4JK7A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk7A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk7A01
3E9LA 4JKGA 4JKGB 3E9OA 3ENBA 4ILJA 4JKHA 4ILHA 3E9PA 4JKDA 3SBTA 3E66A 4JKCA 4JKFA 4JKAA 4JKEA 4JK8A 4JKBA 4ILGB 3SBGA 4JK9A 4JK7A
chains in the Genus database with same CATH superfamily
3WNFA 4BROA 2ZJQL 3CD6N 3OYEA 5FPNA 2UUCK 4PWDA 4R5PA 3QEWA 4ELVA 4MO4A 2X6NA 2O8CA 2P51A 3PV8A 3T19A 1LOTB 1ZBIA 3V9ZA 1TYQA 3M1FA 3FFIA 3VPZA 1ASWA 4NCBA 3FLVA 2JGUA 3TAFA 4LFCK 3SJJA 2EMTA 3S3OA 4BRQA 1EWQA 1TKZA 1Z6RA 2P9IA 3VN5A 1N32K 4N47A 3DLLL 3KLIA 2E2NA 2YCHA 3V1OA 1LAWA 5E84A 4I6MA 2BDPA 3J80O 1Q86O 4KAZA 1M1KO 3OBWA 4YDUA 2HHXA 3AVLA 5AQPA 4FWKA 4HCBA 3OY9A 4M41A 3AU4A 1VSIA 1Y64A 3C94A 4HUGA 4NY0A 2HHQA 1ILYA 1JLCA 1HKBA 3ZT2A 2O8DA 3GDQA 2P5GA 1C6VA 3K5LA 1LW0A 4OGCA 1KAYA 4RW8A 4XIUA 5J2NA 4HWIA 1T6CA 4DTJA 3LPUA 5GINA 3DXKB 2YKMA 2Z1JA 3M6GA 4CCHA 2YJFA 5KPRA 4BE0A 2O8EA 4JI3K 2FF3B 3FZFA 3VEYA 1S9GA 5JS1A 1ACAA 1IKVA 3VQBA 1U2VA 2QWQA 4DTNA 1EP4A 5FLXO 1QSYA 4JLHA 4PL8A 4YORA 3ZETB 1WBBA 1W2BM 3PO4A 4B3OA 4FYDA 2F96A 2YKNA 3V9XA 1H1VA 4IO9L 4BG9A 4HHTA 4KTZA 1Q82O 3O3HA 4B9VA 1S1UA 1QVGM 3K5OA 2KHOA 2P9SB 3DLKA 3O6WA 4FWPA 1BDGA 2QWRA 2F9TA 4DTOA 1WSGA 1RBRA 3VEOA 3WNHA 3L2QA 3SV3A 3CCSN 4FO0A 3AO3A 4OPKA 2YNGA 1X1PA 3VTIA 3CQ8A 2D0BA 3NGYA 5FRMA 1R0AA 3KKRA 3LDNA 3K9KA 3J7AP 4O4GA 2WBNA 3VERA 3U6FA 1ASVA 1C0FA 4G1QA 4BVPA 3B6PA 2BGGA 3O4NA 4RTFD 5AQUA 2OPQA 1JLGA 1T7PA 2P9KA 1IG9A 1KFDA 4F2SA 2BANA 4CI6A 1NGHA 1JLAA 2FJ9A 1NOZA 3CYMA 3KK7A 4HUFA 3ATUA 4DV1K 4DHYA 4CK1A 2NLXA 1RCHA 5CYQA 1DGKN 3HM9A 2D1KA 4U67L 5KQDA 5LJWA 3KJVA 1NGEA 1KXPA 1IBKK 2GWJA 4H5TA 1YITN 2ZWHA 3THWB 5JVGL 3HSTB 1HNWK 3B8AX 3WQUA 3FZKA 3FGUA 4CIEA 1NGIA 2E6MA 1VK0A 4AHTA 4YY3K 2A1RA 5AJ3K 2P9LA 3F5TA 2PYJA 2YHAA 3CERA 3GG4A 2HHUA 1WB9A 4DSLA 1RT5A 4U7BA 1ZYQA 3RMCA 1HUXA 3TTCA 3AU5A 3GE1A 2ZF5O 2LSNA 4DQSA 4H5RA 1MA9B 1WAFA 4F2RA 5HRRA 3ID8A 1S72N 3CM5A 2ZQBA 3ENOA 2HVHA 3NCIA 4DSFA 3J7ZO 3R3LA 4FLTA 1SL0A 4MDAA 4CVNE 4DR7K 1VHXA 5AQJA 3PSFA 1VQLN 4HTUA 1QSLA 4AF1A 5AQTA 3K5MA 3OJUA 2ZGZA 2OZSA 2OPPA 4RWTA 3VETA 1ZXOA 4H0TB 2P9NA 2HHVA 4OLBA 3K5NA 3MEDA 3AVFA 4B3MK 1OH8A 5TKYA 1KC8O 1SL2A 2P1JA 3KKSA 3AY9A 2E88A 4AHCA 2YHWA 4CHOA 1CLQA 4H5NA 4F3TA 4KH4A 3D7EO 4F8RA 3HZ6A 1XWLA 4FJ7A 1KTQA 2ASMA 3PX6A 2LBBA 4UQGA 3CFPA 4KB1A 3RR7A 3H3NO 4RW7A 1YI2N 3VQEA 1DKGD 1I39A 2EWSA 2WH5A 1SUQA 3OA9A 4C8KA 4DUZK 4IDKA 4HTLA 1NMNA 2NNWA 4M45A 3AVNA 1B9FA 4OPHA 4FSVA 4A5AA 4OX9K 3JS6A 1IKXA 3LDOA 3CC2N 3P83D 3FFKB 2HOEA 4K8ZA 3U8XA 4NCGA 4CF0A 1NG9A 3PLAA 5HROA 3D2EA 2V7ZA 3C6UA 4NLBA 3I0SA 3E66A 3KK1A 4CJ5A 5I42A 3ALYA 5BRFA 4DSKA 2P9UB 1K9MO 3NF8A 2Q1NA 1HJOA 1QTMA 2P5OA 3SAHA 2CH6A 2ZGYA 3F9MA 4FWSA 1T6DA 4O44A 1VSJA 4NO7A 3SJHA 1OH5A 5CZ1A 2VGNA 3O9UA 2I7PA 2IDOA 4CZJA 2HVIA 1U47A 3LWMA 3SAGA 1TKTA 4O5BA 3P4IA 3SBTA 4DFPA 3IVFA 3QEPA 3IAYA 4H4MA 1IKYA 2QI2A 5EX5A 3N4PA 1ZBHA 2CH5A 4FZZA 1T8EA 3ULEB 4JN4A 3SQ1A 2VGMA 4LF7K 3AVBA 4W5NA 3L4QA 1CXQA 3A2FA 5AQGA 3NHGA 3IS9A 3EYZA 3V9WA 4ZTFA 4N56A 5GIOA 1SL1A 3ZEUA 1NNEA 4BRKA 5C25A 3LDLA 4KHQA 4DQ8A 1D4XA 1TKDA 2Z1GA 4A61A 4OPAA 4NYFA 3N4QA 4KB0A 1RT4A 4JI5K 5CE3A 3U3GA 2HHHK 4O0IA 1SAZA 4N76A 4EAHD 3KD5E 4KFBA 4CK2A 3DRRA 5J2MA 1C1BA 4XEIA 1VSDA 2YVCA 3EN9A 3T1AA 3MEEA 3G25A 3DLRA 3O8MA 4DWIA 4CBWA 3SPYA 3BZCA 1OVYA 3VQ6A 3G0ZA 4EHUA 3M8RA 1RT7A 3R8EA 2ATQA 2EMSA 4YOWA 4CZKA 1U04A 1HMVA 1QS4A 4CJTA 2GELA 4CJ3A 1ESVA 1BOTO 2JWLA 4N5SA 4X66K 1HQUA 3L2RA 4E89A 4OKJA 2GUIA 3HL8A 4AHRA 4Y0WA 5C2FA 3ZSZA 3M8SA 3KD1E 3OYCA 1QQCA 3A0IX 5JS2A 2QKBA 3L4IA 4OJRA 5FPEA 1UA0A 2VWKA 4ISEA 2E20A 3PUFA 4JKGB 1RT2A 3WEEA 3FZMA 1SV5A 1YXQA 1GC7A 1S1WA 3HOSA 3CCEN 1CZBA 2AEHA 4JKHA 1P90A 3DJCA 1TUUA 2V7YA 5AQLA 3GL1A 1LV5A 2QWLA 3MK6A 1EF1A 4BR9A 3LANA 3P5JA 4AHSA 4OKEA 1NLVA 3L3UA 3ZT4A 5HP1A 4B1YB 3BF1A 4FM2A 5CHIA 2ASPA 1IV0A 4CHZA 5F0XA 1SKSA 3CFRA 3PX0A 1L3TA 5IWAK 4BR5A 5KGWA 4WYBA 1UOCA 2RHKA 5AQZA 1O1WA 1I3AA 4EZ6A 4BREA 4LF8K 1N33K 4DF4A 3SZ2A 3EEQA 2FDQA 3MECA 1YTAA 4CZGA 4B3RK 3NVKA 4JAXA 5KGXA 4F4KA 3ASMA 1Q9XA 4CJUA 3KLGA 1C1CA 1ATRA 1VSMA 3V81A 4N41A 3VENA 4JD2A 4M42A 2XY6A 1P8ZA 4CZFA 1SZ2A 2OYQA 2CGLA 3HPOA 3OYMA 4KV8A 1KVAA 1RTIA 3QFUA 1RTHA 3RRGA 3E9PA 5KQ8A 1W7AA 4BRGA 4Z4GA 3C7NA 4CF1A 3CQXA 3J8AA 3SQ0A 1L3UA 3QIOA 3CPWM 3AVCA 3ZETA 3EE9A 4Y1CA 1ITGA 5M1NA 4CJKA 2CGJA 3CCVN 4DTUA 4NYNA 2QW9A 5EXWA 3AAQA 3C65A 4CFDA 1U6ZA 5C15A 3HP6A 2VG6A 1J53A 3LALA 4CE9A 3X23A 4FOEA 4DV6K 1VQMN 4DR2K 4ILHA 4WFAL 5DMRA 3SMSA 3AVJA 4F9OA 2Q3SA 1RT6A 3H3OB 4PQUA 1XMQK 1K8KB 4ZHRA 4FJIA 4FOIA 3O9TA 5GAHP 2I7NA 4J2DA 1KVCA 4MDBA 3RSEB 1JJ2M 4FCYA 5AZJB 5F1XA 3QEIA 4DV7K 4DQIA 1SS6A 1NVLA 3QINA 2GX9A 3I0RA 4JNEA 4BGBA 1VSEA 4IOXA 5BR9A 3DXMA 3EZWA 3CETA 5M1KA 1IBMK 1EXQA 2UYTA 1NWKA 1HNVA 1ZC6A 1EWRA 3QLHA 3TTDA 3THXB 3FP5A 4FL9A 4EP5A 4FLVA 1FK9A 1Y97A 2F8SA 1JCEA 3CJAA 4MLHA 1NJIO 3V9SA 1BWFO 1GLEG 4FJGA 4ZRJA 1XHZA 4WE1A 2Z1IA 3TR8A 1N36K 3OYIA 2AJQA 3TSQA 4AH9A 5HL7L 4CF8A 3JXUA 5IT9O 1BIZA 3QBXA 2G8FA 3EPYA 1DTTA 4KKOA 2HMPA 3OBYA 1SGHA 4C1NK 3IMXA 2IVPA 5H1SQ 3CJ9A 1NTIA 4I2PA 4BRPA 3IKMA 2J0KA 1JL2A 2A6AA 4JRQA 2O8FB 1A5VA 4Z4EA 2B6AA 2YNIA 1GLAG 1A5XA 3OYHA 2W42A 4JI0K 1K8AO 3D45A 4WF9L 3E1YA 1NGAA 3NAEA 1VQ4N 4CESA 2OZMA 2W40A 4PY5A 4C23A 5AQSA 2B4JA 2IC3A 4A62A 2P9PA 2QEXN 3HBTA 1BG3A 3ENHA 1B92A 4CD3A 4EZ9A 3AGKA 2YV0X 3MWTA 4K43A 3WXJA 5A2QO 1DIKA 3A5MC 4O55A 3WXKA 5JVLA 2F7TA 5ELZA 4KI6A 1O13A 5E26A 3WUHA 4A2AA 2X74A 1JLBA 1H4RA 5K14A 1Y19B 3DWLA 1JLQA 2E1YA 2E4LA 4CGFA 1HPMA 3E9LA 3OYGA 2HB5A 4ZRKA 4FLXA 2XY8A 3OYKA 2NRRA 2JWKA 4JS5A 1JDEA 5AQKA 2ITMA 1S1XA 4CGIA 4KH5A 3TAPA 4YHHK 2ZJRL 3L3VA 4FLWA 1ISNA 4CF9A 3L2WA 2NUBA 3PX4A 4BRFA 1QZ5A 3ULDA 4B08A 4BDPA 1G99A 3CF5L 5LMNK 3QFPA 2QA4N 1YVNA 3ZSRA 1CZAN 4BG8A 4IJNA 1X9JA 4KHSA 1GLLO 4LSLA 3PO5A 4GW6A 5M1OA 1S1VA 2GEMA 4CECA 1ZBSA 2V52B 1QZ6A 1J5EK 4A2BA 1Z26A 4IG3A 3ZSOA 4DTMA 4CJ4A 4DFKA 2PYLA 5AQWA 3MDQA 1WUAA 4H8KA 1RDBA 4HVJA 3VESA 3CCLN 1NU0A 1E4GT 2XY5A 4O8KA 3MN5A 4DQRA 1RBSA 2P9UA 3RWUA 1MIXA 2Y1IA 4KHWA 3J7YP 1S22A 1NKEA 1I94K 4HCCA 1GGOA 2E6LA 3THYB 4CEDA 4PUOA 4JK7A 2FC0A 1NK4A 3T69A 3PIOL 4CGGA 2E5LK 2FSKA 5HRSA 3QDKA 4NCAA 1RDDA 2IS3A 3VOVA 5M1PA 3F73A 1TV6A 3CJ7A 1TAUA 1GLJO 1YJNN 4B1ZA 1LCUA 3PVLA 4QOZB 2RPIA 3CHWA 3HYFA 3ULEA 4LY7A 4FWOA 2ZPYA 4XH5A 4IEEA 2IVOA 4O8UA 1Q18A 2D4WA 5JICA 1KBLA 1SKWA 4OKKA 3VQ7A 2E1ZA 3OYBA 2HMIA 2E2QA 4IFEA 5HOOA 3VGMA 2IAJA 1EO1A 3L8BA 1NGGA 4DUYK 4FJJA 1C1AA 3AA5X 1JCFA 3OYFA 1KVBA 1QHTA 4Z4IA 4CBUA 4ZTJA 4BRMA 3TWHA 2PFUA 1WLJA 1X9SA 4FJKA 4IFYA 1KLNA 5KPZA 2PAVA 3TABA 4J2AA 3IFRA 4RW6A 3Q7CA 3HVTA 4KRFA 1KD1O 1NMDA 4BC4A 2OPSA 3L0QA 3ZT3A 1HRHA 4BDYA 2D10A 2NRTA 1VSLA 4FZYA 4LC9B 4CJ7A 5IJMA 2AP1A 4DR3K 2COPA 2KW4A 3VA0A 3PZDA 4JS4A 4EHTA 4B1UB 1U49A 3HPGA 5LJVA 3VEWA 4CEZA 2Q36A 2ZJPL 1YUWA 5C12A 3CFOA 1J5OA 1S9EA 3VQPA 4X62K 1ASUA 1L3SA 4B9QA 1LWCA 4CIGA 3DOLA 1B9DA 4CEBA 3T1YK 3SI6A 5KTQA 3TU5A 1NGDA 4I6MB 3C95A 3LZJA 3IRXA 4JKEA 4IBNA 4EFHA 4IWVA 4HDQA 4J2EA 3MCAB 3V6DA 1EQYA 2Y1JA 1WBDA 3WT0A 2I1JA 1RDWX 3MEGA 4X64K 4IJAA 4YOVA 2O8DB 2D2QA 3MN7A 4CEEA 4C8MA 5CR4A 2GV9A 1QQNA 2DFFA 3UKRB 5EU7A 3AVAA 1MWMA 4OGEA 4K42A 3VF6A 1U2VB 2BTFA 4E0DA 3LDQA 4FM1A 1WN7A 1ZBFA 3QIPA 3F9KA 2YHYA 4KREA 2FBYA 4CGJA 1BQNA 4W5OA 3K59A 4QCLA 1VRUA 3AV9A 1JKHA 2HNYA 1NK8A 4FZXC 5GADP 2HE7A 3AVIA 4FLZA 2D0AA 4JI6K 4RCHA 3QMLA 4LH5A 5ADXH 4CGHA 1QVFM 4IOCL 2DFHA 4BC5A 2WUSA 3CM6A 4FWNA 4DTPA 4PA1A 5FPDA 3H1VX 3DLHA 3WA0A 1U4BA 1BI4A 1VQ8N 3OYDA 5AR0A 1BL3A 2PBDA 4ZRIA 1NGBA 4M3ZA 1RDUA 3O1WA 4BWJA 1XHXA 4TKNA 5J1EA 1VAZA 2X0SA 4E7JA 3IDHA 3KLEA 1V4SA 2YHXA 1HNIA 3OYJA 3T1HK 5BN8A 4DG1A 3JSMA 4L8RB 1YIJN 3DRPA 2P9KB 3AO2A 3I33A 3ATVA 1EKEA 4DV3K 4BVOA 1NJXA 3G9WA 4LH4A 3O1BA 1TK0A 4DV4K 1NJYA 2O8BA 4CW7B 1G15A 3HPHA 4E7IA 1HR0K 1NKCA 3ISNC 1GLBG 3KZBA 1TK8A 4LF9K 3HO1A 4QS7A 5AZJA 3G4SN 4YOTA 1BU6O 5AQVA 3AVGA 4BR2A 3EKUA 1RBVA 5C2DA 4E1NA 2HBMA 1NBWA 3CI5A 4H5VA 5AQIA 3HOTA 3HRGA 2RQ1A 4BDZA 4GVMA 3EKSA 3MN9A 3P1GA 4H0XB 4Q5VA 2FBXA 1D9FA 1F21A 5BREA 3CIPA 2P9LB 1XNQK 5SZTA 2Q97A 3LWLA 4OVLA 3O9QA 3UKUA 4CJSA 2HNDA 1GLDG 4FLUA 3EE8A 3SUQA 4CFCA 3THVA 4DLEA 3LP2A 1HPZA 3H46O 4ELUA 4FJHA 3PY8A 2UUBK 2OCEA 4OO1J 3DAWA 3ZX0A 2G8UA 1HKGA 3S3NA 1NK5A 2FSJA 5AFUH 1R59O 2NZTA 1HLUA 4C1NI 1DT9A 1VBGA 3KTQA 4JK9A 1LWFA 1TK5A 5EOYA 2IOCA 4CZEA 2OANA 2Q0UA 3S41A 1BA0A 3O9RA 1HNZK 4WFNL 2BH1A 3WQTA 2P9NB 5FRNA 4B9TA 2KKZA 4RW9A 2I5JA 4KHNA 3M8QA 2FF6A 1MK7B 2CGKA 3PSIA 2J0JA 5C0YA 2A41A 2X78A 3O4WA 2HRJA 4GMJB 3NBPA 1X9WA 3IG1A 3SLCA 3QERA 3KHYA 1J19A 4CZIA 3DI6A 3AO5A 2XRIA 4BRNA 5BR8K 3T7ZA 1QSSA 3U7DA 4DQQA 4LF6K 3VQ9A 1X9MA 1VQNN 2I1KA 1HBKA 3MWPA 3TANA 1A5WA 3EY1A 2G8HA 4HUEA 1HYVA 3CCQN 2KFZA 3QNOA 1GG3A 4FVMA 3AO4A 2NRXA 4AILC 3HK2A 4KPYA 3OJSA 2Q31A 3D0PA 5AQYA 2KFNA 4B9NA 3SQ2A 3FZLA 4JYAK 4EKUA 4B8AB 1IO2A 2HBJA 2ASOA 4MFBA 3V1QA 3NH0A 2R82A 5AQRA 4XH4A 3O9SA 2RF2A 4DMNA 4CEOA 3DXKA 3CC4N 4DV0K 3V9UA 3D2EB 2W6LA 2ZE2A 1BA1A 2Q2RA 2A1SA 3DMJA 4I2QA 2R7YA 2WC9A 3P31A 1HB6A 3VQ5A 3NMUA 4BRAA 1NK0A 1WNSA 2RN2A 1GC6A 3UIQA 4OPJA 3SUNA 3S9HA 3U9DA 4H0OA 5BRDA 3VTHA 3MXMA 3NF7A 2V51B 3QEVA 3RMAA 3HJFA 2G8VA 3BINA 1UAXA 1LAVA 4CEFA 2P9SA 3ZX2A 2FBVA 3VGLA 3G6EN 5EVZA 4E1MA 2ZD1A 4M63C 3HVRA 1T44A 4FW1A 4CJVA 1YVUA 2HHSA 4Z4HA 4NLCA 3AAPA 3ZSXA 1C0MA 3ZSWA 2KZZA 5KRTA 3OHRA 3QETA 3B6OA 3ZEUB 4BRLA 1BCOA 3OW2M 3CC7N 1TGOA 4E3SA 1NGCA 1C0UA 4A5BA 1JLFA 3EZ5A 1YJWN 4CJLA 2QWPA 1E3MA 1QQMA 5AQOA 5HLFA 1VQ7N 4R79A 4CJPA 2YJEA 4JI1K 5HBMA 3QO9A 4BR4A 4DSEA 1Q7YO 1VQ5N 4AM6A 2OA8A 5ADXA 3VEZA 4BGAA 2NRVA 2D0CA 3K57A 4HDOA 3NFAA 4DLGA 4Z4CA 2PY5A 4X65K 3AARA 1RNHA 3NF6A 3ZYYX 4CHQA 3MX5A 5DK5A 1RBUA 4BE2A 3VQ4A 4WQ5C 2GWKA 3F2KA 1SQKA 4GV9A 3TI0A 5LMUK 1WSJA 3BZKA 5FDLA 3SV4A 4KHYA 3THWA 1KFSA 2A3ZA 4K41A 4FJ9A 4IEIA 1D8YA 3U4LA 4M3UA 4JRPA 3SYZA 4FJNA 2DIKA 3I56N 3FE1A 3WXIA 1KAXA 5F2RA 3LAKA 4FWLA 4DTRA 4JK8A 1KLMA 2EX3A 5JMVA 3ZSVA 3CCUN 3H45C 3JAMO 2VG7A 4NB4A 1BUPA 3MMVA 3OS1A 1HJRA 2VWBA 3TAEA 3BP8A 4PL7A 3V1RA 4B3SK 3CPEA 3WEEB 2OPRA 5AQMA 3D2FB 3J81O 4FWRA 4L3QA 4M3WA 3HI0A 3SUOA 1TUYA 2H3GX 4PKGA 4B3TK 1BHLA 2X6SA 1IJJA 1KCFA 5BPNA 4KHUA 4DS4A 1BGXT 1CZ9A 2UUAK 4CZLA 1FXXA 4Z94A 3L2VA 3TTFA 3A5NC 3D6RA 2F9WA 1MIZB 4IXCA 1XC3A 4BE1A 3MXIA 1Z05A 3ZT1A 1BCMA 2G8IA 3L2UA 2HNZA 3FR0A 3KLFA 2QWOA 4MQ3A 3BF3A 2IIRA 4BQZA 4JKFA 1GLFO 1HYZA 3O5BA 3ZSQA 1RT3A 5AFUA 3MAQA 2HBKA 1FW6A 4FK4A 3A5OC 4K0KK 4JD2B 4B1XB 4K8XA 3CJCA 4DTSA 2G8KA 1RT1A 4CFBA 3LM2A 3OTOK 4BRIA 3VQCA 1WSHA 3AVHA 3UKRA 2CQUA 1BO5O 1D5AA 3G71N 4DSJA 3E01A 3QBWA 1YF5L 3MX2A 2VCPA 1X3MA 5CZ2A 3C7NB 4JI4K 2OTJN 4O5FA 1W0HA 4BQLA 3TAMA 1W9HA 1IKWA 1QHAA 1YTUA 2BUPA 1NJWA 4ELTA 3QIJA 1X3NA 2QWNA 1OH6A 4BRCA 4BC2A 1YT3A 3OS0A 4W5RA 3RRHA 3EL2A 1REVA 4DTXA 4BRHA 2QK9A 4J2BA 3W0LA 3KWIA 3SK3A 2YHBA 4JKCA 1JXBA 1RBTA 5M1FA 1UA1A 5DM7L 2QKKA 5AZIB 4CYEA 5J2PA 1JXEA 1L5UA 4LF4K 1TKXA 2D0PA 3VF4A 3PIPL 4CD1A 2VWJA 3CJBA 2AA4A 3FLCO 3SMPA 3CJ1A 4JEPA 1FKPA 2KZMA 3W3DA 1T05A 1T3VA 3DLEA 3S3MA 5MLCQ 4C8LA 3WXMB 3AVKA 1YJ9N 3DXMB 4LFBK 4FJ8A 4CFAA 4JHDB 4CERA 3VEXA 3BUZB 4DS5A 1IBLK 2DTUA 4PKIA 4FPBA 2AL6A 4UY8O 1IG8A 2E8AA 2WTUA 4Q0BA 1Z25A 1HKCA 3H08A 5TKWA 1XNRK 4F7GA 4I7FA 3H1QA 1J54A 5GIPA 4B9MA 1VSKA 1N8RO 3LDSA 1RTDA 3HT3A 1HX1A 3FZHA 4NXNK 3ITHA 4JKDA 4FK0A 3CCRN 2XY7A 3KWGA 4WQ5A 4GV6A 1FJGK 1RDAA 2E2PA 4ID1A 5GAGP 1XMOK 3MCPA 1S6QA 3ZCMA 4DXAB 3BDPA 2UXCK 2HBLA 1Q81O 2HF4A 1HQEA 4E7LA 2F8TA 3LAMA 3CMAN 1KC7A 4QS9A 1JLEA 3VQQA 2O8CB 3KIOA 3KK2A 4ISFA 4CIFA 2IVNA 1TYQB 5KPTA 2WFBA 3BEXA 3CMEN 3C6HA 3DOKA 3LZIA 2Q0RA 2KTQA 1VRTA 4M7XA 3JYTA 3P39A 2P9PB 2KLAA 2EHGA 1N5YA 5T7BA 2P9IB 3DYAA 3ZX3A 4IOAL 4DU4A 4FWQA 4CEAA 5SWMA 3EO3A 1RTJA 4OLAA 4RG8A 3LDPA 4M3RA 4BWMA 4QAGA 3CXCM 2GBZA 4JKBA 4FWMA 1KSPA 1CXUA 3WNGA 3AA4A 3C6TA 2DFEA 4JKGA 3E9OA 1D9DA 3C6AA 4GY2B 1V4TA 3NE6A 1XI1A 1JL1A 2UXBK 5BPLA 3KVGA 3K58A 1ATSA 4AHUA 4H0PA 2O8EB 4MLEA 4NXMK 4CHPA 2A42A 5J2QA 3NGIA 1E4FT 5BRHA 3WNEA 3RTVA 3C0BA 5KI6A 3ZLJA 4DKWA 1NK9A 3NVMA 3ZDTA 3K0SA 4IDHA 1FKOA 4YFUA 4F3OA 4B1VA 1DLOA 5LY3A 4B9UA 3TSUA 2ETJA 3TPQA 2NRZA 4BACA 1Q9YA 4LF5K 4CZHA 4Z4FA 2KQ2A 4BR7A 3RR8A 5BN9A 3O08A 3O3FA 4KO0A 2XO7A 4ILGB 3TAQA 2FSNA 3DLBA 1JCGA 3HP9A 3RVCA 1HB8A 3UB5A 4EIAA 1ST7A 3OYNA 4J8FA 1OH7A 2DPNA 4CBXA 4BRDA 1ZBLA 4FVUA 3SAFA 4BR0A 2E2OA 2RKIA 1BISA 5JLFA 1DEJA 3SQ4A 4KTQA 5C24A 2HHWA 1MK9B 1RGIA 1WAJA 3MN6A 4YNQA 1NKBA 3HSCA 4M3XA 3LM9A 1TL1A 2D5RA 1EETA 4E19A 2W6KA 4YOYA 2BE2A 3SBGA 4FJLA 1HYSA 4CK3A 5AQFA 5JVHL 3ENBA 5FPMA 4Y1DA 5I9EB 1BQMA 4E7KA 4DR1K 3BY5A 4FLYA 4WCEL 1K8KA 1VSHA 3HM8A 5BPMA 4FW2A 1MDUB 4V19S 3LL3A 3LP3A 5KRSA 4GV3A 4XH1A 4ICLA 3TAGA 1K6YA 3VQDA 4DR6K 3RSEA 2O4GA 4H03B 1NGJA 2B5JA 1GOAA 1T03A 1TVRA 2IGIA 3SPZA 4H5WA 5LL6Z 3I55N 4DU1A 1KRPA 5AQXA 2G8WA 2CB8A 4P7IA 4CJFA 1M90O 5AQNA 1IH7A 3LP0A 4KI4A 3I8DA 3QEXA 1KAZA 2QWMA 3THXA 2HHTA 4IG0A 4CHNA 5FROA 2ZM6K 2VQEK 4DR4K 3ID6A 5E41A 4IO8A 4KH6A 3WXLA 3NDKA 4GKJK 3U3YA 4WQ4C 1HNXK 3VQAA 3DLGA 3L6QA 3M8PA 2D0OA 4GKKK 2NRWA 4FM0A 4DV5K 3G10A 3AO1A 5CYMA 4DQPA 3QICA 5CY4A 4DV2K 2GUPA 1LW2A 3V4IA 1DTQA 2WONA 1C0GA 4KBOA 3GBTA 2HW3A 1GOCA 4JI7K 1GLCG 4LSNA 5B8HA 4TSXA 3AVMA 1BIUA 2WOMA 5GAEP 3RMBA 4PHTX 4CHYA 3OS2A 2O8FA 4QS8A 3SNNA 4CJQA 4O0JA 3SCXA 1VQ6N 3O80A 1C0TA 3BGRA 4GNIA 3UE5A 3VF2A 3M3ZA 4KHPK 3NGZA 4YOXA 1YAGA 2YX6A 4LD0A 3R9PA 5AQQA 5AQHA 4B9SA 1KQSM 1N6QA 3AGRA 4CF2A 2O4IA 4M7YA 3HXMA 2UXDK 1NJZA 3VGKA 3D2FA 5C10A 4DFMA 1NK7A 1TL3A 5EY4A 2XHBA 2PZSA 3I8BA 3TARA 4AHVA 4JKAA 3R6MA 1NK6A 4W5QA 4CJWA 3NH1A 4E7HA 1W97L 4YDUC 1VQ9N 1L3VA 3T3FA 3KLHA 3O4QA 3NH2A 2RE2A 4GXBA 3CG7A 3QB0A 4KTWA 1NOYA 4FJMA 1J6ZA 5I3UA 1WSIA 2OTLN 2QXLA 3A5LC 2W41A 3MXJA 4DF8A 4DFJA 4B8CA 4B9LA 4FXDA 1RILA 2ITGA 2FBTA 4CGDA 2FLOA 3OVNA 3OYLA 4ID5A 3TSPA 2VYPA 1Q8IA 2JLEA 5C42A 1RDCA 3GOIA 5JLHA 1BI4B 4M3TA 1QE1A 3R1XA 4M3YA 1WOQA 4A57A 1VQPN 4YL8A 2UU9K 4C8OA 1EX4A 1NGFA 1XQSC 1UWBA 4I9LA 3QESA 5HRPA 4CJRA 4EP4A 3QNNA 4W5TA 4AM7A 4I9QA 5DM6L 3CCJN 2Z1HA 5M1QA 1U48A 3HTVA 3DRSA 4BC3A 4PKHA 3ZSYA 2F4VK 3KK3A 2VQFK 1LWEA 1ATNA 2QTDA 4LFAK 4JI8K 2O8BB 3U9ZA 3VMFB 3CQYA 5AZIA 3IUCA 1XUPO 3LP1A 1NI2A 3H6EA 1MU2A 3THYA 1YHQN 4E1JA 1K73O 4FK2A 2A5XA 4JV5K 4YOUA 4G9ZA 4GVEA 2ABDA 2GTDA 1GOBA 4RW4A 4CZMA 2YI1A 4AQYK 2D11A 4JHDA 3OYAA 1VQON 3K2PA 2QXFA 4FPAA 4CJEA 3U8ZA 4B1WB 1U45A 1S6PA 4IFVA 3VEVA 2DY4A 2J4RA 4WQ4A 2QM1A 4H0VB 4FJXA 1N34K 4ISGA 4WFBL 1S1TA 3A8YA 4Z0UA 1VQKN 2HSTA 1VBHA 3UKUB 4IKFA 4DSIA 1QQOA 4DCHA 3M5RA 1VSFA 1MWKA 4CEQA 2FXUA 2YNHA 1WSFA 4DR5K 3ZT0A 3RMDA 1XC9A 1OVQA 4BY9C 4ILJA 3P38A 1S5JA 4IZ9A 3AA3A 5HRNA 1S3XA 3O3GA 2A40A 2HF3A 4H4OA 2VG5A 3Q7BA 3VQ8A 4FJ5A 1J9AA 1ZBUA 1RFQA 3NF9A 3K9JA 4JI2K 4A59A 4C8NA 2J0MA 4H0YB 1NM1A 2NRHA 4K25A 1WSEA 3AA2A 3LPTA 4MO5A 2YNFA 4DU3A 5D3GA 1TAQA 3DM2A 3CCMN 1OKJA 1E5WA 1SKRA 3VA3A 4DB3A 3SUPA
chains in the Genus database with same CATH topology
3WA0A 5GIPA 1N8RO 4BROA 4BR5A 2ZJQL 3CD6N 4WYBA 1HX1A 1VQ8N 5FPNA 2RHKA 5AQZA 3FZHA 2PBDA 5AR0A 4ZRIA 1NGBA 4MO4A 4JKDA 1RDUA 3O1WA 3CCRN 4BREA 1LOTB 4TKNA 3KWGA 4WQ5A 4GV6A 1TYQA 1VAZA 2FDQA 2X0SA 3M1FA 2E2PA 4CZGA 3IDHA 3NVKA 1V4SA 4JAXA 5GAGP 2YHXA 3VPZA 3MCPA 3FLVA 5BN8A 1ATRA 3VENA 1YIJN 4JD2A 4DXAB 2P9KB 2EMTA 3I33A 2HBLA 3ATVA 1Q81O 4BRQA 1Z6RA 1P8ZA 2HF4A 1SZ2A 2P9IA 4BVOA 4CZFA 2CGLA 3G9WA 3QFUA 3DLLL 3O1BA 3E9PA 2E2NA 1KC7A 3CMAN 2YCHA 4QS9A 5KQ8A 4BRGA 5E84A 4I6MA 3C7NA 3CQXA 4ISFA 1Q86O 1M1KO 3J8AA 3OBWA 4YDUA 2IVNA 1TYQB 5AQPA 5KPTA 1GLBG 2WFBA 4FWKA 3KZBA 3CPWM 3BEXA 3CMEN 3ZETA 3C6HA 3AU4A 1Y64A 3EE9A 4QS7A 5AZJA 4NY0A 1ILYA 2Q0RA 3CCVN 5M1NA 3G4SN 2CGJA 4YOTA 1HKBA 2QW9A 5EXWA 1BU6O 5AQVA 3AAQA 3C65A 1U6ZA 3GDQA 4M7XA 4BR2A 3EKUA 5C15A 3P39A 2P9PB 5C2DA 1KAYA 2HBMA 2KLAA 1NBWA 4HWIA 1T6CA 3X23A 2P9IB 4FOEA 1VQMN 3CI5A 5GINA 3DXKB 3M6GA 4ILHA 4H5VA 5AQIA 4WFAL 3ZX3A 3HOTA 2YJFA 3HRGA 3SMSA 4IOAL 2RQ1A 4F9OA 5KPRA 3H3OB 3EKSA 1K8KB 3MN9A 2FF3B 3FZFA 4FOIA 4H0XB 3VEYA 4FWQA 1ACAA 3EO3A 3O9TA 5BREA 5GAHP 1U2VA 2I7NA 2P9LB 2QWQA 3CIPA 3LDPA 3CXCM 4JKBA 4FWMA 4MDBA 2Q97A 3RSEB 1JJ2M 4PL8A 4YORA 3ZETB 5AZJB 5F1XA 1W2BM 3O9QA 3UKUA 1GLDG 1SS6A 4JKGA 3EE8A 1H1VA 1NVLA 3E9OA 4IO9L 3C6AA 4GY2B 2GX9A 4BG9A 4JNEA 1V4TA 4BGBA 3H46O 5BPLA 1Q82O 4IOXA 4OO1J 5BR9A 3DXMA 3EZWA 3CETA 3KVGA 5M1KA 2UYTA 1ATSA 3DAWA 1NWKA 3ZX0A 4H0PA 1QVGM 2KHOA 2P9SB 1HKGA 1ZC6A 4MLEA 3O6WA 4FWPA 1BDGA 2FSJA 2A42A 5AFUH 3TTDA 3FP5A 4FL9A 1E4FT 5BRHA 1R59O 3C0BA 2NZTA 2QWRA 2F9TA 1HLUA 4C1NI 1DT9A 4DKWA 1VBGA 1JCEA 3CJAA 4JK9A 3VEOA 4MLHA 3NVMA 1NJIO 5EOYA 4CZEA 2OANA 3ZDTA 2Q0UA 1BWFO 1GLEG 4IDHA 3S41A 3CCSN 4FO0A 4B1VA 1BA0A 4ZRJA 3O9RA 4WFNL 2BH1A 3VTIA 2P9NB 3WQTA 5LY3A 2KKZA 3TSUA 3LDNA 3K9KA 3TPQA 3TSQA 2WBNA 3VERA 5HL7L 3JXUA 2NRZA 2FF6A 4CZHA 1MK7B 3QBXA 2CGKA 2J0JA 5C0YA 2A41A 3O4WA 2HRJA 4BR7A 3EPYA 1C0FA 5BN9A 3O08A 3SLCA 4BVPA 3KHYA 1J19A 4CZIA 2HMPA 3OBYA 1SGHA 4ILGB 4C1NK 4BRNA 3IMXA 2FSNA 4RTFD 5AQUA 3T7ZA 1JCGA 3U7DA 2IVPA 3RVCA 1HB8A 3UB5A 2P9KA 4EIAA 2I1KA 1HBKA 3MWPA 5H1SQ 1ST7A 3CJ9A 1VQNN 1NTIA 4J8FA 4BRPA 3IKMA 2J0KA 2DPNA 4CBXA 2A6AA 3CCQN 4BRDA 4CI6A 4FVUA 3SAFA 4BR0A 1NGHA 2E2OA 1GG3A 5JLFA 1DEJA 2NRXA 2FJ9A 1GLAG 1MK9B 3KK7A 3ATUA 4DHYA 1RGIA 2Q31A 4WF9L 5AQYA 3MN6A 1K8AO 3E1YA 1NGAA 2NLXA 3HSCA 1DGKN 3LM9A 1VQ4N 3FZLA 2D1KA 4EKUA 4U67L 5KQDA 5LJWA 4YOYA 2W40A 3SBGA 2HBJA 2ASOA 1NGEA 1KXPA 4C23A 5AQSA 2R82A 2GWJA 4H5TA 5AQRA 5AQFA 4A62A 1YITN 2P9PA 2QEXN 4XH4A 2ZWHA 3ENBA 1BG3A 3ENHA 3HBTA 5FPMA 5I9EB 3O9SA 5JVGL 4CD3A 3B8AX 3DXKA 3CC4N 3WQUA 3FZKA 3FGUA 3D2EB 3AGKA 1BA1A 2Q2RA 3MWTA 4K43A 3WXJA 1DIKA 3A5MC 1NGIA 4WCEL 1K8KA 3HM8A 5BPMA 2WC9A 3WXKA 5JVLA 1MDUB 3P31A 2F7TA 1HB6A 3LL3A 5ELZA 2P9LA 4GV3A 4XH1A 1O13A 3F5TA 5E26A 3WUHA 3NMUA 4BRAA 1VQKN 4A2AA 3CERA 3RSEA 1GC6A 1H4RA 3GG4A 4H03B 1Y19B 1NGJA 3U9DA 3DWLA 2E1YA 4H0OA 5BRDA 3VTHA 2V51B 4U7BA 4H5WA 1HPMA 3E9LA 1HUXA 3TTCA 3AU5A 3GE1A 2ZF5O 3I55N 4ZRKA 4H5RA 5AQXA 2CB8A 1MA9B 4P7IA 1M90O 5AQNA 3ID8A 1S72N 3BINA 3ENOA 2NRRA 2P9SA 1KAZA 3ZX2A 2QWMA 3VGLA 3G6EN 5EVZA 2JWKA 4M63C 3J7ZO 3R3LA 1JDEA 4MDAA 1T44A 5AQJA 5AQKA 2ITMA 1VQLN 3ID6A 4AF1A 5AQTA 4IO8A 4KH6A 3WXLA 2ZGZA 4KH5A 4WQ4C 4RWTA 3VETA 4NLCA 1ZXOA 3AAPA 4H0TB 2P9NA 2ZJRL 1ISNA 3L6QA 2D0OA 2NRWA 3OHRA 3ZEUB 4BRLA 4BRFA 1QZ5A 3OW2M 3CC7N 5TKYA 1NGCA 3QICA 1KC8O 2GUPA 4A5BA 1G99A 3CF5L 1YJWN 3QFPA 2QWPA 2QA4N 1YVNA 1QQMA 5AQOA 1VQ7N 1C0GA 4R79A 4KBOA 1CZAN 2YJEA 3AY9A 3GBTA 2E88A 4IJNA 1X9JA 4BG8A 4BR4A 1Q7YO 1GLCG 1VQ5N 2YHWA 4AM6A 5ADXA 1GLLO 4H5NA 2NRVA 4KH4A 3D7EO 5M1OA 3VEZA 4BGAA 5B8HA 3HZ6A 2GEMA 4HDOA 1ZBSA 2ASMA 2LBBA 2V52B 1QZ6A 5GAEP 4A2BA 4PHTX 4QS8A 5AQWA 3MDQA 1WUAA 3AARA 1VQ6N 3O80A 3H3NO 3VESA 3CCLN 1YI2N 1E4GT 4GNIA 3ZYYX 3UE5A 3VF2A 1DKGD 3MX5A 3M3ZA 2EWSA 2WH5A 3MN5A 4O8KA 2P9UA 3OA9A 4YOXA 4HTLA 1YAGA 2NNWA 1MIXA 2YX6A 3R9PA 5AQQA 5AQHA 1S22A 2GWKA 4WQ5C 1KQSM 3F2KA 4OPHA 4FSVA 4A5AA 1SQKA 4GV9A 1GGOA 3JS6A 3LDOA 3AGRA 3CC2N 4JK7A 4M7YA 3FFKB 2HOEA 3U8XA 2A3ZA 3D2FA 3VGKA 5C10A 3T69A 5EY4A 3PIOL 4K41A 4IEIA 3PLAA 3U4LA 3D2EA 2V7ZA 2FSKA 3QDKA 4NLBA 3E66A 3VOVA 5M1PA 2DIKA 3CJ7A 3I8BA 1GLJO 3I56N 4B1ZA 1YJNN 3FE1A 1LCUA 3PVLA 3WXIA 1KAXA 4JKAA 5F2RA 3R6MA 4FWLA 5BRFA 2P9UB 1K9MO 4JK8A 3CHWA 2Q1NA 1HJOA 5JMVA 3CCUN 3H45C 3ULEA 1W97L 3SAHA 4FWOA 4YDUC 1VQ9N 2ZPYA 2CH6A 2ZGYA 3H1VX 4NB4A 4XH5A 3F9MA 1BUPA 3MMVA 4FWSA 4IEEA 2IVOA 1T6DA 4O8UA 1Q18A 2D4WA 4NO7A 2VWBA 1KBLA 3SJHA 5JICA 2VGNA 3BP8A 4PL7A 3O9UA 2E1ZA 3CPEA 3WEEB 2E2QA 2I7PA 2RE2A 4GXBA 4IFEA 5AQMA 3D2FB 3QB0A 3VGMA 5HOOA 1EO1A 4CZJA 4FWRA 4L3QA 1NGGA 3HI0A 1J6ZA 3SAGA 3P4IA 2OTLN 3SBTA 1JCFA 1TUYA 2H3GX 2QXLA 3A5LC 2W41A 4PKGA 3IVFA 4CBUA 4BRMA 1IJJA 2PFUA 2QI2A 5EX5A 5BPNA 3N4PA 5KPZA 4CZLA 2CH5A 2PAVA 2FLOA 4Z94A 3IFRA 3TTFA 3A5NC 3TSPA 3ULEB 3Q7CA 4JN4A 2VYPA 2VGMA 5JVHL 3D6RA 1KD1O 1NMDA 4BC4A 3L0QA 2F9WA 3L4QA 5AQGA 1MIZB 2D10A 4IXCA 3GOIA 1XC3A 5JLHA 2NRTA 5GIOA 1Z05A 3ZEUA 3R1XA 4BRKA 1WOQA 4LC9B 4A57A 4YL8A 4CJ7A 1VQPN 3LDLA 3FR0A 5IJMA 2AP1A 1NGFA 1XQSC 1D4XA 4DQ8A 2COPA 2QWOA 3BF3A 2IIRA 4BQZA 4A61A 3PZDA 4JKFA 1GLFO 4OPAA 4B1UB 4EHTA 3O5BA 4AM7A 3N4QA 5LJVA 5DM6L 3CCJN 3VEWA 5M1QA 5AFUA 2Q36A 2HBKA 2ZJPL 5CE3A 1YUWA 5C12A 3A5OC 3HTVA 4JD2B 4B1XB 4BC3A 3CJCA 1SAZA 4PKHA 4DCHA 3LM2A 4B9QA 4EAHD 4BRIA 1ATNA 3UKRA 4XEIA 2CQUA 1BO5O 2QTDA 3G71N 2YVCA 3EN9A 3QBWA 3G25A 1YF5L 3MX2A 3TU5A 2VCPA 1NGDA 3O8MA 1X3MA 4I6MB 3C7NB 2OTJN 4O5FA 3U9ZA 4CBWA 3VMFB 1OVYA 3CQYA 5AZIA 3IUCA 4JKEA 1XUPO 4BQLA 1QHAA 1NI2A 3H6EA 4EHUA 3R8EA 4EFHA 2BUPA 4IWVA 4HDQA 3QIJA 3MCAB 2EMSA 1EQYA 4E1JA 4YOWA 3WT0A 1X3NA 4CZKA 2I1JA 2QWNA 1YHQN 1K73O 1RDWX 2A5XA 4IJAA 4YOVA 2D2QA 2GELA 3MN7A 4BRCA 4YOUA 4BC2A 4G9ZA 1ESVA 1BOTO 4GVEA 2JWLA 5CR4A 2ABDA 2GTDA 1QQNA 3EL2A 4BRHA 4CZMA 3UKRB 2YI1A 3W0LA 2D11A 4JHDA 3KWIA 3SK3A 1VQON 1MWMA 4JKCA 4FPAA 4K42A 5M1FA 3U8ZA 4B1WB 4Y0WA 3VF6A 5C2FA 1U2VB 2BTFA 3VEVA 5DM7L 5AZIB 4CYEA 2J4RA 3LDQA 4WQ4A 2QM1A 4H0VB 3A0IX 2YHYA 4ISGA 4WFBL 2D0PA 3A8YA 3VF4A 3PIPL 3L4IA 4CD1A 2HSTA 1VBHA 2AA4A 3CJBA 3UKUB 5FPEA 3FLCO 4ISEA 1QQOA 2E20A 3SMPA 4JKGB 3CJ1A 4JEPA 1YXQA 3FZMA 3M5RA 3WEEA 1GC7A 1MWKA 3HOSA 2FXUA 3CCEN 4BY9C 2AEHA 5GADP 4ILJA 3P38A 2HE7A 4JKHA 1T3VA 4IZ9A 1P90A 3W3DA 5MLCQ 1S3XA 3DJCA 3WXMB 1TUUA 2V7YA 2A40A 5AQLA 2HF3A 3GL1A 3DXMB 1YJ9N 2QWLA 3MK6A 3Q7BA 1EF1A 1RFQA 4JHDB 3VEXA 3BUZB 4BR9A 3K9JA 3QMLA 4RCHA 4PKIA 4A59A 4FPBA 2AL6A 2J0MA 1NM1A 1NLVA 2NRHA 4H0YB 4K25A 4UY8O 1IG8A 2E8AA 4B1YB 5ADXH 3BF1A 4MO5A 5CHIA 4IOCL 1QVFM 2ASPA 1HKCA 4BC5A 5TKWA 5F0XA 2WUSA 3CCMN 1OKJA 4FWNA 1E5WA 5FPDA 4F7GA 4DB3A 3H1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9L A;  4JKG A;  4JKG B;  3E9O A;  3ENB A;  4ILJ A;  4JKH A;  4ILH A;  3E9P A;  4JKD A;  3SBT A;  3E66 A;  4JKC A;  4JKF A;  4JKA A;  4JKE A;  4JK8 A;  4JKB A;  4ILG B;  3SBG A;  4JK9 A;  4JK7 A; 
#chains in the Genus database with same CATH topology
 3WNF A;  4BRO A;  2ZJQ L;  3CD6 N;  3OYE A;  5FPN A;  2UUC K;  4PWD A;  4R5P A;  3QEW A;  4ELV A;  4MO4 A;  2X6N A;  2O8C A;  2P51 A;  3PV8 A;  3T19 A;  1LOT B;  1ZBI A;  3V9Z A;  1TYQ A;  3M1F A;  3FFI A;  3VPZ A;  1ASW A;  4NCB A;  3FLV A;  2JGU A;  3TAF A;  4LFC K;  3SJJ A;  2EMT A;  3S3O A;  4BRQ A;  1EWQ A;  1TKZ A;  1Z6R A;  2P9I A;  3VN5 A;  1N32 K;  4N47 A;  3DLL L;  3KLI A;  2E2N A;  2YCH A;  3V1O A;  1LAW A;  5E84 A;  4I6M A;  2BDP A;  3J80 O;  1Q86 O;  4KAZ A;  1M1K O;  3OBW A;  4YDU A;  2HHX A;  3AVL A;  5AQP A;  4FWK A;  4HCB A;  3OY9 A;  4M41 A;  3AU4 A;  1VSI A;  1Y64 A;  3C94 A;  4HUG A;  4NY0 A;  2HHQ A;  1ILY A;  1JLC A;  1HKB A;  3ZT2 A;  2O8D A;  3GDQ A;  2P5G A;  1C6V A;  3K5L A;  1LW0 A;  4OGC A;  1KAY A;  4RW8 A;  4XIU A;  5J2N A;  4HWI A;  1T6C A;  4DTJ A;  3LPU A;  5GIN A;  3DXK B;  2YKM A;  2Z1J A;  3M6G A;  4CCH A;  2YJF A;  5KPR A;  4BE0 A;  2O8E A;  4JI3 K;  2FF3 B;  3FZF A;  3VEY A;  1S9G A;  5JS1 A;  1ACA A;  1IKV A;  3VQB A;  1U2V A;  2QWQ A;  4DTN A;  1EP4 A;  5FLX O;  1QSY A;  4JLH A;  4PL8 A;  4YOR A;  3ZET B;  1WBB A;  1W2B M;  3PO4 A;  4B3O A;  4FYD A;  2F96 A;  2YKN A;  3V9X A;  1H1V A;  4IO9 L;  4BG9 A;  4HHT A;  4KTZ A;  1Q82 O;  3O3H A;  4B9V A;  1S1U A;  1QVG M;  3K5O A;  2KHO A;  2P9S B;  3DLK A;  3O6W A;  4FWP A;  1BDG A;  2QWR A;  2F9T A;  4DTO A;  1WSG A;  1RBR A;  3VEO A;  3WNH A;  3L2Q A;  3SV3 A;  3CCS N;  4FO0 A;  3AO3 A;  4OPK A;  2YNG A;  1X1P A;  3VTI A;  3CQ8 A;  2D0B A;  3NGY A;  5FRM A;  1R0A A;  3KKR A;  3LDN A;  3K9K A;  3J7A P;  4O4G A;  2WBN A;  3VER A;  3U6F A;  1ASV A;  1C0F A;  4G1Q A;  4BVP A;  3B6P A;  2BGG A;  3O4N A;  4RTF D;  5AQU A;  2OPQ A;  1JLG A;  1T7P A;  2P9K A;  1IG9 A;  1KFD A;  4F2S A;  2BAN A;  4CI6 A;  1NGH A;  1JLA A;  2FJ9 A;  1NOZ A;  3CYM A;  3KK7 A;  4HUF A;  3ATU A;  4DV1 K;  4DHY A;  4CK1 A;  2NLX A;  1RCH A;  5CYQ A;  1DGK N;  3HM9 A;  2D1K A;  4U67 L;  5KQD A;  5LJW A;  3KJV A;  1NGE A;  1KXP A;  1IBK K;  2GWJ A;  4H5T A;  1YIT N;  2ZWH A;  3THW B;  5JVG L;  3HST B;  1HNW K;  3B8A X;  3WQU A;  3FZK A;  3FGU A;  4CIE A;  1NGI A;  2E6M A;  1VK0 A;  4AHT A;  4YY3 K;  2A1R A;  5AJ3 K;  2P9L A;  3F5T A;  2PYJ A;  2YHA A;  3CER A;  3GG4 A;  2HHU A;  1WB9 A;  4DSL A;  1RT5 A;  4U7B A;  1ZYQ A;  3RMC A;  1HUX A;  3TTC A;  3AU5 A;  3GE1 A;  2ZF5 O;  2LSN A;  4DQS A;  4H5R A;  1MA9 B;  1WAF A;  4F2R A;  5HRR A;  3ID8 A;  1S72 N;  3CM5 A;  2ZQB A;  3ENO A;  2HVH A;  3NCI A;  4DSF A;  3J7Z O;  3R3L A;  4FLT A;  1SL0 A;  4MDA A;  4CVN E;  4DR7 K;  1VHX A;  5AQJ A;  3PSF A;  1VQL N;  4HTU A;  1QSL A;  4AF1 A;  5AQT A;  3K5M A;  3OJU A;  2ZGZ A;  2OZS A;  2OPP A;  4RWT A;  3VET A;  1ZXO A;  4H0T B;  2P9N A;  2HHV A;  4OLB A;  3K5N A;  3MED A;  3AVF A;  4B3M K;  1OH8 A;  5TKY A;  1KC8 O;  1SL2 A;  2P1J A;  3KKS A;  3AY9 A;  2E88 A;  4AHC A;  2YHW A;  4CHO A;  1CLQ A;  4H5N A;  4F3T A;  4KH4 A;  3D7E O;  4F8R A;  3HZ6 A;  1XWL A;  4FJ7 A;  1KTQ A;  2ASM A;  3PX6 A;  2LBB A;  4UQG A;  3CFP A;  4KB1 A;  3RR7 A;  3H3N O;  4RW7 A;  1YI2 N;  3VQE A;  1DKG D;  1I39 A;  2EWS A;  2WH5 A;  1SUQ A;  3OA9 A;  4C8K A;  4DUZ K;  4IDK A;  4HTL A;  1NMN A;  2NNW A;  4M45 A;  3AVN A;  1B9F A;  4OPH A;  4FSV A;  4A5A A;  4OX9 K;  3JS6 A;  1IKX A;  3LDO A;  3CC2 N;  3P83 D;  3FFK B;  2HOE A;  4K8Z A;  3U8X A;  4NCG A;  4CF0 A;  1NG9 A;  3PLA A;  5HRO A;  3D2E A;  2V7Z A;  3C6U A;  4NLB A;  3I0S A;  3E66 A;  3KK1 A;  4CJ5 A;  5I42 A;  3ALY A;  5BRF A;  4DSK A;  2P9U B;  1K9M O;  3NF8 A;  2Q1N A;  1HJO A;  1QTM A;  2P5O A;  3SAH A;  2CH6 A;  2ZGY A;  3F9M A;  4FWS A;  1T6D A;  4O44 A;  1VSJ A;  4NO7 A;  3SJH A;  1OH5 A;  5CZ1 A;  2VGN A;  3O9U A;  2I7P A;  2IDO A;  4CZJ A;  2HVI A;  1U47 A;  3LWM A;  3SAG A;  1TKT A;  4O5B A;  3P4I A;  3SBT A;  4DFP A;  3IVF A;  3QEP A;  3IAY A;  4H4M A;  1IKY A;  2QI2 A;  5EX5 A;  3N4P A;  1ZBH A;  2CH5 A;  4FZZ A;  1T8E A;  3ULE B;  4JN4 A;  3SQ1 A;  2VGM A;  4LF7 K;  3AVB A;  4W5N A;  3L4Q A;  1CXQ A;  3A2F A;  5AQG A;  3NHG A;  3IS9 A;  3EYZ A;  3V9W A;  4ZTF A;  4N56 A;  5GIO A;  1SL1 A;  3ZEU A;  1NNE A;  4BRK A;  5C25 A;  3LDL A;  4KHQ A;  4DQ8 A;  1D4X A;  1TKD A;  2Z1G A;  4A61 A;  4OPA A;  4NYF A;  3N4Q A;  4KB0 A;  1RT4 A;  4JI5 K;  5CE3 A;  3U3G A;  2HHH K;  4O0I A;  1SAZ A;  4N76 A;  4EAH D;  3KD5 E;  4KFB A;  4CK2 A;  3DRR A;  5J2M A;  1C1B A;  4XEI A;  1VSD A;  2YVC A;  3EN9 A;  3T1A A;  3MEE A;  3G25 A;  3DLR A;  3O8M A;  4DWI A;  4CBW A;  3SPY A;  3BZC A;  1OVY A;  3VQ6 A;  3G0Z A;  4EHU A;  3M8R A;  1RT7 A;  3R8E A;  2ATQ A;  2EMS A;  4YOW A;  4CZK A;  1U04 A;  1HMV A;  1QS4 A;  4CJT A;  2GEL A;  4CJ3 A;  1ESV A;  1BOT O;  2JWL A;  4N5S A;  4X66 K;  1HQU A;  3L2R A;  4E89 A;  4OKJ A;  2GUI A;  3HL8 A;  4AHR A;  4Y0W A;  5C2F A;  3ZSZ A;  3M8S A;  3KD1 E;  3OYC A;  1QQC A;  3A0I X;  5JS2 A;  2QKB A;  3L4I A;  4OJR A;  5FPE A;  1UA0 A;  2VWK A;  4ISE A;  2E20 A;  3PUF A;  4JKG B;  1RT2 A;  3WEE A;  3FZM A;  1SV5 A;  1YXQ A;  1GC7 A;  1S1W A;  3HOS A;  3CCE N;  1CZB A;  2AEH A;  4JKH A;  1P90 A;  3DJC A;  1TUU A;  2V7Y A;  5AQL A;  3GL1 A;  1LV5 A;  2QWL A;  3MK6 A;  1EF1 A;  4BR9 A;  3LAN A;  3P5J A;  4AHS A;  4OKE A;  1NLV A;  3L3U A;  3ZT4 A;  5HP1 A;  4B1Y B;  3BF1 A;  4FM2 A;  5CHI A;  2ASP A;  1IV0 A;  4CHZ A;  5F0X A;  1SKS A;  3CFR A;  3PX0 A;  1L3T A;  5IWA K;  4BR5 A;  5KGW A;  4WYB A;  1UOC A;  2RHK A;  5AQZ A;  1O1W A;  1I3A A;  4EZ6 A;  4BRE A;  4LF8 K;  1N33 K;  4DF4 A;  3SZ2 A;  3EEQ A;  2FDQ A;  3MEC A;  1YTA A;  4CZG A;  4B3R K;  3NVK A;  4JAX A;  5KGX A;  4F4K A;  3ASM A;  1Q9X A;  4CJU A;  3KLG A;  1C1C A;  1ATR A;  1VSM A;  3V81 A;  4N41 A;  3VEN A;  4JD2 A;  4M42 A;  2XY6 A;  1P8Z A;  4CZF A;  1SZ2 A;  2OYQ A;  2CGL A;  3HPO A;  3OYM A;  4KV8 A;  1KVA A;  1RTI A;  3QFU A;  1RTH A;  3RRG A;  3E9P A;  5KQ8 A;  1W7A A;  4BRG A;  4Z4G A;  3C7N A;  4CF1 A;  3CQX A;  3J8A A;  3SQ0 A;  1L3U A;  3QIO A;  3CPW M;  3AVC A;  3ZET A;  3EE9 A;  4Y1C A;  1ITG A;  5M1N A;  4CJK A;  2CGJ A;  3CCV N;  4DTU A;  4NYN A;  2QW9 A;  5EXW A;  3AAQ A;  3C65 A;  4CFD A;  1U6Z A;  5C15 A;  3HP6 A;  2VG6 A;  1J53 A;  3LAL A;  4CE9 A;  3X23 A;  4FOE A;  4DV6 K;  1VQM N;  4DR2 K;  4ILH A;  4WFA L;  5DMR A;  3SMS A;  3AVJ A;  4F9O A;  2Q3S A;  1RT6 A;  3H3O B;  4PQU A;  1XMQ K;  1K8K B;  4ZHR A;  4FJI A;  4FOI A;  3O9T A;  5GAH P;  2I7N A;  4J2D A;  1KVC A;  4MDB A;  3RSE B;  1JJ2 M;  4FCY A;  5AZJ B;  5F1X A;  3QEI A;  4DV7 K;  4DQI A;  1SS6 A;  1NVL A;  3QIN A;  2GX9 A;  3I0R A;  4JNE A;  4BGB A;  1VSE A;  4IOX A;  5BR9 A;  3DXM A;  3EZW A;  3CET A;  5M1K A;  1IBM K;  1EXQ A;  2UYT A;  1NWK A;  1HNV A;  1ZC6 A;  1EWR A;  3QLH A;  3TTD A;  3THX B;  3FP5 A;  4FL9 A;  4EP5 A;  4FLV A;  1FK9 A;  1Y97 A;  2F8S A;  1JCE A;  3CJA A;  4MLH A;  1NJI O;  3V9S A;  1BWF O;  1GLE G;  4FJG A;  4ZRJ A;  1XHZ A;  4WE1 A;  2Z1I A;  3TR8 A;  1N36 K;  3OYI A;  2AJQ A;  3TSQ A;  4AH9 A;  5HL7 L;  4CF8 A;  3JXU A;  5IT9 O;  1BIZ A;  3QBX A;  2G8F A;  3EPY A;  1DTT A;  4KKO A;  2HMP A;  3OBY A;  1SGH A;  4C1N K;  3IMX A;  2IVP A;  5H1S Q;  3CJ9 A;  1NTI A;  4I2P A;  4BRP A;  3IKM A;  2J0K A;  1JL2 A;  2A6A A;  4JRQ A;  2O8F B;  1A5V A;  4Z4E A;  2B6A A;  2YNI A;  1GLA G;  1A5X A;  3OYH A;  2W42 A;  4JI0 K;  1K8A O;  3D45 A;  4WF9 L;  3E1Y A;  1NGA A;  3NAE A;  1VQ4 N;  4CES A;  2OZM A;  2W40 A;  4PY5 A;  4C23 A;  5AQS A;  2B4J A;  2IC3 A;  4A62 A;  2P9P A;  2QEX N;  3HBT A;  1BG3 A;  3ENH A;  1B92 A;  4CD3 A;  4EZ9 A;  3AGK A;  2YV0 X;  3MWT A;  4K43 A;  3WXJ A;  5A2Q O;  1DIK A;  3A5M C;  4O55 A;  3WXK A;  5JVL A;  2F7T A;  5ELZ A;  4KI6 A;  1O13 A;  5E26 A;  3WUH A;  4A2A A;  2X74 A;  1JLB A;  1H4R A;  5K14 A;  1Y19 B;  3DWL A;  1JLQ A;  2E1Y A;  2E4L A;  4CGF A;  1HPM A;  3E9L A;  3OYG A;  2HB5 A;  4ZRK A;  4FLX A;  2XY8 A;  3OYK A;  2NRR A;  2JWK A;  4JS5 A;  1JDE A;  5AQK A;  2ITM A;  1S1X A;  4CGI A;  4KH5 A;  3TAP A;  4YHH K;  2ZJR L;  3L3V A;  4FLW A;  1ISN A;  4CF9 A;  3L2W A;  2NUB A;  3PX4 A;  4BRF A;  1QZ5 A;  3ULD A;  4B08 A;  4BDP A;  1G99 A;  3CF5 L;  5LMN K;  3QFP A;  2QA4 N;  1YVN A;  3ZSR A;  1CZA N;  4BG8 A;  4IJN A;  1X9J A;  4KHS A;  1GLL O;  4LSL A;  3PO5 A;  4GW6 A;  5M1O A;  1S1V A;  2GEM A;  4CEC A;  1ZBS A;  2V52 B;  1QZ6 A;  1J5E K;  4A2B A;  1Z26 A;  4IG3 A;  3ZSO A;  4DTM A;  4CJ4 A;  4DFK A;  2PYL A;  5AQW A;  3MDQ A;  1WUA A;  4H8K A;  1RDB A;  4HVJ A;  3VES A;  3CCL N;  1NU0 A;  1E4G T;  2XY5 A;  4O8K A;  3MN5 A;  4DQR A;  1RBS A;  2P9U A;  3RWU A;  1MIX A;  2Y1I A;  4KHW A;  3J7Y P;  1S22 A;  1NKE A;  1I94 K;  4HCC A;  1GGO A;  2E6L A;  3THY B;  4CED A;  4PUO A;  4JK7 A;  2FC0 A;  1NK4 A;  3T69 A;  3PIO L;  4CGG A;  2E5L K;  2FSK A;  5HRS A;  3QDK A;  4NCA A;  1RDD A;  2IS3 A;  3VOV A;  5M1P A;  3F73 A;  1TV6 A;  3CJ7 A;  1TAU A;  1GLJ O;  1YJN N;  4B1Z A;  1LCU A;  3PVL A;  4QOZ B;  2RPI A;  3CHW A;  3HYF A;  3ULE A;  4LY7 A;  4FWO A;  2ZPY A;  4XH5 A;  4IEE A;  2IVO A;  4O8U A;  1Q18 A;  2D4W A;  5JIC A;  1KBL A;  1SKW A;  4OKK A;  3VQ7 A;  2E1Z A;  3OYB A;  2HMI A;  2E2Q A;  4IFE A;  5HOO A;  3VGM A;  2IAJ A;  1EO1 A;  3L8B A;  1NGG A;  4DUY K;  4FJJ A;  1C1A A;  3AA5 X;  1JCF A;  3OYF A;  1KVB A;  1QHT A;  4Z4I A;  4CBU A;  4ZTJ A;  4BRM A;  3TWH A;  2PFU A;  1WLJ A;  1X9S A;  4FJK A;  4IFY A;  1KLN A;  5KPZ A;  2PAV A;  3TAB A;  4J2A A;  3IFR A;  4RW6 A;  3Q7C A;  3HVT A;  4KRF A;  1KD1 O;  1NMD A;  4BC4 A;  2OPS A;  3L0Q A;  3ZT3 A;  1HRH A;  4BDY A;  2D10 A;  2NRT A;  1VSL A;  4FZY A;  4LC9 B;  4CJ7 A;  5IJM A;  2AP1 A;  4DR3 K;  2COP A;  2KW4 A;  3VA0 A;  3PZD A;  4JS4 A;  4EHT A;  4B1U B;  1U49 A;  3HPG A;  5LJV A;  3VEW A;  4CEZ A;  2Q36 A;  2ZJP L;  1YUW A;  5C12 A;  3CFO A;  1J5O A;  1S9E A;  3VQP A;  4X62 K;  1ASU A;  1L3S A;  4B9Q A;  1LWC A;  4CIG A;  3DOL A;  1B9D A;  4CEB A;  3T1Y K;  3SI6 A;  5KTQ A;  3TU5 A;  1NGD A;  4I6M B;  3C95 A;  3LZJ A;  3IRX A;  4JKE A;  4IBN A;  4EFH A;  4IWV A;  4HDQ A;  4J2E A;  3MCA B;  3V6D A;  1EQY A;  2Y1J A;  1WBD A;  3WT0 A;  2I1J A;  1RDW X;  3MEG A;  4X64 K;  4IJA A;  4YOV A;  2O8D B;  2D2Q A;  3MN7 A;  4CEE A;  4C8M A;  5CR4 A;  2GV9 A;  1QQN A;  2DFF A;  3UKR B;  5EU7 A;  3AVA A;  1MWM A;  4OGE A;  4K42 A;  3VF6 A;  1U2V B;  2BTF A;  4E0D A;  3LDQ A;  4FM1 A;  1WN7 A;  1ZBF A;  3QIP A;  3F9K A;  2YHY A;  4KRE A;  2FBY A;  4CGJ A;  1BQN A;  4W5O A;  3K59 A;  4QCL A;  1VRU A;  3AV9 A;  1JKH A;  2HNY A;  1NK8 A;  4FZX C;  5GAD P;  2HE7 A;  3AVI A;  4FLZ A;  2D0A A;  4JI6 K;  4RCH A;  3QML A;  4LH5 A;  5ADX H;  4CGH A;  1QVF M;  4IOC L;  2DFH A;  4BC5 A;  2WUS A;  3CM6 A;  4FWN A;  4DTP A;  4PA1 A;  5FPD A;  3H1V X;  3DLH A;  3WA0 A;  1U4B A;  1BI4 A;  1VQ8 N;  3OYD A;  5AR0 A;  1BL3 A;  2PBD A;  4ZRI A;  1NGB A;  4M3Z A;  1RDU A;  3O1W A;  4BWJ A;  1XHX A;  4TKN A;  5J1E A;  1VAZ A;  2X0S A;  4E7J A;  3IDH A;  3KLE A;  1V4S A;  2YHX A;  1HNI A;  3OYJ A;  3T1H K;  5BN8 A;  4DG1 A;  3JSM A;  4L8R B;  1YIJ N;  3DRP A;  2P9K B;  3AO2 A;  3I33 A;  3ATV A;  1EKE A;  4DV3 K;  4BVO A;  1NJX A;  3G9W A;  4LH4 A;  3O1B A;  1TK0 A;  4DV4 K;  1NJY A;  2O8B A;  4CW7 B;  1G15 A;  3HPH A;  4E7I A;  1HR0 K;  1NKC A;  3ISN C;  1GLB G;  3KZB A;  1TK8 A;  4LF9 K;  3HO1 A;  4QS7 A;  5AZJ A;  3G4S N;  4YOT A;  1BU6 O;  5AQV A;  3AVG A;  4BR2 A;  3EKU A;  1RBV A;  5C2D A;  4E1N A;  2HBM A;  1NBW A;  3CI5 A;  4H5V A;  5AQI A;  3HOT A;  3HRG A;  2RQ1 A;  4BDZ A;  4GVM A;  3EKS A;  3MN9 A;  3P1G A;  4H0X B;  4Q5V A;  2FBX A;  1D9F A;  1F21 A;  5BRE A;  3CIP A;  2P9L B;  1XNQ K;  5SZT A;  2Q97 A;  3LWL A;  4OVL A;  3O9Q A;  3UKU A;  4CJS A;  2HND A;  1GLD G;  4FLU A;  3EE8 A;  3SUQ A;  4CFC A;  3THV A;  4DLE A;  3LP2 A;  1HPZ A;  3H46 O;  4ELU A;  4FJH A;  3PY8 A;  2UUB K;  2OCE A;  4OO1 J;  3DAW A;  3ZX0 A;  2G8U A;  1HKG A;  3S3N A;  1NK5 A;  2FSJ A;  5AFU H;  1R59 O;  2NZT A;  1HLU A;  4C1N I;  1DT9 A;  1VBG A;  3KTQ A;  4JK9 A;  1LWF A;  1TK5 A;  5EOY A;  2IOC A;  4CZE A;  2OAN A;  2Q0U A;  3S41 A;  1BA0 A;  3O9R A;  1HNZ K;  4WFN L;  2BH1 A;  3WQT A;  2P9N B;  5FRN A;  4B9T A;  2KKZ A;  4RW9 A;  2I5J A;  4KHN A;  3M8Q A;  2FF6 A;  1MK7 B;  2CGK A;  3PSI A;  2J0J A;  5C0Y A;  2A41 A;  2X78 A;  3O4W A;  2HRJ A;  4GMJ B;  3NBP A;  1X9W A;  3IG1 A;  3SLC A;  3QER A;  3KHY A;  1J19 A;  4CZI A;  3DI6 A;  3AO5 A;  2XRI A;  4BRN A;  5BR8 K;  3T7Z A;  1QSS A;  3U7D A;  4DQQ A;  4LF6 K;  3VQ9 A;  1X9M A;  1VQN N;  2I1K A;  1HBK A;  3MWP A;  3TAN A;  1A5W A;  3EY1 A;  2G8H A;  4HUE A;  1HYV A;  3CCQ N;  2KFZ A;  3QNO A;  1GG3 A;  4FVM A;  3AO4 A;  2NRX A;  4AIL C;  3HK2 A;  4KPY A;  3OJS A;  2Q31 A;  3D0P A;  5AQY A;  2KFN A;  4B9N A;  3SQ2 A;  3FZL A;  4JYA K;  4EKU A;  4B8A B;  1IO2 A;  2HBJ A;  2ASO A;  4MFB A;  3V1Q A;  3NH0 A;  2R82 A;  5AQR A;  4XH4 A;  3O9S A;  2RF2 A;  4DMN A;  4CEO A;  3DXK A;  3CC4 N;  4DV0 K;  3V9U A;  3D2E B;  2W6L A;  2ZE2 A;  1BA1 A;  2Q2R A;  2A1S A;  3DMJ A;  4I2Q A;  2R7Y A;  2WC9 A;  3P31 A;  1HB6 A;  3VQ5 A;  3NMU A;  4BRA A;  1NK0 A;  1WNS A;  2RN2 A;  1GC6 A;  3UIQ A;  4OPJ A;  3SUN A;  3S9H A;  3U9D A;  4H0O A;  5BRD A;  3VTH A;  3MXM A;  3NF7 A;  2V51 B;  3QEV A;  3RMA A;  3HJF A;  2G8V A;  3BIN A;  1UAX A;  1LAV A;  4CEF A;  2P9S A;  3ZX2 A;  2FBV A;  3VGL A;  3G6E N;  5EVZ A;  4E1M A;  2ZD1 A;  4M63 C;  3HVR A;  1T44 A;  4FW1 A;  4CJV A;  1YVU A;  2HHS A;  4Z4H A;  4NLC A;  3AAP A;  3ZSX A;  1C0M A;  3ZSW A;  2KZZ A;  5KRT A;  3OHR A;  3QET A;  3B6O A;  3ZEU B;  4BRL A;  1BCO A;  3OW2 M;  3CC7 N;  1TGO A;  4E3S A;  1NGC A;  1C0U A;  4A5B A;  1JLF A;  3EZ5 A;  1YJW N;  4CJL A;  2QWP A;  1E3M A;  1QQM A;  5AQO A;  5HLF A;  1VQ7 N;  4R79 A;  4CJP A;  2YJE A;  4JI1 K;  5HBM A;  3QO9 A;  4BR4 A;  4DSE A;  1Q7Y O;  1VQ5 N;  4AM6 A;  2OA8 A;  5ADX A;  3VEZ A;  4BGA A;  2NRV A;  2D0C A;  3K57 A;  4HDO A;  3NFA A;  4DLG A;  4Z4C A;  2PY5 A;  4X65 K;  3AAR A;  1RNH A;  3NF6 A;  3ZYY X;  4CHQ A;  3MX5 A;  5DK5 A;  1RBU A;  4BE2 A;  3VQ4 A;  4WQ5 C;  2GWK A;  3F2K A;  1SQK A;  4GV9 A;  3TI0 A;  5LMU K;  1WSJ A;  3BZK A;  5FDL A;  3SV4 A;  4KHY A;  3THW A;  1KFS A;  2A3Z A;  4K41 A;  4FJ9 A;  4IEI A;  1D8Y A;  3U4L A;  4M3U A;  4JRP A;  3SYZ A;  4FJN A;  2DIK A;  3I56 N;  3FE1 A;  3WXI A;  1KAX A;  5F2R A;  3LAK A;  4FWL A;  4DTR A;  4JK8 A;  1KLM A;  2EX3 A;  5JMV A;  3ZSV A;  3CCU N;  3H45 C;  3JAM O;  2VG7 A;  4NB4 A;  1BUP A;  3MMV A;  3OS1 A;  1HJR A;  2VWB A;  3TAE A;  3BP8 A;  4PL7 A;  3V1R A;  4B3S K;  3CPE A;  3WEE B;  2OPR A;  5AQM A;  3D2F B;  3J81 O;  4FWR A;  4L3Q A;  4M3W A;  3HI0 A;  3SUO A;  1TUY A;  2H3G X;  4PKG A;  4B3T K;  1BHL A;  2X6S A;  1IJJ A;  1KCF A;  5BPN A;  4KHU A;  4DS4 A;  1BGX T;  1CZ9 A;  2UUA K;  4CZL A;  1FXX A;  4Z94 A;  3L2V A;  3TTF A;  3A5N C;  3D6R A;  2F9W A;  1MIZ B;  4IXC A;  1XC3 A;  4BE1 A;  3MXI A;  1Z05 A;  3ZT1 A;  1BCM A;  2G8I A;  3L2U A;  2HNZ A;  3FR0 A;  3KLF A;  2QWO A;  4MQ3 A;  3BF3 A;  2IIR A;  4BQZ A;  4JKF A;  1GLF O;  1HYZ A;  3O5B A;  3ZSQ A;  1RT3 A;  5AFU A;  3MAQ A;  2HBK A;  1FW6 A;  4FK4 A;  3A5O C;  4K0K K;  4JD2 B;  4B1X B;  4K8X A;  3CJC A;  4DTS A;  2G8K A;  1RT1 A;  4CFB A;  3LM2 A;  3OTO K;  4BRI A;  3VQC A;  1WSH A;  3AVH A;  3UKR A;  2CQU A;  1BO5 O;  1D5A A;  3G71 N;  4DSJ A;  3E01 A;  3QBW A;  1YF5 L;  3MX2 A;  2VCP A;  1X3M A;  5CZ2 A;  3C7N B;  4JI4 K;  2OTJ N;  4O5F A;  1W0H A;  4BQL A;  3TAM A;  1W9H A;  1IKW A;  1QHA A;  1YTU A;  2BUP A;  1NJW A;  4ELT A;  3QIJ A;  1X3N A;  2QWN A;  1OH6 A;  4BRC A;  4BC2 A;  1YT3 A;  3OS0 A;  4W5R A;  3RRH A;  3EL2 A;  1REV A;  4DTX A;  4BRH A;  2QK9 A;  4J2B A;  3W0L A;  3KWI A;  3SK3 A;  2YHB A;  4JKC A;  1JXB A;  1RBT A;  5M1F A;  1UA1 A;  5DM7 L;  2QKK A;  5AZI B;  4CYE A;  5J2P A;  1JXE A;  1L5U A;  4LF4 K;  1TKX A;  2D0P A;  3VF4 A;  3PIP L;  4CD1 A;  2VWJ A;  3CJB A;  2AA4 A;  3FLC O;  3SMP A;  3CJ1 A;  4JEP A;  1FKP A;  2KZM A;  3W3D A;  1T05 A;  1T3V A;  3DLE A;  3S3M A;  5MLC Q;  4C8L A;  3WXM B;  3AVK A;  1YJ9 N;  3DXM B;  4LFB K;  4FJ8 A;  4CFA A;  4JHD B;  4CER A;  3VEX A;  3BUZ B;  4DS5 A;  1IBL K;  2DTU A;  4PKI A;  4FPB A;  2AL6 A;  4UY8 O;  1IG8 A;  2E8A A;  2WTU A;  4Q0B A;  1Z25 A;  1HKC A;  3H08 A;  5TKW A;  1XNR K;  4F7G A;  4I7F A;  3H1Q A;  1J54 A;  5GIP A;  4B9M A;  1VSK A;  1N8R O;  3LDS A;  1RTD A;  3HT3 A;  1HX1 A;  3FZH A;  4NXN K;  3ITH A;  4JKD A;  4FK0 A;  3CCR N;  2XY7 A;  3KWG A;  4WQ5 A;  4GV6 A;  1FJG K;  1RDA A;  2E2P A;  4ID1 A;  5GAG P;  1XMO K;  3MCP A;  1S6Q A;  3ZCM A;  4DXA B;  3BDP A;  2UXC K;  2HBL A;  1Q81 O;  2HF4 A;  1HQE A;  4E7L A;  2F8T A;  3LAM A;  3CMA N;  1KC7 A;  4QS9 A;  1JLE A;  3VQQ A;  2O8C B;  3KIO A;  3KK2 A;  4ISF A;  4CIF A;  2IVN A;  1TYQ B;  5KPT A;  2WFB A;  3BEX A;  3CME N;  3C6H A;  3DOK A;  3LZI A;  2Q0R A;  2KTQ A;  1VRT A;  4M7X A;  3JYT A;  3P39 A;  2P9P B;  2KLA A;  2EHG A;  1N5Y A;  5T7B A;  2P9I B;  3DYA A;  3ZX3 A;  4IOA L;  4DU4 A;  4FWQ A;  4CEA A;  5SWM A;  3EO3 A;  1RTJ A;  4OLA A;  4RG8 A;  3LDP A;  4M3R A;  4BWM A;  4QAG A;  3CXC M;  2GBZ A;  4JKB A;  4FWM A;  1KSP A;  1CXU A;  3WNG A;  3AA4 A;  3C6T A;  2DFE A;  4JKG A;  3E9O A;  1D9D A;  3C6A A;  4GY2 B;  1V4T A;  3NE6 A;  1XI1 A;  1JL1 A;  2UXB K;  5BPL A;  3KVG A;  3K58 A;  1ATS A;  4AHU A;  4H0P A;  2O8E B;  4MLE A;  4NXM K;  4CHP A;  2A42 A;  5J2Q A;  3NGI A;  1E4F T;  5BRH A;  3WNE A;  3RTV A;  3C0B A;  5KI6 A;  3ZLJ A;  4DKW A;  1NK9 A;  3NVM A;  3ZDT A;  3K0S A;  4IDH A;  1FKO A;  4YFU A;  4F3O A;  4B1V A;  1DLO A;  5LY3 A;  4B9U A;  3TSU A;  2ETJ A;  3TPQ A;  2NRZ A;  4BAC A;  1Q9Y A;  4LF5 K;  4CZH A;  4Z4F A;  2KQ2 A;  4BR7 A;  3RR8 A;  5BN9 A;  3O08 A;  3O3F A;  4KO0 A;  2XO7 A;  4ILG B;  3TAQ A;  2FSN A;  3DLB A;  1JCG A;  3HP9 A;  3RVC A;  1HB8 A;  3UB5 A;  4EIA A;  1ST7 A;  3OYN A;  4J8F A;  1OH7 A;  2DPN A;  4CBX A;  4BRD A;  1ZBL A;  4FVU A;  3SAF A;  4BR0 A;  2E2O A;  2RKI A;  1BIS A;  5JLF A;  1DEJ A;  3SQ4 A;  4KTQ A;  5C24 A;  2HHW A;  1MK9 B;  1RGI A;  1WAJ A;  3MN6 A;  4YNQ A;  1NKB A;  3HSC A;  4M3X A;  3LM9 A;  1TL1 A;  2D5R A;  1EET A;  4E19 A;  2W6K A;  4YOY A;  2BE2 A;  3SBG A;  4FJL A;  1HYS A;  4CK3 A;  5AQF A;  5JVH L;  3ENB A;  5FPM A;  4Y1D A;  5I9E B;  1BQM A;  4E7K A;  4DR1 K;  3BY5 A;  4FLY A;  4WCE L;  1K8K A;  1VSH A;  3HM8 A;  5BPM A;  4FW2 A;  1MDU B;  4V19 S;  3LL3 A;  3LP3 A;  5KRS A;  4GV3 A;  4XH1 A;  4ICL A;  3TAG A;  1K6Y A;  3VQD A;  4DR6 K;  3RSE A;  2O4G A;  4H03 B;  1NGJ A;  2B5J A;  1GOA A;  1T03 A;  1TVR A;  2IGI A;  3SPZ A;  4H5W A;  5LL6 Z;  3I55 N;  4DU1 A;  1KRP A;  5AQX A;  2G8W A;  2CB8 A;  4P7I A;  4CJF A;  1M90 O;  5AQN A;  1IH7 A;  3LP0 A;  4KI4 A;  3I8D A;  3QEX A;  1KAZ A;  2QWM A;  3THX A;  2HHT A;  4IG0 A;  4CHN A;  5FRO A;  2ZM6 K;  2VQE K;  4DR4 K;  3ID6 A;  5E41 A;  4IO8 A;  4KH6 A;  3WXL A;  3NDK A;  4GKJ K;  3U3Y A;  4WQ4 C;  1HNX K;  3VQA A;  3DLG A;  3L6Q A;  3M8P A;  2D0O A;  4GKK K;  2NRW A;  4FM0 A;  4DV5 K;  3G10 A;  3AO1 A;  5CYM A;  4DQP A;  3QIC A;  5CY4 A;  4DV2 K;  2GUP A;  1LW2 A;  3V4I A;  1DTQ A;  2WON A;  1C0G A;  4KBO A;  3GBT A;  2HW3 A;  1GOC A;  4JI7 K;  1GLC G;  4LSN A;  5B8H A;  4TSX A;  3AVM A;  1BIU A;  2WOM A;  5GAE P;  3RMB A;  4PHT X;  4CHY A;  3OS2 A;  2O8F A;  4QS8 A;  3SNN A;  4CJQ A;  4O0J A;  3SCX A;  1VQ6 N;  3O80 A;  1C0T A;  3BGR A;  4GNI A;  3UE5 A;  3VF2 A;  3M3Z A;  4KHP K;  3NGZ A;  4YOX A;  1YAG A;  2YX6 A;  4LD0 A;  3R9P A;  5AQQ A;  5AQH A;  4B9S A;  1KQS M;  1N6Q A;  3AGR A;  4CF2 A;  2O4I A;  4M7Y A;  3HXM A;  2UXD K;  1NJZ A;  3VGK A;  3D2F A;  5C10 A;  4DFM A;  1NK7 A;  1TL3 A;  5EY4 A;  2XHB A;  2PZS A;  3I8B A;  3TAR A;  4AHV A;  4JKA A;  3R6M A;  1NK6 A;  4W5Q A;  4CJW A;  3NH1 A;  4E7H A;  1W97 L;  4YDU C;  1VQ9 N;  1L3V A;  3T3F A;  3KLH A;  3O4Q A;  3NH2 A;  2RE2 A;  4GXB A;  3CG7 A;  3QB0 A;  4KTW A;  1NOY A;  4FJM A;  1J6Z A;  5I3U A;  1WSI A;  2OTL N;  2QXL A;  3A5L C;  2W41 A;  3MXJ A;  4DF8 A;  4DFJ A;  4B8C A;  4B9L A;  4FXD A;  1RIL A;  2ITG A;  2FBT A;  4CGD A;  2FLO A;  3OVN A;  3OYL A;  4ID5 A;  3TSP A;  2VYP A;  1Q8I A;  2JLE A;  5C42 A;  1RDC A;  3GOI A;  5JLH A;  1BI4 B;  4M3T A;  1QE1 A;  3R1X A;  4M3Y A;  1WOQ A;  4A57 A;  1VQP N;  4YL8 A;  2UU9 K;  4C8O A;  1EX4 A;  1NGF A;  1XQS C;  1UWB A;  4I9L A;  3QES A;  5HRP A;  4CJR A;  4EP4 A;  3QNN A;  4W5T A;  4AM7 A;  4I9Q A;  5DM6 L;  3CCJ N;  2Z1H A;  5M1Q A;  1U48 A;  3HTV A;  3DRS A;  4BC3 A;  4PKH A;  3ZSY A;  2F4V K;  3KK3 A;  2VQF K;  1LWE A;  1ATN A;  2QTD A;  4LFA K;  4JI8 K;  2O8B B;  3U9Z A;  3VMF B;  3CQY A;  5AZI A;  3IUC A;  1XUP O;  3LP1 A;  1NI2 A;  3H6E A;  1MU2 A;  3THY A;  1YHQ N;  4E1J A;  1K73 O;  4FK2 A;  2A5X A;  4JV5 K;  4YOU A;  4G9Z A;  4GVE A;  2ABD A;  2GTD A;  1GOB A;  4RW4 A;  4CZM A;  2YI1 A;  4AQY K;  2D11 A;  4JHD A;  3OYA A;  1VQO N;  3K2P A;  2QXF A;  4FPA A;  4CJE A;  3U8Z A;  4B1W B;  1U45 A;  1S6P A;  4IFV A;  3VEV A;  2DY4 A;  2J4R A;  4WQ4 A;  2QM1 A;  4H0V B;  4FJX A;  1N34 K;  4ISG A;  4WFB L;  1S1T A;  3A8Y A;  4Z0U A;  1VQK N;  2HST A;  1VBH A;  3UKU B;  4IKF A;  4DSI A;  1QQO A;  4DCH A;  3M5R A;  1VSF A;  1MWK A;  4CEQ A;  2FXU A;  2YNH A;  1WSF A;  4DR5 K;  3ZT0 A;  3RMD A;  1XC9 A;  1OVQ A;  4BY9 C;  4ILJ A;  3P38 A;  1S5J A;  4IZ9 A;  3AA3 A;  5HRN A;  1S3X A;  3O3G A;  2A40 A;  2HF3 A;  4H4O A;  2VG5 A;  3Q7B A;  3VQ8 A;  4FJ5 A;  1J9A A;  1ZBU A;  1RFQ A;  3NF9 A;  3K9J A;  4JI2 K;  4A59 A;  4C8N A;  2J0M A;  4H0Y B;  1NM1 A;  2NRH A;  4K25 A;  1WSE A;  3AA2 A;  3LPT A;  4MO5 A;  2YNF A;  4DU3 A;  5D3G A;  1TAQ A;  3DM2 A;  3CCM N;  1OKJ A;  1E5W A;  1SKR A;  3VA3 A;  4DB3 A;  3SUP A; 
#chains in the Genus database with same CATH homology
 3WA0 A;  5GIP A;  1N8R O;  4BRO A;  4BR5 A;  2ZJQ L;  3CD6 N;  4WYB A;  1HX1 A;  1VQ8 N;  5FPN A;  2RHK A;  5AQZ A;  3FZH A;  2PBD A;  5AR0 A;  4ZRI A;  1NGB A;  4MO4 A;  4JKD A;  1RDU A;  3O1W A;  3CCR N;  4BRE A;  1LOT B;  4TKN A;  3KWG A;  4WQ5 A;  4GV6 A;  1TYQ A;  1VAZ A;  2FDQ A;  2X0S A;  3M1F A;  2E2P A;  4CZG A;  3IDH A;  3NVK A;  1V4S A;  4JAX A;  5GAG P;  2YHX A;  3VPZ A;  3MCP A;  3FLV A;  5BN8 A;  1ATR A;  3VEN A;  1YIJ N;  4JD2 A;  4DXA B;  2P9K B;  2EMT A;  3I33 A;  2HBL A;  3ATV A;  1Q81 O;  4BRQ A;  1Z6R A;  1P8Z A;  2HF4 A;  1SZ2 A;  2P9I A;  4BVO A;  4CZF A;  2CGL A;  3G9W A;  3QFU A;  3DLL L;  3O1B A;  3E9P A;  2E2N A;  1KC7 A;  3CMA N;  2YCH A;  4QS9 A;  5KQ8 A;  4BRG A;  5E84 A;  4I6M A;  3C7N A;  3CQX A;  4ISF A;  1Q86 O;  1M1K O;  3J8A A;  3OBW A;  4YDU A;  2IVN A;  1TYQ B;  5AQP A;  5KPT A;  1GLB G;  2WFB A;  4FWK A;  3KZB A;  3CPW M;  3BEX A;  3CME N;  3ZET A;  3C6H A;  3AU4 A;  1Y64 A;  3EE9 A;  4QS7 A;  5AZJ A;  4NY0 A;  1ILY A;  2Q0R A;  3CCV N;  5M1N A;  3G4S N;  2CGJ A;  4YOT A;  1HKB A;  2QW9 A;  5EXW A;  1BU6 O;  5AQV A;  3AAQ A;  3C65 A;  1U6Z A;  3GDQ A;  4M7X A;  4BR2 A;  3EKU A;  5C15 A;  3P39 A;  2P9P B;  5C2D A;  1KAY A;  2HBM A;  2KLA A;  1NBW A;  4HWI A;  1T6C A;  3X23 A;  2P9I B;  4FOE A;  1VQM N;  3CI5 A;  5GIN A;  3DXK B;  3M6G A;  4ILH A;  4H5V A;  5AQI A;  4WFA L;  3ZX3 A;  3HOT A;  2YJF A;  3HRG A;  3SMS A;  4IOA L;  2RQ1 A;  4F9O A;  5KPR A;  3H3O B;  3EKS A;  1K8K B;  3MN9 A;  2FF3 B;  3FZF A;  4FOI A;  4H0X B;  3VEY A;  4FWQ A;  1ACA A;  3EO3 A;  3O9T A;  5BRE A;  5GAH P;  1U2V A;  2I7N A;  2P9L B;  2QWQ A;  3CIP A;  3LDP A;  3CXC M;  4JKB A;  4FWM A;  4MDB A;  2Q97 A;  3RSE B;  1JJ2 M;  4PL8 A;  4YOR A;  3ZET B;  5AZJ B;  5F1X A;  1W2B M;  3O9Q A;  3UKU A;  1GLD G;  1SS6 A;  4JKG A;  3EE8 A;  1H1V A;  1NVL A;  3E9O A;  4IO9 L;  3C6A A;  4GY2 B;  2GX9 A;  4BG9 A;  4JNE A;  1V4T A;  4BGB A;  3H46 O;  5BPL A;  1Q82 O;  4IOX A;  4OO1 J;  5BR9 A;  3DXM A;  3EZW A;  3CET A;  3KVG A;  5M1K A;  2UYT A;  1ATS A;  3DAW A;  1NWK A;  3ZX0 A;  4H0P A;  1QVG M;  2KHO A;  2P9S B;  1HKG A;  1ZC6 A;  4MLE A;  3O6W A;  4FWP A;  1BDG A;  2FSJ A;  2A42 A;  5AFU H;  3TTD A;  3FP5 A;  4FL9 A;  1E4F T;  5BRH A;  1R59 O;  3C0B A;  2NZT A;  2QWR A;  2F9T A;  1HLU A;  4C1N I;  1DT9 A;  4DKW A;  1VBG A;  1JCE A;  3CJA A;  4JK9 A;  3VEO A;  4MLH A;  3NVM A;  1NJI O;  5EOY A;  4CZE A;  2OAN A;  3ZDT A;  2Q0U A;  1BWF O;  1GLE G;  4IDH A;  3S41 A;  3CCS N;  4FO0 A;  4B1V A;  1BA0 A;  4ZRJ A;  3O9R A;  4WFN L;  2BH1 A;  3VTI A;  2P9N B;  3WQT A;  5LY3 A;  2KKZ A;  3TSU A;  3LDN A;  3K9K A;  3TPQ A;  3TSQ A;  2WBN A;  3VER A;  5HL7 L;  3JXU A;  2NRZ A;  2FF6 A;  4CZH A;  1MK7 B;  3QBX A;  2CGK A;  2J0J A;  5C0Y A;  2A41 A;  3O4W A;  2HRJ A;  4BR7 A;  3EPY A;  1C0F A;  5BN9 A;  3O08 A;  3SLC A;  4BVP A;  3KHY A;  1J19 A;  4CZI A;  2HMP A;  3OBY A;  1SGH A;  4ILG B;  4C1N K;  4BRN A;  3IMX A;  2FSN A;  4RTF D;  5AQU A;  3T7Z A;  1JCG A;  3U7D A;  2IVP A;  3RVC A;  1HB8 A;  3UB5 A;  2P9K A;  4EIA A;  2I1K A;  1HBK A;  3MWP A;  5H1S Q;  1ST7 A;  3CJ9 A;  1VQN N;  1NTI A;  4J8F A;  4BRP A;  3IKM A;  2J0K A;  2DPN A;  4CBX A;  2A6A A;  3CCQ N;  4BRD A;  4CI6 A;  4FVU A;  3SAF A;  4BR0 A;  1NGH A;  2E2O A;  1GG3 A;  5JLF A;  1DEJ A;  2NRX A;  2FJ9 A;  1GLA G;  1MK9 B;  3KK7 A;  3ATU A;  4DHY A;  1RGI A;  2Q31 A;  4WF9 L;  5AQY A;  3MN6 A;  1K8A O;  3E1Y A;  1NGA A;  2NLX A;  3HSC A;  1DGK N;  3LM9 A;  1VQ4 N;  3FZL A;  2D1K A;  4EKU A;  4U67 L;  5KQD A;  5LJW A;  4YOY A;  2W40 A;  3SBG A;  2HBJ A;  2ASO A;  1NGE A;  1KXP A;  4C23 A;  5AQS A;  2R82 A;  2GWJ A;  4H5T A;  5AQR A;  5AQF A;  4A62 A;  1YIT N;  2P9P A;  2QEX N;  4XH4 A;  2ZWH A;  3ENB A;  1BG3 A;  3ENH A;  3HBT A;  5FPM A;  5I9E B;  3O9S A;  5JVG L;  4CD3 A;  3B8A X;  3DXK A;  3CC4 N;  3WQU A;  3FZK A;  3FGU A;  3D2E B;  3AGK A;  1BA1 A;  2Q2R A;  3MWT A;  4K43 A;  3WXJ A;  1DIK A;  3A5M C;  1NGI A;  4WCE L;  1K8K A;  3HM8 A;  5BPM A;  2WC9 A;  3WXK A;  5JVL A;  1MDU B;  3P31 A;  2F7T A;  1HB6 A;  3LL3 A;  5ELZ A;  2P9L A;  4GV3 A;  4XH1 A;  1O13 A;  3F5T A;  5E26 A;  3WUH A;  3NMU A;  4BRA A;  1VQK N;  4A2A A;  3CER A;  3RSE A;  1GC6 A;  1H4R A;  3GG4 A;  4H03 B;  1Y19 B;  1NGJ A;  3U9D A;  3DWL A;  2E1Y A;  4H0O A;  5BRD A;  3VTH A;  2V51 B;  4U7B A;  4H5W A;  1HPM A;  3E9L A;  1HUX A;  3TTC A;  3AU5 A;  3GE1 A;  2ZF5 O;  3I55 N;  4ZRK A;  4H5R A;  5AQX A;  2CB8 A;  1MA9 B;  4P7I A;  1M90 O;  5AQN A;  3ID8 A;  1S72 N;  3BIN A;  3ENO A;  2NRR A;  2P9S A;  1KAZ A;  3ZX2 A;  2QWM A;  3VGL A;  3G6E N;  5EVZ A;  2JWK A;  4M63 C;  3J7Z O;  3R3L A;  1JDE A;  4MDA A;  1T44 A;  5AQJ A;  5AQK A;  2ITM A;  1VQL N;  3ID6 A;  4AF1 A;  5AQT A;  4IO8 A;  4KH6 A;  3WXL A;  2ZGZ A;  4KH5 A;  4WQ4 C;  4RWT A;  3VET A;  4NLC A;  1ZXO A;  3AAP A;  4H0T B;  2P9N A;  2ZJR L;  1ISN A;  3L6Q A;  2D0O A;  2NRW A;  3OHR A;  3ZEU B;  4BRL A;  4BRF A;  1QZ5 A;  3OW2 M;  3CC7 N;  5TKY A;  1NGC A;  3QIC A;  1KC8 O;  2GUP A;  4A5B A;  1G99 A;  3CF5 L;  1YJW N;  3QFP A;  2QWP A;  2QA4 N;  1YVN A;  1QQM A;  5AQO A;  1VQ7 N;  1C0G A;  4R79 A;  4KBO A;  1CZA N;  2YJE A;  3AY9 A;  3GBT A;  2E88 A;  4IJN A;  1X9J A;  4BG8 A;  4BR4 A;  1Q7Y O;  1GLC G;  1VQ5 N;  2YHW A;  4AM6 A;  5ADX A;  1GLL O;  4H5N A;  2NRV A;  4KH4 A;  3D7E O;  5M1O A;  3VEZ A;  4BGA A;  5B8H A;  3HZ6 A;  2GEM A;  4HDO A;  1ZBS A;  2ASM A;  2LBB A;  2V52 B;  1QZ6 A;  5GAE P;  4A2B A;  4PHT X;  4QS8 A;  5AQW A;  3MDQ A;  1WUA A;  3AAR A;  1VQ6 N;  3O80 A;  3H3N O;  3VES A;  3CCL N;  1YI2 N;  1E4G T;  4GNI A;  3ZYY X;  3UE5 A;  3VF2 A;  1DKG D;  3MX5 A;  3M3Z A;  2EWS A;  2WH5 A;  3MN5 A;  4O8K A;  2P9U A;  3OA9 A;  4YOX A;  4HTL A;  1YAG A;  2NNW A;  1MIX A;  2YX6 A;  3R9P A;  5AQQ A;  5AQH A;  1S22 A;  2GWK A;  4WQ5 C;  1KQS M;  3F2K A;  4OPH A;  4FSV A;  4A5A A;  1SQK A;  4GV9 A;  1GGO A;  3JS6 A;  3LDO A;  3AGR A;  3CC2 N;  4JK7 A;  4M7Y A;  3FFK B;  2HOE A;  3U8X A;  2A3Z A;  3D2F A;  3VGK A;  5C10 A;  3T69 A;  5EY4 A;  3PIO L;  4K41 A;  4IEI A;  3PLA A;  3U4L A;  3D2E A;  2V7Z A;  2FSK A;  3QDK A;  4NLB A;  3E66 A;  3VOV A;  5M1P A;  2DIK A;  3CJ7 A;  3I8B A;  1GLJ O;  3I56 N;  4B1Z A;  1YJN N;  3FE1 A;  1LCU A;  3PVL A;  3WXI A;  1KAX A;  4JKA A;  5F2R A;  3R6M A;  4FWL A;  5BRF A;  2P9U B;  1K9M O;  4JK8 A;  3CHW A;  2Q1N A;  1HJO A;  5JMV A;  3CCU N;  3H45 C;  3ULE A;  1W97 L;  3SAH A;  4FWO A;  4YDU C;  1VQ9 N;  2ZPY A;  2CH6 A;  2ZGY A;  3H1V X;  4NB4 A;  4XH5 A;  3F9M A;  1BUP A;  3MMV A;  4FWS A;  4IEE A;  2IVO A;  1T6D A;  4O8U A;  1Q18 A;  2D4W A;  4NO7 A;  2VWB A;  1KBL A;  3SJH A;  5JIC A;  2VGN A;  3BP8 A;  4PL7 A;  3O9U A;  2E1Z A;  3CPE A;  3WEE B;  2E2Q A;  2I7P A;  2RE2 A;  4GXB A;  4IFE A;  5AQM A;  3D2F B;  3QB0 A;  3VGM A;  5HOO A;  1EO1 A;  4CZJ A;  4FWR A;  4L3Q A;  1NGG A;  3HI0 A;  1J6Z A;  3SAG A;  3P4I A;  2OTL N;  3SBT A;  1JCF A;  1TUY A;  2H3G X;  2QXL A;  3A5L C;  2W41 A;  4PKG A;  3IVF A;  4CBU A;  4BRM A;  1IJJ A;  2PFU A;  2QI2 A;  5EX5 A;  5BPN A;  3N4P A;  5KPZ A;  4CZL A;  2CH5 A;  2PAV A;  2FLO A;  4Z94 A;  3IFR A;  3TTF A;  3A5N C;  3TSP A;  3ULE B;  3Q7C A;  4JN4 A;  2VYP A;  2VGM A;  5JVH L;  3D6R A;  1KD1 O;  1NMD A;  4BC4 A;  3L0Q A;  2F9W A;  3L4Q A;  5AQG A;  1MIZ B;  2D10 A;  4IXC A;  3GOI A;  1XC3 A;  5JLH A;  2NRT A;  5GIO A;  1Z05 A;  3ZEU A;  3R1X A;  4BRK A;  1WOQ A;  4LC9 B;  4A57 A;  4YL8 A;  4CJ7 A;  1VQP N;  3LDL A;  3FR0 A;  5IJM A;  2AP1 A;  1NGF A;  1XQS C;  1D4X A;  4DQ8 A;  2COP A;  2QWO A;  3BF3 A;  2IIR A;  4BQZ A;  4A61 A;  3PZD A;  4JKF A;  1GLF O;  4OPA A;  4B1U B;  4EHT A;  3O5B A;  4AM7 A;  3N4Q A;  5LJV A;  5DM6 L;  3CCJ N;  3VEW A;  5M1Q A;  5AFU A;  2Q36 A;  2HBK A;  2ZJP L;  5CE3 A;  1YUW A;  5C12 A;  3A5O C;  3HTV A;  4JD2 B;  4B1X B;  4BC3 A;  3CJC A;  1SAZ A;  4PKH A;  4DCH A;  3LM2 A;  4B9Q A;  4EAH D;  4BRI A;  1ATN A;  3UKR A;  4XEI A;  2CQU A;  1BO5 O;  2QTD A;  3G71 N;  2YVC A;  3EN9 A;  3QBW A;  3G25 A;  1YF5 L;  3MX2 A;  3TU5 A;  2VCP A;  1NGD A;  3O8M A;  1X3M A;  4I6M B;  3C7N B;  2OTJ N;  4O5F A;  3U9Z A;  4CBW A;  3VMF B;  1OVY A;  3CQY A;  5AZI A;  3IUC A;  4JKE A;  1XUP O;  4BQL A;  1QHA A;  1NI2 A;  3H6E A;  4EHU A;  3R8E A;  4EFH A;  2BUP A;  4IWV A;  4HDQ A;  3QIJ A;  3MCA B;  2EMS A;  1EQY A;  4E1J A;  4YOW A;  3WT0 A;  1X3N A;  4CZK A;  2I1J A;  2QWN A;  1YHQ N;  1K73 O;  1RDW X;  2A5X A;  4IJA A;  4YOV A;  2D2Q A;  2GEL A;  3MN7 A;  4BRC A;  4YOU A;  4BC2 A;  4G9Z A;  1ESV A;  1BOT O;  4GVE A;  2JWL A;  5CR4 A;  2ABD A;  2GTD A;  1QQN A;  3EL2 A;  4BRH A;  4CZM A;  3UKR B;  2YI1 A;  3W0L A;  2D11 A;  4JHD A;  3KWI A;  3SK3 A;  1VQO N;  1MWM A;  4JKC A;  4FPA A;  4K42 A;  5M1F A;  3U8Z A;  4B1W B;  4Y0W A;  3VF6 A;  5C2F A;  1U2V B;  2BTF A;  3VEV A;  5DM7 L;  5AZI B;  4CYE A;  2J4R A;  3LDQ A;  4WQ4 A;  2QM1 A;  4H0V B;  3A0I X;  2YHY A;  4ISG A;  4WFB L;  2D0P A;  3A8Y A;  3VF4 A;  3PIP L;  3L4I A;  4CD1 A;  2HST A;  1VBH A;  2AA4 A;  3CJB A;  3UKU B;  5FPE A;  3FLC O;  4ISE A;  1QQO A;  2E20 A;  3SMP A;  4JKG B;  3CJ1 A;  4JEP A;  1YXQ A;  3FZM A;  3M5R A;  3WEE A;  1GC7 A;  1MWK A;  3HOS A;  2FXU A;  3CCE N;  4BY9 C;  2AEH A;  5GAD P;  4ILJ A;  3P38 A;  2HE7 A;  4JKH A;  1T3V A;  4IZ9 A;  1P90 A;  3W3D A;  5MLC Q;  1S3X A;  3DJC A;  3WXM B;  1TUU A;  2V7Y A;  2A40 A;  5AQL A;  2HF3 A;  3GL1 A;  3DXM B;  1YJ9 N;  2QWL A;  3MK6 A;  3Q7B A;  1EF1 A;  1RFQ A;  4JHD B;  3VEX A;  3BUZ B;  4BR9 A;  3K9J A;  3QML A;  4RCH A;  4PKI A;  4A59 A;  4FPB A;  2AL6 A;  2J0M A;  1NM1 A;  1NLV A;  2NRH A;  4H0Y B;  4K25 A;  4UY8 O;  1IG8 A;  2E8A A;  4B1Y B;  5ADX H;  3BF1 A;  4MO5 A;  5CHI A;  4IOC L;  1QVF M;  2ASP A;  1HKC A;  4BC5 A;  5TKW A;  5F0X A;  2WUS A;  3CCM N;  1OKJ A;  4FWN A;  1E5W A;  5FPD A;  4F7G A;  4DB3 A;  3H1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...