1Y19B

Structural basis for phosphatidylinositol phosphate kinase type i-gamma binding to talin at focal adhesions
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
publication title Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein, signaling protein
total genus 58
structure length 192
sequence length 192
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1y19B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y19B02
1HB6A 3FP5A 1V5MA 1U5FA 1XKEA 2YVCA 2N0YA 1HBKA 3BJIA 3SV1A 1U27A 2ABDA 2RLOA 1V5PA 2E2XA 3VIAA 4HAYB 5HE3A 2LULA 1MIZB 3TFMA 2Y8GA 4HDOA 3PP2A 4C0AA 5C16A 4P7IA 1OQNA 3PG7A 2J0MA 2Y8FA 1I7AA 1UNRA 2W2XC 2FDQA 1TJ6A 4F7GA 4CHMA 1ZSQA 2BCJA 3BINA 1FGYA 2DHIA 3PVUA 1FB8A 2IYBA 4KHBB 1GC7A 4ZRIA 5HE2A 1PFJA 1X11A 1NVLA 4KHAA 4DXAB 2EMTA 4WVFB 1IRSA 5D3XA 2VKIA 2CODA 2M14A 2I5CA 1WI1A 4GMVA 2ROZB 1XCGA 2DHKA 2DN6A 2ROVA 2AL6A 3AU5A 5CLLB 3FSSA 2HRJA 4EKUA 1SGHA 2CB8A 1V5UA 2UZSA 2CY5A 2K00A 2LYDA 2COCA 2DFKA 3PVWA 3GYPA 4KAXB 1MAIA 2J0JA 5J3YA 1ACAA 2YT0A 1DROA 3RCPA 4H8SA 2K2JA 4HAXB 2YRYA 5D3YA 1U5GA 1UEFA 2COFA 1W1DA 3PVLA 1EVHA 2L2IA 4L6EA 2RUKB 4A5KA 4HAVB 5CLQB 1FAOA 4Z2NA 2KCJA 1ZM0A 3SO6A 1QQGA 2R0DA 2PZ1A 2RSGA 4KVGB 2I1JA 5KQ1A 3SUZA 1MK9B 2GS0A 3ODOA 3A8QA 3DXDA 3D8EA 3CXBB 1P6SA 1ST7A 2Q13A 2I1KA 2ELAA 2YSZA 1NTVA 2MWNB 2Y7BA 4GXBA 1OY2A 4DX8A 1QC6A 2D9XA 4HB0B 2LBBA 4EJNA 3P7ZA 2HTHB 2ELBA 3IVFA 2QKMA 3SYXA 1RRPB 3TCAA 4ZRKA 3N7CA 2YS1A 2VSZA 1ISNA 1DBHA 4HB2B 4HAWB 3HQCA 2YS5A 2LOZA 1WG7A 1W1HA 3KRXA 3PSCA 1X1FA 1U5EA 3V5WA 5JP4A 1J0WA 3HK0A 2DX5A 1J19A 3F5RA 2UZRA 2D9WA 5LONB 2W2XD 4BBKA 3PEGA 2R09A 2OQBA 2CAYA 3KRWA 4B6HA 2WH5A 3F0WA 4WJ7A 2FJLA 3ODXA 1U5DA 2LKOA 5J3TA 3ZDTA 2CRFA 2GCLA 3DXEA 1M7EA 1V89A 3KY9A 1XR0B 2L1CA 2M38A 2D9YA 2MKRA 1U2BA 3SNHA 5FI0A 3D8FA 4D0NB 1NTYA 1Z87A 3T06A 4K2OA 1MPHA 2Z0PA 1GG3A 2K2UA 2H7DA 2EC1A 5KQ4A 4DBBA 1FHWA 1WVHA 2DKPA 4IFSA 1V88A 2P8VA 4F7UP 1FHXA 2D2QA 1FGZA 3KSYA 1SHCA 1M7RA 4A6KA 2UVMA 3P6AA 3M1IB 4Y94A 3ML4A 5D3VA 5J3QA 3A8PA 5IJMA 5EFXA 1MK7B 1KZGA 4ZRJA 2MFQA 2I5FA 4WSFA 1P3RA 1ZVRA 1MKEA 3TVVA 2ADZA 2D4QA 2Z0OA 1ZC3B 2D9ZA 4XWXA 2DTCA 2Z0QA 2X18A 2D11A 3U8ZA 4YONA 2J0KA 1LW3A 3AU4A 1OMWA 2DHJA 3OANA 1V61A 1LB1A 1PLSA 1X1GA 3EPYA 2DLWA 3A98B 3QWMA 2DX1A 2DYQA 2P0DA 1BTKA 1DDWA 5C6RA 2RGNB 5JHHA 2V76A 1BTNA 2YT1A 4KHOA 1I2HA 2CQUA 1HB8A 1XD4A 3X23A 3O96A 5L81A 1Y5OA 1EAZA 1FHOA 4HB4B 4K2PA 3WYFB 1WJMA 5HE0A 4MK0A 1UNQA 4Z2MB 3CIKA 4DX90 2XQNM 4HB3B 1Y19B 4K81A 2RVBB 5DH9B 3DXCA 2NMBA 4F7HA 2OTXA 1ZC4B 1DDVA 3G9WA 1WGQA 2DA0A 1UPRA 3PZDA 1KZ7A 2KUPA 1UNPA 1KI1B 1N3HA 3QIJA 5D3WA 4GZUA 4A6FA 4EMOA 2FJ9A 3ODWA 5C79A 1NTIA 2QKLA 2NZ8B 4YL8A 1BWNA 2VRWB 4IAPA 3WA0A 1AQCA 2P0HA 2RNRB 1MIXA 5C5BA 3FM8C 1WJ1A 3ZVRA 2D10A 2W2WA 5FI1A 1GC6A 1TXDA 2MDXA 2EMSA 5JHGA 2GJYA 4NSWA 3VOQA 2D9VA 3U7DA 1H10A 1Q67A 2YS3A 3HW2B 2IFSA 2ZPYA 1XODA 1W1GA 2YF0A 4GMXB 1P5TA 1NU2A 3D8DA 2COPA 3ULBA 2H7EA 4PNKA 2LOXA 1FOEA 1K5DB 5KCVA 3GYOA 4TYZA 4HAZB 4GN1A 4HDQA 5LOPB 2CY4A 5DHAB 4HATB 2GCJA 2DKQA 1EGXA 3NSUA 2HE7A 5DI9B 1X05A 4A6HA 5JLJB 5HE1A 3UZTA 5DHFB 1K5GB 3MDBC 4MT7A 1XX0A 1DYNA 3FEHA 3QBVB 1UPQA 4NY0A 3AJ4A 1RJ2A 4MY6A 4A6FB 1B55A 1BAKA 2RQ1A 1X86A 4IOYX 2J59M 1TQZA 2COAA 4K17A 4CHJA 4PQ0A 2N23A 3TW1A 2P0FA 4HAUB 1E5WA 1H4RA 1PMSA 3LJUX 4TKNA 2JP2A 3MPXA 5C5BB 1NI2A 2AEHA 1EF1A 1U29A 3KZ1A 3FLVA 5D27A 2LG1A 2G35A 1DDMA 2EJ8A 5GOWB 2KGXB 4CYEA 5DIFB 4GPTB 1WGUA 3ULCA 1AWEA 4HHVA 2DYNA 3TO1A
chains in the Genus database with same CATH superfamily
1HB6A 3FP5A 1V5MA 1U5FA 4CSQA 1XKEA 2YVCA 2N0YA 1HBKA 3BJIA 3SV1A 1U27A 2ABDA 2RLOA 1V5PA 2E2XA 3VIAA 4HAYB 2ZKMX 4QJ5B 5HE3A 5M4YB 2LULA 1MIZB 3TFMA 2Y8GA 4HDOA 2KR0A 3PP2A 4C0AA 2KIEA 5C16A 4P7IA 4GOUA 1OQNA 3PG7A 3FVCA 4JKDA 2J0MA 2Y8FA 1I7AA 1UNRA 2W2XC 2FDQA 1TJ6A 4F7GA 4CHMA 1ZSQA 2BCJA 3BINA 4JKEA 1FGYA 2DHIA 3PVUA 1FB8A 2IYBA 4KHBB 1GC7A 4ZRIA 5HE2A 1PFJA 1X11A 1NVLA 4KHAA 4DXAB 2EMTA 4WVFB 1IRSA 5D3XA 4D6WA 2VKIA 2CODA 2M14A 2I5CA 1WI1A 4GMVA 2ROZB 1XCGA 2DHKA 2DN6A 2ROVA 2AL6A 3AU5A 5CLLB 3FSSA 2HRJA 4EKUA 2RRFA 1SGHA 2CB8A 1V5UA 2UZSA 2CY5A 2K00A 2LYDA 2COCA 2DFKA 3PVWA 3GYPA 4KAXB 1MAIA 2J0JA 5J3YA 3SBTA 1ACAA 2YT0A 1DROA 3RCPA 4H8SA 2K2JA 4HAXB 2YRYA 5D3YA 1U5GA 1UEFA 2COFA 5I2MA 1W1DA 3PVLA 2FJUB 1EVHA 4JKFA 2L2IA 4L6EA 4ILHA 4QJ3B 2RUKB 4A5KA 4HAVB 5CLQB 1FAOA 4Z2NA 2KCJA 1ZM0A 3SO6A 5LG4B 4JK7A 1QQGA 2R0DA 2PZ1A 2RSGA 4KVGB 2I1JA 5KQ1A 3SUZA 1MI1A 1MK9B 4OSNA 2GS0A 3ODOA 4QXAB 3A8QA 3DXDA 3U12A 3D8EA 3CXBB 1P6SA 1ST7A 3NWDA 2Q13A 2I1KA 2ELAA 2YSZA 1NTVA 2MWNB 2KIGA 2Y7BA 4GXBA 1OY2A 4DX8A 1QC6A 2D9XA 4HB0B 2LBBA 4EJNA 3P7ZA 3E9OA 2HTHB 2ELBA 3IVFA 4QJ4B 3HIEA 2QKMA 3SYXA 1RRPB 3TCAA 4ZRKA 3N7CA 2YS1A 2VSZA 1ISNA 1DBHA 4HB2B 4HAWB 2Z14A 3HQCA 2YS5A 2LOZA 2Z59A 1WG7A 1W1HA 3KRXA 3PSCA 1X1FA 2GUMA 1U5EA 3V5WA 1GGOA 5JP4A 1J0WA 3DCXA 3HK0A 2DX5A 1J19A 3F5RA 2UZRA 2D9WA 5LONB 2W2XD 4BBKA 3PEGA 4DIXA 2R09A 2OQBA 2CAYA 3KRWA 4B6HA 2WH5A 3F0WA 4WJ7A 2FJLA 3ODXA 1U5DA 2LKOA 5J3TA 3ZDTA 2CRFA 2GCLA 3DXEA 1M7EA 4OT1A 1V89A 4JK8A 3KY9A 1XR0B 2L1CA 2M38A 2D9YA 2MKRA 1U2BA 3SNHA 5FI0A 3D8FA 4D0NB 1NTYA 1Z87A 3T06A 4K2OA 1MPHA 2Z0PA 1GG3A 2K2UA 2Z13A 2H7DA 2EC1A 5KQ4A 4DBBA 1FHWA 4JKAA 1WVHA 2DKPA 2R82A 4IFSA 1V88A 3SBGA 2P8VA 4F7UP 3E9PA 1FHXA 2D2QA 1FGZA 3KSYA 1SHCA 1M7RA 4A6KA 2UVMA 3P6AA 5I2SA 3M1IB 4Y94A 3E9LA 4L1RA 3ML4A 4JKBA 5D3VA 5J3QA 3A8PA 5IJMA 5EFXA 1MK7B 1KZGA 2KUQA 1DIKA 4ZRJA 2MFQA 2I5FA 4WSFA 1P3RA 1ZVRA 1MKEA 3TVVA 2ADZA 1T77A 2D4QA 1ZC3B 2Z0OA 2D9ZA 4XWXA 2DTCA 2Z0QA 2X18A 2D11A 3U8ZA 4YONA 2J0KA 3B77A 1LW3A 3AU4A 1OMWA 2DHJA 3OANA 1V61A 1LB1A 4JKCA 1PLSA 1X1GA 3EPYA 2DLWA 3A98B 2Z4DA 1JDEA 3QWMA 2DX1A 2DYQA 2P0DA 1BTKA 1DDWA 5C6RA 2RGNB 5JHHA 2V76A 1BTNA 2YT1A 4KHOA 1I2HA 2CQUA 1KBLA 1HB8A 1XD4A 3X23A 3O96A 5L81A 1Y5OA 1EAZA 4ILJA 1FHOA 4HB4B 4K2PA 3WYFB 1WJMA 5HE0A 4MK0A 1UNQA 4Z2MB 3CIKA 4DX90 2XQNM 4HB3B 1Y19B 4K81A 2RVBB 5DH9B 4GNKB 3DXCA 2NMBA 4F7HA 2OTXA 1ZC4B 1DDVA 3G9WA 1WGQA 2DA0A 1UPRA 3PZDA 1KZ7A 2KUPA 1UNPA 1KI1B 1N3HA 3QIJA 2K8EA 5D3WA 4GZUA 4A6FA 4EMOA 1VBGA 2FJ9A 2X0SA 3ODWA 1NTIA 5C79A 2QKLA 2NZ8B 4YL8A 1BWNA 2VRWB 3E66A 4IAPA 3WA0A 1AQCA 2P0HA 2RNRB 4HSIA 3NWAA 1MIXA 5C5BA 3FM8C 1WJ1A 4ILGB 3ZVRA 2D10A 2W2WA 5FI1A 1GC6A 1TXDA 2MDXA 2EMSA 5JHGA 2GJYA 4NSWA 4JKGA 3VOQA 2D9VA 2K49A 3U7DA 1H10A 1Q67A 2YS3A 3HW2B 3NWFA 2IFSA 2ZPYA 1XODA 1W1GA 2YF0A 4GMXB 1P5TA 1NU2A 3D8DA 2COPA 3ULBA 2H7EA 4PNKA 5JVLA 2LOXA 1FOEA 1K5DB 3NW8A 5KCVA 3GYOA 4TYZA 4HAZB 4GN1A 4HDQA 5LOPB 2CY4A 5DHAB 2NBVA 4HATB 2GCJA 2DKQA 1EGXA 3NSUA 2HE7A 1KC7A 2YT2A 5DI9B 1X05A 4A6HA 5JLJB 4JK9A 5HE1A 3UZTA 5DHFB 1K5GB 3MDBC 4MT7A 1XX0A 1DYNA 3FEHA 3A58A 3QBVB 3HSAA 1UPQA 4NY0A 3AJ4A 1RJ2A 4MY6A 4A6FB 1B55A 4KHBA 1VBHA 1BAKA 2RQ1A 1X86A 4IOYX 4JKHA 2J59M 1ZYIA 1TQZA 2COAA 4K17A 4CHJA 4PQ0A 2N23A 3TW1A 3ENBA 5IRSA 2P0FA 4HAUB 1E5WA 1H4RA 1PMSA 3LJUX 4TKNA 2JP2A 3MPXA 5C5BB 3OHMB 1NI2A 2AEHA 1EF1A 1U29A 3KZ1A 3FLVA 5D27A 2DIKA 2LG1A 2G35A 4JKGB 2EJ8A 1DDMA 5GOWB 2KGXB 2R2YA 4CYEA 5DIFB 4GPTB 1WGUA 3ULCA 1AWEA 4HHVA 2DYNA 3TO1A
chains in the Genus database with same CATH topology
1HB6A 3FP5A 1V5MA 1U5FA 1XKEA 2YVCA 2N0YA 1HBKA 3BJIA 3SV1A 1U27A 2ABDA 2RLOA 1V5PA 2E2XA 3VIAA 4HAYB 5HE3A 2LULA 1MIZB 3TFMA 2Y8GA 4HDOA 3PP2A 4C0AA 5C16A 4P7IA 1OQNA 3PG7A 4JKDA 2J0MA 2Y8FA 1I7AA 1UNRA 2W2XC 2FDQA 1TJ6A 4F7GA 4CHMA 1ZSQA 2BCJA 3BINA 4JKEA 1FGYA 2DHIA 3PVUA 1FB8A 2IYBA 4KHBB 1GC7A 4ZRIA 5HE2A 1PFJA 1X11A 1NVLA 4KHAA 4DXAB 2EMTA 4WVFB 1IRSA 5D3XA 2VKIA 2CODA 2M14A 2I5CA 1WI1A 4GMVA 2ROZB 1XCGA 2DHKA 2DN6A 2ROVA 2AL6A 3AU5A 5CLLB 3FSSA 2HRJA 4EKUA 1SGHA 2CB8A 1V5UA 2UZSA 2CY5A 2K00A 2LYDA 2COCA 2DFKA 3PVWA 3GYPA 4KAXB 1MAIA 2J0JA 5J3YA 3SBTA 1ACAA 2YT0A 1DROA 3RCPA 4H8SA 2K2JA 4HAXB 2YRYA 5D3YA 1U5GA 1UEFA 2COFA 1W1DA 3PVLA 1EVHA 4JKFA 2L2IA 4L6EA 4ILHA 2RUKB 4A5KA 4HAVB 5CLQB 1FAOA 4Z2NA 2KCJA 1ZM0A 3SO6A 4JK7A 1QQGA 2R0DA 2PZ1A 2RSGA 4KVGB 2I1JA 5KQ1A 3SUZA 1MK9B 2GS0A 3ODOA 3A8QA 3DXDA 3D8EA 3CXBB 1P6SA 1ST7A 2Q13A 2I1KA 2ELAA 2YSZA 1NTVA 2MWNB 2Y7BA 4GXBA 1OY2A 4DX8A 1QC6A 2D9XA 4HB0B 2LBBA 4EJNA 3P7ZA 3E9OA 2HTHB 2ELBA 3IVFA 2QKMA 3SYXA 1RRPB 3TCAA 4ZRKA 3N7CA 2YS1A 2VSZA 1ISNA 1DBHA 4HB2B 4HAWB 3HQCA 2YS5A 2LOZA 1WG7A 1W1HA 3KRXA 3PSCA 1X1FA 1U5EA 3V5WA 1GGOA 5JP4A 1J0WA 3HK0A 2DX5A 1J19A 3F5RA 2UZRA 2D9WA 5LONB 2W2XD 4BBKA 3PEGA 2R09A 2OQBA 2CAYA 3KRWA 4B6HA 2WH5A 3F0WA 4WJ7A 2FJLA 3ODXA 1U5DA 2LKOA 5J3TA 3ZDTA 2CRFA 2GCLA 3DXEA 1M7EA 1V89A 4JK8A 3KY9A 1XR0B 2L1CA 2M38A 2D9YA 2MKRA 1U2BA 3SNHA 5FI0A 3D8FA 4D0NB 1NTYA 1Z87A 3T06A 4K2OA 1MPHA 2Z0PA 1GG3A 2K2UA 2H7DA 2EC1A 5KQ4A 4DBBA 1FHWA 4JKAA 1WVHA 2DKPA 2R82A 4IFSA 1V88A 3SBGA 2P8VA 4F7UP 3E9PA 1FHXA 2D2QA 1FGZA 3KSYA 1SHCA 1M7RA 4A6KA 2UVMA 3P6AA 3M1IB 4Y94A 3E9LA 3ML4A 4JKBA 5D3VA 5J3QA 3A8PA 5IJMA 5EFXA 1MK7B 1KZGA 1DIKA 4ZRJA 2MFQA 2I5FA 4WSFA 1P3RA 1ZVRA 1MKEA 3TVVA 2ADZA 2D4QA 2Z0OA 1ZC3B 2D9ZA 4XWXA 2DTCA 2Z0QA 2X18A 2D11A 3U8ZA 4YONA 2J0KA 1LW3A 3AU4A 1OMWA 2DHJA 3OANA 1V61A 1LB1A 4JKCA 1PLSA 1X1GA 3EPYA 2DLWA 3A98B 1JDEA 3QWMA 2DX1A 2DYQA 2P0DA 1BTKA 1DDWA 5C6RA 2RGNB 5JHHA 2V76A 1BTNA 2YT1A 4KHOA 1I2HA 2CQUA 1KBLA 1HB8A 1XD4A 3X23A 3O96A 5L81A 1Y5OA 1EAZA 4ILJA 1FHOA 4HB4B 4K2PA 3WYFB 1WJMA 5HE0A 4MK0A 1UNQA 4Z2MB 3CIKA 4DX90 2XQNM 4HB3B 1Y19B 4K81A 2RVBB 5DH9B 3DXCA 2NMBA 4F7HA 2OTXA 1ZC4B 1DDVA 3G9WA 1WGQA 2DA0A 1UPRA 3PZDA 1KZ7A 2KUPA 1UNPA 1KI1B 1N3HA 3QIJA 5D3WA 4GZUA 4A6FA 4EMOA 1VBGA 2FJ9A 2X0SA 3ODWA 1NTIA 5C79A 2QKLA 2NZ8B 4YL8A 1BWNA 2VRWB 3E66A 4IAPA 3WA0A 1AQCA 2P0HA 2RNRB 1MIXA 5C5BA 3FM8C 1WJ1A 4ILGB 3ZVRA 2D10A 2W2WA 5FI1A 1GC6A 1TXDA 2MDXA 2EMSA 5JHGA 2GJYA 4NSWA 4JKGA 3VOQA 2D9VA 3U7DA 1H10A 1Q67A 2YS3A 3HW2B 2IFSA 2ZPYA 1XODA 1W1GA 2YF0A 4GMXB 1P5TA 1NU2A 3D8DA 2COPA 3ULBA 2H7EA 4PNKA 5JVLA 2LOXA 1FOEA 1K5DB 5KCVA 3GYOA 4TYZA 4HAZB 4GN1A 4HDQA 5LOPB 2CY4A 5DHAB 4HATB 2GCJA 2DKQA 1EGXA 3NSUA 2HE7A 1KC7A 5DI9B 1X05A 4A6HA 5JLJB 4JK9A 5HE1A 3UZTA 5DHFB 1K5GB 3MDBC 4MT7A 1XX0A 1DYNA 3FEHA 3QBVB 1UPQA 4NY0A 3AJ4A 1RJ2A 4MY6A 4A6FB 1B55A 1VBHA 1BAKA 2RQ1A 1X86A 4IOYX 4JKHA 2J59M 1TQZA 2COAA 4K17A 4CHJA 4PQ0A 2N23A 3TW1A 3ENBA 2P0FA 4HAUB 1E5WA 1H4RA 1PMSA 3LJUX 4TKNA 2JP2A 3MPXA 5C5BB 1NI2A 2AEHA 1EF1A 1U29A 3KZ1A 3FLVA 5D27A 2DIKA 2LG1A 2G35A 4JKGB 2EJ8A 1DDMA 5GOWB 2KGXB 4CYEA 5DIFB 4GPTB 1WGUA 3ULCA 1AWEA 4HHVA 2DYNA 3TO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HB6 A;  3FP5 A;  1V5M A;  1U5F A;  1XKE A;  2YVC A;  2N0Y A;  1HBK A;  3BJI A;  3SV1 A;  1U27 A;  2ABD A;  2RLO A;  1V5P A;  2E2X A;  3VIA A;  4HAY B;  5HE3 A;  2LUL A;  1MIZ B;  3TFM A;  2Y8G A;  4HDO A;  3PP2 A;  4C0A A;  5C16 A;  4P7I A;  1OQN A;  3PG7 A;  2J0M A;  2Y8F A;  1I7A A;  1UNR A;  2W2X C;  2FDQ A;  1TJ6 A;  4F7G A;  4CHM A;  1ZSQ A;  2BCJ A;  3BIN A;  1FGY A;  2DHI A;  3PVU A;  1FB8 A;  2IYB A;  4KHB B;  1GC7 A;  4ZRI A;  5HE2 A;  1PFJ A;  1X11 A;  1NVL A;  4KHA A;  4DXA B;  2EMT A;  4WVF B;  1IRS A;  5D3X A;  2VKI A;  2COD A;  2M14 A;  2I5C A;  1WI1 A;  4GMV A;  2ROZ B;  1XCG A;  2DHK A;  2DN6 A;  2ROV A;  2AL6 A;  3AU5 A;  5CLL B;  3FSS A;  2HRJ A;  4EKU A;  1SGH A;  2CB8 A;  1V5U A;  2UZS A;  2CY5 A;  2K00 A;  2LYD A;  2COC A;  2DFK A;  3PVW A;  3GYP A;  4KAX B;  1MAI A;  2J0J A;  5J3Y A;  1ACA A;  2YT0 A;  1DRO A;  3RCP A;  4H8S A;  2K2J A;  4HAX B;  2YRY A;  5D3Y A;  1U5G A;  1UEF A;  2COF A;  1W1D A;  3PVL A;  1EVH A;  2L2I A;  4L6E A;  2RUK B;  4A5K A;  4HAV B;  5CLQ B;  1FAO A;  4Z2N A;  2KCJ A;  1ZM0 A;  3SO6 A;  1QQG A;  2R0D A;  2PZ1 A;  2RSG A;  4KVG B;  2I1J A;  5KQ1 A;  3SUZ A;  1MK9 B;  2GS0 A;  3ODO A;  3A8Q A;  3DXD A;  3D8E A;  3CXB B;  1P6S A;  1ST7 A;  2Q13 A;  2I1K A;  2ELA A;  2YSZ A;  1NTV A;  2MWN B;  2Y7B A;  4GXB A;  1OY2 A;  4DX8 A;  1QC6 A;  2D9X A;  4HB0 B;  2LBB A;  4EJN A;  3P7Z A;  2HTH B;  2ELB A;  3IVF A;  2QKM A;  3SYX A;  1RRP B;  3TCA A;  4ZRK A;  3N7C A;  2YS1 A;  2VSZ A;  1ISN A;  1DBH A;  4HB2 B;  4HAW B;  3HQC A;  2YS5 A;  2LOZ A;  1WG7 A;  1W1H A;  3KRX A;  3PSC A;  1X1F A;  1U5E A;  3V5W A;  5JP4 A;  1J0W A;  3HK0 A;  2DX5 A;  1J19 A;  3F5R A;  2UZR A;  2D9W A;  5LON B;  2W2X D;  4BBK A;  3PEG A;  2R09 A;  2OQB A;  2CAY A;  3KRW A;  4B6H A;  2WH5 A;  3F0W A;  4WJ7 A;  2FJL A;  3ODX A;  1U5D A;  2LKO A;  5J3T A;  3ZDT A;  2CRF A;  2GCL A;  3DXE A;  1M7E A;  1V89 A;  3KY9 A;  1XR0 B;  2L1C A;  2M38 A;  2D9Y A;  2MKR A;  1U2B A;  3SNH A;  5FI0 A;  3D8F A;  4D0N B;  1NTY A;  1Z87 A;  3T06 A;  4K2O A;  1MPH A;  2Z0P A;  1GG3 A;  2K2U A;  2H7D A;  2EC1 A;  5KQ4 A;  4DBB A;  1FHW A;  1WVH A;  2DKP A;  4IFS A;  1V88 A;  2P8V A;  4F7U P;  1FHX A;  2D2Q A;  1FGZ A;  3KSY A;  1SHC A;  1M7R A;  4A6K A;  2UVM A;  3P6A A;  3M1I B;  4Y94 A;  3ML4 A;  5D3V A;  5J3Q A;  3A8P A;  5IJM A;  5EFX A;  1MK7 B;  1KZG A;  4ZRJ A;  2MFQ A;  2I5F A;  4WSF A;  1P3R A;  1ZVR A;  1MKE A;  3TVV A;  2ADZ A;  2D4Q A;  2Z0O A;  1ZC3 B;  2D9Z A;  4XWX A;  2DTC A;  2Z0Q A;  2X18 A;  2D11 A;  3U8Z A;  4YON A;  2J0K A;  1LW3 A;  3AU4 A;  1OMW A;  2DHJ A;  3OAN A;  1V61 A;  1LB1 A;  1PLS A;  1X1G A;  3EPY A;  2DLW A;  3A98 B;  3QWM A;  2DX1 A;  2DYQ A;  2P0D A;  1BTK A;  1DDW A;  5C6R A;  2RGN B;  5JHH A;  2V76 A;  1BTN A;  2YT1 A;  4KHO A;  1I2H A;  2CQU A;  1HB8 A;  1XD4 A;  3X23 A;  3O96 A;  5L81 A;  1Y5O A;  1EAZ A;  1FHO A;  4HB4 B;  4K2P A;  3WYF B;  1WJM A;  5HE0 A;  4MK0 A;  1UNQ A;  4Z2M B;  3CIK A;  4DX9 0;  2XQN M;  4HB3 B;  1Y19 B;  4K81 A;  2RVB B;  5DH9 B;  3DXC A;  2NMB A;  4F7H A;  2OTX A;  1ZC4 B;  1DDV A;  3G9W A;  1WGQ A;  2DA0 A;  1UPR A;  3PZD A;  1KZ7 A;  2KUP A;  1UNP A;  1KI1 B;  1N3H A;  3QIJ A;  5D3W A;  4GZU A;  4A6F A;  4EMO A;  2FJ9 A;  3ODW A;  5C79 A;  1NTI A;  2QKL A;  2NZ8 B;  4YL8 A;  1BWN A;  2VRW B;  4IAP A;  3WA0 A;  1AQC A;  2P0H A;  2RNR B;  1MIX A;  5C5B A;  3FM8 C;  1WJ1 A;  3ZVR A;  2D10 A;  2W2W A;  5FI1 A;  1GC6 A;  1TXD A;  2MDX A;  2EMS A;  5JHG A;  2GJY A;  4NSW A;  3VOQ A;  2D9V A;  3U7D A;  1H10 A;  1Q67 A;  2YS3 A;  3HW2 B;  2IFS A;  2ZPY A;  1XOD A;  1W1G A;  2YF0 A;  4GMX B;  1P5T A;  1NU2 A;  3D8D A;  2COP A;  3ULB A;  2H7E A;  4PNK A;  2LOX A;  1FOE A;  1K5D B;  5KCV A;  3GYO A;  4TYZ A;  4HAZ B;  4GN1 A;  4HDQ A;  5LOP B;  2CY4 A;  5DHA B;  4HAT B;  2GCJ A;  2DKQ A;  1EGX A;  3NSU A;  2HE7 A;  5DI9 B;  1X05 A;  4A6H A;  5JLJ B;  5HE1 A;  3UZT A;  5DHF B;  1K5G B;  3MDB C;  4MT7 A;  1XX0 A;  1DYN A;  3FEH A;  3QBV B;  1UPQ A;  4NY0 A;  3AJ4 A;  1RJ2 A;  4MY6 A;  4A6F B;  1B55 A;  1BAK A;  2RQ1 A;  1X86 A;  4IOY X;  2J59 M;  1TQZ A;  2COA A;  4K17 A;  4CHJ A;  4PQ0 A;  2N23 A;  3TW1 A;  2P0F A;  4HAU B;  1E5W A;  1H4R A;  1PMS A;  3LJU X;  4TKN A;  2JP2 A;  3MPX A;  5C5B B;  1NI2 A;  2AEH A;  1EF1 A;  1U29 A;  3KZ1 A;  3FLV A;  5D27 A;  2LG1 A;  2G35 A;  1DDM A;  2EJ8 A;  5GOW B;  2KGX B;  4CYE A;  5DIF B;  4GPT B;  1WGU A;  3ULC A;  1AWE A;  4HHV A;  2DYN A;  3TO1 A; 
#chains in the Genus database with same CATH topology
 1HB6 A;  3FP5 A;  1V5M A;  1U5F A;  4CSQ A;  1XKE A;  2YVC A;  2N0Y A;  1HBK A;  3BJI A;  3SV1 A;  1U27 A;  2ABD A;  2RLO A;  1V5P A;  2E2X A;  3VIA A;  4HAY B;  2ZKM X;  4QJ5 B;  5HE3 A;  5M4Y B;  2LUL A;  1MIZ B;  3TFM A;  2Y8G A;  4HDO A;  2KR0 A;  3PP2 A;  4C0A A;  2KIE A;  5C16 A;  4P7I A;  4GOU A;  1OQN A;  3PG7 A;  3FVC A;  4JKD A;  2J0M A;  2Y8F A;  1I7A A;  1UNR A;  2W2X C;  2FDQ A;  1TJ6 A;  4F7G A;  4CHM A;  1ZSQ A;  2BCJ A;  3BIN A;  4JKE A;  1FGY A;  2DHI A;  3PVU A;  1FB8 A;  2IYB A;  4KHB B;  1GC7 A;  4ZRI A;  5HE2 A;  1PFJ A;  1X11 A;  1NVL A;  4KHA A;  4DXA B;  2EMT A;  4WVF B;  1IRS A;  5D3X A;  4D6W A;  2VKI A;  2COD A;  2M14 A;  2I5C A;  1WI1 A;  4GMV A;  2ROZ B;  1XCG A;  2DHK A;  2DN6 A;  2ROV A;  2AL6 A;  3AU5 A;  5CLL B;  3FSS A;  2HRJ A;  4EKU A;  2RRF A;  1SGH A;  2CB8 A;  1V5U A;  2UZS A;  2CY5 A;  2K00 A;  2LYD A;  2COC A;  2DFK A;  3PVW A;  3GYP A;  4KAX B;  1MAI A;  2J0J A;  5J3Y A;  3SBT A;  1ACA A;  2YT0 A;  1DRO A;  3RCP A;  4H8S A;  2K2J A;  4HAX B;  2YRY A;  5D3Y A;  1U5G A;  1UEF A;  2COF A;  5I2M A;  1W1D A;  3PVL A;  2FJU B;  1EVH A;  4JKF A;  2L2I A;  4L6E A;  4ILH A;  4QJ3 B;  2RUK B;  4A5K A;  4HAV B;  5CLQ B;  1FAO A;  4Z2N A;  2KCJ A;  1ZM0 A;  3SO6 A;  5LG4 B;  4JK7 A;  1QQG A;  2R0D A;  2PZ1 A;  2RSG A;  4KVG B;  2I1J A;  5KQ1 A;  3SUZ A;  1MI1 A;  1MK9 B;  4OSN A;  2GS0 A;  3ODO A;  4QXA B;  3A8Q A;  3DXD A;  3U12 A;  3D8E A;  3CXB B;  1P6S A;  1ST7 A;  3NWD A;  2Q13 A;  2I1K A;  2ELA A;  2YSZ A;  1NTV A;  2MWN B;  2KIG A;  2Y7B A;  4GXB A;  1OY2 A;  4DX8 A;  1QC6 A;  2D9X A;  4HB0 B;  2LBB A;  4EJN A;  3P7Z A;  3E9O A;  2HTH B;  2ELB A;  3IVF A;  4QJ4 B;  3HIE A;  2QKM A;  3SYX A;  1RRP B;  3TCA A;  4ZRK A;  3N7C A;  2YS1 A;  2VSZ A;  1ISN A;  1DBH A;  4HB2 B;  4HAW B;  2Z14 A;  3HQC A;  2YS5 A;  2LOZ A;  2Z59 A;  1WG7 A;  1W1H A;  3KRX A;  3PSC A;  1X1F A;  2GUM A;  1U5E A;  3V5W A;  1GGO A;  5JP4 A;  1J0W A;  3DCX A;  3HK0 A;  2DX5 A;  1J19 A;  3F5R A;  2UZR A;  2D9W A;  5LON B;  2W2X D;  4BBK A;  3PEG A;  4DIX A;  2R09 A;  2OQB A;  2CAY A;  3KRW A;  4B6H A;  2WH5 A;  3F0W A;  4WJ7 A;  2FJL A;  3ODX A;  1U5D A;  2LKO A;  5J3T A;  3ZDT A;  2CRF A;  2GCL A;  3DXE A;  1M7E A;  4OT1 A;  1V89 A;  4JK8 A;  3KY9 A;  1XR0 B;  2L1C A;  2M38 A;  2D9Y A;  2MKR A;  1U2B A;  3SNH A;  5FI0 A;  3D8F A;  4D0N B;  1NTY A;  1Z87 A;  3T06 A;  4K2O A;  1MPH A;  2Z0P A;  1GG3 A;  2K2U A;  2Z13 A;  2H7D A;  2EC1 A;  5KQ4 A;  4DBB A;  1FHW A;  4JKA A;  1WVH A;  2DKP A;  2R82 A;  4IFS A;  1V88 A;  3SBG A;  2P8V A;  4F7U P;  3E9P A;  1FHX A;  2D2Q A;  1FGZ A;  3KSY A;  1SHC A;  1M7R A;  4A6K A;  2UVM A;  3P6A A;  5I2S A;  3M1I B;  4Y94 A;  3E9L A;  4L1R A;  3ML4 A;  4JKB A;  5D3V A;  5J3Q A;  3A8P A;  5IJM A;  5EFX A;  1MK7 B;  1KZG A;  2KUQ A;  1DIK A;  4ZRJ A;  2MFQ A;  2I5F A;  4WSF A;  1P3R A;  1ZVR A;  1MKE A;  3TVV A;  2ADZ A;  1T77 A;  2D4Q A;  1ZC3 B;  2Z0O A;  2D9Z A;  4XWX A;  2DTC A;  2Z0Q A;  2X18 A;  2D11 A;  3U8Z A;  4YON A;  2J0K A;  3B77 A;  1LW3 A;  3AU4 A;  1OMW A;  2DHJ A;  3OAN A;  1V61 A;  1LB1 A;  4JKC A;  1PLS A;  1X1G A;  3EPY A;  2DLW A;  3A98 B;  2Z4D A;  1JDE A;  3QWM A;  2DX1 A;  2DYQ A;  2P0D A;  1BTK A;  1DDW A;  5C6R A;  2RGN B;  5JHH A;  2V76 A;  1BTN A;  2YT1 A;  4KHO A;  1I2H A;  2CQU A;  1KBL A;  1HB8 A;  1XD4 A;  3X23 A;  3O96 A;  5L81 A;  1Y5O A;  1EAZ A;  4ILJ A;  1FHO A;  4HB4 B;  4K2P A;  3WYF B;  1WJM A;  5HE0 A;  4MK0 A;  1UNQ A;  4Z2M B;  3CIK A;  4DX9 0;  2XQN M;  4HB3 B;  1Y19 B;  4K81 A;  2RVB B;  5DH9 B;  4GNK B;  3DXC A;  2NMB A;  4F7H A;  2OTX A;  1ZC4 B;  1DDV A;  3G9W A;  1WGQ A;  2DA0 A;  1UPR A;  3PZD A;  1KZ7 A;  2KUP A;  1UNP A;  1KI1 B;  1N3H A;  3QIJ A;  2K8E A;  5D3W A;  4GZU A;  4A6F A;  4EMO A;  1VBG A;  2FJ9 A;  2X0S A;  3ODW A;  1NTI A;  5C79 A;  2QKL A;  2NZ8 B;  4YL8 A;  1BWN A;  2VRW B;  3E66 A;  4IAP A;  3WA0 A;  1AQC A;  2P0H A;  2RNR B;  4HSI A;  3NWA A;  1MIX A;  5C5B A;  3FM8 C;  1WJ1 A;  4ILG B;  3ZVR A;  2D10 A;  2W2W A;  5FI1 A;  1GC6 A;  1TXD A;  2MDX A;  2EMS A;  5JHG A;  2GJY A;  4NSW A;  4JKG A;  3VOQ A;  2D9V A;  2K49 A;  3U7D A;  1H10 A;  1Q67 A;  2YS3 A;  3HW2 B;  3NWF A;  2IFS A;  2ZPY A;  1XOD A;  1W1G A;  2YF0 A;  4GMX B;  1P5T A;  1NU2 A;  3D8D A;  2COP A;  3ULB A;  2H7E A;  4PNK A;  5JVL A;  2LOX A;  1FOE A;  1K5D B;  3NW8 A;  5KCV A;  3GYO A;  4TYZ A;  4HAZ B;  4GN1 A;  4HDQ A;  5LOP B;  2CY4 A;  5DHA B;  2NBV A;  4HAT B;  2GCJ A;  2DKQ A;  1EGX A;  3NSU A;  2HE7 A;  1KC7 A;  2YT2 A;  5DI9 B;  1X05 A;  4A6H A;  5JLJ B;  4JK9 A;  5HE1 A;  3UZT A;  5DHF B;  1K5G B;  3MDB C;  4MT7 A;  1XX0 A;  1DYN A;  3FEH A;  3A58 A;  3QBV B;  3HSA A;  1UPQ A;  4NY0 A;  3AJ4 A;  1RJ2 A;  4MY6 A;  4A6F B;  1B55 A;  4KHB A;  1VBH A;  1BAK A;  2RQ1 A;  1X86 A;  4IOY X;  4JKH A;  2J59 M;  1ZYI A;  1TQZ A;  2COA A;  4K17 A;  4CHJ A;  4PQ0 A;  2N23 A;  3TW1 A;  3ENB A;  5IRS A;  2P0F A;  4HAU B;  1E5W A;  1H4R A;  1PMS A;  3LJU X;  4TKN A;  2JP2 A;  3MPX A;  5C5B B;  3OHM B;  1NI2 A;  2AEH A;  1EF1 A;  1U29 A;  3KZ1 A;  3FLV A;  5D27 A;  2DIK A;  2LG1 A;  2G35 A;  4JKG B;  2EJ8 A;  1DDM A;  5GOW B;  2KGX B;  2R2Y A;  4CYE A;  5DIF B;  4GPT B;  1WGU A;  3ULC A;  1AWE A;  4HHV A;  2DYN A;  3TO1 A; 
#chains in the Genus database with same CATH homology
 1HB6 A;  3FP5 A;  1V5M A;  1U5F A;  1XKE A;  2YVC A;  2N0Y A;  1HBK A;  3BJI A;  3SV1 A;  1U27 A;  2ABD A;  2RLO A;  1V5P A;  2E2X A;  3VIA A;  4HAY B;  5HE3 A;  2LUL A;  1MIZ B;  3TFM A;  2Y8G A;  4HDO A;  3PP2 A;  4C0A A;  5C16 A;  4P7I A;  1OQN A;  3PG7 A;  4JKD A;  2J0M A;  2Y8F A;  1I7A A;  1UNR A;  2W2X C;  2FDQ A;  1TJ6 A;  4F7G A;  4CHM A;  1ZSQ A;  2BCJ A;  3BIN A;  4JKE A;  1FGY A;  2DHI A;  3PVU A;  1FB8 A;  2IYB A;  4KHB B;  1GC7 A;  4ZRI A;  5HE2 A;  1PFJ A;  1X11 A;  1NVL A;  4KHA A;  4DXA B;  2EMT A;  4WVF B;  1IRS A;  5D3X A;  2VKI A;  2COD A;  2M14 A;  2I5C A;  1WI1 A;  4GMV A;  2ROZ B;  1XCG A;  2DHK A;  2DN6 A;  2ROV A;  2AL6 A;  3AU5 A;  5CLL B;  3FSS A;  2HRJ A;  4EKU A;  1SGH A;  2CB8 A;  1V5U A;  2UZS A;  2CY5 A;  2K00 A;  2LYD A;  2COC A;  2DFK A;  3PVW A;  3GYP A;  4KAX B;  1MAI A;  2J0J A;  5J3Y A;  3SBT A;  1ACA A;  2YT0 A;  1DRO A;  3RCP A;  4H8S A;  2K2J A;  4HAX B;  2YRY A;  5D3Y A;  1U5G A;  1UEF A;  2COF A;  1W1D A;  3PVL A;  1EVH A;  4JKF A;  2L2I A;  4L6E A;  4ILH A;  2RUK B;  4A5K A;  4HAV B;  5CLQ B;  1FAO A;  4Z2N A;  2KCJ A;  1ZM0 A;  3SO6 A;  4JK7 A;  1QQG A;  2R0D A;  2PZ1 A;  2RSG A;  4KVG B;  2I1J A;  5KQ1 A;  3SUZ A;  1MK9 B;  2GS0 A;  3ODO A;  3A8Q A;  3DXD A;  3D8E A;  3CXB B;  1P6S A;  1ST7 A;  2Q13 A;  2I1K A;  2ELA A;  2YSZ A;  1NTV A;  2MWN B;  2Y7B A;  4GXB A;  1OY2 A;  4DX8 A;  1QC6 A;  2D9X A;  4HB0 B;  2LBB A;  4EJN A;  3P7Z A;  3E9O A;  2HTH B;  2ELB A;  3IVF A;  2QKM A;  3SYX A;  1RRP B;  3TCA A;  4ZRK A;  3N7C A;  2YS1 A;  2VSZ A;  1ISN A;  1DBH A;  4HB2 B;  4HAW B;  3HQC A;  2YS5 A;  2LOZ A;  1WG7 A;  1W1H A;  3KRX A;  3PSC A;  1X1F A;  1U5E A;  3V5W A;  1GGO A;  5JP4 A;  1J0W A;  3HK0 A;  2DX5 A;  1J19 A;  3F5R A;  2UZR A;  2D9W A;  5LON B;  2W2X D;  4BBK A;  3PEG A;  2R09 A;  2OQB A;  2CAY A;  3KRW A;  4B6H A;  2WH5 A;  3F0W A;  4WJ7 A;  2FJL A;  3ODX A;  1U5D A;  2LKO A;  5J3T A;  3ZDT A;  2CRF A;  2GCL A;  3DXE A;  1M7E A;  1V89 A;  4JK8 A;  3KY9 A;  1XR0 B;  2L1C A;  2M38 A;  2D9Y A;  2MKR A;  1U2B A;  3SNH A;  5FI0 A;  3D8F A;  4D0N B;  1NTY A;  1Z87 A;  3T06 A;  4K2O A;  1MPH A;  2Z0P A;  1GG3 A;  2K2U A;  2H7D A;  2EC1 A;  5KQ4 A;  4DBB A;  1FHW A;  4JKA A;  1WVH A;  2DKP A;  2R82 A;  4IFS A;  1V88 A;  3SBG A;  2P8V A;  4F7U P;  3E9P A;  1FHX A;  2D2Q A;  1FGZ A;  3KSY A;  1SHC A;  1M7R A;  4A6K A;  2UVM A;  3P6A A;  3M1I B;  4Y94 A;  3E9L A;  3ML4 A;  4JKB A;  5D3V A;  5J3Q A;  3A8P A;  5IJM A;  5EFX A;  1MK7 B;  1KZG A;  1DIK A;  4ZRJ A;  2MFQ A;  2I5F A;  4WSF A;  1P3R A;  1ZVR A;  1MKE A;  3TVV A;  2ADZ A;  2D4Q A;  2Z0O A;  1ZC3 B;  2D9Z A;  4XWX A;  2DTC A;  2Z0Q A;  2X18 A;  2D11 A;  3U8Z A;  4YON A;  2J0K A;  1LW3 A;  3AU4 A;  1OMW A;  2DHJ A;  3OAN A;  1V61 A;  1LB1 A;  4JKC A;  1PLS A;  1X1G A;  3EPY A;  2DLW A;  3A98 B;  1JDE A;  3QWM A;  2DX1 A;  2DYQ A;  2P0D A;  1BTK A;  1DDW A;  5C6R A;  2RGN B;  5JHH A;  2V76 A;  1BTN A;  2YT1 A;  4KHO A;  1I2H A;  2CQU A;  1KBL A;  1HB8 A;  1XD4 A;  3X23 A;  3O96 A;  5L81 A;  1Y5O A;  1EAZ A;  4ILJ A;  1FHO A;  4HB4 B;  4K2P A;  3WYF B;  1WJM A;  5HE0 A;  4MK0 A;  1UNQ A;  4Z2M B;  3CIK A;  4DX9 0;  2XQN M;  4HB3 B;  1Y19 B;  4K81 A;  2RVB B;  5DH9 B;  3DXC A;  2NMB A;  4F7H A;  2OTX A;  1ZC4 B;  1DDV A;  3G9W A;  1WGQ A;  2DA0 A;  1UPR A;  3PZD A;  1KZ7 A;  2KUP A;  1UNP A;  1KI1 B;  1N3H A;  3QIJ A;  5D3W A;  4GZU A;  4A6F A;  4EMO A;  1VBG A;  2FJ9 A;  2X0S A;  3ODW A;  1NTI A;  5C79 A;  2QKL A;  2NZ8 B;  4YL8 A;  1BWN A;  2VRW B;  3E66 A;  4IAP A;  3WA0 A;  1AQC A;  2P0H A;  2RNR B;  1MIX A;  5C5B A;  3FM8 C;  1WJ1 A;  4ILG B;  3ZVR A;  2D10 A;  2W2W A;  5FI1 A;  1GC6 A;  1TXD A;  2MDX A;  2EMS A;  5JHG A;  2GJY A;  4NSW A;  4JKG A;  3VOQ A;  2D9V A;  3U7D A;  1H10 A;  1Q67 A;  2YS3 A;  3HW2 B;  2IFS A;  2ZPY A;  1XOD A;  1W1G A;  2YF0 A;  4GMX B;  1P5T A;  1NU2 A;  3D8D A;  2COP A;  3ULB A;  2H7E A;  4PNK A;  5JVL A;  2LOX A;  1FOE A;  1K5D B;  5KCV A;  3GYO A;  4TYZ A;  4HAZ B;  4GN1 A;  4HDQ A;  5LOP B;  2CY4 A;  5DHA B;  4HAT B;  2GCJ A;  2DKQ A;  1EGX A;  3NSU A;  2HE7 A;  1KC7 A;  5DI9 B;  1X05 A;  4A6H A;  5JLJ B;  4JK9 A;  5HE1 A;  3UZT A;  5DHF B;  1K5G B;  3MDB C;  4MT7 A;  1XX0 A;  1DYN A;  3FEH A;  3QBV B;  1UPQ A;  4NY0 A;  3AJ4 A;  1RJ2 A;  4MY6 A;  4A6F B;  1B55 A;  1VBH A;  1BAK A;  2RQ1 A;  1X86 A;  4IOY X;  4JKH A;  2J59 M;  1TQZ A;  2COA A;  4K17 A;  4CHJ A;  4PQ0 A;  2N23 A;  3TW1 A;  3ENB A;  2P0F A;  4HAU B;  1E5W A;  1H4R A;  1PMS A;  3LJU X;  4TKN A;  2JP2 A;  3MPX A;  5C5B B;  1NI2 A;  2AEH A;  1EF1 A;  1U29 A;  3KZ1 A;  3FLV A;  5D27 A;  2DIK A;  2LG1 A;  2G35 A;  4JKG B;  2EJ8 A;  1DDM A;  5GOW B;  2KGX B;  4CYE A;  5DIF B;  4GPT B;  1WGU A;  3ULC A;  1AWE A;  4HHV A;  2DYN A;  3TO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...