1Y19B

Structural basis for phosphatidylinositol phosphate kinase type i-gamma binding to talin at focal adhesions
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
b'PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 5-kinase, type 1 gamma
publication title Structural bases for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein, signaling protein
total genus 58
structure length 192
sequence length 192
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2004-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1y19B01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1y19B02
2QKLA 5HE2A 4L6EA 2D9YA 2Y7BA 3RCPA 3TW1A 5DHAB 2ELAA 4CHJA 2DKQA 3KY9A 1UPQA 5C79A 4HB0B 2Y8FA 4MY6A 2J0KA 4MK0A 2D9ZA 2LG1A 2KUPA 1ISNA 3FP5A 3CIKA 2VRWB 2AEHA 2Z0OA 2HTHB 2OQBA 4HAZB 5LOPB 2DYNA 1XX0A 2VSZA 2CY5A 4BBKA 1H4RA 2P0FA 4KHOA 3ZDTA 2RUKB 1HBKA 5JHGA 1J0WA 1FGZA 1M7RA 1U5FA 1U5GA 4HDQA 5D27A 2DA0A 2GCJA 2DYQA 2Z0PA 3ODWA 2D4QA 2FJLA 3PSCA 4MT7A 1XODA 3KRXA 2YS1A 1X11A 2LYDA 1EVHA 1TXDA 2PZ1A 1MAIA 1BTNA 2D9WA 2MFQA 1NTVA 2EJ8A 1J19A 3M1IB 1WGUA 1U2BA 1ACAA 3GYPA 3ULCA 2ABDA 1NU2A 1FHXA 1V89A 4HAWB 1W1GA 2I5CA 4KVGB 1ST7A 2G35A 1ZC3B 5C16A 4EJNA 1BTKA 1LW3A 3GYOA 1GC6A 2D11A 1WJ1A 3VIAA 4F7HA 2DTCA 3NSUA 2J59M 1MIZB 1FOEA 1MPHA 3N7CA 5KCVA 4IFSA 1XCGA 4HAVB 1NTIA 2COAA 2DN6A 1TQZA 3EPYA 5J3YA 3PVLA 1K5GB 5CLLB 1KI1B 4K2OA 1B55A 2IFSA 2FDQA 1FHOA 5HE1A 1P3RA 1ZM0A 4GN1A 2UZRA 1DBHA 2IYBA 3IVFA 1U5EA 1WGQA 4PQ0A 2X18A 2UVMA 3DXCA 4ZRIA 5D3YA 1TJ6A 1P5TA 4HB3B 1NTYA 3KZ1A 2M38A 3D8FA 3PVUA 5FI1A 3BJIA 2K2UA 4HATB 2YF0A 3TCAA 2NZ8B 2LBBA 3SYXA 2CODA 1BWNA 2YS3A 2DKPA 3KSYA 4ZRJA 2D9VA 2L2IA 4H8SA 2DHJA 4HB2B 1DYNA 3A98B 1MK7B 3ML4A 2GJYA 2Z0QA 5JP4A 1XR0B 2COPA 1DROA 1K5DB 1V5MA 4K17A 2HRJA 1ZC4B 2ADZA 3QIJA 3F0WA 2COCA 4Z2MB 1NI2A 2D2QA 2R0DA 1GC7A 2GS0A 5GOWB 2ROVA 2N23A 1X1GA 3A8QA 1X86A 5DIFB 2W2XD 1KZGA 2I5FA 1UNPA 2DFKA 2K00A 4WSFA 3SUZA 3UZTA 5D3WA 2EC1A 5HE0A 5J3QA 5D3VA 1KZ7A 4Z2NA 5EFXA 1PFJA 3ZVRA 1RJ2A 1NVLA 2RSGA 3X23A 1QQGA 1GG3A 5DHFB 2LOZA 3AU5A 2W2WA 1OMWA 5CLQB 3PZDA 3DXDA 1U29A 3FLVA 1ZVRA 2COFA 4HB4B 2YT1A 1Y5OA 3TO1A 2AL6A 2I1JA 3ULBA 1WVHA 4DXAB 5D3XA 1MK9B 4HAYB 2GCLA 4XWXA 3HW2B 3PG7A 4K81A 1X1FA 2W2XC 3VOQA 1BAKA 5KQ4A 5KQ1A 4C0AA 3PEGA 3O96A 2YSZA 3AJ4A 5C6RA 3PVWA 1HB8A 1PLSA 1EGXA 2DLWA 4Y94A 1XD4A 5JLJB 4EKUA 1FAOA 1WI1A 4CYEA 3FEHA 4HHVA 3HQCA 4D0NB 4F7UP 1V5PA 4P7IA 2YRYA 4PNKA 2I1KA 3T06A 2MWNB 2DX1A 5L81A 1WG7A 3D8EA 1AWEA 2RNRB 4GXBA 2Q13A 3F5RA 1I7AA 2KGXB 1V61A 1Q67A 1DDVA 1Z87A 4WVFB 3TVVA 3FSSA 3MDBC 5LONB 1QC6A 2XQNM 4YL8A 2RQ1A 4TKNA 3TFMA 2P0HA 2J0MA 1UNRA 1M7EA 2JP2A 2H7EA 2DHKA 4DX8A 1ZSQA 5JHHA 1PMSA 4HDOA 5C5BA 1HB6A 2CRFA 2CY4A 2BCJA 1N3HA 3SO6A 3QBVB 4DX90 1I2HA 2OTXA 2FJ9A 2ROZB 4WJ7A 4CHMA 3FM8C 2LOXA 2RGNB 2NMBA 2Y8GA 2LKOA 2RLOA 1P6SA 5HE3A 3P7ZA 4IAPA 1OY2A 4KHBB 2YVCA 4DBBA 2WH5A 2KCJA 3V5WA 4IOYX 4B6HA 2CQUA 3PP2A 5J3TA 2DX5A 5DI9B 2CAYA 4KAXB 2K2JA 1V88A 3ODOA 1IRSA 2LULA 2MDXA 2N0YA 4GZUA 4HAXB 4EMOA 5C5BB 3LJUX 4A6FA 4GMVA 2D9XA 2EMTA 2VKIA 4YONA 3ODXA 1EF1A 3D8DA 3AU4A 3SV1A 1X05A 4TYZA 4A6HA 1SHCA 2ELBA 3P6AA 4NY0A 1UNQA 1U27A 3G9WA 2P0DA 4A6KA 1XKEA 1LB1A 3WA0A 2UZSA 1RRPB 1DDMA 4K2PA 1UPRA 2V76A 2YT0A 1H10A 2DHIA 2CB8A 1EAZA 3HK0A 5DH9B 1AQCA 2QKMA 1OQNA 2YS5A 4KHAA 1Y19B 2M14A 2L1CA 2R09A 4ZRKA 4GPTB 2RVBB 1E5WA 1W1DA 4GMXB 1FHWA 3WYFB 2P8VA 1UEFA 1DDWA 4A6FB 3KRWA 3OANA 3CXBB 4A5KA 3DXEA 1SGHA 1WJMA 4F7GA 2E2XA 2J0JA 1MIXA 3U7DA 1FGYA 3MPXA 3BINA 3U8ZA 2EMSA 4HAUB 5FI0A 3A8PA 1U5DA 2H7DA 3QWMA 1V5UA 2D10A 1FB8A 3SNHA 1W1HA 1MKEA 2MKRA 2HE7A 4NSWA 2ZPYA 5IJMA
chains in the Genus database with same CATH superfamily
2QKLA 3B77A 3FVCA 5HE2A 3NWDA 4L6EA 2D9YA 2Y7BA 3RCPA 3TW1A 5DHAB 2ELAA 4CHJA 2DKQA 3KY9A 1UPQA 5C79A 4HB0B 2Y8FA 4MY6A 2J0KA 4MK0A 2D9ZA 2LG1A 2KUPA 1ISNA 3FP5A 3CIKA 4CSQA 2VRWB 2AEHA 2ZKMX 2Z0OA 2HTHB 2OQBA 4HAZB 5LOPB 2DYNA 1XX0A 2VSZA 2CY5A 4BBKA 1H4RA 2P0FA 4JK7A 4KHOA 3ZDTA 2RUKB 1HBKA 4OSNA 5JHGA 1J0WA 1FGZA 1M7RA 1DIKA 1U5FA 1U5GA 4HDQA 5D27A 2DA0A 2GCJA 2DYQA 2Z0PA 3ODWA 2D4QA 2FJLA 3PSCA 4MT7A 1XODA 3KRXA 2YS1A 1X11A 2LYDA 4GNKB 1EVHA 1TXDA 2KUQA 2PZ1A 1MAIA 1BTNA 2D9WA 2MFQA 1NTVA 2EJ8A 1J19A 3M1IB 1WGUA 1U2BA 1ACAA 3GYPA 3ULCA 2ABDA 1NU2A 2K49A 1FHXA 1V89A 4HAWB 1W1GA 4JK8A 2I5CA 3U12A 4KVGB 1ST7A 2RRFA 2G35A 1ZC3B 5C16A 4EJNA 2GUMA 1BTKA 1LW3A 3GYOA 1GC6A 2D11A 1WJ1A 3VIAA 1ZYIA 4F7HA 2DTCA 3NSUA 2J59M 1MIZB 4HSIA 1FOEA 1MPHA 3N7CA 5KCVA 2KIGA 4IFSA 1XCGA 3E66A 4HAVB 1NTIA 2COAA 3DCXA 2DN6A 4GOUA 1TQZA 3EPYA 5J3YA 3PVLA 1K5GB 5CLLB 1KI1B 4K2OA 1B55A 2IFSA 2FDQA 1FHOA 4ILHA 5HE1A 1P3RA 1ZM0A 2R2YA 4GN1A 2UZRA 1DBHA 5IRSA 2IYBA 3IVFA 3NWAA 5I2MA 1U5EA 1WGQA 4PQ0A 2X18A 3OHMB 2UVMA 3DXCA 4JKDA 4ZRIA 5D3YA 1TJ6A 1P5TA 4HB3B 1NTYA 3KZ1A 2M38A 3D8FA 3E9PA 3PVUA 5FI1A 3BJIA 2K2UA 4HATB 2YF0A 3TCAA 2NZ8B 2LBBA 3SYXA 2CODA 1BWNA 2YS3A 2DKPA 3KSYA 4ZRJA 2D9VA 2L2IA 4H8SA 4JKGA 2DHJA 4HB2B 1DYNA 2X0SA 3A98B 1MK7B 3ML4A 2GJYA 2Z0QA 5JP4A 1XR0B 2COPA 1DROA 2Z13A 1K5DB 3NWFA 1V5MA 1KBLA 4K17A 2HRJA 1ZC4B 2ADZA 3QIJA 3F0WA 2COCA 4QJ3B 4Z2MB 1NI2A 2D2QA 2Z59A 2R0DA 1GC7A 2GS0A 5GOWB 2ROVA 4JKCA 2N23A 1X1GA 3A8QA 1X86A 1VBHA 5DIFB 2W2XD 1KZGA 2I5FA 1KC7A 1UNPA 4L1RA 2DFKA 2K00A 4WSFA 3SUZA 3UZTA 5D3WA 2EC1A 5HE0A 5J3QA 2KR0A 5D3VA 2R82A 1KZ7A 3SBGA 4Z2NA 5EFXA 1PFJA 3ZVRA 1RJ2A 1NVLA 2RSGA 1VBGA 4JKGB 3X23A 1QQGA 1GG3A 4OT1A 5DHFB 2LOZA 3AU5A 2W2WA 1OMWA 5CLQB 3PZDA 3DXDA 1U29A 3ENBA 3FLVA 4QJ4B 1ZVRA 2COFA 4HB4B 2YT1A 1Y5OA 3TO1A 2AL6A 2I1JA 3ULBA 1WVHA 4DXAB 5D3XA 1MK9B 4HAYB 2FJUB 1GGOA 2GCLA 4XWXA 3HW2B 3PG7A 4K81A 1X1FA 2W2XC 3VOQA 1BAKA 5KQ4A 5KQ1A 4C0AA 3PEGA 1T77A 3O96A 2YSZA 3AJ4A 5C6RA 3A58A 3PVWA 1HB8A 1PLSA 1MI1A 1EGXA 2DLWA 4Y94A 5I2SA 1XD4A 5JLJB 4EKUA 1FAOA 1WI1A 4CYEA 4JKEA 5M4YB 3FEHA 4HHVA 3HQCA 4D0NB 4F7UP 1V5PA 4P7IA 2YRYA 4PNKA 3E9LA 2I1KA 3T06A 2Z4DA 5LG4B 2MWNB 2DX1A 5L81A 1WG7A 3D8EA 1AWEA 4GXBA 2RNRB 2Q13A 3F5RA 1I7AA 3HIEA 2KGXB 1V61A 4ILGB 1Q67A 1DDVA 1Z87A 4WVFB 3TVVA 4KHBA 3FSSA 3MDBC 5LONB 1QC6A 2XQNM 4YL8A 2RQ1A 4TKNA 3TFMA 2P0HA 2J0MA 1UNRA 1M7EA 2JP2A 2H7EA 2DHKA 4DX8A 1ZSQA 5JHHA 1PMSA 4HDOA 5JVLA 5C5BA 4QJ5B 1HB6A 2CRFA 2CY4A 2BCJA 1N3HA 3SO6A 3QBVB 4QXAB 4DX90 1I2HA 2OTXA 2FJ9A 2ROZB 4WJ7A 4CHMA 3FM8C 2LOXA 2RGNB 2NMBA 2Y8GA 2LKOA 2RLOA 1P6SA 5HE3A 3P7ZA 4IAPA 3E9OA 1OY2A 4KHBB 2YVCA 4DBBA 2WH5A 2KCJA 3NW8A 4JKBA 3V5WA 4IOYX 4B6HA 2CQUA 3PP2A 2KIEA 5J3TA 2DX5A 5DI9B 2CAYA 4JK9A 2Z14A 2NBVA 4KAXB 2K2JA 2K8EA 1V88A 3ODOA 1IRSA 2LULA 2MDXA 2N0YA 4GZUA 4HAXB 4EMOA 5C5BB 3LJUX 4A6FA 4GMVA 2D9XA 2EMTA 2VKIA 4YONA 3ODXA 4JKHA 1EF1A 3D8DA 3AU4A 3SV1A 1X05A 4TYZA 3HSAA 1SHCA 2ELBA 4A6HA 2YT2A 3P6AA 4NY0A 1UNQA 1U27A 3G9WA 2P0DA 4A6KA 1XKEA 1LB1A 3WA0A 2UZSA 1RRPB 1DDMA 4K2PA 1UPRA 2V76A 2YT0A 1H10A 2DHIA 2CB8A 1EAZA 3HK0A 3SBTA 5DH9B 1AQCA 1JDEA 2QKMA 1OQNA 2YS5A 4KHAA 1Y19B 2M14A 4DIXA 2L1CA 2R09A 4ZRKA 4GPTB 2RVBB 1E5WA 1W1DA 4GMXB 1FHWA 3WYFB 4D6WA 2P8VA 1UEFA 1DDWA 4A6FB 3KRWA 3OANA 3CXBB 4A5KA 4ILJA 3DXEA 1SGHA 1WJMA 4F7GA 2E2XA 2J0JA 1MIXA 3U7DA 1FGYA 3MPXA 3BINA 3U8ZA 2EMSA 4HAUB 5FI0A 3A8PA 1U5DA 4JKAA 2H7DA 3QWMA 1V5UA 2D10A 1FB8A 3SNHA 4JKFA 1W1HA 1MKEA 2MKRA 2HE7A 4NSWA 2ZPYA 2DIKA 5IJMA
chains in the Genus database with same CATH topology
2QKLA 5HE2A 4L6EA 2D9YA 2Y7BA 3RCPA 3TW1A 5DHAB 2ELAA 4CHJA 2DKQA 3KY9A 1UPQA 5C79A 4HB0B 2Y8FA 4MY6A 2J0KA 4MK0A 2D9ZA 2LG1A 2KUPA 1ISNA 3FP5A 3CIKA 2VRWB 2AEHA 2Z0OA 2HTHB 2OQBA 4HAZB 5LOPB 2DYNA 1XX0A 2VSZA 2CY5A 4BBKA 1H4RA 2P0FA 4JK7A 4KHOA 3ZDTA 2RUKB 1HBKA 5JHGA 1J0WA 1FGZA 1M7RA 1DIKA 1U5FA 1U5GA 4HDQA 5D27A 2DA0A 2GCJA 2DYQA 2Z0PA 3ODWA 2D4QA 2FJLA 3PSCA 4MT7A 1XODA 3KRXA 2YS1A 1X11A 2LYDA 1EVHA 1TXDA 2PZ1A 1MAIA 1BTNA 2D9WA 2MFQA 1NTVA 2EJ8A 1J19A 3M1IB 1WGUA 1U2BA 1ACAA 3GYPA 3ULCA 2ABDA 1NU2A 1FHXA 1V89A 4HAWB 1W1GA 4JK8A 2I5CA 4KVGB 1ST7A 2G35A 1ZC3B 5C16A 4EJNA 1BTKA 1LW3A 3GYOA 1GC6A 2D11A 1WJ1A 3VIAA 4F7HA 2DTCA 3NSUA 2J59M 1MIZB 1FOEA 1MPHA 3N7CA 5KCVA 4IFSA 1XCGA 3E66A 4HAVB 1NTIA 2COAA 2DN6A 1TQZA 3EPYA 5J3YA 3PVLA 1K5GB 5CLLB 1KI1B 4K2OA 1B55A 2IFSA 2FDQA 1FHOA 4ILHA 5HE1A 1P3RA 1ZM0A 4GN1A 2UZRA 1DBHA 2IYBA 3IVFA 1U5EA 1WGQA 4PQ0A 2X18A 2UVMA 3DXCA 4JKDA 4ZRIA 5D3YA 1TJ6A 1P5TA 4HB3B 1NTYA 3KZ1A 2M38A 3D8FA 3E9PA 3PVUA 5FI1A 3BJIA 2K2UA 4HATB 2YF0A 3TCAA 2NZ8B 2LBBA 3SYXA 2CODA 1BWNA 2YS3A 2DKPA 3KSYA 4ZRJA 2D9VA 2L2IA 4H8SA 4JKGA 2DHJA 4HB2B 1DYNA 2X0SA 3A98B 1MK7B 3ML4A 2GJYA 2Z0QA 5JP4A 1XR0B 2COPA 1DROA 1K5DB 1V5MA 1KBLA 4K17A 2HRJA 1ZC4B 2ADZA 3QIJA 3F0WA 2COCA 4Z2MB 1NI2A 2D2QA 2R0DA 1GC7A 2GS0A 5GOWB 2ROVA 4JKCA 2N23A 1X1GA 3A8QA 1X86A 1VBHA 5DIFB 2W2XD 1KZGA 2I5FA 1KC7A 1UNPA 2DFKA 2K00A 4WSFA 3SUZA 3UZTA 5D3WA 2EC1A 5HE0A 5J3QA 5D3VA 2R82A 1KZ7A 3SBGA 4Z2NA 5EFXA 1PFJA 3ZVRA 1RJ2A 1NVLA 2RSGA 1VBGA 4JKGB 3X23A 1QQGA 1GG3A 5DHFB 2LOZA 3AU5A 2W2WA 1OMWA 5CLQB 3PZDA 3DXDA 1U29A 3ENBA 3FLVA 1ZVRA 2COFA 4HB4B 2YT1A 1Y5OA 3TO1A 2AL6A 2I1JA 3ULBA 1WVHA 4DXAB 5D3XA 1MK9B 4HAYB 1GGOA 2GCLA 4XWXA 3HW2B 3PG7A 4K81A 1X1FA 2W2XC 3VOQA 1BAKA 5KQ4A 5KQ1A 4C0AA 3PEGA 3O96A 2YSZA 3AJ4A 5C6RA 3PVWA 1HB8A 1PLSA 1EGXA 2DLWA 4Y94A 1XD4A 5JLJB 4EKUA 1FAOA 1WI1A 4CYEA 4JKEA 3FEHA 4HHVA 3HQCA 4D0NB 4F7UP 1V5PA 4P7IA 2YRYA 4PNKA 3E9LA 2I1KA 3T06A 2MWNB 2DX1A 5L81A 1WG7A 3D8EA 1AWEA 4GXBA 2RNRB 2Q13A 3F5RA 1I7AA 2KGXB 1V61A 4ILGB 1Q67A 1DDVA 1Z87A 4WVFB 3TVVA 3FSSA 3MDBC 5LONB 1QC6A 2XQNM 4YL8A 2RQ1A 4TKNA 3TFMA 2P0HA 2J0MA 1UNRA 1M7EA 2JP2A 2H7EA 2DHKA 4DX8A 1ZSQA 5JHHA 1PMSA 4HDOA 5JVLA 5C5BA 1HB6A 2CRFA 2CY4A 2BCJA 1N3HA 3SO6A 3QBVB 4DX90 1I2HA 2OTXA 2FJ9A 2ROZB 4WJ7A 4CHMA 3FM8C 2LOXA 2RGNB 2NMBA 2Y8GA 2LKOA 2RLOA 1P6SA 5HE3A 3P7ZA 4IAPA 3E9OA 1OY2A 4KHBB 2YVCA 4DBBA 2WH5A 2KCJA 4JKBA 3V5WA 4IOYX 4B6HA 2CQUA 3PP2A 5J3TA 2DX5A 5DI9B 2CAYA 4JK9A 4KAXB 2K2JA 1V88A 3ODOA 1IRSA 2LULA 2MDXA 2N0YA 4GZUA 4HAXB 4EMOA 5C5BB 3LJUX 4A6FA 4GMVA 2D9XA 2EMTA 2VKIA 4YONA 3ODXA 4JKHA 1EF1A 3D8DA 3AU4A 3SV1A 1X05A 4TYZA 4A6HA 1SHCA 2ELBA 3P6AA 4NY0A 1UNQA 1U27A 3G9WA 2P0DA 4A6KA 1XKEA 1LB1A 3WA0A 2UZSA 1RRPB 1DDMA 4K2PA 1UPRA 2V76A 2YT0A 1H10A 2DHIA 2CB8A 1EAZA 3HK0A 3SBTA 5DH9B 1AQCA 1JDEA 2QKMA 1OQNA 2YS5A 4KHAA 1Y19B 2M14A 2L1CA 2R09A 4ZRKA 4GPTB 2RVBB 1E5WA 1W1DA 4GMXB 1FHWA 3WYFB 2P8VA 1UEFA 1DDWA 4A6FB 3KRWA 3OANA 3CXBB 4A5KA 4ILJA 3DXEA 1SGHA 1WJMA 4F7GA 2E2XA 2J0JA 1MIXA 3U7DA 1FGYA 3MPXA 3BINA 3U8ZA 2EMSA 4HAUB 5FI0A 3A8PA 1U5DA 4JKAA 2H7DA 3QWMA 1V5UA 2D10A 1FB8A 3SNHA 4JKFA 1W1HA 1MKEA 2MKRA 2HE7A 4NSWA 2ZPYA 2DIKA 5IJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKL A;  5HE2 A;  4L6E A;  2D9Y A;  2Y7B A;  3RCP A;  3TW1 A;  5DHA B;  2ELA A;  4CHJ A;  2DKQ A;  3KY9 A;  1UPQ A;  5C79 A;  4HB0 B;  2Y8F A;  4MY6 A;  2J0K A;  4MK0 A;  2D9Z A;  2LG1 A;  2KUP A;  1ISN A;  3FP5 A;  3CIK A;  2VRW B;  2AEH A;  2Z0O A;  2HTH B;  2OQB A;  4HAZ B;  5LOP B;  2DYN A;  1XX0 A;  2VSZ A;  2CY5 A;  4BBK A;  1H4R A;  2P0F A;  4KHO A;  3ZDT A;  2RUK B;  1HBK A;  5JHG A;  1J0W A;  1FGZ A;  1M7R A;  1U5F A;  1U5G A;  4HDQ A;  5D27 A;  2DA0 A;  2GCJ A;  2DYQ A;  2Z0P A;  3ODW A;  2D4Q A;  2FJL A;  3PSC A;  4MT7 A;  1XOD A;  3KRX A;  2YS1 A;  1X11 A;  2LYD A;  1EVH A;  1TXD A;  2PZ1 A;  1MAI A;  1BTN A;  2D9W A;  2MFQ A;  1NTV A;  2EJ8 A;  1J19 A;  3M1I B;  1WGU A;  1U2B A;  1ACA A;  3GYP A;  3ULC A;  2ABD A;  1NU2 A;  1FHX A;  1V89 A;  4HAW B;  1W1G A;  2I5C A;  4KVG B;  1ST7 A;  2G35 A;  1ZC3 B;  5C16 A;  4EJN A;  1BTK A;  1LW3 A;  3GYO A;  1GC6 A;  2D11 A;  1WJ1 A;  3VIA A;  4F7H A;  2DTC A;  3NSU A;  2J59 M;  1MIZ B;  1FOE A;  1MPH A;  3N7C A;  5KCV A;  4IFS A;  1XCG A;  4HAV B;  1NTI A;  2COA A;  2DN6 A;  1TQZ A;  3EPY A;  5J3Y A;  3PVL A;  1K5G B;  5CLL B;  1KI1 B;  4K2O A;  1B55 A;  2IFS A;  2FDQ A;  1FHO A;  5HE1 A;  1P3R A;  1ZM0 A;  4GN1 A;  2UZR A;  1DBH A;  2IYB A;  3IVF A;  1U5E A;  1WGQ A;  4PQ0 A;  2X18 A;  2UVM A;  3DXC A;  4ZRI A;  5D3Y A;  1TJ6 A;  1P5T A;  4HB3 B;  1NTY A;  3KZ1 A;  2M38 A;  3D8F A;  3PVU A;  5FI1 A;  3BJI A;  2K2U A;  4HAT B;  2YF0 A;  3TCA A;  2NZ8 B;  2LBB A;  3SYX A;  2COD A;  1BWN A;  2YS3 A;  2DKP A;  3KSY A;  4ZRJ A;  2D9V A;  2L2I A;  4H8S A;  2DHJ A;  4HB2 B;  1DYN A;  3A98 B;  1MK7 B;  3ML4 A;  2GJY A;  2Z0Q A;  5JP4 A;  1XR0 B;  2COP A;  1DRO A;  1K5D B;  1V5M A;  4K17 A;  2HRJ A;  1ZC4 B;  2ADZ A;  3QIJ A;  3F0W A;  2COC A;  4Z2M B;  1NI2 A;  2D2Q A;  2R0D A;  1GC7 A;  2GS0 A;  5GOW B;  2ROV A;  2N23 A;  1X1G A;  3A8Q A;  1X86 A;  5DIF B;  2W2X D;  1KZG A;  2I5F A;  1UNP A;  2DFK A;  2K00 A;  4WSF A;  3SUZ A;  3UZT A;  5D3W A;  2EC1 A;  5HE0 A;  5J3Q A;  5D3V A;  1KZ7 A;  4Z2N A;  5EFX A;  1PFJ A;  3ZVR A;  1RJ2 A;  1NVL A;  2RSG A;  3X23 A;  1QQG A;  1GG3 A;  5DHF B;  2LOZ A;  3AU5 A;  2W2W A;  1OMW A;  5CLQ B;  3PZD A;  3DXD A;  1U29 A;  3FLV A;  1ZVR A;  2COF A;  4HB4 B;  2YT1 A;  1Y5O A;  3TO1 A;  2AL6 A;  2I1J A;  3ULB A;  1WVH A;  4DXA B;  5D3X A;  1MK9 B;  4HAY B;  2GCL A;  4XWX A;  3HW2 B;  3PG7 A;  4K81 A;  1X1F A;  2W2X C;  3VOQ A;  1BAK A;  5KQ4 A;  5KQ1 A;  4C0A A;  3PEG A;  3O96 A;  2YSZ A;  3AJ4 A;  5C6R A;  3PVW A;  1HB8 A;  1PLS A;  1EGX A;  2DLW A;  4Y94 A;  1XD4 A;  5JLJ B;  4EKU A;  1FAO A;  1WI1 A;  4CYE A;  3FEH A;  4HHV A;  3HQC A;  4D0N B;  4F7U P;  1V5P A;  4P7I A;  2YRY A;  4PNK A;  2I1K A;  3T06 A;  2MWN B;  2DX1 A;  5L81 A;  1WG7 A;  3D8E A;  1AWE A;  2RNR B;  4GXB A;  2Q13 A;  3F5R A;  1I7A A;  2KGX B;  1V61 A;  1Q67 A;  1DDV A;  1Z87 A;  4WVF B;  3TVV A;  3FSS A;  3MDB C;  5LON B;  1QC6 A;  2XQN M;  4YL8 A;  2RQ1 A;  4TKN A;  3TFM A;  2P0H A;  2J0M A;  1UNR A;  1M7E A;  2JP2 A;  2H7E A;  2DHK A;  4DX8 A;  1ZSQ A;  5JHH A;  1PMS A;  4HDO A;  5C5B A;  1HB6 A;  2CRF A;  2CY4 A;  2BCJ A;  1N3H A;  3SO6 A;  3QBV B;  4DX9 0;  1I2H A;  2OTX A;  2FJ9 A;  2ROZ B;  4WJ7 A;  4CHM A;  3FM8 C;  2LOX A;  2RGN B;  2NMB A;  2Y8G A;  2LKO A;  2RLO A;  1P6S A;  5HE3 A;  3P7Z A;  4IAP A;  1OY2 A;  4KHB B;  2YVC A;  4DBB A;  2WH5 A;  2KCJ A;  3V5W A;  4IOY X;  4B6H A;  2CQU A;  3PP2 A;  5J3T A;  2DX5 A;  5DI9 B;  2CAY A;  4KAX B;  2K2J A;  1V88 A;  3ODO A;  1IRS A;  2LUL A;  2MDX A;  2N0Y A;  4GZU A;  4HAX B;  4EMO A;  5C5B B;  3LJU X;  4A6F A;  4GMV A;  2D9X A;  2EMT A;  2VKI A;  4YON A;  3ODX A;  1EF1 A;  3D8D A;  3AU4 A;  3SV1 A;  1X05 A;  4TYZ A;  4A6H A;  1SHC A;  2ELB A;  3P6A A;  4NY0 A;  1UNQ A;  1U27 A;  3G9W A;  2P0D A;  4A6K A;  1XKE A;  1LB1 A;  3WA0 A;  2UZS A;  1RRP B;  1DDM A;  4K2P A;  1UPR A;  2V76 A;  2YT0 A;  1H10 A;  2DHI A;  2CB8 A;  1EAZ A;  3HK0 A;  5DH9 B;  1AQC A;  2QKM A;  1OQN A;  2YS5 A;  4KHA A;  1Y19 B;  2M14 A;  2L1C A;  2R09 A;  4ZRK A;  4GPT B;  2RVB B;  1E5W A;  1W1D A;  4GMX B;  1FHW A;  3WYF B;  2P8V A;  1UEF A;  1DDW A;  4A6F B;  3KRW A;  3OAN A;  3CXB B;  4A5K A;  3DXE A;  1SGH A;  1WJM A;  4F7G A;  2E2X A;  2J0J A;  1MIX A;  3U7D A;  1FGY A;  3MPX A;  3BIN A;  3U8Z A;  2EMS A;  4HAU B;  5FI0 A;  3A8P A;  1U5D A;  2H7D A;  3QWM A;  1V5U A;  2D10 A;  1FB8 A;  3SNH A;  1W1H A;  1MKE A;  2MKR A;  2HE7 A;  4NSW A;  2ZPY A;  5IJM A; 
#chains in the Genus database with same CATH topology
 2QKL A;  3B77 A;  3FVC A;  5HE2 A;  3NWD A;  4L6E A;  2D9Y A;  2Y7B A;  3RCP A;  3TW1 A;  5DHA B;  2ELA A;  4CHJ A;  2DKQ A;  3KY9 A;  1UPQ A;  5C79 A;  4HB0 B;  2Y8F A;  4MY6 A;  2J0K A;  4MK0 A;  2D9Z A;  2LG1 A;  2KUP A;  1ISN A;  3FP5 A;  3CIK A;  4CSQ A;  2VRW B;  2AEH A;  2ZKM X;  2Z0O A;  2HTH B;  2OQB A;  4HAZ B;  5LOP B;  2DYN A;  1XX0 A;  2VSZ A;  2CY5 A;  4BBK A;  1H4R A;  2P0F A;  4JK7 A;  4KHO A;  3ZDT A;  2RUK B;  1HBK A;  4OSN A;  5JHG A;  1J0W A;  1FGZ A;  1M7R A;  1DIK A;  1U5F A;  1U5G A;  4HDQ A;  5D27 A;  2DA0 A;  2GCJ A;  2DYQ A;  2Z0P A;  3ODW A;  2D4Q A;  2FJL A;  3PSC A;  4MT7 A;  1XOD A;  3KRX A;  2YS1 A;  1X11 A;  2LYD A;  4GNK B;  1EVH A;  1TXD A;  2KUQ A;  2PZ1 A;  1MAI A;  1BTN A;  2D9W A;  2MFQ A;  1NTV A;  2EJ8 A;  1J19 A;  3M1I B;  1WGU A;  1U2B A;  1ACA A;  3GYP A;  3ULC A;  2ABD A;  1NU2 A;  2K49 A;  1FHX A;  1V89 A;  4HAW B;  1W1G A;  4JK8 A;  2I5C A;  3U12 A;  4KVG B;  1ST7 A;  2RRF A;  2G35 A;  1ZC3 B;  5C16 A;  4EJN A;  2GUM A;  1BTK A;  1LW3 A;  3GYO A;  1GC6 A;  2D11 A;  1WJ1 A;  3VIA A;  1ZYI A;  4F7H A;  2DTC A;  3NSU A;  2J59 M;  1MIZ B;  4HSI A;  1FOE A;  1MPH A;  3N7C A;  5KCV A;  2KIG A;  4IFS A;  1XCG A;  3E66 A;  4HAV B;  1NTI A;  2COA A;  3DCX A;  2DN6 A;  4GOU A;  1TQZ A;  3EPY A;  5J3Y A;  3PVL A;  1K5G B;  5CLL B;  1KI1 B;  4K2O A;  1B55 A;  2IFS A;  2FDQ A;  1FHO A;  4ILH A;  5HE1 A;  1P3R A;  1ZM0 A;  2R2Y A;  4GN1 A;  2UZR A;  1DBH A;  5IRS A;  2IYB A;  3IVF A;  3NWA A;  5I2M A;  1U5E A;  1WGQ A;  4PQ0 A;  2X18 A;  3OHM B;  2UVM A;  3DXC A;  4JKD A;  4ZRI A;  5D3Y A;  1TJ6 A;  1P5T A;  4HB3 B;  1NTY A;  3KZ1 A;  2M38 A;  3D8F A;  3E9P A;  3PVU A;  5FI1 A;  3BJI A;  2K2U A;  4HAT B;  2YF0 A;  3TCA A;  2NZ8 B;  2LBB A;  3SYX A;  2COD A;  1BWN A;  2YS3 A;  2DKP A;  3KSY A;  4ZRJ A;  2D9V A;  2L2I A;  4H8S A;  4JKG A;  2DHJ A;  4HB2 B;  1DYN A;  2X0S A;  3A98 B;  1MK7 B;  3ML4 A;  2GJY A;  2Z0Q A;  5JP4 A;  1XR0 B;  2COP A;  1DRO A;  2Z13 A;  1K5D B;  3NWF A;  1V5M A;  1KBL A;  4K17 A;  2HRJ A;  1ZC4 B;  2ADZ A;  3QIJ A;  3F0W A;  2COC A;  4QJ3 B;  4Z2M B;  1NI2 A;  2D2Q A;  2Z59 A;  2R0D A;  1GC7 A;  2GS0 A;  5GOW B;  2ROV A;  4JKC A;  2N23 A;  1X1G A;  3A8Q A;  1X86 A;  1VBH A;  5DIF B;  2W2X D;  1KZG A;  2I5F A;  1KC7 A;  1UNP A;  4L1R A;  2DFK A;  2K00 A;  4WSF A;  3SUZ A;  3UZT A;  5D3W A;  2EC1 A;  5HE0 A;  5J3Q A;  2KR0 A;  5D3V A;  2R82 A;  1KZ7 A;  3SBG A;  4Z2N A;  5EFX A;  1PFJ A;  3ZVR A;  1RJ2 A;  1NVL A;  2RSG A;  1VBG A;  4JKG B;  3X23 A;  1QQG A;  1GG3 A;  4OT1 A;  5DHF B;  2LOZ A;  3AU5 A;  2W2W A;  1OMW A;  5CLQ B;  3PZD A;  3DXD A;  1U29 A;  3ENB A;  3FLV A;  4QJ4 B;  1ZVR A;  2COF A;  4HB4 B;  2YT1 A;  1Y5O A;  3TO1 A;  2AL6 A;  2I1J A;  3ULB A;  1WVH A;  4DXA B;  5D3X A;  1MK9 B;  4HAY B;  2FJU B;  1GGO A;  2GCL A;  4XWX A;  3HW2 B;  3PG7 A;  4K81 A;  1X1F A;  2W2X C;  3VOQ A;  1BAK A;  5KQ4 A;  5KQ1 A;  4C0A A;  3PEG A;  1T77 A;  3O96 A;  2YSZ A;  3AJ4 A;  5C6R A;  3A58 A;  3PVW A;  1HB8 A;  1PLS A;  1MI1 A;  1EGX A;  2DLW A;  4Y94 A;  5I2S A;  1XD4 A;  5JLJ B;  4EKU A;  1FAO A;  1WI1 A;  4CYE A;  4JKE A;  5M4Y B;  3FEH A;  4HHV A;  3HQC A;  4D0N B;  4F7U P;  1V5P A;  4P7I A;  2YRY A;  4PNK A;  3E9L A;  2I1K A;  3T06 A;  2Z4D A;  5LG4 B;  2MWN B;  2DX1 A;  5L81 A;  1WG7 A;  3D8E A;  1AWE A;  4GXB A;  2RNR B;  2Q13 A;  3F5R A;  1I7A A;  3HIE A;  2KGX B;  1V61 A;  4ILG B;  1Q67 A;  1DDV A;  1Z87 A;  4WVF B;  3TVV A;  4KHB A;  3FSS A;  3MDB C;  5LON B;  1QC6 A;  2XQN M;  4YL8 A;  2RQ1 A;  4TKN A;  3TFM A;  2P0H A;  2J0M A;  1UNR A;  1M7E A;  2JP2 A;  2H7E A;  2DHK A;  4DX8 A;  1ZSQ A;  5JHH A;  1PMS A;  4HDO A;  5JVL A;  5C5B A;  4QJ5 B;  1HB6 A;  2CRF A;  2CY4 A;  2BCJ A;  1N3H A;  3SO6 A;  3QBV B;  4QXA B;  4DX9 0;  1I2H A;  2OTX A;  2FJ9 A;  2ROZ B;  4WJ7 A;  4CHM A;  3FM8 C;  2LOX A;  2RGN B;  2NMB A;  2Y8G A;  2LKO A;  2RLO A;  1P6S A;  5HE3 A;  3P7Z A;  4IAP A;  3E9O A;  1OY2 A;  4KHB B;  2YVC A;  4DBB A;  2WH5 A;  2KCJ A;  3NW8 A;  4JKB A;  3V5W A;  4IOY X;  4B6H A;  2CQU A;  3PP2 A;  2KIE A;  5J3T A;  2DX5 A;  5DI9 B;  2CAY A;  4JK9 A;  2Z14 A;  2NBV A;  4KAX B;  2K2J A;  2K8E A;  1V88 A;  3ODO A;  1IRS A;  2LUL A;  2MDX A;  2N0Y A;  4GZU A;  4HAX B;  4EMO A;  5C5B B;  3LJU X;  4A6F A;  4GMV A;  2D9X A;  2EMT A;  2VKI A;  4YON A;  3ODX A;  4JKH A;  1EF1 A;  3D8D A;  3AU4 A;  3SV1 A;  1X05 A;  4TYZ A;  3HSA A;  1SHC A;  2ELB A;  4A6H A;  2YT2 A;  3P6A A;  4NY0 A;  1UNQ A;  1U27 A;  3G9W A;  2P0D A;  4A6K A;  1XKE A;  1LB1 A;  3WA0 A;  2UZS A;  1RRP B;  1DDM A;  4K2P A;  1UPR A;  2V76 A;  2YT0 A;  1H10 A;  2DHI A;  2CB8 A;  1EAZ A;  3HK0 A;  3SBT A;  5DH9 B;  1AQC A;  1JDE A;  2QKM A;  1OQN A;  2YS5 A;  4KHA A;  1Y19 B;  2M14 A;  4DIX A;  2L1C A;  2R09 A;  4ZRK A;  4GPT B;  2RVB B;  1E5W A;  1W1D A;  4GMX B;  1FHW A;  3WYF B;  4D6W A;  2P8V A;  1UEF A;  1DDW A;  4A6F B;  3KRW A;  3OAN A;  3CXB B;  4A5K A;  4ILJ A;  3DXE A;  1SGH A;  1WJM A;  4F7G A;  2E2X A;  2J0J A;  1MIX A;  3U7D A;  1FGY A;  3MPX A;  3BIN A;  3U8Z A;  2EMS A;  4HAU B;  5FI0 A;  3A8P A;  1U5D A;  4JKA A;  2H7D A;  3QWM A;  1V5U A;  2D10 A;  1FB8 A;  3SNH A;  4JKF A;  1W1H A;  1MKE A;  2MKR A;  2HE7 A;  4NSW A;  2ZPY A;  2DIK A;  5IJM A; 
#chains in the Genus database with same CATH homology
 2QKL A;  5HE2 A;  4L6E A;  2D9Y A;  2Y7B A;  3RCP A;  3TW1 A;  5DHA B;  2ELA A;  4CHJ A;  2DKQ A;  3KY9 A;  1UPQ A;  5C79 A;  4HB0 B;  2Y8F A;  4MY6 A;  2J0K A;  4MK0 A;  2D9Z A;  2LG1 A;  2KUP A;  1ISN A;  3FP5 A;  3CIK A;  2VRW B;  2AEH A;  2Z0O A;  2HTH B;  2OQB A;  4HAZ B;  5LOP B;  2DYN A;  1XX0 A;  2VSZ A;  2CY5 A;  4BBK A;  1H4R A;  2P0F A;  4JK7 A;  4KHO A;  3ZDT A;  2RUK B;  1HBK A;  5JHG A;  1J0W A;  1FGZ A;  1M7R A;  1DIK A;  1U5F A;  1U5G A;  4HDQ A;  5D27 A;  2DA0 A;  2GCJ A;  2DYQ A;  2Z0P A;  3ODW A;  2D4Q A;  2FJL A;  3PSC A;  4MT7 A;  1XOD A;  3KRX A;  2YS1 A;  1X11 A;  2LYD A;  1EVH A;  1TXD A;  2PZ1 A;  1MAI A;  1BTN A;  2D9W A;  2MFQ A;  1NTV A;  2EJ8 A;  1J19 A;  3M1I B;  1WGU A;  1U2B A;  1ACA A;  3GYP A;  3ULC A;  2ABD A;  1NU2 A;  1FHX A;  1V89 A;  4HAW B;  1W1G A;  4JK8 A;  2I5C A;  4KVG B;  1ST7 A;  2G35 A;  1ZC3 B;  5C16 A;  4EJN A;  1BTK A;  1LW3 A;  3GYO A;  1GC6 A;  2D11 A;  1WJ1 A;  3VIA A;  4F7H A;  2DTC A;  3NSU A;  2J59 M;  1MIZ B;  1FOE A;  1MPH A;  3N7C A;  5KCV A;  4IFS A;  1XCG A;  3E66 A;  4HAV B;  1NTI A;  2COA A;  2DN6 A;  1TQZ A;  3EPY A;  5J3Y A;  3PVL A;  1K5G B;  5CLL B;  1KI1 B;  4K2O A;  1B55 A;  2IFS A;  2FDQ A;  1FHO A;  4ILH A;  5HE1 A;  1P3R A;  1ZM0 A;  4GN1 A;  2UZR A;  1DBH A;  2IYB A;  3IVF A;  1U5E A;  1WGQ A;  4PQ0 A;  2X18 A;  2UVM A;  3DXC A;  4JKD A;  4ZRI A;  5D3Y A;  1TJ6 A;  1P5T A;  4HB3 B;  1NTY A;  3KZ1 A;  2M38 A;  3D8F A;  3E9P A;  3PVU A;  5FI1 A;  3BJI A;  2K2U A;  4HAT B;  2YF0 A;  3TCA A;  2NZ8 B;  2LBB A;  3SYX A;  2COD A;  1BWN A;  2YS3 A;  2DKP A;  3KSY A;  4ZRJ A;  2D9V A;  2L2I A;  4H8S A;  4JKG A;  2DHJ A;  4HB2 B;  1DYN A;  2X0S A;  3A98 B;  1MK7 B;  3ML4 A;  2GJY A;  2Z0Q A;  5JP4 A;  1XR0 B;  2COP A;  1DRO A;  1K5D B;  1V5M A;  1KBL A;  4K17 A;  2HRJ A;  1ZC4 B;  2ADZ A;  3QIJ A;  3F0W A;  2COC A;  4Z2M B;  1NI2 A;  2D2Q A;  2R0D A;  1GC7 A;  2GS0 A;  5GOW B;  2ROV A;  4JKC A;  2N23 A;  1X1G A;  3A8Q A;  1X86 A;  1VBH A;  5DIF B;  2W2X D;  1KZG A;  2I5F A;  1KC7 A;  1UNP A;  2DFK A;  2K00 A;  4WSF A;  3SUZ A;  3UZT A;  5D3W A;  2EC1 A;  5HE0 A;  5J3Q A;  5D3V A;  2R82 A;  1KZ7 A;  3SBG A;  4Z2N A;  5EFX A;  1PFJ A;  3ZVR A;  1RJ2 A;  1NVL A;  2RSG A;  1VBG A;  4JKG B;  3X23 A;  1QQG A;  1GG3 A;  5DHF B;  2LOZ A;  3AU5 A;  2W2W A;  1OMW A;  5CLQ B;  3PZD A;  3DXD A;  1U29 A;  3ENB A;  3FLV A;  1ZVR A;  2COF A;  4HB4 B;  2YT1 A;  1Y5O A;  3TO1 A;  2AL6 A;  2I1J A;  3ULB A;  1WVH A;  4DXA B;  5D3X A;  1MK9 B;  4HAY B;  1GGO A;  2GCL A;  4XWX A;  3HW2 B;  3PG7 A;  4K81 A;  1X1F A;  2W2X C;  3VOQ A;  1BAK A;  5KQ4 A;  5KQ1 A;  4C0A A;  3PEG A;  3O96 A;  2YSZ A;  3AJ4 A;  5C6R A;  3PVW A;  1HB8 A;  1PLS A;  1EGX A;  2DLW A;  4Y94 A;  1XD4 A;  5JLJ B;  4EKU A;  1FAO A;  1WI1 A;  4CYE A;  4JKE A;  3FEH A;  4HHV A;  3HQC A;  4D0N B;  4F7U P;  1V5P A;  4P7I A;  2YRY A;  4PNK A;  3E9L A;  2I1K A;  3T06 A;  2MWN B;  2DX1 A;  5L81 A;  1WG7 A;  3D8E A;  1AWE A;  4GXB A;  2RNR B;  2Q13 A;  3F5R A;  1I7A A;  2KGX B;  1V61 A;  4ILG B;  1Q67 A;  1DDV A;  1Z87 A;  4WVF B;  3TVV A;  3FSS A;  3MDB C;  5LON B;  1QC6 A;  2XQN M;  4YL8 A;  2RQ1 A;  4TKN A;  3TFM A;  2P0H A;  2J0M A;  1UNR A;  1M7E A;  2JP2 A;  2H7E A;  2DHK A;  4DX8 A;  1ZSQ A;  5JHH A;  1PMS A;  4HDO A;  5JVL A;  5C5B A;  1HB6 A;  2CRF A;  2CY4 A;  2BCJ A;  1N3H A;  3SO6 A;  3QBV B;  4DX9 0;  1I2H A;  2OTX A;  2FJ9 A;  2ROZ B;  4WJ7 A;  4CHM A;  3FM8 C;  2LOX A;  2RGN B;  2NMB A;  2Y8G A;  2LKO A;  2RLO A;  1P6S A;  5HE3 A;  3P7Z A;  4IAP A;  3E9O A;  1OY2 A;  4KHB B;  2YVC A;  4DBB A;  2WH5 A;  2KCJ A;  4JKB A;  3V5W A;  4IOY X;  4B6H A;  2CQU A;  3PP2 A;  5J3T A;  2DX5 A;  5DI9 B;  2CAY A;  4JK9 A;  4KAX B;  2K2J A;  1V88 A;  3ODO A;  1IRS A;  2LUL A;  2MDX A;  2N0Y A;  4GZU A;  4HAX B;  4EMO A;  5C5B B;  3LJU X;  4A6F A;  4GMV A;  2D9X A;  2EMT A;  2VKI A;  4YON A;  3ODX A;  4JKH A;  1EF1 A;  3D8D A;  3AU4 A;  3SV1 A;  1X05 A;  4TYZ A;  4A6H A;  1SHC A;  2ELB A;  3P6A A;  4NY0 A;  1UNQ A;  1U27 A;  3G9W A;  2P0D A;  4A6K A;  1XKE A;  1LB1 A;  3WA0 A;  2UZS A;  1RRP B;  1DDM A;  4K2P A;  1UPR A;  2V76 A;  2YT0 A;  1H10 A;  2DHI A;  2CB8 A;  1EAZ A;  3HK0 A;  3SBT A;  5DH9 B;  1AQC A;  1JDE A;  2QKM A;  1OQN A;  2YS5 A;  4KHA A;  1Y19 B;  2M14 A;  2L1C A;  2R09 A;  4ZRK A;  4GPT B;  2RVB B;  1E5W A;  1W1D A;  4GMX B;  1FHW A;  3WYF B;  2P8V A;  1UEF A;  1DDW A;  4A6F B;  3KRW A;  3OAN A;  3CXB B;  4A5K A;  4ILJ A;  3DXE A;  1SGH A;  1WJM A;  4F7G A;  2E2X A;  2J0J A;  1MIX A;  3U7D A;  1FGY A;  3MPX A;  3BIN A;  3U8Z A;  2EMS A;  4HAU B;  5FI0 A;  3A8P A;  1U5D A;  4JKA A;  2H7D A;  3QWM A;  1V5U A;  2D10 A;  1FB8 A;  3SNH A;  4JKF A;  1W1H A;  1MKE A;  2MKR A;  2HE7 A;  4NSW A;  2ZPY A;  2DIK A;  5IJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...