5DIFB 1JMLA 4ICUA 4K3BA 5BMIA 2MP2A 1N63A 1CZPA 2WXJA 3B08A 4WH4A 4HWIB 1J7BA 4LK0M 5LG4B 1WJ4A 3H7SA 3OHMB 2L1AA 1PGAA 4XE0A 2WXOA 2HE7A 2LGDA 2REXA 3U7ZA 3RNAC 1YQ3B 1RYJA 2KNBA 3DQVA 2HTME 1XXGA 4PQ0A 4GDKA 3SO6A 3PLVA 2R09A 5IJMA 2FCQA 2IYBA 4DK5A 2Z0QA 3BYYB 1ACCA 4TQ1A 2CY5A 2VRWB 1V9JA 1M7EA 1RFAA 1D6EC 2WXRA 2ASQA 1TYGB 2ZZPB 4KZ0A 1XKEA 1BMLC 4L2YA 3KUDB 1U5GA 4IC7B 3V05A 1UBQA 3VTVA 3U8ZA 4Y94A 2CJOA 1AARA 5JVLA 1NU2A 2IBIB 2M14A 1OFFA 2R0DA 1SIFA 1X86A 3TVVA 1V5OA 4EUTA 2WXQA 2KO3A 5D3IB 4ARIA 1V88A 4DIXA 1H8CA 1L2NA 2ABDA 1WGHA 5D3YA 2PEAA 1OQRA 2C7HA 2SAKA 1XCGA 4J3OD 1GOZA 2VZKD 2KJHB 3N7CA 1KM7A 4IKGA 4NAWB 2N0YA 2C60A 1Q67A 3IHPC 4LLGM 4IFSA 2L0TA 2DKPA 2FE8A 2G1EA 1J7AA 4P1CC 3LDZE 1X1MA 3QX1A 4HPPA 2BWFA 3ODXA 4GLSC 2LD9A 1CJEA 3AE8B 5J3QA 1L6VA 1RJ2A 1NYQA 5EFXA 3JVZX 3T3NA 3P4QB 3PVWA 2BYEA 4B6HA 5FI0A 4YTPB 1C4CA 2LGSA 2H7EA 2BB5A 2KDFB 1YJIA 1HB8A 1L4ZB 1VBGA 2DWQA 4HJGE 3TEWA 4AOFA 2KTRA 1VZ7A 2M19A 2K5PA 2CS4A 4HB2B 1IBXA 4MACA 3ALBA 5BYQA 3TIXA 1T77A 2HDEA 3NWFA 2MLBA 4PS7A 2GBMA 1E10A 5JHBA 2R2OA 4IM0A 2UU7A 3HUIA 3QQ8B 5BO4B 3VXWA 3DHGC 2RSGA 2K2JA 3SFEB 4A6QA 4A5KA 2D9WA 3KWVA 4TV3A 4RFBA 4ZHOA 3M62B 3NVYA 2MHJA 2VH1A 4AQ7A 5IRSA 4FA6A 4FADA 3SR6A 4HCNB 3RNFC 4XZ4A 1VZ8A 4EKUA 3P4PB 4JKCA 1MJDA 3G9WA 3ZXRA 4JK8A 4MEMA 2JF5A 3RI7C 2KWVB 2ONQA 4WJQA 3E56A 4JE3B 2I5FA 1JWAD 1UUPA 2BWES 2LGIA 5JHHA 1CQVA 1PUTA 1JRUA 5KQ1A 1NTIA 5DHAB 2FJUB 3RFZB 3MDBC 1I4PA 2KIEA 2DYMA 1C76A 4CYEA 4MM3B 3SU8X 3LXFA 3SFDB 2RRFA 3A9JB 4BKSA 4ANVA 4IM3A 3HHMA 4JKGB 3A98B 1BXTA 2KDIA 5HHDG 3HIZA 1DYNA 2I2YA 2RGNB 2ROZB 3PLUA 1Q5WB 3QWMA 3A8QA 1M4VA 2RPVA 5M4YB 3ML9A 3EHVA 4UDUC 2Z59A 2ZPYA 1SF0A 1MG8A 2BS3B 1MFWA 2L2IA 3VUWA 1WE7A 4I6NB 5IKCM 3AEEB 1WYGA 4GPTB 5JH5C 2KIGA 3NZ3A 4FJVB 1WXQA 5HE3A 4ZHPA 2DHJA 2Y7BA 5CX3A 3TL5A 4MGIE 4HATB 1MPEA 2DNFA 4G11A 3BINA 1DOXA 1LFDA 1YOVB 2E6XA 3OJ4B 1S1QB 1Z5SB 4K7SA 3V60A 3ZKJC 4BKSD 1WZ3A 2CHWA 1TT5B 4PYUA 1F1HA 3AI5A 4FLHA 2ZW0A 1V80A 4OZAA 4L1RA 1HZ6A 2BTEA 3CF6E 2KOXA 4FHKA 5D2MB 2Y8GA 2J0JA 1FCCC 4RGTA 1TJEA 3KRWA 3APFA 1EF1A 4IUMB 1GJZA 2KYWA 1IUEA 3H8HA 4LCDE 3E9PA 4MH0E 3BK1A 1RRBA 4W9JA 1RM6C 5LNK1 1SHCA 3LJUX 1E7UA 5H92C 1LXDA 1I4GA 3UINB 1ZOYB 4HRSA 5AZHA 1TS3A 1G6JA 1VJKA 4YSYB 4GMVA 3DDCB 2GBNA 3QCAA 3GP7A 2V4IB 2KN4A 4M02A 3NW8A 2Z0OA 3I9V1 4HPMB 4FULA 4W9FA 4KIKB 2W82A 3AU5A 2WDTB 1EO6A 4GU2A 5HE1A 1XCQL 1ZC3B 4WJ7A 4S17A 4F7ZA 1XD4A 1FXAA 4GZUA 3HM6X 3KLSX 4LNFA 3N1YC 2G45B 1SIJA 2BYFA 3L17A 2KK8A 2GBKA 3H6NA 2Q13A 2GUMA 2P0FA 3TEZA 5E6JA 4M0WB 1ST7A 3PHWB 1NENB 3GS2A 3TMPB 1WX8A 2LASA 4JKEA 3UGBB 1JQ4A 1FHXA 3ZLZA 3P7ZA 3K9PB 1PDXA 1GB4A 3I3TB 2DENB 3VR9B 3AE3B 4HCPB 2WDRB 4IM2A 1QLBB 2QJLA 2RDBC 2GCLA 2PPHA 3PHXB 3DXEA 2K0PA 3VHTC 4A3PA 5LXHA 4MDKE 1A70A 4MT7A 1NDDA 1QT9A 1PGXA 2L05A 3ZDTA 1FRDA 1UBIA 3FM8C 3N3KB 2RQ1A 2YRYA 4JGHB 4JKDA 2X8XX 4US8A 5E6OA 4KGTA 2BYVE 2L1CA 1KLGD 1WJ1A 5C2TB 3OWEB 2DZMA 2VZKB 5EE0A 2MWSB 1P9DU 4KKIA 4AWJA 4GDKB 1ZXHA 2K8HA 5BMHA 1F2RC 1SE9A 1Q1OA 1NBFC 1PYWD 1TBEA 1ET9A 3B1LX 4RGMA 2MBEA 1SE2A 2Y5CA 3AECB 1WFYA 2HRJA 1P98A 3NZUA 2LVQA 4EFOA 4RCOA 1AWDA 1Z2MA 2D3BA 2WU2B 3UF8A 4GGQA 2BS4B 3BVGA 2RVBB 4PNKA 4GOCA 2INPE 1QC6A 1U5FA 2CQUA 3CIRB 2X0SA 2FUG1 2JWZA 1F77A 2QKLA 2NMQA 4KHAA 5IOIA 5JZEB 3NUHB 4H8SA 1M94A 1XO3A 2LFIA 4QJ5B 2PIAA 2WQYB 3RULA 3SV1A 3ZVRA 2KTFA 3VDZA 4FHJA 2K8CA 5GXGB 2KUQA 1V81A 3RNBC 4JKGA 3C0RB 3W5UB 3EECA 2DYQA 2D9VA 4XWWA 1YX5B 2CHXA 3QARA 5D3DA 5CHFA 4JLCA 4B0EA 4WJNA 3RYTA 1WJNA 3IT4B 4K3CA 2CODA 3PGEA 3RNEC 4KHBB 2KC1A 3VVWB 2LRUA 4KGSA 4DHJD 2N9PC 2JVCA 1Y8RC 1C4AA 2PE9A 1T5XD 4HB0B 4KDIC 3DPDA 2WXKA 4FXCA 3ZNZB 3ZIMA 3VH4B 4WVFB 1E9MA 5G55A 2G35A 2V76A 2XK5B 2NR2A 2K3UA 5E6PA 2W2WA 1MPHA
chains in the Genus database with same CATH topology
2DHIA 3VQIA 3ZNGC 1WXAA 4EJNA 2KTRB 2BKRB 5JHGA 1WMHB 3VOQA 1WH3A 3DVNU 2EKEC 2RPQA 4BOZB 2KDEB 1FGZA 2D10A 3NS8A 3O96A 3M1IB 1U2BA 3RZWC 1WI1A 3APDA 2EMSA 2KJ6A 2IO2B 3TBLD 3V5WA 2GBRA 2K00A 1UPQA 1LW3A 4WJOA 2AEHA 2CY4A 1MIZB 2FAZA 4MGKE 3A8PA 3A4SC 1ZC4B 2I1KA 3FSSA 1DDMA 2RGFA 4EZLA 3U30A 1N3HA 2XQNM 4Z2MB 4MJSB 1Z87A 1WJ6A 5GMVA 4JK7A 2LWPA 2UZSA 2WYQA 4DHZE 5CLLB 2LOXA 4W9HA 3GOEA 2DYNA 5AZGA 3H9DA 2ADZA 5L81A 1S3SG 2DYOA 4TUUA 3EPYA 1XD3B 2UZRA 3L13A 2Z0EB 2ZNVC 4PS3A 4KAXB 1WIAA 3T9LA 1TZ1A 2FNJB 1PFJA 5CTRC 2J59M 2LUEA 3N32A 5AEKB 2N4FA 4NNJB 2YT0A 3IG3A 5C6RA 2KD0A 2KQ7A 3QC8B 5LXIB 5LLIA 4TQ0A 1FGYA 2O6VD 3SYXA 4BFRA 2ZNVB 2FIFA 1V5TA 3PSEB 2I5CA 3H7PA 4GIVA 3RZFA 2NBVB 4MGZE 3S2AA 4A6FB 2WH5A 4GSWA 4JKFA 3ZNID 2O2VB 3EC8A 4CO7A 2N7DA 4IG7B 2NPTB 2MX2A 4M8MA 1WXSA 1I42A 4K17A 4JIOU 2RUKB 4K2OA 2GOWA 1UH6A 4DDGD 2OQBA 2K25A 2CR5A 1E5WA 3WALA 2ZEQA 3NOBA 1TJ6A 2XK5A 1W1DA 1J0GA 1TTNA 3HK0A 2KHWB 4NQKE 4I6LB 4HAVB 3M3JA 3BJIA 3R66C 2E2XA 4G3XB 2LKOA 3R3MA 2B3AA 2G4DB 4F7HA 4II3B 1WMHA 5D3XA 1EUVB 2L7RA 3KSYA 1DDVA 4F7UP 4K1RB 3MHSD 2CKHB 2KX3A 1KLVA 1WG7A 4E74A 1WGRA 3VTWA 3FP5A 4HAWB 1HB6A 3K9OB 2BCJA 4DDID 2FIDA 4DBBA 5C16A 1RAXA 2MWNB 2RNRB 2LZ6A 1WX9A 4DHJB 5TR5A 3ZTDA 5D6JB 4BBNC 1X11A 4ZRJA 2DHKA 2L0FA 5DH9B 3WAMA 4MJSA 2NVUI 1P5TA 3ZW3A 3IVFA 5GOWB 5LONB 1WXMA 2KANA 2A5UA 2YSZA 4HDOA 2ELAA 4WWPA 2FUHB 4ZDVA 3P6AA 3CXBB 3PEGA 2LXAA 5J3TA 4ILGB 3DXCA 4ANWA 2ROVA 3ZRCA 1UNPA 3R7QA 1UGMA 5J17A 4JKHA 3PTFC 5D3VA 2L76A 3MPXA 5JLJB 4F8CB 2UWQA 1OGWA 5L95C 4X57B 1QQGA 4EMOA 2DFKA 2MBBB 2KCJA 1P0RA 2FCNA 3WIMA 2P8VA 3DXDA 2QKMA 4DBGA 5C5BB 4J6IA 4KDLB 5FI1A 4W9LA 2NBUA 4B6WA 5E6NA 3TFMA 3HQCA 1WF9A 2KLGA 5DCNA 1WGDA 4ZYNA 4A6FA 2N7EA 2D9YA 2KWUB 1K5DB 1GG3A 3QAQA 1NI2A 2O2VA 1E8WA 2FJ9A 1MKEA 3PVLA 3SBTA 2NPTA 4MGYE 1GGOA 1IRSA 2C5LC 3QA8A 1TGZB 2K39A 1BAKA 3L08A 4A20A 1U29A 4NY0A 2MDXA 1YIWA 4KV2A 2PJHA 3W1SC 2DN6A 1U27A 2AYOB 1B55A 3PREA 1TQZA 3L54A 3PS6A 1V5PA 3PG7A 1UELA 1NTYA 3ZDMC 2I1JA 1FAOA 1UNRA 3NHEB 1BTKA 2O6VB 3QK0A 1LM8B 1XT9B 3AU4A 1YQBA 3V6EB 2DTCA 1WGUA 1WM2A 1ZM0A 1X05A 2K2UA 1ISNA 1X1FA 2JT4B 1MK9B 1DROA 2KFKB 2LGXA 2J0KA 3ONSA 5C23A 3QWZB 4WWNA 2M1MA 4JK9A 2K6DB 2DAFA 2BGFA 4RM8A 1E8XA 4W9CA 1OTRB 3F5RA 2FCSA 2KXJA 1EGXA 2KDBA 2R82A 5DI9B 3D8EA 3H1UA 4P7IA 4B9KA 4IAPA 3ZUNA 3ENBA 3QHTA 2Z0PA 2M4NA 2CRFA 2COCA 3RCZA 4WSFA 3H7PB 1NVLA 2GBJA 2WWZA 3W1YA 2J7QB 4FN2A 3R7RA 2D9ZA 1V49A 3ECIA 4ICVA 5G2NA 1OQYA 4EZKA 2BPSA 2KN5A 1K5GB 4WWOA 2M17A 1GUAB 3RD2A 1KOTA 5JP4A 3QJZA 2XEWA 1YJ1A 5DPTA 1RLFA 3FLVA 1WRDB 4XC2A 2DZIA 1A5RA 5HKHA 2MSED 1E7VA 4ANXA 1BWNA 3DVNV 2LULA 2COPA 3VIAA 4NJ6A 5KHQA 4HB4B 4EOYA 2C9WB 1J8CA 3KYCD 1W1HA 3WA0A 3KW5B 3M63B 1KJTA 1OY2A 4ILJA 1U5DA 1NTVA 1ZGUB 2COAA 2JUOA 2DAJA 1OEYJ 3ZTCA 1DDWA 2HD5B 2KQSA 1P3RA 4XX5A 5C5BA 3VUXA 2YS1A 3IBEA 2HTHA 5D94A 4LJOB 1I35A 4JL9A 3RUIB 1C3TA 4N9F4 4TKNA 2BKFA 4W9DA 3L10B 3X0WA 1UNQA 2N9XA 2NZ8B 3V61A 3GYPA 2YS3A 2DX1A 1KZ7A 3BY4B 1E8ZA 4W9EA 2LBBA 2MQJA 2D4QA 1PLSA 5KHOA 4ANUA 3PV1A 2P0HA 4HLEA 1UPRA 1U5EA 3VTUA 2G4SA 3P2BA 1I7AA 4JKBA 4BVUC 1WX7A 4W9GA 2D11A 2ZPNA 4RMAA 3X23A 1FXTB 2AL3A 1DIKA 4HAZB 2JY6A 5DPWA 3M95A 1WY8A 1UD7A 2ZCBA 1MIXA 2O6VA 4L6EA 4I6PA 1SGHA 3D8FA 4CHJA 4OVUA 1JDEA 5DPSA 1YX6B 4HAXB 3DBSA 2L00B 1J19A 2PE6B 2X18A 4MSMB 2BF8B 2KFKA 3W1SA 2D2QA 4KSKC 2LJ5A 3ZNHB 3TJPA 2MCNB 4WQOB 3DBRI 1MK7B 3ZO5B 1E8YA 3CSTA 4HPLB 3OLMD 1ZKHA 3D8DA 4FJZA 2YLMA 4IWOA 1LQBA 2GCJA 2V1YA 4NSWA 3IFWB 4HVBA 4WAAA 4NJ7A 4C0AA 3V62A 1KC7A 1V6EA 4PYZA 4AJWA 2N23A 3NSUA 2LI5A 4EEWA 2DLWA 3SNHA 2JXXA 2ELBA 1R4NI 5C1ZA 3TO1A 1C1YB 4E3CA 1FOEA 3B0AA 1PQSA 2IY1B 3LJ3A 3OAWA 3A4RA 4YL8A 4HB3B 2XBBC 2DZJA 3PRPB 4KSLC 4NQLB 2ZJDA 3KRXA 4HXDA 2KMCA 2M8SA 3PRMB 3SUZA 2IY0B 3V6CB 1HE8A 3VFKA 1TXDA 1BT0A 1YD8U 5J3YA 1V5MA 2RLOA 1DBHA 1VCBA 1D3ZA 2DX5A 1VBHA 3ODOA 3AXCA 5DPRA 5CHWA 3L16A 5DHFB 4HK2A 4IOYX 3T06A 1ACAA 2A4ZA 1FHWA 5IAAC 2ZVNA 1OQNA 1P6SA 5D7GA 4HAYB 3WAPA 2L3ZA 1XR0B 1R4MI 4Z2NA 2MBHA 2IZVB 4AJYB 3ULBA 2JP2A 2DZKA 3KYDD 1OMWA 3O65B 3E66A 4IWPA 4FBJB 1W1GA 2WX0A 3ODWA 4K81A 3MTNB 2JRIB 4K7UA 1Y5OA 5HE2A 1ZSQA 5CHVC 3CMMB 3Q3FA 2CB8A 5D27A 1ZW7A 4HDQA 3DBLI 2FCMA 2RD0A 3CIKA 2YS5A 3KY9A 5AZFA 4EZJA 3A1QA 3E9LA 1WGQA 4G0NB 2MBOA 4G50A 3ZRFA 2IO1B 2MW5A 3NY5A 2IO3B 4DXAB 4MELA 4F7GA 3L0WB 3F0WA 2K1FA 3QIJA 3JSVA 2LGYA 3SHQA 2QHOA 2J0MA 4ZRKA 3WANA 3JW0X 4KZCA 2ZCCA 4A6KA 1CMXB 4HHVA 3EFUA 4BKGA 3KUZA 1V2YA 2D07B 1WGYA 2GS0A 1XODA 4WJPA 4CHKA 1WJMA 2LVOA 1WGGA 1H4RA 2NBWB 4LDTD 1GC6A 2FDQA 4DX90 1WM3A 2VSZA 3PZDA 2MA9B 3GYOA 3UQAA 4GXBA 2CHZA 3KH0A 1V86A 4BBKA 3ENEA 3KZ1A 3SD5A 3HW2B 1AQCA 2HTHB 1QZEA 2JZZA 1IYFA 3DCGA 5KQ4A 4PS8A 2EC1A 1WXVA 2Y5BB 4MK0A 2MRPA 4F1SA 2KKCA 5D3WA 4JQWC 3UQBA 1I2HA 1KBLA 2Y8FA 3PSCA 2IYDB 2D9XA 4GDLB 3U7DA 1KZGA 2V4LA 2YT1A 1KI1B 5LOPB 1WYWB 5KCVA 2MBQA 4II2B 2JRHA 2OJRA 4GMXB 2KFJA 2LRWA 4W9IA 4NAWA 3A9KB 1Y19B 2W2XD 4AUQC 2LXCA 2WX1A 3NZSA 2M38A 1WJUA 2D3GA 1LB1A 2RR9A 4CHMA 2N9EB 3DBHI 3E9OA 4W9KA 1EF5A 4KHOA 1UEFA 5HE0A 2HJ8A 2GJYA 3PRZA 1V5UA 3SBGA 2JZ3B 2N1VA 1GC7A 4OVVA 4GN1A 3RCPA 4GB9A 2VKIA 2CU1A 1P3QU 4NPNA 4BOSC 4M8NA 2K8BA 4HJKA 4E71A 1FHOA 2MP2B 2KC2A 1J0WA 2P0DA 2IO0B 1VD2A 2H7DA 2NMBA 2VRRB 4D0NB 2C7NB 2L8JA 2DIKA 3SDLC 1UZXB 1XQQA 1WR6E 4IWQA 1Q0WB 2EJ8A 3T8MA 1EAZA 3PVUA 1L7YA 3ML8A 5FR6A 1V61A 2MFQA 2LVPA 2OOBB 4YONA 4IW0A 4DHZB 3PP2A 4XWXA 1OEYA 1U4AA 3AJ4A 2W9NA 3TCAA 3VUYA 4BBNF 2LOZA 1IPGA 2DKQA 4LJPB 3JYUA 1M7RA 3N30A 3PT2B 5JHAA 1P1AA 1H10A 2PZ1A 3DVGY 2KWCA 4MM3A 2COFA 4HAUB 1X1GA 3WAOA 1FB8A 4TYZA 2DYBA 4B95A 4K2PA 4JKAA 3A9JA 3OANA 2DX5B 3GZNI 3PPAA 5CLQB 3MJWA 4MSQB 3RT3B 2DHZA 2KZRA 3UIOB 4AP4C 2GMIC 3ML4A 3AULA 2NS5A 5EDSA 2G3QB 2KMAA 2Z0DB 2CAYA 3ZVVA 4ILHA 2KLCA 2LG1A 3TW1A 4A3OA 2UVMA 3DVGX 1AWEA 2N1WA 2IFSA 3HM3A 2KGXB 3FEHA 4A6HA 4RM9A 4DWFA 2KX0A 2FJLA 4FJYA 1MAIA 2KUPA 1RRPB 2OTXA 2V3SA 1HBKA 3KVFB 3UIPB 1WE6A 2DA0A 4KVGB 1T0YA 4GDLA 3APCA 3D32A 3A33B 1WR1A 2MKRA 3ULCA 2UYZB 4BKTA 2C7MB 3WYFB 1XX0A 2KJRA 1K8RB 1IP9A 3A1QB 4LDTB 2AL6A 3KUCB 2K6QA 3A9KA 2ZVOA 3CSFA 2M0XA 3VAWA 3JSVB 4KIKA 5C79A 1GNUA 4DX8A 3QBVB 4MY6A 1BTNA 3DOWA 2JPHA 3UZTA 4K7WA 5L83A 5J2RA 2LYDA 5IA7A 1WI0A 2AWTA 3Q3JA 3OJ3A 2RSUA 1PMSA 3VH3B 4ZRIA 2EMTA 1EVHA 4ASWC 2KVRA 2W2XC 2NCNA 1ZVRA 1F9JA 1WZ0A 1E90A 2YF0A 2YVCA 4URKA 5J18A 2R2QA 1V89A 1WVHA 2Z59B 5DIFB 4ICUA 2MP2A 3B08A 4HWIB 1WJ4A 3H7SA 2HE7A 2LGDA 2REXA 2KNBA 3DQVA 4PQ0A 4GDKA 3SO6A 3PLVA 2R09A 5IJMA 2FCQA 2IYBA 4DK5A 2Z0QA 4TQ1A 2CY5A 2VRWB 1V9JA 1M7EA 1RFAA 2ASQA 2ZZPB 4KZ0A 1XKEA 3KUDB 1U5GA 4IC7B 1UBQA 3VTVA 3U8ZA 4Y94A 1AARA 5JVLA 1NU2A 2IBIB 2M14A 2R0DA 1SIFA 1X86A 3TVVA 1V5OA 4EUTA 2KO3A 1V88A 1H8CA 1L2NA 2ABDA 1WGHA 5D3YA 2PEAA 2C7HA 1XCGA 2KJHB 3N7CA 1KM7A 4NAWB 2N0YA 2C60A 1Q67A 3IHPC 4IFSA 2L0TA 2DKPA 3LDZE 1X1MA 3QX1A 2BWFA 3ODXA 2LD9A 5J3QA 1RJ2A 5EFXA 3JVZX 3PVWA 2BYEA 4B6HA 5FI0A 2H7EA 2KDFB 1HB8A 1VBGA 4AOFA 2KTRA 2CS4A 4HB2B 3ALBA 3TIXA 2MLBA 4PS7A 2GBMA 5JHBA 2R2OA 4IM0A 3QQ8B 5BO4B 3VXWA 2RSGA 2K2JA 4A5KA 2D9WA 4TV3A 3M62B 4FA6A 4FADA 4HCNB 4XZ4A 4EKUA 4JKCA 3G9WA 4JK8A 4MEMA 2JF5A 2KWVB 4WJQA 2I5FA 2BWES 5JHHA 1JRUA 5KQ1A 1NTIA 5DHAB 3MDBC 2DYMA 4CYEA 3SU8X 4BKSA 3A9JB 4ANVA 4IM3A 3HHMA 4JKGB 3A98B 2KDIA 3HIZA 1DYNA 2RGNB 2ROZB 3PLUA 1Q5WB 3QWMA 3A8QA 3ML9A 3EHVA 2ZPYA 1MG8A 2L2IA 3VUWA 1WE7A 4I6NB 4GPTB 5JH5C 4FJVB 5HE3A 2DHJA 2Y7BA 5CX3A 3TL5A 4MGIE 4HATB 4G11A 3BINA 1LFDA 3OJ4B 1S1QB 1Z5SB 4K7SA 3V60A 3ZKJC 4BKSD 1WZ3A 2CHWA 4PYUA 3AI5A 4FLHA 1V80A 3CF6E 2KOXA 4FHKA 5D2MB 2Y8GA 2J0JA 3KRWA 3APFA 1EF1A 4IUMB 1GJZA 4LCDE 3E9PA 4MH0E 1RRBA 4W9JA 1SHCA 3LJUX 1E7UA 1LXDA 3UINB 5AZHA 1G6JA 4GMVA 3DDCB 2GBNA 3QCAA 2Z0OA 4HPMB 4FULA 4W9FA 4KIKB 3AU5A 2WDTB 1EO6A 4GU2A 5HE1A 1ZC3B 4WJ7A 4F7ZA 1XD4A 4GZUA 3HM6X 2G45B 2BYFA 3L17A 2KK8A 2GBKA 3H6NA 2Q13A 2P0FA 4M0WB 1ST7A 3PHWB 3TMPB 1WX8A 2LASA 4JKEA 3UGBB 1FHXA 3ZLZA 3P7ZA 3K9PB 3I3TB 2DENB 4HCPB 4IM2A 2GCLA 2PPHA 3PHXB 3DXEA 3VHTC 4A3PA 5LXHA 4MDKE 4MT7A 1NDDA 2L05A 3ZDTA 1UBIA 3FM8C 3N3KB 2RQ1A 2YRYA 4JGHB 4JKDA 5E6OA 2L1CA 2BYVE 1WJ1A 2DZMA 2MWSB 1P9DU 4AWJA 4GDKB 2K8HA 1SE9A 1Q1OA 1NBFC 1TBEA 3B1LX 2MBEA 2HRJA 3NZUA 1P98A 1WFYA 2LVQA 4EFOA 1Z2MA 3UF8A 4GGQA 2RVBB 4PNKA 4GOCA 1QC6A 1U5FA 2CQUA 2X0SA 2JWZA 2QKLA 4KHAA 5JZEB 4H8SA 1M94A 3RULA 3SV1A 3ZVRA 2KTFA 3VDZA 4FHJA 2K8CA 1V81A 4JKGA 3C0RB 3EECA 2DYQA 2D9VA 1YX5B 2CHXA 3QARA 5CHFA 4JLCA 4WJNA 3RYTA 1WJNA 2CODA 3PGEA 4KHBB 2KC1A 3VVWB 2LRUA 4DHJD 2N9PC 2JVCA 1Y8RC 2PE9A 4HB0B 4KDIC 3DPDA 3ZIMA 3ZNZB 3VH4B 4WVFB 5G55A 2G35A 2V76A 2XK5B 2NR2A 5E6PA 2W2WA 1MPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHI A;  3VQI A;  3ZNG C;  1WXA A;  4EJN A;  2KTR B;  2BKR B;  5JHG A;  1WMH B;  3VOQ A;  1WH3 A;  3DVN U;  2EKE C;  2RPQ A;  4BOZ B;  2KDE B;  1FGZ A;  2D10 A;  3NS8 A;  3O96 A;  3M1I B;  1U2B A;  3RZW C;  1WI1 A;  3APD A;  2EMS A;  2KJ6 A;  2IO2 B;  3TBL D;  3V5W A;  2GBR A;  2K00 A;  1UPQ A;  1LW3 A;  4WJO A;  2AEH A;  2CY4 A;  1MIZ B;  2FAZ A;  4MGK E;  3A8P A;  3A4S C;  1ZC4 B;  2I1K A;  3FSS A;  1DDM A;  2RGF A;  4EZL A;  3U30 A;  1N3H A;  2XQN M;  4Z2M B;  4MJS B;  1Z87 A;  1WJ6 A;  5GMV A;  2LWP A;  2UZS A;  2WYQ A;  4DHZ E;  5CLL B;  2LOX A;  4W9H A;  3GOE A;  2DYN A;  5AZG A;  3H9D A;  2ADZ A;  5L81 A;  1S3S G;  2DYO A;  4TUU A;  3EPY A;  1XD3 B;  2UZR A;  3L13 A;  2Z0E B;  2ZNV C;  4PS3 A;  4KAX B;  1WIA A;  3T9L A;  1TZ1 A;  2FNJ B;  1PFJ A;  5CTR C;  2J59 M;  2LUE A;  3N32 A;  5AEK B;  2N4F A;  4NNJ B;  2YT0 A;  3IG3 A;  5C6R A;  2KD0 A;  2KQ7 A;  3QC8 B;  5LXI B;  5LLI A;  4TQ0 A;  1FGY A;  2O6V D;  3SYX A;  4BFR A;  2ZNV B;  2FIF A;  1V5T A;  3PSE B;  2I5C A;  3H7P A;  4GIV A;  3RZF A;  2NBV B;  4MGZ E;  3S2A A;  4A6F B;  2WH5 A;  4GSW A;  3ZNI D;  2O2V B;  3EC8 A;  4CO7 A;  2N7D A;  4IG7 B;  2NPT B;  2MX2 A;  4M8M A;  1WXS A;  1I42 A;  4K17 A;  4JIO U;  2RUK B;  4K2O A;  2GOW A;  1UH6 A;  4DDG D;  2OQB A;  2K25 A;  2CR5 A;  1E5W A;  3WAL A;  2ZEQ A;  3NOB A;  1TJ6 A;  2XK5 A;  1W1D A;  1J0G A;  1TTN A;  3HK0 A;  2KHW B;  4NQK E;  4I6L B;  4HAV B;  3M3J A;  3BJI A;  3R66 C;  2E2X A;  4G3X B;  2LKO A;  3R3M A;  2B3A A;  2G4D B;  4F7H A;  4II3 B;  1WMH A;  5D3X A;  1EUV B;  2L7R A;  3KSY A;  1DDV A;  4F7U P;  4K1R B;  3MHS D;  2CKH B;  2KX3 A;  1KLV A;  1WG7 A;  4E74 A;  1WGR A;  3VTW A;  3FP5 A;  4HAW B;  1HB6 A;  3K9O B;  2BCJ A;  4DDI D;  2FID A;  4DBB A;  5C16 A;  1RAX A;  2MWN B;  2RNR B;  2LZ6 A;  1WX9 A;  4DHJ B;  5TR5 A;  3ZTD A;  5D6J B;  4BBN C;  1X11 A;  4ZRJ A;  2DHK A;  2L0F A;  5DH9 B;  3WAM A;  4MJS A;  2NVU I;  1P5T A;  3ZW3 A;  3IVF A;  5GOW B;  5LON B;  1WXM A;  2KAN A;  2A5U A;  2YSZ A;  4HDO A;  2ELA A;  4WWP A;  2FUH B;  4ZDV A;  3P6A A;  3CXB B;  3PEG A;  2LXA A;  5J3T A;  3DXC A;  4ANW A;  2ROV A;  3ZRC A;  1UNP A;  3R7Q A;  1UGM A;  5J17 A;  3PTF C;  5D3V A;  2L76 A;  3MPX A;  5JLJ B;  4F8C B;  2UWQ A;  1OGW A;  5L95 C;  4X57 B;  1QQG A;  4EMO A;  2DFK A;  2MBB B;  2KCJ A;  1P0R A;  2FCN A;  3WIM A;  2P8V A;  3DXD A;  2QKM A;  4DBG A;  5C5B B;  4J6I A;  4KDL B;  5FI1 A;  4W9L A;  2NBU A;  4B6W A;  5E6N A;  3TFM A;  3HQC A;  1WF9 A;  2KLG A;  5DCN A;  1WGD A;  4ZYN A;  4A6F A;  2N7E A;  2D9Y A;  2KWU B;  1K5D B;  1GG3 A;  3QAQ A;  1NI2 A;  2O2V A;  1E8W A;  2FJ9 A;  1MKE A;  3PVL A;  2NPT A;  4MGY E;  1IRS A;  2C5L C;  3QA8 A;  1TGZ B;  2K39 A;  1BAK A;  3L08 A;  4A20 A;  1U29 A;  4NY0 A;  2MDX A;  1YIW A;  4KV2 A;  2PJH A;  3W1S C;  2DN6 A;  1U27 A;  2AYO B;  1B55 A;  3PRE A;  1TQZ A;  3L54 A;  3PS6 A;  1V5P A;  3PG7 A;  1UEL A;  1NTY A;  3ZDM C;  2I1J A;  1FAO A;  1UNR A;  3NHE B;  1BTK A;  2O6V B;  3QK0 A;  1LM8 B;  1XT9 B;  3AU4 A;  1YQB A;  3V6E B;  2DTC A;  1WGU A;  1WM2 A;  1ZM0 A;  1X05 A;  2K2U A;  1ISN A;  1X1F A;  2JT4 B;  1MK9 B;  1DRO A;  2KFK B;  2LGX A;  2J0K A;  3ONS A;  5C23 A;  3QWZ B;  4WWN A;  2M1M A;  2K6D B;  2DAF A;  2BGF A;  4RM8 A;  1E8X A;  4W9C A;  1OTR B;  3F5R A;  2FCS A;  2KXJ A;  1EGX A;  2KDB A;  5DI9 B;  3D8E A;  3H1U A;  4P7I A;  4B9K A;  4IAP A;  3ZUN A;  3QHT A;  2Z0P A;  2M4N A;  2CRF A;  2COC A;  3RCZ A;  4WSF A;  3H7P B;  1NVL A;  2GBJ A;  2WWZ A;  3W1Y A;  2J7Q B;  4FN2 A;  3R7R A;  2D9Z A;  1V49 A;  3ECI A;  4ICV A;  5G2N A;  1OQY A;  4EZK A;  2BPS A;  2KN5 A;  1K5G B;  4WWO A;  2M17 A;  1GUA B;  3RD2 A;  1KOT A;  5JP4 A;  3QJZ A;  2XEW A;  1YJ1 A;  5DPT A;  1RLF A;  3FLV A;  1WRD B;  4XC2 A;  2DZI A;  1A5R A;  5HKH A;  2MSE D;  1E7V A;  4ANX A;  1BWN A;  3DVN V;  2LUL A;  2COP A;  3VIA A;  4NJ6 A;  5KHQ A;  4HB4 B;  4EOY A;  2C9W B;  1J8C A;  3KYC D;  1W1H A;  3WA0 A;  3KW5 B;  3M63 B;  1KJT A;  1OY2 A;  1U5D A;  1NTV A;  1ZGU B;  2COA A;  2JUO A;  2DAJ A;  1OEY J;  3ZTC A;  1DDW A;  2HD5 B;  2KQS A;  1P3R A;  4XX5 A;  5C5B A;  3VUX A;  2YS1 A;  3IBE A;  2HTH A;  5D94 A;  4LJO B;  1I35 A;  4JL9 A;  3RUI B;  1C3T A;  4N9F 4;  4TKN A;  2BKF A;  4W9D A;  3L10 B;  3X0W A;  1UNQ A;  2N9X A;  2NZ8 B;  3V61 A;  3GYP A;  2YS3 A;  2DX1 A;  1KZ7 A;  3BY4 B;  1E8Z A;  4W9E A;  2LBB A;  2MQJ A;  2D4Q A;  1PLS A;  5KHO A;  4ANU A;  3PV1 A;  2P0H A;  4HLE A;  1UPR A;  1U5E A;  3VTU A;  2G4S A;  3P2B A;  1I7A A;  4BVU C;  1WX7 A;  4W9G A;  2D11 A;  2ZPN A;  4RMA A;  3X23 A;  1FXT B;  2AL3 A;  4HAZ B;  2JY6 A;  5DPW A;  3M95 A;  1WY8 A;  1UD7 A;  2ZCB A;  1MIX A;  2O6V A;  4L6E A;  4I6P A;  1SGH A;  3D8F A;  4CHJ A;  4OVU A;  5DPS A;  1YX6 B;  4HAX B;  3DBS A;  2L00 B;  1J19 A;  2PE6 B;  2X18 A;  4MSM B;  2BF8 B;  2KFK A;  3W1S A;  2D2Q A;  4KSK C;  2LJ5 A;  3ZNH B;  3TJP A;  2MCN B;  4WQO B;  3DBR I;  1MK7 B;  3ZO5 B;  1E8Y A;  3CST A;  4HPL B;  3OLM D;  1ZKH A;  3D8D A;  4FJZ A;  2YLM A;  4IWO A;  1LQB A;  2GCJ A;  2V1Y A;  4NSW A;  3IFW B;  4HVB A;  4WAA A;  4NJ7 A;  4C0A A;  3V62 A;  1V6E A;  4PYZ A;  4AJW A;  2N23 A;  3NSU A;  2LI5 A;  4EEW A;  2DLW A;  3SNH A;  2JXX A;  2ELB A;  1R4N I;  5C1Z A;  3TO1 A;  1C1Y B;  4E3C A;  1FOE A;  3B0A A;  1PQS A;  2IY1 B;  3LJ3 A;  3OAW A;  3A4R A;  4YL8 A;  4HB3 B;  2XBB C;  2DZJ A;  3PRP B;  4KSL C;  4NQL B;  2ZJD A;  3KRX A;  4HXD A;  2KMC A;  2M8S A;  3PRM B;  3SUZ A;  2IY0 B;  3V6C B;  1HE8 A;  3VFK A;  1TXD A;  1BT0 A;  1YD8 U;  5J3Y A;  1V5M A;  2RLO A;  1DBH A;  1VCB A;  1D3Z A;  2DX5 A;  3ODO A;  3AXC A;  5DPR A;  5CHW A;  3L16 A;  5DHF B;  4HK2 A;  4IOY X;  3T06 A;  1ACA A;  2A4Z A;  1FHW A;  5IAA C;  2ZVN A;  1OQN A;  1P6S A;  5D7G A;  4HAY B;  3WAP A;  2L3Z A;  1XR0 B;  1R4M I;  4Z2N A;  2MBH A;  2IZV B;  4AJY B;  3ULB A;  2JP2 A;  2DZK A;  3KYD D;  1OMW A;  3O65 B;  4IWP A;  4FBJ B;  1W1G A;  2WX0 A;  3ODW A;  4K81 A;  3MTN B;  2JRI B;  4K7U A;  1Y5O A;  5HE2 A;  1ZSQ A;  5CHV C;  3CMM B;  3Q3F A;  2CB8 A;  5D27 A;  1ZW7 A;  4HDQ A;  3DBL I;  2FCM A;  2RD0 A;  3CIK A;  2YS5 A;  3KY9 A;  5AZF A;  4EZJ A;  3A1Q A;  1WGQ A;  4G0N B;  2MBO A;  4G50 A;  3ZRF A;  2IO1 B;  2MW5 A;  3NY5 A;  2IO3 B;  4DXA B;  4MEL A;  4F7G A;  3L0W B;  3F0W A;  2K1F A;  3QIJ A;  3JSV A;  2LGY A;  3SHQ A;  2QHO A;  2J0M A;  4ZRK A;  3WAN A;  3JW0 X;  4KZC A;  2ZCC A;  4A6K A;  1CMX B;  4HHV A;  3EFU A;  4BKG A;  3KUZ A;  1V2Y A;  2D07 B;  1WGY A;  2GS0 A;  1XOD A;  4WJP A;  4CHK A;  1WJM A;  2LVO A;  1WGG A;  1H4R A;  2NBW B;  4LDT D;  1GC6 A;  2FDQ A;  4DX9 0;  1WM3 A;  2VSZ A;  3PZD A;  2MA9 B;  3GYO A;  3UQA A;  4GXB A;  2CHZ A;  3KH0 A;  1V86 A;  4BBK A;  3ENE A;  3KZ1 A;  3SD5 A;  3HW2 B;  1AQC A;  2HTH B;  1QZE A;  2JZZ A;  1IYF A;  3DCG A;  5KQ4 A;  4PS8 A;  2EC1 A;  1WXV A;  2Y5B B;  4MK0 A;  2MRP A;  4F1S A;  2KKC A;  5D3W A;  4JQW C;  3UQB A;  1I2H A;  2Y8F A;  3PSC A;  2IYD B;  2D9X A;  4GDL B;  3U7D A;  1KZG A;  2V4L A;  2YT1 A;  1KI1 B;  5LOP B;  1WYW B;  5KCV A;  2MBQ A;  4II2 B;  2JRH A;  2OJR A;  4GMX B;  2KFJ A;  2LRW A;  4W9I A;  4NAW A;  3A9K B;  1Y19 B;  2W2X D;  4AUQ C;  2LXC A;  2WX1 A;  3NZS A;  2M38 A;  1WJU A;  2D3G A;  1LB1 A;  2RR9 A;  4CHM A;  2N9E B;  3DBH I;  4W9K A;  1EF5 A;  4KHO A;  1UEF A;  5HE0 A;  2HJ8 A;  2GJY A;  3PRZ A;  1V5U A;  2JZ3 B;  2N1V A;  1GC7 A;  4OVV A;  4GN1 A;  3RCP A;  4GB9 A;  2VKI A;  2CU1 A;  1P3Q U;  4NPN A;  4BOS C;  4M8N A;  2K8B A;  4HJK A;  4E71 A;  1FHO A;  2MP2 B;  2KC2 A;  1J0W A;  2P0D A;  2IO0 B;  1VD2 A;  2H7D A;  2NMB A;  2VRR B;  4D0N B;  2C7N B;  2L8J A;  3SDL C;  1UZX B;  1XQQ A;  1WR6 E;  4IWQ A;  1Q0W B;  2EJ8 A;  3T8M A;  1EAZ A;  3PVU A;  1L7Y A;  3ML8 A;  5FR6 A;  1V61 A;  2MFQ A;  2LVP A;  2OOB B;  4YON A;  4IW0 A;  4DHZ B;  3PP2 A;  4XWX A;  1OEY A;  1U4A A;  3AJ4 A;  2W9N A;  3TCA A;  3VUY A;  4BBN F;  2LOZ A;  1IPG A;  2DKQ A;  4LJP B;  3JYU A;  1M7R A;  3N30 A;  3PT2 B;  5JHA A;  1P1A A;  1H10 A;  2PZ1 A;  3DVG Y;  2KWC A;  4MM3 A;  2COF A;  4HAU B;  1X1G A;  3WAO A;  1FB8 A;  4TYZ A;  2DYB A;  4B95 A;  4K2P A;  3A9J A;  3OAN A;  2DX5 B;  3GZN I;  3PPA A;  5CLQ B;  3MJW A;  4MSQ B;  3RT3 B;  2DHZ A;  2KZR A;  3UIO B;  4AP4 C;  2GMI C;  3ML4 A;  3AUL A;  2NS5 A;  5EDS A;  2G3Q B;  2KMA A;  2Z0D B;  2CAY A;  3ZVV A;  2KLC A;  2LG1 A;  3TW1 A;  4A3O A;  2UVM A;  3DVG X;  1AWE A;  2N1W A;  2IFS A;  3HM3 A;  2KGX B;  3FEH A;  4A6H A;  4RM9 A;  4DWF A;  2KX0 A;  2FJL A;  4FJY A;  1MAI A;  2KUP A;  1RRP B;  2OTX A;  2V3S A;  1HBK A;  3KVF B;  3UIP B;  1WE6 A;  2DA0 A;  4KVG B;  1T0Y A;  4GDL A;  3APC A;  3D32 A;  3A33 B;  1WR1 A;  2MKR A;  3ULC A;  2UYZ B;  4BKT A;  2C7M B;  3WYF B;  1XX0 A;  2KJR A;  1K8R B;  1IP9 A;  3A1Q B;  4LDT B;  2AL6 A;  3KUC B;  2K6Q A;  3A9K A;  2ZVO A;  3CSF A;  2M0X A;  3VAW A;  3JSV B;  4KIK A;  5C79 A;  1GNU A;  4DX8 A;  3QBV B;  4MY6 A;  1BTN A;  3DOW A;  2JPH A;  3UZT A;  4K7W A;  5L83 A;  5J2R A;  2LYD A;  5IA7 A;  1WI0 A;  2AWT A;  3Q3J A;  3OJ3 A;  2RSU A;  1PMS A;  3VH3 B;  4ZRI A;  2EMT A;  1EVH A;  4ASW C;  2KVR A;  2W2X C;  2NCN A;  1ZVR A;  1F9J A;  1WZ0 A;  1E90 A;  2YF0 A;  2YVC A;  4URK A;  5J18 A;  2R2Q A;  1V89 A;  1WVH A;  2Z59 B;  5DIF B;  4ICU A;  2MP2 A;  3B08 A;  4HWI B;  1WJ4 A;  3H7S A;  2HE7 A;  2LGD A;  2REX A;  2KNB A;  3DQV A;  4PQ0 A;  4GDK A;  3SO6 A;  3PLV A;  2R09 A;  5IJM A;  2FCQ A;  2IYB A;  4DK5 A;  2Z0Q A;  4TQ1 A;  2CY5 A;  2VRW B;  1V9J A;  1M7E A;  1RFA A;  2ASQ A;  2ZZP B;  4KZ0 A;  1XKE A;  3KUD B;  1U5G A;  4IC7 B;  1UBQ A;  3VTV A;  3U8Z A;  4Y94 A;  1AAR A;  1NU2 A;  2IBI B;  2M14 A;  2R0D A;  1SIF A;  1X86 A;  3TVV A;  1V5O A;  4EUT A;  2KO3 A;  1V88 A;  1H8C A;  1L2N A;  2ABD A;  1WGH A;  5D3Y A;  2PEA A;  2C7H A;  1XCG A;  2KJH B;  3N7C A;  1KM7 A;  4NAW B;  2N0Y A;  2C60 A;  1Q67 A;  3IHP C;  4IFS A;  2L0T A;  2DKP A;  3LDZ E;  1X1M A;  3QX1 A;  2BWF A;  3ODX A;  2LD9 A;  5J3Q A;  1RJ2 A;  5EFX A;  3JVZ X;  3PVW A;  2BYE A;  4B6H A;  5FI0 A;  2H7E A;  2KDF B;  1HB8 A;  4AOF A;  2KTR A;  2CS4 A;  4HB2 B;  3ALB A;  3TIX A;  2MLB A;  4PS7 A;  2GBM A;  5JHB A;  2R2O A;  4IM0 A;  3QQ8 B;  5BO4 B;  3VXW A;  2RSG A;  2K2J A;  4A5K A;  2D9W A;  4TV3 A;  3M62 B;  4FA6 A;  4FAD A;  4HCN B;  4XZ4 A;  4EKU A;  3G9W A;  4MEM A;  2JF5 A;  2KWV B;  4WJQ A;  2I5F A;  2BWE S;  5JHH A;  1JRU A;  5KQ1 A;  1NTI A;  5DHA B;  3MDB C;  2DYM A;  4CYE A;  3SU8 X;  4BKS A;  3A9J B;  4ANV A;  4IM3 A;  3HHM A;  3A98 B;  2KDI A;  3HIZ A;  1DYN A;  2RGN B;  2ROZ B;  3PLU A;  1Q5W B;  3QWM A;  3A8Q A;  3ML9 A;  3EHV A;  2ZPY A;  1MG8 A;  2L2I A;  3VUW A;  1WE7 A;  4I6N B;  4GPT B;  5JH5 C;  4FJV B;  5HE3 A;  2DHJ A;  2Y7B A;  5CX3 A;  3TL5 A;  4MGI E;  4HAT B;  4G11 A;  3BIN A;  1LFD A;  3OJ4 B;  1S1Q B;  1Z5S B;  4K7S A;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  2CHW A;  4PYU A;  3AI5 A;  4FLH A;  1V80 A;  3CF6 E;  2KOX A;  4FHK A;  5D2M B;  2Y8G A;  2J0J A;  3KRW A;  3APF A;  1EF1 A;  4IUM B;  1GJZ A;  4LCD E;  4MH0 E;  1RRB A;  4W9J A;  1SHC A;  3LJU X;  1E7U A;  1LXD A;  3UIN B;  5AZH A;  1G6J A;  4GMV A;  3DDC B;  2GBN A;  3QCA A;  2Z0O A;  4HPM B;  4FUL A;  4W9F A;  4KIK B;  3AU5 A;  2WDT B;  1EO6 A;  4GU2 A;  5HE1 A;  1ZC3 B;  4WJ7 A;  4F7Z A;  1XD4 A;  4GZU A;  3HM6 X;  2G45 B;  2BYF A;  3L17 A;  2KK8 A;  2GBK A;  3H6N A;  2Q13 A;  2P0F A;  4M0W B;  1ST7 A;  3PHW B;  3TMP B;  1WX8 A;  2LAS A;  3UGB B;  1FHX A;  3ZLZ A;  3P7Z A;  3K9P B;  3I3T B;  2DEN B;  4HCP B;  4IM2 A;  2GCL A;  2PPH A;  3PHX B;  3DXE A;  3VHT C;  4A3P A;  5LXH A;  4MDK E;  4MT7 A;  1NDD A;  2L05 A;  3ZDT A;  1UBI A;  3FM8 C;  3N3K B;  2RQ1 A;  2YRY A;  4JGH B;  5E6O A;  2L1C A;  2BYV E;  1WJ1 A;  2DZM A;  2MWS B;  1P9D U;  4AWJ A;  4GDK B;  2K8H A;  1SE9 A;  1Q1O A;  1NBF C;  1TBE A;  3B1L X;  2MBE A;  2HRJ A;  3NZU A;  1P98 A;  1WFY A;  2LVQ A;  4EFO A;  1Z2M A;  3UF8 A;  4GGQ A;  2RVB B;  4PNK A;  4GOC A;  1QC6 A;  1U5F A;  2CQU A;  2JWZ A;  2QKL A;  4KHA A;  5JZE B;  4H8S A;  1M94 A;  3RUL A;  3SV1 A;  3ZVR A;  2KTF A;  3VDZ A;  4FHJ A;  2K8C A;  1V81 A;  3C0R B;  3EEC A;  2DYQ A;  2D9V A;  1YX5 B;  2CHX A;  3QAR A;  5CHF A;  4JLC A;  4WJN A;  3RYT A;  1WJN A;  2COD A;  3PGE A;  4KHB B;  2KC1 A;  3VVW B;  2LRU A;  4DHJ D;  2N9P C;  2JVC A;  1Y8R C;  2PE9 A;  4HB0 B;  4KDI C;  3DPD A;  3ZIM A;  3ZNZ B;  3VH4 B;  4WVF B;  5G55 A;  2G35 A;  2V76 A;  2XK5 B;  2NR2 A;  5E6P A;  2W2W A;  1MPH A; 
#chains in the Genus database with same CATH topology
 2WS3 B;  1KFY B;  2DHI A;  2PKO A;  1XF5 L;  3VQI A;  3ZNG C;  1WXA A;  4EJN A;  1UF0 A;  4M01 A;  4ZRQ A;  1PGB A;  2KTR B;  2KWD A;  2BKR B;  5JHG A;  1WMH B;  3VOQ A;  1WH3 A;  3DVN U;  3ZYY X;  1IBX B;  2E3T A;  2EKE C;  2WU5 B;  2RPQ A;  4BOZ B;  2KDE B;  1FGZ A;  2D10 A;  3NS8 A;  3AE4 B;  2BBC A;  3O96 A;  3M1I B;  1U2B A;  2PVO D;  3RZW C;  1FCL A;  1WI1 A;  3APD A;  2EMS A;  2Z14 A;  2KJ6 A;  2IO2 B;  3TBL D;  3V5W A;  2GBR A;  2K00 A;  1UPQ A;  1LW3 A;  2NTS A;  4WJO A;  1HZ5 A;  2AEH A;  4LNN A;  2CY4 A;  2OED A;  2RDG A;  1MIZ B;  2FAZ A;  4MGK E;  3A8P A;  3A4S C;  1ZC4 B;  2I1K A;  3FSS A;  1FMA D;  1DDM A;  2RGF A;  4EZL A;  2DLB A;  4H2A A;  4D2K A;  3U30 A;  2IJ0 A;  1N3H A;  3FKY A;  2W3R A;  2XQN M;  4Z2M B;  4MJS B;  3N1X C;  1Z87 A;  1WJ6 A;  5I2M A;  5GMV A;  4JK7 A;  5IO9 A;  2LWP A;  5MPO A;  4YXD B;  1AW7 A;  2UZS A;  2WYQ A;  4DHZ E;  3P4R B;  5CLL B;  2WDV B;  4XWT A;  2LOX A;  4M0W A;  3MP9 A;  4W9H A;  3GOE A;  1SE3 A;  1B9R A;  2DYN A;  5AZG A;  5H8Y E;  3H9D A;  2ADZ A;  1T0R C;  3BVM A;  5L81 A;  1S3S G;  2DYO A;  4TUU A;  2NTT A;  3EPY A;  1JWB D;  1XD3 B;  1K52 A;  2UZR A;  3L13 A;  2Z0E B;  2ZNV C;  2D5G A;  4PS3 A;  4KAX B;  3GB1 A;  1WIA A;  3T9L A;  1TZ1 A;  2X38 A;  3BII D;  2FNJ B;  1PFJ A;  2JWU A;  5CTR C;  2J59 M;  4YSZ B;  1PFD A;  3BVZ A;  1MHH E;  2KDM A;  2LUE A;  3N32 A;  5AEK B;  1FNV A;  2N4F A;  3AEA B;  2L32 A;  4NNJ B;  1FNW A;  2YT0 A;  3KQ4 A;  3NVV A;  2FBW B;  3IG3 A;  1TIF A;  4PT5 A;  5C6R A;  2KD0 A;  2KQ7 A;  3QC8 B;  5LXI B;  1JWU D;  5LLI A;  4TQ0 A;  1FGY A;  2O6V D;  1GPX A;  3SYX A;  3I57 A;  4BFR A;  2ZNV B;  2FIF A;  1YNT E;  1V5T A;  4C00 A;  2INC C;  1HXY D;  4ARC A;  3PSE B;  2I5C A;  3H7P A;  3FIL B;  3V3X A;  4GIV A;  3RZF A;  3AN1 A;  2NBV B;  1IGC A;  4C56 C;  4MGZ E;  3DBR B;  3S2A A;  4A6F B;  2N0S B;  2WH5 A;  1TS5 A;  3TSS A;  3R2T A;  1TKE A;  4GSW A;  2K8E A;  3NWA A;  4JKF A;  1QIL A;  1EU3 A;  3ZNI D;  2O2V B;  3EC8 A;  4CO7 A;  2N7D A;  3NWD A;  4IG7 B;  1RWS A;  2NPT B;  2MX2 A;  3DHI C;  3EUB 2;  4M8M A;  1QF6 A;  1WXS A;  1I42 A;  4K17 A;  4JIO U;  2RUK B;  4RH6 A;  2ZW1 A;  4K2O A;  3Q8E A;  2GOW A;  2R61 A;  3I5J C;  1UH6 A;  2QEJ C;  4DDG D;  4RNA A;  4KHB A;  2OQB A;  2K25 A;  1R4N B;  4WIP A;  5HI1 A;  1UWM A;  3RN9 C;  1C78 A;  3HIE A;  1RFK A;  2CR5 A;  4R3D A;  1E5W A;  3P42 A;  4OVZ A;  3WAL A;  2B76 B;  2WXF A;  1QOG A;  2ZEQ A;  4HSI A;  3NOB A;  2WXP A;  1TJ6 A;  2XK5 A;  1W1D A;  1J0G A;  1TTN A;  4OZB A;  4RGN A;  3HK0 A;  2KHW B;  4NQK E;  4I6L B;  4QJ3 B;  4HAV B;  3M3J A;  1HEZ E;  3BJI A;  3R66 C;  2BVC A;  2E2X A;  4G3X B;  2LKO A;  3R3M A;  4A8X C;  2B3A A;  2G4D B;  1E7P B;  2L52 A;  4F7H A;  4II3 B;  1WMH A;  5D3X A;  4US9 A;  1EUV B;  2L7R A;  4YWG G;  3KSY A;  3AV8 A;  3HRD D;  1DDV A;  4F7U P;  1N62 A;  4K1R B;  3MHS D;  1FFV A;  2CKH B;  2KX3 A;  3EGR A;  1WG7 A;  1I4R A;  1KLV A;  4E74 A;  1WGR A;  2KAC A;  3VTW A;  3FP5 A;  4HAW B;  2IGH A;  1HB6 A;  3K9O B;  1UNS A;  2BCJ A;  2YEP B;  2W54 A;  2MJ3 A;  4DDI D;  4QJ4 B;  2FID A;  2M56 B;  2RDH A;  4DBB A;  5C16 A;  1RAX A;  2MWN B;  3MJ5 A;  1R4M B;  1WSP A;  2RNR B;  2WXM A;  1JAL A;  2LZ6 A;  2PW9 A;  1WX9 A;  4XDD A;  2MEK A;  4DHJ B;  5TR5 A;  3ZTD A;  1D5X C;  3IXS A;  1DGJ A;  2H88 B;  5D6J B;  4BBN C;  4GNK B;  2LMC A;  1X11 A;  3N20 C;  4ZRJ A;  1FRR A;  2DHK A;  2L0F A;  5DH9 B;  3WAM A;  4MJS A;  2NVU I;  1P5T A;  3ZW3 A;  3IVF A;  5GOW B;  5LON B;  3WCQ A;  1WXM A;  2KAN A;  3P1M A;  2A5U A;  1EWY C;  1DYQ A;  3P4S B;  2YSZ A;  4HDO A;  2ELA A;  4WWP A;  2YT2 A;  2FUH B;  4ZDV A;  3P6A A;  3CXB B;  3PEG A;  3AE6 B;  3DBL B;  2LXA A;  5J3T A;  4ILG B;  3DXC A;  4ANW A;  2ROV A;  3ZRC A;  1UNP A;  3R7Q A;  5HFY A;  2LHD A;  1UGM A;  5J17 A;  1TS2 A;  2XN9 C;  3AE5 B;  3DWG C;  4JKH A;  3PTF C;  5D3V A;  1Y56 A;  1L0V B;  2QIL A;  2L76 A;  3MPX A;  5JLJ B;  3ZJV A;  4F8C B;  2UWQ A;  1OGW A;  2MJD A;  2LEK A;  1ZUD 2;  5L95 C;  5I4D A;  3AE7 B;  4X57 B;  4YSX B;  4RF0 A;  1QQG A;  4OSN A;  3TEX A;  4OT1 A;  4EMO A;  2DFK A;  2PMV A;  4USA A;  4WAF A;  3UI3 A;  2MBB B;  1KLU D;  4IOI E;  2KCJ A;  1P0R A;  1HTO A;  2FCN A;  3Q69 A;  2QC8 A;  2P8V A;  3DXD A;  3WIM A;  2QKM A;  2I38 A;  5EE1 A;  5C5B B;  4DBG A;  4J6I A;  4KDL B;  5FI1 A;  1FEH A;  4W9L A;  4YTN B;  2NBU A;  4B6W A;  4ZYS A;  3FIL A;  5E6N A;  3TFM A;  2OJW A;  3HQC A;  1WF9 A;  3NG0 A;  2KLG A;  3GE8 C;  2NBV A;  5DCN A;  2BS2 B;  1WGD A;  1JWS D;  4A6F A;  1IGD A;  4ZYN A;  1YN3 A;  2KQ4 X;  4LNI A;  2N7E A;  3AEF B;  3Q8C A;  2D9Y A;  2KWU B;  1T0S C;  4A9A A;  1K5D B;  2SEB D;  1GG3 A;  3QAQ A;  1NI2 A;  2O2V A;  1E8W A;  2FJ9 A;  1MKE A;  3PVL A;  3SBT A;  2NPT A;  4MGY E;  1GGO A;  1TY0 A;  3RMK C;  2DBY A;  1IRS A;  2C5L C;  3QA8 A;  5T8I A;  1TGZ B;  2K39 A;  1BAK A;  3L08 A;  4A20 A;  2R2Y A;  1U29 A;  4NY0 A;  2MDX A;  1YIW A;  4KV2 A;  2PJH A;  4LTU A;  4Q2J A;  3W1S C;  1XEE A;  1FFU A;  2DN6 A;  1SJH D;  1U27 A;  4A55 A;  2AYO B;  1B55 A;  3Q8F A;  3PRE A;  3AED B;  1TQZ A;  3J9C A;  3L54 A;  3PS6 A;  1V5P A;  3PG7 A;  1UEL A;  1NTY A;  3ZDM C;  3HVZ A;  2I1J A;  1FAO A;  3IAS 1;  1KRH A;  1UNR A;  1SE4 A;  3NHE B;  1FNU A;  1BTK A;  1QKZ A;  2H89 B;  2O6V B;  3QK0 A;  2V0G A;  4P6V F;  1LM8 B;  3L4P A;  1JRO A;  1XT9 B;  3AU4 A;  1HA5 A;  1YQB A;  3V6E B;  2DTC A;  1WGU A;  1WM2 A;  4OZC A;  1ZM0 A;  1X05 A;  2K2U A;  1ISN A;  1X1F A;  2JT4 B;  1MK9 B;  3ZGZ A;  1DRO A;  2KFK B;  3E9S A;  2LGX A;  3PO0 A;  2J0K A;  2V3N A;  3ONS A;  5IN7 A;  3Q6B A;  5C23 A;  3QWZ B;  2QCZ A;  4WWN A;  2M1M A;  2KT7 A;  4JK9 A;  2K6D B;  2DAF A;  2BGF A;  4RM8 A;  1E8X A;  1OTR B;  3F5R A;  4W9C A;  2FCS A;  2KXJ A;  1QQR A;  3MC8 A;  5HG2 A;  2V3P A;  1EGX A;  2KDB A;  2R82 A;  5DI9 B;  1LO5 D;  4LNK A;  3AEB B;  3D8E A;  3H1U A;  3I63 C;  4P7I A;  4B9K A;  4IAP A;  1F2R I;  3ZUN A;  3PZ8 A;  3ENB A;  3QHT A;  2Z0P A;  2M4N A;  2ZKM X;  3DBH B;  2CRF A;  2COC A;  3RCZ A;  1L5P A;  4WSF A;  3H7P B;  1NVL A;  2GBJ A;  2WWZ A;  5I2S A;  3W1Y A;  5G5G A;  2J7Q B;  3BZD B;  4FN2 A;  5G5H A;  3R7R A;  2D9Z A;  1V49 A;  3ECI A;  4ICV A;  5G2N A;  4JPS A;  4KX6 B;  1OQY A;  4EZK A;  2LHE A;  2BPS A;  3DHH C;  5BMG A;  2KN5 A;  3U2S C;  1K5G B;  4WWO A;  2M17 A;  3MC9 A;  1VDV A;  1GUA B;  3RD2 A;  1KOT A;  3VRB B;  4N6E B;  5JP4 A;  3QJZ A;  1I4X A;  1JCK B;  1ESF A;  2XEW A;  1YJ1 A;  5DPT A;  2KR0 A;  1RLF A;  3FLV A;  1WRD B;  4XC2 A;  2DZI A;  1A5R A;  5HKH A;  1V97 A;  4JX1 C;  2MSE D;  1E7V A;  1MHX A;  4ANX A;  1BWN A;  3DVN V;  3B9J A;  1C9F A;  2LUL A;  2COP A;  3VIA A;  4NJ6 A;  5KHQ A;  4HB4 B;  4EOY A;  2C9W B;  1J8C A;  3KYC D;  1W1H A;  3WA0 A;  3KW5 B;  3M63 B;  1KJT A;  1OY2 A;  4ILJ A;  1U5D A;  4CQN A;  1NTV A;  1ZGU B;  1ENF A;  2COA A;  2JUO A;  2DAJ A;  4B0M A;  1OEY J;  3ZTC A;  1DDW A;  2HD5 B;  3RPF C;  2W3S A;  2KQS A;  1L0X B;  1P3R A;  4XX5 A;  5C5B A;  3VUX A;  3URY A;  2YS1 A;  3IBE A;  2HTH A;  5D94 A;  4LJO B;  1I35 A;  4JL9 A;  2JYT A;  3RUI B;  1F52 A;  1N60 A;  1C3T A;  4N59 A;  4N9F 4;  4TKN A;  2BKF A;  4W9D A;  2D3A A;  3DCX A;  3L10 B;  3X0W A;  1FO4 A;  1UNQ A;  3PZ7 A;  2N9X A;  2NZ8 B;  3V61 A;  3GYP A;  2YS3 A;  2DX1 A;  1NI3 A;  1KZ7 A;  1I4H A;  3BY4 B;  4QAY A;  4QXA B;  1E8Z A;  1V1P A;  4W9E A;  1OQQ A;  2LBB A;  2MQJ A;  2D4Q A;  1HTQ A;  1PLS A;  3Q3O C;  5KHO A;  4ANU A;  3PV1 A;  2P0H A;  2RMM A;  4C4V B;  4HLE A;  1UPR A;  1XLO A;  3ZQ4 A;  1U5E A;  3VTU A;  2G4S A;  3P2B A;  1I7A A;  4JKB A;  4BVU C;  1WX7 A;  4W9G A;  4YTM B;  2D11 A;  3N1Z C;  2ZPN A;  4RMA A;  1C79 A;  3X23 A;  1FXT B;  2AL3 A;  3B77 A;  4AS1 A;  1DIK A;  4HAZ B;  1LGR A;  2JY6 A;  5DPW A;  3M95 A;  4KKJ A;  1WY8 A;  1UD7 A;  2ZCB A;  4BZA A;  1MIX A;  3TUO A;  2O6V A;  4L6E A;  4I6P A;  1SGH A;  3D8F A;  4CHJ A;  4OVU A;  1JDE A;  5DPS A;  3VRA B;  3BK2 A;  3SEB A;  1YX6 B;  4HAX B;  1L4D B;  1N61 A;  1QOF A;  5AUK A;  3DBS A;  2L00 B;  1J19 A;  4L23 A;  2PE6 B;  2X18 A;  4MSM B;  2M0A A;  2BF8 B;  1QOB A;  2KFK A;  3W1S A;  1ZDV A;  2D2Q A;  4KSK C;  4C7Z A;  2LJ5 A;  3ZNH B;  1SJE D;  3TJP A;  2JSV X;  2MCN B;  4WQO B;  3DBR I;  1MK7 B;  3ZO5 B;  1E8Y A;  3CST A;  1L6U A;  4HPL B;  3OLM D;  1ZKH A;  3D8D A;  3TEY A;  4FJZ A;  2YLM A;  1SEB D;  2JU6 X;  4IWO A;  1LQB A;  2GCJ A;  2GLS A;  3W2D A;  2V1Y A;  4NSW A;  3IFW B;  4HVB A;  1YN5 A;  4WAA A;  4NJ7 A;  4C0A A;  4REZ A;  3V62 A;  1FXI A;  1Q10 A;  4LNO A;  1KC7 A;  1V6E A;  2INN E;  3EFC A;  4PYZ A;  1AN8 A;  2N23 A;  2GRI A;  4AJW A;  2GB1 A;  1ET6 A;  3NSU A;  2LI5 A;  2K9X A;  2Z13 A;  4EEW A;  2KAJ A;  2DLW A;  3SNH A;  3U4E G;  2JXX A;  2PTL A;  2ELB A;  1R4N I;  4XGA B;  5C1Z A;  3TO1 A;  1C1Y B;  4HRO A;  4E3C A;  1FOE A;  4WUR A;  3B0A A;  2AQ1 B;  2PVG C;  1D4B A;  1PQS A;  1ROE A;  2IY1 B;  1K51 A;  5EE3 A;  1UGJ A;  2WDQ B;  3LJ3 A;  3Q8B A;  3OAW A;  3A4R A;  4P16 A;  1ZP0 B;  4YL8 A;  4HB3 B;  2XBB C;  2BW2 A;  4RF1 A;  2DZJ A;  4BAX A;  3PRP B;  4KSL C;  2QSD A;  4NQL B;  1MI0 A;  2ZJD A;  2CU3 A;  3KRX A;  4HXD A;  2KMC A;  2M8S A;  3PRM B;  3SUZ A;  2WXN A;  2IY0 B;  3Q8A A;  1HE8 A;  3V6C B;  3VFK A;  1TXD A;  3W9C B;  1BT0 A;  1YD8 U;  5J3Y A;  1V5M A;  2RLO A;  1DBH A;  1E0Z A;  1VCB A;  1D3Z A;  2DX5 A;  1T0Q C;  1VBH A;  3ODO A;  2N7J A;  3AXC A;  5DPR A;  5CHW A;  1N5X A;  3L16 A;  1VZ6 A;  1EU4 A;  2HJ1 A;  5DHF B;  4HK2 A;  4IOY X;  3T06 A;  1ACA A;  2A4Z A;  3AM9 A;  1FHW A;  4NAM A;  3N9Y C;  5IAA C;  3HSA A;  2WXI A;  2ZVN A;  2QMT A;  2VH2 A;  4A90 A;  1OQN A;  1P6S A;  1ZYI A;  5D7G A;  3KWL A;  2WXL A;  4HAY B;  3WAP A;  2L3Z A;  1XR0 B;  1R4M I;  3B2G A;  3AE9 B;  4Z2N A;  2MBH A;  2IZV B;  4AJY B;  1TS4 A;  3ULB A;  2JP2 A;  2DZK A;  2MJE A;  2LUM A;  1V1O A;  3KYD D;  1OMW A;  3O65 B;  3E66 A;  4IWP A;  4FBJ B;  4C7Y A;  1W1G A;  2WX0 A;  3ODW A;  4ZOH C;  4K81 A;  3MTN B;  2JRI B;  3B2F A;  4K7U A;  1Y5O A;  5HE2 A;  1ZSQ A;  4YT0 B;  5CHV C;  1NVI D;  1E6E B;  3CMM B;  1T6B X;  3Q3F A;  4C4V A;  2CB8 A;  5D27 A;  1ZW7 A;  4HDQ A;  3DBL I;  2FCM A;  2JYE A;  2RD0 A;  3ZXV A;  3CIK A;  4D6W A;  2WLB A;  2YS5 A;  3KY9 A;  5AZF A;  1D5Z C;  4EZJ A;  3A1Q A;  1B1Z A;  4S0R A;  5JXV A;  3E9L A;  1WGQ A;  4RGO S;  5FK9 C;  4G0N B;  2MBO A;  4G50 A;  4MT5 A;  3ZRF A;  2IO1 B;  1F0Z A;  2MW5 A;  3NVZ A;  3NY5 A;  3O13 A;  2IO3 B;  4DXA B;  4MEL A;  5TSS A;  2WHI A;  4F7G A;  3L0W B;  3F0W A;  5BYS A;  1C77 A;  2Z8L A;  2K1F A;  3QIJ A;  3JSV A;  2LGY A;  3SHQ A;  1JRP A;  4OHJ A;  3LYY A;  2BT6 A;  2QHO A;  2J0M A;  4ZRK A;  4N58 A;  4EE2 A;  2JXT A;  3C19 A;  3WAN A;  3JW0 X;  2IND C;  4KZC A;  2ZCC A;  4A6K A;  1CMX B;  4HHV A;  3EFU A;  4BKG A;  3KUZ A;  1V2Y A;  2D07 B;  1WGY A;  3FAH A;  2GS0 A;  1XOD A;  3C8Y A;  1T3Q A;  4WJP A;  4CHK A;  5AUI A;  1WJM A;  2LVO A;  1WGG A;  4M00 A;  1H4R A;  2NBW B;  1I4Q A;  1CK1 A;  4LDT D;  1TY2 A;  1GC6 A;  2FDQ A;  1XCT L;  4HKQ A;  3HVD A;  4DX9 0;  1WM3 A;  2AQ2 B;  2VSZ A;  3PZD A;  2MA9 B;  3GYO A;  5FKA C;  3UQA A;  1MVK A;  1YN4 A;  3LB8 C;  1ZDX A;  4PK1 A;  4GXB A;  2EEL A;  2CHZ A;  3KH0 A;  2JX5 A;  1V86 A;  4BBK A;  2WGS A;  2ICI A;  3ENE A;  1KH0 A;  3KZ1 A;  3IAM 1;  4XYC A;  2GI9 A;  2IGG A;  3SD5 A;  1FPY A;  3HW2 B;  1AQC A;  1WWT A;  2HTH B;  1QZE A;  3EA6 A;  2JZZ A;  1IYF A;  3DCG A;  5KQ4 A;  4PS8 A;  2EC1 A;  1TKY A;  1WXV A;  2JQR B;  2Y5B B;  4MK0 A;  2MRP A;  4F1S A;  2KKC A;  5D3W A;  4JQW C;  5BYR A;  3UQB A;  1I2H A;  3AB5 A;  1KBL A;  2Y8F A;  4GOU A;  3PSC A;  1VLB A;  1V1P B;  2IYD B;  2D9X A;  1EM7 A;  4GDL B;  3U7D A;  1SB3 C;  1DOI A;  1KZG A;  2WP9 B;  2V4L A;  3R8B A;  2YT1 A;  2J4X A;  3ZJT A;  3RNG C;  4TSS A;  1KI1 B;  1STE A;  5LOP B;  1WYW B;  5KCV A;  2MBQ A;  2BQQ A;  4II2 B;  2JRH A;  2OJR A;  4GMX B;  2KFJ A;  2LRW A;  2OHF A;  4W9I A;  4NAW A;  3CWI A;  4HEA 1;  3A9K B;  1Y19 B;  2W2X D;  2J42 A;  1L0Y B;  4AUQ C;  3T3O A;  2LXC A;  2TSS A;  4DXG A;  4ACF A;  1KTK A;  2WX1 A;  3Q2A C;  3NZS A;  4KGR A;  3Q3N C;  2M38 A;  1P7F A;  1WJU A;  3OG5 A;  2D3G A;  1LB1 A;  5FR3 A;  2BYT A;  1K53 A;  2RR9 A;  5EE9 A;  4CHM A;  2N9E B;  3DBH I;  3E9O A;  4W9K A;  3ETR A;  1EF5 A;  2KVZ A;  4KHO A;  1UEF A;  4CSQ A;  5HE0 A;  2HJ8 A;  2GJY A;  2YEP F;  1JWM D;  3BWU D;  3IT6 B;  4TMA B;  3PRZ A;  2IPK D;  4WWM A;  1V5U A;  3SBG A;  2JZ3 B;  2N1V A;  3NRZ A;  4XDC A;  1GC7 A;  4OVV A;  4GN1 A;  3RCP A;  3FC4 A;  4GB9 A;  2VKI A;  2CU1 A;  2L83 A;  2QIE B;  1P3Q U;  4NPN A;  4BOS C;  4HKZ E;  4M8N A;  2K8B A;  5IP4 D;  4HJK A;  4E71 A;  1FHO A;  2MP2 B;  1SBB B;  2KC2 A;  1J0W A;  1QOA A;  2P0D A;  2IO0 B;  1ZE3 D;  1VD2 A;  2H7D A;  2NMB A;  2VRR B;  2BB6 A;  4D0N B;  1JW9 D;  2C7N B;  2L8J A;  2DIK A;  3SDL C;  1UZX B;  1XQQ A;  1WR6 E;  2WXG A;  4IWQ A;  2W55 A;  1Q0W B;  2EJ8 A;  3T8M A;  1EAZ A;  3DWM A;  3PVU A;  2KMM A;  1FIQ A;  2J52 A;  4NJC A;  2AX5 A;  1L7Y A;  3ML8 A;  5FR6 A;  2QDF A;  1V61 A;  2MFQ A;  2LVP A;  2OOB B;  4YON A;  4JWS C;  4IW0 A;  4DHZ B;  3PP2 A;  3W5V B;  3ZJU A;  4XWX A;  1OEY A;  1U4A A;  3AJ4 A;  2W9N A;  3TCA A;  3VUY A;  4BBN F;  1R7S A;  2LOZ A;  1IPG A;  2DKQ A;  4LJP B;  2G9H D;  3JYU A;  1M7R A;  2K22 A;  3N30 A;  3PT2 B;  5JHA A;  1P1A A;  4O1N A;  1H10 A;  3R2I A;  2PZ1 A;  3AE1 B;  2WNM A;  5C3J B;  3DVG Y;  2KWC A;  1YJJ A;  4MM3 A;  2COF A;  3U12 A;  4HAU B;  3RNC C;  1X1G A;  3WAO A;  1FD6 A;  1FB8 A;  1WGK A;  4TYZ A;  2DYB A;  4B95 A;  2IGD A;  4K2P A;  4JKA A;  3A9J A;  4JWU C;  3OAN A;  2DX5 B;  1D5M C;  3GZN I;  3PPA A;  3NJT A;  3MFG A;  4DQO C;  5CLQ B;  1UWX A;  1AYF A;  3MJW A;  3Q14 C;  1TKG A;  4MSQ B;  3RT3 B;  2DHZ A;  2KZR A;  4NZL B;  3UIO B;  3MC0 B;  4AP4 C;  2GMI C;  3NVW A;  1GAQ B;  3ML4 A;  2Z4D A;  1EWC A;  3AUL A;  2NS5 A;  5EDS A;  2G3Q B;  2KMA A;  2Z0D B;  2CAY A;  3ZVV A;  4ILH A;  2KLC A;  3AMZ A;  3NS1 A;  2LG1 A;  2XNA C;  3TW1 A;  4A3O A;  1N6Z A;  2N9L A;  2UVM A;  1SSN A;  1V8C A;  1YQ4 B;  3DVG X;  4OW0 A;  1AWE A;  2N1W A;  2N9K A;  2IFS A;  3HM3 A;  3GZN B;  2KGX B;  3U52 E;  3FEH A;  2EKI A;  2V9H A;  4A6H A;  3Q3M C;  2K49 A;  4WQM A;  4RM9 A;  3ABV B;  2Q5W D;  2PLP A;  4DWF A;  2KX0 A;  2FJL A;  4FJY A;  1MAI A;  2KUP A;  1RRP B;  2OTX A;  2V3S A;  1HBK A;  2CJN A;  2MH7 A;  1TZO A;  3KVF B;  3UIP B;  1BUI C;  1WE6 A;  1ZPS A;  1NEK B;  2DA0 A;  4KVG B;  1T0Y A;  1XLQ A;  4GDL A;  1VRA B;  3APC A;  3D32 A;  2Y3A A;  3VR8 B;  3A33 B;  1XLP A;  2Y5P A;  1WR1 A;  1K50 A;  2WXH A;  2MKR A;  1HQR D;  3ULC A;  2UYZ B;  4BKT A;  3AEG B;  2C7M B;  3WYF B;  1XX0 A;  2KJR A;  1MG4 A;  1K8R B;  2ACZ B;  1IP9 A;  3A1Q B;  1YMH E;  4LDT B;  2AL6 A;  1ZXI A;  3KUC B;  4C80 A;  2JZP A;  2K6Q A;  1WRI A;  3AH7 A;  3A9K A;  2ZVO A;  3CSF A;  1C4P A;  3P63 A;  2J53 A;  2M0X A;  3BYT B;  3GE3 C;  4P1B C;  2IDY A;  3VAW A;  3JSV B;  4KIK A;  1KF6 B;  5C79 A;  1GNU A;  4DX8 A;  3QBV B;  1J7C A;  1VR9 A;  4MY6 A;  4DXF A;  1P7E A;  1BTN A;  3DOW A;  1DOY A;  2JPH A;  1FM0 D;  1MI1 A;  4ZRP A;  3UZT A;  4K7W A;  5L83 A;  5J2R A;  3A58 A;  2LYD A;  5IA7 A;  1WI0 A;  2AWT A;  3Q3J A;  3OJ3 A;  2RSU A;  2AQ3 B;  1PMS A;  1GB1 A;  3VH3 B;  4ZRI A;  2ON8 A;  2LJI A;  2EMT A;  1EVH A;  4ASW C;  2KVR A;  4MH8 A;  2W2X C;  2NCN A;  1ZVR A;  1F9J A;  1WZ0 A;  1I7H A;  1E90 A;  1N5W A;  2YF0 A;  2YVC A;  4ITK A;  4L1B A;  3MHZ A;  3AE2 B;  4URK A;  1NYR A;  5J18 A;  2D3C A;  2R2Q A;  4IDI A;  1XLN A;  1SXT A;  1V89 A;  3FVC A;  1WVH A;  2Z59 B;  5DIF B;  1JML A;  4ICU A;  4K3B A;  5BMI A;  2MP2 A;  1N63 A;  1CZP A;  2WXJ A;  3B08 A;  4WH4 A;  4HWI B;  1J7B A;  4LK0 M;  5LG4 B;  1WJ4 A;  3H7S A;  3OHM B;  2L1A A;  1PGA A;  4XE0 A;  2WXO A;  2HE7 A;  2LGD A;  2REX A;  3U7Z A;  3RNA C;  1YQ3 B;  1RYJ A;  2KNB A;  3DQV A;  2HTM E;  1XXG A;  4PQ0 A;  4GDK A;  3SO6 A;  3PLV A;  2R09 A;  5IJM A;  2FCQ A;  2IYB A;  4DK5 A;  2Z0Q A;  3BYY B;  1ACC A;  4TQ1 A;  2CY5 A;  2VRW B;  1V9J A;  1M7E A;  1RFA A;  1D6E C;  2WXR A;  2ASQ A;  1TYG B;  2ZZP B;  4KZ0 A;  1XKE A;  1BML C;  4L2Y A;  3KUD B;  1U5G A;  4IC7 B;  3V05 A;  1UBQ A;  3VTV A;  3U8Z A;  4Y94 A;  2CJO A;  1AAR A;  5JVL A;  1NU2 A;  2IBI B;  2M14 A;  1OFF A;  2R0D A;  1SIF A;  1X86 A;  3TVV A;  1V5O A;  4EUT A;  2WXQ A;  2KO3 A;  5D3I B;  4ARI A;  1V88 A;  4DIX A;  1H8C A;  1L2N A;  2ABD A;  1WGH A;  5D3Y A;  2PEA A;  1OQR A;  2C7H A;  2SAK A;  1XCG A;  4J3O D;  1GOZ A;  2VZK D;  2KJH B;  3N7C A;  1KM7 A;  4IKG A;  4NAW B;  2N0Y A;  2C60 A;  1Q67 A;  3IHP C;  4LLG M;  4IFS A;  2L0T A;  2DKP A;  2FE8 A;  2G1E A;  1J7A A;  4P1C C;  3LDZ E;  1X1M A;  3QX1 A;  4HPP A;  2BWF A;  3ODX A;  4GLS C;  2LD9 A;  1CJE A;  3AE8 B;  5J3Q A;  1L6V A;  1RJ2 A;  1NYQ A;  5EFX A;  3JVZ X;  3T3N A;  3P4Q B;  3PVW A;  2BYE A;  4B6H A;  5FI0 A;  4YTP B;  1C4C A;  2LGS A;  2H7E A;  2BB5 A;  2KDF B;  1YJI A;  1HB8 A;  1L4Z B;  1VBG A;  2DWQ A;  4HJG E;  3TEW A;  4AOF A;  2KTR A;  1VZ7 A;  2M19 A;  2K5P A;  2CS4 A;  4HB2 B;  1IBX A;  4MAC A;  3ALB A;  5BYQ A;  3TIX A;  1T77 A;  2HDE A;  3NWF A;  2MLB A;  4PS7 A;  2GBM A;  1E10 A;  5JHB A;  2R2O A;  4IM0 A;  2UU7 A;  3HUI A;  3QQ8 B;  5BO4 B;  3VXW A;  3DHG C;  2RSG A;  2K2J A;  3SFE B;  4A6Q A;  4A5K A;  2D9W A;  3KWV A;  4TV3 A;  4RFB A;  4ZHO A;  3M62 B;  3NVY A;  2MHJ A;  2VH1 A;  4AQ7 A;  5IRS A;  4FA6 A;  4FAD A;  3SR6 A;  4HCN B;  3RNF C;  4XZ4 A;  1VZ8 A;  4EKU A;  3P4P B;  4JKC A;  1MJD A;  3G9W A;  3ZXR A;  4JK8 A;  4MEM A;  2JF5 A;  3RI7 C;  2KWV B;  2ONQ A;  4WJQ A;  3E56 A;  4JE3 B;  2I5F A;  1JWA D;  1UUP A;  2BWE S;  2LGI A;  5JHH A;  1CQV A;  1PUT A;  1JRU A;  5KQ1 A;  1NTI A;  5DHA B;  2FJU B;  3RFZ B;  3MDB C;  1I4P A;  2KIE A;  2DYM A;  1C76 A;  4CYE A;  4MM3 B;  3SU8 X;  3LXF A;  3SFD B;  2RRF A;  3A9J B;  4BKS A;  4ANV A;  4IM3 A;  3HHM A;  4JKG B;  3A98 B;  1BXT A;  2KDI A;  5HHD G;  3HIZ A;  1DYN A;  2I2Y A;  2RGN B;  2ROZ B;  3PLU A;  1Q5W B;  3QWM A;  3A8Q A;  1M4V A;  2RPV A;  5M4Y B;  3ML9 A;  3EHV A;  4UDU C;  2Z59 A;  2ZPY A;  1SF0 A;  1MG8 A;  2BS3 B;  1MFW A;  2L2I A;  3VUW A;  1WE7 A;  4I6N B;  5IKC M;  3AEE B;  1WYG A;  4GPT B;  5JH5 C;  2KIG A;  3NZ3 A;  4FJV B;  1WXQ A;  5HE3 A;  4ZHP A;  2DHJ A;  2Y7B A;  5CX3 A;  3TL5 A;  4MGI E;  4HAT B;  1MPE A;  2DNF A;  4G11 A;  3BIN A;  1DOX A;  1LFD A;  1YOV B;  2E6X A;  3OJ4 B;  1S1Q B;  1Z5S B;  4K7S A;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  2CHW A;  1TT5 B;  4PYU A;  1F1H A;  3AI5 A;  4FLH A;  2ZW0 A;  1V80 A;  4OZA A;  4L1R A;  1HZ6 A;  2BTE A;  3CF6 E;  2KOX A;  4FHK A;  5D2M B;  2Y8G A;  2J0J A;  1FCC C;  4RGT A;  1TJE A;  3KRW A;  3APF A;  1EF1 A;  4IUM B;  1GJZ A;  2KYW A;  1IUE A;  3H8H A;  4LCD E;  3E9P A;  4MH0 E;  3BK1 A;  1RRB A;  4W9J A;  1RM6 C;  5LNK 1;  1SHC A;  3LJU X;  1E7U A;  5H92 C;  1LXD A;  1I4G A;  3UIN B;  1ZOY B;  4HRS A;  5AZH A;  1TS3 A;  1G6J A;  1VJK A;  4YSY B;  4GMV A;  3DDC B;  2GBN A;  3QCA A;  3GP7 A;  2V4I B;  2KN4 A;  4M02 A;  3NW8 A;  2Z0O A;  3I9V 1;  4HPM B;  4FUL A;  4W9F A;  4KIK B;  2W82 A;  3AU5 A;  2WDT B;  1EO6 A;  4GU2 A;  5HE1 A;  1XCQ L;  1ZC3 B;  4WJ7 A;  4S17 A;  4F7Z A;  1XD4 A;  1FXA A;  4GZU A;  3HM6 X;  3KLS X;  4LNF A;  3N1Y C;  2G45 B;  1SIJ A;  2BYF A;  3L17 A;  2KK8 A;  2GBK A;  3H6N A;  2Q13 A;  2GUM A;  2P0F A;  3TEZ A;  5E6J A;  4M0W B;  1ST7 A;  3PHW B;  1NEN B;  3GS2 A;  3TMP B;  1WX8 A;  2LAS A;  4JKE A;  3UGB B;  1JQ4 A;  1FHX A;  3ZLZ A;  3P7Z A;  3K9P B;  1PDX A;  1GB4 A;  3I3T B;  2DEN B;  3VR9 B;  3AE3 B;  4HCP B;  2WDR B;  4IM2 A;  1QLB B;  2QJL A;  2RDB C;  2GCL A;  2PPH A;  3PHX B;  3DXE A;  2K0P A;  3VHT C;  4A3P A;  5LXH A;  4MDK E;  1A70 A;  4MT7 A;  1NDD A;  1QT9 A;  1PGX A;  2L05 A;  3ZDT A;  1FRD A;  1UBI A;  3FM8 C;  3N3K B;  2RQ1 A;  2YRY A;  4JGH B;  4JKD A;  2X8X X;  4US8 A;  5E6O A;  4KGT A;  2BYV E;  2L1C A;  1KLG D;  1WJ1 A;  5C2T B;  3OWE B;  2DZM A;  2VZK B;  5EE0 A;  2MWS B;  1P9D U;  4KKI A;  4AWJ A;  4GDK B;  1ZXH A;  2K8H A;  5BMH A;  1F2R C;  1SE9 A;  1Q1O A;  1NBF C;  1PYW D;  1TBE A;  1ET9 A;  3B1L X;  4RGM A;  2MBE A;  1SE2 A;  2Y5C A;  3AEC B;  1WFY A;  2HRJ A;  1P98 A;  3NZU A;  2LVQ A;  4EFO A;  4RCO A;  1AWD A;  1Z2M A;  2D3B A;  2WU2 B;  3UF8 A;  4GGQ A;  2BS4 B;  3BVG A;  2RVB B;  4PNK A;  4GOC A;  2INP E;  1QC6 A;  1U5F A;  2CQU A;  3CIR B;  2X0S A;  2FUG 1;  2JWZ A;  1F77 A;  2QKL A;  2NMQ A;  4KHA A;  5IOI A;  5JZE B;  3NUH B;  4H8S A;  1M94 A;  1XO3 A;  2LFI A;  4QJ5 B;  2PIA A;  2WQY B;  3RUL A;  3SV1 A;  3ZVR A;  2KTF A;  3VDZ A;  4FHJ A;  2K8C A;  5GXG B;  2KUQ A;  1V81 A;  3RNB C;  4JKG A;  3C0R B;  3W5U B;  3EEC A;  2DYQ A;  2D9V A;  4XWW A;  1YX5 B;  2CHX A;  3QAR A;  5D3D A;  5CHF A;  4JLC A;  4B0E A;  4WJN A;  3RYT A;  1WJN A;  3IT4 B;  4K3C A;  2COD A;  3PGE A;  3RNE C;  4KHB B;  2KC1 A;  3VVW B;  2LRU A;  4KGS A;  4DHJ D;  2N9P C;  2JVC A;  1Y8R C;  1C4A A;  2PE9 A;  1T5X D;  4HB0 B;  4KDI C;  3DPD A;  2WXK A;  4FXC A;  3ZNZ B;  3ZIM A;  3VH4 B;  4WVF B;  1E9M A;  5G55 A;  2G35 A;  2V76 A;  2XK5 B;  2NR2 A;  2K3U A;  5E6P A;  2W2W A;  1MPH A; 
#chains in the Genus database with same CATH homology
 2DHI A;  3VQI A;  3ZNG C;  1WXA A;  4EJN A;  2KTR B;  2BKR B;  5JHG A;  1WMH B;  3VOQ A;  1WH3 A;  3DVN U;  2EKE C;  2RPQ A;  4BOZ B;  2KDE B;  1FGZ A;  2D10 A;  3NS8 A;  3O96 A;  3M1I B;  1U2B A;  3RZW C;  1WI1 A;  3APD A;  2EMS A;  2KJ6 A;  2IO2 B;  3TBL D;  3V5W A;  2GBR A;  2K00 A;  1UPQ A;  1LW3 A;  4WJO A;  2AEH A;  2CY4 A;  1MIZ B;  2FAZ A;  4MGK E;  3A8P A;  3A4S C;  1ZC4 B;  2I1K A;  3FSS A;  1DDM A;  2RGF A;  4EZL A;  3U30 A;  1N3H A;  2XQN M;  4Z2M B;  4MJS B;  1Z87 A;  1WJ6 A;  5GMV A;  4JK7 A;  2LWP A;  2UZS A;  2WYQ A;  4DHZ E;  5CLL B;  2LOX A;  4W9H A;  3GOE A;  2DYN A;  5AZG A;  3H9D A;  2ADZ A;  5L81 A;  1S3S G;  2DYO A;  4TUU A;  3EPY A;  1XD3 B;  2UZR A;  3L13 A;  2Z0E B;  2ZNV C;  4PS3 A;  4KAX B;  1WIA A;  3T9L A;  1TZ1 A;  2FNJ B;  1PFJ A;  5CTR C;  2J59 M;  2LUE A;  3N32 A;  5AEK B;  2N4F A;  4NNJ B;  2YT0 A;  3IG3 A;  5C6R A;  2KD0 A;  2KQ7 A;  3QC8 B;  5LXI B;  5LLI A;  4TQ0 A;  1FGY A;  2O6V D;  3SYX A;  4BFR A;  2ZNV B;  2FIF A;  1V5T A;  3PSE B;  2I5C A;  3H7P A;  4GIV A;  3RZF A;  2NBV B;  4MGZ E;  3S2A A;  4A6F B;  2WH5 A;  4GSW A;  4JKF A;  3ZNI D;  2O2V B;  3EC8 A;  4CO7 A;  2N7D A;  4IG7 B;  2NPT B;  2MX2 A;  4M8M A;  1WXS A;  1I42 A;  4K17 A;  4JIO U;  2RUK B;  4K2O A;  2GOW A;  1UH6 A;  4DDG D;  2OQB A;  2K25 A;  2CR5 A;  1E5W A;  3WAL A;  2ZEQ A;  3NOB A;  1TJ6 A;  2XK5 A;  1W1D A;  1J0G A;  1TTN A;  3HK0 A;  2KHW B;  4NQK E;  4I6L B;  4HAV B;  3M3J A;  3BJI A;  3R66 C;  2E2X A;  4G3X B;  2LKO A;  3R3M A;  2B3A A;  2G4D B;  4F7H A;  4II3 B;  1WMH A;  5D3X A;  1EUV B;  2L7R A;  3KSY A;  1DDV A;  4F7U P;  4K1R B;  3MHS D;  2CKH B;  2KX3 A;  1KLV A;  1WG7 A;  4E74 A;  1WGR A;  3VTW A;  3FP5 A;  4HAW B;  1HB6 A;  3K9O B;  2BCJ A;  4DDI D;  2FID A;  4DBB A;  5C16 A;  1RAX A;  2MWN B;  2RNR B;  2LZ6 A;  1WX9 A;  4DHJ B;  5TR5 A;  3ZTD A;  5D6J B;  4BBN C;  1X11 A;  4ZRJ A;  2DHK A;  2L0F A;  5DH9 B;  3WAM A;  4MJS A;  2NVU I;  1P5T A;  3ZW3 A;  3IVF A;  5GOW B;  5LON B;  1WXM A;  2KAN A;  2A5U A;  2YSZ A;  4HDO A;  2ELA A;  4WWP A;  2FUH B;  4ZDV A;  3P6A A;  3CXB B;  3PEG A;  2LXA A;  5J3T A;  4ILG B;  3DXC A;  4ANW A;  2ROV A;  3ZRC A;  1UNP A;  3R7Q A;  1UGM A;  5J17 A;  4JKH A;  3PTF C;  5D3V A;  2L76 A;  3MPX A;  5JLJ B;  4F8C B;  2UWQ A;  1OGW A;  5L95 C;  4X57 B;  1QQG A;  4EMO A;  2DFK A;  2MBB B;  2KCJ A;  1P0R A;  2FCN A;  3WIM A;  2P8V A;  3DXD A;  2QKM A;  4DBG A;  5C5B B;  4J6I A;  4KDL B;  5FI1 A;  4W9L A;  2NBU A;  4B6W A;  5E6N A;  3TFM A;  3HQC A;  1WF9 A;  2KLG A;  5DCN A;  1WGD A;  4ZYN A;  4A6F A;  2N7E A;  2D9Y A;  2KWU B;  1K5D B;  1GG3 A;  3QAQ A;  1NI2 A;  2O2V A;  1E8W A;  2FJ9 A;  1MKE A;  3PVL A;  3SBT A;  2NPT A;  4MGY E;  1GGO A;  1IRS A;  2C5L C;  3QA8 A;  1TGZ B;  2K39 A;  1BAK A;  3L08 A;  4A20 A;  1U29 A;  4NY0 A;  2MDX A;  1YIW A;  4KV2 A;  2PJH A;  3W1S C;  2DN6 A;  1U27 A;  2AYO B;  1B55 A;  3PRE A;  1TQZ A;  3L54 A;  3PS6 A;  1V5P A;  3PG7 A;  1UEL A;  1NTY A;  3ZDM C;  2I1J A;  1FAO A;  1UNR A;  3NHE B;  1BTK A;  2O6V B;  3QK0 A;  1LM8 B;  1XT9 B;  3AU4 A;  1YQB A;  3V6E B;  2DTC A;  1WGU A;  1WM2 A;  1ZM0 A;  1X05 A;  2K2U A;  1ISN A;  1X1F A;  2JT4 B;  1MK9 B;  1DRO A;  2KFK B;  2LGX A;  2J0K A;  3ONS A;  5C23 A;  3QWZ B;  4WWN A;  2M1M A;  4JK9 A;  2K6D B;  2DAF A;  2BGF A;  4RM8 A;  1E8X A;  4W9C A;  1OTR B;  3F5R A;  2FCS A;  2KXJ A;  1EGX A;  2KDB A;  2R82 A;  5DI9 B;  3D8E A;  3H1U A;  4P7I A;  4B9K A;  4IAP A;  3ZUN A;  3ENB A;  3QHT A;  2Z0P A;  2M4N A;  2CRF A;  2COC A;  3RCZ A;  4WSF A;  3H7P B;  1NVL A;  2GBJ A;  2WWZ A;  3W1Y A;  2J7Q B;  4FN2 A;  3R7R A;  2D9Z A;  1V49 A;  3ECI A;  4ICV A;  5G2N A;  1OQY A;  4EZK A;  2BPS A;  2KN5 A;  1K5G B;  4WWO A;  2M17 A;  1GUA B;  3RD2 A;  1KOT A;  5JP4 A;  3QJZ A;  2XEW A;  1YJ1 A;  5DPT A;  1RLF A;  3FLV A;  1WRD B;  4XC2 A;  2DZI A;  1A5R A;  5HKH A;  2MSE D;  1E7V A;  4ANX A;  1BWN A;  3DVN V;  2LUL A;  2COP A;  3VIA A;  4NJ6 A;  5KHQ A;  4HB4 B;  4EOY A;  2C9W B;  1J8C A;  3KYC D;  1W1H A;  3WA0 A;  3KW5 B;  3M63 B;  1KJT A;  1OY2 A;  4ILJ A;  1U5D A;  1NTV A;  1ZGU B;  2COA A;  2JUO A;  2DAJ A;  1OEY J;  3ZTC A;  1DDW A;  2HD5 B;  2KQS A;  1P3R A;  4XX5 A;  5C5B A;  3VUX A;  2YS1 A;  3IBE A;  2HTH A;  5D94 A;  4LJO B;  1I35 A;  4JL9 A;  3RUI B;  1C3T A;  4N9F 4;  4TKN A;  2BKF A;  4W9D A;  3L10 B;  3X0W A;  1UNQ A;  2N9X A;  2NZ8 B;  3V61 A;  3GYP A;  2YS3 A;  2DX1 A;  1KZ7 A;  3BY4 B;  1E8Z A;  4W9E A;  2LBB A;  2MQJ A;  2D4Q A;  1PLS A;  5KHO A;  4ANU A;  3PV1 A;  2P0H A;  4HLE A;  1UPR A;  1U5E A;  3VTU A;  2G4S A;  3P2B A;  1I7A A;  4JKB A;  4BVU C;  1WX7 A;  4W9G A;  2D11 A;  2ZPN A;  4RMA A;  3X23 A;  1FXT B;  2AL3 A;  1DIK A;  4HAZ B;  2JY6 A;  5DPW A;  3M95 A;  1WY8 A;  1UD7 A;  2ZCB A;  1MIX A;  2O6V A;  4L6E A;  4I6P A;  1SGH A;  3D8F A;  4CHJ A;  4OVU A;  1JDE A;  5DPS A;  1YX6 B;  4HAX B;  3DBS A;  2L00 B;  1J19 A;  2PE6 B;  2X18 A;  4MSM B;  2BF8 B;  2KFK A;  3W1S A;  2D2Q A;  4KSK C;  2LJ5 A;  3ZNH B;  3TJP A;  2MCN B;  4WQO B;  3DBR I;  1MK7 B;  3ZO5 B;  1E8Y A;  3CST A;  4HPL B;  3OLM D;  1ZKH A;  3D8D A;  4FJZ A;  2YLM A;  4IWO A;  1LQB A;  2GCJ A;  2V1Y A;  4NSW A;  3IFW B;  4HVB A;  4WAA A;  4NJ7 A;  4C0A A;  3V62 A;  1KC7 A;  1V6E A;  4PYZ A;  4AJW A;  2N23 A;  3NSU A;  2LI5 A;  4EEW A;  2DLW A;  3SNH A;  2JXX A;  2ELB A;  1R4N I;  5C1Z A;  3TO1 A;  1C1Y B;  4E3C A;  1FOE A;  3B0A A;  1PQS A;  2IY1 B;  3LJ3 A;  3OAW A;  3A4R A;  4YL8 A;  4HB3 B;  2XBB C;  2DZJ A;  3PRP B;  4KSL C;  4NQL B;  2ZJD A;  3KRX A;  4HXD A;  2KMC A;  2M8S A;  3PRM B;  3SUZ A;  2IY0 B;  3V6C B;  1HE8 A;  3VFK A;  1TXD A;  1BT0 A;  1YD8 U;  5J3Y A;  1V5M A;  2RLO A;  1DBH A;  1VCB A;  1D3Z A;  2DX5 A;  1VBH A;  3ODO A;  3AXC A;  5DPR A;  5CHW A;  3L16 A;  5DHF B;  4HK2 A;  4IOY X;  3T06 A;  1ACA A;  2A4Z A;  1FHW A;  5IAA C;  2ZVN A;  1OQN A;  1P6S A;  5D7G A;  4HAY B;  3WAP A;  2L3Z A;  1XR0 B;  1R4M I;  4Z2N A;  2MBH A;  2IZV B;  4AJY B;  3ULB A;  2JP2 A;  2DZK A;  3KYD D;  1OMW A;  3O65 B;  3E66 A;  4IWP A;  4FBJ B;  1W1G A;  2WX0 A;  3ODW A;  4K81 A;  3MTN B;  2JRI B;  4K7U A;  1Y5O A;  5HE2 A;  1ZSQ A;  5CHV C;  3CMM B;  3Q3F A;  2CB8 A;  5D27 A;  1ZW7 A;  4HDQ A;  3DBL I;  2FCM A;  2RD0 A;  3CIK A;  2YS5 A;  3KY9 A;  5AZF A;  4EZJ A;  3A1Q A;  3E9L A;  1WGQ A;  4G0N B;  2MBO A;  4G50 A;  3ZRF A;  2IO1 B;  2MW5 A;  3NY5 A;  2IO3 B;  4DXA B;  4MEL A;  4F7G A;  3L0W B;  3F0W A;  2K1F A;  3QIJ A;  3JSV A;  2LGY A;  3SHQ A;  2QHO A;  2J0M A;  4ZRK A;  3WAN A;  3JW0 X;  4KZC A;  2ZCC A;  4A6K A;  1CMX B;  4HHV A;  3EFU A;  4BKG A;  3KUZ A;  1V2Y A;  2D07 B;  1WGY A;  2GS0 A;  1XOD A;  4WJP A;  4CHK A;  1WJM A;  2LVO A;  1WGG A;  1H4R A;  2NBW B;  4LDT D;  1GC6 A;  2FDQ A;  4DX9 0;  1WM3 A;  2VSZ A;  3PZD A;  2MA9 B;  3GYO A;  3UQA A;  4GXB A;  2CHZ A;  3KH0 A;  1V86 A;  4BBK A;  3ENE A;  3KZ1 A;  3SD5 A;  3HW2 B;  1AQC A;  2HTH B;  1QZE A;  2JZZ A;  1IYF A;  3DCG A;  5KQ4 A;  4PS8 A;  2EC1 A;  1WXV A;  2Y5B B;  4MK0 A;  2MRP A;  4F1S A;  2KKC A;  5D3W A;  4JQW C;  3UQB A;  1I2H A;  1KBL A;  2Y8F A;  3PSC A;  2IYD B;  2D9X A;  4GDL B;  3U7D A;  1KZG A;  2V4L A;  2YT1 A;  1KI1 B;  5LOP B;  1WYW B;  5KCV A;  2MBQ A;  4II2 B;  2JRH A;  2OJR A;  4GMX B;  2KFJ A;  2LRW A;  4W9I A;  4NAW A;  3A9K B;  1Y19 B;  2W2X D;  4AUQ C;  2LXC A;  2WX1 A;  3NZS A;  2M38 A;  1WJU A;  2D3G A;  1LB1 A;  2RR9 A;  4CHM A;  2N9E B;  3DBH I;  3E9O A;  4W9K A;  1EF5 A;  4KHO A;  1UEF A;  5HE0 A;  2HJ8 A;  2GJY A;  3PRZ A;  1V5U A;  3SBG A;  2JZ3 B;  2N1V A;  1GC7 A;  4OVV A;  4GN1 A;  3RCP A;  4GB9 A;  2VKI A;  2CU1 A;  1P3Q U;  4NPN A;  4BOS C;  4M8N A;  2K8B A;  4HJK A;  4E71 A;  1FHO A;  2MP2 B;  2KC2 A;  1J0W A;  2P0D A;  2IO0 B;  1VD2 A;  2H7D A;  2NMB A;  2VRR B;  4D0N B;  2C7N B;  2L8J A;  2DIK A;  3SDL C;  1UZX B;  1XQQ A;  1WR6 E;  4IWQ A;  1Q0W B;  2EJ8 A;  3T8M A;  1EAZ A;  3PVU A;  1L7Y A;  3ML8 A;  5FR6 A;  1V61 A;  2MFQ A;  2LVP A;  2OOB B;  4YON A;  4IW0 A;  4DHZ B;  3PP2 A;  4XWX A;  1OEY A;  1U4A A;  3AJ4 A;  2W9N A;  3TCA A;  3VUY A;  4BBN F;  2LOZ A;  1IPG A;  2DKQ A;  4LJP B;  3JYU A;  1M7R A;  3N30 A;  3PT2 B;  5JHA A;  1P1A A;  1H10 A;  2PZ1 A;  3DVG Y;  2KWC A;  4MM3 A;  2COF A;  4HAU B;  1X1G A;  3WAO A;  1FB8 A;  4TYZ A;  2DYB A;  4B95 A;  4K2P A;  4JKA A;  3A9J A;  3OAN A;  2DX5 B;  3GZN I;  3PPA A;  5CLQ B;  3MJW A;  4MSQ B;  3RT3 B;  2DHZ A;  2KZR A;  3UIO B;  4AP4 C;  2GMI C;  3ML4 A;  3AUL A;  2NS5 A;  5EDS A;  2G3Q B;  2KMA A;  2Z0D B;  2CAY A;  3ZVV A;  4ILH A;  2KLC A;  2LG1 A;  3TW1 A;  4A3O A;  2UVM A;  3DVG X;  1AWE A;  2N1W A;  2IFS A;  3HM3 A;  2KGX B;  3FEH A;  4A6H A;  4RM9 A;  4DWF A;  2KX0 A;  2FJL A;  4FJY A;  1MAI A;  2KUP A;  1RRP B;  2OTX A;  2V3S A;  1HBK A;  3KVF B;  3UIP B;  1WE6 A;  2DA0 A;  4KVG B;  1T0Y A;  4GDL A;  3APC A;  3D32 A;  3A33 B;  1WR1 A;  2MKR A;  3ULC A;  2UYZ B;  4BKT A;  2C7M B;  3WYF B;  1XX0 A;  2KJR A;  1K8R B;  1IP9 A;  3A1Q B;  4LDT B;  2AL6 A;  3KUC B;  2K6Q A;  3A9K A;  2ZVO A;  3CSF A;  2M0X A;  3VAW A;  3JSV B;  4KIK A;  5C79 A;  1GNU A;  4DX8 A;  3QBV B;  4MY6 A;  1BTN A;  3DOW A;  2JPH A;  3UZT A;  4K7W A;  5L83 A;  5J2R A;  2LYD A;  5IA7 A;  1WI0 A;  2AWT A;  3Q3J A;  3OJ3 A;  2RSU A;  1PMS A;  3VH3 B;  4ZRI A;  2EMT A;  1EVH A;  4ASW C;  2KVR A;  2W2X C;  2NCN A;  1ZVR A;  1F9J A;  1WZ0 A;  1E90 A;  2YF0 A;  2YVC A;  4URK A;  5J18 A;  2R2Q A;  1V89 A;  1WVH A;  2Z59 B;  5DIF B;  4ICU A;  2MP2 A;  3B08 A;  4HWI B;  1WJ4 A;  3H7S A;  2HE7 A;  2LGD A;  2REX A;  2KNB A;  3DQV A;  4PQ0 A;  4GDK A;  3SO6 A;  3PLV A;  2R09 A;  5IJM A;  2FCQ A;  2IYB A;  4DK5 A;  2Z0Q A;  4TQ1 A;  2CY5 A;  2VRW B;  1V9J A;  1M7E A;  1RFA A;  2ASQ A;  2ZZP B;  4KZ0 A;  1XKE A;  3KUD B;  1U5G A;  4IC7 B;  1UBQ A;  3VTV A;  3U8Z A;  4Y94 A;  1AAR A;  5JVL A;  1NU2 A;  2IBI B;  2M14 A;  2R0D A;  1SIF A;  1X86 A;  3TVV A;  1V5O A;  4EUT A;  2KO3 A;  1V88 A;  1H8C A;  1L2N A;  2ABD A;  1WGH A;  5D3Y A;  2PEA A;  2C7H A;  1XCG A;  2KJH B;  3N7C A;  1KM7 A;  4NAW B;  2N0Y A;  2C60 A;  1Q67 A;  3IHP C;  4IFS A;  2L0T A;  2DKP A;  3LDZ E;  1X1M A;  3QX1 A;  2BWF A;  3ODX A;  2LD9 A;  5J3Q A;  1RJ2 A;  5EFX A;  3JVZ X;  3PVW A;  2BYE A;  4B6H A;  5FI0 A;  2H7E A;  2KDF B;  1HB8 A;  1VBG A;  4AOF A;  2KTR A;  2CS4 A;  4HB2 B;  3ALB A;  3TIX A;  2MLB A;  4PS7 A;  2GBM A;  5JHB A;  2R2O A;  4IM0 A;  3QQ8 B;  5BO4 B;  3VXW A;  2RSG A;  2K2J A;  4A5K A;  2D9W A;  4TV3 A;  3M62 B;  4FA6 A;  4FAD A;  4HCN B;  4XZ4 A;  4EKU A;  4JKC A;  3G9W A;  4JK8 A;  4MEM A;  2JF5 A;  2KWV B;  4WJQ A;  2I5F A;  2BWE S;  5JHH A;  1JRU A;  5KQ1 A;  1NTI A;  5DHA B;  3MDB C;  2DYM A;  4CYE A;  3SU8 X;  4BKS A;  3A9J B;  4ANV A;  4IM3 A;  3HHM A;  4JKG B;  3A98 B;  2KDI A;  3HIZ A;  1DYN A;  2RGN B;  2ROZ B;  3PLU A;  1Q5W B;  3QWM A;  3A8Q A;  3ML9 A;  3EHV A;  2ZPY A;  1MG8 A;  2L2I A;  3VUW A;  1WE7 A;  4I6N B;  4GPT B;  5JH5 C;  4FJV B;  5HE3 A;  2DHJ A;  2Y7B A;  5CX3 A;  3TL5 A;  4MGI E;  4HAT B;  4G11 A;  3BIN A;  1LFD A;  3OJ4 B;  1S1Q B;  1Z5S B;  4K7S A;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  2CHW A;  4PYU A;  3AI5 A;  4FLH A;  1V80 A;  3CF6 E;  2KOX A;  4FHK A;  5D2M B;  2Y8G A;  2J0J A;  3KRW A;  3APF A;  1EF1 A;  4IUM B;  1GJZ A;  4LCD E;  3E9P A;  4MH0 E;  1RRB A;  4W9J A;  1SHC A;  3LJU X;  1E7U A;  1LXD A;  3UIN B;  5AZH A;  1G6J A;  4GMV A;  3DDC B;  2GBN A;  3QCA A;  2Z0O A;  4HPM B;  4FUL A;  4W9F A;  4KIK B;  3AU5 A;  2WDT B;  1EO6 A;  4GU2 A;  5HE1 A;  1ZC3 B;  4WJ7 A;  4F7Z A;  1XD4 A;  4GZU A;  3HM6 X;  2G45 B;  2BYF A;  3L17 A;  2KK8 A;  2GBK A;  3H6N A;  2Q13 A;  2P0F A;  4M0W B;  1ST7 A;  3PHW B;  3TMP B;  1WX8 A;  2LAS A;  4JKE A;  3UGB B;  1FHX A;  3ZLZ A;  3P7Z A;  3K9P B;  3I3T B;  2DEN B;  4HCP B;  4IM2 A;  2GCL A;  2PPH A;  3PHX B;  3DXE A;  3VHT C;  4A3P A;  5LXH A;  4MDK E;  4MT7 A;  1NDD A;  2L05 A;  3ZDT A;  1UBI A;  3FM8 C;  3N3K B;  2RQ1 A;  2YRY A;  4JGH B;  4JKD A;  5E6O A;  2L1C A;  2BYV E;  1WJ1 A;  2DZM A;  2MWS B;  1P9D U;  4AWJ A;  4GDK B;  2K8H A;  1SE9 A;  1Q1O A;  1NBF C;  1TBE A;  3B1L X;  2MBE A;  2HRJ A;  3NZU A;  1P98 A;  1WFY A;  2LVQ A;  4EFO A;  1Z2M A;  3UF8 A;  4GGQ A;  2RVB B;  4PNK A;  4GOC A;  1QC6 A;  1U5F A;  2CQU A;  2X0S A;  2JWZ A;  2QKL A;  4KHA A;  5JZE B;  4H8S A;  1M94 A;  3RUL A;  3SV1 A;  3ZVR A;  2KTF A;  3VDZ A;  4FHJ A;  2K8C A;  1V81 A;  4JKG A;  3C0R B;  3EEC A;  2DYQ A;  2D9V A;  1YX5 B;  2CHX A;  3QAR A;  5CHF A;  4JLC A;  4WJN A;  3RYT A;  1WJN A;  2COD A;  3PGE A;  4KHB B;  2KC1 A;  3VVW B;  2LRU A;  4DHJ D;  2N9P C;  2JVC A;  1Y8R C;  2PE9 A;  4HB0 B;  4KDI C;  3DPD A;  3ZIM A;  3ZNZ B;  3VH4 B;  4WVF B;  5G55 A;  2G35 A;  2V76 A;  2XK5 B;  2NR2 A;  5E6P A;  2W2W A;  1MPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...