3IVFA

Crystal structure of the talin head ferm domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
368
structure length
358
Chain Sequence
b'VALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Talin-1
publication title The Structure of the talin head reveals a novel extended conformation of the FERM domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 101
structure length 358
sequence length 368
ec nomenclature
pdb deposition date 2009-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3ivfA03
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3ivfA04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ivfA02
1P3QU 2RD0A 3RULA 4NNJB 4F8CB 4MY6A 4DHJB 4EFOA 3PV1A 4KHAA 3PVLA 5HE0A 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 3A98B 3FP5A 4OVUA 4W9LA 3D8DA 5L81A 2FJ9A 3CMMB 1XD4A 1WJ6A 2MBHA 4URKA 3VIAA 5J18A 1HE8A 3UF8A 3PVUA 2J0KA 3NZSA 1U29A 2DENB 2N9PC 4YONA 3WANA 1E7UA 1BTNA 3A33B 5FI0A 4AOFA 2KANA 2RPQA 3V5WA 1TJ6A 4EUTA 1P3RA 4MJSA 4JQWC 3BINA 4LJOB 3TIXA 2JRIB 3VTVA 4GMVA 2ZCCA 2KFJA 3F0WA 3TBLD 4IWPA 3OAWA 2P0HA 3HM3A 3ZKJC 2NR2A 4AP4C 3QCAA 4HWIB 4HB3B 3H7SA 1WYWB 2C7NB 3QWZB 2BYEA 4A6HA 2LVQA 3PLUA 1M94A 2B3AA 2MBQA 4K7UA 2ROZB 1WGHA 2J7QB 3VXWA 1HB8A 4AWJA 4BBNC 4NSWA 4OVVA 2ZJDA 5D6JB 2MQJA 2L2IA 4WWOA 5D3YA 3VAWA 4XZ4A 4EEWA 4Z2MB 1I7AA 2KWCA 3QA8A 3PLVA 3ML8A 3B08A 4LJPB 4HHVA 5J3QA 2M17A 3JW0X 3P6AA 3TJPA 2G3QB 1E90A 1TTNA 4IWOA 1KJTA 2CRFA 3MHSD 4FJVB 1V5TA 5DCNA 4BKTA 2PPHA 1ZSQA 3ULBA 1Y8RC 2Z0DB 4MK0A 3NS8A 1V86A 2MBOA 4L6EA 1ZKHA 1WXMA 3A8QA 2MCNB 3PGEA 2V3SA 3VQIA 2IYDB 3ZRFA 2DZJA 1RRPB 1N3HA 4MDKE 2ROVA 5E6OA 2COFA 3QIJA 2RGFA 2LYDA 4E74A 1BWNA 1J19A 3KVFB 3H6NA 2KNBA 2MWNB 4BBNF 1WMHB 4NPNA 5C16A 2LGXA 3DXDA 4GB9A 2P0FA 2DHZA 2FCMA 2KDFB 3DDCB 1F9JA 2IY1B 1RLFA 3FEHA 3FM8C 3APCA 2GBRA 2C5LC 1EF1A 5DPWA 3QHTA 3APDA 3UIPB 1JRUA 2I5FA 1LQBA 2KK8A 1S1QB 2N23A 1U5DA 2KMCA 1OGWA 1EGXA 3LDZE 2HD5B 4ICUA 2W2WA 4G50A 1WGUA 4GSWA 2KC2A 2MWSB 3SHQA 4ANUA 2NBUA 3AU5A 3IFWB 2O6VA 4ZRJA 1J0WA 2DYNA 2XK5B 5J17A 1OQYA 2EMSA 3ZW3A 1LXDA 4AJWA 4EZJA 3GOEA 2ELBA 1RRBA 3M63B 2YLMA 2MLBA 3TL5A 2BYVE 1V61A 2D9ZA 2GBMA 1IRSA 2DYQA 5AZFA 3L08A 4KZCA 4H8SA 2IO3B 4A20A 1MIXA 2AEHA 1MPHA 3HK0A 4DX8A 1U5EA 3DVGX 2BF8B 4HB2B 3WALA 1OQNA 1Q67A 3CIKA 2RR9A 4HDOA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 2YS1A 4MM3A 1V2YA 3UIOB 5DHFB 3O65B 2CHZA 1WF9A 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 2MA9B 1RJ2A 4BFRA 1Q5WB 3A9JB 3PREA 2CHWA 3H7PA 2N1VA 2KTFA 2NMBA 2D11A 2KCJA 4WJNA 2Q13A 3N32A 4NAWB 3SU8X 4YL8A 2DTCA 4HK2A 3ZNGC 2LGYA 4PS3A 4XWXA 2ZPYA 1UGMA 1FHOA 4FADA 4FJZA 1P0RA 5J3YA 5D94A 1H4RA 4I6NB 5AZHA 4MSMB 2RQ1A 5KQ4A 5D3VA 5C79A 1K8RB 2JWZA 4TKNA 4M8MA 2JRHA 4Z2NA 2K8BA 1E7VA 4LDTB 2KLCA 1WGDA 4HPLB 1MG8A 3KH0A 3ECIA 3CXBB 3NHEB 5LONB 4K2OA 1WE7A 2OJRA 4P7IA 1C1YB 2D2QA 1YX5B 5KQ1A 4CO7A 5C5BA 2LWPA 4KHBB 2Z0QA 4TQ1A 1AWEA 3V6CB 2N1WA 2LD9A 3N30A 4GMXB 2K6QA 1P9DU 3N3KB 2RVBB 5L95C 3TW1A 2KTRB 2DKPA 1L2NA 1FGYA 2KFKB 3SDLC 1V5MA 2G35A 1WJ4A 2O6VB 2COCA 4MT7A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 5CLLB 1OY2A 1HBKA 4F7HA 3A4SC 2KOXA 1KOTA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 2W9NA 4IM2A 4G0NB 2KWVB 5D3XA 3TVVA 3PG7A 5D27A 1XODA 2DHIA 4BKSA 4GDLB 4DDID 2BWFA 3AI5A 3VOQA 2MRPA 2IBIB 1U2BA 1M7RA 5DPTA 4HAWB 1S3SG 1WFYA 1C3TA 4IC7B 1G6JA 3C0RB 3JSVA 1WGYA 4PS7A 3ZNHB 2CODA 1KLVA 3SNHA 2LOXA 2ZVNA 2KXJA 4XC2A 2HTHB 4GXBA 2D9YA 2L0TA 4KV2A 3FLVA 4B95A 4BOSC 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 1GG3A 4GDKB 2ZCBA 2L1CA 1WZ3A 2K25A 1U4AA 4II2B 1V6EA 4FBJB 2MBBB 2UZRA 4B6HA 2FJLA 3MPXA 2R0DA 4WJOA 1RFAA 3A1QB 2KN5A 4IM0A 1UNRA 4TQ0A 4EKUA 4GZUA 2LGDA 2MKRA 1X1MA 3VUYA 4A6FA 2FAZA 5J3TA 3DBLI 1XQQA 1KZ7A 1EO6A 3WIMA 5DHAB 1WX7A 1IP9A 3HM6X 2MDXA 4NY0A 4JL9A 1X1GA 2D9WA 2AL3A 2ZZPB 4GN1A 2WX0A 2LVOA 1Q0WB 3VUWA 4A5KA 3ML4A 5G2NA 4FJYA 2PEAA 3VVWB 4XX5A 2NZ8B 4JLCA 1XCGA 3L16A 2OOBB 1WI0A 4DBGA 2YF0A 3VDZA 5CX3A 4MSQB 2C60A 1MK9B 1WJMA 1UELA 1UBQA 2MP2B 3A9KB 3RUIB 4DX90 3VTUA 1WX8A 3KY9A 4B6WA 1BT0A 2ASQA 2LUEA 1U5GA 1TGZB 3JYUA 2M14A 2BWES 3NZUA 2GS0A 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 3HW2B 3NSUA 4HJKA 2ABDA 4A6KA 3SYXA 2DKQA 2HRJA 3UQAA 1WR1A 5CTRC 4IWQA 2BKFA 2K6DB 4EZLA 3PVWA 3IHPC 1AARA 2VKIA 2DLWA 2VSZA 2E2XA 2UWQA 1PFJA 2FCNA 4DK5A 5HKHA 3HHMA 4MGKE 2ZVOA 3MDBC 2I1KA 4ANWA 4TV3A 4HAYB 4WJ7A 4WAAA 1V89A 2RGNB 4KSLC 5HE3A 1V80A 3AXCA 5EFXA 4W9JA 4I6PA 1E8WA 1W1DA 4HB0B 3W1SC 2J59M 1Y5OA 1MK7B 4LDTD 3M3JA 4G3XB 4E71A 3T9LA 2HE7A 3KUDB 3UQBA 3DBRI 1OEYA 3SO6A 3VH4B 1V88A 1Z2MA 4HAZB 5C6RA 2NPTA 3B0AA 1LB1A 4FN2A 2Z0PA 1WXVA 2IZVB 2LXAA 1TBEA 1UPQA 1WG7A 2N9XA 5AEKB 3RT3B 1GJZA 1X05A 2FUHB 4W9CA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 4KSKC 3PP2A 3P7ZA 1SIFA 1XR0B 3HQCA 4FHJA 2KJRA 1L7YA 3PHXB 3KW5B 4K7SA 4EMOA 3ZDMC 3ZIMA 4MGIE 3L13A 3R3MA 3UINB 4HLEA 2DX5A 2DX1A 5KHQA 2HJ8A 4BBKA 1WM3A 5CHWA 3ZO5B 3WA0A 2M8SA 5KCVA 2JT4B 1WH3A 1NVLA 5D7GA 1HB6A 3P2BA 5E6NA 4DHZE 2JY6A 2VRWB 1WZ0A 2C7MB 1VD2A 2G4SA 3QK0A 1SE9A 3ZDTA 2BKRB 4K17A 1B55A 1WXSA 4WQOB 2BYFA 3OJ3A 5JP4A 4HDQA 1D3ZA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 3ALBA 3EECA 1I42A 1EAZA 2WYQA 3JVZX 1J8CA 2NS5A 3A8PA 2XQNM 1Y19B 2Y7BA 2LJ5A 3RZFA 3EHVA 2YVCA 3R66C 1IYFA 2LOZA 3QQ8B 2KZRA 4M8NA 2IO1B 1WR6E 1Z87A 4IAPA 4NJ6A 3K9PB 1UNPA 3WAPA 3D8EA 2CU1A 5GOWB 1V9JA 2FIDA 3PRZA 1WVHA 1YX6B 2H7DA 5JHBA 2AL6A 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3ZTCA 3BY4B 2IO2B 5CHVC 1LW3A 1MKEA 1OEYJ 3ZTDA 1A5RA 1H8CA 2V1YA 4GIVA 2COAA 4ZYNA 2OQBA 3ZVVA 2REXA 2FIFA 1KM7A 2DYOA 3L10B 3ODOA 3PSEB 2N7DA 2BGFA 3EPYA 3ENEA 2K2UA 4WWNA 1WJNA 2COPA 3SD5A 2CR5A 1X86A 4HAUB 2JPHA 3DVNV 1QC6A 2IYBA 1FB8A 1R4NI 3BJIA 2RNRB 2YT0A 1MAIA 3KRWA 1WX9A 5DH9B 2WWZA 1LFDA 1I35A 4W9FA 3PT2B 1Z5SB 3N7CA 1RAXA 5E6PA 4CHMA 2CB8A 1BAKA 1WGGA 3VH3B 1NTIA 2D07B 1P98A 4DXAB 3M1IB 1UBIA 2PZ1A 2UZSA 5EDSA 2KDEB 2KVRA 2KLGA 2KO3A 3MTNB 3PHWB 2FNJB 2D10A 4CYEA 5LLIA 4ICVA 4MH0E 1WRDB 2DN6A 1I2HA 2I1JA 3ML9A 1WY8A 4MGYE 1YD8U 3OJ4B 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 1WJ1A 2R09A 2FCSA 5JLJB 2X18A 2D9VA 2Y8GA 2K39A 1GC7A 4F7ZA 2KMAA 2RUKB 3PRMB 1UD7A 2I5CA 4K81A 3TO1A 3KRXA 3DOWA 1SGHA 2FCQA 1CMXB 2EC1A 2YS3A 2KHWB 4LCDE 2RLOA 1W1HA 1P1AA 1WMHA 4HAXB 5LXIB 3PPAA 2Z0OA 2KX0A 3UZTA 5JZEB 3DVNU 1V81A 2LRUA 2M4NA 3H7PB 4KZ0A 2WDTB 1U5FA 1Q1OA 4K2PA 5JHGA 3M62B 4MELA 4EZKA 4G11A 2PE6B 4ANXA 3KSYA 2CS4A 4N9F4 3X23A 3V62A 3IVFA 2A5UA 2C7HA 1NU2A 1V5OA 5IJMA 1ZW7A 3TMPB 5DIFB 3MJWA 2MFQA 4ZRIA 1WE6A 3PEGA 4MGZE 1H10A 2KJ6A 3U8ZA 3G9WA 4GOCA 2K8HA 2GBJA 4BOZB 1IPGA 2K2JA 3OANA 2XK5A 2LVPA 2C9WB 3WYFB 5BO4B 5GMVA 2YS5A 3DBSA 1EF5A 4DDGD 5C5BB 4M0WB 1PMSA 1ZC4B 2KWUB 5D2MB 4ASWC 5DI9B 2MX2A 4ZRKA 1XD3B 3R7RA 3L17A 2LZ6A 3AULA 4PYUA 3RD2A 4KDLB 2CKHB 2L8JA 4A3OA 3D8FA 2AYOB 1BTKA 1E5WA 2LASA 3VUXA 1EVHA 4PNKA 4TYZA 2QKLA 2JF5A 1DDWA 2CHXA 4F1SA 2Z59B 4KVGB 4HCNB 3LJUX 2NBVB 3KUCB 2GJYA 1VCBA 4HATB 1ZVRA 2ADZA 4NQLB 2DZIA 4NQKE 2N4FA 5AZGA 4HXDA 3H9DA 1U27A 1WJUA 1WXAA 1YIWA 1ISNA 4DBBA 3Q3FA 4GPTB 2M38A 1E8ZA 3T8MA 2R2QA 3QWMA 5LOPB 4A3PA 2O2VA 4NJ7A 3L0WB 5KHOA 4FULA 2N9EB 4RMAA 3A9JA 2M0XA 3W1YA 2D4QA 3JSVB 5JHAA 3B1LX 3F5RA 3HIZA 4K1RB 4FA6A 2DA0A 1MIZB 2L76A 3H1UA 4NAWA 3WAMA 3GYPA 2KKCA 3NY5A 5FI1A 4K7WA 5CLQB 4W9IA 3IBEA 4F7UP 2QKMA 2EKEC 4HCPB 3QAQA 2DFKA 2MSED 4PS8A 2DAJA 2Z0EB 5L83A 4IG7B 2JP2A 3DPDA 2BCJA 2N0YA 2XEWA 2JZ3B 4IOYX 2PE9A 3ZLZA 3OLMD 3CSFA 2GBKA 1FHXA 3V60A 4MEMA 2KDBA 4WJPA 4KDIC 3AU4A 4FHKA 4AUQC 1DDMA 5IA7A 3DXCA 2A4ZA 1YQBA 3CF6E 3PRPB 3QJZA 2P8VA 2G4DB 2NCNA 3PSCA 1QQGA 4A6FB 2YT1A 3RCPA 2DZMA 4WJQA 4HAVB 2DYBA 4IM3A 2LI5A 3ODXA 2ZPNA 5JH5C 2CQUA 4J6IA 3RCZA 4B9KA 1PLSA 2KTRA 1KZGA 3TFMA 2KFKA 2ZNVB 2CAYA 3SUZA 3ONSA 2L05A 2BPSA 4PYZA 1YJ1A 3K9OB 2UYZB 3U7DA 2MBEA 2K8CA 2KUPA 2YSZA 1GNUA 1P5TA 5HE1A 2IO0B 3W1SA 4FLHA 1TQZA 3U30A 3S2AA 4KAXB 2GOWA 1NBFC 1V5UA 3PS6A 3X0WA 1UNQA 4GDLA 2MW5A 5TR5A 2DHKA 3DBHI 4BKGA 1V49A 2EJ8A 1V5PA 1FAOA 3IG3A 4WSFA 2FDQA 3AJ4A 2LRWA 3TCAA 1SHCA 3ZNZB 2DHJA 2LG1A 4DWFA 5IAAC 1XT9B 4KHOA 2CY4A 2HTHA 1PQSA 4W9DA 4RM8A 4W9GA 2CY5A 1XKEA 1FOEA 3UGBB 2NBWB 1UZXB 1FGZA 2LULA 3WAOA 4II3B 4ZDVA 3GYOA 1NTYA 1WM2A 4CHKA 4TUUA 3ZVRA 2NVUI 4GGQA 5FR6A 4GDKA 2L0FA 1DYNA 1E8YA 4IW0A 1DROA 3EFUA 3ZRCA 2KJHB 2ELAA 1TXDA 2AWTA 5DPRA 2YRYA 2W2XC 3RYTA 3A1QA 3DVGY 2GCLA 4BVUC 4E3CA 2KD0A 2V76A 3CSTA 4HVBA 1WGRA 4JIOU 1UPRA 2DYMA 4RM9A 2QHOA 4I6LB 4DHZB 4W9HA 1W1GA 1NDDA 3PTFC 2PJHA 3V61A 4AJYB 3O96A 2L00B 3KYCD 3L54A 2K1FA 1DDVA 3RZWC 2J0MA 2KQ7A 1P6SA 1ST7A 5LXHA 2JZZA 3I3TB 2UVMA 1ACAA 2P0DA 4EJNA 2LXCA 3KYDD 2D9XA 4F7GA 1NI2A 2K00A 2N7EA 3SV1A 3DQVA 3KUZA 5G55A 1ZM0A 1E8XA 3ODWA 2NPTB 2LBBA 2WX1A 1GC6A 3KZ1A 2DZKA 2KQSA 1DBHA 1TZ1A 1K5GB 4X57B 2JVCA 2W2XD 2Y8FA 1X1FA 2MP2A 3A9KA 3ZUNA 1EUVB 3QC8B 2KC1A 1M7EA 4KIKB 2IFSA 3A4RA 5C23A 1AQCA 1X11A 5CHFA 2G45B 4GU2A 5D3WA 4WWPA 2EMTA 1NTVA 3ULCA 2DX5B 5HE2A 2JXXA 4HPMB 2ZEQA 3QBVB 4PQ0A 2GMIC 3FSSA 3T06A 2JUOA 2R2OA 5C1ZA 4JGHB 1XX0A 2KDIA 1K5DB 2GCJA 2L7RA 1WIAA 1ZGUB 3QARA 4ANVA 2KX3A 1UH6A 1QZEA 2H7EA 2V4LA 3LJ3A 2RSGA 1OMWA 2ZNVC 3R7QA 4HB4B 1FXTB 4Y94A 3PZDA
chains in the Genus database with same CATH superfamily
1P3QU 2RD0A 2WNMA 3W2DA 3RULA 4NNJB 4F8CB 1LGRA 4MY6A 4DHJB 4EFOA 3PV1A 2JWUA 4KHAA 3PVLA 5HE0A 5JXVA 2K3UA 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 3A98B 3FP5A 4OVUA 4W9LA 3D8DA 1PGXA 5L81A 3ZXVA 2FJ9A 1JQ4A 3CMMB 3NWAA 1XD4A 1WJ6A 2MBHA 3OWEB 3VIAA 4URKA 5J18A 1HE8A 3UF8A 1MI1A 1SJED 3AN1A 3PVUA 2J0KA 3NZSA 4A9AA 4YSXB 1U29A 2Q5WD 2DENB 3P4PB 2N9PC 4YONA 3WANA 3U2SC 1E7UA 4LTUA 1BTNA 3I63C 3A33B 5FI0A 2BBCA 4AOFA 2YEPB 2KANA 3HRDD 2RPQA 2RMMA 3V5WA 1TJ6A 3Q2AC 1P3RA 4EUTA 4MJSA 4JQWC 3BINA 1C79A 4LJOB 3TIXA 1ROEA 2JRIB 3VTVA 3AE1B 4GMVA 2ZCCA 3ZYYX 2KFJA 4P16A 3F0WA 3TBLD 4IWPA 1F2RI 3OAWA 4N6EB 2P0HA 4M00A 3HM3A 3ZKJC 2NR2A 4QJ3B 4AP4C 1DOIA 3QCAA 3TEYA 5T8IA 4C56C 2K49A 4HWIB 4HB3B 1L4DB 3H7SA 1YJJA 1WYWB 2GI9A 2C7NB 3QWZB 2BYEA 2E6XA 4A6HA 2LVQA 1MVKA 3PLUA 1M94A 2M0AA 2B3AA 2MBQA 4K7UA 2ROZB 1WGHA 3U7ZA 4AQ7A 3LXFA 2J7QB 1E7PB 5G5HA 3VXWA 1HB8A 4AWJA 3CWIA 3IAS1 4BBNC 4NSWA 4OVVA 2ZJDA 5D6JB 2MQJA 2L2IA 4WWOA 5D3YA 1ZXIA 3VAWA 4XZ4A 4EEWA 4Z2MB 1XLOA 1I7AA 1KTKA 3KQ4A 4ILHA 2KWCA 3QA8A 2WXRA 3PLVA 3ML8A 2V3PA 2PMVA 3B08A 1VZ8A 4LJPB 4HHVA 5J3QA 2M17A 2PVOD 3P6AA 3AE3B 3JW0X 3TJPA 2G3QB 1E90A 1TTNA 4IWOA 1KJTA 2AQ2B 3MC0B 3N20C 3BWUD 2CRFA 3MHSD 2INPE 1TY2A 1GB1A 4FJVB 3V05A 2V9HA 1D6EC 1V5TA 2R82A 5DCNA 4BKTA 2PPHA 1ZSQA 3ULBA 1Y8RC 2WXGA 2Z0DB 4MK0A 3SBGA 3NS8A 1V86A 2KUQA 2MH7A 2MBOA 4DQOC 4L6EA 1ZKHA 1WXMA 3A8QA 2MCNB 5E6JA 2X0SA 3PGEA 2V3SA 3VQIA 1F0ZA 2IYDB 2WXJA 3ZRFA 2DZJA 1RRPB 1N3HA 1N6ZA 4MDKE 3FKYA 2ROVA 5E6OA 2COFA 1HA5A 3QIJA 2RGFA 2LYDA 5D3DA 4E74A 4K3CA 1BWNA 1ACCA 1XXGA 1J19A 3KVFB 3BVMA 1A70A 3C19A 4OW0A 4HROA 3DBHB 3Q8AA 1K51A 4H2AA 4RGNA 3H6NA 2KNBA 2MWNB 4BBNF 3RFZB 1WMHB 4NPNA 2Z14A 4JX1C 5C16A 5LG4B 2LGXA 3DXDA 2PLPA 3EFCA 4GB9A 2P0FA 2DHZA 2FCMA 2KDFB 3DDCB 1T77A 4WH4A 1FCLA 1F9JA 2IY1B 1RLFA 3FEHA 3FM8C 3APCA 1YN5A 1HTQA 2GBRA 2C5LC 1EF1A 5DPWA 2QJLA 4GLSC 3QHTA 3Q69A 3APDA 5EE1A 2WXHA 5I2MA 3UIPB 3I5JC 2DWQA 4IDIA 1XO3A 1JRUA 2I5FA 1NVID 1I4PA 2QMTA 2E3TA 1LQBA 2KK8A 1S1QB 3NJTA 2N23A 1U5DA 2KMCA 1OGWA 1EGXA 3LDZE 2GLSA 3RI7C 2HD5B 4ICUA 2W2WA 2KIGA 4G50A 4RNAA 1WGUA 1ZUD2 4GSWA 2KC2A 2MWSB 1HXYD 3SHQA 2Z8LA 2NBUA 4ANUA 3AU5A 2RPVA 3IFWB 2O6VA 2BW2A 4ZRJA 3TEWA 1J0WA 2DYNA 2BB6A 3FILA 2I38A 2XK5B 4US8A 5J17A 1OQYA 2EMSA 3NVVA 3ZW3A 1FXIA 1LXDA 4AJWA 4EZJA 3GE8C 3GOEA 2ELBA 1RRBA 3CIRB 3M63B 3RNGC 1FXAA 1SB3C 2YLMA 2MLBA 3TL5A 1I4HA 2BYVE 2FJUB 1JW9D 2WXPA 1V61A 3BVGA 2D9ZA 2GBMA 2R61A 2D5GA 1I7HA 1CQVA 1IRSA 2DYQA 2G1EA 1JWBD 5AZFA 2B76B 3L08A 3ABVB 4KZCA 3GP7A 4H8SA 3Q3MC 2IO3B 3E9LA 4A20A 3AEFB 1MIXA 2AEHA 4J3OD 1MPHA 3HK0A 1SEBD 3T3NA 4DX8A 1U5EA 1TKEA 1DGJA 3DVGX 3AEBB 2K8EA 2BS2B 3RNBC 1PYWD 2BF8B 4HB2B 3WALA 1OQNA 1Q67A 3CIKA 2RR9A 4L1RA 4EE2A 3MJ5A 4HDOA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 1VZ7A 2YS1A 4MM3A 1V2YA 3UIOB 4HRSA 5DHFB 3O65B 2CHZA 5H92C 4C4VA 1WF9A 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 2MA9B 2KN4A 1RJ2A 2JU6X 2VH1A 4A55A 1FRRA 3V3XA 4BFRA 1Q5WB 2WXQA 2KACA 3A9JB 2CHWA 3PREA 3H7PA 2N1VA 2KTFA 2L83A 2ZKMX 2KCJA 2NMBA 2D11A 4WJNA 3NRZA 2Q13A 1OQQA 3N32A 4NAWB 3HIEA 3ZGZA 3SU8X 4YL8A 2DTCA 4HK2A 1NI3A 4M02A 3HVZA 3ZNGC 1VLBA 2LGYA 4PS3A 5IN7A 1L6UA 1JRPA 4XWXA 1GB4A 1QLBB 3MFGA 2ZPYA 1UGMA 1FHOA 4FADA 1YOVB 5HFYA 4FJZA 1P0RA 2AQ1B 5J3YA 5D94A 2VZKB 1H4RA 4I6NB 5AZHA 2JX5A 4MSMB 2RQ1A 5TSSA 5KQ4A 1IBXA 1FCCC 5D3VA 5C79A 1K8RB 1J7BA 2JWZA 4TKNA 4M8MA 2JRHA 2LUMA 4Z2NA 3FC4A 2K8BA 4S0RA 1E7VA 4RGTA 4LNKA 4LDTB 4ZRQA 2KLCA 1J7CA 1WGDA 4HPLB 4CQNA 1MG8A 3KH0A 3Q6BA 5BYSA 3ECIA 3CXBB 3NHEB 5LONB 4K2OA 1WE7A 2INCC 2OJRA 1JWUD 4P7IA 1C1YB 2D2QA 1YX5B 5KQ1A 3H8HA 4CO7A 5C5BA 1NYRA 2LWPA 3NVYA 4M0WA 4KHBB 2Z0QA 2IGHA 4TQ1A 1AWEA 3V6CB 2N1WA 1TS4A 2J53A 2WXOA 3E56A 2PVGC 2LD9A 2BVCA 1T5XD 3N30A 4GMXB 3GZNB 4JWSC 2K6QA 4XGAB 4DIXA 1P9DU 1UF0A 3N3KB 4LNNA 2RVBB 5L95C 3TW1A 1YN3A 2I2YA 2KTRB 2DKPA 2X38A 1VJKA 1AW7A 1L2NA 1FGYA 2KFKB 3FAHA 4JWUC 3SDLC 1V5MA 2G35A 1WJ4A 2O6VB 2COCA 4MT7A 5H8YE 2Z59A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 1CK1A 1L5PA 2NBVA 5CLLB 1MHHE 1OY2A 1HBKA 4F7HA 3A4SC 3LB8C 2KOXA 4WIPA 1E6EB 1KOTA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 1C78A 4ZHOA 2LMCA 2W9NA 3KLSX 4IM2A 4G0NB 2KWVB 3J9CA 1LO5D 5D3XA 2MJ3A 3TVVA 1WGKA 3PG7A 5D27A 2H89B 1XODA 1NENB 3TUOA 1QT9A 2DHIA 1TJEA 4BKSA 1JCKB 4GDLB 2WXKA 4DDID 3BYYB 2BWFA 3AI5A 3VOQA 2MRPA 2IBIB 1U2BA 2ONQA 1M7RA 2IPKD 5DPTA 4HAWB 1S3SG 1WFYA 1C3TA 1DOXA 4IC7B 4XDCA 1G6JA 3C0RB 3JSVA 2OHFA 5C3JB 4JKHA 1C77A 1WGYA 4PS7A 3ZNHB 2CODA 3UI3A 5IKCM 1QOBA 1KLVA 3SNHA 2LOXA 1P7FA 2ZVNA 1UWMA 5C2TB 2KXJA 4XC2A 2HTHB 2WGSA 4GXBA 2ON8A 2D9YA 1L6VA 2L0TA 2WXFA 1E9MA 4KV2A 1EWYC 4JK9A 3FLVA 4B95A 4WQMA 4BOSC 4US9A 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 1GG3A 1STEA 4M01A 4GDKB 2WXIA 2OEDA 2WDRB 1EU3A 4Q2JA 2ZCBA 4JE3B 2L1CA 1CJEA 4UDUC 1WZ3A 2K25A 1U4AA 3HUIA 4II2B 1V6EA 4FBJB 2MBBB 3U12A 2UZRA 4B6HA 4C7ZA 2FJLA 1L0XB 3MPXA 1KFYB 2R0DA 4WJOA 1RFAA 3A1QB 2KN5A 4IM0A 1UNRA 2J42A 4TQ0A 4EKUA 3NWDA 1TS2A 3KWLA 4GZUA 2LGDA 2MKRA 2WXMA 4B0EA 1NEKB 1X1MA 4D2KA 3VUYA 4A6FA 2FAZA 3E9OA 5J3TA 3DBLI 4HJGE 2CJOA 1XQQA 2UU7A 5M4YB 2K5PA 3NVWA 1KZ7A 1EO6A 1V1PA 3WIMA 5DHAB 1WX7A 1FD6A 3ENBA 4JKBA 3I57A 2KR0A 3SFDB 1IP9A 3HM6X 3AE8B 4XE0A 2MDXA 4NY0A 4JL9A 1X1GA 4A8XC 1F1HA 2D9WA 2AL3A 2ZZPB 3R8BA 4GN1A 2WX0A 2LVOA 3E9SA 3L4PA 1Q0WB 4XWWA 3VUWA 4A5KA 3ML4A 5G2NA 4FJYA 4S17A 2MJDA 1UUPA 2PEAA 3GE3C 3VVWB 4XX5A 2NZ8B 4JLCA 1XCGA 3WCQA 3L16A 2OOBB 1WI0A 4DBGA 2YF0A 3VDZA 1FFVA 5CX3A 4C7YA 1D5XC 4MSQB 4OZCA 2C60A 1MK9B 1WJMA 1UELA 1EWCA 1UBQA 2MP2B 3A9KB 3RUIB 4DX90 3VTUA 2GB1A 1WX8A 3KY9A 4B6WA 5BMGA 4ZRPA 2WS3B 1BT0A 1MG4A 2ASQA 3HVDA 2LUEA 1U5GA 1L0YB 1NYQA 1TGZB 3JYUA 3ZJTA 4JK7A 2M14A 2BYTA 2BWES 4LNIA 4NZLB 3P63A 4RGMA 3NZUA 2GS0A 3P4QB 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 3HW2B 3NSUA 4ITKA 4HJKA 1RYJA 2ABDA 4A6KA 2V3NA 2BTEA 3SYXA 2DKQA 3GS2A 2HRJA 3UQAA 3EGRA 3AEGB 2PTLA 1WR1A 5CTRC 3DHHC 4RF0A 4IWQA 3VRBB 2BKFA 2ZW1A 2K6DB 3ZQ4A 4EZLA 3PVWA 3DWGC 1B1ZA 3IHPC 1AARA 1WWTA 2VKIA 1E10A 2DLWA 1QILA 2VSZA 2E2XA 2UWQA 1PFJA 2FCNA 4DK5A 5HKHA 3HHMA 4MGKE 2ZVOA 2XNAC 3MDBC 2I1KA 4TSSA 4ANWA 4TV3A 3T3OA 1SBBB 3VR9B 3HSAA 4HAYB 4WJ7A 4WAAA 4K3BA 1V89A 3BK1A 3B77A 1ZE3D 2RGNB 1HTOA 4KSLC 5HE3A 2W3SA 2VZKD 2KQ4X 1V80A 2RDBC 3AXCA 5EFXA 4W9JA 4I6PA 1N61A 1PGAA 1E8WA 3R2IA 1W1DA 4HB0B 3W1SC 2J59M 3OG5A 4JKGA 3RNEC 2IGGA 1Y5OA 3AE9B 4LNOA 2KIEA 2IGDA 3MC8A 1MK7B 4LDTD 3AMZA 4CSQA 3M3JA 4G3XB 5I2SA 4E71A 1PUTA 3T9LA 3SBTA 5BMIA 2INNE 2HE7A 1MFWA 3KUDB 3UQBA 3DBRI 3ETRA 1N5WA 1OEYA 3SO6A 3VH4B 1V88A 1PGBA 4ARIA 1Z2MA 4HAZB 1YJIA 4WURA 1F2RC 5C6RA 2NPTA 3B0AA 3P1MA 1LB1A 4FN2A 2Z0PA 1WXVA 2IZVB 4RGOS 2LXAA 1TIFA 2EELA 1TBEA 1UPQA 3DHIC 1WG7A 2N9XA 3NG0A 4JKEA 5AEKB 3RT3B 1GJZA 1K50A 1X05A 4KX6B 5EE0A 2FUHB 4W9CA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 4KSKC 3PP2A 3N1XC 3RPFC 3P7ZA 1SIFA 1XR0B 3HQCA 2QCZA 4FHJA 2JZPA 3BYTB 2KJRA 3URYA 3OHMB 1L7YA 3PHXB 3KW5B 4K7SA 4EMOA 3ZDMC 3ZIMA 4MGIE 5EE3A 5HG2A 3L13A 1ENFA 3R3MA 2Y5CA 4C80A 3UINB 3RNCC 2JYEA 4HLEA 2DX5A 2DX1A 1SF0A 5KHQA 3Q8CA 2HJ8A 1TKGA 4BBKA 1WM3A 4JPSA 5CHWA 3ZO5B 3WA0A 2M8SA 5KCVA 2JT4B 1Q10A 1FRDA 1WH3A 5FR3A 4RFBA 1NVLA 5D7GA 1HB6A 1RM6C 2LHDA 3P2BA 1JWSD 1ZDXA 2JY6A 5E6NA 4DHZE 1XCQL 2VRWB 4LLGM 1WZ0A 2C7MB 1VD2A 2J4XA 2G4SA 3QK0A 4L2YA 3RNAC 1SE9A 3ZDTA 3Q3OC 2BKRB 2SEBD 4K17A 3P4SB 4QJ5B 1B55A 1WXSA 2W3RA 2BYFA 4WQOB 3OJ3A 3BK2A 5JP4A 2KMMA 4HDQA 1D3ZA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 3ALBA 3EECA 5BMHA 1BXTA 1EAZA 1I42A 2LHEA 2WYQA 1ZPSA 3JVZX 1J8CA 2NS5A 4LK0M 1JDEA 3A8PA 1EU4A 2XQNM 1Y19B 2Y7BA 2LJ5A 5BYRA 3RZFA 4BZAA 3EHVA 3MC9A 1I4GA 2YVCA 1KH0A 3R66C 1IYFA 1YNTE 2LOZA 3QQ8B 1N62A 2KZRA 4M8NA 1CZPA 2IO1B 2G9HD 1WR6E 1Z87A 4IAPA 4NJ6A 1J7AA 3K9PB 2Z4DA 1UNPA 3WAPA 3D8EA 2CU1A 3DCXA 4GNKB 5GOWB 3AE4B 1V9JA 2FIDA 3PRZA 4MH8A 3B2FA 3RN9C 3PZ7A 1E0ZA 1WVHA 4YTMB 4MACA 1YX6B 4OT1A 2H7DA 2CU3A 5JHBA 1SE4A 1R7SA 4LNFA 4N59A 2K9XA 1TS5A 3MHZA 2AL6A 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3TEXA 3ZTCA 3BY4B 4NJCA 2IO2B 5CHVC 2YEPF 1LW3A 1XEEA 1MKEA 1OEYJ 3ZTDA 1A5RA 1H8CA 1HZ5A 2QEJC 2WLBA 2V1YA 3AEAB 2BT6A 3AM9A 4GIVA 5LNK1 2COAA 4ZYNA 2OQBA 3ZVVA 3C8YA 2REXA 2FIFA 1KM7A 2JQRB 2DYOA 3L10B 3ODOA 3PSEB 1SE2A 2N7DA 2BGFA 3EPYA 3ENEA 2JSVX 2K2UA 3O13A 4WWNA 1WJNA 2COPA 3W5UB 3SD5A 4YWGG 2K0PA 2CR5A 1X86A 2D3BA 1FFUA 1D4BA 4HAUB 2JPHA 3DVNV 1R4MB 1QC6A 2IYBA 4D6WA 1FB8A 1R4NI 2AQ3B 1ET9A 4C00A 3NUHB 3BJIA 4R3DA 1M4VA 1QOAA 4KKJA 4L1BA 2RNRB 2YT0A 4HEA1 1MAIA 1FMAD 1YQ4B 3KRWA 1WX9A 5DH9B 1FNWA 2X8XX 2WWZA 3EUB2 1LFDA 1I35A 1K52A 4W9FA 3B2GA 3SFEB 3PT2B 1Z5SB 3N7CA 5I4DA 1RAXA 5E6PA 4CHMA 2CB8A 1BAKA 2RRFA 1WGGA 3VH3B 3BVZA 1NTIA 2D07B 5HI1A 1P98A 3FILB 1WSPA 3IT4B 4DXAB 3M1IB 1UBIA 2PZ1A 3DHGC 2PIAA 3P42A 2LGIA 2WU5B 2UZSA 3R2TA 2KDEB 5EDSA 2KVRA 2KLGA 2KO3A 5JVLA 4RCOA 3MTNB 3DBLB 3PHWB 2FNJB 3Q8BA 4RH6A 4A90A 2FUG1 4YSYB 3BIID 2D10A 4CYEA 5LLIA 1C4CA 4YSZB 4ICVA 4MH0E 1C4AA 3P4RB 1WRDB 2KWDA 2DN6A 1I2HA 2I1JA 3ML9A 1WY8A 4MGYE 4ACFA 3NW8A 1YD8U 3OJ4B 1OQRA 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 4USAA 3ZXRA 1WJ1A 2R09A 2FCSA 1Y56A 2OJWA 3DWMA 5JLJB 1I4QA 1FNVA 2X18A 2D9VA 2Y8GA 2FBWB 4XYCA 2K39A 1GC7A 3N1ZC 4F7ZA 2V4IB 2KMAA 2RUKB 3PRMB 2MJEA 1KC7A 2EKIA 4KGRA 1UD7A 2I5CA 1KF6B 1IGCA 4K81A 3TO1A 4YTNB 3KRXA 3DOWA 1SGHA 2FCQA 4YT0B 4MM3B 5D3IB 1CMXB 2EC1A 2YS3A 2KHWB 4LCDE 1QF6A 4HPPA 4WWMA 1QOGA 2RLOA 1WXQA 1W1HA 1P1AA 2K22A 3A58A 4C4VB 1WMHA 4HAXB 5LXIB 3PPAA 1YMHE 2Z0OA 2KX0A 3UZTA 5JZEB 2L1AA 3BZDB 3DVNU 1V81A 1C76A 2LRUA 4KGSA 2M4NA 3H7PB 4KZ0A 3AE7B 3TSSA 2WDTB 1DOYA 1U5FA 1Q1OA 1SJHD 2QILA 2WU2B 4K2PA 5JHGA 3M62B 4MELA 4EZKA 4L23A 1IGDA 5EE9A 4ILJA 4G11A 2PE6B 4ANXA 3KSYA 1V97A 2CS4A 4N9F4 3SEBA 3X23A 2Y5PA 3V62A 3KWVA 1TZOA 3IVFA 1TT5B 3ZJVA 2AX5A 4MT5A 2A5UA 2C7HA 3GB1A 1NU2A 3E66A 2W54A 3TEZA 1V5OA 5IJMA 1K53A 1ZW7A 3TMPB 1IBXB 1T0QC 3Q8FA 5DIFB 3MJWA 2MFQA 4ZRIA 1WE6A 3PEGA 1ZOYB 4MGZE 1HZ6A 1H10A 1UGJA 1KRHA 2KJ6A 3AH7A 3U8ZA 3G9WA 5G5GA 4GOCA 2K8HA 2GBJA 4BOZB 1HEZE 2LGSA 2JXTA 3VR8B 1IPGA 4RF1A 1VZ6A 2K2JA 3OANA 2LJIA 2ACZB 2XK5A 2L32A 5IOIA 2LVPA 5FK9C 2C9WB 3WYFB 5BO4B 5GMVA 2J52A 2YS5A 3DBSA 3Q3NC 1EF5A 2IJ0A 4DDGD 5C5BB 4HSIA 4M0WB 1FM0D 1XCTL 1PMSA 1ZC4B 3MP9A 2KWUB 5D2MB 3NWFA 1KLGD 3PZ8A 4ASWC 2MHJA 5DI9B 2MX2A 4ZRKA 4OZBA 1XD3B 3R7RA 3L17A 4PT5A 5IO9A 2LZ6A 3AULA 4PYUA 3RD2A 4KDLB 2CKHB 2L8JA 2BS3B 4A3OA 2LFIA 1VBHA 3D8FA 3VRAB 4XDDA 2AYOB 1BTKA 1E5WA 2LASA 3VUXA 1EVHA 3DBRB 1UWXA 4PNKA 1FO4A 4TYZA 2QKLA 2JF5A 1DDWA 2CHXA 4P6VF 4F1SA 3ZJUA 3B9JA 2Z59B 4KVGB 2NTSA 2N9LA 2KDMA 4HCNB 3LJUX 1JMLA 4JKDA 2NBVB 3KUCB 4JKFA 2GJYA 1VCBA 3AEEB 4HATB 1ZVRA 2ADZA 4NQLB 2DZIA 4NQKE 1RFKA 2N4FA 5AZGA 4ZYSA 4HXDA 3H9DA 2DNFA 1U27A 1WJUA 1WXAA 1YIWA 1ISNA 3I9V1 2XN9C 4A6QA 2NMQA 4DBBA 3Q3FA 4GPTB 2M38A 1E8ZA 1GGOA 3NZ3A 5FKAC 3FVCA 1KBLA 4YXDB 3T8MA 2VH2A 2R2QA 3QWMA 5LOPB 4A3PA 2O2VA 4NJ7A 3L0WB 5MPOA 5KHOA 4FULA 2FE8A 2N9EB 4RMAA 3A9JA 4KKIA 2M0XA 3W1YA 2D4QA 2RDGA 3JSVB 5JHAA 3B1LX 1ESFA 3F5RA 3HIZA 4K1RB 4FA6A 2DA0A 4OZAA 1MIZB 2L76A 1VDVA 3H1UA 1L4ZB 4NAWA 3WAMA 3GYPA 2KAJA 2KKCA 3NY5A 1BMLC 5FI1A 2DLBA 4K7WA 5CLQB 4W9IA 5IRSA 3IBEA 4F7UP 2QKMA 1D5MC 2EKEC 4HCPB 3QAQA 2DFKA 1FEHA 2MSED 1T0SC 3IT6B 2M19A 4PS8A 1T6BX 2DAJA 2Z0EB 4YTPB 3W5VB 5L83A 2N0SB 3AE2B 1TS3A 4IG7B 1FPYA 4HKQA 2JP2A 2QC8A 3AB5A 3DPDA 3U52E 2W82A 3U4EG 2BCJA 2N0YA 2XEWA 2JZ3B 4IOYX 2ICIA 2PE9A 3ZLZA 3E9PA 3OLMD 1AWDA 3CSFA 2BQQA 2GBKA 1FHXA 3LYYA 3V60A 4MEMA 1KLUD 2KDBA 4WJPA 2D3CA 4KDIC 3AU4A 4FHKA 4AUQC 1DDMA 1T3QA 5IA7A 3DXCA 2A4ZA 3RMKC 2R2YA 1YQBA 2WDVB 3CF6E 3PRPB 3QJZA 4KHBA 4WAFA 2P8VA 2G4DB 2NCNA 1AYFA 1D5ZC 2PKOA 3PSCA 2IDYA 2SAKA 1QQGA 4A6FB 4P1BC 2YT1A 3RCPA 2DZMA 4WJQA 4HAVB 2DYBA 5GXGB 4IM3A 1V8CA 2LI5A 3ODXA 1VR9A 2ZPNA 3Q14C 5JH5C 1V1PB 2CQUA 4J6IA 3RCZA 4B9KA 2Y3AA 1ZYIA 1PLSA 3N9YC 2KTRA 3AECB 1KZGA 3TFMA 2KFKA 2ZNVB 3IAM1 2CAYA 3SUZA 3ONSA 2DIKA 2L05A 1TKYA 2BPSA 4PYZA 2WXNA 1YJ1A 3K9OB 4XWTA 2UYZB 4IOIE 3U7DA 2MBEA 2K8CA 2KUPA 2YSZA 4ARCA 1GNUA 1P5TA 2WQYB 5HE1A 1JWMD 4IKGA 1MHXA 2IO0B 3W1SA 1I4RA 4ZHPA 1XLPA 4FLHA 1TQZA 3U30A 2YT2A 4QAYA 3S2AA 1N60A 4KAXB 2GOWA 1B9RA 1NBFC 1V5UA 2BB5A 3PS6A 1VBGA 2N7JA 1VRAB 3X0WA 1UNQA 4GDLA 2MW5A 1P7EA 5TR5A 3EA6A 2HTME 2DHKA 3DBHI 3RNFC 4BKGA 1V49A 2EJ8A 1V5PA 1XLNA 1FAOA 2KYWA 4WSFA 3IG3A 2FDQA 3AJ4A 2LRWA 3TCAA 1SHCA 1TYGB 1R4NB 1AN8A 1F77A 1MPEA 1XF5L 2DHJA 2LG1A 1YN4A 3ZNZB 4FXCA 4DWFA 5IAAC 1V1OA 2WHIA 3NVZA 1XT9B 1MI0A 4KHOA 2CY4A 2HTHA 1PQSA 4W9DA 2D3AA 4RM8A 4W9GA 2CY5A 1XKEA 1FOEA 3UGBB 3PO0A 1JROA 2NBWB 2V0GA 1UZXB 1FNUA 1FGZA 2WDQB 2LULA 1L0VB 3WAOA 4II3B 4ZDVA 3GYOA 1NTYA 1WM2A 4CHKA 4TUUA 3SR6A 3ZVRA 5AUKA 2NVUI 4GGQA 3W9CB 5FR6A 4GDKA 2L0FA 3NS1A 1DYNA 1E8YA 2WXLA 4IW0A 4ILGB 1DROA 3EFUA 1GOZA 3ZRCA 2MEKA 1IUEA 2JYTA 2ELAA 1TXDA 2AWTA 2KJHB 5DPRA 5BYQA 1N63A 4JKAA 2YRYA 4REZA 4TMAB 4P1CC 2W2XC 3RYTA 1C4PA 3A1QA 3DVGY 1EM7A 2GCLA 4BVUC 2GUMA 2INDC 4E3CA 1YQ3B 2KD0A 2V76A 1FIQA 3CSTA 1ZP0B 2RDHA 4HVBA 2PW9A 1WGRA 4JIOU 4B0MA 1UPRA 4JK8A 2DYMA 4KGTA 4RM9A 2CJNA 4JKGB 1DYQA 2QHOA 4I6LB 1C9FA 4DHZB 4W9HA 4QJ4B 1XLQA 1W1GA 1NDDA 3PTFC 2PJHA 3V61A 1T0RC 1F52A 4AJYB 1GAQB 3O96A 2L00B 1JWAD 3KYCD 3L54A 2K1FA 1DDVA 3RZWC 2J0MA 2KT7A 4OVZA 2QIEB 1QOFA 2KQ7A 1P6SA 1ST7A 5LXHA 2LEKA 2JZZA 3I3TB 5IP4D 4AS1A 2UVMA 4OSNA 1ACAA 2P0DA 4EJNA 2LXCA 3KYDD 2D9XA 4DXGA 4O1NA 4F7GA 1UNSA 5HHDG 2M56B 1NI2A 2K00A 2N7EA 1QKZA 2QSDA 3SV1A 3DQVA 3KUZA 5G55A 1ZM0A 1E8XA 3ODWA 2NPTB 2W55A 2LBBA 2WX1A 1JALA 2H88B 1GC6A 3KZ1A 2DZKA 3AE5B 2KQSA 1DBHA 1TZ1A 1K5GB 2N9KA 4X57B 2JVCA 2HDEA 4N58A 1MJDA 2W2XD 2Y8FA 1X1FA 2MP2A 3A9KA 3ZUNA 1EUVB 2Z13A 1N5XA 1SSNA 2KC1A 3QC8B 2TSSA 1M7EA 4KIKB 1WYGA 4DXFA 1SIJA 2L52A 3AEDB 2GRIA 2IFSA 3A4RA 5C23A 1AQCA 1X11A 5CHFA 2G45B 4GU2A 1PDXA 5D3WA 1RWSA 4WWPA 1QQRA 5AUIA 2EMTA 1NTVA 3ULCA 2DX5B 2KVZA 5HE2A 1TY0A 2JXXA 4HPMB 4HKZE 2ZEQA 3QBVB 4PQ0A 2GMIC 2HJ1A 2QDFA 3Q8EA 1I4XA 3FSSA 3T06A 1SE3A 1ET6A 4QXAB 2DBYA 2JUOA 4ZOHC 2R2OA 5C1ZA 4JGHB 1XX0A 2KDIA 1K5DB 2GCJA 4BAXA 2L7RA 2ZW0A 1WIAA 3IXSA 1ZGUB 3QARA 4ANVA 2KX3A 4GOUA 2NTTA 1UH6A 3N1YC 1QZEA 2BS4B 1HQRD 3AV8A 1WRIA 4PK1A 3AE6B 2H7EA 4JKCA 4NAMA 2V4LA 1BUIC 3LJ3A 2RSGA 1OMWA 1SXTA 1ZXHA 1OFFA 2ZNVC 3R7QA 1DIKA 4HB4B 1GPXA 1FXTB 1PFDA 2WP9B 4OHJA 4Y94A 1ZDVA 3PZDA
chains in the Genus database with same CATH topology
1P3QU 2RD0A 3RULA 4NNJB 4F8CB 4MY6A 4DHJB 4EFOA 3PV1A 4KHAA 3PVLA 5HE0A 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 3A98B 3FP5A 4OVUA 4W9LA 3D8DA 5L81A 2FJ9A 3CMMB 1XD4A 1WJ6A 2MBHA 4URKA 3VIAA 5J18A 1HE8A 3UF8A 3PVUA 2J0KA 3NZSA 1U29A 2DENB 2N9PC 4YONA 3WANA 1E7UA 1BTNA 3A33B 5FI0A 4AOFA 2KANA 2RPQA 3V5WA 1TJ6A 4EUTA 1P3RA 4MJSA 4JQWC 3BINA 4LJOB 3TIXA 2JRIB 3VTVA 4GMVA 2ZCCA 2KFJA 3F0WA 3TBLD 4IWPA 3OAWA 2P0HA 3HM3A 3ZKJC 2NR2A 4AP4C 3QCAA 4HWIB 4HB3B 3H7SA 1WYWB 2C7NB 3QWZB 2BYEA 4A6HA 2LVQA 3PLUA 1M94A 2B3AA 2MBQA 4K7UA 2ROZB 1WGHA 2J7QB 3VXWA 1HB8A 4AWJA 4BBNC 4NSWA 4OVVA 2ZJDA 5D6JB 2MQJA 2L2IA 4WWOA 5D3YA 3VAWA 4XZ4A 4EEWA 4Z2MB 1I7AA 4ILHA 2KWCA 3QA8A 3PLVA 3ML8A 3B08A 4LJPB 4HHVA 5J3QA 2M17A 3JW0X 3P6AA 3TJPA 2G3QB 1E90A 1TTNA 4IWOA 1KJTA 2CRFA 3MHSD 4FJVB 1V5TA 2R82A 5DCNA 4BKTA 2PPHA 1ZSQA 3ULBA 1Y8RC 2Z0DB 4MK0A 3SBGA 3NS8A 1V86A 2MBOA 4L6EA 1ZKHA 1WXMA 3A8QA 2MCNB 2X0SA 3PGEA 2V3SA 3VQIA 2IYDB 3ZRFA 2DZJA 1RRPB 1N3HA 4MDKE 2ROVA 5E6OA 2COFA 3QIJA 2RGFA 2LYDA 4E74A 1BWNA 1J19A 3KVFB 3H6NA 2KNBA 2MWNB 4BBNF 1WMHB 4NPNA 5C16A 2LGXA 3DXDA 4GB9A 2P0FA 2DHZA 2FCMA 2KDFB 3DDCB 1F9JA 2IY1B 1RLFA 3FEHA 3FM8C 3APCA 2GBRA 2C5LC 1EF1A 5DPWA 3QHTA 3APDA 3UIPB 1JRUA 2I5FA 1LQBA 2KK8A 1S1QB 2N23A 1U5DA 2KMCA 1OGWA 1EGXA 3LDZE 2HD5B 4ICUA 2W2WA 4G50A 1WGUA 4GSWA 2KC2A 2MWSB 3SHQA 4ANUA 2NBUA 3AU5A 3IFWB 2O6VA 4ZRJA 1J0WA 2DYNA 2XK5B 5J17A 1OQYA 2EMSA 3ZW3A 1LXDA 4AJWA 4EZJA 3GOEA 2ELBA 1RRBA 3M63B 2YLMA 2MLBA 3TL5A 2BYVE 1V61A 2D9ZA 2GBMA 1IRSA 2DYQA 5AZFA 3L08A 4KZCA 4H8SA 2IO3B 3E9LA 4A20A 1MIXA 2AEHA 1MPHA 3HK0A 4DX8A 1U5EA 3DVGX 2BF8B 4HB2B 3WALA 1OQNA 1Q67A 3CIKA 2RR9A 4HDOA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 2YS1A 4MM3A 1V2YA 3UIOB 5DHFB 3O65B 2CHZA 1WF9A 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 2MA9B 1RJ2A 4BFRA 1Q5WB 3A9JB 3PREA 2CHWA 3H7PA 2N1VA 2KTFA 2KCJA 2NMBA 2D11A 4WJNA 2Q13A 3N32A 4NAWB 3SU8X 4YL8A 2DTCA 4HK2A 3ZNGC 2LGYA 4PS3A 4XWXA 2ZPYA 1UGMA 1FHOA 4FADA 4FJZA 1P0RA 5J3YA 5D94A 1H4RA 4I6NB 5AZHA 4MSMB 2RQ1A 5KQ4A 5D3VA 5C79A 1K8RB 2JWZA 4TKNA 4M8MA 2JRHA 4Z2NA 2K8BA 1E7VA 4LDTB 2KLCA 1WGDA 4HPLB 1MG8A 3KH0A 3ECIA 3CXBB 3NHEB 5LONB 4K2OA 1WE7A 2OJRA 4P7IA 1C1YB 2D2QA 1YX5B 5KQ1A 4CO7A 5C5BA 2LWPA 4KHBB 2Z0QA 4TQ1A 1AWEA 3V6CB 2N1WA 2LD9A 3N30A 4GMXB 2K6QA 1P9DU 3N3KB 2RVBB 5L95C 3TW1A 2KTRB 2DKPA 1L2NA 1FGYA 2KFKB 3SDLC 1V5MA 2G35A 1WJ4A 2O6VB 2COCA 4MT7A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 5CLLB 1OY2A 1HBKA 4F7HA 3A4SC 2KOXA 1KOTA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 2W9NA 4IM2A 4G0NB 2KWVB 5D3XA 3TVVA 3PG7A 5D27A 1XODA 2DHIA 4BKSA 4GDLB 4DDID 2BWFA 3AI5A 3VOQA 2MRPA 2IBIB 1U2BA 1M7RA 5DPTA 4HAWB 1S3SG 1WFYA 1C3TA 4IC7B 1G6JA 3C0RB 3JSVA 4JKHA 1WGYA 4PS7A 3ZNHB 2CODA 1KLVA 3SNHA 2LOXA 2ZVNA 2KXJA 4XC2A 2HTHB 4GXBA 2D9YA 2L0TA 4KV2A 4JK9A 3FLVA 4B95A 4BOSC 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 1GG3A 4GDKB 2ZCBA 2L1CA 1WZ3A 2K25A 1U4AA 4II2B 1V6EA 4FBJB 2MBBB 2UZRA 4B6HA 2FJLA 3MPXA 2R0DA 4WJOA 1RFAA 3A1QB 2KN5A 4IM0A 1UNRA 4TQ0A 4EKUA 4GZUA 2LGDA 2MKRA 1X1MA 3VUYA 4A6FA 2FAZA 3E9OA 5J3TA 3DBLI 1XQQA 1KZ7A 1EO6A 3WIMA 5DHAB 1WX7A 3ENBA 4JKBA 1IP9A 3HM6X 2MDXA 4NY0A 4JL9A 1X1GA 2D9WA 2AL3A 2ZZPB 4GN1A 2WX0A 2LVOA 1Q0WB 3VUWA 4A5KA 3ML4A 5G2NA 4FJYA 2PEAA 3VVWB 4XX5A 2NZ8B 4JLCA 1XCGA 3L16A 2OOBB 1WI0A 4DBGA 2YF0A 3VDZA 5CX3A 4MSQB 2C60A 1MK9B 1WJMA 1UELA 1UBQA 2MP2B 3A9KB 3RUIB 4DX90 3VTUA 1WX8A 3KY9A 4B6WA 1BT0A 2ASQA 2LUEA 1U5GA 1TGZB 3JYUA 4JK7A 2M14A 2BWES 3NZUA 2GS0A 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 3HW2B 3NSUA 4HJKA 2ABDA 4A6KA 3SYXA 2DKQA 2HRJA 3UQAA 1WR1A 5CTRC 4IWQA 2BKFA 2K6DB 4EZLA 3PVWA 3IHPC 1AARA 2VKIA 2DLWA 2VSZA 2E2XA 2UWQA 1PFJA 2FCNA 4DK5A 5HKHA 3HHMA 4MGKE 2ZVOA 3MDBC 2I1KA 4ANWA 4TV3A 4HAYB 4WJ7A 4WAAA 1V89A 2RGNB 4KSLC 5HE3A 1V80A 3AXCA 5EFXA 4W9JA 4I6PA 1E8WA 1W1DA 4HB0B 3W1SC 2J59M 4JKGA 1Y5OA 1MK7B 4LDTD 3M3JA 4G3XB 4E71A 3T9LA 3SBTA 2HE7A 3KUDB 3UQBA 3DBRI 1OEYA 3SO6A 3VH4B 1V88A 1Z2MA 4HAZB 5C6RA 2NPTA 3B0AA 1LB1A 4FN2A 2Z0PA 1WXVA 2IZVB 2LXAA 1TBEA 1UPQA 1WG7A 2N9XA 4JKEA 5AEKB 3RT3B 1GJZA 1X05A 2FUHB 4W9CA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 4KSKC 3PP2A 3P7ZA 1SIFA 1XR0B 3HQCA 4FHJA 2KJRA 1L7YA 3PHXB 3KW5B 4K7SA 4EMOA 3ZDMC 3ZIMA 4MGIE 3L13A 3R3MA 3UINB 4HLEA 2DX5A 2DX1A 5KHQA 2HJ8A 4BBKA 1WM3A 5CHWA 3ZO5B 3WA0A 2M8SA 5KCVA 2JT4B 1WH3A 1NVLA 5D7GA 1HB6A 3P2BA 5E6NA 4DHZE 2JY6A 2VRWB 1WZ0A 2C7MB 1VD2A 2G4SA 3QK0A 1SE9A 3ZDTA 2BKRB 4K17A 1B55A 1WXSA 4WQOB 2BYFA 3OJ3A 5JP4A 4HDQA 1D3ZA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 3ALBA 3EECA 1I42A 1EAZA 2WYQA 3JVZX 1J8CA 2NS5A 1JDEA 3A8PA 2XQNM 1Y19B 2Y7BA 2LJ5A 3RZFA 3EHVA 2YVCA 3R66C 1IYFA 2LOZA 3QQ8B 2KZRA 4M8NA 2IO1B 1WR6E 1Z87A 4IAPA 4NJ6A 3K9PB 1UNPA 3WAPA 3D8EA 2CU1A 5GOWB 1V9JA 2FIDA 3PRZA 1WVHA 1YX6B 2H7DA 5JHBA 2AL6A 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3ZTCA 3BY4B 2IO2B 5CHVC 1LW3A 1MKEA 1OEYJ 3ZTDA 1A5RA 1H8CA 2V1YA 4GIVA 2COAA 4ZYNA 2OQBA 3ZVVA 2REXA 2FIFA 1KM7A 2DYOA 3L10B 3ODOA 3PSEB 2N7DA 2BGFA 3EPYA 3ENEA 2K2UA 4WWNA 1WJNA 2COPA 3SD5A 2CR5A 1X86A 4HAUB 2JPHA 3DVNV 1QC6A 2IYBA 1FB8A 1R4NI 3BJIA 2RNRB 2YT0A 1MAIA 3KRWA 1WX9A 5DH9B 2WWZA 1LFDA 1I35A 4W9FA 3PT2B 1Z5SB 3N7CA 1RAXA 5E6PA 4CHMA 2CB8A 1BAKA 1WGGA 3VH3B 1NTIA 2D07B 1P98A 4DXAB 3M1IB 1UBIA 2PZ1A 2UZSA 5EDSA 2KDEB 2KVRA 2KLGA 2KO3A 5JVLA 3MTNB 3PHWB 2FNJB 2D10A 4CYEA 5LLIA 4ICVA 4MH0E 1WRDB 2DN6A 1I2HA 2I1JA 3ML9A 1WY8A 4MGYE 1YD8U 3OJ4B 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 1WJ1A 2R09A 2FCSA 5JLJB 2X18A 2D9VA 2Y8GA 2K39A 1GC7A 4F7ZA 2KMAA 2RUKB 3PRMB 1KC7A 1UD7A 2I5CA 4K81A 3TO1A 3KRXA 3DOWA 1SGHA 2FCQA 1CMXB 2EC1A 2YS3A 2KHWB 4LCDE 2RLOA 1W1HA 1P1AA 1WMHA 4HAXB 5LXIB 3PPAA 2Z0OA 2KX0A 3UZTA 5JZEB 3DVNU 1V81A 2LRUA 2M4NA 3H7PB 4KZ0A 2WDTB 1U5FA 1Q1OA 4K2PA 5JHGA 3M62B 4MELA 4EZKA 4ILJA 4G11A 2PE6B 4ANXA 3KSYA 2CS4A 4N9F4 3X23A 3V62A 3IVFA 2A5UA 2C7HA 1NU2A 3E66A 1V5OA 5IJMA 1ZW7A 3TMPB 5DIFB 3MJWA 2MFQA 4ZRIA 1WE6A 3PEGA 4MGZE 1H10A 2KJ6A 3U8ZA 3G9WA 4GOCA 2K8HA 2GBJA 4BOZB 1IPGA 2K2JA 3OANA 2XK5A 2LVPA 2C9WB 3WYFB 5BO4B 5GMVA 2YS5A 3DBSA 1EF5A 4DDGD 5C5BB 4M0WB 1PMSA 1ZC4B 2KWUB 5D2MB 4ASWC 5DI9B 2MX2A 4ZRKA 1XD3B 3R7RA 3L17A 2LZ6A 3AULA 4PYUA 3RD2A 4KDLB 2CKHB 2L8JA 4A3OA 1VBHA 3D8FA 2AYOB 1BTKA 1E5WA 2LASA 3VUXA 1EVHA 4PNKA 4TYZA 2QKLA 2JF5A 1DDWA 2CHXA 4F1SA 2Z59B 4KVGB 4HCNB 3LJUX 4JKDA 2NBVB 3KUCB 4JKFA 2GJYA 1VCBA 4HATB 1ZVRA 2ADZA 4NQLB 2DZIA 4NQKE 2N4FA 5AZGA 4HXDA 3H9DA 1U27A 1WJUA 1WXAA 1YIWA 1ISNA 4DBBA 3Q3FA 4GPTB 2M38A 1E8ZA 1GGOA 1KBLA 3T8MA 2R2QA 3QWMA 5LOPB 4A3PA 2O2VA 4NJ7A 3L0WB 5KHOA 4FULA 2N9EB 4RMAA 3A9JA 2M0XA 3W1YA 2D4QA 3JSVB 5JHAA 3B1LX 3F5RA 3HIZA 4K1RB 4FA6A 2DA0A 1MIZB 2L76A 3H1UA 4NAWA 3WAMA 3GYPA 2KKCA 3NY5A 5FI1A 4K7WA 5CLQB 4W9IA 3IBEA 4F7UP 2QKMA 2EKEC 4HCPB 3QAQA 2DFKA 2MSED 4PS8A 2DAJA 2Z0EB 5L83A 4IG7B 2JP2A 3DPDA 2BCJA 2N0YA 2XEWA 2JZ3B 4IOYX 2PE9A 3ZLZA 3E9PA 3OLMD 3CSFA 2GBKA 1FHXA 3V60A 4MEMA 2KDBA 4WJPA 4KDIC 3AU4A 4FHKA 4AUQC 1DDMA 5IA7A 3DXCA 2A4ZA 1YQBA 3CF6E 3PRPB 3QJZA 2P8VA 2G4DB 2NCNA 3PSCA 1QQGA 4A6FB 2YT1A 3RCPA 2DZMA 4WJQA 4HAVB 2DYBA 4IM3A 2LI5A 3ODXA 2ZPNA 5JH5C 2CQUA 4J6IA 3RCZA 4B9KA 1PLSA 2KTRA 1KZGA 3TFMA 2KFKA 2ZNVB 2CAYA 3SUZA 3ONSA 2DIKA 2L05A 2BPSA 4PYZA 1YJ1A 3K9OB 2UYZB 3U7DA 2MBEA 2K8CA 2KUPA 2YSZA 1GNUA 1P5TA 5HE1A 2IO0B 3W1SA 4FLHA 1TQZA 3U30A 3S2AA 4KAXB 2GOWA 1NBFC 1V5UA 3PS6A 1VBGA 3X0WA 1UNQA 4GDLA 2MW5A 5TR5A 2DHKA 3DBHI 4BKGA 1V49A 2EJ8A 1V5PA 1FAOA 3IG3A 4WSFA 2FDQA 3AJ4A 2LRWA 3TCAA 1SHCA 3ZNZB 2DHJA 2LG1A 4DWFA 5IAAC 1XT9B 4KHOA 2CY4A 2HTHA 1PQSA 4W9DA 4RM8A 4W9GA 2CY5A 1XKEA 1FOEA 3UGBB 2NBWB 1UZXB 1FGZA 2LULA 3WAOA 4II3B 4ZDVA 3GYOA 1NTYA 1WM2A 4CHKA 4TUUA 3ZVRA 2NVUI 4GGQA 5FR6A 4GDKA 2L0FA 1DYNA 1E8YA 4IW0A 4ILGB 1DROA 3EFUA 3ZRCA 2KJHB 2ELAA 1TXDA 2AWTA 5DPRA 4JKAA 2YRYA 2W2XC 3RYTA 3A1QA 3DVGY 2GCLA 4BVUC 4E3CA 2KD0A 2V76A 3CSTA 4HVBA 1WGRA 4JIOU 1UPRA 4JK8A 2DYMA 4RM9A 4JKGB 2QHOA 4I6LB 4DHZB 4W9HA 1W1GA 1NDDA 3PTFC 2PJHA 3V61A 4AJYB 3O96A 2L00B 3KYCD 3L54A 2K1FA 1DDVA 3RZWC 2J0MA 2KQ7A 1P6SA 1ST7A 5LXHA 2JZZA 3I3TB 2UVMA 1ACAA 2P0DA 4EJNA 2LXCA 3KYDD 2D9XA 4F7GA 1NI2A 2K00A 2N7EA 3SV1A 3DQVA 3KUZA 5G55A 1ZM0A 1E8XA 3ODWA 2NPTB 2LBBA 2WX1A 1GC6A 3KZ1A 2DZKA 2KQSA 1DBHA 1TZ1A 1K5GB 4X57B 2JVCA 2W2XD 2Y8FA 1X1FA 2MP2A 3A9KA 3ZUNA 1EUVB 3QC8B 2KC1A 1M7EA 4KIKB 2IFSA 3A4RA 5C23A 1AQCA 1X11A 5CHFA 2G45B 4GU2A 5D3WA 4WWPA 2EMTA 1NTVA 3ULCA 2DX5B 5HE2A 2JXXA 4HPMB 2ZEQA 3QBVB 4PQ0A 2GMIC 3FSSA 3T06A 2JUOA 2R2OA 5C1ZA 4JGHB 1XX0A 2KDIA 1K5DB 2GCJA 2L7RA 1WIAA 1ZGUB 3QARA 4ANVA 2KX3A 1UH6A 1QZEA 2H7EA 4JKCA 2V4LA 3LJ3A 2RSGA 1OMWA 3R7QA 2ZNVC 1DIKA 4HB4B 1FXTB 4Y94A 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3Q U;  2RD0 A;  3RUL A;  4NNJ B;  4F8C B;  4MY6 A;  4DHJ B;  4EFO A;  3PV1 A;  4KHA A;  3PVL A;  5HE0 A;  3V6E B;  2DAF A;  3Q3J A;  2VRR B;  3GZN I;  3A98 B;  3FP5 A;  4OVU A;  4W9L A;  3D8D A;  5L81 A;  2FJ9 A;  3CMM B;  1XD4 A;  1WJ6 A;  2MBH A;  4URK A;  3VIA A;  5J18 A;  1HE8 A;  3UF8 A;  3PVU A;  2J0K A;  3NZS A;  1U29 A;  2DEN B;  2N9P C;  4YON A;  3WAN A;  1E7U A;  1BTN A;  3A33 B;  5FI0 A;  4AOF A;  2KAN A;  2RPQ A;  3V5W A;  1TJ6 A;  4EUT A;  1P3R A;  4MJS A;  4JQW C;  3BIN A;  4LJO B;  3TIX A;  2JRI B;  3VTV A;  4GMV A;  2ZCC A;  2KFJ A;  3F0W A;  3TBL D;  4IWP A;  3OAW A;  2P0H A;  3HM3 A;  3ZKJ C;  2NR2 A;  4AP4 C;  3QCA A;  4HWI B;  4HB3 B;  3H7S A;  1WYW B;  2C7N B;  3QWZ B;  2BYE A;  4A6H A;  2LVQ A;  3PLU A;  1M94 A;  2B3A A;  2MBQ A;  4K7U A;  2ROZ B;  1WGH A;  2J7Q B;  3VXW A;  1HB8 A;  4AWJ A;  4BBN C;  4NSW A;  4OVV A;  2ZJD A;  5D6J B;  2MQJ A;  2L2I A;  4WWO A;  5D3Y A;  3VAW A;  4XZ4 A;  4EEW A;  4Z2M B;  1I7A A;  2KWC A;  3QA8 A;  3PLV A;  3ML8 A;  3B08 A;  4LJP B;  4HHV A;  5J3Q A;  2M17 A;  3JW0 X;  3P6A A;  3TJP A;  2G3Q B;  1E90 A;  1TTN A;  4IWO A;  1KJT A;  2CRF A;  3MHS D;  4FJV B;  1V5T A;  5DCN A;  4BKT A;  2PPH A;  1ZSQ A;  3ULB A;  1Y8R C;  2Z0D B;  4MK0 A;  3NS8 A;  1V86 A;  2MBO A;  4L6E A;  1ZKH A;  1WXM A;  3A8Q A;  2MCN B;  3PGE A;  2V3S A;  3VQI A;  2IYD B;  3ZRF A;  2DZJ A;  1RRP B;  1N3H A;  4MDK E;  2ROV A;  5E6O A;  2COF A;  3QIJ A;  2RGF A;  2LYD A;  4E74 A;  1BWN A;  1J19 A;  3KVF B;  3H6N A;  2KNB A;  2MWN B;  4BBN F;  1WMH B;  4NPN A;  5C16 A;  2LGX A;  3DXD A;  4GB9 A;  2P0F A;  2DHZ A;  2FCM A;  2KDF B;  3DDC B;  1F9J A;  2IY1 B;  1RLF A;  3FEH A;  3FM8 C;  3APC A;  2GBR A;  2C5L C;  1EF1 A;  5DPW A;  3QHT A;  3APD A;  3UIP B;  1JRU A;  2I5F A;  1LQB A;  2KK8 A;  1S1Q B;  2N23 A;  1U5D A;  2KMC A;  1OGW A;  1EGX A;  3LDZ E;  2HD5 B;  4ICU A;  2W2W A;  4G50 A;  1WGU A;  4GSW A;  2KC2 A;  2MWS B;  3SHQ A;  4ANU A;  2NBU A;  3AU5 A;  3IFW B;  2O6V A;  4ZRJ A;  1J0W A;  2DYN A;  2XK5 B;  5J17 A;  1OQY A;  2EMS A;  3ZW3 A;  1LXD A;  4AJW A;  4EZJ A;  3GOE A;  2ELB A;  1RRB A;  3M63 B;  2YLM A;  2MLB A;  3TL5 A;  2BYV E;  1V61 A;  2D9Z A;  2GBM A;  1IRS A;  2DYQ A;  5AZF A;  3L08 A;  4KZC A;  4H8S A;  2IO3 B;  4A20 A;  1MIX A;  2AEH A;  1MPH A;  3HK0 A;  4DX8 A;  1U5E A;  3DVG X;  2BF8 B;  4HB2 B;  3WAL A;  1OQN A;  1Q67 A;  3CIK A;  2RR9 A;  4HDO A;  2WH5 A;  4C0A A;  2J0J A;  3QX1 A;  1WGQ A;  2YS1 A;  4MM3 A;  1V2Y A;  3UIO B;  5DHF B;  3O65 B;  2CHZ A;  1WF9 A;  1WI1 A;  4DHJ D;  2O2V B;  4WVF B;  4EOY A;  2MA9 B;  1RJ2 A;  4BFR A;  1Q5W B;  3A9J B;  3PRE A;  2CHW A;  3H7P A;  2N1V A;  2KTF A;  2NMB A;  2D11 A;  2KCJ A;  4WJN A;  2Q13 A;  3N32 A;  4NAW B;  3SU8 X;  4YL8 A;  2DTC A;  4HK2 A;  3ZNG C;  2LGY A;  4PS3 A;  4XWX A;  2ZPY A;  1UGM A;  1FHO A;  4FAD A;  4FJZ A;  1P0R A;  5J3Y A;  5D94 A;  1H4R A;  4I6N B;  5AZH A;  4MSM B;  2RQ1 A;  5KQ4 A;  5D3V A;  5C79 A;  1K8R B;  2JWZ A;  4TKN A;  4M8M A;  2JRH A;  4Z2N A;  2K8B A;  1E7V A;  4LDT B;  2KLC A;  1WGD A;  4HPL B;  1MG8 A;  3KH0 A;  3ECI A;  3CXB B;  3NHE B;  5LON B;  4K2O A;  1WE7 A;  2OJR A;  4P7I A;  1C1Y B;  2D2Q A;  1YX5 B;  5KQ1 A;  4CO7 A;  5C5B A;  2LWP A;  4KHB B;  2Z0Q A;  4TQ1 A;  1AWE A;  3V6C B;  2N1W A;  2LD9 A;  3N30 A;  4GMX B;  2K6Q A;  1P9D U;  3N3K B;  2RVB B;  5L95 C;  3TW1 A;  2KTR B;  2DKP A;  1L2N A;  1FGY A;  2KFK B;  3SDL C;  1V5M A;  2G35 A;  1WJ4 A;  2O6V B;  2COC A;  4MT7 A;  1UEF A;  2XBB C;  4CHJ A;  4IUM B;  3VFK A;  5CLL B;  1OY2 A;  1HBK A;  4F7H A;  3A4S C;  2KOX A;  1KOT A;  3D32 A;  2OTX A;  1LM8 B;  3VTW A;  4D0N B;  2W9N A;  4IM2 A;  4G0N B;  2KWV B;  5D3X A;  3TVV A;  3PG7 A;  5D27 A;  1XOD A;  2DHI A;  4BKS A;  4GDL B;  4DDI D;  2BWF A;  3AI5 A;  3VOQ A;  2MRP A;  2IBI B;  1U2B A;  1M7R A;  5DPT A;  4HAW B;  1S3S G;  1WFY A;  1C3T A;  4IC7 B;  1G6J A;  3C0R B;  3JSV A;  1WGY A;  4PS7 A;  3ZNH B;  2COD A;  1KLV A;  3SNH A;  2LOX A;  2ZVN A;  2KXJ A;  4XC2 A;  2HTH B;  4GXB A;  2D9Y A;  2L0T A;  4KV2 A;  3FLV A;  4B95 A;  4BOS C;  1R4M I;  1KI1 B;  4W9K A;  2L3Z A;  3DXE A;  1GG3 A;  4GDK B;  2ZCB A;  2L1C A;  1WZ3 A;  2K25 A;  1U4A A;  4II2 B;  1V6E A;  4FBJ B;  2MBB B;  2UZR A;  4B6H A;  2FJL A;  3MPX A;  2R0D A;  4WJO A;  1RFA A;  3A1Q B;  2KN5 A;  4IM0 A;  1UNR A;  4TQ0 A;  4EKU A;  4GZU A;  2LGD A;  2MKR A;  1X1M A;  3VUY A;  4A6F A;  2FAZ A;  5J3T A;  3DBL I;  1XQQ A;  1KZ7 A;  1EO6 A;  3WIM A;  5DHA B;  1WX7 A;  1IP9 A;  3HM6 X;  2MDX A;  4NY0 A;  4JL9 A;  1X1G A;  2D9W A;  2AL3 A;  2ZZP B;  4GN1 A;  2WX0 A;  2LVO A;  1Q0W B;  3VUW A;  4A5K A;  3ML4 A;  5G2N A;  4FJY A;  2PEA A;  3VVW B;  4XX5 A;  2NZ8 B;  4JLC A;  1XCG A;  3L16 A;  2OOB B;  1WI0 A;  4DBG A;  2YF0 A;  3VDZ A;  5CX3 A;  4MSQ B;  2C60 A;  1MK9 B;  1WJM A;  1UEL A;  1UBQ A;  2MP2 B;  3A9K B;  3RUI B;  4DX9 0;  3VTU A;  1WX8 A;  3KY9 A;  4B6W A;  1BT0 A;  2ASQ A;  2LUE A;  1U5G A;  1TGZ B;  3JYU A;  2M14 A;  2BWE S;  3NZU A;  2GS0 A;  4W9E A;  1J0G A;  1FHW A;  1OTR B;  2Y5B B;  3HW2 B;  3NSU A;  4HJK A;  2ABD A;  4A6K A;  3SYX A;  2DKQ A;  2HRJ A;  3UQA A;  1WR1 A;  5CTR C;  4IWQ A;  2BKF A;  2K6D B;  4EZL A;  3PVW A;  3IHP C;  1AAR A;  2VKI A;  2DLW A;  2VSZ A;  2E2X A;  2UWQ A;  1PFJ A;  2FCN A;  4DK5 A;  5HKH A;  3HHM A;  4MGK E;  2ZVO A;  3MDB C;  2I1K A;  4ANW A;  4TV3 A;  4HAY B;  4WJ7 A;  4WAA A;  1V89 A;  2RGN B;  4KSL C;  5HE3 A;  1V80 A;  3AXC A;  5EFX A;  4W9J A;  4I6P A;  1E8W A;  1W1D A;  4HB0 B;  3W1S C;  2J59 M;  1Y5O A;  1MK7 B;  4LDT D;  3M3J A;  4G3X B;  4E71 A;  3T9L A;  2HE7 A;  3KUD B;  3UQB A;  3DBR I;  1OEY A;  3SO6 A;  3VH4 B;  1V88 A;  1Z2M A;  4HAZ B;  5C6R A;  2NPT A;  3B0A A;  1LB1 A;  4FN2 A;  2Z0P A;  1WXV A;  2IZV B;  2LXA A;  1TBE A;  1UPQ A;  1WG7 A;  2N9X A;  5AEK B;  3RT3 B;  1GJZ A;  1X05 A;  2FUH B;  4W9C A;  4MJS B;  2LKO A;  5JHH A;  2O6V D;  2GBN A;  3DCG A;  2M1M A;  4KIK A;  4KSK C;  3PP2 A;  3P7Z A;  1SIF A;  1XR0 B;  3HQC A;  4FHJ A;  2KJR A;  1L7Y A;  3PHX B;  3KW5 B;  4K7S A;  4EMO A;  3ZDM C;  3ZIM A;  4MGI E;  3L13 A;  3R3M A;  3UIN B;  4HLE A;  2DX5 A;  2DX1 A;  5KHQ A;  2HJ8 A;  4BBK A;  1WM3 A;  5CHW A;  3ZO5 B;  3WA0 A;  2M8S A;  5KCV A;  2JT4 B;  1WH3 A;  1NVL A;  5D7G A;  1HB6 A;  3P2B A;  5E6N A;  4DHZ E;  2JY6 A;  2VRW B;  1WZ0 A;  2C7M B;  1VD2 A;  2G4S A;  3QK0 A;  1SE9 A;  3ZDT A;  2BKR B;  4K17 A;  1B55 A;  1WXS A;  4WQO B;  2BYF A;  3OJ3 A;  5JP4 A;  4HDQ A;  1D3Z A;  3VHT C;  4IFS A;  3M95 A;  2IY0 B;  3EC8 A;  3ALB A;  3EEC A;  1I42 A;  1EAZ A;  2WYQ A;  3JVZ X;  1J8C A;  2NS5 A;  3A8P A;  2XQN M;  1Y19 B;  2Y7B A;  2LJ5 A;  3RZF A;  3EHV A;  2YVC A;  3R66 C;  1IYF A;  2LOZ A;  3QQ8 B;  2KZR A;  4M8N A;  2IO1 B;  1WR6 E;  1Z87 A;  4IAP A;  4NJ6 A;  3K9P B;  1UNP A;  3WAP A;  3D8E A;  2CU1 A;  5GOW B;  1V9J A;  2FID A;  3PRZ A;  1WVH A;  1YX6 B;  2H7D A;  5JHB A;  2AL6 A;  3ZNI D;  3APF A;  3NOB A;  1ZC3 B;  5DPS A;  2KGX B;  3ZTC A;  3BY4 B;  2IO2 B;  5CHV C;  1LW3 A;  1MKE A;  1OEY J;  3ZTD A;  1A5R A;  1H8C A;  2V1Y A;  4GIV A;  2COA A;  4ZYN A;  2OQB A;  3ZVV A;  2REX A;  2FIF A;  1KM7 A;  2DYO A;  3L10 B;  3ODO A;  3PSE B;  2N7D A;  2BGF A;  3EPY A;  3ENE A;  2K2U A;  4WWN A;  1WJN A;  2COP A;  3SD5 A;  2CR5 A;  1X86 A;  4HAU B;  2JPH A;  3DVN V;  1QC6 A;  2IYB A;  1FB8 A;  1R4N I;  3BJI A;  2RNR B;  2YT0 A;  1MAI A;  3KRW A;  1WX9 A;  5DH9 B;  2WWZ A;  1LFD A;  1I35 A;  4W9F A;  3PT2 B;  1Z5S B;  3N7C A;  1RAX A;  5E6P A;  4CHM A;  2CB8 A;  1BAK A;  1WGG A;  3VH3 B;  1NTI A;  2D07 B;  1P98 A;  4DXA B;  3M1I B;  1UBI A;  2PZ1 A;  2UZS A;  5EDS A;  2KDE B;  2KVR A;  2KLG A;  2KO3 A;  3MTN B;  3PHW B;  2FNJ B;  2D10 A;  4CYE A;  5LLI A;  4ICV A;  4MH0 E;  1WRD B;  2DN6 A;  1I2H A;  2I1J A;  3ML9 A;  1WY8 A;  4MGY E;  1YD8 U;  3OJ4 B;  5J2R A;  1GUA B;  4BKS D;  2D3G A;  2RSU A;  1T0Y A;  1WJ1 A;  2R09 A;  2FCS A;  5JLJ B;  2X18 A;  2D9V A;  2Y8G A;  2K39 A;  1GC7 A;  4F7Z A;  2KMA A;  2RUK B;  3PRM B;  1UD7 A;  2I5C A;  4K81 A;  3TO1 A;  3KRX A;  3DOW A;  1SGH A;  2FCQ A;  1CMX B;  2EC1 A;  2YS3 A;  2KHW B;  4LCD E;  2RLO A;  1W1H A;  1P1A A;  1WMH A;  4HAX B;  5LXI B;  3PPA A;  2Z0O A;  2KX0 A;  3UZT A;  5JZE B;  3DVN U;  1V81 A;  2LRU A;  2M4N A;  3H7P B;  4KZ0 A;  2WDT B;  1U5F A;  1Q1O A;  4K2P A;  5JHG A;  3M62 B;  4MEL A;  4EZK A;  4G11 A;  2PE6 B;  4ANX A;  3KSY A;  2CS4 A;  4N9F 4;  3X23 A;  3V62 A;  3IVF A;  2A5U A;  2C7H A;  1NU2 A;  1V5O A;  5IJM A;  1ZW7 A;  3TMP B;  5DIF B;  3MJW A;  2MFQ A;  4ZRI A;  1WE6 A;  3PEG A;  4MGZ E;  1H10 A;  2KJ6 A;  3U8Z A;  3G9W A;  4GOC A;  2K8H A;  2GBJ A;  4BOZ B;  1IPG A;  2K2J A;  3OAN A;  2XK5 A;  2LVP A;  2C9W B;  3WYF B;  5BO4 B;  5GMV A;  2YS5 A;  3DBS A;  1EF5 A;  4DDG D;  5C5B B;  4M0W B;  1PMS A;  1ZC4 B;  2KWU B;  5D2M B;  4ASW C;  5DI9 B;  2MX2 A;  4ZRK A;  1XD3 B;  3R7R A;  3L17 A;  2LZ6 A;  3AUL A;  4PYU A;  3RD2 A;  4KDL B;  2CKH B;  2L8J A;  4A3O A;  3D8F A;  2AYO B;  1BTK A;  1E5W A;  2LAS A;  3VUX A;  1EVH A;  4PNK A;  4TYZ A;  2QKL A;  2JF5 A;  1DDW A;  2CHX A;  4F1S A;  2Z59 B;  4KVG B;  4HCN B;  3LJU X;  2NBV B;  3KUC B;  2GJY A;  1VCB A;  4HAT B;  1ZVR A;  2ADZ A;  4NQL B;  2DZI A;  4NQK E;  2N4F A;  5AZG A;  4HXD A;  3H9D A;  1U27 A;  1WJU A;  1WXA A;  1YIW A;  1ISN A;  4DBB A;  3Q3F A;  4GPT B;  2M38 A;  1E8Z A;  3T8M A;  2R2Q A;  3QWM A;  5LOP B;  4A3P A;  2O2V A;  4NJ7 A;  3L0W B;  5KHO A;  4FUL A;  2N9E B;  4RMA A;  3A9J A;  2M0X A;  3W1Y A;  2D4Q A;  3JSV B;  5JHA A;  3B1L X;  3F5R A;  3HIZ A;  4K1R B;  4FA6 A;  2DA0 A;  1MIZ B;  2L76 A;  3H1U A;  4NAW A;  3WAM A;  3GYP A;  2KKC A;  3NY5 A;  5FI1 A;  4K7W A;  5CLQ B;  4W9I A;  3IBE A;  4F7U P;  2QKM A;  2EKE C;  4HCP B;  3QAQ A;  2DFK A;  2MSE D;  4PS8 A;  2DAJ A;  2Z0E B;  5L83 A;  4IG7 B;  2JP2 A;  3DPD A;  2BCJ A;  2N0Y A;  2XEW A;  2JZ3 B;  4IOY X;  2PE9 A;  3ZLZ A;  3OLM D;  3CSF A;  2GBK A;  1FHX A;  3V60 A;  4MEM A;  2KDB A;  4WJP A;  4KDI C;  3AU4 A;  4FHK A;  4AUQ C;  1DDM A;  5IA7 A;  3DXC A;  2A4Z A;  1YQB A;  3CF6 E;  3PRP B;  3QJZ A;  2P8V A;  2G4D B;  2NCN A;  3PSC A;  1QQG A;  4A6F B;  2YT1 A;  3RCP A;  2DZM A;  4WJQ A;  4HAV B;  2DYB A;  4IM3 A;  2LI5 A;  3ODX A;  2ZPN A;  5JH5 C;  2CQU A;  4J6I A;  3RCZ A;  4B9K A;  1PLS A;  2KTR A;  1KZG A;  3TFM A;  2KFK A;  2ZNV B;  2CAY A;  3SUZ A;  3ONS A;  2L05 A;  2BPS A;  4PYZ A;  1YJ1 A;  3K9O B;  2UYZ B;  3U7D A;  2MBE A;  2K8C A;  2KUP A;  2YSZ A;  1GNU A;  1P5T A;  5HE1 A;  2IO0 B;  3W1S A;  4FLH A;  1TQZ A;  3U30 A;  3S2A A;  4KAX B;  2GOW A;  1NBF C;  1V5U A;  3PS6 A;  3X0W A;  1UNQ A;  4GDL A;  2MW5 A;  5TR5 A;  2DHK A;  3DBH I;  4BKG A;  1V49 A;  2EJ8 A;  1V5P A;  1FAO A;  3IG3 A;  4WSF A;  2FDQ A;  3AJ4 A;  2LRW A;  3TCA A;  1SHC A;  3ZNZ B;  2DHJ A;  2LG1 A;  4DWF A;  5IAA C;  1XT9 B;  4KHO A;  2CY4 A;  2HTH A;  1PQS A;  4W9D A;  4RM8 A;  4W9G A;  2CY5 A;  1XKE A;  1FOE A;  3UGB B;  2NBW B;  1UZX B;  1FGZ A;  2LUL A;  3WAO A;  4II3 B;  4ZDV A;  3GYO A;  1NTY A;  1WM2 A;  4CHK A;  4TUU A;  3ZVR A;  2NVU I;  4GGQ A;  5FR6 A;  4GDK A;  2L0F A;  1DYN A;  1E8Y A;  4IW0 A;  1DRO A;  3EFU A;  3ZRC A;  2KJH B;  2ELA A;  1TXD A;  2AWT A;  5DPR A;  2YRY A;  2W2X C;  3RYT A;  3A1Q A;  3DVG Y;  2GCL A;  4BVU C;  4E3C A;  2KD0 A;  2V76 A;  3CST A;  4HVB A;  1WGR A;  4JIO U;  1UPR A;  2DYM A;  4RM9 A;  2QHO A;  4I6L B;  4DHZ B;  4W9H A;  1W1G A;  1NDD A;  3PTF C;  2PJH A;  3V61 A;  4AJY B;  3O96 A;  2L00 B;  3KYC D;  3L54 A;  2K1F A;  1DDV A;  3RZW C;  2J0M A;  2KQ7 A;  1P6S A;  1ST7 A;  5LXH A;  2JZZ A;  3I3T B;  2UVM A;  1ACA A;  2P0D A;  4EJN A;  2LXC A;  3KYD D;  2D9X A;  4F7G A;  1NI2 A;  2K00 A;  2N7E A;  3SV1 A;  3DQV A;  3KUZ A;  5G55 A;  1ZM0 A;  1E8X A;  3ODW A;  2NPT B;  2LBB A;  2WX1 A;  1GC6 A;  3KZ1 A;  2DZK A;  2KQS A;  1DBH A;  1TZ1 A;  1K5G B;  4X57 B;  2JVC A;  2W2X D;  2Y8F A;  1X1F A;  2MP2 A;  3A9K A;  3ZUN A;  1EUV B;  3QC8 B;  2KC1 A;  1M7E A;  4KIK B;  2IFS A;  3A4R A;  5C23 A;  1AQC A;  1X11 A;  5CHF A;  2G45 B;  4GU2 A;  5D3W A;  4WWP A;  2EMT A;  1NTV A;  3ULC A;  2DX5 B;  5HE2 A;  2JXX A;  4HPM B;  2ZEQ A;  3QBV B;  4PQ0 A;  2GMI C;  3FSS A;  3T06 A;  2JUO A;  2R2O A;  5C1Z A;  4JGH B;  1XX0 A;  2KDI A;  1K5D B;  2GCJ A;  2L7R A;  1WIA A;  1ZGU B;  3QAR A;  4ANV A;  2KX3 A;  1UH6 A;  1QZE A;  2H7E A;  2V4L A;  3LJ3 A;  2RSG A;  1OMW A;  2ZNV C;  3R7Q A;  4HB4 B;  1FXT B;  4Y94 A;  3PZD A; 
#chains in the Genus database with same CATH topology
 1P3Q U;  2RD0 A;  2WNM A;  3W2D A;  3RUL A;  4NNJ B;  4F8C B;  1LGR A;  4MY6 A;  4DHJ B;  4EFO A;  3PV1 A;  2JWU A;  4KHA A;  3PVL A;  5HE0 A;  5JXV A;  2K3U A;  3V6E B;  2DAF A;  3Q3J A;  2VRR B;  3GZN I;  3A98 B;  3FP5 A;  4OVU A;  4W9L A;  3D8D A;  1PGX A;  5L81 A;  3ZXV A;  2FJ9 A;  1JQ4 A;  3CMM B;  3NWA A;  1XD4 A;  1WJ6 A;  2MBH A;  3OWE B;  3VIA A;  4URK A;  5J18 A;  1HE8 A;  3UF8 A;  1MI1 A;  1SJE D;  3AN1 A;  3PVU A;  2J0K A;  3NZS A;  4A9A A;  4YSX B;  1U29 A;  2Q5W D;  2DEN B;  3P4P B;  2N9P C;  4YON A;  3WAN A;  3U2S C;  1E7U A;  4LTU A;  1BTN A;  3I63 C;  3A33 B;  5FI0 A;  2BBC A;  4AOF A;  2YEP B;  2KAN A;  3HRD D;  2RPQ A;  2RMM A;  3V5W A;  1TJ6 A;  3Q2A C;  1P3R A;  4EUT A;  4MJS A;  4JQW C;  3BIN A;  1C79 A;  4LJO B;  3TIX A;  1ROE A;  2JRI B;  3VTV A;  3AE1 B;  4GMV A;  2ZCC A;  3ZYY X;  2KFJ A;  4P16 A;  3F0W A;  3TBL D;  4IWP A;  1F2R I;  3OAW A;  4N6E B;  2P0H A;  4M00 A;  3HM3 A;  3ZKJ C;  2NR2 A;  4QJ3 B;  4AP4 C;  1DOI A;  3QCA A;  3TEY A;  5T8I A;  4C56 C;  2K49 A;  4HWI B;  4HB3 B;  1L4D B;  3H7S A;  1YJJ A;  1WYW B;  2GI9 A;  2C7N B;  3QWZ B;  2BYE A;  2E6X A;  4A6H A;  2LVQ A;  1MVK A;  3PLU A;  1M94 A;  2M0A A;  2B3A A;  2MBQ A;  4K7U A;  2ROZ B;  1WGH A;  3U7Z A;  4AQ7 A;  3LXF A;  2J7Q B;  1E7P B;  5G5H A;  3VXW A;  1HB8 A;  4AWJ A;  3CWI A;  3IAS 1;  4BBN C;  4NSW A;  4OVV A;  2ZJD A;  5D6J B;  2MQJ A;  2L2I A;  4WWO A;  5D3Y A;  1ZXI A;  3VAW A;  4XZ4 A;  4EEW A;  4Z2M B;  1XLO A;  1I7A A;  1KTK A;  3KQ4 A;  4ILH A;  2KWC A;  3QA8 A;  2WXR A;  3PLV A;  3ML8 A;  2V3P A;  2PMV A;  3B08 A;  1VZ8 A;  4LJP B;  4HHV A;  5J3Q A;  2M17 A;  2PVO D;  3P6A A;  3AE3 B;  3JW0 X;  3TJP A;  2G3Q B;  1E90 A;  1TTN A;  4IWO A;  1KJT A;  2AQ2 B;  3MC0 B;  3N20 C;  3BWU D;  2CRF A;  3MHS D;  2INP E;  1TY2 A;  1GB1 A;  4FJV B;  3V05 A;  2V9H A;  1D6E C;  1V5T A;  2R82 A;  5DCN A;  4BKT A;  2PPH A;  1ZSQ A;  3ULB A;  1Y8R C;  2WXG A;  2Z0D B;  4MK0 A;  3SBG A;  3NS8 A;  1V86 A;  2KUQ A;  2MH7 A;  2MBO A;  4DQO C;  4L6E A;  1ZKH A;  1WXM A;  3A8Q A;  2MCN B;  5E6J A;  2X0S A;  3PGE A;  2V3S A;  3VQI A;  1F0Z A;  2IYD B;  2WXJ A;  3ZRF A;  2DZJ A;  1RRP B;  1N3H A;  1N6Z A;  4MDK E;  3FKY A;  2ROV A;  5E6O A;  2COF A;  1HA5 A;  3QIJ A;  2RGF A;  2LYD A;  5D3D A;  4E74 A;  4K3C A;  1BWN A;  1ACC A;  1XXG A;  1J19 A;  3KVF B;  3BVM A;  1A70 A;  3C19 A;  4OW0 A;  4HRO A;  3DBH B;  3Q8A A;  1K51 A;  4H2A A;  4RGN A;  3H6N A;  2KNB A;  2MWN B;  4BBN F;  3RFZ B;  1WMH B;  4NPN A;  2Z14 A;  4JX1 C;  5C16 A;  5LG4 B;  2LGX A;  3DXD A;  2PLP A;  3EFC A;  4GB9 A;  2P0F A;  2DHZ A;  2FCM A;  2KDF B;  3DDC B;  1T77 A;  4WH4 A;  1FCL A;  1F9J A;  2IY1 B;  1RLF A;  3FEH A;  3FM8 C;  3APC A;  1YN5 A;  1HTQ A;  2GBR A;  2C5L C;  1EF1 A;  5DPW A;  2QJL A;  4GLS C;  3QHT A;  3Q69 A;  3APD A;  5EE1 A;  2WXH A;  5I2M A;  3UIP B;  3I5J C;  2DWQ A;  4IDI A;  1XO3 A;  1JRU A;  2I5F A;  1NVI D;  1I4P A;  2QMT A;  2E3T A;  1LQB A;  2KK8 A;  1S1Q B;  3NJT A;  2N23 A;  1U5D A;  2KMC A;  1OGW A;  1EGX A;  3LDZ E;  2GLS A;  3RI7 C;  2HD5 B;  4ICU A;  2W2W A;  2KIG A;  4G50 A;  4RNA A;  1WGU A;  1ZUD 2;  4GSW A;  2KC2 A;  2MWS B;  1HXY D;  3SHQ A;  2Z8L A;  2NBU A;  4ANU A;  3AU5 A;  2RPV A;  3IFW B;  2O6V A;  2BW2 A;  4ZRJ A;  3TEW A;  1J0W A;  2DYN A;  2BB6 A;  3FIL A;  2I38 A;  2XK5 B;  4US8 A;  5J17 A;  1OQY A;  2EMS A;  3NVV A;  3ZW3 A;  1FXI A;  1LXD A;  4AJW A;  4EZJ A;  3GE8 C;  3GOE A;  2ELB A;  1RRB A;  3CIR B;  3M63 B;  3RNG C;  1FXA A;  1SB3 C;  2YLM A;  2MLB A;  3TL5 A;  1I4H A;  2BYV E;  2FJU B;  1JW9 D;  2WXP A;  1V61 A;  3BVG A;  2D9Z A;  2GBM A;  2R61 A;  2D5G A;  1I7H A;  1CQV A;  1IRS A;  2DYQ A;  2G1E A;  1JWB D;  5AZF A;  2B76 B;  3L08 A;  3ABV B;  4KZC A;  3GP7 A;  4H8S A;  3Q3M C;  2IO3 B;  3E9L A;  4A20 A;  3AEF B;  1MIX A;  2AEH A;  4J3O D;  1MPH A;  3HK0 A;  1SEB D;  3T3N A;  4DX8 A;  1U5E A;  1TKE A;  1DGJ A;  3DVG X;  3AEB B;  2K8E A;  2BS2 B;  3RNB C;  1PYW D;  2BF8 B;  4HB2 B;  3WAL A;  1OQN A;  1Q67 A;  3CIK A;  2RR9 A;  4L1R A;  4EE2 A;  3MJ5 A;  4HDO A;  2WH5 A;  4C0A A;  2J0J A;  3QX1 A;  1WGQ A;  1VZ7 A;  2YS1 A;  4MM3 A;  1V2Y A;  3UIO B;  4HRS A;  5DHF B;  3O65 B;  2CHZ A;  5H92 C;  4C4V A;  1WF9 A;  1WI1 A;  4DHJ D;  2O2V B;  4WVF B;  4EOY A;  2MA9 B;  2KN4 A;  1RJ2 A;  2JU6 X;  2VH1 A;  4A55 A;  1FRR A;  3V3X A;  4BFR A;  1Q5W B;  2WXQ A;  2KAC A;  3A9J B;  2CHW A;  3PRE A;  3H7P A;  2N1V A;  2KTF A;  2L83 A;  2ZKM X;  2KCJ A;  2NMB A;  2D11 A;  4WJN A;  3NRZ A;  2Q13 A;  1OQQ A;  3N32 A;  4NAW B;  3HIE A;  3ZGZ A;  3SU8 X;  4YL8 A;  2DTC A;  4HK2 A;  1NI3 A;  4M02 A;  3HVZ A;  3ZNG C;  1VLB A;  2LGY A;  4PS3 A;  5IN7 A;  1L6U A;  1JRP A;  4XWX A;  1GB4 A;  1QLB B;  3MFG A;  2ZPY A;  1UGM A;  1FHO A;  4FAD A;  1YOV B;  5HFY A;  4FJZ A;  1P0R A;  2AQ1 B;  5J3Y A;  5D94 A;  2VZK B;  1H4R A;  4I6N B;  5AZH A;  2JX5 A;  4MSM B;  2RQ1 A;  5TSS A;  5KQ4 A;  1IBX A;  1FCC C;  5D3V A;  5C79 A;  1K8R B;  1J7B A;  2JWZ A;  4TKN A;  4M8M A;  2JRH A;  2LUM A;  4Z2N A;  3FC4 A;  2K8B A;  4S0R A;  1E7V A;  4RGT A;  4LNK A;  4LDT B;  4ZRQ A;  2KLC A;  1J7C A;  1WGD A;  4HPL B;  4CQN A;  1MG8 A;  3KH0 A;  3Q6B A;  5BYS A;  3ECI A;  3CXB B;  3NHE B;  5LON B;  4K2O A;  1WE7 A;  2INC C;  2OJR A;  1JWU D;  4P7I A;  1C1Y B;  2D2Q A;  1YX5 B;  5KQ1 A;  3H8H A;  4CO7 A;  5C5B A;  1NYR A;  2LWP A;  3NVY A;  4M0W A;  4KHB B;  2Z0Q A;  2IGH A;  4TQ1 A;  1AWE A;  3V6C B;  2N1W A;  1TS4 A;  2J53 A;  2WXO A;  3E56 A;  2PVG C;  2LD9 A;  2BVC A;  1T5X D;  3N30 A;  4GMX B;  3GZN B;  4JWS C;  2K6Q A;  4XGA B;  4DIX A;  1P9D U;  1UF0 A;  3N3K B;  4LNN A;  2RVB B;  5L95 C;  3TW1 A;  1YN3 A;  2I2Y A;  2KTR B;  2DKP A;  2X38 A;  1VJK A;  1AW7 A;  1L2N A;  1FGY A;  2KFK B;  3FAH A;  4JWU C;  3SDL C;  1V5M A;  2G35 A;  1WJ4 A;  2O6V B;  2COC A;  4MT7 A;  5H8Y E;  2Z59 A;  1UEF A;  2XBB C;  4CHJ A;  4IUM B;  3VFK A;  1CK1 A;  1L5P A;  2NBV A;  5CLL B;  1MHH E;  1OY2 A;  1HBK A;  4F7H A;  3A4S C;  3LB8 C;  2KOX A;  4WIP A;  1E6E B;  1KOT A;  3D32 A;  2OTX A;  1LM8 B;  3VTW A;  4D0N B;  1C78 A;  4ZHO A;  2LMC A;  2W9N A;  3KLS X;  4IM2 A;  4G0N B;  2KWV B;  3J9C A;  1LO5 D;  5D3X A;  2MJ3 A;  3TVV A;  1WGK A;  3PG7 A;  5D27 A;  2H89 B;  1XOD A;  1NEN B;  3TUO A;  1QT9 A;  2DHI A;  1TJE A;  4BKS A;  1JCK B;  4GDL B;  2WXK A;  4DDI D;  3BYY B;  2BWF A;  3AI5 A;  3VOQ A;  2MRP A;  2IBI B;  1U2B A;  2ONQ A;  1M7R A;  2IPK D;  5DPT A;  4HAW B;  1S3S G;  1WFY A;  1C3T A;  1DOX A;  4IC7 B;  4XDC A;  1G6J A;  3C0R B;  3JSV A;  2OHF A;  5C3J B;  4JKH A;  1C77 A;  1WGY A;  4PS7 A;  3ZNH B;  2COD A;  3UI3 A;  5IKC M;  1QOB A;  1KLV A;  3SNH A;  2LOX A;  1P7F A;  2ZVN A;  1UWM A;  5C2T B;  2KXJ A;  4XC2 A;  2HTH B;  2WGS A;  4GXB A;  2ON8 A;  2D9Y A;  1L6V A;  2L0T A;  2WXF A;  1E9M A;  4KV2 A;  1EWY C;  4JK9 A;  3FLV A;  4B95 A;  4WQM A;  4BOS C;  4US9 A;  1R4M I;  1KI1 B;  4W9K A;  2L3Z A;  3DXE A;  1GG3 A;  1STE A;  4M01 A;  4GDK B;  2WXI A;  2OED A;  2WDR B;  1EU3 A;  4Q2J A;  2ZCB A;  4JE3 B;  2L1C A;  1CJE A;  4UDU C;  1WZ3 A;  2K25 A;  1U4A A;  3HUI A;  4II2 B;  1V6E A;  4FBJ B;  2MBB B;  3U12 A;  2UZR A;  4B6H A;  4C7Z A;  2FJL A;  1L0X B;  3MPX A;  1KFY B;  2R0D A;  4WJO A;  1RFA A;  3A1Q B;  2KN5 A;  4IM0 A;  1UNR A;  2J42 A;  4TQ0 A;  4EKU A;  3NWD A;  1TS2 A;  3KWL A;  4GZU A;  2LGD A;  2MKR A;  2WXM A;  4B0E A;  1NEK B;  1X1M A;  4D2K A;  3VUY A;  4A6F A;  2FAZ A;  3E9O A;  5J3T A;  3DBL I;  4HJG E;  2CJO A;  1XQQ A;  2UU7 A;  5M4Y B;  2K5P A;  3NVW A;  1KZ7 A;  1EO6 A;  1V1P A;  3WIM A;  5DHA B;  1WX7 A;  1FD6 A;  3ENB A;  4JKB A;  3I57 A;  2KR0 A;  3SFD B;  1IP9 A;  3HM6 X;  3AE8 B;  4XE0 A;  2MDX A;  4NY0 A;  4JL9 A;  1X1G A;  4A8X C;  1F1H A;  2D9W A;  2AL3 A;  2ZZP B;  3R8B A;  4GN1 A;  2WX0 A;  2LVO A;  3E9S A;  3L4P A;  1Q0W B;  4XWW A;  3VUW A;  4A5K A;  3ML4 A;  5G2N A;  4FJY A;  4S17 A;  2MJD A;  1UUP A;  2PEA A;  3GE3 C;  3VVW B;  4XX5 A;  2NZ8 B;  4JLC A;  1XCG A;  3WCQ A;  3L16 A;  2OOB B;  1WI0 A;  4DBG A;  2YF0 A;  3VDZ A;  1FFV A;  5CX3 A;  4C7Y A;  1D5X C;  4MSQ B;  4OZC A;  2C60 A;  1MK9 B;  1WJM A;  1UEL A;  1EWC A;  1UBQ A;  2MP2 B;  3A9K B;  3RUI B;  4DX9 0;  3VTU A;  2GB1 A;  1WX8 A;  3KY9 A;  4B6W A;  5BMG A;  4ZRP A;  2WS3 B;  1BT0 A;  1MG4 A;  2ASQ A;  3HVD A;  2LUE A;  1U5G A;  1L0Y B;  1NYQ A;  1TGZ B;  3JYU A;  3ZJT A;  4JK7 A;  2M14 A;  2BYT A;  2BWE S;  4LNI A;  4NZL B;  3P63 A;  4RGM A;  3NZU A;  2GS0 A;  3P4Q B;  4W9E A;  1J0G A;  1FHW A;  1OTR B;  2Y5B B;  3HW2 B;  3NSU A;  4ITK A;  4HJK A;  1RYJ A;  2ABD A;  4A6K A;  2V3N A;  2BTE A;  3SYX A;  2DKQ A;  3GS2 A;  2HRJ A;  3UQA A;  3EGR A;  3AEG B;  2PTL A;  1WR1 A;  5CTR C;  3DHH C;  4RF0 A;  4IWQ A;  3VRB B;  2BKF A;  2ZW1 A;  2K6D B;  3ZQ4 A;  4EZL A;  3PVW A;  3DWG C;  1B1Z A;  3IHP C;  1AAR A;  1WWT A;  2VKI A;  1E10 A;  2DLW A;  1QIL A;  2VSZ A;  2E2X A;  2UWQ A;  1PFJ A;  2FCN A;  4DK5 A;  5HKH A;  3HHM A;  4MGK E;  2ZVO A;  2XNA C;  3MDB C;  2I1K A;  4TSS A;  4ANW A;  4TV3 A;  3T3O A;  1SBB B;  3VR9 B;  3HSA A;  4HAY B;  4WJ7 A;  4WAA A;  4K3B A;  1V89 A;  3BK1 A;  3B77 A;  1ZE3 D;  2RGN B;  1HTO A;  4KSL C;  5HE3 A;  2W3S A;  2VZK D;  2KQ4 X;  1V80 A;  2RDB C;  3AXC A;  5EFX A;  4W9J A;  4I6P A;  1N61 A;  1PGA A;  1E8W A;  3R2I A;  1W1D A;  4HB0 B;  3W1S C;  2J59 M;  3OG5 A;  4JKG A;  3RNE C;  2IGG A;  1Y5O A;  3AE9 B;  4LNO A;  2KIE A;  2IGD A;  3MC8 A;  1MK7 B;  4LDT D;  3AMZ A;  4CSQ A;  3M3J A;  4G3X B;  5I2S A;  4E71 A;  1PUT A;  3T9L A;  3SBT A;  5BMI A;  2INN E;  2HE7 A;  1MFW A;  3KUD B;  3UQB A;  3DBR I;  3ETR A;  1N5W A;  1OEY A;  3SO6 A;  3VH4 B;  1V88 A;  1PGB A;  4ARI A;  1Z2M A;  4HAZ B;  1YJI A;  4WUR A;  1F2R C;  5C6R A;  2NPT A;  3B0A A;  3P1M A;  1LB1 A;  4FN2 A;  2Z0P A;  1WXV A;  2IZV B;  4RGO S;  2LXA A;  1TIF A;  2EEL A;  1TBE A;  1UPQ A;  3DHI C;  1WG7 A;  2N9X A;  3NG0 A;  4JKE A;  5AEK B;  3RT3 B;  1GJZ A;  1K50 A;  1X05 A;  4KX6 B;  5EE0 A;  2FUH B;  4W9C A;  4MJS B;  2LKO A;  5JHH A;  2O6V D;  2GBN A;  3DCG A;  2M1M A;  4KIK A;  4KSK C;  3PP2 A;  3N1X C;  3RPF C;  3P7Z A;  1SIF A;  1XR0 B;  3HQC A;  2QCZ A;  4FHJ A;  2JZP A;  3BYT B;  2KJR A;  3URY A;  3OHM B;  1L7Y A;  3PHX B;  3KW5 B;  4K7S A;  4EMO A;  3ZDM C;  3ZIM A;  4MGI E;  5EE3 A;  5HG2 A;  3L13 A;  1ENF A;  3R3M A;  2Y5C A;  4C80 A;  3UIN B;  3RNC C;  2JYE A;  4HLE A;  2DX5 A;  2DX1 A;  1SF0 A;  5KHQ A;  3Q8C A;  2HJ8 A;  1TKG A;  4BBK A;  1WM3 A;  4JPS A;  5CHW A;  3ZO5 B;  3WA0 A;  2M8S A;  5KCV A;  2JT4 B;  1Q10 A;  1FRD A;  1WH3 A;  5FR3 A;  4RFB A;  1NVL A;  5D7G A;  1HB6 A;  1RM6 C;  2LHD A;  3P2B A;  1JWS D;  1ZDX A;  2JY6 A;  5E6N A;  4DHZ E;  1XCQ L;  2VRW B;  4LLG M;  1WZ0 A;  2C7M B;  1VD2 A;  2J4X A;  2G4S A;  3QK0 A;  4L2Y A;  3RNA C;  1SE9 A;  3ZDT A;  3Q3O C;  2BKR B;  2SEB D;  4K17 A;  3P4S B;  4QJ5 B;  1B55 A;  1WXS A;  2W3R A;  2BYF A;  4WQO B;  3OJ3 A;  3BK2 A;  5JP4 A;  2KMM A;  4HDQ A;  1D3Z A;  3VHT C;  4IFS A;  3M95 A;  2IY0 B;  3EC8 A;  3ALB A;  3EEC A;  5BMH A;  1BXT A;  1EAZ A;  1I42 A;  2LHE A;  2WYQ A;  1ZPS A;  3JVZ X;  1J8C A;  2NS5 A;  4LK0 M;  1JDE A;  3A8P A;  1EU4 A;  2XQN M;  1Y19 B;  2Y7B A;  2LJ5 A;  5BYR A;  3RZF A;  4BZA A;  3EHV A;  3MC9 A;  1I4G A;  2YVC A;  1KH0 A;  3R66 C;  1IYF A;  1YNT E;  2LOZ A;  3QQ8 B;  1N62 A;  2KZR A;  4M8N A;  1CZP A;  2IO1 B;  2G9H D;  1WR6 E;  1Z87 A;  4IAP A;  4NJ6 A;  1J7A A;  3K9P B;  2Z4D A;  1UNP A;  3WAP A;  3D8E A;  2CU1 A;  3DCX A;  4GNK B;  5GOW B;  3AE4 B;  1V9J A;  2FID A;  3PRZ A;  4MH8 A;  3B2F A;  3RN9 C;  3PZ7 A;  1E0Z A;  1WVH A;  4YTM B;  4MAC A;  1YX6 B;  4OT1 A;  2H7D A;  2CU3 A;  5JHB A;  1SE4 A;  1R7S A;  4LNF A;  4N59 A;  2K9X A;  1TS5 A;  3MHZ A;  2AL6 A;  3ZNI D;  3APF A;  3NOB A;  1ZC3 B;  5DPS A;  2KGX B;  3TEX A;  3ZTC A;  3BY4 B;  4NJC A;  2IO2 B;  5CHV C;  2YEP F;  1LW3 A;  1XEE A;  1MKE A;  1OEY J;  3ZTD A;  1A5R A;  1H8C A;  1HZ5 A;  2QEJ C;  2WLB A;  2V1Y A;  3AEA B;  2BT6 A;  3AM9 A;  4GIV A;  5LNK 1;  2COA A;  4ZYN A;  2OQB A;  3ZVV A;  3C8Y A;  2REX A;  2FIF A;  1KM7 A;  2JQR B;  2DYO A;  3L10 B;  3ODO A;  3PSE B;  1SE2 A;  2N7D A;  2BGF A;  3EPY A;  3ENE A;  2JSV X;  2K2U A;  3O13 A;  4WWN A;  1WJN A;  2COP A;  3W5U B;  3SD5 A;  4YWG G;  2K0P A;  2CR5 A;  1X86 A;  2D3B A;  1FFU A;  1D4B A;  4HAU B;  2JPH A;  3DVN V;  1R4M B;  1QC6 A;  2IYB A;  4D6W A;  1FB8 A;  1R4N I;  2AQ3 B;  1ET9 A;  4C00 A;  3NUH B;  3BJI A;  4R3D A;  1M4V A;  1QOA A;  4KKJ A;  4L1B A;  2RNR B;  2YT0 A;  4HEA 1;  1MAI A;  1FMA D;  1YQ4 B;  3KRW A;  1WX9 A;  5DH9 B;  1FNW A;  2X8X X;  2WWZ A;  3EUB 2;  1LFD A;  1I35 A;  1K52 A;  4W9F A;  3B2G A;  3SFE B;  3PT2 B;  1Z5S B;  3N7C A;  5I4D A;  1RAX A;  5E6P A;  4CHM A;  2CB8 A;  1BAK A;  2RRF A;  1WGG A;  3VH3 B;  3BVZ A;  1NTI A;  2D07 B;  5HI1 A;  1P98 A;  3FIL B;  1WSP A;  3IT4 B;  4DXA B;  3M1I B;  1UBI A;  2PZ1 A;  3DHG C;  2PIA A;  3P42 A;  2LGI A;  2WU5 B;  2UZS A;  3R2T A;  2KDE B;  5EDS A;  2KVR A;  2KLG A;  2KO3 A;  5JVL A;  4RCO A;  3MTN B;  3DBL B;  3PHW B;  2FNJ B;  3Q8B A;  4RH6 A;  4A90 A;  2FUG 1;  4YSY B;  3BII D;  2D10 A;  4CYE A;  5LLI A;  1C4C A;  4YSZ B;  4ICV A;  4MH0 E;  1C4A A;  3P4R B;  1WRD B;  2KWD A;  2DN6 A;  1I2H A;  2I1J A;  3ML9 A;  1WY8 A;  4MGY E;  4ACF A;  3NW8 A;  1YD8 U;  3OJ4 B;  1OQR A;  5J2R A;  1GUA B;  4BKS D;  2D3G A;  2RSU A;  1T0Y A;  4USA A;  3ZXR A;  1WJ1 A;  2R09 A;  2FCS A;  1Y56 A;  2OJW A;  3DWM A;  5JLJ B;  1I4Q A;  1FNV A;  2X18 A;  2D9V A;  2Y8G A;  2FBW B;  4XYC A;  2K39 A;  1GC7 A;  3N1Z C;  4F7Z A;  2V4I B;  2KMA A;  2RUK B;  3PRM B;  2MJE A;  1KC7 A;  2EKI A;  4KGR A;  1UD7 A;  2I5C A;  1KF6 B;  1IGC A;  4K81 A;  3TO1 A;  4YTN B;  3KRX A;  3DOW A;  1SGH A;  2FCQ A;  4YT0 B;  4MM3 B;  5D3I B;  1CMX B;  2EC1 A;  2YS3 A;  2KHW B;  4LCD E;  1QF6 A;  4HPP A;  4WWM A;  1QOG A;  2RLO A;  1WXQ A;  1W1H A;  1P1A A;  2K22 A;  3A58 A;  4C4V B;  1WMH A;  4HAX B;  5LXI B;  3PPA A;  1YMH E;  2Z0O A;  2KX0 A;  3UZT A;  5JZE B;  2L1A A;  3BZD B;  3DVN U;  1V81 A;  1C76 A;  2LRU A;  4KGS A;  2M4N A;  3H7P B;  4KZ0 A;  3AE7 B;  3TSS A;  2WDT B;  1DOY A;  1U5F A;  1Q1O A;  1SJH D;  2QIL A;  2WU2 B;  4K2P A;  5JHG A;  3M62 B;  4MEL A;  4EZK A;  4L23 A;  1IGD A;  5EE9 A;  4ILJ A;  4G11 A;  2PE6 B;  4ANX A;  3KSY A;  1V97 A;  2CS4 A;  4N9F 4;  3SEB A;  3X23 A;  2Y5P A;  3V62 A;  3KWV A;  1TZO A;  3IVF A;  1TT5 B;  3ZJV A;  2AX5 A;  4MT5 A;  2A5U A;  2C7H A;  3GB1 A;  1NU2 A;  3E66 A;  2W54 A;  3TEZ A;  1V5O A;  5IJM A;  1K53 A;  1ZW7 A;  3TMP B;  1IBX B;  1T0Q C;  3Q8F A;  5DIF B;  3MJW A;  2MFQ A;  4ZRI A;  1WE6 A;  3PEG A;  1ZOY B;  4MGZ E;  1HZ6 A;  1H10 A;  1UGJ A;  1KRH A;  2KJ6 A;  3AH7 A;  3U8Z A;  3G9W A;  5G5G A;  4GOC A;  2K8H A;  2GBJ A;  4BOZ B;  1HEZ E;  2LGS A;  2JXT A;  3VR8 B;  1IPG A;  4RF1 A;  1VZ6 A;  2K2J A;  3OAN A;  2LJI A;  2ACZ B;  2XK5 A;  2L32 A;  5IOI A;  2LVP A;  5FK9 C;  2C9W B;  3WYF B;  5BO4 B;  5GMV A;  2J52 A;  2YS5 A;  3DBS A;  3Q3N C;  1EF5 A;  2IJ0 A;  4DDG D;  5C5B B;  4HSI A;  4M0W B;  1FM0 D;  1XCT L;  1PMS A;  1ZC4 B;  3MP9 A;  2KWU B;  5D2M B;  3NWF A;  1KLG D;  3PZ8 A;  4ASW C;  2MHJ A;  5DI9 B;  2MX2 A;  4ZRK A;  4OZB A;  1XD3 B;  3R7R A;  3L17 A;  4PT5 A;  5IO9 A;  2LZ6 A;  3AUL A;  4PYU A;  3RD2 A;  4KDL B;  2CKH B;  2L8J A;  2BS3 B;  4A3O A;  2LFI A;  1VBH A;  3D8F A;  3VRA B;  4XDD A;  2AYO B;  1BTK A;  1E5W A;  2LAS A;  3VUX A;  1EVH A;  3DBR B;  1UWX A;  4PNK A;  1FO4 A;  4TYZ A;  2QKL A;  2JF5 A;  1DDW A;  2CHX A;  4P6V F;  4F1S A;  3ZJU A;  3B9J A;  2Z59 B;  4KVG B;  2NTS A;  2N9L A;  2KDM A;  4HCN B;  3LJU X;  1JML A;  4JKD A;  2NBV B;  3KUC B;  4JKF A;  2GJY A;  1VCB A;  3AEE B;  4HAT B;  1ZVR A;  2ADZ A;  4NQL B;  2DZI A;  4NQK E;  1RFK A;  2N4F A;  5AZG A;  4ZYS A;  4HXD A;  3H9D A;  2DNF A;  1U27 A;  1WJU A;  1WXA A;  1YIW A;  1ISN A;  3I9V 1;  2XN9 C;  4A6Q A;  2NMQ A;  4DBB A;  3Q3F A;  4GPT B;  2M38 A;  1E8Z A;  1GGO A;  3NZ3 A;  5FKA C;  3FVC A;  1KBL A;  4YXD B;  3T8M A;  2VH2 A;  2R2Q A;  3QWM A;  5LOP B;  4A3P A;  2O2V A;  4NJ7 A;  3L0W B;  5MPO A;  5KHO A;  4FUL A;  2FE8 A;  2N9E B;  4RMA A;  3A9J A;  4KKI A;  2M0X A;  3W1Y A;  2D4Q A;  2RDG A;  3JSV B;  5JHA A;  3B1L X;  1ESF A;  3F5R A;  3HIZ A;  4K1R B;  4FA6 A;  2DA0 A;  4OZA A;  1MIZ B;  2L76 A;  1VDV A;  3H1U A;  1L4Z B;  4NAW A;  3WAM A;  3GYP A;  2KAJ A;  2KKC A;  3NY5 A;  1BML C;  5FI1 A;  2DLB A;  4K7W A;  5CLQ B;  4W9I A;  5IRS A;  3IBE A;  4F7U P;  2QKM A;  1D5M C;  2EKE C;  4HCP B;  3QAQ A;  2DFK A;  1FEH A;  2MSE D;  1T0S C;  3IT6 B;  2M19 A;  4PS8 A;  1T6B X;  2DAJ A;  2Z0E B;  4YTP B;  3W5V B;  5L83 A;  2N0S B;  3AE2 B;  1TS3 A;  4IG7 B;  1FPY A;  4HKQ A;  2JP2 A;  2QC8 A;  3AB5 A;  3DPD A;  3U52 E;  2W82 A;  3U4E G;  2BCJ A;  2N0Y A;  2XEW A;  2JZ3 B;  4IOY X;  2ICI A;  2PE9 A;  3ZLZ A;  3E9P A;  3OLM D;  1AWD A;  3CSF A;  2BQQ A;  2GBK A;  1FHX A;  3LYY A;  3V60 A;  4MEM A;  1KLU D;  2KDB A;  4WJP A;  2D3C A;  4KDI C;  3AU4 A;  4FHK A;  4AUQ C;  1DDM A;  1T3Q A;  5IA7 A;  3DXC A;  2A4Z A;  3RMK C;  2R2Y A;  1YQB A;  2WDV B;  3CF6 E;  3PRP B;  3QJZ A;  4KHB A;  4WAF A;  2P8V A;  2G4D B;  2NCN A;  1AYF A;  1D5Z C;  2PKO A;  3PSC A;  2IDY A;  2SAK A;  1QQG A;  4A6F B;  4P1B C;  2YT1 A;  3RCP A;  2DZM A;  4WJQ A;  4HAV B;  2DYB A;  5GXG B;  4IM3 A;  1V8C A;  2LI5 A;  3ODX A;  1VR9 A;  2ZPN A;  3Q14 C;  5JH5 C;  1V1P B;  2CQU A;  4J6I A;  3RCZ A;  4B9K A;  2Y3A A;  1ZYI A;  1PLS A;  3N9Y C;  2KTR A;  3AEC B;  1KZG A;  3TFM A;  2KFK A;  2ZNV B;  3IAM 1;  2CAY A;  3SUZ A;  3ONS A;  2DIK A;  2L05 A;  1TKY A;  2BPS A;  4PYZ A;  2WXN A;  1YJ1 A;  3K9O B;  4XWT A;  2UYZ B;  4IOI E;  3U7D A;  2MBE A;  2K8C A;  2KUP A;  2YSZ A;  4ARC A;  1GNU A;  1P5T A;  2WQY B;  5HE1 A;  1JWM D;  4IKG A;  1MHX A;  2IO0 B;  3W1S A;  1I4R A;  4ZHP A;  1XLP A;  4FLH A;  1TQZ A;  3U30 A;  2YT2 A;  4QAY A;  3S2A A;  1N60 A;  4KAX B;  2GOW A;  1B9R A;  1NBF C;  1V5U A;  2BB5 A;  3PS6 A;  1VBG A;  2N7J A;  1VRA B;  3X0W A;  1UNQ A;  4GDL A;  2MW5 A;  1P7E A;  5TR5 A;  3EA6 A;  2HTM E;  2DHK A;  3DBH I;  3RNF C;  4BKG A;  1V49 A;  2EJ8 A;  1V5P A;  1XLN A;  1FAO A;  2KYW A;  4WSF A;  3IG3 A;  2FDQ A;  3AJ4 A;  2LRW A;  3TCA A;  1SHC A;  1TYG B;  1R4N B;  1AN8 A;  1F77 A;  1MPE A;  1XF5 L;  2DHJ A;  2LG1 A;  1YN4 A;  3ZNZ B;  4FXC A;  4DWF A;  5IAA C;  1V1O A;  2WHI A;  3NVZ A;  1XT9 B;  1MI0 A;  4KHO A;  2CY4 A;  2HTH A;  1PQS A;  4W9D A;  2D3A A;  4RM8 A;  4W9G A;  2CY5 A;  1XKE A;  1FOE A;  3UGB B;  3PO0 A;  1JRO A;  2NBW B;  2V0G A;  1UZX B;  1FNU A;  1FGZ A;  2WDQ B;  2LUL A;  1L0V B;  3WAO A;  4II3 B;  4ZDV A;  3GYO A;  1NTY A;  1WM2 A;  4CHK A;  4TUU A;  3SR6 A;  3ZVR A;  5AUK A;  2NVU I;  4GGQ A;  3W9C B;  5FR6 A;  4GDK A;  2L0F A;  3NS1 A;  1DYN A;  1E8Y A;  2WXL A;  4IW0 A;  4ILG B;  1DRO A;  3EFU A;  1GOZ A;  3ZRC A;  2MEK A;  1IUE A;  2JYT A;  2ELA A;  1TXD A;  2AWT A;  2KJH B;  5DPR A;  5BYQ A;  1N63 A;  4JKA A;  2YRY A;  4REZ A;  4TMA B;  4P1C C;  2W2X C;  3RYT A;  1C4P A;  3A1Q A;  3DVG Y;  1EM7 A;  2GCL A;  4BVU C;  2GUM A;  2IND C;  4E3C A;  1YQ3 B;  2KD0 A;  2V76 A;  1FIQ A;  3CST A;  1ZP0 B;  2RDH A;  4HVB A;  2PW9 A;  1WGR A;  4JIO U;  4B0M A;  1UPR A;  4JK8 A;  2DYM A;  4KGT A;  4RM9 A;  2CJN A;  4JKG B;  1DYQ A;  2QHO A;  4I6L B;  1C9F A;  4DHZ B;  4W9H A;  4QJ4 B;  1XLQ A;  1W1G A;  1NDD A;  3PTF C;  2PJH A;  3V61 A;  1T0R C;  1F52 A;  4AJY B;  1GAQ B;  3O96 A;  2L00 B;  1JWA D;  3KYC D;  3L54 A;  2K1F A;  1DDV A;  3RZW C;  2J0M A;  2KT7 A;  4OVZ A;  2QIE B;  1QOF A;  2KQ7 A;  1P6S A;  1ST7 A;  5LXH A;  2LEK A;  2JZZ A;  3I3T B;  5IP4 D;  4AS1 A;  2UVM A;  4OSN A;  1ACA A;  2P0D A;  4EJN A;  2LXC A;  3KYD D;  2D9X A;  4DXG A;  4O1N A;  4F7G A;  1UNS A;  5HHD G;  2M56 B;  1NI2 A;  2K00 A;  2N7E A;  1QKZ A;  2QSD A;  3SV1 A;  3DQV A;  3KUZ A;  5G55 A;  1ZM0 A;  1E8X A;  3ODW A;  2NPT B;  2W55 A;  2LBB A;  2WX1 A;  1JAL A;  2H88 B;  1GC6 A;  3KZ1 A;  2DZK A;  3AE5 B;  2KQS A;  1DBH A;  1TZ1 A;  1K5G B;  2N9K A;  4X57 B;  2JVC A;  2HDE A;  4N58 A;  1MJD A;  2W2X D;  2Y8F A;  1X1F A;  2MP2 A;  3A9K A;  3ZUN A;  1EUV B;  2Z13 A;  1N5X A;  1SSN A;  2KC1 A;  3QC8 B;  2TSS A;  1M7E A;  4KIK B;  1WYG A;  4DXF A;  1SIJ A;  2L52 A;  3AED B;  2GRI A;  2IFS A;  3A4R A;  5C23 A;  1AQC A;  1X11 A;  5CHF A;  2G45 B;  4GU2 A;  1PDX A;  5D3W A;  1RWS A;  4WWP A;  1QQR A;  5AUI A;  2EMT A;  1NTV A;  3ULC A;  2DX5 B;  2KVZ A;  5HE2 A;  1TY0 A;  2JXX A;  4HPM B;  4HKZ E;  2ZEQ A;  3QBV B;  4PQ0 A;  2GMI C;  2HJ1 A;  2QDF A;  3Q8E A;  1I4X A;  3FSS A;  3T06 A;  1SE3 A;  1ET6 A;  4QXA B;  2DBY A;  2JUO A;  4ZOH C;  2R2O A;  5C1Z A;  4JGH B;  1XX0 A;  2KDI A;  1K5D B;  2GCJ A;  4BAX A;  2L7R A;  2ZW0 A;  1WIA A;  3IXS A;  1ZGU B;  3QAR A;  4ANV A;  2KX3 A;  4GOU A;  2NTT A;  1UH6 A;  3N1Y C;  1QZE A;  2BS4 B;  1HQR D;  3AV8 A;  1WRI A;  4PK1 A;  3AE6 B;  2H7E A;  4JKC A;  4NAM A;  2V4L A;  1BUI C;  3LJ3 A;  2RSG A;  1OMW A;  1SXT A;  1ZXH A;  1OFF A;  2ZNV C;  3R7Q A;  1DIK A;  4HB4 B;  1GPX A;  1FXT B;  1PFD A;  2WP9 B;  4OHJ A;  4Y94 A;  1ZDV A;  3PZD A; 
#chains in the Genus database with same CATH homology
 1P3Q U;  2RD0 A;  3RUL A;  4NNJ B;  4F8C B;  4MY6 A;  4DHJ B;  4EFO A;  3PV1 A;  4KHA A;  3PVL A;  5HE0 A;  3V6E B;  2DAF A;  3Q3J A;  2VRR B;  3GZN I;  3A98 B;  3FP5 A;  4OVU A;  4W9L A;  3D8D A;  5L81 A;  2FJ9 A;  3CMM B;  1XD4 A;  1WJ6 A;  2MBH A;  4URK A;  3VIA A;  5J18 A;  1HE8 A;  3UF8 A;  3PVU A;  2J0K A;  3NZS A;  1U29 A;  2DEN B;  2N9P C;  4YON A;  3WAN A;  1E7U A;  1BTN A;  3A33 B;  5FI0 A;  4AOF A;  2KAN A;  2RPQ A;  3V5W A;  1TJ6 A;  4EUT A;  1P3R A;  4MJS A;  4JQW C;  3BIN A;  4LJO B;  3TIX A;  2JRI B;  3VTV A;  4GMV A;  2ZCC A;  2KFJ A;  3F0W A;  3TBL D;  4IWP A;  3OAW A;  2P0H A;  3HM3 A;  3ZKJ C;  2NR2 A;  4AP4 C;  3QCA A;  4HWI B;  4HB3 B;  3H7S A;  1WYW B;  2C7N B;  3QWZ B;  2BYE A;  4A6H A;  2LVQ A;  3PLU A;  1M94 A;  2B3A A;  2MBQ A;  4K7U A;  2ROZ B;  1WGH A;  2J7Q B;  3VXW A;  1HB8 A;  4AWJ A;  4BBN C;  4NSW A;  4OVV A;  2ZJD A;  5D6J B;  2MQJ A;  2L2I A;  4WWO A;  5D3Y A;  3VAW A;  4XZ4 A;  4EEW A;  4Z2M B;  1I7A A;  4ILH A;  2KWC A;  3QA8 A;  3PLV A;  3ML8 A;  3B08 A;  4LJP B;  4HHV A;  5J3Q A;  2M17 A;  3JW0 X;  3P6A A;  3TJP A;  2G3Q B;  1E90 A;  1TTN A;  4IWO A;  1KJT A;  2CRF A;  3MHS D;  4FJV B;  1V5T A;  2R82 A;  5DCN A;  4BKT A;  2PPH A;  1ZSQ A;  3ULB A;  1Y8R C;  2Z0D B;  4MK0 A;  3SBG A;  3NS8 A;  1V86 A;  2MBO A;  4L6E A;  1ZKH A;  1WXM A;  3A8Q A;  2MCN B;  2X0S A;  3PGE A;  2V3S A;  3VQI A;  2IYD B;  3ZRF A;  2DZJ A;  1RRP B;  1N3H A;  4MDK E;  2ROV A;  5E6O A;  2COF A;  3QIJ A;  2RGF A;  2LYD A;  4E74 A;  1BWN A;  1J19 A;  3KVF B;  3H6N A;  2KNB A;  2MWN B;  4BBN F;  1WMH B;  4NPN A;  5C16 A;  2LGX A;  3DXD A;  4GB9 A;  2P0F A;  2DHZ A;  2FCM A;  2KDF B;  3DDC B;  1F9J A;  2IY1 B;  1RLF A;  3FEH A;  3FM8 C;  3APC A;  2GBR A;  2C5L C;  1EF1 A;  5DPW A;  3QHT A;  3APD A;  3UIP B;  1JRU A;  2I5F A;  1LQB A;  2KK8 A;  1S1Q B;  2N23 A;  1U5D A;  2KMC A;  1OGW A;  1EGX A;  3LDZ E;  2HD5 B;  4ICU A;  2W2W A;  4G50 A;  1WGU A;  4GSW A;  2KC2 A;  2MWS B;  3SHQ A;  4ANU A;  2NBU A;  3AU5 A;  3IFW B;  2O6V A;  4ZRJ A;  1J0W A;  2DYN A;  2XK5 B;  5J17 A;  1OQY A;  2EMS A;  3ZW3 A;  1LXD A;  4AJW A;  4EZJ A;  3GOE A;  2ELB A;  1RRB A;  3M63 B;  2YLM A;  2MLB A;  3TL5 A;  2BYV E;  1V61 A;  2D9Z A;  2GBM A;  1IRS A;  2DYQ A;  5AZF A;  3L08 A;  4KZC A;  4H8S A;  2IO3 B;  3E9L A;  4A20 A;  1MIX A;  2AEH A;  1MPH A;  3HK0 A;  4DX8 A;  1U5E A;  3DVG X;  2BF8 B;  4HB2 B;  3WAL A;  1OQN A;  1Q67 A;  3CIK A;  2RR9 A;  4HDO A;  2WH5 A;  4C0A A;  2J0J A;  3QX1 A;  1WGQ A;  2YS1 A;  4MM3 A;  1V2Y A;  3UIO B;  5DHF B;  3O65 B;  2CHZ A;  1WF9 A;  1WI1 A;  4DHJ D;  2O2V B;  4WVF B;  4EOY A;  2MA9 B;  1RJ2 A;  4BFR A;  1Q5W B;  3A9J B;  3PRE A;  2CHW A;  3H7P A;  2N1V A;  2KTF A;  2KCJ A;  2NMB A;  2D11 A;  4WJN A;  2Q13 A;  3N32 A;  4NAW B;  3SU8 X;  4YL8 A;  2DTC A;  4HK2 A;  3ZNG C;  2LGY A;  4PS3 A;  4XWX A;  2ZPY A;  1UGM A;  1FHO A;  4FAD A;  4FJZ A;  1P0R A;  5J3Y A;  5D94 A;  1H4R A;  4I6N B;  5AZH A;  4MSM B;  2RQ1 A;  5KQ4 A;  5D3V A;  5C79 A;  1K8R B;  2JWZ A;  4TKN A;  4M8M A;  2JRH A;  4Z2N A;  2K8B A;  1E7V A;  4LDT B;  2KLC A;  1WGD A;  4HPL B;  1MG8 A;  3KH0 A;  3ECI A;  3CXB B;  3NHE B;  5LON B;  4K2O A;  1WE7 A;  2OJR A;  4P7I A;  1C1Y B;  2D2Q A;  1YX5 B;  5KQ1 A;  4CO7 A;  5C5B A;  2LWP A;  4KHB B;  2Z0Q A;  4TQ1 A;  1AWE A;  3V6C B;  2N1W A;  2LD9 A;  3N30 A;  4GMX B;  2K6Q A;  1P9D U;  3N3K B;  2RVB B;  5L95 C;  3TW1 A;  2KTR B;  2DKP A;  1L2N A;  1FGY A;  2KFK B;  3SDL C;  1V5M A;  2G35 A;  1WJ4 A;  2O6V B;  2COC A;  4MT7 A;  1UEF A;  2XBB C;  4CHJ A;  4IUM B;  3VFK A;  5CLL B;  1OY2 A;  1HBK A;  4F7H A;  3A4S C;  2KOX A;  1KOT A;  3D32 A;  2OTX A;  1LM8 B;  3VTW A;  4D0N B;  2W9N A;  4IM2 A;  4G0N B;  2KWV B;  5D3X A;  3TVV A;  3PG7 A;  5D27 A;  1XOD A;  2DHI A;  4BKS A;  4GDL B;  4DDI D;  2BWF A;  3AI5 A;  3VOQ A;  2MRP A;  2IBI B;  1U2B A;  1M7R A;  5DPT A;  4HAW B;  1S3S G;  1WFY A;  1C3T A;  4IC7 B;  1G6J A;  3C0R B;  3JSV A;  4JKH A;  1WGY A;  4PS7 A;  3ZNH B;  2COD A;  1KLV A;  3SNH A;  2LOX A;  2ZVN A;  2KXJ A;  4XC2 A;  2HTH B;  4GXB A;  2D9Y A;  2L0T A;  4KV2 A;  4JK9 A;  3FLV A;  4B95 A;  4BOS C;  1R4M I;  1KI1 B;  4W9K A;  2L3Z A;  3DXE A;  1GG3 A;  4GDK B;  2ZCB A;  2L1C A;  1WZ3 A;  2K25 A;  1U4A A;  4II2 B;  1V6E A;  4FBJ B;  2MBB B;  2UZR A;  4B6H A;  2FJL A;  3MPX A;  2R0D A;  4WJO A;  1RFA A;  3A1Q B;  2KN5 A;  4IM0 A;  1UNR A;  4TQ0 A;  4EKU A;  4GZU A;  2LGD A;  2MKR A;  1X1M A;  3VUY A;  4A6F A;  2FAZ A;  3E9O A;  5J3T A;  3DBL I;  1XQQ A;  1KZ7 A;  1EO6 A;  3WIM A;  5DHA B;  1WX7 A;  3ENB A;  4JKB A;  1IP9 A;  3HM6 X;  2MDX A;  4NY0 A;  4JL9 A;  1X1G A;  2D9W A;  2AL3 A;  2ZZP B;  4GN1 A;  2WX0 A;  2LVO A;  1Q0W B;  3VUW A;  4A5K A;  3ML4 A;  5G2N A;  4FJY A;  2PEA A;  3VVW B;  4XX5 A;  2NZ8 B;  4JLC A;  1XCG A;  3L16 A;  2OOB B;  1WI0 A;  4DBG A;  2YF0 A;  3VDZ A;  5CX3 A;  4MSQ B;  2C60 A;  1MK9 B;  1WJM A;  1UEL A;  1UBQ A;  2MP2 B;  3A9K B;  3RUI B;  4DX9 0;  3VTU A;  1WX8 A;  3KY9 A;  4B6W A;  1BT0 A;  2ASQ A;  2LUE A;  1U5G A;  1TGZ B;  3JYU A;  4JK7 A;  2M14 A;  2BWE S;  3NZU A;  2GS0 A;  4W9E A;  1J0G A;  1FHW A;  1OTR B;  2Y5B B;  3HW2 B;  3NSU A;  4HJK A;  2ABD A;  4A6K A;  3SYX A;  2DKQ A;  2HRJ A;  3UQA A;  1WR1 A;  5CTR C;  4IWQ A;  2BKF A;  2K6D B;  4EZL A;  3PVW A;  3IHP C;  1AAR A;  2VKI A;  2DLW A;  2VSZ A;  2E2X A;  2UWQ A;  1PFJ A;  2FCN A;  4DK5 A;  5HKH A;  3HHM A;  4MGK E;  2ZVO A;  3MDB C;  2I1K A;  4ANW A;  4TV3 A;  4HAY B;  4WJ7 A;  4WAA A;  1V89 A;  2RGN B;  4KSL C;  5HE3 A;  1V80 A;  3AXC A;  5EFX A;  4W9J A;  4I6P A;  1E8W A;  1W1D A;  4HB0 B;  3W1S C;  2J59 M;  4JKG A;  1Y5O A;  1MK7 B;  4LDT D;  3M3J A;  4G3X B;  4E71 A;  3T9L A;  3SBT A;  2HE7 A;  3KUD B;  3UQB A;  3DBR I;  1OEY A;  3SO6 A;  3VH4 B;  1V88 A;  1Z2M A;  4HAZ B;  5C6R A;  2NPT A;  3B0A A;  1LB1 A;  4FN2 A;  2Z0P A;  1WXV A;  2IZV B;  2LXA A;  1TBE A;  1UPQ A;  1WG7 A;  2N9X A;  4JKE A;  5AEK B;  3RT3 B;  1GJZ A;  1X05 A;  2FUH B;  4W9C A;  4MJS B;  2LKO A;  5JHH A;  2O6V D;  2GBN A;  3DCG A;  2M1M A;  4KIK A;  4KSK C;  3PP2 A;  3P7Z A;  1SIF A;  1XR0 B;  3HQC A;  4FHJ A;  2KJR A;  1L7Y A;  3PHX B;  3KW5 B;  4K7S A;  4EMO A;  3ZDM C;  3ZIM A;  4MGI E;  3L13 A;  3R3M A;  3UIN B;  4HLE A;  2DX5 A;  2DX1 A;  5KHQ A;  2HJ8 A;  4BBK A;  1WM3 A;  5CHW A;  3ZO5 B;  3WA0 A;  2M8S A;  5KCV A;  2JT4 B;  1WH3 A;  1NVL A;  5D7G A;  1HB6 A;  3P2B A;  5E6N A;  4DHZ E;  2JY6 A;  2VRW B;  1WZ0 A;  2C7M B;  1VD2 A;  2G4S A;  3QK0 A;  1SE9 A;  3ZDT A;  2BKR B;  4K17 A;  1B55 A;  1WXS A;  4WQO B;  2BYF A;  3OJ3 A;  5JP4 A;  4HDQ A;  1D3Z A;  3VHT C;  4IFS A;  3M95 A;  2IY0 B;  3EC8 A;  3ALB A;  3EEC A;  1I42 A;  1EAZ A;  2WYQ A;  3JVZ X;  1J8C A;  2NS5 A;  1JDE A;  3A8P A;  2XQN M;  1Y19 B;  2Y7B A;  2LJ5 A;  3RZF A;  3EHV A;  2YVC A;  3R66 C;  1IYF A;  2LOZ A;  3QQ8 B;  2KZR A;  4M8N A;  2IO1 B;  1WR6 E;  1Z87 A;  4IAP A;  4NJ6 A;  3K9P B;  1UNP A;  3WAP A;  3D8E A;  2CU1 A;  5GOW B;  1V9J A;  2FID A;  3PRZ A;  1WVH A;  1YX6 B;  2H7D A;  5JHB A;  2AL6 A;  3ZNI D;  3APF A;  3NOB A;  1ZC3 B;  5DPS A;  2KGX B;  3ZTC A;  3BY4 B;  2IO2 B;  5CHV C;  1LW3 A;  1MKE A;  1OEY J;  3ZTD A;  1A5R A;  1H8C A;  2V1Y A;  4GIV A;  2COA A;  4ZYN A;  2OQB A;  3ZVV A;  2REX A;  2FIF A;  1KM7 A;  2DYO A;  3L10 B;  3ODO A;  3PSE B;  2N7D A;  2BGF A;  3EPY A;  3ENE A;  2K2U A;  4WWN A;  1WJN A;  2COP A;  3SD5 A;  2CR5 A;  1X86 A;  4HAU B;  2JPH A;  3DVN V;  1QC6 A;  2IYB A;  1FB8 A;  1R4N I;  3BJI A;  2RNR B;  2YT0 A;  1MAI A;  3KRW A;  1WX9 A;  5DH9 B;  2WWZ A;  1LFD A;  1I35 A;  4W9F A;  3PT2 B;  1Z5S B;  3N7C A;  1RAX A;  5E6P A;  4CHM A;  2CB8 A;  1BAK A;  1WGG A;  3VH3 B;  1NTI A;  2D07 B;  1P98 A;  4DXA B;  3M1I B;  1UBI A;  2PZ1 A;  2UZS A;  5EDS A;  2KDE B;  2KVR A;  2KLG A;  2KO3 A;  5JVL A;  3MTN B;  3PHW B;  2FNJ B;  2D10 A;  4CYE A;  5LLI A;  4ICV A;  4MH0 E;  1WRD B;  2DN6 A;  1I2H A;  2I1J A;  3ML9 A;  1WY8 A;  4MGY E;  1YD8 U;  3OJ4 B;  5J2R A;  1GUA B;  4BKS D;  2D3G A;  2RSU A;  1T0Y A;  1WJ1 A;  2R09 A;  2FCS A;  5JLJ B;  2X18 A;  2D9V A;  2Y8G A;  2K39 A;  1GC7 A;  4F7Z A;  2KMA A;  2RUK B;  3PRM B;  1KC7 A;  1UD7 A;  2I5C A;  4K81 A;  3TO1 A;  3KRX A;  3DOW A;  1SGH A;  2FCQ A;  1CMX B;  2EC1 A;  2YS3 A;  2KHW B;  4LCD E;  2RLO A;  1W1H A;  1P1A A;  1WMH A;  4HAX B;  5LXI B;  3PPA A;  2Z0O A;  2KX0 A;  3UZT A;  5JZE B;  3DVN U;  1V81 A;  2LRU A;  2M4N A;  3H7P B;  4KZ0 A;  2WDT B;  1U5F A;  1Q1O A;  4K2P A;  5JHG A;  3M62 B;  4MEL A;  4EZK A;  4ILJ A;  4G11 A;  2PE6 B;  4ANX A;  3KSY A;  2CS4 A;  4N9F 4;  3X23 A;  3V62 A;  3IVF A;  2A5U A;  2C7H A;  1NU2 A;  3E66 A;  1V5O A;  5IJM A;  1ZW7 A;  3TMP B;  5DIF B;  3MJW A;  2MFQ A;  4ZRI A;  1WE6 A;  3PEG A;  4MGZ E;  1H10 A;  2KJ6 A;  3U8Z A;  3G9W A;  4GOC A;  2K8H A;  2GBJ A;  4BOZ B;  1IPG A;  2K2J A;  3OAN A;  2XK5 A;  2LVP A;  2C9W B;  3WYF B;  5BO4 B;  5GMV A;  2YS5 A;  3DBS A;  1EF5 A;  4DDG D;  5C5B B;  4M0W B;  1PMS A;  1ZC4 B;  2KWU B;  5D2M B;  4ASW C;  5DI9 B;  2MX2 A;  4ZRK A;  1XD3 B;  3R7R A;  3L17 A;  2LZ6 A;  3AUL A;  4PYU A;  3RD2 A;  4KDL B;  2CKH B;  2L8J A;  4A3O A;  1VBH A;  3D8F A;  2AYO B;  1BTK A;  1E5W A;  2LAS A;  3VUX A;  1EVH A;  4PNK A;  4TYZ A;  2QKL A;  2JF5 A;  1DDW A;  2CHX A;  4F1S A;  2Z59 B;  4KVG B;  4HCN B;  3LJU X;  4JKD A;  2NBV B;  3KUC B;  4JKF A;  2GJY A;  1VCB A;  4HAT B;  1ZVR A;  2ADZ A;  4NQL B;  2DZI A;  4NQK E;  2N4F A;  5AZG A;  4HXD A;  3H9D A;  1U27 A;  1WJU A;  1WXA A;  1YIW A;  1ISN A;  4DBB A;  3Q3F A;  4GPT B;  2M38 A;  1E8Z A;  1GGO A;  1KBL A;  3T8M A;  2R2Q A;  3QWM A;  5LOP B;  4A3P A;  2O2V A;  4NJ7 A;  3L0W B;  5KHO A;  4FUL A;  2N9E B;  4RMA A;  3A9J A;  2M0X A;  3W1Y A;  2D4Q A;  3JSV B;  5JHA A;  3B1L X;  3F5R A;  3HIZ A;  4K1R B;  4FA6 A;  2DA0 A;  1MIZ B;  2L76 A;  3H1U A;  4NAW A;  3WAM A;  3GYP A;  2KKC A;  3NY5 A;  5FI1 A;  4K7W A;  5CLQ B;  4W9I A;  3IBE A;  4F7U P;  2QKM A;  2EKE C;  4HCP B;  3QAQ A;  2DFK A;  2MSE D;  4PS8 A;  2DAJ A;  2Z0E B;  5L83 A;  4IG7 B;  2JP2 A;  3DPD A;  2BCJ A;  2N0Y A;  2XEW A;  2JZ3 B;  4IOY X;  2PE9 A;  3ZLZ A;  3E9P A;  3OLM D;  3CSF A;  2GBK A;  1FHX A;  3V60 A;  4MEM A;  2KDB A;  4WJP A;  4KDI C;  3AU4 A;  4FHK A;  4AUQ C;  1DDM A;  5IA7 A;  3DXC A;  2A4Z A;  1YQB A;  3CF6 E;  3PRP B;  3QJZ A;  2P8V A;  2G4D B;  2NCN A;  3PSC A;  1QQG A;  4A6F B;  2YT1 A;  3RCP A;  2DZM A;  4WJQ A;  4HAV B;  2DYB A;  4IM3 A;  2LI5 A;  3ODX A;  2ZPN A;  5JH5 C;  2CQU A;  4J6I A;  3RCZ A;  4B9K A;  1PLS A;  2KTR A;  1KZG A;  3TFM A;  2KFK A;  2ZNV B;  2CAY A;  3SUZ A;  3ONS A;  2DIK A;  2L05 A;  2BPS A;  4PYZ A;  1YJ1 A;  3K9O B;  2UYZ B;  3U7D A;  2MBE A;  2K8C A;  2KUP A;  2YSZ A;  1GNU A;  1P5T A;  5HE1 A;  2IO0 B;  3W1S A;  4FLH A;  1TQZ A;  3U30 A;  3S2A A;  4KAX B;  2GOW A;  1NBF C;  1V5U A;  3PS6 A;  1VBG A;  3X0W A;  1UNQ A;  4GDL A;  2MW5 A;  5TR5 A;  2DHK A;  3DBH I;  4BKG A;  1V49 A;  2EJ8 A;  1V5P A;  1FAO A;  3IG3 A;  4WSF A;  2FDQ A;  3AJ4 A;  2LRW A;  3TCA A;  1SHC A;  3ZNZ B;  2DHJ A;  2LG1 A;  4DWF A;  5IAA C;  1XT9 B;  4KHO A;  2CY4 A;  2HTH A;  1PQS A;  4W9D A;  4RM8 A;  4W9G A;  2CY5 A;  1XKE A;  1FOE A;  3UGB B;  2NBW B;  1UZX B;  1FGZ A;  2LUL A;  3WAO A;  4II3 B;  4ZDV A;  3GYO A;  1NTY A;  1WM2 A;  4CHK A;  4TUU A;  3ZVR A;  2NVU I;  4GGQ A;  5FR6 A;  4GDK A;  2L0F A;  1DYN A;  1E8Y A;  4IW0 A;  4ILG B;  1DRO A;  3EFU A;  3ZRC A;  2KJH B;  2ELA A;  1TXD A;  2AWT A;  5DPR A;  4JKA A;  2YRY A;  2W2X C;  3RYT A;  3A1Q A;  3DVG Y;  2GCL A;  4BVU C;  4E3C A;  2KD0 A;  2V76 A;  3CST A;  4HVB A;  1WGR A;  4JIO U;  1UPR A;  4JK8 A;  2DYM A;  4RM9 A;  4JKG B;  2QHO A;  4I6L B;  4DHZ B;  4W9H A;  1W1G A;  1NDD A;  3PTF C;  2PJH A;  3V61 A;  4AJY B;  3O96 A;  2L00 B;  3KYC D;  3L54 A;  2K1F A;  1DDV A;  3RZW C;  2J0M A;  2KQ7 A;  1P6S A;  1ST7 A;  5LXH A;  2JZZ A;  3I3T B;  2UVM A;  1ACA A;  2P0D A;  4EJN A;  2LXC A;  3KYD D;  2D9X A;  4F7G A;  1NI2 A;  2K00 A;  2N7E A;  3SV1 A;  3DQV A;  3KUZ A;  5G55 A;  1ZM0 A;  1E8X A;  3ODW A;  2NPT B;  2LBB A;  2WX1 A;  1GC6 A;  3KZ1 A;  2DZK A;  2KQS A;  1DBH A;  1TZ1 A;  1K5G B;  4X57 B;  2JVC A;  2W2X D;  2Y8F A;  1X1F A;  2MP2 A;  3A9K A;  3ZUN A;  1EUV B;  3QC8 B;  2KC1 A;  1M7E A;  4KIK B;  2IFS A;  3A4R A;  5C23 A;  1AQC A;  1X11 A;  5CHF A;  2G45 B;  4GU2 A;  5D3W A;  4WWP A;  2EMT A;  1NTV A;  3ULC A;  2DX5 B;  5HE2 A;  2JXX A;  4HPM B;  2ZEQ A;  3QBV B;  4PQ0 A;  2GMI C;  3FSS A;  3T06 A;  2JUO A;  2R2O A;  5C1Z A;  4JGH B;  1XX0 A;  2KDI A;  1K5D B;  2GCJ A;  2L7R A;  1WIA A;  1ZGU B;  3QAR A;  4ANV A;  2KX3 A;  1UH6 A;  1QZE A;  2H7E A;  4JKC A;  2V4L A;  3LJ3 A;  2RSG A;  1OMW A;  3R7Q A;  2ZNV C;  1DIK A;  4HB4 B;  1FXT B;  4Y94 A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...