1Y19B

Structural basis for phosphatidylinositol phosphate kinase type i-gamma binding to talin at focal adhesions
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein, signaling protein
molecule keywords Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
total genus 58
structure length 192
sequence length 192
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1y19B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y19B02
1I7AA 1V89A 4HDQA 2GS0A 3SUZA 4D0NB 2DHIA 2CY4A 2L2IA 2AEHA 3FLVA 2D9XA 4MY6A 4IOYX 3SNHA 1TXDA 3KY9A 4EKUA 3P7ZA 3F5RA 1QC6A 5FI1A 1U5EA 2CY5A 2D11A 2KUPA 3DXCA 2COCA 1FHOA 2MDXA 1GC7A 4A6KA 4A5KA 2YRYA 4HAWB 2LYDA 2YS3A 5C5BB 2KCJA 2D9WA 1MK9B 1ISNA 3D8DA 4PQ0A 3VIAA 2COAA 1XX0A 4KHOA 2DX1A 2G35A 4HATB 4C0AA 3A98B 2J0MA 5J3TA 2HRJA 2M14A 2OQBA 4YL8A 4HB3B 4DX8A 2CQUA 2I1KA 4EMOA 5L81A 3RCPA 2H7DA 4F7UP 4GPTB 2ABDA 2Y8FA 2EMTA 2DN6A 1OY2A 4YONA 5EFXA 1U29A 2NZ8B 3A8QA 2W2WA 5JP4A 2LBBA 5HE0A 1WI1A 3AU5A 2K00A 1ST7A 2D9YA 2IYBA 2RLOA 4B6HA 4XWXA 4Y94A 2VKIA 5JLJB 1ZVRA 2P0HA 2YF0A 3GYOA 1LW3A 5D3VA 2DHKA 5D27A 1DYNA 2COPA 1U5DA 2YT0A 2V76A 3P6AA 2CB8A 2DKQA 2Y7BA 4TKNA 2P0FA 3NSUA 2DX5A 1EAZA 1H10A 2D2QA 2QKLA 3TCAA 4L6EA 2OTXA 2NMBA 4A6HA 1FHWA 2M38A 2EC1A 3U7DA 1V5MA 1V61A 4ZRIA 3KRWA 5J3YA 1NVLA 3ODXA 1BWNA 2L1CA 4GZUA 1DDVA 5DI9B 1FHXA 1X1FA 1X11A 1WVHA 1X05A 1P5TA 1EGXA 4ZRJA 2YS1A 3LJUX 2Z0QA 1DDWA 4K2OA 2RSGA 4H8SA 2D4QA 4F7GA 4GMXB 5DHAB 2VSZA 2LG1A 1FB8A 2PZ1A 3ULCA 3MPXA 1RRPB 1W1GA 1PLSA 2D9VA 3PVWA 2YVCA 3WA0A 1U5FA 3BJIA 2GJYA 1KZ7A 1EF1A 2CRFA 3FSSA 2D9ZA 5CLQB 1V5PA 5GOWB 3SO6A 2K2JA 2AL6A 3FP5A 3F0WA 1M7RA 4DX90 2COFA 2RUKB 2GCJA 2CODA 5C6RA 3AU4A 2LKOA 1SGHA 1P3RA 1HB6A 2WH5A 2K2UA 1FAOA 1SHCA 3BINA 1AWEA 1BTNA 4IFSA 1B55A 1M7EA 4HB0B 1GC6A 1HB8A 3KSYA 5HE3A 3HK0A 4KHBB 3PVUA 4P7IA 3QIJA 4DXAB 2LOZA 1W1HA 3PP2A 4GMVA 3FEHA 1UEFA 1PMSA 5HE2A 3TVVA 2J0KA 2DYQA 5LONB 2RQ1A 5KQ1A 1UNQA 4GN1A 4TYZA 2FDQA 1NTYA 2P0DA 1J0WA 2RNRB 2EJ8A 1BAKA 3QBVB 4NSWA 1P6SA 2Z0OA 1XD4A 2ADZA 3TO1A 4CHMA 2DKPA 4MK0A 5C79A 1WGUA 1IRSA 2DFKA 1XR0B 1K5GB 3PSCA 3V5WA 2RGNB 5JHHA 2LULA 5J3QA 3SYXA 4KHAA 1MIXA 3ZDTA 4DBBA 1U5GA 1BTKA 1H4RA 5DH9B 2HTHB 4A6FA 2W2XD 2MWNB 1NI2A 3EPYA 4HAVB 4HB2B 2I5FA 4CYEA 3OANA 2FJ9A 4Z2MB 5HE1A 4WSFA 3T06A 1W1DA 3G9WA 4WJ7A 4MT7A 2J0JA 1DBHA 1X1GA 3DXDA 2D10A 1X86A 1MPHA 1KZGA 4EJNA 2EMSA 4HAXB 1FGZA 1ZC3B 3PVLA 3CIKA 3VOQA 1OQNA 2BCJA 5CLLB 1AQCA 1NTVA 2DYNA 1XKEA 4K81A 1U27A 3QWMA 2E2XA 3ML4A 1NTIA 4Z2NA 1EVHA 1NU2A 1MK7B 2YS5A 4CHJA 2CAYA 4KVGB 2DHJA 5FI0A 4BBKA 4NY0A 2ELBA 1J19A 2ELAA 1TJ6A 3SV1A 4K17A 5IJMA 1UPRA 3D8EA 3WYFB 2LOXA 1ZSQA 5KCVA 2Z0PA 2P8VA 2I5CA 3ZVRA 5DHFB 2H7EA 1LB1A 2DTCA 2VRWB 4GXBA 2R0DA 3ODOA 4IAPA 5C5BA 2GCLA 5DIFB 5C16A 2HE7A 2MKRA 2UZSA 3UZTA 1DROA 1E5WA 3CXBB 2ROZB 3O96A 2N23A 3A8PA 4WVFB 1QQGA 4ZRKA 1I2HA 1UNRA 2DLWA 3HQCA 2DA0A 3MDBC 3TW1A 1U2BA 2JP2A 4HAYB 2ZPYA 3AJ4A 1UNPA 3DXEA 2XQNM 1ZM0A 1HBKA 2YSZA 4A6FB 3FM8C 1MAIA 2Q13A 4HHVA 3M1IB 2FJLA 1FGYA 1XCGA 1WG7A 4HAZB 1FOEA 1UPQA 1Q67A 1RJ2A 4HDOA 1Z87A 2I1JA 1XODA 2UVMA 3PG7A 1TQZA 2KGXB 3D8FA 3GYPA 4PNKA 3IVFA 2Y8GA 2IFSA 1OMWA 1WJ1A 2N0YA 3HW2B 2UZRA 2R09A 3ULBA 3KRXA 5KQ4A 1ZC4B 4HB4B 3KZ1A 5D3WA 5D3YA 4KAXB 2X18A 1Y5OA 3PZDA 1V5UA 2QKMA 2MFQA 1MIZB 1MKEA 1K5DB 5JHGA 2J59M 1KI1B 3N7CA 4K2PA 1GG3A 1V88A 1DDMA 1N3HA 3X23A 3U8ZA 1WGQA 4HAUB 5D3XA 2ROVA 1Y19B 5LOPB 1WJMA 4F7HA 2YT1A 1ACAA 2RVBB 3ODWA 3TFMA 1PFJA 2W2XC 3PEGA
chains in the Genus database with same CATH superfamily
1I7AA 1V89A 4JKHA 4HDQA 2GS0A 2FJUB 4CSQA 3SUZA 4KHBA 4D0NB 2DHIA 2CY4A 1DIKA 2L2IA 2AEHA 4DIXA 3FLVA 2D9XA 4MY6A 4IOYX 4JKAA 3SNHA 1TXDA 3KY9A 4EKUA 3P7ZA 3F5RA 1QC6A 5FI1A 2KUQA 1U5EA 2CY5A 2D11A 2KUPA 1VBGA 3DXCA 2COCA 3E9PA 1FHOA 2MDXA 1JDEA 1GC7A 4A6KA 4A5KA 2YRYA 4GNKB 4JKBA 4HAWB 2LYDA 2YS3A 5C5BB 2KCJA 2D9WA 1MK9B 1ISNA 3D8DA 4PQ0A 3VIAA 2COAA 1XX0A 4KHOA 2DX1A 2G35A 4HATB 4C0AA 3A98B 2J0MA 5J3TA 2HRJA 5LG4B 2M14A 2OQBA 4YL8A 3NW8A 4HB3B 4DX8A 2CQUA 2I1KA 5JVLA 4EMOA 5L81A 3RCPA 2H7DA 4F7UP 4GPTB 2ABDA 2Y8FA 2EMTA 2DN6A 1OY2A 4YONA 5EFXA 1U29A 2NZ8B 2W2WA 3A8QA 5JP4A 2K8EA 2LBBA 5HE0A 1WI1A 3AU5A 1KC7A 4ILJA 2K00A 1ST7A 2D9YA 2IYBA 2RLOA 4B6HA 4XWXA 4Y94A 2VKIA 3OHMB 5JLJB 1ZVRA 2P0HA 2YF0A 3GYOA 1LW3A 5D3VA 2DHKA 5D27A 1DYNA 2COPA 4QJ4B 1U5DA 2YT0A 2V76A 3P6AA 2CB8A 2NBVA 2DKQA 2Y7BA 4TKNA 2P0FA 3NSUA 2DX5A 1EAZA 1H10A 2D2QA 2QKLA 3TCAA 4L6EA 2OTXA 3E9OA 2NMBA 4A6HA 1FHWA 2M38A 2Z14A 2EC1A 3U7DA 1V5MA 1V61A 4ZRIA 3KRWA 5J3YA 1NVLA 2KR0A 3ODXA 2R82A 1BWNA 2L1CA 4GZUA 1DDVA 5DI9B 1FHXA 1X1FA 1X11A 1WVHA 1X05A 1P5TA 1EGXA 4ZRJA 2YS1A 3LJUX 2Z0QA 3NWAA 1DDWA 4K2OA 2RSGA 4H8SA 2D4QA 4F7GA 4GMXB 4JKEA 5DHAB 2VSZA 2LG1A 4JKFA 1FB8A 2PZ1A 3ULCA 3MPXA 1RRPB 1W1GA 1PLSA 2D9VA 3PVWA 2YVCA 3WA0A 4L1RA 1U5FA 3BJIA 2GJYA 4JKDA 1KZ7A 1EF1A 2CRFA 3FSSA 2D9ZA 5CLQB 1V5PA 5GOWB 3SO6A 2K2JA 2AL6A 3FP5A 3F0WA 1M7RA 4DX90 2COFA 2RUKB 2GCJA 2CODA 5C6RA 3AU4A 2LKOA 1SGHA 1P3RA 1HB6A 2WH5A 2K2UA 1FAOA 1SHCA 3BINA 1AWEA 1BTNA 4IFSA 1B55A 1M7EA 2X0SA 1GC6A 4HB0B 1HB8A 3KSYA 2ZKMX 5HE3A 3HK0A 2Z13A 4KHBB 3PVUA 4P7IA 3QIJA 4DXAB 2LOZA 1W1HA 3PP2A 4GMVA 3FEHA 1UEFA 3E9LA 1PMSA 5HE2A 3TVVA 2J0KA 2DYQA 5LONB 2RQ1A 2YT2A 5KQ1A 1UNQA 4GN1A 4TYZA 2GUMA 2FDQA 1NTYA 2P0DA 1J0WA 2RNRB 2EJ8A 1BAKA 3QBVB 4NSWA 1P6SA 2Z0OA 1XD4A 2ADZA 4QJ3B 3TO1A 4CHMA 2DKPA 4MK0A 5C79A 1WGUA 1IRSA 2DFKA 1XR0B 1K5GB 3PSCA 3V5WA 3A58A 2RGNB 5JHHA 2LULA 5J3QA 5M4YB 3SYXA 4KHAA 1MIXA 3ZDTA 4DBBA 1U5GA 1BTKA 1H4RA 5DH9B 4JKCA 2HTHB 4A6FA 2W2XD 2MWNB 1NI2A 1VBHA 3EPYA 4HAVB 4HB2B 2I5FA 4CYEA 3OANA 2FJ9A 4Z2MB 5HE1A 4WSFA 3T06A 1W1DA 3G9WA 4WJ7A 4MT7A 2J0JA 1DBHA 1X1GA 2Z4DA 3DXDA 2D10A 1X86A 1MPHA 1KZGA 4EJNA 2EMSA 4HAXB 5I2SA 5IRSA 1FGZA 1ZC3B 3PVLA 3CIKA 3NWFA 3VOQA 1OQNA 2BCJA 5CLLB 1AQCA 4HSIA 1NTVA 3SBTA 2DYNA 3B77A 1XKEA 4K81A 1U27A 3QWMA 2E2XA 2R2YA 3ML4A 1NTIA 4Z2NA 1EVHA 1NU2A 1MK7B 2YS5A 4CHJA 2CAYA 4QJ5B 1ZYIA 4KVGB 2DHJA 5FI0A 4BBKA 4NY0A 2ELBA 2Z59A 1J19A 2ELAA 1TJ6A 3SV1A 4K17A 1T77A 5IJMA 1UPRA 3D8EA 3WYFB 2LOXA 1ZSQA 5KCVA 2Z0PA 2P8VA 2I5CA 3ZVRA 5DHFB 2H7EA 1LB1A 2DTCA 2VRWB 4GXBA 2R0DA 4JKGA 3ODOA 4IAPA 5C5BA 2GCLA 5DIFB 5C16A 2HE7A 2MKRA 2UZSA 3UZTA 1DROA 1E5WA 3CXBB 2ROZB 3O96A 2N23A 3A8PA 4JK8A 4WVFB 1QQGA 4ZRKA 1I2HA 1UNRA 2DLWA 3HQCA 2DA0A 2K49A 3MDBC 3TW1A 1U2BA 2JP2A 4HAYB 2ZPYA 3AJ4A 1UNPA 3DXEA 1KBLA 2XQNM 1ZM0A 3HSAA 1HBKA 2YSZA 4A6FB 3FM8C 1MAIA 2Q13A 4HHVA 3M1IB 3HIEA 2FJLA 1FGYA 1XCGA 1WG7A 4HAZB 1FOEA 1UPQA 1Q67A 3ENBA 1RJ2A 4HDOA 1Z87A 3SBGA 2I1JA 1XODA 3E66A 2UVMA 3PG7A 4JKGB 1TQZA 2DIKA 2KGXB 3D8FA 3GYPA 4JK9A 4PNKA 3IVFA 2Y8GA 2IFSA 1OMWA 1WJ1A 2N0YA 3HW2B 2UZRA 2R09A 4JK7A 3ULBA 3KRXA 2KIGA 5KQ4A 1ZC4B 4HB4B 3KZ1A 5D3WA 5D3YA 4KAXB 2X18A 1MI1A 4OSNA 1GGOA 1Y5OA 3PZDA 3FVCA 1V5UA 2QKMA 2MFQA 1MIZB 1MKEA 4ILGB 4QXAB 4ILHA 1K5DB 5JHGA 2J59M 1KI1B 3N7CA 2RRFA 3DCXA 4K2PA 5I2MA 1GG3A 1V88A 1DDMA 3U12A 1N3HA 3X23A 3U8ZA 1WGQA 4HAUB 5D3XA 4GOUA 2ROVA 1Y19B 5LOPB 1WJMA 2KIEA 4F7HA 2YT1A 1ACAA 3NWDA 2RVBB 3ODWA 3TFMA 4D6WA 4OT1A 1PFJA 2W2XC 3PEGA
chains in the Genus database with same CATH topology
1I7AA 1V89A 4JKHA 4HDQA 2GS0A 3SUZA 4D0NB 2DHIA 2CY4A 1DIKA 2L2IA 2AEHA 3FLVA 2D9XA 4MY6A 4IOYX 4JKAA 3SNHA 1TXDA 3KY9A 4EKUA 3P7ZA 3F5RA 1QC6A 5FI1A 1U5EA 2CY5A 2D11A 2KUPA 1VBGA 3DXCA 2COCA 3E9PA 1FHOA 2MDXA 1JDEA 1GC7A 4A6KA 4A5KA 2YRYA 4JKBA 4HAWB 2LYDA 2YS3A 5C5BB 2KCJA 2D9WA 1MK9B 1ISNA 3D8DA 4PQ0A 3VIAA 2COAA 1XX0A 4KHOA 2DX1A 2G35A 4HATB 4C0AA 3A98B 2J0MA 5J3TA 2HRJA 2M14A 2OQBA 4YL8A 4HB3B 4DX8A 2CQUA 2I1KA 5JVLA 4EMOA 5L81A 3RCPA 2H7DA 4F7UP 4GPTB 2ABDA 2Y8FA 2EMTA 2DN6A 1OY2A 4YONA 5EFXA 1U29A 2NZ8B 3A8QA 2W2WA 5JP4A 2LBBA 5HE0A 1WI1A 3AU5A 1KC7A 4ILJA 2K00A 1ST7A 2D9YA 2IYBA 2RLOA 4B6HA 4XWXA 4Y94A 2VKIA 5JLJB 1ZVRA 2P0HA 2YF0A 3GYOA 1LW3A 5D3VA 2DHKA 5D27A 1DYNA 2COPA 1U5DA 2YT0A 2V76A 3P6AA 2CB8A 2DKQA 2Y7BA 4TKNA 2P0FA 3NSUA 2DX5A 1EAZA 1H10A 2D2QA 2QKLA 3TCAA 4L6EA 2OTXA 3E9OA 2NMBA 4A6HA 1FHWA 2M38A 2EC1A 3U7DA 1V5MA 1V61A 4ZRIA 3KRWA 5J3YA 1NVLA 3ODXA 2R82A 1BWNA 2L1CA 4GZUA 1DDVA 5DI9B 1FHXA 1X1FA 1X11A 1WVHA 1X05A 1P5TA 1EGXA 4ZRJA 2YS1A 3LJUX 2Z0QA 1DDWA 4K2OA 2RSGA 4H8SA 2D4QA 4F7GA 4GMXB 4JKEA 5DHAB 2VSZA 2LG1A 4JKFA 1FB8A 2PZ1A 3ULCA 3MPXA 1RRPB 1W1GA 1PLSA 2D9VA 3PVWA 2YVCA 3WA0A 1U5FA 3BJIA 2GJYA 4JKDA 1KZ7A 1EF1A 2CRFA 3FSSA 2D9ZA 5CLQB 1V5PA 5GOWB 3SO6A 2K2JA 2AL6A 3FP5A 3F0WA 1M7RA 4DX90 2COFA 2RUKB 2GCJA 2CODA 5C6RA 3AU4A 2LKOA 1SGHA 1P3RA 1HB6A 2WH5A 2K2UA 1FAOA 1SHCA 3BINA 1AWEA 1BTNA 4IFSA 1B55A 1M7EA 2X0SA 1GC6A 4HB0B 1HB8A 3KSYA 5HE3A 3HK0A 4KHBB 3PVUA 4P7IA 3QIJA 4DXAB 2LOZA 1W1HA 3PP2A 4GMVA 3FEHA 1UEFA 3E9LA 1PMSA 5HE2A 3TVVA 2J0KA 2DYQA 5LONB 2RQ1A 5KQ1A 1UNQA 4GN1A 4TYZA 2FDQA 1NTYA 2P0DA 1J0WA 2RNRB 2EJ8A 1BAKA 3QBVB 4NSWA 1P6SA 2Z0OA 1XD4A 2ADZA 3TO1A 4CHMA 2DKPA 4MK0A 5C79A 1WGUA 1IRSA 2DFKA 1XR0B 1K5GB 3PSCA 3V5WA 2RGNB 5JHHA 2LULA 5J3QA 3SYXA 4KHAA 1MIXA 3ZDTA 4DBBA 1U5GA 1BTKA 1H4RA 5DH9B 4JKCA 2HTHB 4A6FA 2W2XD 2MWNB 1NI2A 1VBHA 3EPYA 4HAVB 4HB2B 2I5FA 4CYEA 3OANA 2FJ9A 4Z2MB 5HE1A 4WSFA 3T06A 1W1DA 3G9WA 4WJ7A 4MT7A 2J0JA 1DBHA 1X1GA 3DXDA 2D10A 1X86A 1MPHA 1KZGA 4EJNA 2EMSA 4HAXB 1FGZA 1ZC3B 3PVLA 3CIKA 3VOQA 1OQNA 2BCJA 5CLLB 1AQCA 1NTVA 3SBTA 2DYNA 1XKEA 4K81A 1U27A 3QWMA 2E2XA 3ML4A 1NTIA 4Z2NA 1EVHA 1NU2A 1MK7B 2YS5A 4CHJA 2CAYA 4KVGB 2DHJA 5FI0A 4BBKA 4NY0A 2ELBA 1J19A 2ELAA 1TJ6A 3SV1A 4K17A 5IJMA 1UPRA 3D8EA 3WYFB 2LOXA 1ZSQA 5KCVA 2Z0PA 2P8VA 2I5CA 3ZVRA 5DHFB 2H7EA 1LB1A 2DTCA 2VRWB 4GXBA 2R0DA 4JKGA 3ODOA 4IAPA 5C5BA 2GCLA 5DIFB 5C16A 2HE7A 2MKRA 2UZSA 3UZTA 1DROA 1E5WA 3CXBB 2ROZB 3O96A 2N23A 3A8PA 4JK8A 4WVFB 1QQGA 4ZRKA 1I2HA 1UNRA 2DLWA 3HQCA 2DA0A 3MDBC 3TW1A 1U2BA 2JP2A 4HAYB 2ZPYA 3AJ4A 1UNPA 3DXEA 1KBLA 2XQNM 1ZM0A 1HBKA 2YSZA 4A6FB 3FM8C 1MAIA 2Q13A 4HHVA 3M1IB 2FJLA 1FGYA 1XCGA 1WG7A 4HAZB 1FOEA 1UPQA 1Q67A 3ENBA 1RJ2A 4HDOA 1Z87A 3SBGA 2I1JA 1XODA 3E66A 2UVMA 3PG7A 4JKGB 1TQZA 2DIKA 2KGXB 3D8FA 3GYPA 4JK9A 4PNKA 3IVFA 2Y8GA 2IFSA 1OMWA 1WJ1A 2N0YA 3HW2B 2UZRA 2R09A 4JK7A 3ULBA 3KRXA 5KQ4A 1ZC4B 4HB4B 3KZ1A 5D3WA 5D3YA 4KAXB 2X18A 1GGOA 1Y5OA 3PZDA 1V5UA 2QKMA 2MFQA 1MIZB 1MKEA 4ILGB 4ILHA 1K5DB 5JHGA 2J59M 1KI1B 3N7CA 4K2PA 1GG3A 1V88A 1DDMA 1N3HA 3X23A 3U8ZA 1WGQA 4HAUB 5D3XA 2ROVA 1Y19B 5LOPB 1WJMA 4F7HA 2YT1A 1ACAA 2RVBB 3ODWA 3TFMA 1PFJA 2W2XC 3PEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7A A;  1V89 A;  4HDQ A;  2GS0 A;  3SUZ A;  4D0N B;  2DHI A;  2CY4 A;  2L2I A;  2AEH A;  3FLV A;  2D9X A;  4MY6 A;  4IOY X;  3SNH A;  1TXD A;  3KY9 A;  4EKU A;  3P7Z A;  3F5R A;  1QC6 A;  5FI1 A;  1U5E A;  2CY5 A;  2D11 A;  2KUP A;  3DXC A;  2COC A;  1FHO A;  2MDX A;  1GC7 A;  4A6K A;  4A5K A;  2YRY A;  4HAW B;  2LYD A;  2YS3 A;  5C5B B;  2KCJ A;  2D9W A;  1MK9 B;  1ISN A;  3D8D A;  4PQ0 A;  3VIA A;  2COA A;  1XX0 A;  4KHO A;  2DX1 A;  2G35 A;  4HAT B;  4C0A A;  3A98 B;  2J0M A;  5J3T A;  2HRJ A;  2M14 A;  2OQB A;  4YL8 A;  4HB3 B;  4DX8 A;  2CQU A;  2I1K A;  4EMO A;  5L81 A;  3RCP A;  2H7D A;  4F7U P;  4GPT B;  2ABD A;  2Y8F A;  2EMT A;  2DN6 A;  1OY2 A;  4YON A;  5EFX A;  1U29 A;  2NZ8 B;  3A8Q A;  2W2W A;  5JP4 A;  2LBB A;  5HE0 A;  1WI1 A;  3AU5 A;  2K00 A;  1ST7 A;  2D9Y A;  2IYB A;  2RLO A;  4B6H A;  4XWX A;  4Y94 A;  2VKI A;  5JLJ B;  1ZVR A;  2P0H A;  2YF0 A;  3GYO A;  1LW3 A;  5D3V A;  2DHK A;  5D27 A;  1DYN A;  2COP A;  1U5D A;  2YT0 A;  2V76 A;  3P6A A;  2CB8 A;  2DKQ A;  2Y7B A;  4TKN A;  2P0F A;  3NSU A;  2DX5 A;  1EAZ A;  1H10 A;  2D2Q A;  2QKL A;  3TCA A;  4L6E A;  2OTX A;  2NMB A;  4A6H A;  1FHW A;  2M38 A;  2EC1 A;  3U7D A;  1V5M A;  1V61 A;  4ZRI A;  3KRW A;  5J3Y A;  1NVL A;  3ODX A;  1BWN A;  2L1C A;  4GZU A;  1DDV A;  5DI9 B;  1FHX A;  1X1F A;  1X11 A;  1WVH A;  1X05 A;  1P5T A;  1EGX A;  4ZRJ A;  2YS1 A;  3LJU X;  2Z0Q A;  1DDW A;  4K2O A;  2RSG A;  4H8S A;  2D4Q A;  4F7G A;  4GMX B;  5DHA B;  2VSZ A;  2LG1 A;  1FB8 A;  2PZ1 A;  3ULC A;  3MPX A;  1RRP B;  1W1G A;  1PLS A;  2D9V A;  3PVW A;  2YVC A;  3WA0 A;  1U5F A;  3BJI A;  2GJY A;  1KZ7 A;  1EF1 A;  2CRF A;  3FSS A;  2D9Z A;  5CLQ B;  1V5P A;  5GOW B;  3SO6 A;  2K2J A;  2AL6 A;  3FP5 A;  3F0W A;  1M7R A;  4DX9 0;  2COF A;  2RUK B;  2GCJ A;  2COD A;  5C6R A;  3AU4 A;  2LKO A;  1SGH A;  1P3R A;  1HB6 A;  2WH5 A;  2K2U A;  1FAO A;  1SHC A;  3BIN A;  1AWE A;  1BTN A;  4IFS A;  1B55 A;  1M7E A;  4HB0 B;  1GC6 A;  1HB8 A;  3KSY A;  5HE3 A;  3HK0 A;  4KHB B;  3PVU A;  4P7I A;  3QIJ A;  4DXA B;  2LOZ A;  1W1H A;  3PP2 A;  4GMV A;  3FEH A;  1UEF A;  1PMS A;  5HE2 A;  3TVV A;  2J0K A;  2DYQ A;  5LON B;  2RQ1 A;  5KQ1 A;  1UNQ A;  4GN1 A;  4TYZ A;  2FDQ A;  1NTY A;  2P0D A;  1J0W A;  2RNR B;  2EJ8 A;  1BAK A;  3QBV B;  4NSW A;  1P6S A;  2Z0O A;  1XD4 A;  2ADZ A;  3TO1 A;  4CHM A;  2DKP A;  4MK0 A;  5C79 A;  1WGU A;  1IRS A;  2DFK A;  1XR0 B;  1K5G B;  3PSC A;  3V5W A;  2RGN B;  5JHH A;  2LUL A;  5J3Q A;  3SYX A;  4KHA A;  1MIX A;  3ZDT A;  4DBB A;  1U5G A;  1BTK A;  1H4R A;  5DH9 B;  2HTH B;  4A6F A;  2W2X D;  2MWN B;  1NI2 A;  3EPY A;  4HAV B;  4HB2 B;  2I5F A;  4CYE A;  3OAN A;  2FJ9 A;  4Z2M B;  5HE1 A;  4WSF A;  3T06 A;  1W1D A;  3G9W A;  4WJ7 A;  4MT7 A;  2J0J A;  1DBH A;  1X1G A;  3DXD A;  2D10 A;  1X86 A;  1MPH A;  1KZG A;  4EJN A;  2EMS A;  4HAX B;  1FGZ A;  1ZC3 B;  3PVL A;  3CIK A;  3VOQ A;  1OQN A;  2BCJ A;  5CLL B;  1AQC A;  1NTV A;  2DYN A;  1XKE A;  4K81 A;  1U27 A;  3QWM A;  2E2X A;  3ML4 A;  1NTI A;  4Z2N A;  1EVH A;  1NU2 A;  1MK7 B;  2YS5 A;  4CHJ A;  2CAY A;  4KVG B;  2DHJ A;  5FI0 A;  4BBK A;  4NY0 A;  2ELB A;  1J19 A;  2ELA A;  1TJ6 A;  3SV1 A;  4K17 A;  5IJM A;  1UPR A;  3D8E A;  3WYF B;  2LOX A;  1ZSQ A;  5KCV A;  2Z0P A;  2P8V A;  2I5C A;  3ZVR A;  5DHF B;  2H7E A;  1LB1 A;  2DTC A;  2VRW B;  4GXB A;  2R0D A;  3ODO A;  4IAP A;  5C5B A;  2GCL A;  5DIF B;  5C16 A;  2HE7 A;  2MKR A;  2UZS A;  3UZT A;  1DRO A;  1E5W A;  3CXB B;  2ROZ B;  3O96 A;  2N23 A;  3A8P A;  4WVF B;  1QQG A;  4ZRK A;  1I2H A;  1UNR A;  2DLW A;  3HQC A;  2DA0 A;  3MDB C;  3TW1 A;  1U2B A;  2JP2 A;  4HAY B;  2ZPY A;  3AJ4 A;  1UNP A;  3DXE A;  2XQN M;  1ZM0 A;  1HBK A;  2YSZ A;  4A6F B;  3FM8 C;  1MAI A;  2Q13 A;  4HHV A;  3M1I B;  2FJL A;  1FGY A;  1XCG A;  1WG7 A;  4HAZ B;  1FOE A;  1UPQ A;  1Q67 A;  1RJ2 A;  4HDO A;  1Z87 A;  2I1J A;  1XOD A;  2UVM A;  3PG7 A;  1TQZ A;  2KGX B;  3D8F A;  3GYP A;  4PNK A;  3IVF A;  2Y8G A;  2IFS A;  1OMW A;  1WJ1 A;  2N0Y A;  3HW2 B;  2UZR A;  2R09 A;  3ULB A;  3KRX A;  5KQ4 A;  1ZC4 B;  4HB4 B;  3KZ1 A;  5D3W A;  5D3Y A;  4KAX B;  2X18 A;  1Y5O A;  3PZD A;  1V5U A;  2QKM A;  2MFQ A;  1MIZ B;  1MKE A;  1K5D B;  5JHG A;  2J59 M;  1KI1 B;  3N7C A;  4K2P A;  1GG3 A;  1V88 A;  1DDM A;  1N3H A;  3X23 A;  3U8Z A;  1WGQ A;  4HAU B;  5D3X A;  2ROV A;  1Y19 B;  5LOP B;  1WJM A;  4F7H A;  2YT1 A;  1ACA A;  2RVB B;  3ODW A;  3TFM A;  1PFJ A;  2W2X C;  3PEG A; 
#chains in the Genus database with same CATH topology
 1I7A A;  1V89 A;  4JKH A;  4HDQ A;  2GS0 A;  2FJU B;  4CSQ A;  3SUZ A;  4KHB A;  4D0N B;  2DHI A;  2CY4 A;  1DIK A;  2L2I A;  2AEH A;  4DIX A;  3FLV A;  2D9X A;  4MY6 A;  4IOY X;  4JKA A;  3SNH A;  1TXD A;  3KY9 A;  4EKU A;  3P7Z A;  3F5R A;  1QC6 A;  5FI1 A;  2KUQ A;  1U5E A;  2CY5 A;  2D11 A;  2KUP A;  1VBG A;  3DXC A;  2COC A;  3E9P A;  1FHO A;  2MDX A;  1JDE A;  1GC7 A;  4A6K A;  4A5K A;  2YRY A;  4GNK B;  4JKB A;  4HAW B;  2LYD A;  2YS3 A;  5C5B B;  2KCJ A;  2D9W A;  1MK9 B;  1ISN A;  3D8D A;  4PQ0 A;  3VIA A;  2COA A;  1XX0 A;  4KHO A;  2DX1 A;  2G35 A;  4HAT B;  4C0A A;  3A98 B;  2J0M A;  5J3T A;  2HRJ A;  5LG4 B;  2M14 A;  2OQB A;  4YL8 A;  3NW8 A;  4HB3 B;  4DX8 A;  2CQU A;  2I1K A;  5JVL A;  4EMO A;  5L81 A;  3RCP A;  2H7D A;  4F7U P;  4GPT B;  2ABD A;  2Y8F A;  2EMT A;  2DN6 A;  1OY2 A;  4YON A;  5EFX A;  1U29 A;  2NZ8 B;  2W2W A;  3A8Q A;  5JP4 A;  2K8E A;  2LBB A;  5HE0 A;  1WI1 A;  3AU5 A;  1KC7 A;  4ILJ A;  2K00 A;  1ST7 A;  2D9Y A;  2IYB A;  2RLO A;  4B6H A;  4XWX A;  4Y94 A;  2VKI A;  3OHM B;  5JLJ B;  1ZVR A;  2P0H A;  2YF0 A;  3GYO A;  1LW3 A;  5D3V A;  2DHK A;  5D27 A;  1DYN A;  2COP A;  4QJ4 B;  1U5D A;  2YT0 A;  2V76 A;  3P6A A;  2CB8 A;  2NBV A;  2DKQ A;  2Y7B A;  4TKN A;  2P0F A;  3NSU A;  2DX5 A;  1EAZ A;  1H10 A;  2D2Q A;  2QKL A;  3TCA A;  4L6E A;  2OTX A;  3E9O A;  2NMB A;  4A6H A;  1FHW A;  2M38 A;  2Z14 A;  2EC1 A;  3U7D A;  1V5M A;  1V61 A;  4ZRI A;  3KRW A;  5J3Y A;  1NVL A;  2KR0 A;  3ODX A;  2R82 A;  1BWN A;  2L1C A;  4GZU A;  1DDV A;  5DI9 B;  1FHX A;  1X1F A;  1X11 A;  1WVH A;  1X05 A;  1P5T A;  1EGX A;  4ZRJ A;  2YS1 A;  3LJU X;  2Z0Q A;  3NWA A;  1DDW A;  4K2O A;  2RSG A;  4H8S A;  2D4Q A;  4F7G A;  4GMX B;  4JKE A;  5DHA B;  2VSZ A;  2LG1 A;  4JKF A;  1FB8 A;  2PZ1 A;  3ULC A;  3MPX A;  1RRP B;  1W1G A;  1PLS A;  2D9V A;  3PVW A;  2YVC A;  3WA0 A;  4L1R A;  1U5F A;  3BJI A;  2GJY A;  4JKD A;  1KZ7 A;  1EF1 A;  2CRF A;  3FSS A;  2D9Z A;  5CLQ B;  1V5P A;  5GOW B;  3SO6 A;  2K2J A;  2AL6 A;  3FP5 A;  3F0W A;  1M7R A;  4DX9 0;  2COF A;  2RUK B;  2GCJ A;  2COD A;  5C6R A;  3AU4 A;  2LKO A;  1SGH A;  1P3R A;  1HB6 A;  2WH5 A;  2K2U A;  1FAO A;  1SHC A;  3BIN A;  1AWE A;  1BTN A;  4IFS A;  1B55 A;  1M7E A;  2X0S A;  1GC6 A;  4HB0 B;  1HB8 A;  3KSY A;  2ZKM X;  5HE3 A;  3HK0 A;  2Z13 A;  4KHB B;  3PVU A;  4P7I A;  3QIJ A;  4DXA B;  2LOZ A;  1W1H A;  3PP2 A;  4GMV A;  3FEH A;  1UEF A;  3E9L A;  1PMS A;  5HE2 A;  3TVV A;  2J0K A;  2DYQ A;  5LON B;  2RQ1 A;  2YT2 A;  5KQ1 A;  1UNQ A;  4GN1 A;  4TYZ A;  2GUM A;  2FDQ A;  1NTY A;  2P0D A;  1J0W A;  2RNR B;  2EJ8 A;  1BAK A;  3QBV B;  4NSW A;  1P6S A;  2Z0O A;  1XD4 A;  2ADZ A;  4QJ3 B;  3TO1 A;  4CHM A;  2DKP A;  4MK0 A;  5C79 A;  1WGU A;  1IRS A;  2DFK A;  1XR0 B;  1K5G B;  3PSC A;  3V5W A;  3A58 A;  2RGN B;  5JHH A;  2LUL A;  5J3Q A;  5M4Y B;  3SYX A;  4KHA A;  1MIX A;  3ZDT A;  4DBB A;  1U5G A;  1BTK A;  1H4R A;  5DH9 B;  4JKC A;  2HTH B;  4A6F A;  2W2X D;  2MWN B;  1NI2 A;  1VBH A;  3EPY A;  4HAV B;  4HB2 B;  2I5F A;  4CYE A;  3OAN A;  2FJ9 A;  4Z2M B;  5HE1 A;  4WSF A;  3T06 A;  1W1D A;  3G9W A;  4WJ7 A;  4MT7 A;  2J0J A;  1DBH A;  1X1G A;  2Z4D A;  3DXD A;  2D10 A;  1X86 A;  1MPH A;  1KZG A;  4EJN A;  2EMS A;  4HAX B;  5I2S A;  5IRS A;  1FGZ A;  1ZC3 B;  3PVL A;  3CIK A;  3NWF A;  3VOQ A;  1OQN A;  2BCJ A;  5CLL B;  1AQC A;  4HSI A;  1NTV A;  3SBT A;  2DYN A;  3B77 A;  1XKE A;  4K81 A;  1U27 A;  3QWM A;  2E2X A;  2R2Y A;  3ML4 A;  1NTI A;  4Z2N A;  1EVH A;  1NU2 A;  1MK7 B;  2YS5 A;  4CHJ A;  2CAY A;  4QJ5 B;  1ZYI A;  4KVG B;  2DHJ A;  5FI0 A;  4BBK A;  4NY0 A;  2ELB A;  2Z59 A;  1J19 A;  2ELA A;  1TJ6 A;  3SV1 A;  4K17 A;  1T77 A;  5IJM A;  1UPR A;  3D8E A;  3WYF B;  2LOX A;  1ZSQ A;  5KCV A;  2Z0P A;  2P8V A;  2I5C A;  3ZVR A;  5DHF B;  2H7E A;  1LB1 A;  2DTC A;  2VRW B;  4GXB A;  2R0D A;  4JKG A;  3ODO A;  4IAP A;  5C5B A;  2GCL A;  5DIF B;  5C16 A;  2HE7 A;  2MKR A;  2UZS A;  3UZT A;  1DRO A;  1E5W A;  3CXB B;  2ROZ B;  3O96 A;  2N23 A;  3A8P A;  4JK8 A;  4WVF B;  1QQG A;  4ZRK A;  1I2H A;  1UNR A;  2DLW A;  3HQC A;  2DA0 A;  2K49 A;  3MDB C;  3TW1 A;  1U2B A;  2JP2 A;  4HAY B;  2ZPY A;  3AJ4 A;  1UNP A;  3DXE A;  1KBL A;  2XQN M;  1ZM0 A;  3HSA A;  1HBK A;  2YSZ A;  4A6F B;  3FM8 C;  1MAI A;  2Q13 A;  4HHV A;  3M1I B;  3HIE A;  2FJL A;  1FGY A;  1XCG A;  1WG7 A;  4HAZ B;  1FOE A;  1UPQ A;  1Q67 A;  3ENB A;  1RJ2 A;  4HDO A;  1Z87 A;  3SBG A;  2I1J A;  1XOD A;  3E66 A;  2UVM A;  3PG7 A;  4JKG B;  1TQZ A;  2DIK A;  2KGX B;  3D8F A;  3GYP A;  4JK9 A;  4PNK A;  3IVF A;  2Y8G A;  2IFS A;  1OMW A;  1WJ1 A;  2N0Y A;  3HW2 B;  2UZR A;  2R09 A;  4JK7 A;  3ULB A;  3KRX A;  2KIG A;  5KQ4 A;  1ZC4 B;  4HB4 B;  3KZ1 A;  5D3W A;  5D3Y A;  4KAX B;  2X18 A;  1MI1 A;  4OSN A;  1GGO A;  1Y5O A;  3PZD A;  3FVC A;  1V5U A;  2QKM A;  2MFQ A;  1MIZ B;  1MKE A;  4ILG B;  4QXA B;  4ILH A;  1K5D B;  5JHG A;  2J59 M;  1KI1 B;  3N7C A;  2RRF A;  3DCX A;  4K2P A;  5I2M A;  1GG3 A;  1V88 A;  1DDM A;  3U12 A;  1N3H A;  3X23 A;  3U8Z A;  1WGQ A;  4HAU B;  5D3X A;  4GOU A;  2ROV A;  1Y19 B;  5LOP B;  1WJM A;  2KIE A;  4F7H A;  2YT1 A;  1ACA A;  3NWD A;  2RVB B;  3ODW A;  3TFM A;  4D6W A;  4OT1 A;  1PFJ A;  2W2X C;  3PEG A; 
#chains in the Genus database with same CATH homology
 1I7A A;  1V89 A;  4JKH A;  4HDQ A;  2GS0 A;  3SUZ A;  4D0N B;  2DHI A;  2CY4 A;  1DIK A;  2L2I A;  2AEH A;  3FLV A;  2D9X A;  4MY6 A;  4IOY X;  4JKA A;  3SNH A;  1TXD A;  3KY9 A;  4EKU A;  3P7Z A;  3F5R A;  1QC6 A;  5FI1 A;  1U5E A;  2CY5 A;  2D11 A;  2KUP A;  1VBG A;  3DXC A;  2COC A;  3E9P A;  1FHO A;  2MDX A;  1JDE A;  1GC7 A;  4A6K A;  4A5K A;  2YRY A;  4JKB A;  4HAW B;  2LYD A;  2YS3 A;  5C5B B;  2KCJ A;  2D9W A;  1MK9 B;  1ISN A;  3D8D A;  4PQ0 A;  3VIA A;  2COA A;  1XX0 A;  4KHO A;  2DX1 A;  2G35 A;  4HAT B;  4C0A A;  3A98 B;  2J0M A;  5J3T A;  2HRJ A;  2M14 A;  2OQB A;  4YL8 A;  4HB3 B;  4DX8 A;  2CQU A;  2I1K A;  5JVL A;  4EMO A;  5L81 A;  3RCP A;  2H7D A;  4F7U P;  4GPT B;  2ABD A;  2Y8F A;  2EMT A;  2DN6 A;  1OY2 A;  4YON A;  5EFX A;  1U29 A;  2NZ8 B;  3A8Q A;  2W2W A;  5JP4 A;  2LBB A;  5HE0 A;  1WI1 A;  3AU5 A;  1KC7 A;  4ILJ A;  2K00 A;  1ST7 A;  2D9Y A;  2IYB A;  2RLO A;  4B6H A;  4XWX A;  4Y94 A;  2VKI A;  5JLJ B;  1ZVR A;  2P0H A;  2YF0 A;  3GYO A;  1LW3 A;  5D3V A;  2DHK A;  5D27 A;  1DYN A;  2COP A;  1U5D A;  2YT0 A;  2V76 A;  3P6A A;  2CB8 A;  2DKQ A;  2Y7B A;  4TKN A;  2P0F A;  3NSU A;  2DX5 A;  1EAZ A;  1H10 A;  2D2Q A;  2QKL A;  3TCA A;  4L6E A;  2OTX A;  3E9O A;  2NMB A;  4A6H A;  1FHW A;  2M38 A;  2EC1 A;  3U7D A;  1V5M A;  1V61 A;  4ZRI A;  3KRW A;  5J3Y A;  1NVL A;  3ODX A;  2R82 A;  1BWN A;  2L1C A;  4GZU A;  1DDV A;  5DI9 B;  1FHX A;  1X1F A;  1X11 A;  1WVH A;  1X05 A;  1P5T A;  1EGX A;  4ZRJ A;  2YS1 A;  3LJU X;  2Z0Q A;  1DDW A;  4K2O A;  2RSG A;  4H8S A;  2D4Q A;  4F7G A;  4GMX B;  4JKE A;  5DHA B;  2VSZ A;  2LG1 A;  4JKF A;  1FB8 A;  2PZ1 A;  3ULC A;  3MPX A;  1RRP B;  1W1G A;  1PLS A;  2D9V A;  3PVW A;  2YVC A;  3WA0 A;  1U5F A;  3BJI A;  2GJY A;  4JKD A;  1KZ7 A;  1EF1 A;  2CRF A;  3FSS A;  2D9Z A;  5CLQ B;  1V5P A;  5GOW B;  3SO6 A;  2K2J A;  2AL6 A;  3FP5 A;  3F0W A;  1M7R A;  4DX9 0;  2COF A;  2RUK B;  2GCJ A;  2COD A;  5C6R A;  3AU4 A;  2LKO A;  1SGH A;  1P3R A;  1HB6 A;  2WH5 A;  2K2U A;  1FAO A;  1SHC A;  3BIN A;  1AWE A;  1BTN A;  4IFS A;  1B55 A;  1M7E A;  2X0S A;  1GC6 A;  4HB0 B;  1HB8 A;  3KSY A;  5HE3 A;  3HK0 A;  4KHB B;  3PVU A;  4P7I A;  3QIJ A;  4DXA B;  2LOZ A;  1W1H A;  3PP2 A;  4GMV A;  3FEH A;  1UEF A;  3E9L A;  1PMS A;  5HE2 A;  3TVV A;  2J0K A;  2DYQ A;  5LON B;  2RQ1 A;  5KQ1 A;  1UNQ A;  4GN1 A;  4TYZ A;  2FDQ A;  1NTY A;  2P0D A;  1J0W A;  2RNR B;  2EJ8 A;  1BAK A;  3QBV B;  4NSW A;  1P6S A;  2Z0O A;  1XD4 A;  2ADZ A;  3TO1 A;  4CHM A;  2DKP A;  4MK0 A;  5C79 A;  1WGU A;  1IRS A;  2DFK A;  1XR0 B;  1K5G B;  3PSC A;  3V5W A;  2RGN B;  5JHH A;  2LUL A;  5J3Q A;  3SYX A;  4KHA A;  1MIX A;  3ZDT A;  4DBB A;  1U5G A;  1BTK A;  1H4R A;  5DH9 B;  4JKC A;  2HTH B;  4A6F A;  2W2X D;  2MWN B;  1NI2 A;  1VBH A;  3EPY A;  4HAV B;  4HB2 B;  2I5F A;  4CYE A;  3OAN A;  2FJ9 A;  4Z2M B;  5HE1 A;  4WSF A;  3T06 A;  1W1D A;  3G9W A;  4WJ7 A;  4MT7 A;  2J0J A;  1DBH A;  1X1G A;  3DXD A;  2D10 A;  1X86 A;  1MPH A;  1KZG A;  4EJN A;  2EMS A;  4HAX B;  1FGZ A;  1ZC3 B;  3PVL A;  3CIK A;  3VOQ A;  1OQN A;  2BCJ A;  5CLL B;  1AQC A;  1NTV A;  3SBT A;  2DYN A;  1XKE A;  4K81 A;  1U27 A;  3QWM A;  2E2X A;  3ML4 A;  1NTI A;  4Z2N A;  1EVH A;  1NU2 A;  1MK7 B;  2YS5 A;  4CHJ A;  2CAY A;  4KVG B;  2DHJ A;  5FI0 A;  4BBK A;  4NY0 A;  2ELB A;  1J19 A;  2ELA A;  1TJ6 A;  3SV1 A;  4K17 A;  5IJM A;  1UPR A;  3D8E A;  3WYF B;  2LOX A;  1ZSQ A;  5KCV A;  2Z0P A;  2P8V A;  2I5C A;  3ZVR A;  5DHF B;  2H7E A;  1LB1 A;  2DTC A;  2VRW B;  4GXB A;  2R0D A;  4JKG A;  3ODO A;  4IAP A;  5C5B A;  2GCL A;  5DIF B;  5C16 A;  2HE7 A;  2MKR A;  2UZS A;  3UZT A;  1DRO A;  1E5W A;  3CXB B;  2ROZ B;  3O96 A;  2N23 A;  3A8P A;  4JK8 A;  4WVF B;  1QQG A;  4ZRK A;  1I2H A;  1UNR A;  2DLW A;  3HQC A;  2DA0 A;  3MDB C;  3TW1 A;  1U2B A;  2JP2 A;  4HAY B;  2ZPY A;  3AJ4 A;  1UNP A;  3DXE A;  1KBL A;  2XQN M;  1ZM0 A;  1HBK A;  2YSZ A;  4A6F B;  3FM8 C;  1MAI A;  2Q13 A;  4HHV A;  3M1I B;  2FJL A;  1FGY A;  1XCG A;  1WG7 A;  4HAZ B;  1FOE A;  1UPQ A;  1Q67 A;  3ENB A;  1RJ2 A;  4HDO A;  1Z87 A;  3SBG A;  2I1J A;  1XOD A;  3E66 A;  2UVM A;  3PG7 A;  4JKG B;  1TQZ A;  2DIK A;  2KGX B;  3D8F A;  3GYP A;  4JK9 A;  4PNK A;  3IVF A;  2Y8G A;  2IFS A;  1OMW A;  1WJ1 A;  2N0Y A;  3HW2 B;  2UZR A;  2R09 A;  4JK7 A;  3ULB A;  3KRX A;  5KQ4 A;  1ZC4 B;  4HB4 B;  3KZ1 A;  5D3W A;  5D3Y A;  4KAX B;  2X18 A;  1GGO A;  1Y5O A;  3PZD A;  1V5U A;  2QKM A;  2MFQ A;  1MIZ B;  1MKE A;  4ILG B;  4ILH A;  1K5D B;  5JHG A;  2J59 M;  1KI1 B;  3N7C A;  4K2P A;  1GG3 A;  1V88 A;  1DDM A;  1N3H A;  3X23 A;  3U8Z A;  1WGQ A;  4HAU B;  5D3X A;  2ROV A;  1Y19 B;  5LOP B;  1WJM A;  4F7H A;  2YT1 A;  1ACA A;  2RVB B;  3ODW A;  3TFM A;  1PFJ A;  2W2X C;  3PEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...