1Y19B

Structural basis for phosphatidylinositol phosphate kinase type i-gamma binding to talin at focal adhesions
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
publication title Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein, signaling protein
total genus 58
structure length 192
sequence length 192
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1y19B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y19B02
4KHAA 4A5KA 4IOYX 2DHJA 4GZUA 1FGZA 4IAPA 3KRWA 5FI0A 3WYFB 2DHIA 3A98B 3MDBC 2P8VA 1MK9B 1ZC3B 2VRWB 1W1HA 1UPQA 2DYNA 4WSFA 4A6HA 2M38A 1X1GA 1ZC4B 1UNPA 1EAZA 2UZSA 3F5RA 2G35A 4P7IA 1EGXA 4KHOA 2J0MA 2J0KA 2ELAA 4HDQA 2IYBA 1AWEA 3BINA 1FGYA 3FLVA 2EC1A 1GG3A 1NTVA 2D2QA 1I7AA 1XODA 1U2BA 2BCJA 1SGHA 4PNKA 1GC6A 2COCA 1U5FA 4DX8A 4GMXB 2DX1A 2MWNB 3DXCA 2Y8FA 1WJ1A 2V76A 4ZRIA 1MK7B 1M7RA 1N3HA 1P5TA 4NSWA 3FP5A 2LOZA 2UZRA 3P6AA 2DLWA 1K5GB 2FDQA 5DHAB 2GCLA 4BBKA 1NTIA 1E5WA 2RLOA 4KHBB 4IFSA 2L1CA 3UZTA 2DTCA 4K81A 4DBBA 3AU5A 4TKNA 4F7HA 2K00A 5HE1A 1DBHA 2DA0A 2GJYA 3ML4A 1WJMA 1WVHA 2K2UA 2N23A 2RNRB 3ZDTA 2LG1A 3RCPA 4D0NB 3A8PA 1WGQA 1X11A 2IFSA 4A6FB 1FOEA 4F7UP 1HB8A 3VOQA 5HE3A 4WJ7A 1V89A 3TFMA 4MK0A 2P0HA 4KAXB 1KZGA 1QC6A 2COAA 2ABDA 2ROZB 2Q13A 2RUKB 2YRYA 4HAZB 5D3XA 1W1DA 4CHJA 2RQ1A 2LULA 5EFXA 3ULCA 2CRFA 1KZ7A 1XR0B 1IRSA 2DYQA 3VIAA 5D3VA 2RSGA 3ZVRA 2D9YA 5KQ4A 1Q67A 2EJ8A 3MPXA 1MIZB 3SV1A 3QBVB 2FJLA 2CY4A 2Z0OA 5JHGA 3PG7A 1MKEA 1B55A 2H7EA 2I1JA 4F7GA 3CIKA 2YT1A 1P3RA 2CAYA 2DN6A 2D9XA 1DDWA 1FHWA 1X05A 5DI9B 4TYZA 1RJ2A 1UNRA 4B6HA 3N7CA 1J0WA 3LJUX 3PZDA 4HDOA 2NZ8B 3PVLA 1W1GA 4KVGB 5J3TA 4DXAB 3SYXA 5GOWB 2D10A 4HB4B 5J3YA 5D3YA 3GYPA 1EF1A 4GXBA 2YSZA 1LB1A 1PLSA 4K2PA 3U7DA 5DIFB 1Z87A 1UPRA 1H4RA 5HE0A 3TVVA 1OMWA 3DXEA 1V5PA 4DX90 1DDVA 2YS1A 2LBBA 2W2WA 2ELBA 4NY0A 1ACAA 3IVFA 1V5MA 1MAIA 3PSCA 1ZSQA 2MKRA 3TO1A 2K2JA 3QIJA 3G9WA 5D27A 2D9WA 5LOPB 2J59M 1QQGA 1J19A 1AQCA 4EKUA 1V61A 2MFQA 1DYNA 2YT0A 4HB0B 5DH9B 3U8ZA 2J0JA 2COFA 5C5BA 3OANA 2DHKA 1XCGA 3F0WA 4HHVA 3SNHA 5JLJB 5IJMA 2D11A 1XX0A 1XD4A 2DKQA 1FHOA 1V88A 2LOXA 4YL8A 2E2XA 2LKOA 2KUPA 1HBKA 3TCAA 2FJ9A 1WGUA 3FSSA 2YVCA 1UNQA 2ADZA 3WA0A 2QKLA 1U27A 2R09A 2P0FA 4HAYB 5CLLB 1FHXA 1PFJA 1U29A 3X23A 2RGNB 2R0DA 4EJNA 4Z2NA 3ULBA 4PQ0A 4K2OA 2CB8A 2VKIA 2YS3A 3FM8C 3PEGA 1ISNA 1Y19B 2XQNM 2N0YA 2I5FA 1ST7A 1SHCA 3TW1A 1NTYA 1FB8A 1LW3A 2Z0PA 5CLQB 3AJ4A 1BTNA 5JP4A 2M14A 2DKPA 4L6EA 1UEFA 1OY2A 2JP2A 1ZVRA 4HB2B 3PP2A 2HE7A 4HAXB 2YF0A 3AU4A 3PVUA 1H10A 1X1FA 4CYEA 4K17A 4ZRKA 3CXBB 1FAOA 1Y5OA 3D8EA 2L2IA 3KY9A 5LONB 2MDXA 2OQBA 4HAWB 2YS5A 4MT7A 1U5EA 4HB3B 1NI2A 1ZM0A 2CQUA 2Y8GA 1TXDA 5D3WA 2PZ1A 2LYDA 1WG7A 1K5DB 1GC7A 2HRJA 4WVFB 3ODWA 1TJ6A 1U5DA 3GYOA 2UVMA 2D4QA 2KGXB 3KZ1A 2D9VA 2W2XD 1TQZA 1XKEA 3D8DA 1V5UA 4Z2MB 3HW2B 1DDMA 5DHFB 1PMSA 2I5CA 2CODA 3HQCA 4A6KA 5KCVA 5KQ1A 3EPYA 2DX5A 1P6SA 1RRPB 2DFKA 3P7ZA 1NVLA 1MIXA 3O96A 2VSZA 3SUZA 3M1IB 1MPHA 1BWNA 4XWXA 4A6FA 2Y7BA 2CY5A 3QWMA 1WI1A 2ROVA 3T06A 4GPTB 2W2XC 2H7DA 1DROA 1M7EA 2I1KA 3NSUA 2GS0A 2X18A 3PVWA 1U5GA 3KRXA 4GMVA 3SO6A 2KCJA 2HTHB 5FI1A 3V5WA 1OQNA 2NMBA 4H8SA 5JHHA 2QKMA 2OTXA 4HATB 4HAVB 2Z0QA 1X86A 4MY6A 3BJIA 2D9ZA 5C16A 2EMSA 2RVBB 3ODOA 1HB6A 3A8QA 5L81A 1KI1B 2P0DA 3FEHA 1I2HA 2GCJA 5C5BB 4CHMA 5C6RA 5HE2A 3ODXA 3DXDA 2EMTA 4ZRJA 3KSYA 5C79A 4GN1A 2ZPYA 4Y94A 2AL6A 1EVHA 1BAKA 4C0AA 4EMOA 5J3QA 2AEHA 1BTKA 3HK0A 4YONA 1NU2A 2COPA 2WH5A 3D8FA 4HAUB
chains in the Genus database with same CATH superfamily
4KHAA 4A5KA 4IOYX 2DHJA 4GZUA 1FGZA 4IAPA 3KRWA 5FI0A 3WYFB 2DHIA 3A98B 3MDBC 2P8VA 4JKDA 1MK9B 4D6WA 1ZC3B 2VRWB 1W1HA 1UPQA 2DYNA 4WSFA 4A6HA 2M38A 3HSAA 1X1GA 1ZC4B 1UNPA 1EAZA 2UZSA 3F5RA 2G35A 4P7IA 1EGXA 4KHOA 2J0MA 2J0KA 2ELAA 4HDQA 2IYBA 1AWEA 3BINA 1FGYA 3FLVA 2EC1A 1GG3A 1JDEA 1NTVA 2D2QA 2RRFA 1I7AA 1XODA 1U2BA 2BCJA 1SGHA 5I2MA 4PNKA 1GC6A 3NWFA 2COCA 1U5FA 4DX8A 4GMXB 2DX1A 2MWNB 3SBGA 3DXCA 2Y8FA 1WJ1A 2V76A 4ZRIA 1MK7B 1M7RA 1N3HA 1P5TA 4NSWA 3FP5A 2LOZA 2UZRA 3P6AA 2DLWA 1K5GB 2FDQA 5DHAB 2GCLA 4BBKA 1NTIA 1E5WA 2RLOA 3B77A 4KHBB 3FVCA 4IFSA 2L1CA 3UZTA 2DTCA 2Z13A 4K81A 4DBBA 1DIKA 3AU5A 4TKNA 4F7HA 2K00A 4ILGB 5HE1A 1DBHA 2DA0A 4DIXA 2GJYA 3ML4A 1WJMA 1WVHA 2K2UA 2N23A 2RNRB 3ZDTA 2LG1A 3RCPA 1ZYIA 4D0NB 3A8PA 1WGQA 1X11A 2IFSA 4A6FB 1FOEA 4F7UP 1HB8A 4QJ4B 3VOQA 5HE3A 4WJ7A 4OSNA 1V89A 3TFMA 4MK0A 2P0HA 3E9PA 1KZGA 4KAXB 4JKHA 1QC6A 4QXAB 3NWAA 2COAA 2ABDA 1KC7A 2ROZB 2Q13A 2RUKB 2YRYA 4HAZB 5D3XA 1W1DA 4CHJA 2KR0A 2RQ1A 2X0SA 2LULA 5EFXA 3ULCA 2CRFA 1KZ7A 1XR0B 1IRSA 2ZKMX 3OHMB 4QJ3B 2DYQA 3VIAA 5D3VA 2RSGA 3ZVRA 2KUQA 2D9YA 4JKGA 5KQ4A 1Q67A 2EJ8A 3MPXA 1MIZB 3SV1A 3QBVB 4JKAA 2FJLA 2CY4A 2Z0OA 5JHGA 3PG7A 1GGOA 4HSIA 1MKEA 1B55A 2H7EA 2I1JA 4F7GA 3CIKA 2YT1A 1P3RA 2CAYA 2DN6A 3DCXA 5I2SA 2D9XA 1DDWA 1FHWA 1X05A 3E9OA 5DI9B 4TYZA 1RJ2A 1UNRA 3E66A 4B6HA 3N7CA 1J0WA 3LJUX 3PZDA 2GUMA 1MI1A 4HDOA 2FJUB 2NZ8B 3PVLA 1W1GA 4KVGB 5J3TA 4DXAB 3SYXA 5GOWB 2D10A 4HB4B 5J3YA 5D3YA 3GYPA 1EF1A 4GXBA 2YSZA 1LB1A 1PLSA 4K2PA 3U7DA 5DIFB 1Z87A 1UPRA 2Z14A 1H4RA 5HE0A 3TVVA 4JK8A 1OMWA 3DXEA 1V5PA 4DX90 1DDVA 2YS1A 1VBHA 2LBBA 2W2WA 2ELBA 4NY0A 1ACAA 3IVFA 1V5MA 1MAIA 3PSCA 1ZSQA 2MKRA 3TO1A 2K2JA 3QIJA 3G9WA 5D27A 2D9WA 5LOPB 4GOUA 2J59M 1QQGA 1J19A 3ENBA 1AQCA 3NWDA 4EKUA 1V61A 2MFQA 1DYNA 2YT0A 4HB0B 5DH9B 3U8ZA 2J0JA 2COFA 2R82A 5C5BA 3OANA 2DHKA 1XCGA 3F0WA 4HHVA 3SNHA 5JLJB 5IJMA 2D11A 1XX0A 1XD4A 2DKQA 1FHOA 1KBLA 1V88A 4JKCA 2LOXA 4YL8A 2E2XA 2LKOA 2KUPA 1HBKA 3TCAA 2FJ9A 1WGUA 3FSSA 2YVCA 1UNQA 2ADZA 3WA0A 3U12A 2P0FA 1U27A 2QKLA 2R09A 4HAYB 5CLLB 1FHXA 1PFJA 1U29A 3X23A 2RGNB 2R0DA 4EJNA 4GNKB 4JKEA 2NBVA 3SBTA 3ULBA 4Z2NA 4PQ0A 4K2OA 2YT2A 2CB8A 2VKIA 2YS3A 3FM8C 3PEGA 1ISNA 1Y19B 2XQNM 2N0YA 2I5FA 1ST7A 3E9LA 1SHCA 3A58A 3TW1A 5JVLA 1NTYA 4ILJA 1FB8A 1LW3A 2KIEA 2Z0PA 5CLQB 3AJ4A 1BTNA 5JP4A 2M14A 2DKPA 4L6EA 1UEFA 3NW8A 1OY2A 2JP2A 1ZVRA 4HB2B 4OT1A 3PP2A 2HE7A 4HAXB 2YF0A 3AU4A 3PVUA 1H10A 1X1FA 4CYEA 4K17A 4ZRKA 3CXBB 1FAOA 1Y5OA 3D8EA 2L2IA 4JKGB 3KY9A 2MDXA 2OQBA 5LONB 4HAWB 2YS5A 4MT7A 1U5EA 4HB3B 1NI2A 1ZM0A 2CQUA 2Y8GA 1TXDA 5D3WA 2PZ1A 2LYDA 1WG7A 1K5DB 1GC7A 2HRJA 4WVFB 3ODWA 1TJ6A 1U5DA 3GYOA 2UVMA 2D4QA 2KGXB 3KZ1A 2D9VA 2W2XD 1TQZA 4KHBA 2Z4DA 1XKEA 3D8DA 1T77A 1V5UA 4Z2MB 3HW2B 1DDMA 4QJ5B 5DHFB 1PMSA 2I5CA 2CODA 3HQCA 4A6KA 5KCVA 5KQ1A 3EPYA 2DX5A 2K8EA 1P6SA 1RRPB 2R2YA 2K49A 2DFKA 3P7ZA 5M4YB 1NVLA 1MIXA 4ILHA 3O96A 2VSZA 3SUZA 3M1IB 1MPHA 4CSQA 4JKBA 1BWNA 4XWXA 4A6FA 4JK9A 2Y7BA 2CY5A 3QWMA 1WI1A 2ROVA 3T06A 4JKFA 4GPTB 2W2XC 2H7DA 1DROA 5IRSA 1M7EA 2KIGA 2I1KA 3NSUA 2GS0A 2X18A 3PVWA 1U5GA 3KRXA 4GMVA 3SO6A 2KCJA 2HTHB 5FI1A 3V5WA 1OQNA 2NMBA 4H8SA 5JHHA 2QKMA 2OTXA 4HATB 4HAVB 2Z0QA 1X86A 4MY6A 3BJIA 2D9ZA 5C16A 2EMSA 2RVBB 3ODOA 1HB6A 3A8QA 5L81A 1KI1B 2P0DA 3FEHA 1I2HA 2GCJA 5C5BB 4CHMA 4JK7A 5LG4B 5C6RA 5HE2A 3ODXA 3DXDA 2EMTA 4ZRJA 3HIEA 3KSYA 5C79A 4GN1A 2ZPYA 4Y94A 2AL6A 1EVHA 1BAKA 2DIKA 4C0AA 4EMOA 5J3QA 2AEHA 1BTKA 4L1RA 3HK0A 4YONA 1VBGA 1NU2A 2COPA 2WH5A 3D8FA 2Z59A 4HAUB
chains in the Genus database with same CATH topology
4KHAA 4A5KA 4IOYX 2DHJA 4GZUA 1FGZA 4IAPA 3KRWA 5FI0A 3WYFB 2DHIA 3A98B 3MDBC 2P8VA 4JKDA 1MK9B 1ZC3B 2VRWB 1W1HA 1UPQA 2DYNA 4WSFA 4A6HA 2M38A 1X1GA 1ZC4B 1UNPA 1EAZA 2UZSA 3F5RA 2G35A 4P7IA 1EGXA 4KHOA 2J0MA 2J0KA 2ELAA 4HDQA 2IYBA 1AWEA 3BINA 1FGYA 3FLVA 2EC1A 1GG3A 1JDEA 1NTVA 2D2QA 1I7AA 1XODA 1U2BA 2BCJA 1SGHA 4PNKA 1GC6A 2COCA 1U5FA 4DX8A 4GMXB 2DX1A 2MWNB 3SBGA 3DXCA 2Y8FA 1WJ1A 2V76A 4ZRIA 1MK7B 1M7RA 1N3HA 1P5TA 4NSWA 3FP5A 2LOZA 2UZRA 3P6AA 2DLWA 1K5GB 2FDQA 5DHAB 2GCLA 4BBKA 1NTIA 1E5WA 2RLOA 4KHBB 4IFSA 2L1CA 3UZTA 2DTCA 4K81A 4DBBA 1DIKA 3AU5A 4TKNA 4F7HA 2K00A 4ILGB 5HE1A 1DBHA 2DA0A 2GJYA 3ML4A 1WJMA 1WVHA 2K2UA 2N23A 2RNRB 3ZDTA 2LG1A 3RCPA 4D0NB 3A8PA 1WGQA 1X11A 2IFSA 4A6FB 1FOEA 4F7UP 1HB8A 3VOQA 5HE3A 4WJ7A 1V89A 3TFMA 4MK0A 2P0HA 3E9PA 1KZGA 4KAXB 4JKHA 1QC6A 2COAA 2ABDA 1KC7A 2ROZB 2Q13A 2RUKB 2YRYA 4HAZB 5D3XA 1W1DA 4CHJA 2RQ1A 2X0SA 2LULA 5EFXA 3ULCA 2CRFA 1KZ7A 1XR0B 1IRSA 2DYQA 3VIAA 5D3VA 2RSGA 3ZVRA 2D9YA 4JKGA 5KQ4A 1Q67A 2EJ8A 3MPXA 1MIZB 3SV1A 3QBVB 4JKAA 2FJLA 2CY4A 2Z0OA 5JHGA 3PG7A 1GGOA 1MKEA 1B55A 2H7EA 2I1JA 4F7GA 3CIKA 2YT1A 1P3RA 2CAYA 2DN6A 2D9XA 1DDWA 1FHWA 1X05A 3E9OA 5DI9B 4TYZA 1RJ2A 1UNRA 3E66A 4B6HA 3N7CA 1J0WA 3LJUX 3PZDA 4HDOA 2NZ8B 3PVLA 1W1GA 4KVGB 5J3TA 4DXAB 3SYXA 5GOWB 2D10A 4HB4B 5J3YA 5D3YA 3GYPA 1EF1A 4GXBA 2YSZA 1LB1A 1PLSA 4K2PA 3U7DA 5DIFB 1Z87A 1UPRA 1H4RA 5HE0A 3TVVA 4JK8A 1OMWA 3DXEA 1V5PA 4DX90 1DDVA 2YS1A 1VBHA 2LBBA 2W2WA 2ELBA 4NY0A 1ACAA 3IVFA 1V5MA 1MAIA 3PSCA 1ZSQA 2MKRA 3TO1A 2K2JA 3QIJA 3G9WA 5D27A 2D9WA 5LOPB 2J59M 1QQGA 1J19A 3ENBA 1AQCA 4EKUA 1V61A 2MFQA 1DYNA 2YT0A 4HB0B 5DH9B 3U8ZA 2J0JA 2COFA 2R82A 5C5BA 3OANA 2DHKA 1XCGA 3F0WA 4HHVA 3SNHA 5JLJB 5IJMA 2D11A 1XX0A 1XD4A 2DKQA 1FHOA 1KBLA 1V88A 4JKCA 2LOXA 4YL8A 2E2XA 2LKOA 2KUPA 1HBKA 3TCAA 2FJ9A 1WGUA 3FSSA 2YVCA 1UNQA 2ADZA 3WA0A 2QKLA 2P0FA 2R09A 1U27A 4HAYB 5CLLB 1FHXA 1PFJA 1U29A 3X23A 2RGNB 2R0DA 4EJNA 4JKEA 3SBTA 3ULBA 4Z2NA 4PQ0A 4K2OA 2CB8A 2VKIA 2YS3A 3FM8C 3PEGA 1ISNA 1Y19B 2XQNM 2N0YA 2I5FA 1ST7A 3E9LA 1SHCA 3TW1A 5JVLA 1NTYA 4ILJA 1FB8A 1LW3A 2Z0PA 5CLQB 3AJ4A 1BTNA 5JP4A 2M14A 2DKPA 4L6EA 1UEFA 1OY2A 2JP2A 1ZVRA 4HB2B 3PP2A 2HE7A 4HAXB 2YF0A 3AU4A 3PVUA 1H10A 1X1FA 4CYEA 4K17A 4ZRKA 3CXBB 1FAOA 1Y5OA 3D8EA 2L2IA 4JKGB 3KY9A 2MDXA 2OQBA 5LONB 4HAWB 2YS5A 4MT7A 1U5EA 4HB3B 1NI2A 1ZM0A 2CQUA 2Y8GA 1TXDA 5D3WA 2PZ1A 2LYDA 1WG7A 1K5DB 1GC7A 2HRJA 4WVFB 3ODWA 1TJ6A 1U5DA 3GYOA 2UVMA 2D4QA 2KGXB 3KZ1A 2D9VA 2W2XD 1TQZA 1XKEA 3D8DA 1V5UA 4Z2MB 3HW2B 1DDMA 5DHFB 1PMSA 2I5CA 2CODA 3HQCA 4A6KA 5KCVA 5KQ1A 3EPYA 2DX5A 1P6SA 1RRPB 2DFKA 3P7ZA 1NVLA 1MIXA 4ILHA 3O96A 2VSZA 3SUZA 3M1IB 1MPHA 4JKBA 1BWNA 4XWXA 4A6FA 4JK9A 2Y7BA 2CY5A 3QWMA 1WI1A 2ROVA 3T06A 4JKFA 4GPTB 2W2XC 2H7DA 1DROA 1M7EA 2I1KA 3NSUA 2GS0A 2X18A 3PVWA 1U5GA 3KRXA 4GMVA 3SO6A 2KCJA 2HTHB 5FI1A 3V5WA 1OQNA 2NMBA 4H8SA 5JHHA 2QKMA 2OTXA 4HATB 4HAVB 2Z0QA 1X86A 4MY6A 3BJIA 2D9ZA 5C16A 2EMSA 2RVBB 3ODOA 1HB6A 3A8QA 5L81A 1KI1B 2P0DA 3FEHA 1I2HA 2GCJA 5C5BB 4CHMA 4JK7A 5C6RA 5HE2A 3ODXA 3DXDA 2EMTA 4ZRJA 3KSYA 5C79A 4GN1A 2ZPYA 4Y94A 2AL6A 1EVHA 1BAKA 2DIKA 4C0AA 4EMOA 5J3QA 2AEHA 1BTKA 3HK0A 4YONA 1VBGA 1NU2A 2COPA 2WH5A 3D8FA 4HAUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  4A5K A;  4IOY X;  2DHJ A;  4GZU A;  1FGZ A;  4IAP A;  3KRW A;  5FI0 A;  3WYF B;  2DHI A;  3A98 B;  3MDB C;  2P8V A;  1MK9 B;  1ZC3 B;  2VRW B;  1W1H A;  1UPQ A;  2DYN A;  4WSF A;  4A6H A;  2M38 A;  1X1G A;  1ZC4 B;  1UNP A;  1EAZ A;  2UZS A;  3F5R A;  2G35 A;  4P7I A;  1EGX A;  4KHO A;  2J0M A;  2J0K A;  2ELA A;  4HDQ A;  2IYB A;  1AWE A;  3BIN A;  1FGY A;  3FLV A;  2EC1 A;  1GG3 A;  1NTV A;  2D2Q A;  1I7A A;  1XOD A;  1U2B A;  2BCJ A;  1SGH A;  4PNK A;  1GC6 A;  2COC A;  1U5F A;  4DX8 A;  4GMX B;  2DX1 A;  2MWN B;  3DXC A;  2Y8F A;  1WJ1 A;  2V76 A;  4ZRI A;  1MK7 B;  1M7R A;  1N3H A;  1P5T A;  4NSW A;  3FP5 A;  2LOZ A;  2UZR A;  3P6A A;  2DLW A;  1K5G B;  2FDQ A;  5DHA B;  2GCL A;  4BBK A;  1NTI A;  1E5W A;  2RLO A;  4KHB B;  4IFS A;  2L1C A;  3UZT A;  2DTC A;  4K81 A;  4DBB A;  3AU5 A;  4TKN A;  4F7H A;  2K00 A;  5HE1 A;  1DBH A;  2DA0 A;  2GJY A;  3ML4 A;  1WJM A;  1WVH A;  2K2U A;  2N23 A;  2RNR B;  3ZDT A;  2LG1 A;  3RCP A;  4D0N B;  3A8P A;  1WGQ A;  1X11 A;  2IFS A;  4A6F B;  1FOE A;  4F7U P;  1HB8 A;  3VOQ A;  5HE3 A;  4WJ7 A;  1V89 A;  3TFM A;  4MK0 A;  2P0H A;  4KAX B;  1KZG A;  1QC6 A;  2COA A;  2ABD A;  2ROZ B;  2Q13 A;  2RUK B;  2YRY A;  4HAZ B;  5D3X A;  1W1D A;  4CHJ A;  2RQ1 A;  2LUL A;  5EFX A;  3ULC A;  2CRF A;  1KZ7 A;  1XR0 B;  1IRS A;  2DYQ A;  3VIA A;  5D3V A;  2RSG A;  3ZVR A;  2D9Y A;  5KQ4 A;  1Q67 A;  2EJ8 A;  3MPX A;  1MIZ B;  3SV1 A;  3QBV B;  2FJL A;  2CY4 A;  2Z0O A;  5JHG A;  3PG7 A;  1MKE A;  1B55 A;  2H7E A;  2I1J A;  4F7G A;  3CIK A;  2YT1 A;  1P3R A;  2CAY A;  2DN6 A;  2D9X A;  1DDW A;  1FHW A;  1X05 A;  5DI9 B;  4TYZ A;  1RJ2 A;  1UNR A;  4B6H A;  3N7C A;  1J0W A;  3LJU X;  3PZD A;  4HDO A;  2NZ8 B;  3PVL A;  1W1G A;  4KVG B;  5J3T A;  4DXA B;  3SYX A;  5GOW B;  2D10 A;  4HB4 B;  5J3Y A;  5D3Y A;  3GYP A;  1EF1 A;  4GXB A;  2YSZ A;  1LB1 A;  1PLS A;  4K2P A;  3U7D A;  5DIF B;  1Z87 A;  1UPR A;  1H4R A;  5HE0 A;  3TVV A;  1OMW A;  3DXE A;  1V5P A;  4DX9 0;  1DDV A;  2YS1 A;  2LBB A;  2W2W A;  2ELB A;  4NY0 A;  1ACA A;  3IVF A;  1V5M A;  1MAI A;  3PSC A;  1ZSQ A;  2MKR A;  3TO1 A;  2K2J A;  3QIJ A;  3G9W A;  5D27 A;  2D9W A;  5LOP B;  2J59 M;  1QQG A;  1J19 A;  1AQC A;  4EKU A;  1V61 A;  2MFQ A;  1DYN A;  2YT0 A;  4HB0 B;  5DH9 B;  3U8Z A;  2J0J A;  2COF A;  5C5B A;  3OAN A;  2DHK A;  1XCG A;  3F0W A;  4HHV A;  3SNH A;  5JLJ B;  5IJM A;  2D11 A;  1XX0 A;  1XD4 A;  2DKQ A;  1FHO A;  1V88 A;  2LOX A;  4YL8 A;  2E2X A;  2LKO A;  2KUP A;  1HBK A;  3TCA A;  2FJ9 A;  1WGU A;  3FSS A;  2YVC A;  1UNQ A;  2ADZ A;  3WA0 A;  2QKL A;  1U27 A;  2R09 A;  2P0F A;  4HAY B;  5CLL B;  1FHX A;  1PFJ A;  1U29 A;  3X23 A;  2RGN B;  2R0D A;  4EJN A;  4Z2N A;  3ULB A;  4PQ0 A;  4K2O A;  2CB8 A;  2VKI A;  2YS3 A;  3FM8 C;  3PEG A;  1ISN A;  1Y19 B;  2XQN M;  2N0Y A;  2I5F A;  1ST7 A;  1SHC A;  3TW1 A;  1NTY A;  1FB8 A;  1LW3 A;  2Z0P A;  5CLQ B;  3AJ4 A;  1BTN A;  5JP4 A;  2M14 A;  2DKP A;  4L6E A;  1UEF A;  1OY2 A;  2JP2 A;  1ZVR A;  4HB2 B;  3PP2 A;  2HE7 A;  4HAX B;  2YF0 A;  3AU4 A;  3PVU A;  1H10 A;  1X1F A;  4CYE A;  4K17 A;  4ZRK A;  3CXB B;  1FAO A;  1Y5O A;  3D8E A;  2L2I A;  3KY9 A;  5LON B;  2MDX A;  2OQB A;  4HAW B;  2YS5 A;  4MT7 A;  1U5E A;  4HB3 B;  1NI2 A;  1ZM0 A;  2CQU A;  2Y8G A;  1TXD A;  5D3W A;  2PZ1 A;  2LYD A;  1WG7 A;  1K5D B;  1GC7 A;  2HRJ A;  4WVF B;  3ODW A;  1TJ6 A;  1U5D A;  3GYO A;  2UVM A;  2D4Q A;  2KGX B;  3KZ1 A;  2D9V A;  2W2X D;  1TQZ A;  1XKE A;  3D8D A;  1V5U A;  4Z2M B;  3HW2 B;  1DDM A;  5DHF B;  1PMS A;  2I5C A;  2COD A;  3HQC A;  4A6K A;  5KCV A;  5KQ1 A;  3EPY A;  2DX5 A;  1P6S A;  1RRP B;  2DFK A;  3P7Z A;  1NVL A;  1MIX A;  3O96 A;  2VSZ A;  3SUZ A;  3M1I B;  1MPH A;  1BWN A;  4XWX A;  4A6F A;  2Y7B A;  2CY5 A;  3QWM A;  1WI1 A;  2ROV A;  3T06 A;  4GPT B;  2W2X C;  2H7D A;  1DRO A;  1M7E A;  2I1K A;  3NSU A;  2GS0 A;  2X18 A;  3PVW A;  1U5G A;  3KRX A;  4GMV A;  3SO6 A;  2KCJ A;  2HTH B;  5FI1 A;  3V5W A;  1OQN A;  2NMB A;  4H8S A;  5JHH A;  2QKM A;  2OTX A;  4HAT B;  4HAV B;  2Z0Q A;  1X86 A;  4MY6 A;  3BJI A;  2D9Z A;  5C16 A;  2EMS A;  2RVB B;  3ODO A;  1HB6 A;  3A8Q A;  5L81 A;  1KI1 B;  2P0D A;  3FEH A;  1I2H A;  2GCJ A;  5C5B B;  4CHM A;  5C6R A;  5HE2 A;  3ODX A;  3DXD A;  2EMT A;  4ZRJ A;  3KSY A;  5C79 A;  4GN1 A;  2ZPY A;  4Y94 A;  2AL6 A;  1EVH A;  1BAK A;  4C0A A;  4EMO A;  5J3Q A;  2AEH A;  1BTK A;  3HK0 A;  4YON A;  1NU2 A;  2COP A;  2WH5 A;  3D8F A;  4HAU B; 
#chains in the Genus database with same CATH topology
 4KHA A;  4A5K A;  4IOY X;  2DHJ A;  4GZU A;  1FGZ A;  4IAP A;  3KRW A;  5FI0 A;  3WYF B;  2DHI A;  3A98 B;  3MDB C;  2P8V A;  4JKD A;  1MK9 B;  4D6W A;  1ZC3 B;  2VRW B;  1W1H A;  1UPQ A;  2DYN A;  4WSF A;  4A6H A;  2M38 A;  3HSA A;  1X1G A;  1ZC4 B;  1UNP A;  1EAZ A;  2UZS A;  3F5R A;  2G35 A;  4P7I A;  1EGX A;  4KHO A;  2J0M A;  2J0K A;  2ELA A;  4HDQ A;  2IYB A;  1AWE A;  3BIN A;  1FGY A;  3FLV A;  2EC1 A;  1GG3 A;  1JDE A;  1NTV A;  2D2Q A;  2RRF A;  1I7A A;  1XOD A;  1U2B A;  2BCJ A;  1SGH A;  5I2M A;  4PNK A;  1GC6 A;  3NWF A;  2COC A;  1U5F A;  4DX8 A;  4GMX B;  2DX1 A;  2MWN B;  3SBG A;  3DXC A;  2Y8F A;  1WJ1 A;  2V76 A;  4ZRI A;  1MK7 B;  1M7R A;  1N3H A;  1P5T A;  4NSW A;  3FP5 A;  2LOZ A;  2UZR A;  3P6A A;  2DLW A;  1K5G B;  2FDQ A;  5DHA B;  2GCL A;  4BBK A;  1NTI A;  1E5W A;  2RLO A;  3B77 A;  4KHB B;  3FVC A;  4IFS A;  2L1C A;  3UZT A;  2DTC A;  2Z13 A;  4K81 A;  4DBB A;  1DIK A;  3AU5 A;  4TKN A;  4F7H A;  2K00 A;  4ILG B;  5HE1 A;  1DBH A;  2DA0 A;  4DIX A;  2GJY A;  3ML4 A;  1WJM A;  1WVH A;  2K2U A;  2N23 A;  2RNR B;  3ZDT A;  2LG1 A;  3RCP A;  1ZYI A;  4D0N B;  3A8P A;  1WGQ A;  1X11 A;  2IFS A;  4A6F B;  1FOE A;  4F7U P;  1HB8 A;  4QJ4 B;  3VOQ A;  5HE3 A;  4WJ7 A;  4OSN A;  1V89 A;  3TFM A;  4MK0 A;  2P0H A;  3E9P A;  1KZG A;  4KAX B;  4JKH A;  1QC6 A;  4QXA B;  3NWA A;  2COA A;  2ABD A;  1KC7 A;  2ROZ B;  2Q13 A;  2RUK B;  2YRY A;  4HAZ B;  5D3X A;  1W1D A;  4CHJ A;  2KR0 A;  2RQ1 A;  2X0S A;  2LUL A;  5EFX A;  3ULC A;  2CRF A;  1KZ7 A;  1XR0 B;  1IRS A;  2ZKM X;  3OHM B;  4QJ3 B;  2DYQ A;  3VIA A;  5D3V A;  2RSG A;  3ZVR A;  2KUQ A;  2D9Y A;  4JKG A;  5KQ4 A;  1Q67 A;  2EJ8 A;  3MPX A;  1MIZ B;  3SV1 A;  3QBV B;  4JKA A;  2FJL A;  2CY4 A;  2Z0O A;  5JHG A;  3PG7 A;  1GGO A;  4HSI A;  1MKE A;  1B55 A;  2H7E A;  2I1J A;  4F7G A;  3CIK A;  2YT1 A;  1P3R A;  2CAY A;  2DN6 A;  3DCX A;  5I2S A;  2D9X A;  1DDW A;  1FHW A;  1X05 A;  3E9O A;  5DI9 B;  4TYZ A;  1RJ2 A;  1UNR A;  3E66 A;  4B6H A;  3N7C A;  1J0W A;  3LJU X;  3PZD A;  2GUM A;  1MI1 A;  4HDO A;  2FJU B;  2NZ8 B;  3PVL A;  1W1G A;  4KVG B;  5J3T A;  4DXA B;  3SYX A;  5GOW B;  2D10 A;  4HB4 B;  5J3Y A;  5D3Y A;  3GYP A;  1EF1 A;  4GXB A;  2YSZ A;  1LB1 A;  1PLS A;  4K2P A;  3U7D A;  5DIF B;  1Z87 A;  1UPR A;  2Z14 A;  1H4R A;  5HE0 A;  3TVV A;  4JK8 A;  1OMW A;  3DXE A;  1V5P A;  4DX9 0;  1DDV A;  2YS1 A;  1VBH A;  2LBB A;  2W2W A;  2ELB A;  4NY0 A;  1ACA A;  3IVF A;  1V5M A;  1MAI A;  3PSC A;  1ZSQ A;  2MKR A;  3TO1 A;  2K2J A;  3QIJ A;  3G9W A;  5D27 A;  2D9W A;  5LOP B;  4GOU A;  2J59 M;  1QQG A;  1J19 A;  3ENB A;  1AQC A;  3NWD A;  4EKU A;  1V61 A;  2MFQ A;  1DYN A;  2YT0 A;  4HB0 B;  5DH9 B;  3U8Z A;  2J0J A;  2COF A;  2R82 A;  5C5B A;  3OAN A;  2DHK A;  1XCG A;  3F0W A;  4HHV A;  3SNH A;  5JLJ B;  5IJM A;  2D11 A;  1XX0 A;  1XD4 A;  2DKQ A;  1FHO A;  1KBL A;  1V88 A;  4JKC A;  2LOX A;  4YL8 A;  2E2X A;  2LKO A;  2KUP A;  1HBK A;  3TCA A;  2FJ9 A;  1WGU A;  3FSS A;  2YVC A;  1UNQ A;  2ADZ A;  3WA0 A;  3U12 A;  2P0F A;  1U27 A;  2QKL A;  2R09 A;  4HAY B;  5CLL B;  1FHX A;  1PFJ A;  1U29 A;  3X23 A;  2RGN B;  2R0D A;  4EJN A;  4GNK B;  4JKE A;  2NBV A;  3SBT A;  3ULB A;  4Z2N A;  4PQ0 A;  4K2O A;  2YT2 A;  2CB8 A;  2VKI A;  2YS3 A;  3FM8 C;  3PEG A;  1ISN A;  1Y19 B;  2XQN M;  2N0Y A;  2I5F A;  1ST7 A;  3E9L A;  1SHC A;  3A58 A;  3TW1 A;  5JVL A;  1NTY A;  4ILJ A;  1FB8 A;  1LW3 A;  2KIE A;  2Z0P A;  5CLQ B;  3AJ4 A;  1BTN A;  5JP4 A;  2M14 A;  2DKP A;  4L6E A;  1UEF A;  3NW8 A;  1OY2 A;  2JP2 A;  1ZVR A;  4HB2 B;  4OT1 A;  3PP2 A;  2HE7 A;  4HAX B;  2YF0 A;  3AU4 A;  3PVU A;  1H10 A;  1X1F A;  4CYE A;  4K17 A;  4ZRK A;  3CXB B;  1FAO A;  1Y5O A;  3D8E A;  2L2I A;  4JKG B;  3KY9 A;  2MDX A;  2OQB A;  5LON B;  4HAW B;  2YS5 A;  4MT7 A;  1U5E A;  4HB3 B;  1NI2 A;  1ZM0 A;  2CQU A;  2Y8G A;  1TXD A;  5D3W A;  2PZ1 A;  2LYD A;  1WG7 A;  1K5D B;  1GC7 A;  2HRJ A;  4WVF B;  3ODW A;  1TJ6 A;  1U5D A;  3GYO A;  2UVM A;  2D4Q A;  2KGX B;  3KZ1 A;  2D9V A;  2W2X D;  1TQZ A;  4KHB A;  2Z4D A;  1XKE A;  3D8D A;  1T77 A;  1V5U A;  4Z2M B;  3HW2 B;  1DDM A;  4QJ5 B;  5DHF B;  1PMS A;  2I5C A;  2COD A;  3HQC A;  4A6K A;  5KCV A;  5KQ1 A;  3EPY A;  2DX5 A;  2K8E A;  1P6S A;  1RRP B;  2R2Y A;  2K49 A;  2DFK A;  3P7Z A;  5M4Y B;  1NVL A;  1MIX A;  4ILH A;  3O96 A;  2VSZ A;  3SUZ A;  3M1I B;  1MPH A;  4CSQ A;  4JKB A;  1BWN A;  4XWX A;  4A6F A;  4JK9 A;  2Y7B A;  2CY5 A;  3QWM A;  1WI1 A;  2ROV A;  3T06 A;  4JKF A;  4GPT B;  2W2X C;  2H7D A;  1DRO A;  5IRS A;  1M7E A;  2KIG A;  2I1K A;  3NSU A;  2GS0 A;  2X18 A;  3PVW A;  1U5G A;  3KRX A;  4GMV A;  3SO6 A;  2KCJ A;  2HTH B;  5FI1 A;  3V5W A;  1OQN A;  2NMB A;  4H8S A;  5JHH A;  2QKM A;  2OTX A;  4HAT B;  4HAV B;  2Z0Q A;  1X86 A;  4MY6 A;  3BJI A;  2D9Z A;  5C16 A;  2EMS A;  2RVB B;  3ODO A;  1HB6 A;  3A8Q A;  5L81 A;  1KI1 B;  2P0D A;  3FEH A;  1I2H A;  2GCJ A;  5C5B B;  4CHM A;  4JK7 A;  5LG4 B;  5C6R A;  5HE2 A;  3ODX A;  3DXD A;  2EMT A;  4ZRJ A;  3HIE A;  3KSY A;  5C79 A;  4GN1 A;  2ZPY A;  4Y94 A;  2AL6 A;  1EVH A;  1BAK A;  2DIK A;  4C0A A;  4EMO A;  5J3Q A;  2AEH A;  1BTK A;  4L1R A;  3HK0 A;  4YON A;  1VBG A;  1NU2 A;  2COP A;  2WH5 A;  3D8F A;  2Z59 A;  4HAU B; 
#chains in the Genus database with same CATH homology
 4KHA A;  4A5K A;  4IOY X;  2DHJ A;  4GZU A;  1FGZ A;  4IAP A;  3KRW A;  5FI0 A;  3WYF B;  2DHI A;  3A98 B;  3MDB C;  2P8V A;  4JKD A;  1MK9 B;  1ZC3 B;  2VRW B;  1W1H A;  1UPQ A;  2DYN A;  4WSF A;  4A6H A;  2M38 A;  1X1G A;  1ZC4 B;  1UNP A;  1EAZ A;  2UZS A;  3F5R A;  2G35 A;  4P7I A;  1EGX A;  4KHO A;  2J0M A;  2J0K A;  2ELA A;  4HDQ A;  2IYB A;  1AWE A;  3BIN A;  1FGY A;  3FLV A;  2EC1 A;  1GG3 A;  1JDE A;  1NTV A;  2D2Q A;  1I7A A;  1XOD A;  1U2B A;  2BCJ A;  1SGH A;  4PNK A;  1GC6 A;  2COC A;  1U5F A;  4DX8 A;  4GMX B;  2DX1 A;  2MWN B;  3SBG A;  3DXC A;  2Y8F A;  1WJ1 A;  2V76 A;  4ZRI A;  1MK7 B;  1M7R A;  1N3H A;  1P5T A;  4NSW A;  3FP5 A;  2LOZ A;  2UZR A;  3P6A A;  2DLW A;  1K5G B;  2FDQ A;  5DHA B;  2GCL A;  4BBK A;  1NTI A;  1E5W A;  2RLO A;  4KHB B;  4IFS A;  2L1C A;  3UZT A;  2DTC A;  4K81 A;  4DBB A;  1DIK A;  3AU5 A;  4TKN A;  4F7H A;  2K00 A;  4ILG B;  5HE1 A;  1DBH A;  2DA0 A;  2GJY A;  3ML4 A;  1WJM A;  1WVH A;  2K2U A;  2N23 A;  2RNR B;  3ZDT A;  2LG1 A;  3RCP A;  4D0N B;  3A8P A;  1WGQ A;  1X11 A;  2IFS A;  4A6F B;  1FOE A;  4F7U P;  1HB8 A;  3VOQ A;  5HE3 A;  4WJ7 A;  1V89 A;  3TFM A;  4MK0 A;  2P0H A;  3E9P A;  1KZG A;  4KAX B;  4JKH A;  1QC6 A;  2COA A;  2ABD A;  1KC7 A;  2ROZ B;  2Q13 A;  2RUK B;  2YRY A;  4HAZ B;  5D3X A;  1W1D A;  4CHJ A;  2RQ1 A;  2X0S A;  2LUL A;  5EFX A;  3ULC A;  2CRF A;  1KZ7 A;  1XR0 B;  1IRS A;  2DYQ A;  3VIA A;  5D3V A;  2RSG A;  3ZVR A;  2D9Y A;  4JKG A;  5KQ4 A;  1Q67 A;  2EJ8 A;  3MPX A;  1MIZ B;  3SV1 A;  3QBV B;  4JKA A;  2FJL A;  2CY4 A;  2Z0O A;  5JHG A;  3PG7 A;  1GGO A;  1MKE A;  1B55 A;  2H7E A;  2I1J A;  4F7G A;  3CIK A;  2YT1 A;  1P3R A;  2CAY A;  2DN6 A;  2D9X A;  1DDW A;  1FHW A;  1X05 A;  3E9O A;  5DI9 B;  4TYZ A;  1RJ2 A;  1UNR A;  3E66 A;  4B6H A;  3N7C A;  1J0W A;  3LJU X;  3PZD A;  4HDO A;  2NZ8 B;  3PVL A;  1W1G A;  4KVG B;  5J3T A;  4DXA B;  3SYX A;  5GOW B;  2D10 A;  4HB4 B;  5J3Y A;  5D3Y A;  3GYP A;  1EF1 A;  4GXB A;  2YSZ A;  1LB1 A;  1PLS A;  4K2P A;  3U7D A;  5DIF B;  1Z87 A;  1UPR A;  1H4R A;  5HE0 A;  3TVV A;  4JK8 A;  1OMW A;  3DXE A;  1V5P A;  4DX9 0;  1DDV A;  2YS1 A;  1VBH A;  2LBB A;  2W2W A;  2ELB A;  4NY0 A;  1ACA A;  3IVF A;  1V5M A;  1MAI A;  3PSC A;  1ZSQ A;  2MKR A;  3TO1 A;  2K2J A;  3QIJ A;  3G9W A;  5D27 A;  2D9W A;  5LOP B;  2J59 M;  1QQG A;  1J19 A;  3ENB A;  1AQC A;  4EKU A;  1V61 A;  2MFQ A;  1DYN A;  2YT0 A;  4HB0 B;  5DH9 B;  3U8Z A;  2J0J A;  2COF A;  2R82 A;  5C5B A;  3OAN A;  2DHK A;  1XCG A;  3F0W A;  4HHV A;  3SNH A;  5JLJ B;  5IJM A;  2D11 A;  1XX0 A;  1XD4 A;  2DKQ A;  1FHO A;  1KBL A;  1V88 A;  4JKC A;  2LOX A;  4YL8 A;  2E2X A;  2LKO A;  2KUP A;  1HBK A;  3TCA A;  2FJ9 A;  1WGU A;  3FSS A;  2YVC A;  1UNQ A;  2ADZ A;  3WA0 A;  2QKL A;  2P0F A;  2R09 A;  1U27 A;  4HAY B;  5CLL B;  1FHX A;  1PFJ A;  1U29 A;  3X23 A;  2RGN B;  2R0D A;  4EJN A;  4JKE A;  3SBT A;  3ULB A;  4Z2N A;  4PQ0 A;  4K2O A;  2CB8 A;  2VKI A;  2YS3 A;  3FM8 C;  3PEG A;  1ISN A;  1Y19 B;  2XQN M;  2N0Y A;  2I5F A;  1ST7 A;  3E9L A;  1SHC A;  3TW1 A;  5JVL A;  1NTY A;  4ILJ A;  1FB8 A;  1LW3 A;  2Z0P A;  5CLQ B;  3AJ4 A;  1BTN A;  5JP4 A;  2M14 A;  2DKP A;  4L6E A;  1UEF A;  1OY2 A;  2JP2 A;  1ZVR A;  4HB2 B;  3PP2 A;  2HE7 A;  4HAX B;  2YF0 A;  3AU4 A;  3PVU A;  1H10 A;  1X1F A;  4CYE A;  4K17 A;  4ZRK A;  3CXB B;  1FAO A;  1Y5O A;  3D8E A;  2L2I A;  4JKG B;  3KY9 A;  2MDX A;  2OQB A;  5LON B;  4HAW B;  2YS5 A;  4MT7 A;  1U5E A;  4HB3 B;  1NI2 A;  1ZM0 A;  2CQU A;  2Y8G A;  1TXD A;  5D3W A;  2PZ1 A;  2LYD A;  1WG7 A;  1K5D B;  1GC7 A;  2HRJ A;  4WVF B;  3ODW A;  1TJ6 A;  1U5D A;  3GYO A;  2UVM A;  2D4Q A;  2KGX B;  3KZ1 A;  2D9V A;  2W2X D;  1TQZ A;  1XKE A;  3D8D A;  1V5U A;  4Z2M B;  3HW2 B;  1DDM A;  5DHF B;  1PMS A;  2I5C A;  2COD A;  3HQC A;  4A6K A;  5KCV A;  5KQ1 A;  3EPY A;  2DX5 A;  1P6S A;  1RRP B;  2DFK A;  3P7Z A;  1NVL A;  1MIX A;  4ILH A;  3O96 A;  2VSZ A;  3SUZ A;  3M1I B;  1MPH A;  4JKB A;  1BWN A;  4XWX A;  4A6F A;  4JK9 A;  2Y7B A;  2CY5 A;  3QWM A;  1WI1 A;  2ROV A;  3T06 A;  4JKF A;  4GPT B;  2W2X C;  2H7D A;  1DRO A;  1M7E A;  2I1K A;  3NSU A;  2GS0 A;  2X18 A;  3PVW A;  1U5G A;  3KRX A;  4GMV A;  3SO6 A;  2KCJ A;  2HTH B;  5FI1 A;  3V5W A;  1OQN A;  2NMB A;  4H8S A;  5JHH A;  2QKM A;  2OTX A;  4HAT B;  4HAV B;  2Z0Q A;  1X86 A;  4MY6 A;  3BJI A;  2D9Z A;  5C16 A;  2EMS A;  2RVB B;  3ODO A;  1HB6 A;  3A8Q A;  5L81 A;  1KI1 B;  2P0D A;  3FEH A;  1I2H A;  2GCJ A;  5C5B B;  4CHM A;  4JK7 A;  5C6R A;  5HE2 A;  3ODX A;  3DXD A;  2EMT A;  4ZRJ A;  3KSY A;  5C79 A;  4GN1 A;  2ZPY A;  4Y94 A;  2AL6 A;  1EVH A;  1BAK A;  2DIK A;  4C0A A;  4EMO A;  5J3Q A;  2AEH A;  1BTK A;  3HK0 A;  4YON A;  1VBG A;  1NU2 A;  2COP A;  2WH5 A;  3D8F A;  4HAU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...