1Y19B

Structural basis for phosphatidylinositol phosphate kinase type i-gamma binding to talin at focal adhesions
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein, signaling protein
molecule keywords Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
publication title Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
pubmed doi rcsb
source organism Mus musculus
total genus 58
structure length 192
sequence length 192
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1y19B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y19B02
2ZPYA 5KCVA 4TYZA 1UNQA 3IVFA 1DDMA 4ZRJA 2Q13A 2CQUA 1J19A 3HK0A 3P7ZA 2P0FA 1ACAA 3SUZA 3DXDA 2GJYA 1SGHA 2OTXA 4GXBA 3ZVRA 2LOZA 1PFJA 4KHAA 2QKLA 2HRJA 3P6AA 2RVBB 1NTVA 5HE3A 1ST7A 5D3YA 5HE2A 3ODXA 2ROZB 1W1GA 3PSCA 2J0KA 1WI1A 1ZSQA 1M7RA 2YSZA 4K2PA 4Z2NA 3OANA 1TXDA 1DYNA 4HHVA 1X1GA 4NSWA 1U5FA 2LG1A 3FSSA 5FI1A 2COCA 2D9YA 1QQGA 2LULA 5D3WA 2Y8FA 2I1JA 1J0WA 2I5CA 2K2JA 2YS1A 4A5KA 3AU5A 2EJ8A 3M1IB 1P6SA 3A98B 2RUKB 4K2OA 3PVLA 2ELBA 4WVFB 3A8PA 2WH5A 1PMSA 5JHGA 2CODA 4PQ0A 1U2BA 5FI0A 3N7CA 1DDWA 1PLSA 4KAXB 1P3RA 4Z2MB 1I7AA 2N23A 5C16A 1N3HA 4A6FA 5J3QA 3ODOA 1H10A 3KRXA 3KZ1A 2VRWB 3ULCA 1DBHA 4HAZB 5JHHA 4HB4B 1IRSA 2DN6A 2MWNB 5J3YA 5HE0A 2EMSA 1V5MA 3PZDA 3FLVA 1UEFA 4GPTB 2UZRA 4TKNA 1Y5OA 2GS0A 5C6RA 2G35A 4WSFA 4B6HA 1U5EA 4A6FB 2LKOA 2PZ1A 1WG7A 2KCJA 2RNRB 1MK7B 1UPRA 2RGNB 2MDXA 3D8EA 2X18A 4HATB 2CB8A 4MY6A 3U7DA 2D9ZA 2YF0A 4F7GA 2NZ8B 2DKQA 4DX8A 3VOQA 2CY4A 2LYDA 1K5DB 4EMOA 2W2XC 1NVLA 4HAWB 4HDQA 4GN1A 4PNKA 3DXCA 2RQ1A 2ADZA 2J0JA 4KHOA 1GG3A 2D4QA 2FDQA 1WGQA 2D9VA 3MDBC 2L1CA 4GMVA 1K5GB 3QIJA 3ZDTA 2M14A 2DHJA 2I1KA 5DIFB 2NMBA 3G9WA 2BCJA 2KGXB 1QC6A 2K00A 3FP5A 2D9WA 4L6EA 1FHWA 1XKEA 3F0WA 1HB6A 4HAUB 3TFMA 1EF1A 2D11A 1M7EA 3WYFB 2Z0PA 3D8DA 3PVWA 4C0AA 3FM8C 2LBBA 1EAZA 1GC7A 3ODWA 1GC6A 4KHBB 1RJ2A 2P0DA 3FEHA 1MIXA 4XWXA 4NY0A 1AWEA 2I5FA 2D10A 2Z0OA 2VKIA 3X23A 2CRFA 1EGXA 5DHAB 1KZ7A 2LOXA 1FOEA 4MK0A 4IOYX 3U8ZA 1BAKA 2DX5A 4YONA 1LB1A 1MPHA 2EC1A 5J3TA 1XODA 4CHMA 2J59M 3AU4A 2YT1A 4ZRIA 2MFQA 2DHKA 2ABDA 1X05A 1NI2A 1UNRA 2FJ9A 2HE7A 3PG7A 5CLQB 1V5PA 3CIKA 4D0NB 1FGYA 3ULBA 3VIAA 2GCJA 2IFSA 1WVHA 2DTCA 2J0MA 1V5UA 1SHCA 2ROVA 4YL8A 2YS3A 1ZM0A 1MK9B 1I2HA 2MKRA 2N0YA 3TVVA 1FHOA 1ZVRA 3WA0A 5L81A 3KSYA 3BJIA 5IJMA 1B55A 2OQBA 4HAVB 3HW2B 5EFXA 3SNHA 2YS5A 2YRYA 4A6KA 1NTIA 3KY9A 4DX90 2D9XA 1ZC3B 4Y94A 3A8QA 4CYEA 2COFA 1ISNA 2P8VA 2Y7BA 2DKPA 5C5BA 2D2QA 4HAYB 2W2XD 4K81A 4GMXB 3HQCA 4K17A 2RSGA 2YT0A 2H7EA 2M38A 2GCLA 4CHJA 1KZGA 2COAA 2DX1A 1TJ6A 1DDVA 1U27A 2DFKA 1FGZA 4HB2B 3UZTA 3GYOA 5D3XA 2UVMA 5DHFB 2R0DA 1KI1B 4GZUA 2V76A 3F5RA 4KVGB 3TW1A 1U5GA 2JP2A 5C5BB 3NSUA 3GYPA 1AQCA 2H7DA 3T06A 1BWNA 1W1HA 2FJLA 5DI9B 2P0HA 2DHIA 1BTKA 2AEHA 4P7IA 2VSZA 5HE1A 5KQ4A 1BTNA 1FB8A 5D27A 4HB3B 2KUPA 1XX0A 1DROA 1RRPB 5D3VA 2UZSA 4EJNA 2IYBA 4IFSA 1FHXA 1WGUA 2DA0A 1WJ1A 1U29A 1OQNA 2ELAA 1OMWA 2DLWA 1UPQA 1Y19B 1W1DA 4IAPA 3PVUA 1V89A 2Z0QA 5JLJB 1UNPA 1NTYA 5C79A 3BINA 4HDOA 3PEGA 4DXAB 2CY5A 1LW3A 1MAIA 1XR0B 4EKUA 2RLOA 2XQNM 5JP4A 1WJMA 2AL6A 5GOWB 4HB0B 3TCAA 5LOPB 4MT7A 1OY2A 2W2WA 1V88A 5CLLB 2COPA 1X1FA 3DXEA 2K2UA 3RCPA 2EMTA 1HB8A 1HBKA 3AJ4A 4ZRKA 5DH9B 1XCGA 1ZC4B 2CAYA 3LJUX 3QWMA 3D8FA 1Q67A 1V61A 3SV1A 1XD4A 3O96A 3EPYA 2DYNA 2R09A 1MIZB 4DBBA 3KRWA 3TO1A 1H4RA 2L2IA 5KQ1A 4F7HA 1E5WA 4HAXB 1X86A 1TQZA 3V5WA 1FAOA 4F7UP 3CXBB 1EVHA 2DYQA 3SO6A 2Y8GA 3PP2A 1P5TA 2YVCA 4WJ7A 1X11A 3MPXA 3ML4A 1NU2A 2E2XA 1U5DA 4A6HA 4H8SA 1MKEA 2HTHB 3QBVB 3SYXA 2QKMA 4BBKA 1Z87A 5LONB
chains in the Genus database with same CATH superfamily
2ZPYA 5KCVA 4TYZA 1UNQA 3IVFA 2K8EA 4ZRJA 1DDMA 2Q13A 2CQUA 1J19A 3HK0A 3P7ZA 2P0FA 1ACAA 3SUZA 3DXDA 2GJYA 1SGHA 2OTXA 4GXBA 3ZVRA 2LOZA 1PFJA 2K49A 4KHAA 2QKLA 2HRJA 3P6AA 2RVBB 1NTVA 5HE3A 1ST7A 5D3YA 5HE2A 3ODXA 2ROZB 1W1GA 3PSCA 2J0KA 1WI1A 1KC7A 1ZSQA 1M7RA 2YSZA 4K2PA 4Z2NA 3OANA 1TXDA 4JKFA 1DYNA 1X1GA 4HHVA 4NSWA 1U5FA 2LG1A 3FSSA 4ILGB 1VBHA 5FI1A 2COCA 4JKBA 2D9YA 1QQGA 2LULA 5D3WA 2Y8FA 2I1JA 1J0WA 2I5CA 2K2JA 2YS1A 4A5KA 3AU5A 2Z14A 2EJ8A 3M1IB 1MI1A 1P6SA 3A98B 2RUKB 5LONB 4K2OA 3PVLA 2ELBA 4WVFB 3A8PA 2WH5A 1PMSA 5JHGA 2CODA 4OSNA 4PQ0A 4DIXA 1U2BA 5FI0A 3N7CA 1DDWA 1PLSA 4KAXB 1P3RA 2ZKMX 4Z2MB 1I7AA 4QXAB 2N23A 5C16A 2Z59A 1N3HA 4A6FA 5J3QA 3ODOA 1H10A 3KRXA 3KZ1A 2VRWB 3E66A 3ULCA 1DBHA 4HAZB 5JHHA 4HB4B 1IRSA 2DN6A 2MWNB 4JK9A 5J3YA 5HE0A 2EMSA 2KIGA 1V5MA 3PZDA 3FLVA 1UEFA 4GPTB 2UZRA 4TKNA 1Y5OA 2GS0A 5C6RA 2G35A 4WSFA 4B6HA 1U5EA 2R82A 4A6FB 1KBLA 2LKOA 2PZ1A 1WG7A 2KCJA 2RNRB 1MK7B 1UPRA 2RGNB 3B77A 2MDXA 3D8EA 2X18A 3OHMB 4HATB 2CB8A 4MY6A 3U7DA 2D9ZA 2YF0A 3FVCA 4F7GA 2NZ8B 2DKQA 4DX8A 3VOQA 3E9OA 2CY4A 2LYDA 1K5DB 4EMOA 2W2XC 1NVLA 4HAWB 4HDQA 4GN1A 4PNKA 3DXCA 2RQ1A 2ADZA 2J0JA 4KHOA 1GG3A 2D4QA 2FDQA 1WGQA 2D9VA 3MDBC 2L1CA 4GMVA 1K5GB 3QIJA 3ZDTA 4KHBA 2M14A 2DHJA 2I1KA 5DIFB 2NMBA 3G9WA 2BCJA 2KGXB 1QC6A 2K00A 3FP5A 2D9WA 4L6EA 2FJUB 1FHWA 1XKEA 3F0WA 1HB6A 4HAUB 3TFMA 1EF1A 2D11A 1M7EA 3WYFB 2Z0PA 3D8DA 3PVWA 4C0AA 3FM8C 2LBBA 1EAZA 1GC7A 3ODWA 1GC6A 4KHBB 4OT1A 1RJ2A 2P0DA 2Z4DA 2RRFA 3FEHA 1MIXA 4XWXA 4NY0A 1AWEA 2I5FA 2D10A 2Z0OA 2VKIA 4JKEA 3E9PA 3X23A 2CRFA 1EGXA 5LG4B 5DHAB 1KZ7A 2LOXA 2KUQA 1FOEA 4MK0A 4IOYX 3U8ZA 1BAKA 2DX5A 4YONA 1LB1A 1MPHA 2EC1A 4L1RA 5J3TA 1XODA 4CHMA 2J59M 3AU4A 4ZRIA 2YT1A 2MFQA 2DHKA 2ABDA 1X05A 1NI2A 1UNRA 2FJ9A 2HE7A 2KIEA 3PG7A 5CLQB 2R2YA 3ENBA 1V5PA 3CIKA 3HSAA 4D0NB 1FGYA 3ULBA 3VIAA 2GCJA 2IFSA 1WVHA 2DTCA 2J0MA 1V5UA 1SHCA 2ROVA 4JKDA 4YL8A 3A58A 2YS3A 1ZM0A 2GUMA 1MK9B 1I2HA 2MKRA 2N0YA 3TVVA 1FHOA 1ZVRA 3WA0A 5L81A 2YT2A 3KSYA 3BJIA 1T77A 5IJMA 1B55A 2OQBA 4HAVB 3HW2B 5EFXA 3SNHA 2YS5A 2YRYA 4A6KA 1NTIA 1DIKA 4JK8A 3KY9A 4DX90 2D9XA 1ZC3B 5M4YB 4Y94A 3A8QA 4CYEA 2COFA 1ISNA 2P8VA 2Y7BA 2DKPA 2X0SA 5C5BA 2D2QA 4HAYB 2W2XD 4K81A 2NBVA 1JDEA 3HQCA 3NWAA 4GMXB 4K17A 2RSGA 2YT0A 2H7EA 2M38A 2GCLA 2Z13A 4CHJA 1KZGA 2COAA 2DX1A 1TJ6A 1DDVA 1U27A 2DFKA 1FGZA 3DCXA 4HB2B 4JK7A 3UZTA 3GYOA 1ZYIA 5D3XA 2UVMA 5DHFB 2R0DA 4CSQA 5JVLA 4JKCA 1KI1B 4GZUA 2V76A 3F5RA 4KVGB 3TW1A 1U5GA 2JP2A 5C5BB 4JKAA 3NSUA 3GYPA 1AQCA 2H7DA 3T06A 1BWNA 1W1HA 2FJLA 5DI9B 2P0HA 2DHIA 1BTKA 2AEHA 3SBTA 4P7IA 2VSZA 4QJ4B 5HE1A 5KQ4A 1BTNA 1FB8A 5D27A 4GNKB 4HB3B 2KUPA 5I2SA 1XX0A 1DROA 4ILJA 3NW8A 1RRPB 5D3VA 2UZSA 3HIEA 4EJNA 2IYBA 4IFSA 1FHXA 1WGUA 2DA0A 3NWDA 5I2MA 1WJ1A 1U29A 1OQNA 2ELAA 1OMWA 2DLWA 1UPQA 3NWFA 1Y19B 1W1DA 4IAPA 3PVUA 1V89A 2Z0QA 5JLJB 1UNPA 1NTYA 5C79A 5IRSA 3BINA 4HDOA 3PEGA 3E9LA 4DXAB 4D6WA 2CY5A 1LW3A 1MAIA 1XR0B 4EKUA 2RLOA 2XQNM 5JP4A 1WJMA 2AL6A 5GOWB 4HB0B 3TCAA 5LOPB 4MT7A 1OY2A 2W2WA 4QJ3B 1V88A 5CLLB 2COPA 3U12A 1X1FA 3DXEA 2K2UA 3RCPA 1GGOA 2EMTA 4ILHA 1HB8A 1HBKA 3AJ4A 4ZRKA 5DH9B 1XCGA 1ZC4B 2CAYA 3LJUX 3QWMA 3D8FA 1Q67A 1V61A 3SBGA 3SV1A 1XD4A 3O96A 4HSIA 3EPYA 2DYNA 2R09A 1MIZB 4QJ5B 4DBBA 3KRWA 3TO1A 1H4RA 2DIKA 4JKGA 2L2IA 5KQ1A 4F7HA 1E5WA 4HAXB 2KR0A 1X86A 1TQZA 3V5WA 1FAOA 4F7UP 3CXBB 1EVHA 2DYQA 3SO6A 2Y8GA 3PP2A 1P5TA 2YVCA 4WJ7A 1X11A 3MPXA 3ML4A 1NU2A 2E2XA 1U5DA 4A6HA 1VBGA 4JKGB 4H8SA 1MKEA 2HTHB 4GOUA 3QBVB 3SYXA 2QKMA 4BBKA 1Z87A 4JKHA
chains in the Genus database with same CATH topology
2ZPYA 5KCVA 4TYZA 1UNQA 3IVFA 1DDMA 4ZRJA 2Q13A 2CQUA 1J19A 3HK0A 3P7ZA 2P0FA 1ACAA 3SUZA 3DXDA 2GJYA 1SGHA 2OTXA 4GXBA 3ZVRA 2LOZA 1PFJA 4KHAA 2QKLA 2HRJA 3P6AA 2RVBB 1NTVA 5HE3A 1ST7A 5D3YA 5HE2A 3ODXA 2ROZB 1W1GA 3PSCA 2J0KA 1WI1A 1KC7A 1ZSQA 1M7RA 2YSZA 4K2PA 4Z2NA 3OANA 1TXDA 4JKFA 1DYNA 1X1GA 4HHVA 4NSWA 1U5FA 2LG1A 3FSSA 4ILGB 1VBHA 5FI1A 2COCA 4JKBA 2D9YA 1QQGA 2LULA 5D3WA 2Y8FA 2I1JA 1J0WA 2I5CA 2K2JA 2YS1A 4A5KA 3AU5A 2EJ8A 3M1IB 1P6SA 3A98B 2RUKB 5LONB 4K2OA 3PVLA 2ELBA 4WVFB 3A8PA 2WH5A 1PMSA 5JHGA 2CODA 4PQ0A 1U2BA 5FI0A 3N7CA 1DDWA 1PLSA 4KAXB 1P3RA 4Z2MB 1I7AA 2N23A 5C16A 1N3HA 4A6FA 5J3QA 3ODOA 1H10A 3KRXA 3KZ1A 2VRWB 3E66A 3ULCA 1DBHA 4HAZB 5JHHA 4HB4B 1IRSA 2DN6A 2MWNB 4JK9A 5J3YA 5HE0A 2EMSA 1V5MA 3PZDA 3FLVA 1UEFA 4GPTB 2UZRA 4TKNA 1Y5OA 2GS0A 5C6RA 2G35A 4WSFA 4B6HA 1U5EA 2R82A 4A6FB 1KBLA 2LKOA 2PZ1A 1WG7A 2KCJA 2RNRB 1MK7B 1UPRA 2RGNB 2MDXA 3D8EA 2X18A 4HATB 2CB8A 4MY6A 3U7DA 2D9ZA 2YF0A 4F7GA 2NZ8B 2DKQA 4DX8A 3VOQA 3E9OA 2CY4A 2LYDA 1K5DB 4EMOA 2W2XC 1NVLA 4HAWB 4HDQA 4GN1A 4PNKA 3DXCA 2RQ1A 2ADZA 2J0JA 4KHOA 1GG3A 2D4QA 2FDQA 1WGQA 2D9VA 3MDBC 2L1CA 4GMVA 1K5GB 3QIJA 3ZDTA 2M14A 2DHJA 2I1KA 5DIFB 2NMBA 3G9WA 2BCJA 2KGXB 1QC6A 2K00A 3FP5A 2D9WA 4L6EA 1FHWA 1XKEA 3F0WA 1HB6A 4HAUB 3TFMA 1EF1A 2D11A 1M7EA 3WYFB 2Z0PA 3D8DA 3PVWA 4C0AA 3FM8C 2LBBA 1EAZA 1GC7A 3ODWA 1GC6A 4KHBB 1RJ2A 2P0DA 3FEHA 1MIXA 4XWXA 4NY0A 1AWEA 2I5FA 2D10A 2Z0OA 2VKIA 4JKEA 3E9PA 3X23A 2CRFA 1EGXA 5DHAB 1KZ7A 2LOXA 1FOEA 4MK0A 4IOYX 3U8ZA 1BAKA 2DX5A 4YONA 1LB1A 1MPHA 2EC1A 5J3TA 1XODA 4CHMA 2J59M 3AU4A 4ZRIA 2YT1A 2MFQA 2DHKA 2ABDA 1X05A 1NI2A 1UNRA 2FJ9A 2HE7A 3PG7A 5CLQB 3ENBA 1V5PA 3CIKA 4D0NB 1FGYA 3ULBA 3VIAA 2GCJA 2IFSA 1WVHA 2DTCA 2J0MA 1V5UA 1SHCA 2ROVA 4JKDA 4YL8A 2YS3A 1ZM0A 1MK9B 1I2HA 2MKRA 2N0YA 3TVVA 1FHOA 1ZVRA 3WA0A 5L81A 3KSYA 3BJIA 5IJMA 1B55A 2OQBA 4HAVB 3HW2B 5EFXA 3SNHA 2YS5A 2YRYA 4A6KA 1NTIA 1DIKA 4JK8A 3KY9A 4DX90 2D9XA 1ZC3B 4Y94A 3A8QA 4CYEA 2COFA 1ISNA 2P8VA 2Y7BA 2DKPA 2X0SA 5C5BA 2D2QA 4HAYB 2W2XD 4K81A 1JDEA 3HQCA 4GMXB 4K17A 2RSGA 2YT0A 2H7EA 2M38A 2GCLA 4CHJA 1KZGA 2COAA 2DX1A 1TJ6A 1DDVA 1U27A 2DFKA 1FGZA 4HB2B 4JK7A 3UZTA 3GYOA 5D3XA 2UVMA 5DHFB 2R0DA 5JVLA 4JKCA 1KI1B 4GZUA 2V76A 3F5RA 4KVGB 3TW1A 1U5GA 2JP2A 5C5BB 4JKAA 3NSUA 3GYPA 1AQCA 2H7DA 3T06A 1BWNA 1W1HA 2FJLA 5DI9B 2P0HA 2DHIA 1BTKA 2AEHA 3SBTA 4P7IA 2VSZA 5HE1A 5KQ4A 1BTNA 1FB8A 5D27A 4HB3B 2KUPA 1XX0A 1DROA 4ILJA 1RRPB 5D3VA 2UZSA 4EJNA 2IYBA 4IFSA 1FHXA 1WGUA 2DA0A 1WJ1A 1U29A 1OQNA 2ELAA 1OMWA 2DLWA 1UPQA 1Y19B 1W1DA 4IAPA 3PVUA 1V89A 2Z0QA 5JLJB 1UNPA 1NTYA 5C79A 3BINA 4HDOA 3PEGA 3E9LA 4DXAB 2CY5A 1LW3A 1MAIA 1XR0B 4EKUA 2RLOA 2XQNM 5JP4A 1WJMA 2AL6A 5GOWB 4HB0B 3TCAA 5LOPB 4MT7A 1OY2A 2W2WA 1V88A 5CLLB 2COPA 1X1FA 3DXEA 2K2UA 3RCPA 1GGOA 2EMTA 4ILHA 1HB8A 1HBKA 3AJ4A 4ZRKA 5DH9B 1XCGA 1ZC4B 2CAYA 3LJUX 3QWMA 3D8FA 1Q67A 1V61A 3SBGA 3SV1A 1XD4A 3O96A 3EPYA 2DYNA 2R09A 1MIZB 4DBBA 3KRWA 3TO1A 1H4RA 2DIKA 4JKGA 2L2IA 5KQ1A 4F7HA 1E5WA 4HAXB 1X86A 1TQZA 3V5WA 1FAOA 4F7UP 3CXBB 1EVHA 2DYQA 3SO6A 2Y8GA 3PP2A 1P5TA 2YVCA 4WJ7A 1X11A 3MPXA 3ML4A 1NU2A 2E2XA 1U5DA 4A6HA 1VBGA 4JKGB 4H8SA 1MKEA 2HTHB 3QBVB 3SYXA 2QKMA 4BBKA 1Z87A 4JKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPY A;  5KCV A;  4TYZ A;  1UNQ A;  3IVF A;  1DDM A;  4ZRJ A;  2Q13 A;  2CQU A;  1J19 A;  3HK0 A;  3P7Z A;  2P0F A;  1ACA A;  3SUZ A;  3DXD A;  2GJY A;  1SGH A;  2OTX A;  4GXB A;  3ZVR A;  2LOZ A;  1PFJ A;  4KHA A;  2QKL A;  2HRJ A;  3P6A A;  2RVB B;  1NTV A;  5HE3 A;  1ST7 A;  5D3Y A;  5HE2 A;  3ODX A;  2ROZ B;  1W1G A;  3PSC A;  2J0K A;  1WI1 A;  1ZSQ A;  1M7R A;  2YSZ A;  4K2P A;  4Z2N A;  3OAN A;  1TXD A;  1DYN A;  4HHV A;  1X1G A;  4NSW A;  1U5F A;  2LG1 A;  3FSS A;  5FI1 A;  2COC A;  2D9Y A;  1QQG A;  2LUL A;  5D3W A;  2Y8F A;  2I1J A;  1J0W A;  2I5C A;  2K2J A;  2YS1 A;  4A5K A;  3AU5 A;  2EJ8 A;  3M1I B;  1P6S A;  3A98 B;  2RUK B;  4K2O A;  3PVL A;  2ELB A;  4WVF B;  3A8P A;  2WH5 A;  1PMS A;  5JHG A;  2COD A;  4PQ0 A;  1U2B A;  5FI0 A;  3N7C A;  1DDW A;  1PLS A;  4KAX B;  1P3R A;  4Z2M B;  1I7A A;  2N23 A;  5C16 A;  1N3H A;  4A6F A;  5J3Q A;  3ODO A;  1H10 A;  3KRX A;  3KZ1 A;  2VRW B;  3ULC A;  1DBH A;  4HAZ B;  5JHH A;  4HB4 B;  1IRS A;  2DN6 A;  2MWN B;  5J3Y A;  5HE0 A;  2EMS A;  1V5M A;  3PZD A;  3FLV A;  1UEF A;  4GPT B;  2UZR A;  4TKN A;  1Y5O A;  2GS0 A;  5C6R A;  2G35 A;  4WSF A;  4B6H A;  1U5E A;  4A6F B;  2LKO A;  2PZ1 A;  1WG7 A;  2KCJ A;  2RNR B;  1MK7 B;  1UPR A;  2RGN B;  2MDX A;  3D8E A;  2X18 A;  4HAT B;  2CB8 A;  4MY6 A;  3U7D A;  2D9Z A;  2YF0 A;  4F7G A;  2NZ8 B;  2DKQ A;  4DX8 A;  3VOQ A;  2CY4 A;  2LYD A;  1K5D B;  4EMO A;  2W2X C;  1NVL A;  4HAW B;  4HDQ A;  4GN1 A;  4PNK A;  3DXC A;  2RQ1 A;  2ADZ A;  2J0J A;  4KHO A;  1GG3 A;  2D4Q A;  2FDQ A;  1WGQ A;  2D9V A;  3MDB C;  2L1C A;  4GMV A;  1K5G B;  3QIJ A;  3ZDT A;  2M14 A;  2DHJ A;  2I1K A;  5DIF B;  2NMB A;  3G9W A;  2BCJ A;  2KGX B;  1QC6 A;  2K00 A;  3FP5 A;  2D9W A;  4L6E A;  1FHW A;  1XKE A;  3F0W A;  1HB6 A;  4HAU B;  3TFM A;  1EF1 A;  2D11 A;  1M7E A;  3WYF B;  2Z0P A;  3D8D A;  3PVW A;  4C0A A;  3FM8 C;  2LBB A;  1EAZ A;  1GC7 A;  3ODW A;  1GC6 A;  4KHB B;  1RJ2 A;  2P0D A;  3FEH A;  1MIX A;  4XWX A;  4NY0 A;  1AWE A;  2I5F A;  2D10 A;  2Z0O A;  2VKI A;  3X23 A;  2CRF A;  1EGX A;  5DHA B;  1KZ7 A;  2LOX A;  1FOE A;  4MK0 A;  4IOY X;  3U8Z A;  1BAK A;  2DX5 A;  4YON A;  1LB1 A;  1MPH A;  2EC1 A;  5J3T A;  1XOD A;  4CHM A;  2J59 M;  3AU4 A;  2YT1 A;  4ZRI A;  2MFQ A;  2DHK A;  2ABD A;  1X05 A;  1NI2 A;  1UNR A;  2FJ9 A;  2HE7 A;  3PG7 A;  5CLQ B;  1V5P A;  3CIK A;  4D0N B;  1FGY A;  3ULB A;  3VIA A;  2GCJ A;  2IFS A;  1WVH A;  2DTC A;  2J0M A;  1V5U A;  1SHC A;  2ROV A;  4YL8 A;  2YS3 A;  1ZM0 A;  1MK9 B;  1I2H A;  2MKR A;  2N0Y A;  3TVV A;  1FHO A;  1ZVR A;  3WA0 A;  5L81 A;  3KSY A;  3BJI A;  5IJM A;  1B55 A;  2OQB A;  4HAV B;  3HW2 B;  5EFX A;  3SNH A;  2YS5 A;  2YRY A;  4A6K A;  1NTI A;  3KY9 A;  4DX9 0;  2D9X A;  1ZC3 B;  4Y94 A;  3A8Q A;  4CYE A;  2COF A;  1ISN A;  2P8V A;  2Y7B A;  2DKP A;  5C5B A;  2D2Q A;  4HAY B;  2W2X D;  4K81 A;  4GMX B;  3HQC A;  4K17 A;  2RSG A;  2YT0 A;  2H7E A;  2M38 A;  2GCL A;  4CHJ A;  1KZG A;  2COA A;  2DX1 A;  1TJ6 A;  1DDV A;  1U27 A;  2DFK A;  1FGZ A;  4HB2 B;  3UZT A;  3GYO A;  5D3X A;  2UVM A;  5DHF B;  2R0D A;  1KI1 B;  4GZU A;  2V76 A;  3F5R A;  4KVG B;  3TW1 A;  1U5G A;  2JP2 A;  5C5B B;  3NSU A;  3GYP A;  1AQC A;  2H7D A;  3T06 A;  1BWN A;  1W1H A;  2FJL A;  5DI9 B;  2P0H A;  2DHI A;  1BTK A;  2AEH A;  4P7I A;  2VSZ A;  5HE1 A;  5KQ4 A;  1BTN A;  1FB8 A;  5D27 A;  4HB3 B;  2KUP A;  1XX0 A;  1DRO A;  1RRP B;  5D3V A;  2UZS A;  4EJN A;  2IYB A;  4IFS A;  1FHX A;  1WGU A;  2DA0 A;  1WJ1 A;  1U29 A;  1OQN A;  2ELA A;  1OMW A;  2DLW A;  1UPQ A;  1Y19 B;  1W1D A;  4IAP A;  3PVU A;  1V89 A;  2Z0Q A;  5JLJ B;  1UNP A;  1NTY A;  5C79 A;  3BIN A;  4HDO A;  3PEG A;  4DXA B;  2CY5 A;  1LW3 A;  1MAI A;  1XR0 B;  4EKU A;  2RLO A;  2XQN M;  5JP4 A;  1WJM A;  2AL6 A;  5GOW B;  4HB0 B;  3TCA A;  5LOP B;  4MT7 A;  1OY2 A;  2W2W A;  1V88 A;  5CLL B;  2COP A;  1X1F A;  3DXE A;  2K2U A;  3RCP A;  2EMT A;  1HB8 A;  1HBK A;  3AJ4 A;  4ZRK A;  5DH9 B;  1XCG A;  1ZC4 B;  2CAY A;  3LJU X;  3QWM A;  3D8F A;  1Q67 A;  1V61 A;  3SV1 A;  1XD4 A;  3O96 A;  3EPY A;  2DYN A;  2R09 A;  1MIZ B;  4DBB A;  3KRW A;  3TO1 A;  1H4R A;  2L2I A;  5KQ1 A;  4F7H A;  1E5W A;  4HAX B;  1X86 A;  1TQZ A;  3V5W A;  1FAO A;  4F7U P;  3CXB B;  1EVH A;  2DYQ A;  3SO6 A;  2Y8G A;  3PP2 A;  1P5T A;  2YVC A;  4WJ7 A;  1X11 A;  3MPX A;  3ML4 A;  1NU2 A;  2E2X A;  1U5D A;  4A6H A;  4H8S A;  1MKE A;  2HTH B;  3QBV B;  3SYX A;  2QKM A;  4BBK A;  1Z87 A;  5LON B; 
#chains in the Genus database with same CATH topology
 2ZPY A;  5KCV A;  4TYZ A;  1UNQ A;  3IVF A;  2K8E A;  4ZRJ A;  1DDM A;  2Q13 A;  2CQU A;  1J19 A;  3HK0 A;  3P7Z A;  2P0F A;  1ACA A;  3SUZ A;  3DXD A;  2GJY A;  1SGH A;  2OTX A;  4GXB A;  3ZVR A;  2LOZ A;  1PFJ A;  2K49 A;  4KHA A;  2QKL A;  2HRJ A;  3P6A A;  2RVB B;  1NTV A;  5HE3 A;  1ST7 A;  5D3Y A;  5HE2 A;  3ODX A;  2ROZ B;  1W1G A;  3PSC A;  2J0K A;  1WI1 A;  1KC7 A;  1ZSQ A;  1M7R A;  2YSZ A;  4K2P A;  4Z2N A;  3OAN A;  1TXD A;  4JKF A;  1DYN A;  1X1G A;  4HHV A;  4NSW A;  1U5F A;  2LG1 A;  3FSS A;  4ILG B;  1VBH A;  5FI1 A;  2COC A;  4JKB A;  2D9Y A;  1QQG A;  2LUL A;  5D3W A;  2Y8F A;  2I1J A;  1J0W A;  2I5C A;  2K2J A;  2YS1 A;  4A5K A;  3AU5 A;  2Z14 A;  2EJ8 A;  3M1I B;  1MI1 A;  1P6S A;  3A98 B;  2RUK B;  5LON B;  4K2O A;  3PVL A;  2ELB A;  4WVF B;  3A8P A;  2WH5 A;  1PMS A;  5JHG A;  2COD A;  4OSN A;  4PQ0 A;  4DIX A;  1U2B A;  5FI0 A;  3N7C A;  1DDW A;  1PLS A;  4KAX B;  1P3R A;  2ZKM X;  4Z2M B;  1I7A A;  4QXA B;  2N23 A;  5C16 A;  2Z59 A;  1N3H A;  4A6F A;  5J3Q A;  3ODO A;  1H10 A;  3KRX A;  3KZ1 A;  2VRW B;  3E66 A;  3ULC A;  1DBH A;  4HAZ B;  5JHH A;  4HB4 B;  1IRS A;  2DN6 A;  2MWN B;  4JK9 A;  5J3Y A;  5HE0 A;  2EMS A;  2KIG A;  1V5M A;  3PZD A;  3FLV A;  1UEF A;  4GPT B;  2UZR A;  4TKN A;  1Y5O A;  2GS0 A;  5C6R A;  2G35 A;  4WSF A;  4B6H A;  1U5E A;  2R82 A;  4A6F B;  1KBL A;  2LKO A;  2PZ1 A;  1WG7 A;  2KCJ A;  2RNR B;  1MK7 B;  1UPR A;  2RGN B;  3B77 A;  2MDX A;  3D8E A;  2X18 A;  3OHM B;  4HAT B;  2CB8 A;  4MY6 A;  3U7D A;  2D9Z A;  2YF0 A;  3FVC A;  4F7G A;  2NZ8 B;  2DKQ A;  4DX8 A;  3VOQ A;  3E9O A;  2CY4 A;  2LYD A;  1K5D B;  4EMO A;  2W2X C;  1NVL A;  4HAW B;  4HDQ A;  4GN1 A;  4PNK A;  3DXC A;  2RQ1 A;  2ADZ A;  2J0J A;  4KHO A;  1GG3 A;  2D4Q A;  2FDQ A;  1WGQ A;  2D9V A;  3MDB C;  2L1C A;  4GMV A;  1K5G B;  3QIJ A;  3ZDT A;  4KHB A;  2M14 A;  2DHJ A;  2I1K A;  5DIF B;  2NMB A;  3G9W A;  2BCJ A;  2KGX B;  1QC6 A;  2K00 A;  3FP5 A;  2D9W A;  4L6E A;  2FJU B;  1FHW A;  1XKE A;  3F0W A;  1HB6 A;  4HAU B;  3TFM A;  1EF1 A;  2D11 A;  1M7E A;  3WYF B;  2Z0P A;  3D8D A;  3PVW A;  4C0A A;  3FM8 C;  2LBB A;  1EAZ A;  1GC7 A;  3ODW A;  1GC6 A;  4KHB B;  4OT1 A;  1RJ2 A;  2P0D A;  2Z4D A;  2RRF A;  3FEH A;  1MIX A;  4XWX A;  4NY0 A;  1AWE A;  2I5F A;  2D10 A;  2Z0O A;  2VKI A;  4JKE A;  3E9P A;  3X23 A;  2CRF A;  1EGX A;  5LG4 B;  5DHA B;  1KZ7 A;  2LOX A;  2KUQ A;  1FOE A;  4MK0 A;  4IOY X;  3U8Z A;  1BAK A;  2DX5 A;  4YON A;  1LB1 A;  1MPH A;  2EC1 A;  4L1R A;  5J3T A;  1XOD A;  4CHM A;  2J59 M;  3AU4 A;  4ZRI A;  2YT1 A;  2MFQ A;  2DHK A;  2ABD A;  1X05 A;  1NI2 A;  1UNR A;  2FJ9 A;  2HE7 A;  2KIE A;  3PG7 A;  5CLQ B;  2R2Y A;  3ENB A;  1V5P A;  3CIK A;  3HSA A;  4D0N B;  1FGY A;  3ULB A;  3VIA A;  2GCJ A;  2IFS A;  1WVH A;  2DTC A;  2J0M A;  1V5U A;  1SHC A;  2ROV A;  4JKD A;  4YL8 A;  3A58 A;  2YS3 A;  1ZM0 A;  2GUM A;  1MK9 B;  1I2H A;  2MKR A;  2N0Y A;  3TVV A;  1FHO A;  1ZVR A;  3WA0 A;  5L81 A;  2YT2 A;  3KSY A;  3BJI A;  1T77 A;  5IJM A;  1B55 A;  2OQB A;  4HAV B;  3HW2 B;  5EFX A;  3SNH A;  2YS5 A;  2YRY A;  4A6K A;  1NTI A;  1DIK A;  4JK8 A;  3KY9 A;  4DX9 0;  2D9X A;  1ZC3 B;  5M4Y B;  4Y94 A;  3A8Q A;  4CYE A;  2COF A;  1ISN A;  2P8V A;  2Y7B A;  2DKP A;  2X0S A;  5C5B A;  2D2Q A;  4HAY B;  2W2X D;  4K81 A;  2NBV A;  1JDE A;  3HQC A;  3NWA A;  4GMX B;  4K17 A;  2RSG A;  2YT0 A;  2H7E A;  2M38 A;  2GCL A;  2Z13 A;  4CHJ A;  1KZG A;  2COA A;  2DX1 A;  1TJ6 A;  1DDV A;  1U27 A;  2DFK A;  1FGZ A;  3DCX A;  4HB2 B;  4JK7 A;  3UZT A;  3GYO A;  1ZYI A;  5D3X A;  2UVM A;  5DHF B;  2R0D A;  4CSQ A;  5JVL A;  4JKC A;  1KI1 B;  4GZU A;  2V76 A;  3F5R A;  4KVG B;  3TW1 A;  1U5G A;  2JP2 A;  5C5B B;  4JKA A;  3NSU A;  3GYP A;  1AQC A;  2H7D A;  3T06 A;  1BWN A;  1W1H A;  2FJL A;  5DI9 B;  2P0H A;  2DHI A;  1BTK A;  2AEH A;  3SBT A;  4P7I A;  2VSZ A;  4QJ4 B;  5HE1 A;  5KQ4 A;  1BTN A;  1FB8 A;  5D27 A;  4GNK B;  4HB3 B;  2KUP A;  5I2S A;  1XX0 A;  1DRO A;  4ILJ A;  3NW8 A;  1RRP B;  5D3V A;  2UZS A;  3HIE A;  4EJN A;  2IYB A;  4IFS A;  1FHX A;  1WGU A;  2DA0 A;  3NWD A;  5I2M A;  1WJ1 A;  1U29 A;  1OQN A;  2ELA A;  1OMW A;  2DLW A;  1UPQ A;  3NWF A;  1Y19 B;  1W1D A;  4IAP A;  3PVU A;  1V89 A;  2Z0Q A;  5JLJ B;  1UNP A;  1NTY A;  5C79 A;  5IRS A;  3BIN A;  4HDO A;  3PEG A;  3E9L A;  4DXA B;  4D6W A;  2CY5 A;  1LW3 A;  1MAI A;  1XR0 B;  4EKU A;  2RLO A;  2XQN M;  5JP4 A;  1WJM A;  2AL6 A;  5GOW B;  4HB0 B;  3TCA A;  5LOP B;  4MT7 A;  1OY2 A;  2W2W A;  4QJ3 B;  1V88 A;  5CLL B;  2COP A;  3U12 A;  1X1F A;  3DXE A;  2K2U A;  3RCP A;  1GGO A;  2EMT A;  4ILH A;  1HB8 A;  1HBK A;  3AJ4 A;  4ZRK A;  5DH9 B;  1XCG A;  1ZC4 B;  2CAY A;  3LJU X;  3QWM A;  3D8F A;  1Q67 A;  1V61 A;  3SBG A;  3SV1 A;  1XD4 A;  3O96 A;  4HSI A;  3EPY A;  2DYN A;  2R09 A;  1MIZ B;  4QJ5 B;  4DBB A;  3KRW A;  3TO1 A;  1H4R A;  2DIK A;  4JKG A;  2L2I A;  5KQ1 A;  4F7H A;  1E5W A;  4HAX B;  2KR0 A;  1X86 A;  1TQZ A;  3V5W A;  1FAO A;  4F7U P;  3CXB B;  1EVH A;  2DYQ A;  3SO6 A;  2Y8G A;  3PP2 A;  1P5T A;  2YVC A;  4WJ7 A;  1X11 A;  3MPX A;  3ML4 A;  1NU2 A;  2E2X A;  1U5D A;  4A6H A;  1VBG A;  4JKG B;  4H8S A;  1MKE A;  2HTH B;  4GOU A;  3QBV B;  3SYX A;  2QKM A;  4BBK A;  1Z87 A;  4JKH A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  5KCV A;  4TYZ A;  1UNQ A;  3IVF A;  1DDM A;  4ZRJ A;  2Q13 A;  2CQU A;  1J19 A;  3HK0 A;  3P7Z A;  2P0F A;  1ACA A;  3SUZ A;  3DXD A;  2GJY A;  1SGH A;  2OTX A;  4GXB A;  3ZVR A;  2LOZ A;  1PFJ A;  4KHA A;  2QKL A;  2HRJ A;  3P6A A;  2RVB B;  1NTV A;  5HE3 A;  1ST7 A;  5D3Y A;  5HE2 A;  3ODX A;  2ROZ B;  1W1G A;  3PSC A;  2J0K A;  1WI1 A;  1KC7 A;  1ZSQ A;  1M7R A;  2YSZ A;  4K2P A;  4Z2N A;  3OAN A;  1TXD A;  4JKF A;  1DYN A;  1X1G A;  4HHV A;  4NSW A;  1U5F A;  2LG1 A;  3FSS A;  4ILG B;  1VBH A;  5FI1 A;  2COC A;  4JKB A;  2D9Y A;  1QQG A;  2LUL A;  5D3W A;  2Y8F A;  2I1J A;  1J0W A;  2I5C A;  2K2J A;  2YS1 A;  4A5K A;  3AU5 A;  2EJ8 A;  3M1I B;  1P6S A;  3A98 B;  2RUK B;  5LON B;  4K2O A;  3PVL A;  2ELB A;  4WVF B;  3A8P A;  2WH5 A;  1PMS A;  5JHG A;  2COD A;  4PQ0 A;  1U2B A;  5FI0 A;  3N7C A;  1DDW A;  1PLS A;  4KAX B;  1P3R A;  4Z2M B;  1I7A A;  2N23 A;  5C16 A;  1N3H A;  4A6F A;  5J3Q A;  3ODO A;  1H10 A;  3KRX A;  3KZ1 A;  2VRW B;  3E66 A;  3ULC A;  1DBH A;  4HAZ B;  5JHH A;  4HB4 B;  1IRS A;  2DN6 A;  2MWN B;  4JK9 A;  5J3Y A;  5HE0 A;  2EMS A;  1V5M A;  3PZD A;  3FLV A;  1UEF A;  4GPT B;  2UZR A;  4TKN A;  1Y5O A;  2GS0 A;  5C6R A;  2G35 A;  4WSF A;  4B6H A;  1U5E A;  2R82 A;  4A6F B;  1KBL A;  2LKO A;  2PZ1 A;  1WG7 A;  2KCJ A;  2RNR B;  1MK7 B;  1UPR A;  2RGN B;  2MDX A;  3D8E A;  2X18 A;  4HAT B;  2CB8 A;  4MY6 A;  3U7D A;  2D9Z A;  2YF0 A;  4F7G A;  2NZ8 B;  2DKQ A;  4DX8 A;  3VOQ A;  3E9O A;  2CY4 A;  2LYD A;  1K5D B;  4EMO A;  2W2X C;  1NVL A;  4HAW B;  4HDQ A;  4GN1 A;  4PNK A;  3DXC A;  2RQ1 A;  2ADZ A;  2J0J A;  4KHO A;  1GG3 A;  2D4Q A;  2FDQ A;  1WGQ A;  2D9V A;  3MDB C;  2L1C A;  4GMV A;  1K5G B;  3QIJ A;  3ZDT A;  2M14 A;  2DHJ A;  2I1K A;  5DIF B;  2NMB A;  3G9W A;  2BCJ A;  2KGX B;  1QC6 A;  2K00 A;  3FP5 A;  2D9W A;  4L6E A;  1FHW A;  1XKE A;  3F0W A;  1HB6 A;  4HAU B;  3TFM A;  1EF1 A;  2D11 A;  1M7E A;  3WYF B;  2Z0P A;  3D8D A;  3PVW A;  4C0A A;  3FM8 C;  2LBB A;  1EAZ A;  1GC7 A;  3ODW A;  1GC6 A;  4KHB B;  1RJ2 A;  2P0D A;  3FEH A;  1MIX A;  4XWX A;  4NY0 A;  1AWE A;  2I5F A;  2D10 A;  2Z0O A;  2VKI A;  4JKE A;  3E9P A;  3X23 A;  2CRF A;  1EGX A;  5DHA B;  1KZ7 A;  2LOX A;  1FOE A;  4MK0 A;  4IOY X;  3U8Z A;  1BAK A;  2DX5 A;  4YON A;  1LB1 A;  1MPH A;  2EC1 A;  5J3T A;  1XOD A;  4CHM A;  2J59 M;  3AU4 A;  4ZRI A;  2YT1 A;  2MFQ A;  2DHK A;  2ABD A;  1X05 A;  1NI2 A;  1UNR A;  2FJ9 A;  2HE7 A;  3PG7 A;  5CLQ B;  3ENB A;  1V5P A;  3CIK A;  4D0N B;  1FGY A;  3ULB A;  3VIA A;  2GCJ A;  2IFS A;  1WVH A;  2DTC A;  2J0M A;  1V5U A;  1SHC A;  2ROV A;  4JKD A;  4YL8 A;  2YS3 A;  1ZM0 A;  1MK9 B;  1I2H A;  2MKR A;  2N0Y A;  3TVV A;  1FHO A;  1ZVR A;  3WA0 A;  5L81 A;  3KSY A;  3BJI A;  5IJM A;  1B55 A;  2OQB A;  4HAV B;  3HW2 B;  5EFX A;  3SNH A;  2YS5 A;  2YRY A;  4A6K A;  1NTI A;  1DIK A;  4JK8 A;  3KY9 A;  4DX9 0;  2D9X A;  1ZC3 B;  4Y94 A;  3A8Q A;  4CYE A;  2COF A;  1ISN A;  2P8V A;  2Y7B A;  2DKP A;  2X0S A;  5C5B A;  2D2Q A;  4HAY B;  2W2X D;  4K81 A;  1JDE A;  3HQC A;  4GMX B;  4K17 A;  2RSG A;  2YT0 A;  2H7E A;  2M38 A;  2GCL A;  4CHJ A;  1KZG A;  2COA A;  2DX1 A;  1TJ6 A;  1DDV A;  1U27 A;  2DFK A;  1FGZ A;  4HB2 B;  4JK7 A;  3UZT A;  3GYO A;  5D3X A;  2UVM A;  5DHF B;  2R0D A;  5JVL A;  4JKC A;  1KI1 B;  4GZU A;  2V76 A;  3F5R A;  4KVG B;  3TW1 A;  1U5G A;  2JP2 A;  5C5B B;  4JKA A;  3NSU A;  3GYP A;  1AQC A;  2H7D A;  3T06 A;  1BWN A;  1W1H A;  2FJL A;  5DI9 B;  2P0H A;  2DHI A;  1BTK A;  2AEH A;  3SBT A;  4P7I A;  2VSZ A;  5HE1 A;  5KQ4 A;  1BTN A;  1FB8 A;  5D27 A;  4HB3 B;  2KUP A;  1XX0 A;  1DRO A;  4ILJ A;  1RRP B;  5D3V A;  2UZS A;  4EJN A;  2IYB A;  4IFS A;  1FHX A;  1WGU A;  2DA0 A;  1WJ1 A;  1U29 A;  1OQN A;  2ELA A;  1OMW A;  2DLW A;  1UPQ A;  1Y19 B;  1W1D A;  4IAP A;  3PVU A;  1V89 A;  2Z0Q A;  5JLJ B;  1UNP A;  1NTY A;  5C79 A;  3BIN A;  4HDO A;  3PEG A;  3E9L A;  4DXA B;  2CY5 A;  1LW3 A;  1MAI A;  1XR0 B;  4EKU A;  2RLO A;  2XQN M;  5JP4 A;  1WJM A;  2AL6 A;  5GOW B;  4HB0 B;  3TCA A;  5LOP B;  4MT7 A;  1OY2 A;  2W2W A;  1V88 A;  5CLL B;  2COP A;  1X1F A;  3DXE A;  2K2U A;  3RCP A;  1GGO A;  2EMT A;  4ILH A;  1HB8 A;  1HBK A;  3AJ4 A;  4ZRK A;  5DH9 B;  1XCG A;  1ZC4 B;  2CAY A;  3LJU X;  3QWM A;  3D8F A;  1Q67 A;  1V61 A;  3SBG A;  3SV1 A;  1XD4 A;  3O96 A;  3EPY A;  2DYN A;  2R09 A;  1MIZ B;  4DBB A;  3KRW A;  3TO1 A;  1H4R A;  2DIK A;  4JKG A;  2L2I A;  5KQ1 A;  4F7H A;  1E5W A;  4HAX B;  1X86 A;  1TQZ A;  3V5W A;  1FAO A;  4F7U P;  3CXB B;  1EVH A;  2DYQ A;  3SO6 A;  2Y8G A;  3PP2 A;  1P5T A;  2YVC A;  4WJ7 A;  1X11 A;  3MPX A;  3ML4 A;  1NU2 A;  2E2X A;  1U5D A;  4A6H A;  1VBG A;  4JKG B;  4H8S A;  1MKE A;  2HTH B;  3QBV B;  3SYX A;  2QKM A;  4BBK A;  1Z87 A;  4JKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...