3IVFA

Crystal structure of the talin head ferm domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
358
Chain Sequence
VALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the talin head reveals a novel extended conformation of the FERM domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Talin-1
total genus 101
structure length 358
sequence length 368
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3ivfA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ivfA04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA02
1N3HA 4H8SA 4CHKA 5IA7A 2QKLA 2J0MA 4KHBB 2IO1B 1I42A 4DX90 1IPGA 2X18A 4HDQA 3DBRI 2RUKB 3L0WB 1VD2A 4MY6A 1WRDB 5JP4A 4W9DA 3N7CA 5LOPB 1LM8B 2G4DB 2YLMA 2M14A 2V76A 1OEYA 2DYMA 2L76A 1WMHB 2D9VA 4K81A 4PS7A 1XKEA 3A8PA 2D10A 2LOXA 1J0WA 1OEYJ 3DXDA 1UH6A 2RD0A 2BYFA 3SD5A 4PS8A 3ODWA 1WR1A 2ZJDA 1Y19B 2ABDA 2XQNM 2Z0OA 2LZ6A 2NBUA 4II2B 1U29A 4ANWA 2O6VD 3UQAA 2NPTA 4W9JA 1GJZA 1PMSA 1WJMA 1V6EA 2BKFA 5C16A 2NVUI 3R66C 1AARA 4GMVA 5D7GA 2OTXA 1YX5B 5HE1A 2IZVB 2KHWB 4FJZA 3UGBB 4K2OA 3QK0A 2FUHB 3P2BA 3RCZA 1X05A 4E74A 2CHZA 3P6AA 4K2PA 1UBIA 3DBSA 4HXDA 4OVVA 3WALA 2A5UA 2KJ6A 2LRWA 1RFAA 1UD7A 1ACAA 2LD9A 2ELAA 1Q0WB 1OMWA 1YIWA 2RGFA 3HQCA 2D3GA 1UEFA 5CHFA 3RUIB 2CAYA 3A33B 3UZTA 2VSZA 2IYDB 4C0AA 1MIZB 1WH3A 2KK8A 2RLOA 3QCAA 2FDQA 5HE3A 2JRHA 2N1VA 5D2MB 3EFUA 5E6OA 5C79A 4WWOA 2LYDA 1MK9B 1L7YA 4HPMB 1Z2MA 3V60A 3UQBA 3H7SA 2EJ8A 2KQSA 4AWJA 2C7HA 1H8CA 3K9PB 1BT0A 5E6NA 3RD2A 4PYUA 3I3TB 1XD3B 2GBRA 3VDZA 5JH5C 3TFMA 5CHWA 2E2XA 1UPQA 4OVUA 1P98A 3VUYA 1SIFA 4EOYA 3VXWA 1E8WA 5DHFB 4FA6A 1RJ2A 3D8EA 4BFRA 1GC7A 1CMXB 1WJ6A 4J6IA 2WX0A 3EECA 3G9WA 3HHMA 2L0TA 1RRPB 3GYPA 1GG3A 4TKNA 4KV2A 3ZIMA 1NVLA 2WX1A 2GS0A 4FADA 4GDKA 4FLHA 3ULCA 3OLMD 3GOEA 4HPLB 1AQCA 2KOXA 1Q1OA 2P0HA 2CKHB 3ML8A 4Z2NA 2DHIA 4I6PA 3U30A 4MEMA 3ZVVA 1WXMA 2YVCA 1WFYA 3PLUA 4F7GA 1U5FA 1SHCA 2MCNB 3ZDMC 2P0DA 3TCAA 2J0KA 1T0YA 2K6DB 1Y5OA 2BYEA 2CQUA 3AI5A 4JLCA 4WJPA 4MT7A 2COAA 4WJ7A 2GBKA 1A5RA 3UF8A 4HAUB 3AU4A 4TV3A 4WJNA 4IUMB 2GBMA 3KVFB 2KVRA 1OGWA 2HTHB 3NHEB 2LASA 2RSGA 1BAKA 2PJHA 1KM7A 2JF5A 3CMMB 3DBLI 3ZW3A 3ALBA 4MH0E 1KZ7A 3QARA 3H1UA 1P5TA 2YRYA 2HJ8A 2D9WA 1WGYA 2LRUA 3CIKA 1WXVA 2LG1A 3GYOA 2C5LC 4W9HA 4IM0A 2V3SA 2KQ7A 2FNJB 4HB0B 4MGKE 4D0NB 1XT9B 5AZHA 3F5RA 1KJTA 2D9XA 4ZRJA 2KTFA 4K17A 1HB8A 4B6WA 1FHOA 3DPDA 4DX8A 4LJPB 1MG8A 2HRJA 1I2HA 1P3RA 2NCNA 1R4MI 2BYVE 2DTCA 3B1LX 4GZUA 2RR9A 4A6FB 1FGYA 2FIDA 2AYOB 3VH4B 3A98B 3PSCA 3D32A 2UZRA 2XEWA 3DVNV 4KSKC 1UZXB 5CLQB 1KOTA 2KGXB 1F9JA 2ASQA 4MJSA 2AEHA 2KO3A 2M8SA 3AJ4A 1RRBA 2P0FA 1U5GA 2UVMA 2CHXA 3QIJA 2K00A 4G0NB 1EO6A 4GOCA 4NJ6A 4EZJA 4EZKA 2LOZA 1WZ0A 3PSEB 1WM3A 2COCA 2DZIA 4BBNF 5G55A 4CHMA 3HK0A 2LXAA 4K7SA 1WJUA 3VQIA 1EVHA 2Q13A 2EKEC 2KX3A 3CF6E 2O2VB 1MAIA 2YSZA 3GZNI 3VTWA 1WI1A 1EAZA 3MTNB 2PEAA 3PREA 4ANUA 5JZEB 4MDKE 2REXA 2KANA 3VHTC 2ZEQA 1RLFA 3BINA 4GN1A 4FJYA 3O96A 2XBBC 3JW0X 4NY0A 1QZEA 1WE7A 1WX8A 4AJYB 2L8JA 5J2RA 1XX0A 3PVLA 1UELA 4FBJB 3WA0A 4A5KA 2KD0A 3A9KB 1OQYA 3LDZE 2DENB 5AZFA 2J0JA 1ZM0A 1C1YB 2O6VA 2RQ1A 4ZRKA 1BTNA 3MDBC 2XK5A 1E7UA 1UNRA 2ZCBA 4EFOA 1KZGA 3VVWB 4DHZB 4G3XB 1UBQA 1DBHA 1WX9A 1E7VA 4A6KA 2PPHA 2V4LA 1YD8U 3QJZA 4IM3A 2LVPA 2KWVB 3RULA 1FHWA 2Z0QA 5KQ4A 3PRPB 5FR6A 4FJVB 2O2VA 3KYDD 2KKCA 2MBQA 3AULA 1WF9A 1KLVA 4IFSA 1J8CA 3KRWA 2AL3A 3PVWA 2BWES 2WDTB 4LCDE 4G50A 2R2QA 5DH9B 1WGGA 3VH3B 3A4SC 3ZKJC 3EPYA 4MM3A 2YS3A 2K8CA 2B3AA 2PE6B 4DK5A 5KCVA 4Y94A 2JXXA 3Q3FA 2YF0A 5EDSA 1ISNA 2MKRA 4CHJA 3APCA 2LKOA 3V5WA 2GMIC 2MP2A 2Z0DB 3WIMA 4DDID 4HWIB 4MK0A 2KDBA 1WI0A 3L16A 3ECIA 5CHVC 1V86A 3QC8B 2N9EB 5JHBA 4F7HA 2MSED 4HHVA 2M17A 2KDIA 2QHOA 5CX3A 2KLGA 4DXAB 4FN2A 2LGXA 3D8DA 2GBNA 2DX5B 5DPRA 3VUWA 2DN6A 4ASWC 3ZRCA 4E3CA 1G6JA 2VKIA 1FOEA 4GXBA 5FI0A 3SYXA 2KMAA 2LJ5A 4DHJB 2DAJA 2DYNA 3A9JA 4HCNB 4HAXB 4KZ0A 4GMXB 2ZPNA 4BOSC 5HE0A 4WWNA 4M8NA 3WAOA 1NI2A 1W1HA 2FCNA 2K8HA 4MGZE 1HB6A 3RZFA 3ULBA 1GUAB 3B08A 2RSUA 3PPAA 2FAZA 2LXCA 3UIOB 2BCJA 2JP2A 2I5FA 5DIFB 2LI5A 3APDA 5D3XA 5DPSA 3QHTA 1NU2A 4W9FA 4KIKB 1I7AA 3ZTCA 4ZDVA 2RPQA 5J18A 2KN5A 4HJKA 2I5CA 1DDVA 3VOQA 4IWPA 4EUTA 1S1QB 4YONA 1U5EA 3DBHI 2M4NA 2KLCA 3L08A 2LBBA 3V6CB 2K2UA 2FJ9A 3LJUX 4F7UP 1TZ1A 1LFDA 2IO2B 1NTYA 1TQZA 1V61A 4EMOA 4HK2A 4MSMB 4AJWA 4HB2B 1V5OA 2L00B 3AU5A 2EMTA 1P9DU 1XODA 2IO3B 2L0FA 5LXIB 3PRMB 3OANA 2L2IA 3KZ1A 5AEKB 3V6EB 2KNBA 3NS8A 1LW3A 4BOZB 2BKRB 2BF8B 1PFJA 4BVUC 2Y7BA 1M94A 1P1AA 1V88A 1WM2A 2ZNVB 3A1QA 4HCPB 2IY0B 2MP2B 3RCPA 2J7QB 2RNRB 2LULA 2W2XC 3QWMA 1YJ1A 3OAWA 4N9F4 1VCBA 2Y8GA 2COPA 2G35A 2NMBA 2J59M 2JZ3B 2K8BA 1Z87A 2MA9B 2ZNVC 1WGRA 1QC6A 2GOWA 3JYUA 4JL9A 5IAAC 5KHOA 1E90A 1V9JA 2KJRA 4NNJB 4BKSA 3MPXA 4W9EA 5TR5A 3ZTDA 5CLLB 5C5BA 4BKGA 4EZLA 1TXDA 5DPTA 3TBLD 4BKTA 3R7QA 1FB8A 1MPHA 2GCJA 2KCJA 2M38A 3CXBB 4HAYB 1E8XA 1XR0B 2KTRA 3KRXA 3ONSA 4JIOU 3SDLC 3ZNID 3QX1A 3FSSA 2G45B 4BKSD 4PS3A 3KSYA 4HAWB 2KDFB 4JQWC 5D94A 3UINB 4URKA 2O6VB 1E8YA 1M7RA 5J3TA 2OQBA 2JZZA 1AWEA 2FCSA 4IAPA 3X23A 4RM8A 4KDIC 2C7MB 3PT2B 3T8MA 2CRFA 5D3VA 4BBKA 4IM2A 4WWPA 1DROA 2W9NA 2DYQA 3M95A 4HATB 3VIAA 4X57B 1ZW7A 4ANXA 3TL5A 3T06A 2L3ZA 1LB1A 4W9KA 4ZRIA 1IRSA 2EC1A 2ROZB 2HD5B 3AXCA 5C1ZA 5LONB 4RM9A 4E71A 3W1SC 2NZ8B 3ODXA 3KUDB 2DFKA 4I6NB 3W1YA 3MJWA 4A20A 4HB3B 2W2XD 3SO6A 1X1MA 2NS5A 3A9JB 4FHJA 4WAAA 5KHQA 2N0YA 1J19A 3F0WA 2JUOA 3APFA 3IBEA 4K7UA 2C60A 1V81A 1J0GA 3PEGA 1NDDA 3IFWB 4W9GA 2W2WA 2D2QA 2JVCA 4F1SA 2R09A 1E8ZA 3RT3B 4XWXA 4KHAA 3DVGY 2UZSA 3KH0A 4WQOB 5G2NA 3PVUA 1DDWA 2HE7A 3NZSA 1ST7A 4WJQA 4A6FA 2KC1A 1PQSA 2Z0EB 2Y8FA 2IBIB 5C6RA 2N23A 2DZJA 2NR2A 1WIAA 2WYQA 1JRUA 3DDCB 2K2JA 4B6HA 3HM6X 1MKEA 1ZVRA 4KHOA 4EKUA 3KW5B 2KX0A 1BTKA 4I6LB 2Z59B 1DYNA 1YQBA 4DBBA 2DYBA 2MBOA 2JWZA 2CB8A 3IVFA 2WWZA 3DCGA 3SHQA 4DHZE 3FLVA 1HBKA 2MDXA 1S3SG 2KFKB 3WYFB 3K9OB 2EMSA 4TQ0A 1I35A 4KSLC 4YL8A 4HB4B 2H7DA 2ADZA 1OTRB 4RMAA 3TMPB 5D27A 3VTVA 1C3TA 3A1QB 4NQKE 4GDLB 5EFXA 2MWSB 4PQ0A 1NTIA 4IOYX 1WGUA 2D4QA 3N32A 3B0AA 4GSWA 2MWNB 2MBEA 1OY2A 1KI1B 3PHWB 1WZ3A 3PZDA 2D11A 2UYZB 5AZGA 1WY8A 2CR5A 1EF1A 5GOWB 5DHAB 2YS1A 4HAZB 5HE2A 5JHGA 2NBWB 3Q3JA 2KDEB 3PS6A 4EJNA 3QQ8B 1V89A 3L10B 3FEHA 3O65B 1X11A 3SV1A 1H10A 4LDTD 2BPSA 2N9XA 3HIZA 4MSQB 2KFJA 3PV1A 4ICVA 2D07B 3PG7A 3FM8C 5JHAA 1WGQA 1UNQA 4NSWA 2RGNB 5LLIA 1NTVA 1UNPA 2ROVA 4W9IA 2DYOA 1V80A 2K6QA 3PLVA 2MX2A 1BWNA 3A8QA 1TBEA 1U4AA 4KIKA 3VUXA 1W1DA 3ENEA 3PTFC 4MJSB 4AUQC 2JY6A 2L1CA 2DA0A 2D9ZA 4WJOA 3TIXA 1SGHA 1X1GA 2N7DA 4M8MA 2KWCA 1WXSA 3DOWA 1X1FA 4JGHB 2I1JA 3VAWA 1K5DB 3SNHA 1WMHA 2KWUB 2MRPA 4GPTB 2V1YA 4GU2A 2LVOA 3N30A 5CTRC 3VTUA 4LJOB 5GMVA 1K8RB 3EC8A 3NZUA 4B95A 1V2YA 1HE8A 3BJIA 4W9LA 2LVQA 3P7ZA 3QBVB 3TW1A 3TVVA 3IHPC 3N3KB 4WSFA 3A4RA 4K1RB 3DXCA 2ZZPB 3U8ZA 2KFKA 3NY5A 1LXDA 2IO0B 1WR6E 3ZNGC 2R2OA 2D9YA 2ZVOA 1Y8RC 2I1KA 1ZKHA 3ZUNA 3H9DA 1V5TA 2K1FA 3H7PA 5LXHA 3HM3A 3PRZA 5DI9B 3FP5A 1ZC4B 2DKQA 2BWFA 4GGQA 1Z5SB 3M3JA 5DCNA 4F7ZA 1TJ6A 3ZVRA 2KXJA 3JSVA 4KZCA 2KJHB 3W1SA 1H4RA 1TGZB 5D3WA 2JPHA 4GB9A 2DX1A 3WANA 4A3PA 4DBGA 1UGMA 2LWPA 1X86A 4AOFA 1ZSQA 2IYBA 2G4SA 1P6SA 1EGXA 2NPTB 2ZCCA 2CS4A 3D8FA 3KUZA 4NPNA 1U2BA 2PZ1A 3PGEA 3TJPA 1WJ4A 1WX7A 4LDTB 1XCGA 4IC7B 1P0RA 5L83A 2N1WA 4WVFB 1PLSA 3DVGX 4CO7A 3ZNHB 4II3B 3QAQA 2CY4A 1LQBA 2GBJA 2DZKA 3JSVB 3C0RB 1B55A 2LGYA 4IG7B 4M0WB 1WJ1A 2MFQA 2FIFA 3RZWC 5BO4B 5J17A 2JRIB 2DHJA 3H7PB 4GDKB 2DLWA 4CYEA 3DXEA 2G3QB 3OJ3A 3QA8A 4FULA 4NJ7A 2M0XA 1FHXA 4NQLB 3R3MA 5D6JB 3PP2A 1XD4A 3NSUA 1EF5A 3X0WA 3SUZA 4XX5A 4HVBA 2OJRA 3WAMA 4DWFA 3A9KA 1U5DA 2C7NB 2DX5A 1WE6A 2FCMA 2JT4B 2QKMA 2IFSA 3ODOA 1WYWB 2KUPA 3OJ4B 3SU8X 4FHKA 1Q5WB 3MHSD 2YT1A 2DHZA 2MQJA 3KUCB 4G11A 5IJMA 1K5GB 2NBVB 2A4ZA 1D3ZA 1L2NA 2Z0PA 2UWQA 1U27A 1SE9A 3M63B 4PYZA 2DZMA 5C23A 1WXAA 1FAOA 2FCQA 5JHHA 3L17A 4K7WA 4TQ1A 1Q67A 3V62A 1OQNA 4A6HA 5C5BB 3ZO5B 2IY1B 2CODA 2CU1A 2MLBA 2PE9A 4A3OA 1IP9A 2L7RA 1UPRA 4BBNC 2LUEA 1TTNA 1NBFC 4MGYE 4DHJD 2RVBB 2BGFA 4IW0A 1P3QU 2VRRB 4KVGB 5L81A 2DAFA 2N4FA 3IG3A 5DPWA 1WGDA 5D3YA 1W1GA 4PNKA 4GIVA 4HLEA 4NAWB 1YX6B 4Z2MB 3ML9A 4HDOA 1WGHA 2KC2A 2ZVNA 3BY4B 3VFKA 2DHKA 2YT0A 3WAPA 3UIPB 2YS5A 4XZ4A 1V5PA 2LGDA 4XC2A 2K39A 4IWQA 1RAXA 2KZRA 1IYFA 1ZC3B 2GCLA 1GC6A 1DDMA 2XK5B 3KYCD 4ZYNA 2FJLA 3HW2B 2MBHA 2MW5A 3CSTA 3ML4A 4W9CA 4KDLB 5J3QA 4MGIE 5FI1A 1QQGA 2WH5A 4ICUA 1FXTB 1WG7A 3TO1A 2CHWA 4L6EA 5L95C 2K25A 1GNUA 3DQVA 3T9LA 4TUUA 1E5WA 2VRWB 2M1MA 3R7RA 4HAVB 3M1IB 1V49A 4NAWA 4TYZA 2AWTA 4ANVA 2P8VA 1XQQA 2H7EA 2HTHA 2L05A 2Y5BB 4GDLA 2N7EA 1EUVB 3PHXB 5J3YA 4P7IA 1M7EA 1FGZA 1V5MA 5HKHA 2GJYA 5KQ1A 3ZDTA 3LJ3A 3KY9A 1V5UA 3NOBA 4IWOA 4F8CB 3DVNU 3V61A 1WJNA 5E6PA 3EHVA 4EEWA 2COFA 3U7DA 3H6NA 5JLJB 1MK7B 2MBBB 2R0DA 4DDGD 1R4NI 4MELA 2N9PC 3ZRFA 4AP4C 3CSFA 2ZPYA 4KAXB 1ZGUB 3JVZX 3S2AA 2ELBA 3L13A 4B9KA 3RYTA 3QWZB 2KTRB 2CY5A 3ZLZA 3ZNZB 2KMCA 2OOBB 3L54A 1WVHA 2DKPA 1MIXA 2C9WB 3M62B 2AL6A
chains in the Genus database with same CATH superfamily
2J0MA 2IO1B 2QEJC 4HDQA 1WRDB 2G4DB 2DYMA 1FPYA 1WMHB 4K81A 1XKEA 1J0WA 4ARIA 3DXDA 1YQ4B 2BYFA 1HTQA 4PS8A 1WR1A 3AE8B 2NBUA 3Q8EA 1JWUD 4ILGB 3RMKC 1U29A 2O6VD 1FD6A 1GJZA 2AQ3B 2I2YA 1TKGA 5C16A 1MHHE 3IT6B 4N6EB 3KWLA 4FJZA 3QK0A 2FUHB 3RCZA 1X05A 2TSSA 3WALA 4QJ4B 1T0QC 2MJ3A 2ELAA 2FBWB 2WXGA 1YIWA 5CHFA 2CAYA 3A33B 1E9MA 1C4AA 2YEPB 2LYDA 1L7YA 3RNFC 3UQBA 3H7SA 1CZPA 2KQSA 3EA6A 3N9YC 4BZAA 3I3TB 4ZHPA 3VDZA 4HEA1 2KUQA 2E2XA 1UPQA 5AUKA 1SIFA 2PLPA 4FA6A 4RGTA 4BFRA 4J6IA 3ZIMA 1RRPB 2Z59A 2WX1A 4FADA 4GDKA 1RM6C 3ULCA 2WXJA 3GOEA 1AQCA 2CKHB 3NVYA 4AS1A 5BYRA 3PLUA 4LK0M 1U5FA 2K6DB 3TCAA 2CQUA 4D6WA 4XDCA 3Q2AC 1L0VB 4WJPA 1A5RA 1TS3A 1TT5B 1FM0D 2GBKA 1VZ6A 3AU4A 1N5WA 4TV3A 1BMLC 3FILA 1OGWA 2LASA 1YNTE 4RH6A 3ALBA 4MH0E 4P16A 4LNOA 2C5LC 2LUMA 3FVCA 4ZRJA 1F0ZA 3NVZA 4DX8A 3NW8A 4R3DA 1I2HA 4A6FB 4HPPA 2BS3B 3A98B 2XEWA 1UZXB 1KOTA 1K53A 2ASQA 1OFFA 2AEHA 4USAA 3AJ4A 1YOVB 1EO6A 4AQ7A 2LOZA 1N6ZA 3GZNI 3VTWA 1JRPA 1EAZA 3VR9B 4ANUA 1VZ7A 2DNFA 3BINA 4GN1A 3O96A 1XX0A 5GXGB 4FBJB 3WA0A 1L6UA 3A9KB 1OQYA 3AEEB 2DENB 1IUEA 4ZRKA 1E7UA 1UNRA 1UBQA 2V4LA 4IM3A 2WDRB 2KWVB 4DQOC 1FHWA 2Z0QA 5KQ4A 4M01A 4S17A 4K3CA 1WGKA 3DBHB 3PVWA 4LCDE 3DCXA 3VH3B 3A4SC 3EPYA 4MM3A 2YS3A 4KX6B 3Q3FA 3PZ7A 1V97A 5I4DA 3APCA 2GMIC 2SEBD 2KDBA 5CHVC 1ZOYB 2G9HD 4HROA 4F7HA 4FXCA 2DX5B 2DN6A 5IP4D 2FJUB 3Q8CA 4DHJB 3RN9C 1E6EB 4LNIA 1XXGA 2VH2A 5HE0A 1W1HA 3TEXA 2PVGC 1GUAB 3B08A 1JMLA 2RSUA 3PPAA 2FAZA 3UIOB 5DIFB 3APDA 1STEA 2JWUA 4N59A 2KMMA 3E9OA 3NWFA 2RPQA 4ZDVA 1XEEA 2I5CA 1DDVA 1S1QB 1DOIA 1U5EA 1WRIA 2LBBA 1TZ1A 4F7UP 1V61A 1LO5D 2IO3B 2OJWA 4YSYB 3OANA 4ITKA 1JQ4A 3KZ1A 3V6EB 3IAS1 3NS8A 3DBLB 3RI7C 2BKRB 2V4IB 2ZNVB 2W2XC 2QCZA 2COPA 2G35A 2JZ3B 3B1LX 5KHOA 4W9EA 3ZTDA 5CLLB 5C5BA 4EZLA 1FB8A 3ONSA 4JIOU 2IGHA 1XCQL 2G45B 4BKSD 4PS3A 3KSYA 2MH7A 2O6VB 4KDIC 4ILJA 4WWPA 4GOUA 2DYQA 1ZW7A 1ZYIA 5BMHA 2PTLA 1LB1A 4ZRIA 2HD5B 4JWSC 5LONB 4RM9A 4I6NB 3MJWA 3NS1A 1HTOA 3F0WA 3APFA 3IBEA 2N9LA 3IFWB 5M4YB 2R09A 4YXDB 5G2NA 3AEGB 1ST7A 4WJQA 2IBIB 5C6RA 1NI3A 1WIAA 3DDCB 2Z59B 1DYNA 2DYBA 2JU6X 2WWZA 1ZE3D 2JWZA 1L5PA 2D3BA 1XLOA 2JYTA 2EMSA 4YL8A 4HB4B 2H7DA 1OTRB 5D27A 1JW9D 2MWSB 1AN8A 2MWNB 2MBEA 2IJ0A 1V1OA 2V9HA 3N20C 3PHWB 1WZ3A 1XF5L 1ET6A 1KC7A 3W5UB 2CR5A 1C9FA 1EF1A 4C80A 5GOWB 3Q3JA 4EJNA 3O65B 2BPSA 2N9XA 3HIZA 3AEDB 2D07B 1WGQA 1UNQA 3Q6BA 2RGNB 1EWCA 4W9IA 2DYOA 1V80A 2K6QA 4OHJA 1BWNA 3PO0A 4KIKA 1W1DA 2M56B 4L23A 3VRAB 4RGMA 3ZQ4A 3TIXA 1SGHA 1X1GA 4M8MA 3DOWA 1WXSA 1ZXIA 3SNHA 4GU2A 1WMHA 2V1YA 5CTRC 3RPFC 2LVOA 3VTUA 4B95A 1K8RB 3BJIA 3QBVB 3TVVA 4WSFA 1SSNA 2GRIA 3UI3A 3ZNGC 1YJJA 2I1KA 3ZUNA 2NMQA 1ZC4B 1SJHD 2PMVA 1Z5SB 2ZW1A 3MFGA 5FKAC 1MFWA 3W1SA 1H4RA 3WANA 3HVZA 4AOFA 2ZCCA 1IBXA 1F1HA 3D8FA 3PGEA 4JKDA 4IC7B 2WXLA 1PLSA 1YJIA 1V1PA 3ZNHB 4CO7A 3QAQA 1LQBA 1KLGD 2NTSA 3NWDA 4GDKB 4CYEA 4N58A 2G3QB 4YSZB 2BW2A 4NJ7A 2M0XA 3PP2A 3AEFB 1EF5A 3X0WA 2N9KA 1E0ZA 3A9KA 2JT4B 2FCMA 3OJ4B 3Q69A 1Q5WB 3MHSD 2YT1A 3KUCB 1K5GB 2A4ZA 1SE9A 5TSSA 3HVDA 5D3IB 5C23A 4A6HA 5C5BB 2CODA 2MLBA 1IP9A 2LUEA 1TTNA 3R2TA 4IW0A 1P3QU 3IG3A 4KVGB 1W1GA 4GIVA 4NAWB 1YX6B 4KGTA 2KC2A 3WAPA 2LGDA 3AV8A 1KRHA 1DDMA 2XK5B 4ZYNA 1WSPA 2MW5A 1MHXA 3DHGC 4C56C 2WH5A 1FXTB 1WG7A 4L6EA 3T9LA 2PW9A 2M1MA 1FMAD 1PDXA 4TYZA 1MI0A 2H7EA 2Y5BB 1M7EA 3NOBA 3KY9A 1V5UA 3V61A 3U7DA 5JLJB 1IBXB 2MBBB 4MELA 3ZRFA 2PKOA 2RMMA 2NTTA 2ONQA 1N3HA 2W3SA 2BS2B 2Y5PA 1I42A 2X18A 4YTMB 1JROA 1G6JA 2VZKB 2L76A 4O1NA 2D9VA 4PS7A 2D10A 2ABDA 1C4PA 2LZ6A 4II2B 2KN4A 3UQAA 2NPTA 4W9JA 3PZ8A 2LHEA 2BKFA 3Q8AA 1D6EC 3RNAC 2NVUI 3R66C 2J53A 1WWTA 1XCTL 2IZVB 3DBSA 2A5UA 2LRWA 1RFAA 2LD9A 2RGFA 1UEFA 1L4DB 2VSZA 2KK8A 1WH3A 2RLOA 5E6OA 2IGDA 5C79A 4WWOA 1YMHE 2QDFA 1Z2MA 2Y5CA 2V3PA 3RFZB 3AE1B 2K22A 1RJ2A 3D8EA 1WJ6A 1BXTA 2WX0A 3G9WA 2BS4B 3GYPA 3ABVB 2GS0A 3ZXRA 3L4PA 1L4ZB 4HPLB 1Q1OA 2W55A 4MEMA 3EUB2 4RCOA 1WXMA 2WNMA 4F7GA 1QOFA 2P0DA 1T0YA 4S0RA 3E9PA 1Y5OA 2BYEA 3AI5A 3B2FA 4JE3B 1UWXA 4KGRA 3FKYA 3NHEB 2PJHA 2RSGA 1KM7A 2JF5A 4C7ZA 4ZRPA 1KZ7A 3QARA 1P5TA 2D9WA 3CIKA 3GYOA 2FNJB 4HB0B 1OQQA 1XT9B 3F5RA 1KJTA 2D9XA 1UWMA 1HB8A 1FHOA 2CJNA 3DPDA 4LJPB 2HRJA 2W82A 1P3RA 1R4MI 2BYVE 4JKEA 2RR9A 2AYOB 5C3JB 3VH4B 3PSCA 1I7HA 1F9JA 2M8SA 1C3TA 1U5GA 4G0NB 3QIJA 3IAM1 4JX1C 4L1RA 1WZ0A 5G55A 4CHMA 1L0YB 1EVHA 3ZO5B 1MAIA 2YSZA 3MTNB 2M19A 2KANA 4RFBA 2ZEQA 1RLFA 2L8JA 5J2RA 3PVLA 2KD0A 3LDZE 1ZM0A 2RQ1A 1BTNA 2K9XA 3Q3OC 2ZCBA 4DHZB 1DBHA 1WX9A 2LVPA 2L83A 4FJVB 2O2VA 3GZNB 2MBQA 1K52A 1KLVA 4IFSA 2JSVX 2AL3A 2WDTB 5DH9B 4DK5A 4Y94A 2JXXA 2YF0A 4L2YA 5EDSA 2MKRA 3V5WA 2MP2A 4Q2JA 3P42A 2AX5A 2M17A 3E66A 2LGXA 2GBNA 5DPRA 5I2MA 2CJOA 3VUWA 3ZRCA 2K49A 4M02A 1FOEA 3SYXA 2DYNA 3A9JA 4K3BA 1SE2A 4XGAB 4HAXB 4KZ0A 1YN5A 4RF1A 4WWNA 3WAOA 1NI2A 4MGZE 1HB6A 3RZFA 3ULBA 3EFCA 2LXCA 2I5FA 5D3XA 3QHTA 1NU2A 2JZPA 4KIKB 1FNWA 3VOQA 4IWPA 3V6CB 2K2UA 2IO2B 4JK9A 1LFDA 2QC8A 4KKJA 1TQZA 2XNAC 1V5OA 2L00B 3AU5A 2EMTA 3B77A 2EELA 1XODA 1SF0A 2L0FA 3PRMB 5I2SA 4BVUC 1PFJA 2KDMA 1M94A 3BK2A 2IY0B 2MP2B 5JHBA 4ASWC 3DWMA 2Y8GA 2K8BA 1GPXA 5IAAC 4JKBA 1TYGB 2GOWA 1TY0A 1E90A 2GB1A 2KJRA 5TR5A 1Q10A 3HIEA 1PGBA 3GE8C 1MPHA 2KCJA 4HAYB 1E8XA 1UNSA 2DBYA 1JDEA 3QX1A 3FSSA 4HAWB 2KDFB 1ENFA 4URKA 1E8YA 5J3TA 4JPSA 1AWEA 3X23A 4RM8A 3PT2B 3C8YA 1DROA 3M95A 3VIAA 1I4PA 1I4XA 1ZDVA 1P7EA 4WURA 3SBTA 3T06A 2EC1A 3AXCA 5C1ZA 3W1SC 3W1YA 3TEYA 4H2AA 5EE9A 4A20A 1TY2A 4FHJA 5KHQA 2Y3AA 2N0YA 1J0GA 1V81A 4F1SA 2W2WA 2JVCA 3AM9A 3AE9B 3N1YC 4KHAA 4WQOB 3KH0A 4ZYSA 3AE5B 3PVUA 1DDWA 1PQSA 2Z0EB 2N23A 2NR2A 3T3NA 1JRUA 1ZUD2 4B6HA 1DIKA 1MKEA 1ZVRA 3HM6X 4EKUA 2KX0A 4I6LB 3I57A 1YQBA 4KGSA 4DHZE 2CB8A 4JK7A 2MDXA 1S3SG 3P4PB 1I35A 4A8XC 3TMPB 2ADZA 4RMAA 3VTVA 1I4HA 5EFXA 3Q3NC 2D4QA 3N32A 3B0AA 1KI1B 3MHZA 5IRSA 2K3UA 4HAZB 3I63C 2KDEB 1ZP0B 1V89A 3L10B 2MJEA 4MSQB 3NWAA 2KFJA 3PV1A 3KQ4A 3PG7A 2RDBC 4TMAB 3RNEC 3P1MA 5LLIA 2Z14A 3PLVA 2YT2A 3J9CA 3A8QA 1U4AA 1N62A 3ENEA 3PTFC 1QOGA 4MJSB 2DA0A 2D9ZA 2L32A 4WJOA 4REZA 3VAWA 1K5DB 4GPTB 2IGGA 3KLSX 3NZUA 1HE8A 2LVQA 1VDVA 3IHPC 1QT9A 2GI9A 3A4RA 2HDEA 1WR6E 3AN1A 5H92C 2R2OA 1Y8RC 1ZKHA 1NVID 1V5TA 2K1FA 1NEKB 3W5VB 3M3JA 4LTUA 4F7ZA 1R7SA 3ZVRA 2KXJA 3JSVA 4KZCA 2J52A 1TGZB 2JPHA 1MPEA 5LNK1 3HRDD 1X86A 1R4NB 2NPTB 1P6SA 3AH7A 2CS4A 3KUZA 2KQ4X 3Q14C 1WX7A 1YN3A 4LDTB 5L83A 1C76A 3DVGX 1N60A 4NZLB 1B55A 1M4VA 4M0WB 2MFQA 5J17A 5BO4B 2DLWA 2ICIA 4KHBA 1XD4A 3NSUA 4JKFA 3SUZA 2HTME 1PYWD 2OJRA 4HVBA 1U5DA 3ODOA 2IFSA 1WYWB 2KUPA 3H8HA 2KWDA 3AE7B 5IJMA 1SEBD 1D3ZA 1L2NA 2BT6A 1P7FA 1VBGA 3ZYYX 2DZMA 4K7WA 3HSAA 4TQ1A 1OQNA 2IY1B 1UPRA 2L52A 3DHHC 4CQNA 5L81A 2DAFA 4RNAA 2WXFA 5BMIA 4QJ5B 4HLEA 4PNKA 4QXAB 1I4QA 2ZVNA 3BY4B 2YT0A 1UGJA 4XC2A 2FJLA 3AE2B 1FXIA 3GE3C 4MGIE 5J3QA 2L1AA 1QQGA 2HJ1A 1T6BX 4TUUA 1E5WA 2V3NA 3R7RA 3M1IB 1OQRA 1XQQA 1T0SC 3R2IA 2L05A 2FE8A 1EUVB 5J3YA 5KQ1A 4RGOS 1B9RA 2WHIA 2INNE 1WJNA 1L6VA 3H6NA 2OHFA 4A6QA 4JWUC 2R0DA 1J7BA 1R4NI 4DDGD 3ZGZA 4KAXB 1DGJA 1ZGUB 5H8YE 2ELBA 3ZLZA 3TEZA 2KMCA 1WVHA 2DKPA 3ZTCA 4L1BA 1T77A 5IA7A 4KHBB 4MT5A 2JX5A 2QSDA 4DX90 1IPGA 3DBRI 1E7PB 2RUKB 3L0WB 4MY6A 3N7CA 2M14A 2V76A 1OEYA 5FR3A 5HG2A 2XN9C 3A8PA 2LOXA 1OEYJ 4US9A 2RD0A 2DWQA 1NYRA 2XQNM 2Z0OA 4ANWA 3T3OA 1T3QA 3U52E 3P4SB 1DOYA 2Q5WD 2VH1A 4HRSA 1D4BA 2KHWB 5HE1A 3UGBB 1SE3A 1HZ5A 3BYYB 3P2BA 4E74A 2RDHA 3P6AA 4K2PA 1UBIA 3MC9A 1MG4A 1Q0WB 1OMWA 3RUIB 2IYDB 4PYUA 4C0AA 1MIZB 5CHWA 2E6XA 1F52A 4DIXA 1PUTA 2ON8A 4HPMB 1RYJA 2C7HA 3K9PB 1BT0A 5E6NA 1QOAA 2LMCA 2GBRA 4OVUA 5EE0A 1P98A 4C4VB 2R2YA 1CK1A 3LXFA 4JKHA 1E8WA 1I4GA 3VXWA 3DHIC 4TSSA 4OSNA 1CMXB 3EECA 3HHMA 4NAMA 1NVLA 1D5ZC 3OLMD 3SFEB 2KOXA 1YQ3B 3ML8A 2WLBA 2LFIA 4I6PA 2WXIA 3AB5A 2YVCA 1WFYA 1SHCA 2MCNB 2UU7A 5EE3A 3ZDMC 3SBGA 2J0KA 1ESFA 4JLCA 1VRAB 4MT7A 4WJ7A 3UF8A 4WJNA 2GBMA 3KVFB 1BAKA 3ZW3A 3NJTA 3DBLI 2YRYA 2HJ8A 2LG1A 4IM0A 2KQ7A 4D0NB 4K17A 1E10A 4HKZE 1MG8A 1T5XD 1V8CA 2NCNA 1R4MB 2KIGA 2DTCA 4GZUA 3Q3MC 3AEAB 2G1EA 1ZXHA 1FIQA 3DVNV 2UZRA 4KSKC 1GB1A 5CLQB 2KGXB 1RFKA 2GUMA 4OW0A 2KO3A 1RRBA 2P0FA 1HXYD 4HSIA 3BIID 4YTPB 4EZJA 4GOCA 2COCA 3NUHB 4BBNF 3ZJUA 2EKEC 3CF6E 3CWIA 5JZEB 2PEAA 2REXA 4FJYA 4QAYA 3JW0X 4AJYB 3CIRB 1UELA 2O6VA 2CU3A 3MDBC 2XK5A 4EFOA 2N7JA 4G3XB 3QJZA 2PPHA 1E7VA 3BYTB 3RULA 4YSXB 3PRPB 3KYDD 2KKCA 2W54A 1WF9A 4OT1A 3KWVA 3FILB 3KRWA 2FUG1 4G50A 2WXMA 3ZKJC 1QOBA 2K8CA 2B3AA 2PE6B 2WDQB 3A58A 3SFDB 1ISNA 4MH8A 2RRFA 3WIMA 4HWIB 3L16A 3ECIA 4UDUC 1V86A 3OWEB 2QHOA 5CX3A 2KLGA 4FN2A 3GP7A 3D8DA 3IXSA 3GS2A 4GXBA 5FI0A 2KMAA 2LJ5A 3P63A 4RF0A 2BTEA 2DAJA 1Y56A 4HCNB 1AYFA 4M8NA 2K8HA 2FCNA 2J4XA 3RNCC 1JALA 1GOZA 1HQRD 2BCJA 4ARCA 2LI5A 3EGRA 1VLBA 1I7AA 5J18A 4HJKA 3P4RB 4EUTA 3ETRA 4YONA 4LLGM 2M4NA 3GB1A 2KLCA 3L08A 2FJ9A 1NTYA 2D3AA 4EMOA 4MSMB 4AJWA 2M0AA 2MJDA 1P9DU 1J7CA 2KYWA 2KR0A 1QLBB 1FO4A 2KNBA 3ZXVA 1P1AA 1V88A 1WM2A 4HKQA 3RNBC 4HCPB 4JKGA 3U12A 2J7QB 1YJ1A 2LULA 3SR6A 3VFKA 2WQYB 3ZVVA 1VCBA 3CSTA 2J59M 2ZNVC 3JYUA 1WGRA 2LGSA 1V9JA 3LB8C 1FFUA 4NNJB 3MPXA 1TXDA 5DPTA 3TBLD 1ZDXA 3R7QA 2GCJA 1TZOA 3CXBB 3SDLC 3ZNID 1XR0B 3KRXA 2YEPF 2KIEA 2JZZA 2FCSA 4IAPA 3ZJVA 4JKAA 2C7MB 2CRFA 5D3VA 4BBKA 4X57B 4ANXA 2R82A 2D3CA 2L3ZA 4W9KA 1IRSA 2ROZB 4LNFA 4E71A 1K50A 3U4EG 4OZAA 5G5HA 2W2XD 3SO6A 2NS5A 4WAAA 3LYYA 1J19A 2JUOA 1C78A 2BVCA 3DVGY 3MJ5A 3NZSA 4A6FA 1WYGA 2KC1A 2DZJA 1UF0A 2PIAA 4KHOA 1HEZE 3KW5B 3SHQA 2INPE 3W9CB 3FLVA 4ILHA 1HBKA 2KFKB 3WYFB 3K9OB 5LG4B 4IOIE 4XWWA 3A1QB 2ACZB 4NQKE 3DBRB 4PQ0A 1NTIA 4IOYX 1WGUA 5G5GA 1SJED 4GSWA 1OY2A 3Q8BA 2JQRB 2D11A 3C19A 1WXQA 1WY8A 3I5JC 1IGDA 2YS1A 3NVWA 1MI1A 2NBWB 5JHGA 3PS6A 3QQ8B 3FEHA 1C79A 3SV1A 1H10A 3BVZA 3VR8B 2LHDA 4OZCA 4NSWA 2AQ1B 5MPOA 1NTVA 1UNPA 2ROVA 4XYCA 4AUQC 2L1CA 4A55A 2N0SB 2KWCA 4JGHB 3ZJTA 1X1FA 2WGSA 2WXKA 2MRPA 3N30A 3EC8A 1V2YA 4LNNA 3P7ZA 3TW1A 4K1RB 3DXCA 2ZZPB 3U8ZA 2KFKA 1LXDA 2IO0B 2ZVOA 4WQMA 5LXHA 3FP5A 2DKQA 4GB9A 1TIFA 2RPVA 4DBGA 2J42A 1ZSQA 2IYBA 1GAQB 1EGXA 1FNVA 2N1WA 2KACA 3BWUD 2CY4A 2DZKA 3JSVB 1FRDA 4C00A 2LGYA 1WJ1A 2JRIB 2DHJA 1XLNA 3U7ZA 3R3MA 5D6JB 2VZKD 2BBCA 4XX5A 1F2RI 3WAMA 5E6JA 2DX5A 1WE6A 2QKMA 3SU8X 4IDIA 4G11A 2NBVB 2Z0PA 1U27A 1HA5A 3M63B 1K51A 3AMZA 1FAOA 1EU3A 5JHHA 1Q67A 3V62A 4ZHOA 2BQQA 2PE9A 4A3OA 2L7RA 4BBNC 4A90A 3MC0B 4MGYE 2RVBB 2N4FA 1B1ZA 1WGDA 4Z2MB 2KVZA 1WGHA 2DHKA 3AE6B 2YS5A 3UIPB 2NBVA 4GNKB 2WDVB 4IWQA 1D5MC 2KZRA 1ZC3B 1IYFA 1GC6A 3E56A 3ML4A 4XDDA 4ZRQA 1FCLA 4KDLB 1BUIC 5BYQA 3TO1A 2CHWA 1FNUA 2K25A 1GNUA 1PGXA 4WIPA 2BYTA 5IOIA 4HAVB 4B0MA 4NAWA 2AWTA 4ANVA 2HTHA 4GDLA 3PHXB 4P7IA 1H8CA 1PFDA 4IWOA 4F8CB 3DVNU 2WXNA 2MHJA 4AP4C 2OEDA 3JVZX 4GLSC 4B9KA 3L13A 4NJCA 3VRBB 2KTRB 4EE2A 2CY5A 3ZNZB 3I9V1 1UUPA 1MIXA 1TS5A 2LEKA 3R8BA 4H8SA 4CHKA 2QKLA 1FFVA 1KFYB 3URYA 1VD2A 5JP4A 4W9DA 4JKGB 5LOPB 1LM8B 2YLMA 1N63A 4ZOHC 1UH6A 3SD5A 3NG0A 3ODWA 2ZJDA 3UINB 1Y19B 4YT0B 1PMSA 1WJMA 1V6EA 1MVKA 2WU2B 1QQRA 1AARA 4GMVA 5D7GA 2OTXA 1YX5B 4K2OA 4IKGA 2CHZA 1LGRA 4HXDA 4OVVA 2KJ6A 1UD7A 1ACAA 3HQCA 2D3GA 3UZTA 4FLHA 3QCAA 5D2MB 2FDQA 5HE3A 2JRHA 2N1VA 3EFUA 4P6VF 2WXQA 1MK9B 3V60A 4AWJA 2EJ8A 1C4CA 3RD2A 1XD3B 5JH5C 3TFMA 3VUYA 2R61A 4EOYA 5DHFB 1GC7A 2L0TA 1GG3A 4TKNA 4KV2A 2X0SA 4XE0A 5C2TB 1D5XC 1I4RA 1VJKA 5JVLA 2P0HA 4Z2NA 2DHIA 1DYQA 4WH4A 3U30A 1V1PB 2QIEB 3AECB 3RNGC 2COAA 4HAUB 1AWDA 1XLPA 1PGAA 4IUMB 2KVRA 2HTHB 4GDLB 3CMMB 3P4QB 1TKEA 3H1UA 1N61A 1SE4A 1WGYA 4W9HA 2LRUA 3W2DA 1WXVA 2AQ2B 2V3SA 4WWMA 4MGKE 2DLBA 5AZHA 3V05A 2KTFA 2ZW0A 4B6WA 4HJGE 1FCCC 2FIDA 1FGYA 3D32A 3ENBA 4MJSA 5T8IA 2CHXA 2UVMA 2B76B 4NJ6A 2K00A 4EZKA 2LJIA 1C77A 3PSEB 1FXAA 1WM3A 2DZIA 3HK0A 2LXAA 4K7SA 1WJUA 1AW7A 3VQIA 4C4VA 2Q13A 2KX3A 2O2VB 4CSQA 1WI1A 3FAHA 3PREA 4MDKE 3VHTC 2E3TA 2XBBC 4NY0A 1QZEA 1WE7A 1WX8A 1CJEA 4A5KA 2K8EA 1JWSD 2J0JA 1C1YB 5AZFA 4P1CC 5IO9A 1KZGA 3VVWB 1YN4A 1ET9A 4A6KA 1YD8U 2WXHA 5FR6A 3AULA 1J8CA 2BWES 2W3RA 1DOXA 2R2QA 1WGGA 1CQVA 2WP9B 5KCVA 2WS3B 4QJ3B 4CHJA 2LKOA 2Z0DB 4DDID 4MK0A 3V3XA 1WI0A 3QC8B 2N9EB 2MSED 4HHVA 2KDIA 4DXAB 4E3CA 2VKIA 3NVVA 3DWGC 4PT5A 4GMXB 2ZPNA 4BOSC 3HUIA 2IDYA 3Q8FA 1TS2A 1J7AA 1KTKA 2JP2A 5DPSA 4W9FA 1KLUD 1ROEA 2KN5A 4DXFA 4RGNA 5HFYA 1QKZA 3DBHI 2Z4DA 1SXTA 5HHDG 3LJUX 2WU5B 4HK2A 4HB2B 1F77A 1JWMD 2MEKA 2INDC 1A70A 1GGOA 5LXIB 1KH0A 2L2IA 1EU4A 1EWYC 5AEKB 1LW3A 3N1XC 4BOZB 3MP9A 2BF8B 4OZBA 2Y7BA 1QILA 2IPKD 4YTNB 3A1QA 3OAWA 3RCPA 1XO3A 2RNRB 3QWMA 4N9F4 2MA9B 2NMBA 1Z87A 4JL9A 1QC6A 3IT4B 2WXOA 2INCC 2QMTA 4BKSA 4BKGA 2D5GA 4BKTA 3RZWC 2M38A 4KKIA 2KTRA 4DXGA 2WXRA 4C7YA 1ACCA 4JQWC 5D94A 2WXPA 2BB6A 5D3DA 1M7RA 2OQBA 3T8MA 4IM2A 1TS4A 4XWTA 2Z8LA 2W9NA 2QJLA 4HATB 3TL5A 4LNKA 2NZ8B 3ODXA 3KUDB 2DFKA 2X38A 1GB4A 4HB3B 1X1MA 3A9JB 4K7UA 2C60A 3PEGA 1NDDA 4J3OD 4W9GA 2D2QA 2RDGA 1E8ZA 3RT3B 4XWXA 2UZSA 1RWSA 2LGIA 2HE7A 1SB3C 2Y8FA 2WYQA 2K2JA 3OG5A 1BTKA 1SBBB 4DBBA 2MBOA 3AEBB 3DCGA 3IVFA 2JYEA 4MM3B 3WCQA 4TQ0A 4KSLC 3TSSA 2BB5A 3MC8A 3OHMB 4P1BC 1JCKB 2K0PA 2KT7A 4JK8A 2K5PA 4A9AA 3TEWA 5BYSA 3PZDA 3O13A 2UYZB 5AZGA 5DHAB 5HE2A 4B0EA 1N5XA 2V0GA 3AE3B 1X11A 4LDTD 5BMGA 4ICVA 5JHAA 3FM8C 4M0WA 1MJDA 3B9JA 4WAFA 1QF6A 3B2GA 2DIKA 2H88B 2MX2A 1TBEA 5AUIA 3VUXA 4PK1A 1IGCA 1XLQA 2JY6A 1ZPSA 5IN7A 2N7DA 3E9SA 2I1JA 2KWUB 1KBLA 4LJOB 5GMVA 4W9LA 3N3KB 1L0XB 4ACFA 3NY5A 2D9YA 1FEHA 3H9DA 3H7PA 3HM3A 3PRZA 5DI9B 1NYQA 4GGQA 2BWFA 2PVOD 3AE4B 5DCNA 1TJ6A 2Z13A 2KJHB 4A3PA 5D3WA 2DX1A 1UGMA 2LWPA 1JWBD 1VR9A 2G4SA 1KF6B 3BVGA 4NPNA 1U2BA 2PZ1A 1NENB 3TJPA 1WJ4A 1XCGA 1P0RA 3SEBA 4WVFB 1TJEA 4II3B 2GBJA 3TUOA 3C0RB 4M00A 4IG7B 2FIFA 3BK1A 4D2KA 3H7PB 3DXEA 3OJ3A 4FULA 3QA8A 2I38A 1FHXA 4NQLB 4DWFA 2C7NB 1FRRA 4FHKA 2DHZA 2MQJA 3BZDB 2UWQA 2QILA 1TKYA 4PYZA 1WXAA 2FCQA 3L17A 5FK9C 2ZKMX 2CU1A 2SAKA 3E9LA 1NBFC 4DHJD 2BGFA 5DPWA 1F2RC 2VRRB 5D3YA 1T0RC 4HDOA 3ML9A 3U2SC 4XZ4A 1V5PA 2KAJA 2K39A 1RAXA 2GCLA 3KYCD 4JKCA 3HW2B 2MBHA 4W9CA 5FI1A 4ICUA 2GLSA 5L95C 3DQVA 2VRWB 5JXVA 1V49A 1HZ6A 3N1ZC 3NZ3A 5EE1A 4YWGG 2P8VA 1VBHA 5IKCM 2N7EA 1V5MA 4MACA 1FGZA 5HKHA 2GJYA 3ZDTA 3LJ3A 4EEWA 5E6PA 3EHVA 2X8XX 2COFA 4OVZA 1MK7B 3BVMA 1JWAD 2N9PC 4US8A 3CSFA 5HI1A 2ZPYA 1SIJA 2H89B 1VZ8A 3S2AA 3RYTA 2EKIA 1EM7A 3QWZB 4BAXA 2OOBB 3L54A 3NRZA 3FC4A 2JXTA 2C9WB 3M62B 2AL6A
chains in the Genus database with same CATH topology
2J0MA 2IO1B 4HDQA 1WRDB 2G4DB 2DYMA 1WMHB 4K81A 1XKEA 1J0WA 3DXDA 2BYFA 4PS8A 1WR1A 2NBUA 4ILGB 1U29A 2O6VD 1GJZA 5C16A 4FJZA 3QK0A 2FUHB 3RCZA 1X05A 3WALA 2ELAA 1YIWA 5CHFA 2CAYA 3A33B 2LYDA 1L7YA 3UQBA 3H7SA 2KQSA 3I3TB 3VDZA 2E2XA 1UPQA 1SIFA 4FA6A 4BFRA 4J6IA 3ZIMA 1RRPB 2WX1A 4FADA 4GDKA 3ULCA 3GOEA 1AQCA 2CKHB 3PLUA 1U5FA 2K6DB 3TCAA 2CQUA 4WJPA 1A5RA 2GBKA 3AU4A 4TV3A 1OGWA 2LASA 3ALBA 4MH0E 2C5LC 4ZRJA 4DX8A 1I2HA 4A6FB 3A98B 2XEWA 1UZXB 1KOTA 2ASQA 2AEHA 3AJ4A 1EO6A 2LOZA 3GZNI 3VTWA 1EAZA 4ANUA 3BINA 4GN1A 3O96A 1XX0A 4FBJB 3WA0A 3A9KB 1OQYA 2DENB 4ZRKA 1E7UA 1UNRA 1UBQA 2V4LA 4IM3A 2KWVB 1FHWA 2Z0QA 5KQ4A 3PVWA 4LCDE 3VH3B 3A4SC 3EPYA 4MM3A 2YS3A 3Q3FA 3APCA 2GMIC 5CHVC 2KDBA 4F7HA 2DX5B 2DN6A 4DHJB 5HE0A 1W1HA 1GUAB 3B08A 2RSUA 3PPAA 2FAZA 3UIOB 5DIFB 3APDA 3E9OA 4ZDVA 2RPQA 2I5CA 1DDVA 1S1QB 1U5EA 2LBBA 1TZ1A 4F7UP 1V61A 2IO3B 3OANA 3KZ1A 3V6EB 3NS8A 2BKRB 2ZNVB 2W2XC 3B1LX 2COPA 2G35A 2JZ3B 5KHOA 4W9EA 3ZTDA 5CLLB 5C5BA 4EZLA 1FB8A 3ONSA 4JIOU 2G45B 4BKSD 4PS3A 3KSYA 2O6VB 4KDIC 4ILJA 4WWPA 2DYQA 1ZW7A 1LB1A 4ZRIA 2HD5B 5LONB 4RM9A 4I6NB 3MJWA 3F0WA 3APFA 3IBEA 3IFWB 2R09A 5G2NA 1ST7A 4WJQA 2IBIB 5C6RA 1WIAA 3DDCB 2Z59B 1DYNA 2DYBA 2WWZA 2JWZA 2EMSA 4YL8A 4HB4B 2H7DA 1OTRB 5D27A 2MWSB 2MWNB 2MBEA 3PHWB 1WZ3A 1KC7A 2CR5A 1EF1A 5GOWB 3Q3JA 4EJNA 3O65B 2BPSA 2N9XA 3HIZA 2D07B 1WGQA 1UNQA 2RGNB 4W9IA 2DYOA 1V80A 2K6QA 1BWNA 4KIKA 1W1DA 3TIXA 1SGHA 1X1GA 4M8MA 3DOWA 1WXSA 3SNHA 4GU2A 1WMHA 2V1YA 5CTRC 2LVOA 3VTUA 4B95A 1K8RB 3BJIA 3QBVB 3TVVA 4WSFA 3ZNGC 2I1KA 3ZUNA 1ZC4B 1Z5SB 3W1SA 1H4RA 3WANA 4AOFA 2ZCCA 3D8FA 3PGEA 4JKDA 4IC7B 1PLSA 4CO7A 3ZNHB 3QAQA 1LQBA 4GDKB 4CYEA 2G3QB 4NJ7A 2M0XA 3PP2A 1EF5A 3X0WA 3A9KA 2JT4B 2FCMA 3OJ4B 1Q5WB 3MHSD 2YT1A 3KUCB 1K5GB 2A4ZA 1SE9A 5C23A 4A6HA 5C5BB 2CODA 2MLBA 1IP9A 2LUEA 1TTNA 4IW0A 1P3QU 3IG3A 4KVGB 1W1GA 4GIVA 4NAWB 1YX6B 2KC2A 3WAPA 2LGDA 1DDMA 2XK5B 4ZYNA 2MW5A 2WH5A 1FXTB 1WG7A 4L6EA 3T9LA 2M1MA 4TYZA 2H7EA 2Y5BB 1M7EA 3NOBA 3KY9A 1V5UA 3V61A 3U7DA 5JLJB 2MBBB 4MELA 3ZRFA 1N3HA 1I42A 2X18A 1G6JA 2L76A 2D9VA 4PS7A 2D10A 2ABDA 2LZ6A 4II2B 3UQAA 2NPTA 4W9JA 2BKFA 2NVUI 3R66C 2IZVB 3DBSA 2A5UA 2LRWA 1RFAA 2LD9A 2RGFA 1UEFA 2VSZA 2KK8A 1WH3A 2RLOA 5E6OA 5C79A 4WWOA 1Z2MA 1RJ2A 3D8EA 1WJ6A 2WX0A 3G9WA 3GYPA 2GS0A 4HPLB 1Q1OA 4MEMA 1WXMA 4F7GA 2P0DA 1T0YA 3E9PA 1Y5OA 2BYEA 3AI5A 3NHEB 2PJHA 2RSGA 1KM7A 2JF5A 1KZ7A 3QARA 1P5TA 2D9WA 3CIKA 3GYOA 2FNJB 4HB0B 1XT9B 3F5RA 1KJTA 2D9XA 1HB8A 1FHOA 3DPDA 4LJPB 2HRJA 1P3RA 1R4MI 2BYVE 4JKEA 2RR9A 2AYOB 3VH4B 3PSCA 1F9JA 2M8SA 1C3TA 1U5GA 4G0NB 3QIJA 1WZ0A 5G55A 4CHMA 1EVHA 3ZO5B 1MAIA 2YSZA 3MTNB 2KANA 2ZEQA 1RLFA 2L8JA 5J2RA 3PVLA 2KD0A 3LDZE 1ZM0A 2RQ1A 1BTNA 2ZCBA 4DHZB 1DBHA 1WX9A 2LVPA 4FJVB 2O2VA 2MBQA 1KLVA 4IFSA 2AL3A 2WDTB 5DH9B 4DK5A 4Y94A 2JXXA 2YF0A 5EDSA 2MKRA 3V5WA 2MP2A 2M17A 3E66A 2LGXA 2GBNA 5DPRA 3VUWA 3ZRCA 1FOEA 3SYXA 2DYNA 3A9JA 4HAXB 4KZ0A 4WWNA 3WAOA 1NI2A 4MGZE 1HB6A 3RZFA 3ULBA 2LXCA 2I5FA 5D3XA 3QHTA 1NU2A 4KIKB 3VOQA 4IWPA 3V6CB 2K2UA 2IO2B 4JK9A 1LFDA 1TQZA 1V5OA 2L00B 3AU5A 2EMTA 1XODA 2L0FA 3PRMB 4BVUC 1PFJA 1M94A 2IY0B 5JHBA 2MP2B 4ASWC 2Y8GA 2K8BA 5IAAC 4JKBA 2GOWA 1E90A 2KJRA 5TR5A 1MPHA 2KCJA 4HAYB 1E8XA 1JDEA 3QX1A 3FSSA 4HAWB 2KDFB 4URKA 1E8YA 5J3TA 1AWEA 3X23A 4RM8A 3PT2B 1DROA 3M95A 3VIAA 3SBTA 3T06A 2EC1A 3AXCA 5C1ZA 3W1SC 3W1YA 4A20A 5KHQA 4FHJA 2N0YA 1J0GA 1V81A 4F1SA 2W2WA 2JVCA 4KHAA 4WQOB 3KH0A 3PVUA 1DDWA 1PQSA 2Z0EB 2N23A 2NR2A 1JRUA 4B6HA 1DIKA 1MKEA 1ZVRA 3HM6X 4EKUA 2KX0A 4I6LB 1YQBA 4DHZE 2CB8A 4JK7A 2MDXA 1S3SG 1I35A 3TMPB 2ADZA 4RMAA 3VTVA 5EFXA 2D4QA 3N32A 3B0AA 1KI1B 4HAZB 2KDEB 1V89A 3L10B 4MSQB 2KFJA 3PV1A 3PG7A 5LLIA 3PLVA 3A8QA 1U4AA 3ENEA 3PTFC 4MJSB 2DA0A 2D9ZA 4WJOA 3VAWA 1K5DB 4GPTB 3NZUA 1HE8A 2LVQA 3IHPC 3A4RA 1WR6E 2R2OA 1Y8RC 1ZKHA 1V5TA 2K1FA 3M3JA 4F7ZA 3ZVRA 2KXJA 3JSVA 4KZCA 1TGZB 2JPHA 1X86A 2NPTB 1P6SA 2CS4A 3KUZA 1WX7A 4LDTB 5L83A 3DVGX 1B55A 4M0WB 2MFQA 5J17A 5BO4B 2DLWA 1XD4A 3NSUA 4JKFA 3SUZA 4HVBA 2OJRA 1U5DA 3ODOA 2IFSA 1WYWB 2KUPA 5IJMA 1D3ZA 1L2NA 1VBGA 2DZMA 4K7WA 4TQ1A 1OQNA 2IY1B 1UPRA 5L81A 2DAFA 4HLEA 4PNKA 2ZVNA 3BY4B 2YT0A 4XC2A 2FJLA 4MGIE 5J3QA 1QQGA 4TUUA 1E5WA 3R7RA 3M1IB 1XQQA 2L05A 1EUVB 5J3YA 5KQ1A 1WJNA 3H6NA 2R0DA 4DDGD 1R4NI 4KAXB 1ZGUB 2ELBA 3ZLZA 2KMCA 1WVHA 2DKPA 3ZTCA 5IA7A 4KHBB 4DX90 1IPGA 3DBRI 3L0WB 2RUKB 4MY6A 3N7CA 2M14A 2V76A 1OEYA 3A8PA 2LOXA 1OEYJ 2RD0A 2XQNM 2Z0OA 4ANWA 2KHWB 5HE1A 3UGBB 3P2BA 4E74A 3P6AA 4K2PA 1UBIA 1Q0WB 1OMWA 3RUIB 2IYDB 4PYUA 4C0AA 1MIZB 5CHWA 4HPMB 2C7HA 3K9PB 1BT0A 5E6NA 2GBRA 4OVUA 1P98A 4JKHA 1E8WA 3VXWA 1CMXB 3EECA 3HHMA 1NVLA 3OLMD 2KOXA 3ML8A 4I6PA 2YVCA 1WFYA 1SHCA 2MCNB 3ZDMC 3SBGA 2J0KA 4JLCA 4MT7A 4WJ7A 3UF8A 4WJNA 2GBMA 3KVFB 1BAKA 3ZW3A 3DBLI 2YRYA 2HJ8A 2LG1A 4IM0A 2KQ7A 4D0NB 4K17A 1MG8A 2NCNA 2DTCA 4GZUA 3DVNV 2UZRA 4KSKC 5CLQB 2KGXB 2KO3A 1RRBA 2P0FA 4EZJA 4GOCA 2COCA 4BBNF 2EKEC 3CF6E 5JZEB 2PEAA 2REXA 4FJYA 3JW0X 4AJYB 1UELA 2O6VA 3MDBC 2XK5A 4EFOA 4G3XB 3QJZA 2PPHA 1E7VA 3RULA 3PRPB 3KYDD 2KKCA 1WF9A 3KRWA 4G50A 3ZKJC 2K8CA 2B3AA 2PE6B 1ISNA 3WIMA 4HWIB 3L16A 3ECIA 1V86A 2QHOA 5CX3A 2KLGA 4FN2A 3D8DA 4GXBA 5FI0A 2KMAA 2LJ5A 2DAJA 4HCNB 4M8NA 2K8HA 2FCNA 2BCJA 2LI5A 1I7AA 5J18A 4HJKA 4EUTA 4YONA 2M4NA 2KLCA 3L08A 2FJ9A 1NTYA 4MSMB 4EMOA 4AJWA 1P9DU 2KNBA 1P1AA 1V88A 1WM2A 4HCPB 4JKGA 2J7QB 1YJ1A 2LULA 3VFKA 3ZVVA 1VCBA 3CSTA 2J59M 2ZNVC 1WGRA 1V9JA 4NNJB 3MPXA 1TXDA 5DPTA 3TBLD 3R7QA 2GCJA 3CXBB 3SDLC 3ZNID 1XR0B 3KRXA 2JZZA 2FCSA 4IAPA 4JKAA 2C7MB 2CRFA 5D3VA 4BBKA 4X57B 4ANXA 2R82A 2L3ZA 4W9KA 1IRSA 2ROZB 4E71A 2W2XD 3SO6A 2NS5A 4WAAA 1J19A 2JUOA 3DVGY 3NZSA 4A6FA 2KC1A 2DZJA 4KHOA 3KW5B 3SHQA 3FLVA 4ILHA 1HBKA 2KFKB 3WYFB 3K9OB 3A1QB 4NQKE 4PQ0A 1NTIA 4IOYX 1WGUA 4GSWA 1OY2A 2D11A 1WY8A 2YS1A 2NBWB 5JHGA 3PS6A 3QQ8B 3FEHA 3SV1A 1H10A 4NSWA 1NTVA 1UNPA 2ROVA 4AUQC 2L1CA 2KWCA 4JGHB 1X1FA 2MRPA 3N30A 3EC8A 1V2YA 3P7ZA 3TW1A 4K1RB 3DXCA 2ZZPB 3U8ZA 2KFKA 1LXDA 2IO0B 2ZVOA 5LXHA 3FP5A 2DKQA 4GB9A 4DBGA 1ZSQA 2IYBA 1EGXA 2N1WA 2CY4A 2DZKA 3JSVB 2LGYA 1WJ1A 2JRIB 2DHJA 3R3MA 5D6JB 4XX5A 3WAMA 2DX5A 1WE6A 2QKMA 3SU8X 4G11A 2NBVB 2Z0PA 1U27A 3M63B 1FAOA 5JHHA 1Q67A 3V62A 2PE9A 4A3OA 2L7RA 4BBNC 4MGYE 2RVBB 2N4FA 1WGDA 4Z2MB 1WGHA 2DHKA 3UIPB 2YS5A 4IWQA 2KZRA 1IYFA 1ZC3B 1GC6A 3ML4A 4KDLB 3TO1A 2CHWA 2K25A 1GNUA 4HAVB 4NAWA 2AWTA 4ANVA 2HTHA 4GDLA 3PHXB 4P7IA 1H8CA 4IWOA 4F8CB 3DVNU 4AP4C 3JVZX 4B9KA 3L13A 2KTRB 2CY5A 3ZNZB 1MIXA 4H8SA 4CHKA 2QKLA 1VD2A 5JP4A 4W9DA 4JKGB 5LOPB 1LM8B 2YLMA 1UH6A 3SD5A 3ODWA 2ZJDA 3UINB 1Y19B 1PMSA 1WJMA 1V6EA 1AARA 4GMVA 5D7GA 2OTXA 1YX5B 4K2OA 2CHZA 4HXDA 4OVVA 2KJ6A 1UD7A 1ACAA 3HQCA 2D3GA 3UZTA 4FLHA 3QCAA 5D2MB 2FDQA 5HE3A 2JRHA 2N1VA 3EFUA 1MK9B 3V60A 4AWJA 2EJ8A 3RD2A 1XD3B 5JH5C 3TFMA 3VUYA 4EOYA 5DHFB 1GC7A 2L0TA 1GG3A 4TKNA 4KV2A 2X0SA 5JVLA 2P0HA 4Z2NA 2DHIA 3U30A 2COAA 4HAUB 4IUMB 2KVRA 2HTHB 4GDLB 3CMMB 3H1UA 1WGYA 4W9HA 2LRUA 1WXVA 2V3SA 4MGKE 5AZHA 2KTFA 4B6WA 2FIDA 1FGYA 3D32A 3ENBA 4MJSA 2AL6A 2CHXA 2UVMA 4NJ6A 2K00A 4EZKA 3PSEB 1WM3A 2DZIA 3HK0A 2LXAA 4K7SA 1WJUA 3VQIA 2Q13A 2KX3A 2O2VB 1WI1A 3PREA 4MDKE 3VHTC 2XBBC 4NY0A 1QZEA 1WE7A 1WX8A 4A5KA 5AZFA 2J0JA 1C1YB 1KZGA 3VVWB 4A6KA 1YD8U 5FR6A 3AULA 1J8CA 2BWES 2R2QA 1WGGA 5KCVA 4CHJA 2LKOA 2Z0DB 4DDID 4MK0A 1WI0A 3QC8B 2N9EB 2MSED 4HHVA 2KDIA 4DXAB 4E3CA 2VKIA 4GMXB 2ZPNA 4BOSC 2JP2A 5DPSA 4W9FA 2KN5A 3DBHI 3LJUX 4HK2A 4HB2B 1GGOA 5LXIB 2L2IA 5AEKB 1LW3A 4BOZB 2BF8B 2Y7BA 3A1QA 3OAWA 3RCPA 2RNRB 3QWMA 4N9F4 2MA9B 2NMBA 1Z87A 4JL9A 1QC6A 4BKSA 4BKGA 4BKTA 3RZWC 2M38A 2KTRA 4JQWC 5D94A 1M7RA 2OQBA 3T8MA 4IM2A 2W9NA 4HATB 3TL5A 2NZ8B 3ODXA 3KUDB 2DFKA 4HB3B 1X1MA 3A9JB 4K7UA 2C60A 3PEGA 1NDDA 4W9GA 2D2QA 1E8ZA 3RT3B 4XWXA 2UZSA 2HE7A 2Y8FA 2WYQA 2K2JA 1BTKA 4DBBA 2MBOA 3DCGA 3IVFA 4TQ0A 4KSLC 4JK8A 3PZDA 2UYZB 5AZGA 5DHAB 5HE2A 1X11A 4LDTD 4ICVA 5JHAA 3FM8C 2DIKA 2MX2A 1TBEA 3VUXA 2JY6A 2N7DA 2I1JA 2KWUB 1KBLA 4LJOB 5GMVA 4W9LA 3N3KB 3NY5A 2D9YA 3H9DA 3H7PA 3HM3A 3PRZA 5DI9B 4GGQA 2BWFA 5DCNA 1TJ6A 2KJHB 4A3PA 5D3WA 2DX1A 1UGMA 2LWPA 2G4SA 4NPNA 1U2BA 2PZ1A 3TJPA 1WJ4A 1XCGA 1P0RA 4WVFB 4II3B 2GBJA 3C0RB 4IG7B 2FIFA 3H7PB 3DXEA 3OJ3A 4FULA 3QA8A 1FHXA 4NQLB 4DWFA 2C7NB 4FHKA 2DHZA 2MQJA 2UWQA 4PYZA 1WXAA 2FCQA 3L17A 2CU1A 3E9LA 1NBFC 4DHJD 2BGFA 5DPWA 2VRRB 5D3YA 3ML9A 4HDOA 4XZ4A 1V5PA 2K39A 1RAXA 2GCLA 3KYCD 4JKCA 3HW2B 2MBHA 4W9CA 5FI1A 4ICUA 5L95C 3DQVA 2VRWB 1V49A 2P8VA 1VBHA 2N7EA 1V5MA 1FGZA 5HKHA 2GJYA 3ZDTA 3LJ3A 4EEWA 5E6PA 3EHVA 2COFA 1MK7B 2N9PC 3CSFA 2ZPYA 3S2AA 3RYTA 3QWZB 2OOBB 3L54A 2C9WB 3M62B 3JYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3H A;  4H8S A;  4CHK A;  5IA7 A;  2QKL A;  2J0M A;  4KHB B;  2IO1 B;  1I42 A;  4DX9 0;  1IPG A;  2X18 A;  4HDQ A;  3DBR I;  2RUK B;  3L0W B;  1VD2 A;  4MY6 A;  1WRD B;  5JP4 A;  4W9D A;  3N7C A;  5LOP B;  1LM8 B;  2G4D B;  2YLM A;  2M14 A;  2V76 A;  1OEY A;  2DYM A;  2L76 A;  1WMH B;  2D9V A;  4K81 A;  4PS7 A;  1XKE A;  3A8P A;  2D10 A;  2LOX A;  1J0W A;  1OEY J;  3DXD A;  1UH6 A;  2RD0 A;  2BYF A;  3SD5 A;  4PS8 A;  3ODW A;  1WR1 A;  2ZJD A;  1Y19 B;  2ABD A;  2XQN M;  2Z0O A;  2LZ6 A;  2NBU A;  4II2 B;  1U29 A;  4ANW A;  2O6V D;  3UQA A;  2NPT A;  4W9J A;  1GJZ A;  1PMS A;  1WJM A;  1V6E A;  2BKF A;  5C16 A;  2NVU I;  3R66 C;  1AAR A;  4GMV A;  5D7G A;  2OTX A;  1YX5 B;  5HE1 A;  2IZV B;  2KHW B;  4FJZ A;  3UGB B;  4K2O A;  3QK0 A;  2FUH B;  3P2B A;  3RCZ A;  1X05 A;  4E74 A;  2CHZ A;  3P6A A;  4K2P A;  1UBI A;  3DBS A;  4HXD A;  4OVV A;  3WAL A;  2A5U A;  2KJ6 A;  2LRW A;  1RFA A;  1UD7 A;  1ACA A;  2LD9 A;  2ELA A;  1Q0W B;  1OMW A;  1YIW A;  2RGF A;  3HQC A;  2D3G A;  1UEF A;  5CHF A;  3RUI B;  2CAY A;  3A33 B;  3UZT A;  2VSZ A;  2IYD B;  4C0A A;  1MIZ B;  1WH3 A;  2KK8 A;  2RLO A;  3QCA A;  2FDQ A;  5HE3 A;  2JRH A;  2N1V A;  5D2M B;  3EFU A;  5E6O A;  5C79 A;  4WWO A;  2LYD A;  1MK9 B;  1L7Y A;  4HPM B;  1Z2M A;  3V60 A;  3UQB A;  3H7S A;  2EJ8 A;  2KQS A;  4AWJ A;  2C7H A;  1H8C A;  3K9P B;  1BT0 A;  5E6N A;  3RD2 A;  4PYU A;  3I3T B;  1XD3 B;  2GBR A;  3VDZ A;  5JH5 C;  3TFM A;  5CHW A;  2E2X A;  1UPQ A;  4OVU A;  1P98 A;  3VUY A;  1SIF A;  4EOY A;  3VXW A;  1E8W A;  5DHF B;  4FA6 A;  1RJ2 A;  3D8E A;  4BFR A;  1GC7 A;  1CMX B;  1WJ6 A;  4J6I A;  2WX0 A;  3EEC A;  3G9W A;  3HHM A;  2L0T A;  1RRP B;  3GYP A;  1GG3 A;  4TKN A;  4KV2 A;  3ZIM A;  1NVL A;  2WX1 A;  2GS0 A;  4FAD A;  4GDK A;  4FLH A;  3ULC A;  3OLM D;  3GOE A;  4HPL B;  1AQC A;  2KOX A;  1Q1O A;  2P0H A;  2CKH B;  3ML8 A;  4Z2N A;  2DHI A;  4I6P A;  3U30 A;  4MEM A;  3ZVV A;  1WXM A;  2YVC A;  1WFY A;  3PLU A;  4F7G A;  1U5F A;  1SHC A;  2MCN B;  3ZDM C;  2P0D A;  3TCA A;  2J0K A;  1T0Y A;  2K6D B;  1Y5O A;  2BYE A;  2CQU A;  3AI5 A;  4JLC A;  4WJP A;  4MT7 A;  2COA A;  4WJ7 A;  2GBK A;  1A5R A;  3UF8 A;  4HAU B;  3AU4 A;  4TV3 A;  4WJN A;  4IUM B;  2GBM A;  3KVF B;  2KVR A;  1OGW A;  2HTH B;  3NHE B;  2LAS A;  2RSG A;  1BAK A;  2PJH A;  1KM7 A;  2JF5 A;  3CMM B;  3DBL I;  3ZW3 A;  3ALB A;  4MH0 E;  1KZ7 A;  3QAR A;  3H1U A;  1P5T A;  2YRY A;  2HJ8 A;  2D9W A;  1WGY A;  2LRU A;  3CIK A;  1WXV A;  2LG1 A;  3GYO A;  2C5L C;  4W9H A;  4IM0 A;  2V3S A;  2KQ7 A;  2FNJ B;  4HB0 B;  4MGK E;  4D0N B;  1XT9 B;  5AZH A;  3F5R A;  1KJT A;  2D9X A;  4ZRJ A;  2KTF A;  4K17 A;  1HB8 A;  4B6W A;  1FHO A;  3DPD A;  4DX8 A;  4LJP B;  1MG8 A;  2HRJ A;  1I2H A;  1P3R A;  2NCN A;  1R4M I;  2BYV E;  2DTC A;  3B1L X;  4GZU A;  2RR9 A;  4A6F B;  1FGY A;  2FID A;  2AYO B;  3VH4 B;  3A98 B;  3PSC A;  3D32 A;  2UZR A;  2XEW A;  3DVN V;  4KSK C;  1UZX B;  5CLQ B;  1KOT A;  2KGX B;  1F9J A;  2ASQ A;  4MJS A;  2AEH A;  2KO3 A;  2M8S A;  3AJ4 A;  1RRB A;  2P0F A;  1U5G A;  2UVM A;  2CHX A;  3QIJ A;  2K00 A;  4G0N B;  1EO6 A;  4GOC A;  4NJ6 A;  4EZJ A;  4EZK A;  2LOZ A;  1WZ0 A;  3PSE B;  1WM3 A;  2COC A;  2DZI A;  4BBN F;  5G55 A;  4CHM A;  3HK0 A;  2LXA A;  4K7S A;  1WJU A;  3VQI A;  1EVH A;  2Q13 A;  2EKE C;  2KX3 A;  3CF6 E;  2O2V B;  1MAI A;  2YSZ A;  3GZN I;  3VTW A;  1WI1 A;  1EAZ A;  3MTN B;  2PEA A;  3PRE A;  4ANU A;  5JZE B;  4MDK E;  2REX A;  2KAN A;  3VHT C;  2ZEQ A;  1RLF A;  3BIN A;  4GN1 A;  4FJY A;  3O96 A;  2XBB C;  3JW0 X;  4NY0 A;  1QZE A;  1WE7 A;  1WX8 A;  4AJY B;  2L8J A;  5J2R A;  1XX0 A;  3PVL A;  1UEL A;  4FBJ B;  3WA0 A;  4A5K A;  2KD0 A;  3A9K B;  1OQY A;  3LDZ E;  2DEN B;  5AZF A;  2J0J A;  1ZM0 A;  1C1Y B;  2O6V A;  2RQ1 A;  4ZRK A;  1BTN A;  3MDB C;  2XK5 A;  1E7U A;  1UNR A;  2ZCB A;  4EFO A;  1KZG A;  3VVW B;  4DHZ B;  4G3X B;  1UBQ A;  1DBH A;  1WX9 A;  1E7V A;  4A6K A;  2PPH A;  2V4L A;  1YD8 U;  3QJZ A;  4IM3 A;  2LVP A;  2KWV B;  3RUL A;  1FHW A;  2Z0Q A;  5KQ4 A;  3PRP B;  5FR6 A;  4FJV B;  2O2V A;  3KYD D;  2KKC A;  2MBQ A;  3AUL A;  1WF9 A;  1KLV A;  4IFS A;  1J8C A;  3KRW A;  2AL3 A;  3PVW A;  2BWE S;  2WDT B;  4LCD E;  4G50 A;  2R2Q A;  5DH9 B;  1WGG A;  3VH3 B;  3A4S C;  3ZKJ C;  3EPY A;  4MM3 A;  2YS3 A;  2K8C A;  2B3A A;  2PE6 B;  4DK5 A;  5KCV A;  4Y94 A;  2JXX A;  3Q3F A;  2YF0 A;  5EDS A;  1ISN A;  2MKR A;  4CHJ A;  3APC A;  2LKO A;  3V5W A;  2GMI C;  2MP2 A;  2Z0D B;  3WIM A;  4DDI D;  4HWI B;  4MK0 A;  2KDB A;  1WI0 A;  3L16 A;  3ECI A;  5CHV C;  1V86 A;  3QC8 B;  2N9E B;  5JHB A;  4F7H A;  2MSE D;  4HHV A;  2M17 A;  2KDI A;  2QHO A;  5CX3 A;  2KLG A;  4DXA B;  4FN2 A;  2LGX A;  3D8D A;  2GBN A;  2DX5 B;  5DPR A;  3VUW A;  2DN6 A;  4ASW C;  3ZRC A;  4E3C A;  1G6J A;  2VKI A;  1FOE A;  4GXB A;  5FI0 A;  3SYX A;  2KMA A;  2LJ5 A;  4DHJ B;  2DAJ A;  2DYN A;  3A9J A;  4HCN B;  4HAX B;  4KZ0 A;  4GMX B;  2ZPN A;  4BOS C;  5HE0 A;  4WWN A;  4M8N A;  3WAO A;  1NI2 A;  1W1H A;  2FCN A;  2K8H A;  4MGZ E;  1HB6 A;  3RZF A;  3ULB A;  1GUA B;  3B08 A;  2RSU A;  3PPA A;  2FAZ A;  2LXC A;  3UIO B;  2BCJ A;  2JP2 A;  2I5F A;  5DIF B;  2LI5 A;  3APD A;  5D3X A;  5DPS A;  3QHT A;  1NU2 A;  4W9F A;  4KIK B;  1I7A A;  3ZTC A;  4ZDV A;  2RPQ A;  5J18 A;  2KN5 A;  4HJK A;  2I5C A;  1DDV A;  3VOQ A;  4IWP A;  4EUT A;  1S1Q B;  4YON A;  1U5E A;  3DBH I;  2M4N A;  2KLC A;  3L08 A;  2LBB A;  3V6C B;  2K2U A;  2FJ9 A;  3LJU X;  4F7U P;  1TZ1 A;  1LFD A;  2IO2 B;  1NTY A;  1TQZ A;  1V61 A;  4EMO A;  4HK2 A;  4MSM B;  4AJW A;  4HB2 B;  1V5O A;  2L00 B;  3AU5 A;  2EMT A;  1P9D U;  1XOD A;  2IO3 B;  2L0F A;  5LXI B;  3PRM B;  3OAN A;  2L2I A;  3KZ1 A;  5AEK B;  3V6E B;  2KNB A;  3NS8 A;  1LW3 A;  4BOZ B;  2BKR B;  2BF8 B;  1PFJ A;  4BVU C;  2Y7B A;  1M94 A;  1P1A A;  1V88 A;  1WM2 A;  2ZNV B;  3A1Q A;  4HCP B;  2IY0 B;  2MP2 B;  3RCP A;  2J7Q B;  2RNR B;  2LUL A;  2W2X C;  3QWM A;  1YJ1 A;  3OAW A;  4N9F 4;  1VCB A;  2Y8G A;  2COP A;  2G35 A;  2NMB A;  2J59 M;  2JZ3 B;  2K8B A;  1Z87 A;  2MA9 B;  2ZNV C;  1WGR A;  1QC6 A;  2GOW A;  3JYU A;  4JL9 A;  5IAA C;  5KHO A;  1E90 A;  1V9J A;  2KJR A;  4NNJ B;  4BKS A;  3MPX A;  4W9E A;  5TR5 A;  3ZTD A;  5CLL B;  5C5B A;  4BKG A;  4EZL A;  1TXD A;  5DPT A;  3TBL D;  4BKT A;  3R7Q A;  1FB8 A;  1MPH A;  2GCJ A;  2KCJ A;  2M38 A;  3CXB B;  4HAY B;  1E8X A;  1XR0 B;  2KTR A;  3KRX A;  3ONS A;  4JIO U;  3SDL C;  3ZNI D;  3QX1 A;  3FSS A;  2G45 B;  4BKS D;  4PS3 A;  3KSY A;  4HAW B;  2KDF B;  4JQW C;  5D94 A;  3UIN B;  4URK A;  2O6V B;  1E8Y A;  1M7R A;  5J3T A;  2OQB A;  2JZZ A;  1AWE A;  2FCS A;  4IAP A;  3X23 A;  4RM8 A;  4KDI C;  2C7M B;  3PT2 B;  3T8M A;  2CRF A;  5D3V A;  4BBK A;  4IM2 A;  4WWP A;  1DRO A;  2W9N A;  2DYQ A;  3M95 A;  4HAT B;  3VIA A;  4X57 B;  1ZW7 A;  4ANX A;  3TL5 A;  3T06 A;  2L3Z A;  1LB1 A;  4W9K A;  4ZRI A;  1IRS A;  2EC1 A;  2ROZ B;  2HD5 B;  3AXC A;  5C1Z A;  5LON B;  4RM9 A;  4E71 A;  3W1S C;  2NZ8 B;  3ODX A;  3KUD B;  2DFK A;  4I6N B;  3W1Y A;  3MJW A;  4A20 A;  4HB3 B;  2W2X D;  3SO6 A;  1X1M A;  2NS5 A;  3A9J B;  4FHJ A;  4WAA A;  5KHQ A;  2N0Y A;  1J19 A;  3F0W A;  2JUO A;  3APF A;  3IBE A;  4K7U A;  2C60 A;  1V81 A;  1J0G A;  3PEG A;  1NDD A;  3IFW B;  4W9G A;  2W2W A;  2D2Q A;  2JVC A;  4F1S A;  2R09 A;  1E8Z A;  3RT3 B;  4XWX A;  4KHA A;  3DVG Y;  2UZS A;  3KH0 A;  4WQO B;  5G2N A;  3PVU A;  1DDW A;  2HE7 A;  3NZS A;  1ST7 A;  4WJQ A;  4A6F A;  2KC1 A;  1PQS A;  2Z0E B;  2Y8F A;  2IBI B;  5C6R A;  2N23 A;  2DZJ A;  2NR2 A;  1WIA A;  2WYQ A;  1JRU A;  3DDC B;  2K2J A;  4B6H A;  3HM6 X;  1MKE A;  1ZVR A;  4KHO A;  4EKU A;  3KW5 B;  2KX0 A;  1BTK A;  4I6L B;  2Z59 B;  1DYN A;  1YQB A;  4DBB A;  2DYB A;  2MBO A;  2JWZ A;  2CB8 A;  3IVF A;  2WWZ A;  3DCG A;  3SHQ A;  4DHZ E;  3FLV A;  1HBK A;  2MDX A;  1S3S G;  2KFK B;  3WYF B;  3K9O B;  2EMS A;  4TQ0 A;  1I35 A;  4KSL C;  4YL8 A;  4HB4 B;  2H7D A;  2ADZ A;  1OTR B;  4RMA A;  3TMP B;  5D27 A;  3VTV A;  1C3T A;  3A1Q B;  4NQK E;  4GDL B;  5EFX A;  2MWS B;  4PQ0 A;  1NTI A;  4IOY X;  1WGU A;  2D4Q A;  3N32 A;  3B0A A;  4GSW A;  2MWN B;  2MBE A;  1OY2 A;  1KI1 B;  3PHW B;  1WZ3 A;  3PZD A;  2D11 A;  2UYZ B;  5AZG A;  1WY8 A;  2CR5 A;  1EF1 A;  5GOW B;  5DHA B;  2YS1 A;  4HAZ B;  5HE2 A;  5JHG A;  2NBW B;  3Q3J A;  2KDE B;  3PS6 A;  4EJN A;  3QQ8 B;  1V89 A;  3L10 B;  3FEH A;  3O65 B;  1X11 A;  3SV1 A;  1H10 A;  4LDT D;  2BPS A;  2N9X A;  3HIZ A;  4MSQ B;  2KFJ A;  3PV1 A;  4ICV A;  2D07 B;  3PG7 A;  3FM8 C;  5JHA A;  1WGQ A;  1UNQ A;  4NSW A;  2RGN B;  5LLI A;  1NTV A;  1UNP A;  2ROV A;  4W9I A;  2DYO A;  1V80 A;  2K6Q A;  3PLV A;  2MX2 A;  1BWN A;  3A8Q A;  1TBE A;  1U4A A;  4KIK A;  3VUX A;  1W1D A;  3ENE A;  3PTF C;  4MJS B;  4AUQ C;  2JY6 A;  2L1C A;  2DA0 A;  2D9Z A;  4WJO A;  3TIX A;  1SGH A;  1X1G A;  2N7D A;  4M8M A;  2KWC A;  1WXS A;  3DOW A;  1X1F A;  4JGH B;  2I1J A;  3VAW A;  1K5D B;  3SNH A;  1WMH A;  2KWU B;  2MRP A;  4GPT B;  2V1Y A;  4GU2 A;  2LVO A;  3N30 A;  5CTR C;  3VTU A;  4LJO B;  5GMV A;  1K8R B;  3EC8 A;  3NZU A;  4B95 A;  1V2Y A;  1HE8 A;  3BJI A;  4W9L A;  2LVQ A;  3P7Z A;  3QBV B;  3TW1 A;  3TVV A;  3IHP C;  3N3K B;  4WSF A;  3A4R A;  4K1R B;  3DXC A;  2ZZP B;  3U8Z A;  2KFK A;  3NY5 A;  1LXD A;  2IO0 B;  1WR6 E;  3ZNG C;  2R2O A;  2D9Y A;  2ZVO A;  1Y8R C;  2I1K A;  1ZKH A;  3ZUN A;  3H9D A;  1V5T A;  2K1F A;  3H7P A;  5LXH A;  3HM3 A;  3PRZ A;  5DI9 B;  3FP5 A;  1ZC4 B;  2DKQ A;  2BWF A;  4GGQ A;  1Z5S B;  3M3J A;  5DCN A;  4F7Z A;  1TJ6 A;  3ZVR A;  2KXJ A;  3JSV A;  4KZC A;  2KJH B;  3W1S A;  1H4R A;  1TGZ B;  5D3W A;  2JPH A;  4GB9 A;  2DX1 A;  3WAN A;  4A3P A;  4DBG A;  1UGM A;  2LWP A;  1X86 A;  4AOF A;  1ZSQ A;  2IYB A;  2G4S A;  1P6S A;  1EGX A;  2NPT B;  2ZCC A;  2CS4 A;  3D8F A;  3KUZ A;  4NPN A;  1U2B A;  2PZ1 A;  3PGE A;  3TJP A;  1WJ4 A;  1WX7 A;  4LDT B;  1XCG A;  4IC7 B;  1P0R A;  5L83 A;  2N1W A;  4WVF B;  1PLS A;  3DVG X;  4CO7 A;  3ZNH B;  4II3 B;  3QAQ A;  2CY4 A;  1LQB A;  2GBJ A;  2DZK A;  3JSV B;  3C0R B;  1B55 A;  2LGY A;  4IG7 B;  4M0W B;  1WJ1 A;  2MFQ A;  2FIF A;  3RZW C;  5BO4 B;  5J17 A;  2JRI B;  2DHJ A;  3H7P B;  4GDK B;  2DLW A;  4CYE A;  3DXE A;  2G3Q B;  3OJ3 A;  3QA8 A;  4FUL A;  4NJ7 A;  2M0X A;  1FHX A;  4NQL B;  3R3M A;  5D6J B;  3PP2 A;  1XD4 A;  3NSU A;  1EF5 A;  3X0W A;  3SUZ A;  4XX5 A;  4HVB A;  2OJR A;  3WAM A;  4DWF A;  3A9K A;  1U5D A;  2C7N B;  2DX5 A;  1WE6 A;  2FCM A;  2JT4 B;  2QKM A;  2IFS A;  3ODO A;  1WYW B;  2KUP A;  3OJ4 B;  3SU8 X;  4FHK A;  1Q5W B;  3MHS D;  2YT1 A;  2DHZ A;  2MQJ A;  3KUC B;  4G11 A;  5IJM A;  1K5G B;  2NBV B;  2A4Z A;  1D3Z A;  1L2N A;  2Z0P A;  2UWQ A;  1U27 A;  1SE9 A;  3M63 B;  4PYZ A;  2DZM A;  5C23 A;  1WXA A;  1FAO A;  2FCQ A;  5JHH A;  3L17 A;  4K7W A;  4TQ1 A;  1Q67 A;  3V62 A;  1OQN A;  4A6H A;  5C5B B;  3ZO5 B;  2IY1 B;  2COD A;  2CU1 A;  2MLB A;  2PE9 A;  4A3O A;  1IP9 A;  2L7R A;  1UPR A;  4BBN C;  2LUE A;  1TTN A;  1NBF C;  4MGY E;  4DHJ D;  2RVB B;  2BGF A;  4IW0 A;  1P3Q U;  2VRR B;  4KVG B;  5L81 A;  2DAF A;  2N4F A;  3IG3 A;  5DPW A;  1WGD A;  5D3Y A;  1W1G A;  4PNK A;  4GIV A;  4HLE A;  4NAW B;  1YX6 B;  4Z2M B;  3ML9 A;  4HDO A;  1WGH A;  2KC2 A;  2ZVN A;  3BY4 B;  3VFK A;  2DHK A;  2YT0 A;  3WAP A;  3UIP B;  2YS5 A;  4XZ4 A;  1V5P A;  2LGD A;  4XC2 A;  2K39 A;  4IWQ A;  1RAX A;  2KZR A;  1IYF A;  1ZC3 B;  2GCL A;  1GC6 A;  1DDM A;  2XK5 B;  3KYC D;  4ZYN A;  2FJL A;  3HW2 B;  2MBH A;  2MW5 A;  3CST A;  3ML4 A;  4W9C A;  4KDL B;  5J3Q A;  4MGI E;  5FI1 A;  1QQG A;  2WH5 A;  4ICU A;  1FXT B;  1WG7 A;  3TO1 A;  2CHW A;  4L6E A;  5L95 C;  2K25 A;  1GNU A;  3DQV A;  3T9L A;  4TUU A;  1E5W A;  2VRW B;  2M1M A;  3R7R A;  4HAV B;  3M1I B;  1V49 A;  4NAW A;  4TYZ A;  2AWT A;  4ANV A;  2P8V A;  1XQQ A;  2H7E A;  2HTH A;  2L05 A;  2Y5B B;  4GDL A;  2N7E A;  1EUV B;  3PHX B;  5J3Y A;  4P7I A;  1M7E A;  1FGZ A;  1V5M A;  5HKH A;  2GJY A;  5KQ1 A;  3ZDT A;  3LJ3 A;  3KY9 A;  1V5U A;  3NOB A;  4IWO A;  4F8C B;  3DVN U;  3V61 A;  1WJN A;  5E6P A;  3EHV A;  4EEW A;  2COF A;  3U7D A;  3H6N A;  5JLJ B;  1MK7 B;  2MBB B;  2R0D A;  4DDG D;  1R4N I;  4MEL A;  2N9P C;  3ZRF A;  4AP4 C;  3CSF A;  2ZPY A;  4KAX B;  1ZGU B;  3JVZ X;  3S2A A;  2ELB A;  3L13 A;  4B9K A;  3RYT A;  3QWZ B;  2KTR B;  2CY5 A;  3ZLZ A;  3ZNZ B;  2KMC A;  2OOB B;  3L54 A;  1WVH A;  2DKP A;  1MIX A;  2C9W B;  3M62 B;  2AL6 A; 
#chains in the Genus database with same CATH topology
 2J0M A;  2IO1 B;  2QEJ C;  4HDQ A;  1WRD B;  2G4D B;  2DYM A;  1FPY A;  1WMH B;  4K81 A;  1XKE A;  1J0W A;  4ARI A;  3DXD A;  1YQ4 B;  2BYF A;  1HTQ A;  4PS8 A;  1WR1 A;  3AE8 B;  2NBU A;  3Q8E A;  1JWU D;  4ILG B;  3RMK C;  1U29 A;  2O6V D;  1FD6 A;  1GJZ A;  2AQ3 B;  2I2Y A;  1TKG A;  5C16 A;  1MHH E;  3IT6 B;  4N6E B;  3KWL A;  4FJZ A;  3QK0 A;  2FUH B;  3RCZ A;  1X05 A;  2TSS A;  3WAL A;  4QJ4 B;  1T0Q C;  2MJ3 A;  2ELA A;  2FBW B;  2WXG A;  1YIW A;  5CHF A;  2CAY A;  3A33 B;  1E9M A;  1C4A A;  2YEP B;  2LYD A;  1L7Y A;  3RNF C;  3UQB A;  3H7S A;  1CZP A;  2KQS A;  3EA6 A;  3N9Y C;  4BZA A;  3I3T B;  4ZHP A;  3VDZ A;  4HEA 1;  2KUQ A;  2E2X A;  1UPQ A;  5AUK A;  1SIF A;  2PLP A;  4FA6 A;  4RGT A;  4BFR A;  4J6I A;  3ZIM A;  1RRP B;  2Z59 A;  2WX1 A;  4FAD A;  4GDK A;  1RM6 C;  3ULC A;  2WXJ A;  3GOE A;  1AQC A;  2CKH B;  3NVY A;  4AS1 A;  5BYR A;  3PLU A;  4LK0 M;  1U5F A;  2K6D B;  3TCA A;  2CQU A;  4D6W A;  4XDC A;  3Q2A C;  1L0V B;  4WJP A;  1A5R A;  1TS3 A;  1TT5 B;  1FM0 D;  2GBK A;  1VZ6 A;  3AU4 A;  1N5W A;  4TV3 A;  1BML C;  3FIL A;  1OGW A;  2LAS A;  1YNT E;  4RH6 A;  3ALB A;  4MH0 E;  4P16 A;  4LNO A;  2C5L C;  2LUM A;  3FVC A;  4ZRJ A;  1F0Z A;  3NVZ A;  4DX8 A;  3NW8 A;  4R3D A;  1I2H A;  4A6F B;  4HPP A;  2BS3 B;  3A98 B;  2XEW A;  1UZX B;  1KOT A;  1K53 A;  2ASQ A;  1OFF A;  2AEH A;  4USA A;  3AJ4 A;  1YOV B;  1EO6 A;  4AQ7 A;  2LOZ A;  1N6Z A;  3GZN I;  3VTW A;  1JRP A;  1EAZ A;  3VR9 B;  4ANU A;  1VZ7 A;  2DNF A;  3BIN A;  4GN1 A;  3O96 A;  1XX0 A;  5GXG B;  4FBJ B;  3WA0 A;  1L6U A;  3A9K B;  1OQY A;  3AEE B;  2DEN B;  1IUE A;  4ZRK A;  1E7U A;  1UNR A;  1UBQ A;  2V4L A;  4IM3 A;  2WDR B;  2KWV B;  4DQO C;  1FHW A;  2Z0Q A;  5KQ4 A;  4M01 A;  4S17 A;  4K3C A;  1WGK A;  3DBH B;  3PVW A;  4LCD E;  3DCX A;  3VH3 B;  3A4S C;  3EPY A;  4MM3 A;  2YS3 A;  4KX6 B;  3Q3F A;  3PZ7 A;  1V97 A;  5I4D A;  3APC A;  2GMI C;  2SEB D;  2KDB A;  5CHV C;  1ZOY B;  2G9H D;  4HRO A;  4F7H A;  4FXC A;  2DX5 B;  2DN6 A;  5IP4 D;  2FJU B;  3Q8C A;  4DHJ B;  3RN9 C;  1E6E B;  4LNI A;  1XXG A;  2VH2 A;  5HE0 A;  1W1H A;  3TEX A;  2PVG C;  1GUA B;  3B08 A;  1JML A;  2RSU A;  3PPA A;  2FAZ A;  3UIO B;  5DIF B;  3APD A;  1STE A;  2JWU A;  4N59 A;  2KMM A;  3E9O A;  3NWF A;  2RPQ A;  4ZDV A;  1XEE A;  2I5C A;  1DDV A;  1S1Q B;  1DOI A;  1U5E A;  1WRI A;  2LBB A;  1TZ1 A;  4F7U P;  1V61 A;  1LO5 D;  2IO3 B;  2OJW A;  4YSY B;  3OAN A;  4ITK A;  1JQ4 A;  3KZ1 A;  3V6E B;  3IAS 1;  3NS8 A;  3DBL B;  3RI7 C;  2BKR B;  2V4I B;  2ZNV B;  2W2X C;  2QCZ A;  2COP A;  2G35 A;  2JZ3 B;  3B1L X;  5KHO A;  4W9E A;  3ZTD A;  5CLL B;  5C5B A;  4EZL A;  1FB8 A;  3ONS A;  4JIO U;  2IGH A;  1XCQ L;  2G45 B;  4BKS D;  4PS3 A;  3KSY A;  2MH7 A;  2O6V B;  4KDI C;  4ILJ A;  4WWP A;  4GOU A;  2DYQ A;  1ZW7 A;  1ZYI A;  5BMH A;  2PTL A;  1LB1 A;  4ZRI A;  2HD5 B;  4JWS C;  5LON B;  4RM9 A;  4I6N B;  3MJW A;  3NS1 A;  1HTO A;  3F0W A;  3APF A;  3IBE A;  2N9L A;  3IFW B;  5M4Y B;  2R09 A;  4YXD B;  5G2N A;  3AEG B;  1ST7 A;  4WJQ A;  2IBI B;  5C6R A;  1NI3 A;  1WIA A;  3DDC B;  2Z59 B;  1DYN A;  2DYB A;  2JU6 X;  2WWZ A;  1ZE3 D;  2JWZ A;  1L5P A;  2D3B A;  1XLO A;  2JYT A;  2EMS A;  4YL8 A;  4HB4 B;  2H7D A;  1OTR B;  5D27 A;  1JW9 D;  2MWS B;  1AN8 A;  2MWN B;  2MBE A;  2IJ0 A;  1V1O A;  2V9H A;  3N20 C;  3PHW B;  1WZ3 A;  1XF5 L;  1ET6 A;  1KC7 A;  3W5U B;  2CR5 A;  1C9F A;  1EF1 A;  4C80 A;  5GOW B;  3Q3J A;  4EJN A;  3O65 B;  2BPS A;  2N9X A;  3HIZ A;  3AED B;  2D07 B;  1WGQ A;  1UNQ A;  3Q6B A;  2RGN B;  1EWC A;  4W9I A;  2DYO A;  1V80 A;  2K6Q A;  4OHJ A;  1BWN A;  3PO0 A;  4KIK A;  1W1D A;  2M56 B;  4L23 A;  3VRA B;  4RGM A;  3ZQ4 A;  3TIX A;  1SGH A;  1X1G A;  4M8M A;  3DOW A;  1WXS A;  1ZXI A;  3SNH A;  4GU2 A;  1WMH A;  2V1Y A;  5CTR C;  3RPF C;  2LVO A;  3VTU A;  4B95 A;  1K8R B;  3BJI A;  3QBV B;  3TVV A;  4WSF A;  1SSN A;  2GRI A;  3UI3 A;  3ZNG C;  1YJJ A;  2I1K A;  3ZUN A;  2NMQ A;  1ZC4 B;  1SJH D;  2PMV A;  1Z5S B;  2ZW1 A;  3MFG A;  5FKA C;  1MFW A;  3W1S A;  1H4R A;  3WAN A;  3HVZ A;  4AOF A;  2ZCC A;  1IBX A;  1F1H A;  3D8F A;  3PGE A;  4JKD A;  4IC7 B;  2WXL A;  1PLS A;  1YJI A;  1V1P A;  3ZNH B;  4CO7 A;  3QAQ A;  1LQB A;  1KLG D;  2NTS A;  3NWD A;  4GDK B;  4CYE A;  4N58 A;  2G3Q B;  4YSZ B;  2BW2 A;  4NJ7 A;  2M0X A;  3PP2 A;  3AEF B;  1EF5 A;  3X0W A;  2N9K A;  1E0Z A;  3A9K A;  2JT4 B;  2FCM A;  3OJ4 B;  3Q69 A;  1Q5W B;  3MHS D;  2YT1 A;  3KUC B;  1K5G B;  2A4Z A;  1SE9 A;  5TSS A;  3HVD A;  5D3I B;  5C23 A;  4A6H A;  5C5B B;  2COD A;  2MLB A;  1IP9 A;  2LUE A;  1TTN A;  3R2T A;  4IW0 A;  1P3Q U;  3IG3 A;  4KVG B;  1W1G A;  4GIV A;  4NAW B;  1YX6 B;  4KGT A;  2KC2 A;  3WAP A;  2LGD A;  3AV8 A;  1KRH A;  1DDM A;  2XK5 B;  4ZYN A;  1WSP A;  2MW5 A;  1MHX A;  3DHG C;  4C56 C;  2WH5 A;  1FXT B;  1WG7 A;  4L6E A;  3T9L A;  2PW9 A;  2M1M A;  1FMA D;  1PDX A;  4TYZ A;  1MI0 A;  2H7E A;  2Y5B B;  1M7E A;  3NOB A;  3KY9 A;  1V5U A;  3V61 A;  3U7D A;  5JLJ B;  1IBX B;  2MBB B;  4MEL A;  3ZRF A;  2PKO A;  2RMM A;  2NTT A;  2ONQ A;  1N3H A;  2W3S A;  2BS2 B;  2Y5P A;  1I42 A;  2X18 A;  4YTM B;  1JRO A;  1G6J A;  2VZK B;  2L76 A;  4O1N A;  2D9V A;  4PS7 A;  2D10 A;  2ABD A;  1C4P A;  2LZ6 A;  4II2 B;  2KN4 A;  3UQA A;  2NPT A;  4W9J A;  3PZ8 A;  2LHE A;  2BKF A;  3Q8A A;  1D6E C;  3RNA C;  2NVU I;  3R66 C;  2J53 A;  1WWT A;  1XCT L;  2IZV B;  3DBS A;  2A5U A;  2LRW A;  1RFA A;  2LD9 A;  2RGF A;  1UEF A;  1L4D B;  2VSZ A;  2KK8 A;  1WH3 A;  2RLO A;  5E6O A;  2IGD A;  5C79 A;  4WWO A;  1YMH E;  2QDF A;  1Z2M A;  2Y5C A;  2V3P A;  3RFZ B;  3AE1 B;  2K22 A;  1RJ2 A;  3D8E A;  1WJ6 A;  1BXT A;  2WX0 A;  3G9W A;  2BS4 B;  3GYP A;  3ABV B;  2GS0 A;  3ZXR A;  3L4P A;  1L4Z B;  4HPL B;  1Q1O A;  2W55 A;  4MEM A;  3EUB 2;  4RCO A;  1WXM A;  2WNM A;  4F7G A;  1QOF A;  2P0D A;  1T0Y A;  4S0R A;  3E9P A;  1Y5O A;  2BYE A;  3AI5 A;  3B2F A;  4JE3 B;  1UWX A;  4KGR A;  3FKY A;  3NHE B;  2PJH A;  2RSG A;  1KM7 A;  2JF5 A;  4C7Z A;  4ZRP A;  1KZ7 A;  3QAR A;  1P5T A;  2D9W A;  3CIK A;  3GYO A;  2FNJ B;  4HB0 B;  1OQQ A;  1XT9 B;  3F5R A;  1KJT A;  2D9X A;  1UWM A;  1HB8 A;  1FHO A;  2CJN A;  3DPD A;  4LJP B;  2HRJ A;  2W82 A;  1P3R A;  1R4M I;  2BYV E;  4JKE A;  2RR9 A;  2AYO B;  5C3J B;  3VH4 B;  3PSC A;  1I7H A;  1F9J A;  2M8S A;  1C3T A;  1U5G A;  4G0N B;  3QIJ A;  3IAM 1;  4JX1 C;  4L1R A;  1WZ0 A;  5G55 A;  4CHM A;  1L0Y B;  1EVH A;  3ZO5 B;  1MAI A;  2YSZ A;  3MTN B;  2M19 A;  2KAN A;  4RFB A;  2ZEQ A;  1RLF A;  2L8J A;  5J2R A;  3PVL A;  2KD0 A;  3LDZ E;  1ZM0 A;  2RQ1 A;  1BTN A;  2K9X A;  3Q3O C;  2ZCB A;  4DHZ B;  1DBH A;  1WX9 A;  2LVP A;  2L83 A;  4FJV B;  2O2V A;  3GZN B;  2MBQ A;  1K52 A;  1KLV A;  4IFS A;  2JSV X;  2AL3 A;  2WDT B;  5DH9 B;  4DK5 A;  4Y94 A;  2JXX A;  2YF0 A;  4L2Y A;  5EDS A;  2MKR A;  3V5W A;  2MP2 A;  4Q2J A;  3P42 A;  2AX5 A;  2M17 A;  3E66 A;  2LGX A;  2GBN A;  5DPR A;  5I2M A;  2CJO A;  3VUW A;  3ZRC A;  2K49 A;  4M02 A;  1FOE A;  3SYX A;  2DYN A;  3A9J A;  4K3B A;  1SE2 A;  4XGA B;  4HAX B;  4KZ0 A;  1YN5 A;  4RF1 A;  4WWN A;  3WAO A;  1NI2 A;  4MGZ E;  1HB6 A;  3RZF A;  3ULB A;  3EFC A;  2LXC A;  2I5F A;  5D3X A;  3QHT A;  1NU2 A;  2JZP A;  4KIK B;  1FNW A;  3VOQ A;  4IWP A;  3V6C B;  2K2U A;  2IO2 B;  4JK9 A;  1LFD A;  2QC8 A;  4KKJ A;  1TQZ A;  2XNA C;  1V5O A;  2L00 B;  3AU5 A;  2EMT A;  3B77 A;  2EEL A;  1XOD A;  1SF0 A;  2L0F A;  3PRM B;  5I2S A;  4BVU C;  1PFJ A;  2KDM A;  1M94 A;  3BK2 A;  2IY0 B;  2MP2 B;  5JHB A;  4ASW C;  3DWM A;  2Y8G A;  2K8B A;  1GPX A;  5IAA C;  4JKB A;  1TYG B;  2GOW A;  1TY0 A;  1E90 A;  2GB1 A;  2KJR A;  5TR5 A;  1Q10 A;  3HIE A;  1PGB A;  3GE8 C;  1MPH A;  2KCJ A;  4HAY B;  1E8X A;  1UNS A;  2DBY A;  1JDE A;  3QX1 A;  3FSS A;  4HAW B;  2KDF B;  1ENF A;  4URK A;  1E8Y A;  5J3T A;  4JPS A;  1AWE A;  3X23 A;  4RM8 A;  3PT2 B;  3C8Y A;  1DRO A;  3M95 A;  3VIA A;  1I4P A;  1I4X A;  1ZDV A;  1P7E A;  4WUR A;  3SBT A;  3T06 A;  2EC1 A;  3AXC A;  5C1Z A;  3W1S C;  3W1Y A;  3TEY A;  4H2A A;  5EE9 A;  4A20 A;  1TY2 A;  4FHJ A;  5KHQ A;  2Y3A A;  2N0Y A;  1J0G A;  1V81 A;  4F1S A;  2W2W A;  2JVC A;  3AM9 A;  3AE9 B;  3N1Y C;  4KHA A;  4WQO B;  3KH0 A;  4ZYS A;  3AE5 B;  3PVU A;  1DDW A;  1PQS A;  2Z0E B;  2N23 A;  2NR2 A;  3T3N A;  1JRU A;  1ZUD 2;  4B6H A;  1DIK A;  1MKE A;  1ZVR A;  3HM6 X;  4EKU A;  2KX0 A;  4I6L B;  3I57 A;  1YQB A;  4KGS A;  4DHZ E;  2CB8 A;  4JK7 A;  2MDX A;  1S3S G;  3P4P B;  1I35 A;  4A8X C;  3TMP B;  2ADZ A;  4RMA A;  3VTV A;  1I4H A;  5EFX A;  3Q3N C;  2D4Q A;  3N32 A;  3B0A A;  1KI1 B;  3MHZ A;  5IRS A;  2K3U A;  4HAZ B;  3I63 C;  2KDE B;  1ZP0 B;  1V89 A;  3L10 B;  2MJE A;  4MSQ B;  3NWA A;  2KFJ A;  3PV1 A;  3KQ4 A;  3PG7 A;  2RDB C;  4TMA B;  3RNE C;  3P1M A;  5LLI A;  2Z14 A;  3PLV A;  2YT2 A;  3J9C A;  3A8Q A;  1U4A A;  1N62 A;  3ENE A;  3PTF C;  1QOG A;  4MJS B;  2DA0 A;  2D9Z A;  2L32 A;  4WJO A;  4REZ A;  3VAW A;  1K5D B;  4GPT B;  2IGG A;  3KLS X;  3NZU A;  1HE8 A;  2LVQ A;  1VDV A;  3IHP C;  1QT9 A;  2GI9 A;  3A4R A;  2HDE A;  1WR6 E;  3AN1 A;  5H92 C;  2R2O A;  1Y8R C;  1ZKH A;  1NVI D;  1V5T A;  2K1F A;  1NEK B;  3W5V B;  3M3J A;  4LTU A;  4F7Z A;  1R7S A;  3ZVR A;  2KXJ A;  3JSV A;  4KZC A;  2J52 A;  1TGZ B;  2JPH A;  1MPE A;  5LNK 1;  3HRD D;  1X86 A;  1R4N B;  2NPT B;  1P6S A;  3AH7 A;  2CS4 A;  3KUZ A;  2KQ4 X;  3Q14 C;  1WX7 A;  1YN3 A;  4LDT B;  5L83 A;  1C76 A;  3DVG X;  1N60 A;  4NZL B;  1B55 A;  1M4V A;  4M0W B;  2MFQ A;  5J17 A;  5BO4 B;  2DLW A;  2ICI A;  4KHB A;  1XD4 A;  3NSU A;  4JKF A;  3SUZ A;  2HTM E;  1PYW D;  2OJR A;  4HVB A;  1U5D A;  3ODO A;  2IFS A;  1WYW B;  2KUP A;  3H8H A;  2KWD A;  3AE7 B;  5IJM A;  1SEB D;  1D3Z A;  1L2N A;  2BT6 A;  1P7F A;  1VBG A;  3ZYY X;  2DZM A;  4K7W A;  3HSA A;  4TQ1 A;  1OQN A;  2IY1 B;  1UPR A;  2L52 A;  3DHH C;  4CQN A;  5L81 A;  2DAF A;  4RNA A;  2WXF A;  5BMI A;  4QJ5 B;  4HLE A;  4PNK A;  4QXA B;  1I4Q A;  2ZVN A;  3BY4 B;  2YT0 A;  1UGJ A;  4XC2 A;  2FJL A;  3AE2 B;  1FXI A;  3GE3 C;  4MGI E;  5J3Q A;  2L1A A;  1QQG A;  2HJ1 A;  1T6B X;  4TUU A;  1E5W A;  2V3N A;  3R7R A;  3M1I B;  1OQR A;  1XQQ A;  1T0S C;  3R2I A;  2L05 A;  2FE8 A;  1EUV B;  5J3Y A;  5KQ1 A;  4RGO S;  1B9R A;  2WHI A;  2INN E;  1WJN A;  1L6V A;  3H6N A;  2OHF A;  4A6Q A;  4JWU C;  2R0D A;  1J7B A;  1R4N I;  4DDG D;  3ZGZ A;  4KAX B;  1DGJ A;  1ZGU B;  5H8Y E;  2ELB A;  3ZLZ A;  3TEZ A;  2KMC A;  1WVH A;  2DKP A;  3ZTC A;  4L1B A;  1T77 A;  5IA7 A;  4KHB B;  4MT5 A;  2JX5 A;  2QSD A;  4DX9 0;  1IPG A;  3DBR I;  1E7P B;  2RUK B;  3L0W B;  4MY6 A;  3N7C A;  2M14 A;  2V76 A;  1OEY A;  5FR3 A;  5HG2 A;  2XN9 C;  3A8P A;  2LOX A;  1OEY J;  4US9 A;  2RD0 A;  2DWQ A;  1NYR A;  2XQN M;  2Z0O A;  4ANW A;  3T3O A;  1T3Q A;  3U52 E;  3P4S B;  1DOY A;  2Q5W D;  2VH1 A;  4HRS A;  1D4B A;  2KHW B;  5HE1 A;  3UGB B;  1SE3 A;  1HZ5 A;  3BYY B;  3P2B A;  4E74 A;  2RDH A;  3P6A A;  4K2P A;  1UBI A;  3MC9 A;  1MG4 A;  1Q0W B;  1OMW A;  3RUI B;  2IYD B;  4PYU A;  4C0A A;  1MIZ B;  5CHW A;  2E6X A;  1F52 A;  4DIX A;  1PUT A;  2ON8 A;  4HPM B;  1RYJ A;  2C7H A;  3K9P B;  1BT0 A;  5E6N A;  1QOA A;  2LMC A;  2GBR A;  4OVU A;  5EE0 A;  1P98 A;  4C4V B;  2R2Y A;  1CK1 A;  3LXF A;  4JKH A;  1E8W A;  1I4G A;  3VXW A;  3DHI C;  4TSS A;  4OSN A;  1CMX B;  3EEC A;  3HHM A;  4NAM A;  1NVL A;  1D5Z C;  3OLM D;  3SFE B;  2KOX A;  1YQ3 B;  3ML8 A;  2WLB A;  2LFI A;  4I6P A;  2WXI A;  3AB5 A;  2YVC A;  1WFY A;  1SHC A;  2MCN B;  2UU7 A;  5EE3 A;  3ZDM C;  3SBG A;  2J0K A;  1ESF A;  4JLC A;  1VRA B;  4MT7 A;  4WJ7 A;  3UF8 A;  4WJN A;  2GBM A;  3KVF B;  1BAK A;  3ZW3 A;  3NJT A;  3DBL I;  2YRY A;  2HJ8 A;  2LG1 A;  4IM0 A;  2KQ7 A;  4D0N B;  4K17 A;  1E10 A;  4HKZ E;  1MG8 A;  1T5X D;  1V8C A;  2NCN A;  1R4M B;  2KIG A;  2DTC A;  4GZU A;  3Q3M C;  3AEA B;  2G1E A;  1ZXH A;  1FIQ A;  3DVN V;  2UZR A;  4KSK C;  1GB1 A;  5CLQ B;  2KGX B;  1RFK A;  2GUM A;  4OW0 A;  2KO3 A;  1RRB A;  2P0F A;  1HXY D;  4HSI A;  3BII D;  4YTP B;  4EZJ A;  4GOC A;  2COC A;  3NUH B;  4BBN F;  3ZJU A;  2EKE C;  3CF6 E;  3CWI A;  5JZE B;  2PEA A;  2REX A;  4FJY A;  4QAY A;  3JW0 X;  4AJY B;  3CIR B;  1UEL A;  2O6V A;  2CU3 A;  3MDB C;  2XK5 A;  4EFO A;  2N7J A;  4G3X B;  3QJZ A;  2PPH A;  1E7V A;  3BYT B;  3RUL A;  4YSX B;  3PRP B;  3KYD D;  2KKC A;  2W54 A;  1WF9 A;  4OT1 A;  3KWV A;  3FIL B;  3KRW A;  2FUG 1;  4G50 A;  2WXM A;  3ZKJ C;  1QOB A;  2K8C A;  2B3A A;  2PE6 B;  2WDQ B;  3A58 A;  3SFD B;  1ISN A;  4MH8 A;  2RRF A;  3WIM A;  4HWI B;  3L16 A;  3ECI A;  4UDU C;  1V86 A;  3OWE B;  2QHO A;  5CX3 A;  2KLG A;  4FN2 A;  3GP7 A;  3D8D A;  3IXS A;  3GS2 A;  4GXB A;  5FI0 A;  2KMA A;  2LJ5 A;  3P63 A;  4RF0 A;  2BTE A;  2DAJ A;  1Y56 A;  4HCN B;  1AYF A;  4M8N A;  2K8H A;  2FCN A;  2J4X A;  3RNC C;  1JAL A;  1GOZ A;  1HQR D;  2BCJ A;  4ARC A;  2LI5 A;  3EGR A;  1VLB A;  1I7A A;  5J18 A;  4HJK A;  3P4R B;  4EUT A;  3ETR A;  4YON A;  4LLG M;  2M4N A;  3GB1 A;  2KLC A;  3L08 A;  2FJ9 A;  1NTY A;  2D3A A;  4EMO A;  4MSM B;  4AJW A;  2M0A A;  2MJD A;  1P9D U;  1J7C A;  2KYW A;  2KR0 A;  1QLB B;  1FO4 A;  2KNB A;  3ZXV A;  1P1A A;  1V88 A;  1WM2 A;  4HKQ A;  3RNB C;  4HCP B;  4JKG A;  3U12 A;  2J7Q B;  1YJ1 A;  2LUL A;  3SR6 A;  3VFK A;  2WQY B;  3ZVV A;  1VCB A;  3CST A;  2J59 M;  2ZNV C;  3JYU A;  1WGR A;  2LGS A;  1V9J A;  3LB8 C;  1FFU A;  4NNJ B;  3MPX A;  1TXD A;  5DPT A;  3TBL D;  1ZDX A;  3R7Q A;  2GCJ A;  1TZO A;  3CXB B;  3SDL C;  3ZNI D;  1XR0 B;  3KRX A;  2YEP F;  2KIE A;  2JZZ A;  2FCS A;  4IAP A;  3ZJV A;  4JKA A;  2C7M B;  2CRF A;  5D3V A;  4BBK A;  4X57 B;  4ANX A;  2R82 A;  2D3C A;  2L3Z A;  4W9K A;  1IRS A;  2ROZ B;  4LNF A;  4E71 A;  1K50 A;  3U4E G;  4OZA A;  5G5H A;  2W2X D;  3SO6 A;  2NS5 A;  4WAA A;  3LYY A;  1J19 A;  2JUO A;  1C78 A;  2BVC A;  3DVG Y;  3MJ5 A;  3NZS A;  4A6F A;  1WYG A;  2KC1 A;  2DZJ A;  1UF0 A;  2PIA A;  4KHO A;  1HEZ E;  3KW5 B;  3SHQ A;  2INP E;  3W9C B;  3FLV A;  4ILH A;  1HBK A;  2KFK B;  3WYF B;  3K9O B;  5LG4 B;  4IOI E;  4XWW A;  3A1Q B;  2ACZ B;  4NQK E;  3DBR B;  4PQ0 A;  1NTI A;  4IOY X;  1WGU A;  5G5G A;  1SJE D;  4GSW A;  1OY2 A;  3Q8B A;  2JQR B;  2D11 A;  3C19 A;  1WXQ A;  1WY8 A;  3I5J C;  1IGD A;  2YS1 A;  3NVW A;  1MI1 A;  2NBW B;  5JHG A;  3PS6 A;  3QQ8 B;  3FEH A;  1C79 A;  3SV1 A;  1H10 A;  3BVZ A;  3VR8 B;  2LHD A;  4OZC A;  4NSW A;  2AQ1 B;  5MPO A;  1NTV A;  1UNP A;  2ROV A;  4XYC A;  4AUQ C;  2L1C A;  4A55 A;  2N0S B;  2KWC A;  4JGH B;  3ZJT A;  1X1F A;  2WGS A;  2WXK A;  2MRP A;  3N30 A;  3EC8 A;  1V2Y A;  4LNN A;  3P7Z A;  3TW1 A;  4K1R B;  3DXC A;  2ZZP B;  3U8Z A;  2KFK A;  1LXD A;  2IO0 B;  2ZVO A;  4WQM A;  5LXH A;  3FP5 A;  2DKQ A;  4GB9 A;  1TIF A;  2RPV A;  4DBG A;  2J42 A;  1ZSQ A;  2IYB A;  1GAQ B;  1EGX A;  1FNV A;  2N1W A;  2KAC A;  3BWU D;  2CY4 A;  2DZK A;  3JSV B;  1FRD A;  4C00 A;  2LGY A;  1WJ1 A;  2JRI B;  2DHJ A;  1XLN A;  3U7Z A;  3R3M A;  5D6J B;  2VZK D;  2BBC A;  4XX5 A;  1F2R I;  3WAM A;  5E6J A;  2DX5 A;  1WE6 A;  2QKM A;  3SU8 X;  4IDI A;  4G11 A;  2NBV B;  2Z0P A;  1U27 A;  1HA5 A;  3M63 B;  1K51 A;  3AMZ A;  1FAO A;  1EU3 A;  5JHH A;  1Q67 A;  3V62 A;  4ZHO A;  2BQQ A;  2PE9 A;  4A3O A;  2L7R A;  4BBN C;  4A90 A;  3MC0 B;  4MGY E;  2RVB B;  2N4F A;  1B1Z A;  1WGD A;  4Z2M B;  2KVZ A;  1WGH A;  2DHK A;  3AE6 B;  2YS5 A;  3UIP B;  2NBV A;  4GNK B;  2WDV B;  4IWQ A;  1D5M C;  2KZR A;  1ZC3 B;  1IYF A;  1GC6 A;  3E56 A;  3ML4 A;  4XDD A;  4ZRQ A;  1FCL A;  4KDL B;  1BUI C;  5BYQ A;  3TO1 A;  2CHW A;  1FNU A;  2K25 A;  1GNU A;  1PGX A;  4WIP A;  2BYT A;  5IOI A;  4HAV B;  4B0M A;  4NAW A;  2AWT A;  4ANV A;  2HTH A;  4GDL A;  3PHX B;  4P7I A;  1H8C A;  1PFD A;  4IWO A;  4F8C B;  3DVN U;  2WXN A;  2MHJ A;  4AP4 C;  2OED A;  3JVZ X;  4GLS C;  4B9K A;  3L13 A;  4NJC A;  3VRB B;  2KTR B;  4EE2 A;  2CY5 A;  3ZNZ B;  3I9V 1;  1UUP A;  1MIX A;  1TS5 A;  2LEK A;  3R8B A;  4H8S A;  4CHK A;  2QKL A;  1FFV A;  1KFY B;  3URY A;  1VD2 A;  5JP4 A;  4W9D A;  4JKG B;  5LOP B;  1LM8 B;  2YLM A;  1N63 A;  4ZOH C;  1UH6 A;  3SD5 A;  3NG0 A;  3ODW A;  2ZJD A;  3UIN B;  1Y19 B;  4YT0 B;  1PMS A;  1WJM A;  1V6E A;  1MVK A;  2WU2 B;  1QQR A;  1AAR A;  4GMV A;  5D7G A;  2OTX A;  1YX5 B;  4K2O A;  4IKG A;  2CHZ A;  1LGR A;  4HXD A;  4OVV A;  2KJ6 A;  1UD7 A;  1ACA A;  3HQC A;  2D3G A;  3UZT A;  4FLH A;  3QCA A;  5D2M B;  2FDQ A;  5HE3 A;  2JRH A;  2N1V A;  3EFU A;  4P6V F;  2WXQ A;  1MK9 B;  3V60 A;  4AWJ A;  2EJ8 A;  1C4C A;  3RD2 A;  1XD3 B;  5JH5 C;  3TFM A;  3VUY A;  2R61 A;  4EOY A;  5DHF B;  1GC7 A;  2L0T A;  1GG3 A;  4TKN A;  4KV2 A;  2X0S A;  4XE0 A;  5C2T B;  1D5X C;  1I4R A;  1VJK A;  5JVL A;  2P0H A;  4Z2N A;  2DHI A;  1DYQ A;  4WH4 A;  3U30 A;  1V1P B;  2QIE B;  3AEC B;  3RNG C;  2COA A;  4HAU B;  1AWD A;  1XLP A;  1PGA A;  4IUM B;  2KVR A;  2HTH B;  4GDL B;  3CMM B;  3P4Q B;  1TKE A;  3H1U A;  1N61 A;  1SE4 A;  1WGY A;  4W9H A;  2LRU A;  3W2D A;  1WXV A;  2AQ2 B;  2V3S A;  4WWM A;  4MGK E;  2DLB A;  5AZH A;  3V05 A;  2KTF A;  2ZW0 A;  4B6W A;  4HJG E;  1FCC C;  2FID A;  1FGY A;  3D32 A;  3ENB A;  4MJS A;  5T8I A;  2CHX A;  2UVM A;  2B76 B;  4NJ6 A;  2K00 A;  4EZK A;  2LJI A;  1C77 A;  3PSE B;  1FXA A;  1WM3 A;  2DZI A;  3HK0 A;  2LXA A;  4K7S A;  1WJU A;  1AW7 A;  3VQI A;  4C4V A;  2Q13 A;  2KX3 A;  2O2V B;  4CSQ A;  1WI1 A;  3FAH A;  3PRE A;  4MDK E;  3VHT C;  2E3T A;  2XBB C;  4NY0 A;  1QZE A;  1WE7 A;  1WX8 A;  1CJE A;  4A5K A;  2K8E A;  1JWS D;  2J0J A;  1C1Y B;  5AZF A;  4P1C C;  5IO9 A;  1KZG A;  3VVW B;  1YN4 A;  1ET9 A;  4A6K A;  1YD8 U;  2WXH A;  5FR6 A;  3AUL A;  1J8C A;  2BWE S;  2W3R A;  1DOX A;  2R2Q A;  1WGG A;  1CQV A;  2WP9 B;  5KCV A;  2WS3 B;  4QJ3 B;  4CHJ A;  2LKO A;  2Z0D B;  4DDI D;  4MK0 A;  3V3X A;  1WI0 A;  3QC8 B;  2N9E B;  2MSE D;  4HHV A;  2KDI A;  4DXA B;  4E3C A;  2VKI A;  3NVV A;  3DWG C;  4PT5 A;  4GMX B;  2ZPN A;  4BOS C;  3HUI A;  2IDY A;  3Q8F A;  1TS2 A;  1J7A A;  1KTK A;  2JP2 A;  5DPS A;  4W9F A;  1KLU D;  1ROE A;  2KN5 A;  4DXF A;  4RGN A;  5HFY A;  1QKZ A;  3DBH I;  2Z4D A;  1SXT A;  5HHD G;  3LJU X;  2WU5 B;  4HK2 A;  4HB2 B;  1F77 A;  1JWM D;  2MEK A;  2IND C;  1A70 A;  1GGO A;  5LXI B;  1KH0 A;  2L2I A;  1EU4 A;  1EWY C;  5AEK B;  1LW3 A;  3N1X C;  4BOZ B;  3MP9 A;  2BF8 B;  4OZB A;  2Y7B A;  1QIL A;  2IPK D;  4YTN B;  3A1Q A;  3OAW A;  3RCP A;  1XO3 A;  2RNR B;  3QWM A;  4N9F 4;  2MA9 B;  2NMB A;  1Z87 A;  4JL9 A;  1QC6 A;  3IT4 B;  2WXO A;  2INC C;  2QMT A;  4BKS A;  4BKG A;  2D5G A;  4BKT A;  3RZW C;  2M38 A;  4KKI A;  2KTR A;  4DXG A;  2WXR A;  4C7Y A;  1ACC A;  4JQW C;  5D94 A;  2WXP A;  2BB6 A;  5D3D A;  1M7R A;  2OQB A;  3T8M A;  4IM2 A;  1TS4 A;  4XWT A;  2Z8L A;  2W9N A;  2QJL A;  4HAT B;  3TL5 A;  4LNK A;  2NZ8 B;  3ODX A;  3KUD B;  2DFK A;  2X38 A;  1GB4 A;  4HB3 B;  1X1M A;  3A9J B;  4K7U A;  2C60 A;  3PEG A;  1NDD A;  4J3O D;  4W9G A;  2D2Q A;  2RDG A;  1E8Z A;  3RT3 B;  4XWX A;  2UZS A;  1RWS A;  2LGI A;  2HE7 A;  1SB3 C;  2Y8F A;  2WYQ A;  2K2J A;  3OG5 A;  1BTK A;  1SBB B;  4DBB A;  2MBO A;  3AEB B;  3DCG A;  3IVF A;  2JYE A;  4MM3 B;  3WCQ A;  4TQ0 A;  4KSL C;  3TSS A;  2BB5 A;  3MC8 A;  3OHM B;  4P1B C;  1JCK B;  2K0P A;  2KT7 A;  4JK8 A;  2K5P A;  4A9A A;  3TEW A;  5BYS A;  3PZD A;  3O13 A;  2UYZ B;  5AZG A;  5DHA B;  5HE2 A;  4B0E A;  1N5X A;  2V0G A;  3AE3 B;  1X11 A;  4LDT D;  5BMG A;  4ICV A;  5JHA A;  3FM8 C;  4M0W A;  1MJD A;  3B9J A;  4WAF A;  1QF6 A;  3B2G A;  2DIK A;  2H88 B;  2MX2 A;  1TBE A;  5AUI A;  3VUX A;  4PK1 A;  1IGC A;  1XLQ A;  2JY6 A;  1ZPS A;  5IN7 A;  2N7D A;  3E9S A;  2I1J A;  2KWU B;  1KBL A;  4LJO B;  5GMV A;  4W9L A;  3N3K B;  1L0X B;  4ACF A;  3NY5 A;  2D9Y A;  1FEH A;  3H9D A;  3H7P A;  3HM3 A;  3PRZ A;  5DI9 B;  1NYQ A;  4GGQ A;  2BWF A;  2PVO D;  3AE4 B;  5DCN A;  1TJ6 A;  2Z13 A;  2KJH B;  4A3P A;  5D3W A;  2DX1 A;  1UGM A;  2LWP A;  1JWB D;  1VR9 A;  2G4S A;  1KF6 B;  3BVG A;  4NPN A;  1U2B A;  2PZ1 A;  1NEN B;  3TJP A;  1WJ4 A;  1XCG A;  1P0R A;  3SEB A;  4WVF B;  1TJE A;  4II3 B;  2GBJ A;  3TUO A;  3C0R B;  4M00 A;  4IG7 B;  2FIF A;  3BK1 A;  4D2K A;  3H7P B;  3DXE A;  3OJ3 A;  4FUL A;  3QA8 A;  2I38 A;  1FHX A;  4NQL B;  4DWF A;  2C7N B;  1FRR A;  4FHK A;  2DHZ A;  2MQJ A;  3BZD B;  2UWQ A;  2QIL A;  1TKY A;  4PYZ A;  1WXA A;  2FCQ A;  3L17 A;  5FK9 C;  2ZKM X;  2CU1 A;  2SAK A;  3E9L A;  1NBF C;  4DHJ D;  2BGF A;  5DPW A;  1F2R C;  2VRR B;  5D3Y A;  1T0R C;  4HDO A;  3ML9 A;  3U2S C;  4XZ4 A;  1V5P A;  2KAJ A;  2K39 A;  1RAX A;  2GCL A;  3KYC D;  4JKC A;  3HW2 B;  2MBH A;  4W9C A;  5FI1 A;  4ICU A;  2GLS A;  5L95 C;  3DQV A;  2VRW B;  5JXV A;  1V49 A;  1HZ6 A;  3N1Z C;  3NZ3 A;  5EE1 A;  4YWG G;  2P8V A;  1VBH A;  5IKC M;  2N7E A;  1V5M A;  4MAC A;  1FGZ A;  5HKH A;  2GJY A;  3ZDT A;  3LJ3 A;  4EEW A;  5E6P A;  3EHV A;  2X8X X;  2COF A;  4OVZ A;  1MK7 B;  3BVM A;  1JWA D;  2N9P C;  4US8 A;  3CSF A;  5HI1 A;  2ZPY A;  1SIJ A;  2H89 B;  1VZ8 A;  3S2A A;  3RYT A;  2EKI A;  1EM7 A;  3QWZ B;  4BAX A;  2OOB B;  3L54 A;  3NRZ A;  3FC4 A;  2JXT A;  2C9W B;  3M62 B;  2AL6 A; 
#chains in the Genus database with same CATH homology
 2J0M A;  2IO1 B;  4HDQ A;  1WRD B;  2G4D B;  2DYM A;  1WMH B;  4K81 A;  1XKE A;  1J0W A;  3DXD A;  2BYF A;  4PS8 A;  1WR1 A;  2NBU A;  4ILG B;  1U29 A;  2O6V D;  1GJZ A;  5C16 A;  4FJZ A;  3QK0 A;  2FUH B;  3RCZ A;  1X05 A;  3WAL A;  2ELA A;  1YIW A;  5CHF A;  2CAY A;  3A33 B;  2LYD A;  1L7Y A;  3UQB A;  3H7S A;  2KQS A;  3I3T B;  3VDZ A;  2E2X A;  1UPQ A;  1SIF A;  4FA6 A;  4BFR A;  4J6I A;  3ZIM A;  1RRP B;  2WX1 A;  4FAD A;  4GDK A;  3ULC A;  3GOE A;  1AQC A;  2CKH B;  3PLU A;  1U5F A;  2K6D B;  3TCA A;  2CQU A;  4WJP A;  1A5R A;  2GBK A;  3AU4 A;  4TV3 A;  1OGW A;  2LAS A;  3ALB A;  4MH0 E;  2C5L C;  4ZRJ A;  4DX8 A;  1I2H A;  4A6F B;  3A98 B;  2XEW A;  1UZX B;  1KOT A;  2ASQ A;  2AEH A;  3AJ4 A;  1EO6 A;  2LOZ A;  3GZN I;  3VTW A;  1EAZ A;  4ANU A;  3BIN A;  4GN1 A;  3O96 A;  1XX0 A;  4FBJ B;  3WA0 A;  3A9K B;  1OQY A;  2DEN B;  4ZRK A;  1E7U A;  1UNR A;  1UBQ A;  2V4L A;  4IM3 A;  2KWV B;  1FHW A;  2Z0Q A;  5KQ4 A;  3PVW A;  4LCD E;  3VH3 B;  3A4S C;  3EPY A;  4MM3 A;  2YS3 A;  3Q3F A;  3APC A;  2GMI C;  5CHV C;  2KDB A;  4F7H A;  2DX5 B;  2DN6 A;  4DHJ B;  5HE0 A;  1W1H A;  1GUA B;  3B08 A;  2RSU A;  3PPA A;  2FAZ A;  3UIO B;  5DIF B;  3APD A;  3E9O A;  4ZDV A;  2RPQ A;  2I5C A;  1DDV A;  1S1Q B;  1U5E A;  2LBB A;  1TZ1 A;  4F7U P;  1V61 A;  2IO3 B;  3OAN A;  3KZ1 A;  3V6E B;  3NS8 A;  2BKR B;  2ZNV B;  2W2X C;  3B1L X;  2COP A;  2G35 A;  2JZ3 B;  5KHO A;  4W9E A;  3ZTD A;  5CLL B;  5C5B A;  4EZL A;  1FB8 A;  3ONS A;  4JIO U;  2G45 B;  4BKS D;  4PS3 A;  3KSY A;  2O6V B;  4KDI C;  4ILJ A;  4WWP A;  2DYQ A;  1ZW7 A;  1LB1 A;  4ZRI A;  2HD5 B;  5LON B;  4RM9 A;  4I6N B;  3MJW A;  3F0W A;  3APF A;  3IBE A;  3IFW B;  2R09 A;  5G2N A;  1ST7 A;  4WJQ A;  2IBI B;  5C6R A;  1WIA A;  3DDC B;  2Z59 B;  1DYN A;  2DYB A;  2WWZ A;  2JWZ A;  2EMS A;  4YL8 A;  4HB4 B;  2H7D A;  1OTR B;  5D27 A;  2MWS B;  2MWN B;  2MBE A;  3PHW B;  1WZ3 A;  1KC7 A;  2CR5 A;  1EF1 A;  5GOW B;  3Q3J A;  4EJN A;  3O65 B;  2BPS A;  2N9X A;  3HIZ A;  2D07 B;  1WGQ A;  1UNQ A;  2RGN B;  4W9I A;  2DYO A;  1V80 A;  2K6Q A;  1BWN A;  4KIK A;  1W1D A;  3TIX A;  1SGH A;  1X1G A;  4M8M A;  3DOW A;  1WXS A;  3SNH A;  4GU2 A;  1WMH A;  2V1Y A;  5CTR C;  2LVO A;  3VTU A;  4B95 A;  1K8R B;  3BJI A;  3QBV B;  3TVV A;  4WSF A;  3ZNG C;  2I1K A;  3ZUN A;  1ZC4 B;  1Z5S B;  3W1S A;  1H4R A;  3WAN A;  4AOF A;  2ZCC A;  3D8F A;  3PGE A;  4JKD A;  4IC7 B;  1PLS A;  4CO7 A;  3ZNH B;  3QAQ A;  1LQB A;  4GDK B;  4CYE A;  2G3Q B;  4NJ7 A;  2M0X A;  3PP2 A;  1EF5 A;  3X0W A;  3A9K A;  2JT4 B;  2FCM A;  3OJ4 B;  1Q5W B;  3MHS D;  2YT1 A;  3KUC B;  1K5G B;  2A4Z A;  1SE9 A;  5C23 A;  4A6H A;  5C5B B;  2COD A;  2MLB A;  1IP9 A;  2LUE A;  1TTN A;  4IW0 A;  1P3Q U;  3IG3 A;  4KVG B;  1W1G A;  4GIV A;  4NAW B;  1YX6 B;  2KC2 A;  3WAP A;  2LGD A;  1DDM A;  2XK5 B;  4ZYN A;  2MW5 A;  2WH5 A;  1FXT B;  1WG7 A;  4L6E A;  3T9L A;  2M1M A;  4TYZ A;  2H7E A;  2Y5B B;  1M7E A;  3NOB A;  3KY9 A;  1V5U A;  3V61 A;  3U7D A;  5JLJ B;  2MBB B;  4MEL A;  3ZRF A;  1N3H A;  1I42 A;  2X18 A;  1G6J A;  2L76 A;  2D9V A;  4PS7 A;  2D10 A;  2ABD A;  2LZ6 A;  4II2 B;  3UQA A;  2NPT A;  4W9J A;  2BKF A;  2NVU I;  3R66 C;  2IZV B;  3DBS A;  2A5U A;  2LRW A;  1RFA A;  2LD9 A;  2RGF A;  1UEF A;  2VSZ A;  2KK8 A;  1WH3 A;  2RLO A;  5E6O A;  5C79 A;  4WWO A;  1Z2M A;  1RJ2 A;  3D8E A;  1WJ6 A;  2WX0 A;  3G9W A;  3GYP A;  2GS0 A;  4HPL B;  1Q1O A;  4MEM A;  1WXM A;  4F7G A;  2P0D A;  1T0Y A;  3E9P A;  1Y5O A;  2BYE A;  3AI5 A;  3NHE B;  2PJH A;  2RSG A;  1KM7 A;  2JF5 A;  1KZ7 A;  3QAR A;  1P5T A;  2D9W A;  3CIK A;  3GYO A;  2FNJ B;  4HB0 B;  1XT9 B;  3F5R A;  1KJT A;  2D9X A;  1HB8 A;  1FHO A;  3DPD A;  4LJP B;  2HRJ A;  1P3R A;  1R4M I;  2BYV E;  4JKE A;  2RR9 A;  2AYO B;  3VH4 B;  3PSC A;  1F9J A;  2M8S A;  1C3T A;  1U5G A;  4G0N B;  3QIJ A;  1WZ0 A;  5G55 A;  4CHM A;  1EVH A;  3ZO5 B;  1MAI A;  2YSZ A;  3MTN B;  2KAN A;  2ZEQ A;  1RLF A;  2L8J A;  5J2R A;  3PVL A;  2KD0 A;  3LDZ E;  1ZM0 A;  2RQ1 A;  1BTN A;  2ZCB A;  4DHZ B;  1DBH A;  1WX9 A;  2LVP A;  4FJV B;  2O2V A;  2MBQ A;  1KLV A;  4IFS A;  2AL3 A;  2WDT B;  5DH9 B;  4DK5 A;  4Y94 A;  2JXX A;  2YF0 A;  5EDS A;  2MKR A;  3V5W A;  2MP2 A;  2M17 A;  3E66 A;  2LGX A;  2GBN A;  5DPR A;  3VUW A;  3ZRC A;  1FOE A;  3SYX A;  2DYN A;  3A9J A;  4HAX B;  4KZ0 A;  4WWN A;  3WAO A;  1NI2 A;  4MGZ E;  1HB6 A;  3RZF A;  3ULB A;  2LXC A;  2I5F A;  5D3X A;  3QHT A;  1NU2 A;  4KIK B;  3VOQ A;  4IWP A;  3V6C B;  2K2U A;  2IO2 B;  4JK9 A;  1LFD A;  1TQZ A;  1V5O A;  2L00 B;  3AU5 A;  2EMT A;  1XOD A;  2L0F A;  3PRM B;  4BVU C;  1PFJ A;  1M94 A;  2IY0 B;  5JHB A;  2MP2 B;  4ASW C;  2Y8G A;  2K8B A;  5IAA C;  4JKB A;  2GOW A;  1E90 A;  2KJR A;  5TR5 A;  1MPH A;  2KCJ A;  4HAY B;  1E8X A;  1JDE A;  3QX1 A;  3FSS A;  4HAW B;  2KDF B;  4URK A;  1E8Y A;  5J3T A;  1AWE A;  3X23 A;  4RM8 A;  3PT2 B;  1DRO A;  3M95 A;  3VIA A;  3SBT A;  3T06 A;  2EC1 A;  3AXC A;  5C1Z A;  3W1S C;  3W1Y A;  4A20 A;  5KHQ A;  4FHJ A;  2N0Y A;  1J0G A;  1V81 A;  4F1S A;  2W2W A;  2JVC A;  4KHA A;  4WQO B;  3KH0 A;  3PVU A;  1DDW A;  1PQS A;  2Z0E B;  2N23 A;  2NR2 A;  1JRU A;  4B6H A;  1DIK A;  1MKE A;  1ZVR A;  3HM6 X;  4EKU A;  2KX0 A;  4I6L B;  1YQB A;  4DHZ E;  2CB8 A;  4JK7 A;  2MDX A;  1S3S G;  1I35 A;  3TMP B;  2ADZ A;  4RMA A;  3VTV A;  5EFX A;  2D4Q A;  3N32 A;  3B0A A;  1KI1 B;  4HAZ B;  2KDE B;  1V89 A;  3L10 B;  4MSQ B;  2KFJ A;  3PV1 A;  3PG7 A;  5LLI A;  3PLV A;  3A8Q A;  1U4A A;  3ENE A;  3PTF C;  4MJS B;  2DA0 A;  2D9Z A;  4WJO A;  3VAW A;  1K5D B;  4GPT B;  3NZU A;  1HE8 A;  2LVQ A;  3IHP C;  3A4R A;  1WR6 E;  2R2O A;  1Y8R C;  1ZKH A;  1V5T A;  2K1F A;  3M3J A;  4F7Z A;  3ZVR A;  2KXJ A;  3JSV A;  4KZC A;  1TGZ B;  2JPH A;  1X86 A;  2NPT B;  1P6S A;  2CS4 A;  3KUZ A;  1WX7 A;  4LDT B;  5L83 A;  3DVG X;  1B55 A;  4M0W B;  2MFQ A;  5J17 A;  5BO4 B;  2DLW A;  1XD4 A;  3NSU A;  4JKF A;  3SUZ A;  4HVB A;  2OJR A;  1U5D A;  3ODO A;  2IFS A;  1WYW B;  2KUP A;  5IJM A;  1D3Z A;  1L2N A;  1VBG A;  2DZM A;  4K7W A;  4TQ1 A;  1OQN A;  2IY1 B;  1UPR A;  5L81 A;  2DAF A;  4HLE A;  4PNK A;  2ZVN A;  3BY4 B;  2YT0 A;  4XC2 A;  2FJL A;  4MGI E;  5J3Q A;  1QQG A;  4TUU A;  1E5W A;  3R7R A;  3M1I B;  1XQQ A;  2L05 A;  1EUV B;  5J3Y A;  5KQ1 A;  1WJN A;  3H6N A;  2R0D A;  4DDG D;  1R4N I;  4KAX B;  1ZGU B;  2ELB A;  3ZLZ A;  2KMC A;  1WVH A;  2DKP A;  3ZTC A;  5IA7 A;  4KHB B;  4DX9 0;  1IPG A;  3DBR I;  3L0W B;  2RUK B;  4MY6 A;  3N7C A;  2M14 A;  2V76 A;  1OEY A;  3A8P A;  2LOX A;  1OEY J;  2RD0 A;  2XQN M;  2Z0O A;  4ANW A;  2KHW B;  5HE1 A;  3UGB B;  3P2B A;  4E74 A;  3P6A A;  4K2P A;  1UBI A;  1Q0W B;  1OMW A;  3RUI B;  2IYD B;  4PYU A;  4C0A A;  1MIZ B;  5CHW A;  4HPM B;  2C7H A;  3K9P B;  1BT0 A;  5E6N A;  2GBR A;  4OVU A;  1P98 A;  4JKH A;  1E8W A;  3VXW A;  1CMX B;  3EEC A;  3HHM A;  1NVL A;  3OLM D;  2KOX A;  3ML8 A;  4I6P A;  2YVC A;  1WFY A;  1SHC A;  2MCN B;  3ZDM C;  3SBG A;  2J0K A;  4JLC A;  4MT7 A;  4WJ7 A;  3UF8 A;  4WJN A;  2GBM A;  3KVF B;  1BAK A;  3ZW3 A;  3DBL I;  2YRY A;  2HJ8 A;  2LG1 A;  4IM0 A;  2KQ7 A;  4D0N B;  4K17 A;  1MG8 A;  2NCN A;  2DTC A;  4GZU A;  3DVN V;  2UZR A;  4KSK C;  5CLQ B;  2KGX B;  2KO3 A;  1RRB A;  2P0F A;  4EZJ A;  4GOC A;  2COC A;  4BBN F;  2EKE C;  3CF6 E;  5JZE B;  2PEA A;  2REX A;  4FJY A;  3JW0 X;  4AJY B;  1UEL A;  2O6V A;  3MDB C;  2XK5 A;  4EFO A;  4G3X B;  3QJZ A;  2PPH A;  1E7V A;  3RUL A;  3PRP B;  3KYD D;  2KKC A;  1WF9 A;  3KRW A;  4G50 A;  3ZKJ C;  2K8C A;  2B3A A;  2PE6 B;  1ISN A;  3WIM A;  4HWI B;  3L16 A;  3ECI A;  1V86 A;  2QHO A;  5CX3 A;  2KLG A;  4FN2 A;  3D8D A;  4GXB A;  5FI0 A;  2KMA A;  2LJ5 A;  2DAJ A;  4HCN B;  4M8N A;  2K8H A;  2FCN A;  2BCJ A;  2LI5 A;  1I7A A;  5J18 A;  4HJK A;  4EUT A;  4YON A;  2M4N A;  2KLC A;  3L08 A;  2FJ9 A;  1NTY A;  4MSM B;  4EMO A;  4AJW A;  1P9D U;  2KNB A;  1P1A A;  1V88 A;  1WM2 A;  4HCP B;  4JKG A;  2J7Q B;  1YJ1 A;  2LUL A;  3VFK A;  3ZVV A;  1VCB A;  3CST A;  2J59 M;  2ZNV C;  1WGR A;  1V9J A;  4NNJ B;  3MPX A;  1TXD A;  5DPT A;  3TBL D;  3R7Q A;  2GCJ A;  3CXB B;  3SDL C;  3ZNI D;  1XR0 B;  3KRX A;  2JZZ A;  2FCS A;  4IAP A;  4JKA A;  2C7M B;  2CRF A;  5D3V A;  4BBK A;  4X57 B;  4ANX A;  2R82 A;  2L3Z A;  4W9K A;  1IRS A;  2ROZ B;  4E71 A;  2W2X D;  3SO6 A;  2NS5 A;  4WAA A;  1J19 A;  2JUO A;  3DVG Y;  3NZS A;  4A6F A;  2KC1 A;  2DZJ A;  4KHO A;  3KW5 B;  3SHQ A;  3FLV A;  4ILH A;  1HBK A;  2KFK B;  3WYF B;  3K9O B;  3A1Q B;  4NQK E;  4PQ0 A;  1NTI A;  4IOY X;  1WGU A;  4GSW A;  1OY2 A;  2D11 A;  1WY8 A;  2YS1 A;  2NBW B;  5JHG A;  3PS6 A;  3QQ8 B;  3FEH A;  3SV1 A;  1H10 A;  4NSW A;  1NTV A;  1UNP A;  2ROV A;  4AUQ C;  2L1C A;  2KWC A;  4JGH B;  1X1F A;  2MRP A;  3N30 A;  3EC8 A;  1V2Y A;  3P7Z A;  3TW1 A;  4K1R B;  3DXC A;  2ZZP B;  3U8Z A;  2KFK A;  1LXD A;  2IO0 B;  2ZVO A;  5LXH A;  3FP5 A;  2DKQ A;  4GB9 A;  4DBG A;  1ZSQ A;  2IYB A;  1EGX A;  2N1W A;  2CY4 A;  2DZK A;  3JSV B;  2LGY A;  1WJ1 A;  2JRI B;  2DHJ A;  3R3M A;  5D6J B;  4XX5 A;  3WAM A;  2DX5 A;  1WE6 A;  2QKM A;  3SU8 X;  4G11 A;  2NBV B;  2Z0P A;  1U27 A;  3M63 B;  1FAO A;  5JHH A;  1Q67 A;  3V62 A;  2PE9 A;  4A3O A;  2L7R A;  4BBN C;  4MGY E;  2RVB B;  2N4F A;  1WGD A;  4Z2M B;  1WGH A;  2DHK A;  3UIP B;  2YS5 A;  4IWQ A;  2KZR A;  1IYF A;  1ZC3 B;  1GC6 A;  3ML4 A;  4KDL B;  3TO1 A;  2CHW A;  2K25 A;  1GNU A;  4HAV B;  4NAW A;  2AWT A;  4ANV A;  2HTH A;  4GDL A;  3PHX B;  4P7I A;  1H8C A;  4IWO A;  4F8C B;  3DVN U;  4AP4 C;  3JVZ X;  4B9K A;  3L13 A;  2KTR B;  2CY5 A;  3ZNZ B;  1MIX A;  4H8S A;  4CHK A;  2QKL A;  1VD2 A;  5JP4 A;  4W9D A;  4JKG B;  5LOP B;  1LM8 B;  2YLM A;  1UH6 A;  3SD5 A;  3ODW A;  2ZJD A;  3UIN B;  1Y19 B;  1PMS A;  1WJM A;  1V6E A;  1AAR A;  4GMV A;  5D7G A;  2OTX A;  1YX5 B;  4K2O A;  2CHZ A;  4HXD A;  4OVV A;  2KJ6 A;  1UD7 A;  1ACA A;  3HQC A;  2D3G A;  3UZT A;  4FLH A;  3QCA A;  5D2M B;  2FDQ A;  5HE3 A;  2JRH A;  2N1V A;  3EFU A;  1MK9 B;  3V60 A;  4AWJ A;  2EJ8 A;  3RD2 A;  1XD3 B;  5JH5 C;  3TFM A;  3VUY A;  4EOY A;  5DHF B;  1GC7 A;  2L0T A;  1GG3 A;  4TKN A;  4KV2 A;  2X0S A;  5JVL A;  2P0H A;  4Z2N A;  2DHI A;  3U30 A;  2COA A;  4HAU B;  4IUM B;  2KVR A;  2HTH B;  4GDL B;  3CMM B;  3H1U A;  1WGY A;  4W9H A;  2LRU A;  1WXV A;  2V3S A;  4MGK E;  5AZH A;  2KTF A;  4B6W A;  2FID A;  1FGY A;  3D32 A;  3ENB A;  4MJS A;  2AL6 A;  2CHX A;  2UVM A;  4NJ6 A;  2K00 A;  4EZK A;  3PSE B;  1WM3 A;  2DZI A;  3HK0 A;  2LXA A;  4K7S A;  1WJU A;  3VQI A;  2Q13 A;  2KX3 A;  2O2V B;  1WI1 A;  3PRE A;  4MDK E;  3VHT C;  2XBB C;  4NY0 A;  1QZE A;  1WE7 A;  1WX8 A;  4A5K A;  5AZF A;  2J0J A;  1C1Y B;  1KZG A;  3VVW B;  4A6K A;  1YD8 U;  5FR6 A;  3AUL A;  1J8C A;  2BWE S;  2R2Q A;  1WGG A;  5KCV A;  4CHJ A;  2LKO A;  2Z0D B;  4DDI D;  4MK0 A;  1WI0 A;  3QC8 B;  2N9E B;  2MSE D;  4HHV A;  2KDI A;  4DXA B;  4E3C A;  2VKI A;  4GMX B;  2ZPN A;  4BOS C;  2JP2 A;  5DPS A;  4W9F A;  2KN5 A;  3DBH I;  3LJU X;  4HK2 A;  4HB2 B;  1GGO A;  5LXI B;  2L2I A;  5AEK B;  1LW3 A;  4BOZ B;  2BF8 B;  2Y7B A;  3A1Q A;  3OAW A;  3RCP A;  2RNR B;  3QWM A;  4N9F 4;  2MA9 B;  2NMB A;  1Z87 A;  4JL9 A;  1QC6 A;  4BKS A;  4BKG A;  4BKT A;  3RZW C;  2M38 A;  2KTR A;  4JQW C;  5D94 A;  1M7R A;  2OQB A;  3T8M A;  4IM2 A;  2W9N A;  4HAT B;  3TL5 A;  2NZ8 B;  3ODX A;  3KUD B;  2DFK A;  4HB3 B;  1X1M A;  3A9J B;  4K7U A;  2C60 A;  3PEG A;  1NDD A;  4W9G A;  2D2Q A;  1E8Z A;  3RT3 B;  4XWX A;  2UZS A;  2HE7 A;  2Y8F A;  2WYQ A;  2K2J A;  1BTK A;  4DBB A;  2MBO A;  3DCG A;  3IVF A;  4TQ0 A;  4KSL C;  4JK8 A;  3PZD A;  2UYZ B;  5AZG A;  5DHA B;  5HE2 A;  1X11 A;  4LDT D;  4ICV A;  5JHA A;  3FM8 C;  2DIK A;  2MX2 A;  1TBE A;  3VUX A;  2JY6 A;  2N7D A;  2I1J A;  2KWU B;  1KBL A;  4LJO B;  5GMV A;  4W9L A;  3N3K B;  3NY5 A;  2D9Y A;  3H9D A;  3H7P A;  3HM3 A;  3PRZ A;  5DI9 B;  4GGQ A;  2BWF A;  5DCN A;  1TJ6 A;  2KJH B;  4A3P A;  5D3W A;  2DX1 A;  1UGM A;  2LWP A;  2G4S A;  4NPN A;  1U2B A;  2PZ1 A;  3TJP A;  1WJ4 A;  1XCG A;  1P0R A;  4WVF B;  4II3 B;  2GBJ A;  3C0R B;  4IG7 B;  2FIF A;  3H7P B;  3DXE A;  3OJ3 A;  4FUL A;  3QA8 A;  1FHX A;  4NQL B;  4DWF A;  2C7N B;  4FHK A;  2DHZ A;  2MQJ A;  2UWQ A;  4PYZ A;  1WXA A;  2FCQ A;  3L17 A;  2CU1 A;  3E9L A;  1NBF C;  4DHJ D;  2BGF A;  5DPW A;  2VRR B;  5D3Y A;  3ML9 A;  4HDO A;  4XZ4 A;  1V5P A;  2K39 A;  1RAX A;  2GCL A;  3KYC D;  4JKC A;  3HW2 B;  2MBH A;  4W9C A;  5FI1 A;  4ICU A;  5L95 C;  3DQV A;  2VRW B;  1V49 A;  2P8V A;  1VBH A;  2N7E A;  1V5M A;  1FGZ A;  5HKH A;  2GJY A;  3ZDT A;  3LJ3 A;  4EEW A;  5E6P A;  3EHV A;  2COF A;  1MK7 B;  2N9P C;  3CSF A;  2ZPY A;  3S2A A;  3RYT A;  3QWZ B;  2OOB B;  3L54 A;  2C9W B;  3M62 B;  3JYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...