4JK7A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk7A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk7A01
3E66A 3SBGA 4JK8A 4JK7A 4ILJA 4JKAA 3E9OA 4ILHA 4JKBA 4JKGB 4JKGA 4ILGB 4JKCA 3E9LA 3E9PA 3ENBA 4JKDA 4JK9A 4JKHA 4JKFA 4JKEA 3SBTA
chains in the Genus database with same CATH superfamily
3J7AP 3VGMA 4B9NA 4ZRKA 3ZSVA 1BL3A 3H6EA 2YHAA 3AY9A 1VRUA 4OX9K 1S3XA 4BC5A 4KHSA 5C10A 1ZBFA 3RMAA 1V4SA 1D4XA 2HNZA 1YF5L 5AQRA 4E3SA 2OYQA 4CGHA 2HNYA 3ID6A 2HF4A 3O3GA 5LL6Z 4WQ5A 3WXKA 5JS2A 4AQYK 2B6AA 1NM1A 3CQXA 4ZRIA 4C8MA 1KC7A 2IVOA 3H1VX 4L3QA 1X9SA 5BREA 1K8KB 1ZBHA 3AVCA 4BR0A 3HOSA 1JKHA 2FBYA 2J0JA 4KH6A 2ZJQL 3WXMB 3TAGA 3LP3A 4PQUA 2KKZA 3VQEA 4FWMA 4B3MK 2ZD1A 2HHVA 1VQPN 3SUOA 4IG3A 3I8DA 2P9LB 3AVLA 1NK6A 3F73A 4B9TA 3M8PA 1S9GA 3DLHA 2UUCK 1YXQA 5MLCQ 2PAVA 1Q86O 3SYZA 1Z05A 4BR2A 4JKGA 1Q81O 4M3RA 4B9MA 4IOAL 1KVAA 1P90A 4WQ4A 1BISA 4YOWA 1TK8A 3VEYA 3IMXA 4RWTA 5M1PA 3T69A 5A2QO 1HQEA 3VMFB 3D2FA 2P9LA 2BANA 4CVNE 3LDSA 3CHWA 2O8CA 3U7DA 2COPA 3THXA 4YNQA 1OH7A 1RT4A 3AAQA 3V1OA 4AH9A 4JK7A 3CMEN 3AA5X 2OTLN 2KTQA 5EX5A 4XH4A 2YHYA 4IFYA 1NJXA 2OA8A 2KLAA 4DXAB 1Z25A 3M8QA 4H4MA 4M3ZA 4CJVA 2DFEA 3HM9A 3WXLA 1J53A 4LF4K 1VSIA 2FXUA 1YIJN 2XHBA 4CJ4A 3T1HK 3AVAA 1K8KA 3CERA 3TTFA 4E7JA 1NGIA 5HL7L 4DQSA 2HW3A 5KQ8A 1Q7YO 3ZSWA 1C0MA 2UXCK 1WLJA 2ZWHA 3KD5E 1LCUA 3SQ1A 1YI2N 3BP8A 4M3UA 2P9UA 2I1KA 4KFBA 4FJNA 5AQGA 3CIPA 3V1RA 4B8CA 4PY5A 1S6QA 3TAPA 4O5FA 4CGFA 4CJFA 1LWFA 4FLUA 2GELA 1SL2A 1ISNA 4NCAA 1CZBA 5HRNA 2P5OA 3AGRA 3AVIA 4MO4A 3SCXA 2I5JA 1TVRA 1IBMK 1SKWA 4O44A 4KHNA 5CZ1A 4TSXA 1Y64A 5SWMA 3VQ4A 2BUPA 5C25A 3T1AA 1MIXA 4WFNL 3D0PA 2FDQA 3P38A 3KHYA 4CJRA 4CBUA 4O0IA 4E1MA 5CYQA 2EMSA 2HBLA 4BE1A 2V51B 4EP4A 2YJFA 3J7ZO 4IEEA 3TSUA 1UAXA 2RQ1A 3OYAA 3E9OA 4O0JA 1Q82O 2HMIA 3ISNC 1WSJA 1Q18A 1HX1A 3LDOA 1DIKA 1QZ6A 3TU5A 1Z6RA 1T7PA 3ZX2A 4FM1A 4E19A 4IZ9A 1NNEA 4BRQA 3DLRA 3SV4A 5AQZA 3AO2A 4H0YB 4CF9A 4BACA 1QVFM 5FDLA 4BRGA 4CYEA 3TAQA 3VTIA 4LF5K 3SJHA 3IAYA 1NLVA 3WXIA 3ZT1A 4MO5A 1OH5A 1HNXK 3LM9A 3NH2A 3NDKA 3E01A 2P9PB 3E9LA 4FK0A 3A0IX 3J80O 1B9FA 1RDCA 3CM6A 3LZIA 3QO9A 3CJ1A 4M42A 3QESA 3KWIA 3OYNA 1HJOA 2E1ZA 3F9MA 4H0XB 3P31A 4FWLA 5GAEP 4F4KA 4GKJK 1Y97A 2E88A 3KWGA 3L3UA 1HLUA 4RW9A 4YOXA 4XH5A 4JI1K 4JKHA 1RFQA 4CD1A 4CF8A 4DTPA 1Q8IA 2E4LA 1MU2A 1TUUA 1RDAA 2HHUA 1HYSA 2DY4A 2XY7A 4B1VA 3QBWA 4FJKA 2YKMA 3ID8A 3SV3A 2ZJPL 4EAHD 2O4IA 4BDYA 4R5PA 4B8AB 5C2DA 4WQ5C 4KHPK 3KZBA 1ASVA 1L3TA 5FPDA 3K9JA 3UKUA 2P9KA 2OCEA 5EXWA 4BRKA 1XNQK 3WA0A 1QQMA 4RCHA 3KIOA 3QNOA 3VQPA 4FXDA 4ILJA 5ADXH 3DXKA 2GWJA 5LMUK 4HUGA 2R82A 3KKRA 4JS4A 3F9KA 4U7BA 2A5XA 4N5SA 3KK1A 3CETA 1L3SA 1S1XA 2PBDA 5AZIA 1QQOA 3CQ8A 1NWKA 3RTVA 4DSJA 3J8AA 3NAEA 1NKEA 1KCFA 1WNSA 3RR8A 3DI6A 1BUPA 1GLLO 4FWRA 3NF7A 1HKCA 1CXUA 4ISEA 2DPNA 2Z1IA 3D45A 3ZSYA 3K59A 4JKAA 1QSLA 4E1NA 1BO5O 5AR0A 4IKFA 4KREA 5HP1A 3EE9A 4PHTX 3VA0A 4FJGA 3DRSA 3E9PA 2KFNA 4AM7A 3SK3A 2RHKA 3ZX3A 3M8SA 2UUBK 3O1BA 1J9AA 5EOYA 3EKUA 1GC7A 1VSJA 4YOYA 4DV6K 3P1GA 2AJQA 1BI4B 4CF2A 4I2QA 1KSPA 3HPHA 1KVBA 3SQ2A 4K0KK 4UQGA 4JI7K 2E8AA 1VQ6N 2V7YA 3VQ5A 1YUWA 3QEVA 4FK2A 4DCHA 4DV4K 4U67L 4JI2K 3O6WA 2YHXA 3FR0A 3M5RA 3VQQA 1C1BA 4BC2A 1QSSA 1NK5A 4H5RA 2WTUA 3I33A 4FL9A 4OPAA 1FXXA 4N76A 1S1WA 4DR2K 4MLEA 3AVKA 3QERA 4Z94A 4FJ7A 3T3FA 1GC6A 1BOTO 5HRRA 2G8IA 1YJ9N 2Q97A 4QS9A 3QEWA 1WBBA 5FRMA 1VQNN 4QS8A 1Q9XA 5JLFA 4JK8A 1Q9YA 3RMBA 2HHXA 4FSVA 4IFEA 1YHQN 4GV9A 2E6MA 4AHRA 2ZGYA 1HNWK 2ITGA 4FLTA 4BE0A 4J2AA 5AQKA 3K2PA 4YOUA 4BRDA 3ASMA 4GW6A 1R59O 3ZDTA 1VQ5N 4ICLA 4FLYA 3VPZA 3N4PA 3BUZB 1ZBSA 4I6MA 5BRHA 5AQXA 2ASPA 5F2RA 3CXCM 1MK9B 3ZT4A 3AA3A 4W5TA 2DFFA 4ELUA 2Q0UA 1FJGK 3PX0A 1VQ9N 4I9QA 3WNHA 1KFDA 4FJLA 4JKDA 3MECA 3L4QA 4H0OA 1JLCA 2GBZA 5LJWA 2YX6A 5D3GA 3EZWA 2KFZA 4GNIA 3CJCA 1ATNA 5HROA 3UIQA 3VQ8A 2HMPA 1VSKA 1K73O 3H46O 1S1VA 1VSDA 1X3MA 1XHXA 4Z0UA 1NMNA 4F8RA 2QXFA 1XUPO 4E0DA 1E4FT 3GDQA 5FRNA 3U9ZA 1YJWN 4M63C 1NGAA 4FWOA 1MA9B 4J8FA 2JWKA 4HUFA 1HB6A 1U4BA 4CFDA 1ATRA 3OJSA 1YT3A 2G8WA 1ATSA 3IDHA 4F9OA 2YNIA 3DLBA 3OS2A 2FSNA 3AVGA 4CHNA 2AL6A 4BRHA 4NYFA 1EETA 1MWKA 4Z4GA 4JNEA 1WSGA 2EMTA 2ASOA 4FOEA 1EWRA 3KVGA 4I7FA 1GG3A 4EHUA 3SAHA 4CK1A 3MEDA 4CERA 4CJWA 4FJIA 4KKOA 3J7YP 3ULEA 4CHOA 3AVNA 2E5LK 4FJ5A 4CE9A 1TAUA 5EVZA 5BN9A 4I6MB 4MFBA 4QCLA 4DFMA 3LDLA 3CF5L 1GLBG 5FROA 2O8EB 3OS0A 1VBHA 1TV6A 1XC3A 2Q2RA 2QWRA 3VF2A 1QE1A 2WOMA 3O8MA 4PL7A 4CGIA 1C1CA 4BQZA 2FF6A 5I3UA 3ZSRA 2P9IA 1X3NA 1HYZA 3DXMA 1VQLN 4KBOA 4CFBA 3U6FA 1W9HA 4JAXA 3CFOA 3T1YK 3ALYA 3LP2A 4IOXA 1TGOA 2UUAK 4HDOA 4FJ8A 3CD6N 4OJRA 4C8NA 1RT2A 5GINA 2G8UA 4CJUA 4CEQA 4ISFA 2J4RA 1YAGA 3K57A 3QB0A 1JCEA 4CIFA 4DQPA 1S9EA 3AGKA 5F1XA 1GOBA 3LL3A 4B1UB 3R8EA 3OHRA 3CCUN 4DB3A 4AHUA 2YHBA 5IWAK 3QBXA 3RSEA 1I3AA 4CEDA 2BDPA 5JLHA 3AVBA 2O8FB 2HSTA 4DQIA 3ATUA 3ATVA 3O4NA 1C1AA 4DTJA 4FLXA 2FBXA 3NVMA 3AVHA 4FVUA 1N36K 4CZIA 3AO5A 4CW7B 1S6PA 5FPEA 1ST7A 1YTUA 2G8FA 4KH5A 3LP1A 1L5UA 1N6QA 5HRSA 1QHAA 3THYA 2QKBA 1BA1A 5AQFA 4CEAA 1WOQA 3VGLA 2ZE2A 2EWSA 4DS5A 3RWUA 1ASUA 1GLCG 2QWLA 1QTMA 4Z4CA 4BC4A 2CGLA 2W6KA 1MK7B 1BCOA 2QTDA 4O55A 3OYJA 4DU3A 2KHOA 2FBVA 4QS7A 4C23A 1HMVA 4J2EA 4H5VA 3VA3A 1SS6A 1JXBA 1JJ2M 4LF9K 3A5NC 2G8VA 3LDNA 2VCPA 1TK0A 1NBWA 1NJWA 3V6DA 2O8FA 3U8ZA 1KAXA 1RBTA 2G8HA 2F8TA 2P9PA 1IG8A 2B4JA 3QEPA 3R3LA 2CGKA 3K5LA 3BF3A 3CJ9A 3KTQA 1LOTB 3V9UA 4J2DA 4V19S 3HBTA 4BROA 3AVMA 1U04A 2HBJA 2D4WA 5KPZA 3HZ6A 1EP4A 1U2VA 4CBXA 3SAGA 4IO8A 3C95A 2UYTA 3KLIA 4FW2A 4CJKA 1VRTA 2GX9A 3CC2N 4B9SA 1TKXA 4RW4A 2DTUA 1X9JA 4A5AA 2NRRA 4JD2B 4AILC 1RBUA 1IKWA 4JKFA 4KPYA 3EL2A 3VN5A 1XHZA 1ZYQA 3L2QA 4NY0A 4N47A 3ZETA 4CZGA 3WEEA 4BR7A 1LV5A 1JCFA 3O5BA 3QLHA 4BDPA 1VQ7N 1VSEA 1NU0A 1IG9A 4FZZA 2NRZA 3G10A 1GOCA 4JD2A 4DSKA 4DQRA 1IBKK 1J54A 1NGFA 3JS6A 4YDUC 4JI0K 2HE7A 4O8UA 5AQYA 1RBSA 1L3UA 1LW0A 3VERA 1U6ZA 3FE1A 4CF0A 2ETJA 3S3MA 3BZKA 2DIKA 1IJJA 2ZQBA 2HNDA 4DV3K 4C8LA 1VQMN 3EO3A 4JRQA 1HBKA 3O9UA 4C1NK 4BRCA 5J2PA 3THVA 5AZIB 3BZCA 2F8SA 3OYEA 2P9KB 4CD3A 1HJRA 4LD0A 4KAZA 3MX2A 2FLOA 2YCHA 5AQSA 1DTQA 3CCEN 3L3VA 5C2FA 4K43A 4OPKA 1ZC6A 4MDAA 4CZMA 1BDGA 2AEHA 4YORA 3EYZA 2PZSA 4CJ5A 1SKSA 1U47A 4FPAA 3A8YA 4NYNA 2NZTA 3CCLN 3WNEA 5AQHA 5DM7L 3HPOA 3WUHA 2NRWA 1RDDA 2P9NB 1CLQA 2A42A 4ID1A 4WFBL 3GG4A 1VBGA 1HKGA 3QIPA 4IO9L 4FJ9A 1L3VA 5K14A 4ILHA 1C0FA 1D9FA 4FM2A 2NRVA 4P7IA 3OYDA 4JKCA 4AF1A 3S3OA 1T44A 2FC0A 5AQQA 3L2UA 4Z4IA 3KKSA 1JLFA 1TUYA 2I7NA 4W5NA 3H45C 3K0SA 4FJXA 3QEIA 3AO1A 3ENHA 3PVLA 1BI4A 1A5WA 4CEEA 1RTDA 1U49A 1T3VA 4IJNA 3ULEB 4IFVA 4N41A 3FZMA 4WFAL 4PL8A 1U48A 2D1KA 4BVPA 3SI6A 4DR4K 1HUXA 1ITGA 1SGHA 2GUPA 5AQVA 4EHTA 4DV0K 4B3SK 2ZGZA 4X62K 4Z4HA 2VG6A 2Z1HA 1WSIA 3ENBA 1NGJA 3A5OC 3BGRA 3FFKB 2RF2A 4WQ4C 1NGEA 2A3ZA 3OYIA 1J5EK 1NI2A 4DF4A 1T8EA 1TK5A 1M1KO 2BH1A 3O4WA 2CH6A 3DOLA 1U2VB 4DFKA 1YTAA 1JLBA 3OYMA 2YJEA 3ENOA 1FKPA 3HM8A 3SPYA 1N34K 5LY3A 1UA0A 3RMCA 1C0GA 3G9WA 1KLMA 3HL8A 3OTOK 4B9LA 2E2PA 5C42A 4GXBA 4CJ7A 5GAGP 1K6YA 1KTQA 1VHXA 2VWJA 4FPBA 4CBWA 3UE5A 3ZSQA 5SZTA 1SL1A 1JXEA 3U9DA 2IIRA 3O08A 2VGMA 3QFPA 3CQYA 4NLCA 4BQLA 3VEZA 1EX4A 4KTWA 1HNZK 4L8RB 2QA4N 5BPNA 4HWIA 3OYBA 3NBPA 4F2SA 4CI6A 4Y1DA 1G15A 3LWLA 3A5LC 4XEIA 3VQ9A 4CZFA 4E7LA 1WB9A 1BIUA 1UWBA 4BRMA 3OYHA 5F0XA 2ZJRL 4B1XB 3C6AA 1KD1O 3ZEUB 3DYAA 1U45A 1ESVA 3LALA 5KGXA 2ZM6K 3DWLA 4CJSA 1S1TA 3HPGA 1NK7A 1S1UA 4B08A 3FZLA 4EKUA 3O1WA 3PV8A 2GUIA 5C24A 2NRHA 4BY9C 3VQDA 1NG9A 3R1XA 2EHGA 2ASMA 4DG1A 1IKVA 3FZHA 1RBVA 3NGZA 3O3FA 4E7HA 3AVFA 3TTDA 1TYQB 1H4RA 5JICA 3MN6A 3T7ZA 4H03B 3CI5A 3F2KA 3BINA 3WQTA 4DSEA 4IBNA 1TKZA 3C0BA 3PY8A 3W0LA 4B3RK 3ITHA 2X0SA 2J0MA 4Y1CA 2OPSA 5J2NA 1EO1A 2E6LA 4X66K 1WAFA 4DU1A 3VESA 3IUCA 4LF7K 4M3TA 2PFUA 2A40A 2V52B 4DTSA 2UXDK 3W3DA 4CJPA 4DR3K 4H0VB 4O8KA 4H0PA 4BC3A 3THXB 4CJQA 4NB4A 3I8BA 4NO7A 4KHQA 3Q7BA 4LFBK 4OKEA 4LSLA 4OGEA 4DFPA 4BRPA 5AQJA 1MIZB 4GMJB 2QW9A 4NXMK 4BREA 4LC9B 3ZT3A 3HT3A 4GY2B 3QIOA 2VG7A 3L4IA 3QICA 2Q36A 4DUZK 1MDUB 1HKBA 2W6LA 3ZX0A 4B3TK 4CEBA 1NKCA 1TYQA 2Z1GA 2HB5A 1RT7A 1T6DA 4FO0A 3GL1A 5CY4A 1HQUA 4NCGA 3PSIA 5M1QA 4OPJA 2HHQA 4CECA 4NXNK 5C15A 4CZKA 3T19A 4FOIA 4DV2K 3K5MA 5KTQA 1KVCA 4RW8A 4DLGA 3SPZA 2QWQA 1W2BM 2O8EA 4BRFA 2HHSA 3P83D 4H0TB 1KFSA 2BTFA 3EPYA 3M3ZA 4BG9A 3QFUA 1TL1A 3ZCMA 3FLVA 5TKYA 5JMVA 1X9WA 1N8RO 5HOOA 4BWMA 3AARA 1J6ZA 2D2QA 4AHCA 4IWVA 3FLCO 2HHHK 3THYB 1EF1A 1SV5A 3UKRA 3D2EB 4CIEA 4DKWA 4A5BA 4BG8A 4CHQA 3LDQA 1JLAA 2PYLA 4KI6A 1S5JA 5AQIA 4WF9L 1S72N 3H1QA 3R6MA 1QZ5A 3OYGA 2X6NA 2GEMA 4DU4A 2P5GA 4GV6A 3QEXA 1LWEA 1N5YA 1KAYA 2D0OA 1RDUA 1EXQA 3O9SA 4BGAA 3E66A 3VF4A 3BF1A 3WNGA 2G8KA 4J2BA 4HUEA 4JRPA 1NK4A 4N56A 2B5JA 4XIUA 2AP1A 4KTQA 4FZXC 4CJLA 3TAFA 1FK9A 1REVA 1LWCA 5M1NA 1GLJO 1WSFA 4JEPA 3L2VA 2HVHA 4H5WA 4K8XA 3G6EN 3SZ2A 3MN5A 1IBLK 1YVUA 1IH7A 1YVNA 1B92A 4C8KA 5BRDA 1UA1A 1CZ9A 3IRXA 3VQ7A 1DKGD 3OBYA 3PO5A 3VOVA 2VG5A 1VSHA 3K9KA 2GWKA 5CR4A 2A1RA 4KH4A 2RPIA 2QM1A 1NKBA 2GV9A 1DLOA 3JAMO 2KQ2A 3K58A 3CC7N 2OPQA 3BY5A 1DTTA 1RTJA 2HF3A 4CEOA 2KZMA 3FP5A 1H1VA 4JV5K 2Y1IA 4CF1A 2O8CB 4JHDA 3OYLA 4K42A 1XMQK 3AU4A 3L8BA 2NLXA 3LANA 5I42A 3SQ0A 3LP0A 4CFCA 2A1SA 1NGBA 2E2QA 3B8AX 3ZETB 2QXLA 2VQEK 1XQSC 5BPMA 4DV5K 4DTMA 4UY8O 5AQUA 3MX5A 4B9UA 2E20A 1XMOK 5EY4A 5AJ3K 4I2PA 4B9VA 4CJEA 3B6PA 4JK9A 4KV8A 1HB8A 3IKMA 3UKUB 2QWOA 3MWTA 3A2FA 3P5JA 4FYDA 4CHPA 5BR8K 3DLKA 1YITN 4O5BA 3TR8A 1OVQA 2CQUA 1K9MO 4Q5VA 4CEZA 4BRLA 2F9WA 3OBWA 1NJYA 3V9ZA 1RT3A 4ZHRA 4FLVA 1KLNA 3THWA 4IEIA 4DTUA 3IFRA 5ADXA 3IVFA 4FJJA 3FZFA 3RMDA 5AQWA 1C0UA 3SUPA 3O80A 2XY5A 2P51A 5HLFA 1G99A 3KD1E 3G25A 3TANA 1WBDA 4LH5A 1SUQA 2NUBA 3LWMA 1RILA 5KGWA 2O8BA 5JVGL 4FK4A 2NNWA 4CZLA 1RTHA 5CE3A 3HP6A 1TKDA 1TAQA 2OPRA 2VWBA 4A2BA 2P9NA 1M90O 1X9MA 4PUOA 1BWFO 3CPEA 5IT9O 3CJAA 1UOCA 2O4GA 4A62A 1ILYA 1VSMA 1ZXOA 5DK5A 2Y1JA 1W97L 2D0AA 3WQUA 1LW2A 3L0QA 3U3GA 3WEEB 1JCGA 1ZBUA 3RRGA 4Z4FA 1C0TA 4IXCA 2XY6A 1NOZA 2I1JA 4H5NA 1SKRA 3NGIA 4FLWA 4B9QA 1ZBIA 4DWIA 1IO2A 4IG0A 1HPZA 1K8AO 3NGYA 1QQNA 3B6OA 3EKSA 1QSYA 1QHTA 1T05A 3FZKA 3AA4A 2IC3A 3QIJA 1ACAA 4CEFA 1A5VA 1RT6A 3KJVA 4BRIA 2PYJA 5E84A 4CFAA 1JDEA 1VK0A 5C0YA 5AFUA 3S9HA 3I0RA 4H4OA 1DEJA 4E7IA 3L2RA 3PLAA 3MN9A 4W5OA 4GVMA 1E3MA 2LBBA 4RW6A 4DQ8A 3C7NA 1KXPA 4DQQA 4HDQA 1GLDG 2W40A 3VEWA 3SMPA 5AZJB 2VGNA 2A6AA 5DM6L 4B3OA 1S22A 4JKBA 3OY9A 3KK2A 1BCMA 2HHWA 4JLHA 3QNNA 5KPRA 4FCYA 3CC4N 4KHUA 3O3HA 4RTFD 4BDZA 1VAZA 2RE2A 2QWPA 2A41A 1NGGA 2FBTA 4YHHK 3DRPA 1FKOA 4BR9A 3ZEUA 3VQBA 4CZJA 3ZT2A 3MXMA 3TTCA 1GOAA 4YDUA 3J81O 1QS4A 1X1PA 3DJCA 3QMLA 4DSFA 1BQMA 3SQ4A 4ZTJA 3MEGA 5J2QA 2HRJA 2QKKA 4BVOA 3HO1A 5IJMA 4BRNA 5J2MA 3FFIA 4HCBA 4JYAK 3WXJA 1RBRA 3ZSXA 4R79A 4IJAA 4NLBA 3LAKA 1XNRK 2F4VK 2NRTA 1BU6O 3HVRA 2Q0RA 3AU5A 3HSTB 3CFRA 3S3NA 3K5OA 2HOEA 3HXMA 1N33K 3GBTA 4H8KA 1BG3A 4DR1K 4BR5A 1IKXA 4K8ZA 3NVKA 2PY5A 2ATQA 1I39A 3MXJA 3HI0A 1GLAG 5AZJA 1NGCA 3AA2A 1D5AA 3SAFA 3HRGA 4DR7K 1R0AA 5JVHL 3C6HA 3N4QA 2JLEA 4RW7A 4CGDA 3OS1A 3VEOA 3AAPA 2CGJA 3G4SN 4CGJA 3I56N 4Q0BA 3OA9A 3NFAA 1DGKN 4YOVA 4TKNA 4CJ3A 5J1EA 3CCJN 3OVNA 4C1NI 3HVTA 3PO4A 2Q31A 3ZT0A 4ZTFA 4EZ9A 1JLGA 3TAMA 3JYTA 3EY1A 2XY8A 3LDPA 3NF9A 1VQ8N 1CZAN 3VTHA 3TAEA 4GV3A 3OYCA 2YNHA 3MCAB 3NF6A 4DTOA 4ZRJA 1GLEG 5I9EB 1IV0A 4WCEL 3CYMA 4CZHA 4FLZA 4I9LA 1D9DA 4DSLA 1FW6A 2KZZA 1N32K 1JLQA 4M45A 2VYPA 1HNVA 2FJ9A 1J19A 1NJIO 1EQYA 4FWPA 3SBTA 4G1QA 4Z4EA 4WE1A 3C6UA 2YV0X 4JI4K 2JWLA 4M7XA 5KPTA 2R7YA 4PA1A 2P1JA 1KC8O 4DSIA 2ABDA 4KO0A 4LSNA 4FZYA 3CFPA 3CMAN 3KLHA 3HK2A 1GGOA 1BA0A 1OKJA 1BIZA 2W41A 3ZLJA 4HTUA 1SQKA 1NK9A 2XO7A 2J0KA 4JS5A 1RNHA 4E7KA 4OPHA 4CGGA 2WUSA 3PX4A 3TPQA 3SNNA 2QI2A 3H08A 5H1SQ 3CCRN 4PKGA 1E4GT 3JXUA 4MQ3A 3BDPA 4PKHA 4AHTA 3SUNA 1XI1A 4B1YB 4IOCL 3LPUA 3D2EA 1KAZA 4LFAK 4EP5A 1SZ2A 1YJNN 1NOYA 3QINA 3P4IA 3U4LA 3OJUA 5AQPA 4LF8K 4JI6K 1NJZA 5FLXO 3NHGA 3DMJA 4DHYA 4OKKA 3VQCA 3KLEA 2F96A 4FVMA 5C12A 1JL1A 2FSJA 3CPWM 1EKEA 1OVYA 2NRXA 2IAJA 3R9PA 4BR4A 3NE6A 3OW2M 3DLGA 3AO3A 4C8OA 1KBLA 5AQMA 3FGUA 5ELZA 4LH4A 1RGIA 4K41A 4BWJA 3CCMN 3VQAA 1SAZA 4XH1A 3EN9A 1WN7A 4FWSA 3MCPA 2WBNA 3TWHA 3DXMB 4BGBA 5HRPA 1OH6A 3MK6A 1NK8A 1Y19B 1OH8A 4KB1A 3VF6A 4Y0WA 1F21A 1W7AA 4JKGB 3KK7A 3HTVA 2DFHA 3F5TA 4F7GA 4YFUA 3ZSZA 2FSKA 5LMNK 4LF6K 2D10A 1XWLA 3MXIA 2LSNA 2P9IB 3KLGA 1I94K 2WC9A 2QWNA 3NH1A 2UU9K 2RKIA 3C94A 4M7YA 4JHDB 4AHSA 1J5OA 3GE1A 4QAGA 4IDHA 3C7NB 2O8DB 3VQ6A 4KI4A 4DR6K 3SUQA 3QDKA 1VQON 1D8YA 2ITMA 4FM0A 1NTIA 3PX6A 2ZPYA 1RCHA 4LFCK 3TARA 3C6TA 1JLEA 1Z26A 5DMRA 1T03A 3ULDA 3V81A 1HRHA 5GADP 4AM6A 3HJFA 5B8HA 4KTZA 3LPTA 4KHWA 3DLEA 5KRSA 4E1JA 1RT1A 3D2FB 3UKRB 2YHWA 1MWMA 4JKEA 4CJTA 4M3YA 3ZYYX 4DUYK 3NCIA 4PWDA 1KRPA 3GOIA 5M1FA 4ELTA 4O4GA 2W42A 4M3XA 2IGIA 3OYFA 1LAVA 5FPNA 2P9UB 2CB8A 3S41A 3V9WA 1NVLA 3TABA 5JS1A 2F9TA 4DTXA 3TSQA 4M3WA 4HTLA 4OLBA 3V4IA 2WH5A 3SJJA 3THWB 2ZF5O 1TKTA 2EX3A 5AQNA 4EIAA 3MWPA 1P8ZA 3QETA 2YVCA 4FWNA 3ZSOA 3NMUA 1HYVA 5CZ2A 5AQTA 4K25A 4JI5K 2P9SA 2D0PA 3CM5A 3PZDA 3C65A 4DTNA 2QEXN 2UXBK 3DM2A 3JSMA 4X65K 4CK2A 4FWKA 3VEXA 3OYKA 4CZEA 4CIGA 1A5XA 3CCQN 3U3YA 3LAMA 1O13A 4HHTA 1E5WA 2O8DA 4GKKK 2HVIA 5CHIA 3AO4A 1W0HA 2OTJN 4FJMA 3M8RA 1GLFO 4ILGB 5M1OA 4B1WB 3O9QA 3EE8A 3MEEA 4QOZB 5GIPA 1WUAA 3KK3A 3M1FA 3TI0A 4JI3K 2IDOA 4DR5K 4EFHA 4YL8A 4FW1A 5KRTA 3AVJA 4YY3K 4A59A 3O9RA 2X6SA 1VSFA 5AFUH 4CCHA 4CHZA 3VETA 1DT9A 1HNIA 5JVLA 2V7ZA 3CG7A 3HSCA 2X78A 1KQSM 2D11A 2Q3SA 3IG1A 3V1QA 2JGUA 5CYMA 2QWMA 5M1KA 4W5RA 1NGHA 4DS4A 4G9ZA 4LY7A 1SL0A 3A5MC 4DFJA 2IVPA 5HBMA 3KLFA 3HYFA 3VEVA 2D0BA 1NMDA 3RR7A 2CH5A 2KW4A 4YOTA 3U8XA 2YKNA 3P39A 4CK3A 5TKWA 2P9SB 3SMSA 2OZSA 4OLAA 3H3OB 4MLHA 3VGKA 5BRFA 4ISGA 5AQLA 4A57A 2IOCA 4HCCA 3DAWA 4DLEA 5AQOA 1EWQA 3LZJA 3O4QA 4B1ZA 3MN7A 5BN8A 4FWQA 1RDBA 2X74A 1JL2A 4EZ6A 5EU7A 4BRAA 4DV7K 3CJBA 1ASWA 3PIOL 4HVJA 5KQDA 4JI8K 2OPPA 3G0ZA 3SLCA 1HPMA 5LJVA 1RDWX 3I0SA 2Z1JA 2HHTA 5T7BA 2O8BB 3RRHA 4M41A 4WYBA 4KB0A 4PKIA 4DV1K 4OO1J 2IVNA 2BGGA 3Q7CA 2OANA 1ZBLA 3DLLL 4A2AA 1QQCA 2VWKA 2WFBA 3L6QA 4DTRA 2E2NA 3SBGA 3LM2A 5E26A 3DXKB 3PUFA 4IDKA 1LAWA 4F3TA 4CESA 1RT5A 2HBMA 4OVLA 2F7TA 3X23A 1WSHA 1BGXT 5BPLA 3V9SA 2QK9A 3AV9A 2XRIA 3MDQA 4CHYA 1HR0K 4A61A 3NH0A 2D0CA 1C6VA 3VENA 4OGCA 3HOTA 4KRFA 4F3OA 2E2OA 2OZMA 1XC9A 3O9TA 4AHVA 3G71N 2FF3B 3MMVA 2IS3A 3RSEB 4W5QA 4FJHA 2GTDA 4RG8A 2I7PA 3PIPL 2VQFK 1QVGM 1T6CA 3TSPA 4GVEA 3CCSN 3WT0A 3UB5A 1IKYA 1B9DA 4OKJA 3CJ7A 1RTIA 2D5RA 3H3NO 3HP9A 1VQKN 3K5NA 1VQ4N 4ID5A 1V4TA 1WAJA 3EZ5A 2HBKA 5GIOA 1BQNA 3CCVN 3M6GA 3I55N 3PSFA 3V9XA 3NF8A 3D7EO 2WONA 2YNGA 3IS9A 4MDBA 3EEQA 2H3GX 4H5TA 1TL3A 4NCBA 3D6RA 4X64K 3E1YA 1NK0A 3BEXA 2Q1NA 4F2RA 3L2WA 5BR9A 4KHYA 4JN4A 4E89A 5E41A 3MAQA 1NGDA 1BHLA 3DOKA 4BE2A 1CXQA 2RN2A 5FPMA 2BE2A 2YI1A 2AA4A 3WNFA 5GAHP 4ELVA 3RVCA 5KI6A 4DMNA 4DF8A 2YNFA 1WSEA 1O1WA 3DRRA 1VSLA 2E1YA
chains in the Genus database with same CATH topology
3W3DA 4H0VB 4O8KA 4H0PA 4BC3A 2FSNA 3VGMA 4ZRKA 2JWLA 4NB4A 3I8BA 4M7XA 4NO7A 5KPTA 3Q7BA 3H6EA 3AY9A 2AL6A 4BRHA 1S3XA 4BC5A 1KC8O 4BRPA 5C10A 2ABDA 5AQJA 1MIZB 1V4SA 1D4XA 2QW9A 1YF5L 5AQRA 1MWKA 4BREA 4LC9B 4JNEA 2EMTA 2ASOA 4FOEA 3ID6A 3KVGA 2HF4A 3WXKA 4WQ5A 3CMAN 1GG3A 4GY2B 4EHUA 3L4IA 3SAHA 1GGOA 3QICA 2Q36A 1BA0A 1MDUB 1NM1A 1HKBA 1OKJA 3CQXA 3ULEA 4ZRIA 2W41A 3ZX0A 5F1XA 1KC7A 2IVOA 1SQKA 3H1VX 1TYQA 4L3QA 1T6DA 5EVZA 5BN9A 4I6MB 2J0KA 4FO0A 3GL1A 3LDLA 5BREA 1K8KB 3CF5L 1GLBG 4BR0A 4OPHA 4KH6A 2WUSA 2J0JA 3HOSA 3TPQA 2ZJQL 3WXMB 1VBHA 1XC3A 2Q2RA 2QI2A 2QWRA 3VF2A 5H1SQ 5M1QA 3CCRN 2KKZA 3O8MA 4PKGA 1E4GT 4FWMA 5C15A 4PL7A 4CZKA 1VQPN 4BQZA 2FF6A 3JXUA 2P9IA 4FOIA 1X3NA 3DXMA 4PKHA 1VQLN 2P9LB 4KBOA 4B1YB 4IOCL 3D2EA 1KAZA 4JAXA 1SZ2A 1YXQA 4IOXA 1YJNN 4HDOA 5MLCQ 2PAVA 3CD6N 3P4IA 2QWQA 1Q86O 3U4LA 1W2BM 5GINA 4BRFA 1Z05A 5AQPA 4JKGA 4BR2A 1Q81O 4H0TB 4IOAL 2BTFA 2J4RA 1YAGA 1P90A 3EPYA 4ISFA 3M3ZA 4BG9A 4WQ4A 3QB0A 3QFUA 3FLVA 5TKYA 1JCEA 4DHYA 5JMVA 4YOWA 1N8RO 5HOOA 3VEYA 3IMXA 3AARA 5C12A 4RWTA 1J6ZA 3AGKA 2D2QA 5M1PA 3T69A 4IWVA 3FLCO 2FSJA 1EF1A 2P9LA 3D2FA 3LL3A 3R8EA 3UKRA 3VMFB 3OHRA 3CHWA 4B1UB 4DB3A 3CPWM 3CCUN 1OVYA 3U7DA 3D2EB 2COPA 2NRXA 3R9PA 4BR4A 3QBXA 3RSEA 4DKWA 3AAQA 3OW2M 4A5BA 5JLHA 4BG8A 4JK7A 1KBLA 3LDQA 5AQMA 2HSTA 3FGUA 2OTLN 5ELZA 3CMEN 3ATUA 3ATVA 5EX5A 4XH4A 2YHYA 5AQIA 4WF9L 1S72N 1RGIA 3H1QA 4K41A 3R6MA 2KLAA 1QZ5A 3NVMA 4DXAB 2GEMA 3CCMN 1SAZA 4XH1A 4FVUA 3EN9A 4FWSA 4GV6A 3WXLA 4CZIA 3MCPA 5FPEA 2WBNA 1ST7A 4KH5A 3DXMB 4BGBA 1KAYA 1QHAA 2D0OA 1BA1A 2FXUA 5AQFA 1YIJN 1RDUA 4BGAA 3O9SA 1WOQA 3E66A 3MK6A 3VGLA 3VF4A 1VQNN 2EWSA 1K8KA 3BF1A 1Y19B 3CERA 3TTFA 1GLCG 1NGIA 2QWLA 5HL7L 3VF6A 4Y0WA 5KQ8A 4BC4A 1Q7YO 2CGLA 4JKGB 3KK7A 3HTVA 3F5TA 1MK7B 2QTDA 2ZWHA 2AP1A 2KHOA 4F7GA 1LCUA 1YI2N 3BP8A 2FSKA 2P9UA 4QS7A 2I1KA 4C23A 5AQGA 3CIPA 5M1NA 2D10A 4H5VA 1GLJO 4JEPA 1SS6A 4H5WA 1JJ2M 2P9IB 3G6EN 3MN5A 2WC9A 3A5NC 2QWNA 4O5FA 1YVNA 2VCPA 3LDNA 2GELA 4M7YA 4JHDB 5BRDA 1ISNA 3GE1A 4IDHA 1DKGD 3AGRA 3C7NB 1NBWA 4MO4A 3OBYA 3VOVA 3K9KA 2GWKA 1Y64A 5CR4A 4KH4A 3QDKA 3U8ZA 2QM1A 1VQON 1KAXA 2ITMA 1NTIA 2BUPA 2P9PA 1MIXA 4WFNL 2ZPYA 1IG8A 2FDQA 3P38A 3KHYA 4CBUA 3R3LA 2CGKA 3CC7N 5GADP 3BF3A 4AM6A 3CJ9A 5B8HA 2HF3A 1LOTB 2EMSA 4E1JA 3FP5A 1H1VA 3D2FB 2HBLA 3HBTA 4BROA 3UKRB 2YHWA 1MWMA 4JKEA 2V51B 2HBJA 4JHDA 2D4WA 3ZYYX 3HZ6A 2YJFA 5KPZA 4K42A 1U2VA 4CBXA 3AU4A 3SAGA 4IO8A 3J7ZO 2NLXA 4IEEA 3GOIA 5M1FA 3TSUA 3B8AX 1NGBA 2E2QA 2UYTA 3ZETB 2QXLA 2RQ1A 3E9OA 1XQSC 1Q82O 5FPNA 5BPMA 4UY8O 5AQUA 1Q18A 1HX1A 3MX5A 2P9UB 1DIKA 2CB8A 1QZ6A 1Z6RA 2GX9A 2E20A 3LDOA 3S41A 5EY4A 3TU5A 1NVLA 3ZX2A 3CC2N 2F9TA 4IZ9A 4BRQA 3TSQA 1X9JA 4HTLA 2NRRA 4JD2B 4A5AA 5AQZA 2WH5A 4H0YB 4JK9A 1QVFM 1HB8A 2ZF5O 4EIAA 5AQNA 4JKFA 4CYEA 4BRGA 3IKMA 3MWPA 3UKUB 3VTIA 1P8ZA 2QWOA 3MWTA 2YVCA 3EL2A 3SJHA 4FWNA 4NY0A 3NMUA 1NLVA 3WXIA 1YITN 3ZETA 4MO5A 4CZGA 3LM9A 5AQTA 3WEEA 4BR7A 4K25A 2P9PB 2P9SA 1JCFA 2D0PA 3PZDA 3O5BA 3E9LA 3C65A 2CQUA 1K9MO 3A0IX 2QEXN 1VQ7N 4BRLA 2F9WA 2NRZA 3OBWA 4FWKA 3CJ1A 3VEXA 4CZEA 4JD2A 3CCQN 3KWIA 1HJOA 4IEIA 1NGFA 1O13A 3IFRA 3JS6A 3IVFA 4YDUC 3FZFA 5ADXA 2E1ZA 1E5WA 5CHIA 3F9MA 4H0XB 2HE7A 4O8UA 5AQYA 5AQWA 2OTJN 3O80A 3VERA 1GLFO 1U6ZA 3FE1A 3P31A 1G99A 3G25A 4ILGB 5M1OA 4B1WB 3O9QA 4FWLA 5GAEP 3EE8A 5JVGL 2E88A 2DIKA 2NNWA 1IJJA 4CZLA 3KWGA 5CE3A 1HLUA 5GIPA 1VQMN 4YOXA 1WUAA 3M1FA 3EO3A 1HBKA 3O9UA 4C1NK 2VWBA 4A2BA 2P9NA 4XH5A 4BRCA 5AZIB 1M90O 1BWFO 3CPEA 4JKHA 2P9KB 4EFHA 1RFQA 3CJAA 4A62A 4CD1A 1ILYA 4YL8A 4CD3A 1TUUA 1ZXOA 1W97L 4A59A 3O9RA 3WQUA 3L0QA 3MX2A 2FLOA 4B1VA 2YCHA 5AFUH 3QBWA 1JCGA 5AQSA 1DT9A 3VETA 3WEEB 3CCEN 3ID8A 5C2FA 4IXCA 4K43A 2ZJPL 2I1JA 1ZC6A 4EAHD 5JVLA 4MDAA 4CZMA 1BDGA 2V7ZA 2AEHA 3HSCA 4YORA 4H5NA 1KQSM 2D11A 4FPAA 3A8YA 4B9QA 2NZTA 3CCLN 5C2DA 4WQ5C 5AQHA 5DM7L 2QWMA 5M1KA 1K8AO 1NGHA 3WUHA 1QQNA 2NRWA 4G9ZA 2P9NB 3A5MC 3KZBA 5FPDA 3K9JA 2A42A 3UKUA 2P9KA 2IVPA 4WFBL 3EKSA 3GG4A 1VBGA 5EXWA 4BRKA 3VEVA 3WA0A 3FZKA 1HKGA 1NMDA 2CH5A 1QQMA 4YOTA 4RCHA 3QIJA 3U8XA 4IO9L 1ACAA 3P39A 4ILJA 5ADXH 3DXKA 2GWJA 4ILHA 5TKWA 4BRIA 2P9SB 2R82A 1C0FA 5E84A 3SMSA 2NRVA 1JDEA 4P7IA 4JKCA 3H3OB 4AF1A 1T44A 4MLHA 5AQQA 3VGKA 4U7BA 5AFUA 2A5XA 5C0YA 5BRFA 1TUYA 4ISGA 5AQLA 4A57A 2I7NA 3CETA 3DAWA 3H45C 1DEJA 5AQOA 2PBDA 3PLAA 4B1ZA 3ENHA 3PVLA 1QQOA 1NWKA 3MN7A 3MN9A 5AZIA 5BN8A 3J8AA 4FWQA 1T3VA 4IJNA 3ULEB 2LBBA 4BRAA 4DQ8A 3C7NA 1KXPA 4HDQA 3CJBA 1GLDG 2W40A 1BUPA 1GLLO 3FZMA 4FWRA 1HKCA 3VEWA 5KQDA 3PIOL 4WFAL 3SMPA 4PL8A 5AZJB 4ISEA 2DPNA 2VGNA 2D1KA 3SLCA 2A6AA 1HPMA 4BVPA 5DM6L 1S22A 4JKAA 1HUXA 5LJVA 1RDWX 1SGHA 1BO5O 4JKBA 5AR0A 2GUPA 4WYBA 3EE9A 5AQVA 4PHTX 4EHTA 4PKIA 3E9PA 2ZGZA 4AM7A 3SK3A 2RHKA 3ZX3A 5KPRA 3O1BA 3ENBA 1NGJA 4OO1J 3A5OC 2IVNA 3FFKB 4WQ4C 5EOYA 3CC4N 3Q7CA 2OANA 3EKUA 1NGEA 1GC7A 4RTFD 4YOYA 2A3ZA 1NI2A 3DLLL 4A2AA 1M1KO 2BH1A 3O4WA 2CH6A 2WFBA 1U2VB 1VAZA 3L6QA 2RE2A 2E8AA 2QWPA 1VQ6N 2V7YA 2A41A 1NGGA 1YUWA 2E2NA 2YJEA 3ENOA 3SBGA 4BR9A 3LM2A 3ZEUA 3HM8A 4DCHA 5E26A 3DXKB 4CZJA 4U67L 3TTCA 2HBMA 4YDUA 5LY3A 2F7TA 3O6WA 3X23A 3DJCA 5BPLA 2YHXA 3FR0A 3QMLA 3M5RA 1C0GA 4BC2A 3G9WA 3MDQA 2HRJA 2E2PA 4A61A 4H5RA 4BVOA 3I33A 5IJMA 4GXBA 4FL9A 4OPAA 4CJ7A 4BRNA 5GAGP 4MLEA 3VENA 4Z94A 3WXJA 4FPBA 1GC6A 4CBWA 1BOTO 3UE5A 4R79A 3HOTA 4IJAA 4NLBA 2E2OA 1YJ9N 2Q97A 4QS9A 3O9TA 3U9DA 2NRTA 3G71N 1BU6O 2IIRA 2FF3B 2Q0RA 2VGMA 3O08A 3AU5A 3MMVA 3CQYA 3QFPA 4NLCA 4QS8A 3RSEB 4JK8A 4BQLA 3VEZA 5JLFA 2GTDA 4FSVA 2QA4N 4IFEA 5BPNA 2I7PA 3PIPL 4HWIA 1YHQN 1QVGM 4GV9A 1T6CA 3TSPA 2HOEA 4GVEA 2ZGYA 4CI6A 3GBTA 3CCSN 5AQKA 3WT0A 4YOUA 4BRDA 3UB5A 3A5LC 1BG3A 1R59O 3ZDTA 4XEIA 4BR5A 1VQ5N 4CZFA 3NVKA 3CJ7A 3VPZA 3H3NO 3N4PA 4BRMA 1VQKN 3BUZB 3HI0A 1GLAG 5F0XA 1ZBSA 2ZJRL 4B1XB 5AZJA 3C6AA 1VQ4N 1NGCA 3ZEUB 3SAFA 1V4TA 4I6MA 5BRHA 1KD1O 1ESVA 3HRGA 5JVHL 5AQXA 3C6HA 3N4QA 2ASPA 2HBKA 5F2RA 3VEOA 3CXCM 3AAPA 5GIOA 1MK9B 2CGJA 3DWLA 3G4SN 3I56N 3CCVN 3M6GA 3OA9A 3I55N 3FZLA 2Q0UA 4EKUA 1DGKN 3O1WA 4YOVA 4TKNA 3CCJN 4BY9C 2NRHA 3D7EO 1VQ9N 4C1NI 3R1XA 2Q31A 4JKDA 3L4QA 4H0OA 4MDBA 2ASMA 2H3GX 4H5TA 5LJWA 3FZHA 2YX6A 3LDPA 1CZAN 3D6RA 3VTHA 3EZWA 1VQ8N 3E1YA 4GNIA 3CJCA 1ATNA 3TTDA 3BEXA 1TYQB 2Q1NA 1H4RA 5JICA 4GV3A 2HMPA 3MN6A 3T7ZA 3MCAB 5BR9A 1K73O 3H46O 4JN4A 4H03B 4ZRJA 1X3MA 1GLEG 3CI5A 3F2KA 3BINA 3WQTA 5I9EB 3C0BA 1NGDA 4WCEL 4CZHA 3W0LA 1XUPO 1E4FT 2X0SA 3GDQA 2J0MA 5FPMA 3U9ZA 1YJWN 4M63C 1NGAA 4FWOA 1MA9B 2YI1A 4J8FA 1EO1A 2AA4A 5GAHP 2VYPA 2JWKA 3VESA 1HB6A 2FJ9A 3RVCA 3IUCA 1J19A 1ATRA 2PFUA 1NJIO 1EQYA 2A40A 2V52B 1ATSA 4FWPA 2E1YA 3SBTA 3IDHA 4F9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E66 A;  3SBG A;  4JK8 A;  4JK7 A;  4ILJ A;  4JKA A;  3E9O A;  4ILH A;  4JKB A;  4JKG B;  4JKG A;  4ILG B;  4JKC A;  3E9L A;  3E9P A;  3ENB A;  4JKD A;  4JK9 A;  4JKH A;  4JKF A;  4JKE A;  3SBT A; 
#chains in the Genus database with same CATH topology
 3J7A P;  3VGM A;  4B9N A;  4ZRK A;  3ZSV A;  1BL3 A;  3H6E A;  2YHA A;  3AY9 A;  1VRU A;  4OX9 K;  1S3X A;  4BC5 A;  4KHS A;  5C10 A;  1ZBF A;  3RMA A;  1V4S A;  1D4X A;  2HNZ A;  1YF5 L;  5AQR A;  4E3S A;  2OYQ A;  4CGH A;  2HNY A;  3ID6 A;  2HF4 A;  3O3G A;  5LL6 Z;  4WQ5 A;  3WXK A;  5JS2 A;  4AQY K;  2B6A A;  1NM1 A;  3CQX A;  4ZRI A;  4C8M A;  1KC7 A;  2IVO A;  3H1V X;  4L3Q A;  1X9S A;  5BRE A;  1K8K B;  1ZBH A;  3AVC A;  4BR0 A;  3HOS A;  1JKH A;  2FBY A;  2J0J A;  4KH6 A;  2ZJQ L;  3WXM B;  3TAG A;  3LP3 A;  4PQU A;  2KKZ A;  3VQE A;  4FWM A;  4B3M K;  2ZD1 A;  2HHV A;  1VQP N;  3SUO A;  4IG3 A;  3I8D A;  2P9L B;  3AVL A;  1NK6 A;  3F73 A;  4B9T A;  3M8P A;  1S9G A;  3DLH A;  2UUC K;  1YXQ A;  5MLC Q;  2PAV A;  1Q86 O;  3SYZ A;  1Z05 A;  4BR2 A;  4JKG A;  1Q81 O;  4M3R A;  4B9M A;  4IOA L;  1KVA A;  1P90 A;  4WQ4 A;  1BIS A;  4YOW A;  1TK8 A;  3VEY A;  3IMX A;  4RWT A;  5M1P A;  3T69 A;  5A2Q O;  1HQE A;  3VMF B;  3D2F A;  2P9L A;  2BAN A;  4CVN E;  3LDS A;  3CHW A;  2O8C A;  3U7D A;  2COP A;  3THX A;  4YNQ A;  1OH7 A;  1RT4 A;  3AAQ A;  3V1O A;  4AH9 A;  4JK7 A;  3CME N;  3AA5 X;  2OTL N;  2KTQ A;  5EX5 A;  4XH4 A;  2YHY A;  4IFY A;  1NJX A;  2OA8 A;  2KLA A;  4DXA B;  1Z25 A;  3M8Q A;  4H4M A;  4M3Z A;  4CJV A;  2DFE A;  3HM9 A;  3WXL A;  1J53 A;  4LF4 K;  1VSI A;  2FXU A;  1YIJ N;  2XHB A;  4CJ4 A;  3T1H K;  3AVA A;  1K8K A;  3CER A;  3TTF A;  4E7J A;  1NGI A;  5HL7 L;  4DQS A;  2HW3 A;  5KQ8 A;  1Q7Y O;  3ZSW A;  1C0M A;  2UXC K;  1WLJ A;  2ZWH A;  3KD5 E;  1LCU A;  3SQ1 A;  1YI2 N;  3BP8 A;  4M3U A;  2P9U A;  2I1K A;  4KFB A;  4FJN A;  5AQG A;  3CIP A;  3V1R A;  4B8C A;  4PY5 A;  1S6Q A;  3TAP A;  4O5F A;  4CGF A;  4CJF A;  1LWF A;  4FLU A;  2GEL A;  1SL2 A;  1ISN A;  4NCA A;  1CZB A;  5HRN A;  2P5O A;  3AGR A;  3AVI A;  4MO4 A;  3SCX A;  2I5J A;  1TVR A;  1IBM K;  1SKW A;  4O44 A;  4KHN A;  5CZ1 A;  4TSX A;  1Y64 A;  5SWM A;  3VQ4 A;  2BUP A;  5C25 A;  3T1A A;  1MIX A;  4WFN L;  3D0P A;  2FDQ A;  3P38 A;  3KHY A;  4CJR A;  4CBU A;  4O0I A;  4E1M A;  5CYQ A;  2EMS A;  2HBL A;  4BE1 A;  2V51 B;  4EP4 A;  2YJF A;  3J7Z O;  4IEE A;  3TSU A;  1UAX A;  2RQ1 A;  3OYA A;  3E9O A;  4O0J A;  1Q82 O;  2HMI A;  3ISN C;  1WSJ A;  1Q18 A;  1HX1 A;  3LDO A;  1DIK A;  1QZ6 A;  3TU5 A;  1Z6R A;  1T7P A;  3ZX2 A;  4FM1 A;  4E19 A;  4IZ9 A;  1NNE A;  4BRQ A;  3DLR A;  3SV4 A;  5AQZ A;  3AO2 A;  4H0Y B;  4CF9 A;  4BAC A;  1QVF M;  5FDL A;  4BRG A;  4CYE A;  3TAQ A;  3VTI A;  4LF5 K;  3SJH A;  3IAY A;  1NLV A;  3WXI A;  3ZT1 A;  4MO5 A;  1OH5 A;  1HNX K;  3LM9 A;  3NH2 A;  3NDK A;  3E01 A;  2P9P B;  3E9L A;  4FK0 A;  3A0I X;  3J80 O;  1B9F A;  1RDC A;  3CM6 A;  3LZI A;  3QO9 A;  3CJ1 A;  4M42 A;  3QES A;  3KWI A;  3OYN A;  1HJO A;  2E1Z A;  3F9M A;  4H0X B;  3P31 A;  4FWL A;  5GAE P;  4F4K A;  4GKJ K;  1Y97 A;  2E88 A;  3KWG A;  3L3U A;  1HLU A;  4RW9 A;  4YOX A;  4XH5 A;  4JI1 K;  4JKH A;  1RFQ A;  4CD1 A;  4CF8 A;  4DTP A;  1Q8I A;  2E4L A;  1MU2 A;  1TUU A;  1RDA A;  2HHU A;  1HYS A;  2DY4 A;  2XY7 A;  4B1V A;  3QBW A;  4FJK A;  2YKM A;  3ID8 A;  3SV3 A;  2ZJP L;  4EAH D;  2O4I A;  4BDY A;  4R5P A;  4B8A B;  5C2D A;  4WQ5 C;  4KHP K;  3KZB A;  1ASV A;  1L3T A;  5FPD A;  3K9J A;  3UKU A;  2P9K A;  2OCE A;  5EXW A;  4BRK A;  1XNQ K;  3WA0 A;  1QQM A;  4RCH A;  3KIO A;  3QNO A;  3VQP A;  4FXD A;  4ILJ A;  5ADX H;  3DXK A;  2GWJ A;  5LMU K;  4HUG A;  2R82 A;  3KKR A;  4JS4 A;  3F9K A;  4U7B A;  2A5X A;  4N5S A;  3KK1 A;  3CET A;  1L3S A;  1S1X A;  2PBD A;  5AZI A;  1QQO A;  3CQ8 A;  1NWK A;  3RTV A;  4DSJ A;  3J8A A;  3NAE A;  1NKE A;  1KCF A;  1WNS A;  3RR8 A;  3DI6 A;  1BUP A;  1GLL O;  4FWR A;  3NF7 A;  1HKC A;  1CXU A;  4ISE A;  2DPN A;  2Z1I A;  3D45 A;  3ZSY A;  3K59 A;  4JKA A;  1QSL A;  4E1N A;  1BO5 O;  5AR0 A;  4IKF A;  4KRE A;  5HP1 A;  3EE9 A;  4PHT X;  3VA0 A;  4FJG A;  3DRS A;  3E9P A;  2KFN A;  4AM7 A;  3SK3 A;  2RHK A;  3ZX3 A;  3M8S A;  2UUB K;  3O1B A;  1J9A A;  5EOY A;  3EKU A;  1GC7 A;  1VSJ A;  4YOY A;  4DV6 K;  3P1G A;  2AJQ A;  1BI4 B;  4CF2 A;  4I2Q A;  1KSP A;  3HPH A;  1KVB A;  3SQ2 A;  4K0K K;  4UQG A;  4JI7 K;  2E8A A;  1VQ6 N;  2V7Y A;  3VQ5 A;  1YUW A;  3QEV A;  4FK2 A;  4DCH A;  4DV4 K;  4U67 L;  4JI2 K;  3O6W A;  2YHX A;  3FR0 A;  3M5R A;  3VQQ A;  1C1B A;  4BC2 A;  1QSS A;  1NK5 A;  4H5R A;  2WTU A;  3I33 A;  4FL9 A;  4OPA A;  1FXX A;  4N76 A;  1S1W A;  4DR2 K;  4MLE A;  3AVK A;  3QER A;  4Z94 A;  4FJ7 A;  3T3F A;  1GC6 A;  1BOT O;  5HRR A;  2G8I A;  1YJ9 N;  2Q97 A;  4QS9 A;  3QEW A;  1WBB A;  5FRM A;  1VQN N;  4QS8 A;  1Q9X A;  5JLF A;  4JK8 A;  1Q9Y A;  3RMB A;  2HHX A;  4FSV A;  4IFE A;  1YHQ N;  4GV9 A;  2E6M A;  4AHR A;  2ZGY A;  1HNW K;  2ITG A;  4FLT A;  4BE0 A;  4J2A A;  5AQK A;  3K2P A;  4YOU A;  4BRD A;  3ASM A;  4GW6 A;  1R59 O;  3ZDT A;  1VQ5 N;  4ICL A;  4FLY A;  3VPZ A;  3N4P A;  3BUZ B;  1ZBS A;  4I6M A;  5BRH A;  5AQX A;  2ASP A;  5F2R A;  3CXC M;  1MK9 B;  3ZT4 A;  3AA3 A;  4W5T A;  2DFF A;  4ELU A;  2Q0U A;  1FJG K;  3PX0 A;  1VQ9 N;  4I9Q A;  3WNH A;  1KFD A;  4FJL A;  4JKD A;  3MEC A;  3L4Q A;  4H0O A;  1JLC A;  2GBZ A;  5LJW A;  2YX6 A;  5D3G A;  3EZW A;  2KFZ A;  4GNI A;  3CJC A;  1ATN A;  5HRO A;  3UIQ A;  3VQ8 A;  2HMP A;  1VSK A;  1K73 O;  3H46 O;  1S1V A;  1VSD A;  1X3M A;  1XHX A;  4Z0U A;  1NMN A;  4F8R A;  2QXF A;  1XUP O;  4E0D A;  1E4F T;  3GDQ A;  5FRN A;  3U9Z A;  1YJW N;  4M63 C;  1NGA A;  4FWO A;  1MA9 B;  4J8F A;  2JWK A;  4HUF A;  1HB6 A;  1U4B A;  4CFD A;  1ATR A;  3OJS A;  1YT3 A;  2G8W A;  1ATS A;  3IDH A;  4F9O A;  2YNI A;  3DLB A;  3OS2 A;  2FSN A;  3AVG A;  4CHN A;  2AL6 A;  4BRH A;  4NYF A;  1EET A;  1MWK A;  4Z4G A;  4JNE A;  1WSG A;  2EMT A;  2ASO A;  4FOE A;  1EWR A;  3KVG A;  4I7F A;  1GG3 A;  4EHU A;  3SAH A;  4CK1 A;  3MED A;  4CER A;  4CJW A;  4FJI A;  4KKO A;  3J7Y P;  3ULE A;  4CHO A;  3AVN A;  2E5L K;  4FJ5 A;  4CE9 A;  1TAU A;  5EVZ A;  5BN9 A;  4I6M B;  4MFB A;  4QCL A;  4DFM A;  3LDL A;  3CF5 L;  1GLB G;  5FRO A;  2O8E B;  3OS0 A;  1VBH A;  1TV6 A;  1XC3 A;  2Q2R A;  2QWR A;  3VF2 A;  1QE1 A;  2WOM A;  3O8M A;  4PL7 A;  4CGI A;  1C1C A;  4BQZ A;  2FF6 A;  5I3U A;  3ZSR A;  2P9I A;  1X3N A;  1HYZ A;  3DXM A;  1VQL N;  4KBO A;  4CFB A;  3U6F A;  1W9H A;  4JAX A;  3CFO A;  3T1Y K;  3ALY A;  3LP2 A;  4IOX A;  1TGO A;  2UUA K;  4HDO A;  4FJ8 A;  3CD6 N;  4OJR A;  4C8N A;  1RT2 A;  5GIN A;  2G8U A;  4CJU A;  4CEQ A;  4ISF A;  2J4R A;  1YAG A;  3K57 A;  3QB0 A;  1JCE A;  4CIF A;  4DQP A;  1S9E A;  3AGK A;  5F1X A;  1GOB A;  3LL3 A;  4B1U B;  3R8E A;  3OHR A;  3CCU N;  4DB3 A;  4AHU A;  2YHB A;  5IWA K;  3QBX A;  3RSE A;  1I3A A;  4CED A;  2BDP A;  5JLH A;  3AVB A;  2O8F B;  2HST A;  4DQI A;  3ATU A;  3ATV A;  3O4N A;  1C1A A;  4DTJ A;  4FLX A;  2FBX A;  3NVM A;  3AVH A;  4FVU A;  1N36 K;  4CZI A;  3AO5 A;  4CW7 B;  1S6P A;  5FPE A;  1ST7 A;  1YTU A;  2G8F A;  4KH5 A;  3LP1 A;  1L5U A;  1N6Q A;  5HRS A;  1QHA A;  3THY A;  2QKB A;  1BA1 A;  5AQF A;  4CEA A;  1WOQ A;  3VGL A;  2ZE2 A;  2EWS A;  4DS5 A;  3RWU A;  1ASU A;  1GLC G;  2QWL A;  1QTM A;  4Z4C A;  4BC4 A;  2CGL A;  2W6K A;  1MK7 B;  1BCO A;  2QTD A;  4O55 A;  3OYJ A;  4DU3 A;  2KHO A;  2FBV A;  4QS7 A;  4C23 A;  1HMV A;  4J2E A;  4H5V A;  3VA3 A;  1SS6 A;  1JXB A;  1JJ2 M;  4LF9 K;  3A5N C;  2G8V A;  3LDN A;  2VCP A;  1TK0 A;  1NBW A;  1NJW A;  3V6D A;  2O8F A;  3U8Z A;  1KAX A;  1RBT A;  2G8H A;  2F8T A;  2P9P A;  1IG8 A;  2B4J A;  3QEP A;  3R3L A;  2CGK A;  3K5L A;  3BF3 A;  3CJ9 A;  3KTQ A;  1LOT B;  3V9U A;  4J2D A;  4V19 S;  3HBT A;  4BRO A;  3AVM A;  1U04 A;  2HBJ A;  2D4W A;  5KPZ A;  3HZ6 A;  1EP4 A;  1U2V A;  4CBX A;  3SAG A;  4IO8 A;  3C95 A;  2UYT A;  3KLI A;  4FW2 A;  4CJK A;  1VRT A;  2GX9 A;  3CC2 N;  4B9S A;  1TKX A;  4RW4 A;  2DTU A;  1X9J A;  4A5A A;  2NRR A;  4JD2 B;  4AIL C;  1RBU A;  1IKW A;  4JKF A;  4KPY A;  3EL2 A;  3VN5 A;  1XHZ A;  1ZYQ A;  3L2Q A;  4NY0 A;  4N47 A;  3ZET A;  4CZG A;  3WEE A;  4BR7 A;  1LV5 A;  1JCF A;  3O5B A;  3QLH A;  4BDP A;  1VQ7 N;  1VSE A;  1NU0 A;  1IG9 A;  4FZZ A;  2NRZ A;  3G10 A;  1GOC A;  4JD2 A;  4DSK A;  4DQR A;  1IBK K;  1J54 A;  1NGF A;  3JS6 A;  4YDU C;  4JI0 K;  2HE7 A;  4O8U A;  5AQY A;  1RBS A;  1L3U A;  1LW0 A;  3VER A;  1U6Z A;  3FE1 A;  4CF0 A;  2ETJ A;  3S3M A;  3BZK A;  2DIK A;  1IJJ A;  2ZQB A;  2HND A;  4DV3 K;  4C8L A;  1VQM N;  3EO3 A;  4JRQ A;  1HBK A;  3O9U A;  4C1N K;  4BRC A;  5J2P A;  3THV A;  5AZI B;  3BZC A;  2F8S A;  3OYE A;  2P9K B;  4CD3 A;  1HJR A;  4LD0 A;  4KAZ A;  3MX2 A;  2FLO A;  2YCH A;  5AQS A;  1DTQ A;  3CCE N;  3L3V A;  5C2F A;  4K43 A;  4OPK A;  1ZC6 A;  4MDA A;  4CZM A;  1BDG A;  2AEH A;  4YOR A;  3EYZ A;  2PZS A;  4CJ5 A;  1SKS A;  1U47 A;  4FPA A;  3A8Y A;  4NYN A;  2NZT A;  3CCL N;  3WNE A;  5AQH A;  5DM7 L;  3HPO A;  3WUH A;  2NRW A;  1RDD A;  2P9N B;  1CLQ A;  2A42 A;  4ID1 A;  4WFB L;  3GG4 A;  1VBG A;  1HKG A;  3QIP A;  4IO9 L;  4FJ9 A;  1L3V A;  5K14 A;  4ILH A;  1C0F A;  1D9F A;  4FM2 A;  2NRV A;  4P7I A;  3OYD A;  4JKC A;  4AF1 A;  3S3O A;  1T44 A;  2FC0 A;  5AQQ A;  3L2U A;  4Z4I A;  3KKS A;  1JLF A;  1TUY A;  2I7N A;  4W5N A;  3H45 C;  3K0S A;  4FJX A;  3QEI A;  3AO1 A;  3ENH A;  3PVL A;  1BI4 A;  1A5W A;  4CEE A;  1RTD A;  1U49 A;  1T3V A;  4IJN A;  3ULE B;  4IFV A;  4N41 A;  3FZM A;  4WFA L;  4PL8 A;  1U48 A;  2D1K A;  4BVP A;  3SI6 A;  4DR4 K;  1HUX A;  1ITG A;  1SGH A;  2GUP A;  5AQV A;  4EHT A;  4DV0 K;  4B3S K;  2ZGZ A;  4X62 K;  4Z4H A;  2VG6 A;  2Z1H A;  1WSI A;  3ENB A;  1NGJ A;  3A5O C;  3BGR A;  3FFK B;  2RF2 A;  4WQ4 C;  1NGE A;  2A3Z A;  3OYI A;  1J5E K;  1NI2 A;  4DF4 A;  1T8E A;  1TK5 A;  1M1K O;  2BH1 A;  3O4W A;  2CH6 A;  3DOL A;  1U2V B;  4DFK A;  1YTA A;  1JLB A;  3OYM A;  2YJE A;  3ENO A;  1FKP A;  3HM8 A;  3SPY A;  1N34 K;  5LY3 A;  1UA0 A;  3RMC A;  1C0G A;  3G9W A;  1KLM A;  3HL8 A;  3OTO K;  4B9L A;  2E2P A;  5C42 A;  4GXB A;  4CJ7 A;  5GAG P;  1K6Y A;  1KTQ A;  1VHX A;  2VWJ A;  4FPB A;  4CBW A;  3UE5 A;  3ZSQ A;  5SZT A;  1SL1 A;  1JXE A;  3U9D A;  2IIR A;  3O08 A;  2VGM A;  3QFP A;  3CQY A;  4NLC A;  4BQL A;  3VEZ A;  1EX4 A;  4KTW A;  1HNZ K;  4L8R B;  2QA4 N;  5BPN A;  4HWI A;  3OYB A;  3NBP A;  4F2S A;  4CI6 A;  4Y1D A;  1G15 A;  3LWL A;  3A5L C;  4XEI A;  3VQ9 A;  4CZF A;  4E7L A;  1WB9 A;  1BIU A;  1UWB A;  4BRM A;  3OYH A;  5F0X A;  2ZJR L;  4B1X B;  3C6A A;  1KD1 O;  3ZEU B;  3DYA A;  1U45 A;  1ESV A;  3LAL A;  5KGX A;  2ZM6 K;  3DWL A;  4CJS A;  1S1T A;  3HPG A;  1NK7 A;  1S1U A;  4B08 A;  3FZL A;  4EKU A;  3O1W A;  3PV8 A;  2GUI A;  5C24 A;  2NRH A;  4BY9 C;  3VQD A;  1NG9 A;  3R1X A;  2EHG A;  2ASM A;  4DG1 A;  1IKV A;  3FZH A;  1RBV A;  3NGZ A;  3O3F A;  4E7H A;  3AVF A;  3TTD A;  1TYQ B;  1H4R A;  5JIC A;  3MN6 A;  3T7Z A;  4H03 B;  3CI5 A;  3F2K A;  3BIN A;  3WQT A;  4DSE A;  4IBN A;  1TKZ A;  3C0B A;  3PY8 A;  3W0L A;  4B3R K;  3ITH A;  2X0S A;  2J0M A;  4Y1C A;  2OPS A;  5J2N A;  1EO1 A;  2E6L A;  4X66 K;  1WAF A;  4DU1 A;  3VES A;  3IUC A;  4LF7 K;  4M3T A;  2PFU A;  2A40 A;  2V52 B;  4DTS A;  2UXD K;  3W3D A;  4CJP A;  4DR3 K;  4H0V B;  4O8K A;  4H0P A;  4BC3 A;  3THX B;  4CJQ A;  4NB4 A;  3I8B A;  4NO7 A;  4KHQ A;  3Q7B A;  4LFB K;  4OKE A;  4LSL A;  4OGE A;  4DFP A;  4BRP A;  5AQJ A;  1MIZ B;  4GMJ B;  2QW9 A;  4NXM K;  4BRE A;  4LC9 B;  3ZT3 A;  3HT3 A;  4GY2 B;  3QIO A;  2VG7 A;  3L4I A;  3QIC A;  2Q36 A;  4DUZ K;  1MDU B;  1HKB A;  2W6L A;  3ZX0 A;  4B3T K;  4CEB A;  1NKC A;  1TYQ A;  2Z1G A;  2HB5 A;  1RT7 A;  1T6D A;  4FO0 A;  3GL1 A;  5CY4 A;  1HQU A;  4NCG A;  3PSI A;  5M1Q A;  4OPJ A;  2HHQ A;  4CEC A;  4NXN K;  5C15 A;  4CZK A;  3T19 A;  4FOI A;  4DV2 K;  3K5M A;  5KTQ A;  1KVC A;  4RW8 A;  4DLG A;  3SPZ A;  2QWQ A;  1W2B M;  2O8E A;  4BRF A;  2HHS A;  3P83 D;  4H0T B;  1KFS A;  2BTF A;  3EPY A;  3M3Z A;  4BG9 A;  3QFU A;  1TL1 A;  3ZCM A;  3FLV A;  5TKY A;  5JMV A;  1X9W A;  1N8R O;  5HOO A;  4BWM A;  3AAR A;  1J6Z A;  2D2Q A;  4AHC A;  4IWV A;  3FLC O;  2HHH K;  3THY B;  1EF1 A;  1SV5 A;  3UKR A;  3D2E B;  4CIE A;  4DKW A;  4A5B A;  4BG8 A;  4CHQ A;  3LDQ A;  1JLA A;  2PYL A;  4KI6 A;  1S5J A;  5AQI A;  4WF9 L;  1S72 N;  3H1Q A;  3R6M A;  1QZ5 A;  3OYG A;  2X6N A;  2GEM A;  4DU4 A;  2P5G A;  4GV6 A;  3QEX A;  1LWE A;  1N5Y A;  1KAY A;  2D0O A;  1RDU A;  1EXQ A;  3O9S A;  4BGA A;  3E66 A;  3VF4 A;  3BF1 A;  3WNG A;  2G8K A;  4J2B A;  4HUE A;  4JRP A;  1NK4 A;  4N56 A;  2B5J A;  4XIU A;  2AP1 A;  4KTQ A;  4FZX C;  4CJL A;  3TAF A;  1FK9 A;  1REV A;  1LWC A;  5M1N A;  1GLJ O;  1WSF A;  4JEP A;  3L2V A;  2HVH A;  4H5W A;  4K8X A;  3G6E N;  3SZ2 A;  3MN5 A;  1IBL K;  1YVU A;  1IH7 A;  1YVN A;  1B92 A;  4C8K A;  5BRD A;  1UA1 A;  1CZ9 A;  3IRX A;  3VQ7 A;  1DKG D;  3OBY A;  3PO5 A;  3VOV A;  2VG5 A;  1VSH A;  3K9K A;  2GWK A;  5CR4 A;  2A1R A;  4KH4 A;  2RPI A;  2QM1 A;  1NKB A;  2GV9 A;  1DLO A;  3JAM O;  2KQ2 A;  3K58 A;  3CC7 N;  2OPQ A;  3BY5 A;  1DTT A;  1RTJ A;  2HF3 A;  4CEO A;  2KZM A;  3FP5 A;  1H1V A;  4JV5 K;  2Y1I A;  4CF1 A;  2O8C B;  4JHD A;  3OYL A;  4K42 A;  1XMQ K;  3AU4 A;  3L8B A;  2NLX A;  3LAN A;  5I42 A;  3SQ0 A;  3LP0 A;  4CFC A;  2A1S A;  1NGB A;  2E2Q A;  3B8A X;  3ZET B;  2QXL A;  2VQE K;  1XQS C;  5BPM A;  4DV5 K;  4DTM A;  4UY8 O;  5AQU A;  3MX5 A;  4B9U A;  2E20 A;  1XMO K;  5EY4 A;  5AJ3 K;  4I2P A;  4B9V A;  4CJE A;  3B6P A;  4JK9 A;  4KV8 A;  1HB8 A;  3IKM A;  3UKU B;  2QWO A;  3MWT A;  3A2F A;  3P5J A;  4FYD A;  4CHP A;  5BR8 K;  3DLK A;  1YIT N;  4O5B A;  3TR8 A;  1OVQ A;  2CQU A;  1K9M O;  4Q5V A;  4CEZ A;  4BRL A;  2F9W A;  3OBW A;  1NJY A;  3V9Z A;  1RT3 A;  4ZHR A;  4FLV A;  1KLN A;  3THW A;  4IEI A;  4DTU A;  3IFR A;  5ADX A;  3IVF A;  4FJJ A;  3FZF A;  3RMD A;  5AQW A;  1C0U A;  3SUP A;  3O80 A;  2XY5 A;  2P51 A;  5HLF A;  1G99 A;  3KD1 E;  3G25 A;  3TAN A;  1WBD A;  4LH5 A;  1SUQ A;  2NUB A;  3LWM A;  1RIL A;  5KGW A;  2O8B A;  5JVG L;  4FK4 A;  2NNW A;  4CZL A;  1RTH A;  5CE3 A;  3HP6 A;  1TKD A;  1TAQ A;  2OPR A;  2VWB A;  4A2B A;  2P9N A;  1M90 O;  1X9M A;  4PUO A;  1BWF O;  3CPE A;  5IT9 O;  3CJA A;  1UOC A;  2O4G A;  4A62 A;  1ILY A;  1VSM A;  1ZXO A;  5DK5 A;  2Y1J A;  1W97 L;  2D0A A;  3WQU A;  1LW2 A;  3L0Q A;  3U3G A;  3WEE B;  1JCG A;  1ZBU A;  3RRG A;  4Z4F A;  1C0T A;  4IXC A;  2XY6 A;  1NOZ A;  2I1J A;  4H5N A;  1SKR A;  3NGI A;  4FLW A;  4B9Q A;  1ZBI A;  4DWI A;  1IO2 A;  4IG0 A;  1HPZ A;  1K8A O;  3NGY A;  1QQN A;  3B6O A;  3EKS A;  1QSY A;  1QHT A;  1T05 A;  3FZK A;  3AA4 A;  2IC3 A;  3QIJ A;  1ACA A;  4CEF A;  1A5V A;  1RT6 A;  3KJV A;  4BRI A;  2PYJ A;  5E84 A;  4CFA A;  1JDE A;  1VK0 A;  5C0Y A;  5AFU A;  3S9H A;  3I0R A;  4H4O A;  1DEJ A;  4E7I A;  3L2R A;  3PLA A;  3MN9 A;  4W5O A;  4GVM A;  1E3M A;  2LBB A;  4RW6 A;  4DQ8 A;  3C7N A;  1KXP A;  4DQQ A;  4HDQ A;  1GLD G;  2W40 A;  3VEW A;  3SMP A;  5AZJ B;  2VGN A;  2A6A A;  5DM6 L;  4B3O A;  1S22 A;  4JKB A;  3OY9 A;  3KK2 A;  1BCM A;  2HHW A;  4JLH A;  3QNN A;  5KPR A;  4FCY A;  3CC4 N;  4KHU A;  3O3H A;  4RTF D;  4BDZ A;  1VAZ A;  2RE2 A;  2QWP A;  2A41 A;  1NGG A;  2FBT A;  4YHH K;  3DRP A;  1FKO A;  4BR9 A;  3ZEU A;  3VQB A;  4CZJ A;  3ZT2 A;  3MXM A;  3TTC A;  1GOA A;  4YDU A;  3J81 O;  1QS4 A;  1X1P A;  3DJC A;  3QML A;  4DSF A;  1BQM A;  3SQ4 A;  4ZTJ A;  3MEG A;  5J2Q A;  2HRJ A;  2QKK A;  4BVO A;  3HO1 A;  5IJM A;  4BRN A;  5J2M A;  3FFI A;  4HCB A;  4JYA K;  3WXJ A;  1RBR A;  3ZSX A;  4R79 A;  4IJA A;  4NLB A;  3LAK A;  1XNR K;  2F4V K;  2NRT A;  1BU6 O;  3HVR A;  2Q0R A;  3AU5 A;  3HST B;  3CFR A;  3S3N A;  3K5O A;  2HOE A;  3HXM A;  1N33 K;  3GBT A;  4H8K A;  1BG3 A;  4DR1 K;  4BR5 A;  1IKX A;  4K8Z A;  3NVK A;  2PY5 A;  2ATQ A;  1I39 A;  3MXJ A;  3HI0 A;  1GLA G;  5AZJ A;  1NGC A;  3AA2 A;  1D5A A;  3SAF A;  3HRG A;  4DR7 K;  1R0A A;  5JVH L;  3C6H A;  3N4Q A;  2JLE A;  4RW7 A;  4CGD A;  3OS1 A;  3VEO A;  3AAP A;  2CGJ A;  3G4S N;  4CGJ A;  3I56 N;  4Q0B A;  3OA9 A;  3NFA A;  1DGK N;  4YOV A;  4TKN A;  4CJ3 A;  5J1E A;  3CCJ N;  3OVN A;  4C1N I;  3HVT A;  3PO4 A;  2Q31 A;  3ZT0 A;  4ZTF A;  4EZ9 A;  1JLG A;  3TAM A;  3JYT A;  3EY1 A;  2XY8 A;  3LDP A;  3NF9 A;  1VQ8 N;  1CZA N;  3VTH A;  3TAE A;  4GV3 A;  3OYC A;  2YNH A;  3MCA B;  3NF6 A;  4DTO A;  4ZRJ A;  1GLE G;  5I9E B;  1IV0 A;  4WCE L;  3CYM A;  4CZH A;  4FLZ A;  4I9L A;  1D9D A;  4DSL A;  1FW6 A;  2KZZ A;  1N32 K;  1JLQ A;  4M45 A;  2VYP A;  1HNV A;  2FJ9 A;  1J19 A;  1NJI O;  1EQY A;  4FWP A;  3SBT A;  4G1Q A;  4Z4E A;  4WE1 A;  3C6U A;  2YV0 X;  4JI4 K;  2JWL A;  4M7X A;  5KPT A;  2R7Y A;  4PA1 A;  2P1J A;  1KC8 O;  4DSI A;  2ABD A;  4KO0 A;  4LSN A;  4FZY A;  3CFP A;  3CMA N;  3KLH A;  3HK2 A;  1GGO A;  1BA0 A;  1OKJ A;  1BIZ A;  2W41 A;  3ZLJ A;  4HTU A;  1SQK A;  1NK9 A;  2XO7 A;  2J0K A;  4JS5 A;  1RNH A;  4E7K A;  4OPH A;  4CGG A;  2WUS A;  3PX4 A;  3TPQ A;  3SNN A;  2QI2 A;  3H08 A;  5H1S Q;  3CCR N;  4PKG A;  1E4G T;  3JXU A;  4MQ3 A;  3BDP A;  4PKH A;  4AHT A;  3SUN A;  1XI1 A;  4B1Y B;  4IOC L;  3LPU A;  3D2E A;  1KAZ A;  4LFA K;  4EP5 A;  1SZ2 A;  1YJN N;  1NOY A;  3QIN A;  3P4I A;  3U4L A;  3OJU A;  5AQP A;  4LF8 K;  4JI6 K;  1NJZ A;  5FLX O;  3NHG A;  3DMJ A;  4DHY A;  4OKK A;  3VQC A;  3KLE A;  2F96 A;  4FVM A;  5C12 A;  1JL1 A;  2FSJ A;  3CPW M;  1EKE A;  1OVY A;  2NRX A;  2IAJ A;  3R9P A;  4BR4 A;  3NE6 A;  3OW2 M;  3DLG A;  3AO3 A;  4C8O A;  1KBL A;  5AQM A;  3FGU A;  5ELZ A;  4LH4 A;  1RGI A;  4K41 A;  4BWJ A;  3CCM N;  3VQA A;  1SAZ A;  4XH1 A;  3EN9 A;  1WN7 A;  4FWS A;  3MCP A;  2WBN A;  3TWH A;  3DXM B;  4BGB A;  5HRP A;  1OH6 A;  3MK6 A;  1NK8 A;  1Y19 B;  1OH8 A;  4KB1 A;  3VF6 A;  4Y0W A;  1F21 A;  1W7A A;  4JKG B;  3KK7 A;  3HTV A;  2DFH A;  3F5T A;  4F7G A;  4YFU A;  3ZSZ A;  2FSK A;  5LMN K;  4LF6 K;  2D10 A;  1XWL A;  3MXI A;  2LSN A;  2P9I B;  3KLG A;  1I94 K;  2WC9 A;  2QWN A;  3NH1 A;  2UU9 K;  2RKI A;  3C94 A;  4M7Y A;  4JHD B;  4AHS A;  1J5O A;  3GE1 A;  4QAG A;  4IDH A;  3C7N B;  2O8D B;  3VQ6 A;  4KI4 A;  4DR6 K;  3SUQ A;  3QDK A;  1VQO N;  1D8Y A;  2ITM A;  4FM0 A;  1NTI A;  3PX6 A;  2ZPY A;  1RCH A;  4LFC K;  3TAR A;  3C6T A;  1JLE A;  1Z26 A;  5DMR A;  1T03 A;  3ULD A;  3V81 A;  1HRH A;  5GAD P;  4AM6 A;  3HJF A;  5B8H A;  4KTZ A;  3LPT A;  4KHW A;  3DLE A;  5KRS A;  4E1J A;  1RT1 A;  3D2F B;  3UKR B;  2YHW A;  1MWM A;  4JKE A;  4CJT A;  4M3Y A;  3ZYY X;  4DUY K;  3NCI A;  4PWD A;  1KRP A;  3GOI A;  5M1F A;  4ELT A;  4O4G A;  2W42 A;  4M3X A;  2IGI A;  3OYF A;  1LAV A;  5FPN A;  2P9U B;  2CB8 A;  3S41 A;  3V9W A;  1NVL A;  3TAB A;  5JS1 A;  2F9T A;  4DTX A;  3TSQ A;  4M3W A;  4HTL A;  4OLB A;  3V4I A;  2WH5 A;  3SJJ A;  3THW B;  2ZF5 O;  1TKT A;  2EX3 A;  5AQN A;  4EIA A;  3MWP A;  1P8Z A;  3QET A;  2YVC A;  4FWN A;  3ZSO A;  3NMU A;  1HYV A;  5CZ2 A;  5AQT A;  4K25 A;  4JI5 K;  2P9S A;  2D0P A;  3CM5 A;  3PZD A;  3C65 A;  4DTN A;  2QEX N;  2UXB K;  3DM2 A;  3JSM A;  4X65 K;  4CK2 A;  4FWK A;  3VEX A;  3OYK A;  4CZE A;  4CIG A;  1A5X A;  3CCQ N;  3U3Y A;  3LAM A;  1O13 A;  4HHT A;  1E5W A;  2O8D A;  4GKK K;  2HVI A;  5CHI A;  3AO4 A;  1W0H A;  2OTJ N;  4FJM A;  3M8R A;  1GLF O;  4ILG B;  5M1O A;  4B1W B;  3O9Q A;  3EE8 A;  3MEE A;  4QOZ B;  5GIP A;  1WUA A;  3KK3 A;  3M1F A;  3TI0 A;  4JI3 K;  2IDO A;  4DR5 K;  4EFH A;  4YL8 A;  4FW1 A;  5KRT A;  3AVJ A;  4YY3 K;  4A59 A;  3O9R A;  2X6S A;  1VSF A;  5AFU H;  4CCH A;  4CHZ A;  3VET A;  1DT9 A;  1HNI A;  5JVL A;  2V7Z A;  3CG7 A;  3HSC A;  2X78 A;  1KQS M;  2D11 A;  2Q3S A;  3IG1 A;  3V1Q A;  2JGU A;  5CYM A;  2QWM A;  5M1K A;  4W5R A;  1NGH A;  4DS4 A;  4G9Z A;  4LY7 A;  1SL0 A;  3A5M C;  4DFJ A;  2IVP A;  5HBM A;  3KLF A;  3HYF A;  3VEV A;  2D0B A;  1NMD A;  3RR7 A;  2CH5 A;  2KW4 A;  4YOT A;  3U8X A;  2YKN A;  3P39 A;  4CK3 A;  5TKW A;  2P9S B;  3SMS A;  2OZS A;  4OLA A;  3H3O B;  4MLH A;  3VGK A;  5BRF A;  4ISG A;  5AQL A;  4A57 A;  2IOC A;  4HCC A;  3DAW A;  4DLE A;  5AQO A;  1EWQ A;  3LZJ A;  3O4Q A;  4B1Z A;  3MN7 A;  5BN8 A;  4FWQ A;  1RDB A;  2X74 A;  1JL2 A;  4EZ6 A;  5EU7 A;  4BRA A;  4DV7 K;  3CJB A;  1ASW A;  3PIO L;  4HVJ A;  5KQD A;  4JI8 K;  2OPP A;  3G0Z A;  3SLC A;  1HPM A;  5LJV A;  1RDW X;  3I0S A;  2Z1J A;  2HHT A;  5T7B A;  2O8B B;  3RRH A;  4M41 A;  4WYB A;  4KB0 A;  4PKI A;  4DV1 K;  4OO1 J;  2IVN A;  2BGG A;  3Q7C A;  2OAN A;  1ZBL A;  3DLL L;  4A2A A;  1QQC A;  2VWK A;  2WFB A;  3L6Q A;  4DTR A;  2E2N A;  3SBG A;  3LM2 A;  5E26 A;  3DXK B;  3PUF A;  4IDK A;  1LAW A;  4F3T A;  4CES A;  1RT5 A;  2HBM A;  4OVL A;  2F7T A;  3X23 A;  1WSH A;  1BGX T;  5BPL A;  3V9S A;  2QK9 A;  3AV9 A;  2XRI A;  3MDQ A;  4CHY A;  1HR0 K;  4A61 A;  3NH0 A;  2D0C A;  1C6V A;  3VEN A;  4OGC A;  3HOT A;  4KRF A;  4F3O A;  2E2O A;  2OZM A;  1XC9 A;  3O9T A;  4AHV A;  3G71 N;  2FF3 B;  3MMV A;  2IS3 A;  3RSE B;  4W5Q A;  4FJH A;  2GTD A;  4RG8 A;  2I7P A;  3PIP L;  2VQF K;  1QVG M;  1T6C A;  3TSP A;  4GVE A;  3CCS N;  3WT0 A;  3UB5 A;  1IKY A;  1B9D A;  4OKJ A;  3CJ7 A;  1RTI A;  2D5R A;  3H3N O;  3HP9 A;  1VQK N;  3K5N A;  1VQ4 N;  4ID5 A;  1V4T A;  1WAJ A;  3EZ5 A;  2HBK A;  5GIO A;  1BQN A;  3CCV N;  3M6G A;  3I55 N;  3PSF A;  3V9X A;  3NF8 A;  3D7E O;  2WON A;  2YNG A;  3IS9 A;  4MDB A;  3EEQ A;  2H3G X;  4H5T A;  1TL3 A;  4NCB A;  3D6R A;  4X64 K;  3E1Y A;  1NK0 A;  3BEX A;  2Q1N A;  4F2R A;  3L2W A;  5BR9 A;  4KHY A;  4JN4 A;  4E89 A;  5E41 A;  3MAQ A;  1NGD A;  1BHL A;  3DOK A;  4BE2 A;  1CXQ A;  2RN2 A;  5FPM A;  2BE2 A;  2YI1 A;  2AA4 A;  3WNF A;  5GAH P;  4ELV A;  3RVC A;  5KI6 A;  4DMN A;  4DF8 A;  2YNF A;  1WSE A;  1O1W A;  3DRR A;  1VSL A;  2E1Y A; 
#chains in the Genus database with same CATH homology
 3W3D A;  4H0V B;  4O8K A;  4H0P A;  4BC3 A;  2FSN A;  3VGM A;  4ZRK A;  2JWL A;  4NB4 A;  3I8B A;  4M7X A;  4NO7 A;  5KPT A;  3Q7B A;  3H6E A;  3AY9 A;  2AL6 A;  4BRH A;  1S3X A;  4BC5 A;  1KC8 O;  4BRP A;  5C10 A;  2ABD A;  5AQJ A;  1MIZ B;  1V4S A;  1D4X A;  2QW9 A;  1YF5 L;  5AQR A;  1MWK A;  4BRE A;  4LC9 B;  4JNE A;  2EMT A;  2ASO A;  4FOE A;  3ID6 A;  3KVG A;  2HF4 A;  3WXK A;  4WQ5 A;  3CMA N;  1GG3 A;  4GY2 B;  4EHU A;  3L4I A;  3SAH A;  1GGO A;  3QIC A;  2Q36 A;  1BA0 A;  1MDU B;  1NM1 A;  1HKB A;  1OKJ A;  3CQX A;  3ULE A;  4ZRI A;  2W41 A;  3ZX0 A;  5F1X A;  1KC7 A;  2IVO A;  1SQK A;  3H1V X;  1TYQ A;  4L3Q A;  1T6D A;  5EVZ A;  5BN9 A;  4I6M B;  2J0K A;  4FO0 A;  3GL1 A;  3LDL A;  5BRE A;  1K8K B;  3CF5 L;  1GLB G;  4BR0 A;  4OPH A;  4KH6 A;  2WUS A;  2J0J A;  3HOS A;  3TPQ A;  2ZJQ L;  3WXM B;  1VBH A;  1XC3 A;  2Q2R A;  2QI2 A;  2QWR A;  3VF2 A;  5H1S Q;  5M1Q A;  3CCR N;  2KKZ A;  3O8M A;  4PKG A;  1E4G T;  4FWM A;  5C15 A;  4PL7 A;  4CZK A;  1VQP N;  4BQZ A;  2FF6 A;  3JXU A;  2P9I A;  4FOI A;  1X3N A;  3DXM A;  4PKH A;  1VQL N;  2P9L B;  4KBO A;  4B1Y B;  4IOC L;  3D2E A;  1KAZ A;  4JAX A;  1SZ2 A;  1YXQ A;  4IOX A;  1YJN N;  4HDO A;  5MLC Q;  2PAV A;  3CD6 N;  3P4I A;  2QWQ A;  1Q86 O;  3U4L A;  1W2B M;  5GIN A;  4BRF A;  1Z05 A;  5AQP A;  4JKG A;  4BR2 A;  1Q81 O;  4H0T B;  4IOA L;  2BTF A;  2J4R A;  1YAG A;  1P90 A;  3EPY A;  4ISF A;  3M3Z A;  4BG9 A;  4WQ4 A;  3QB0 A;  3QFU A;  3FLV A;  5TKY A;  1JCE A;  4DHY A;  5JMV A;  4YOW A;  1N8R O;  5HOO A;  3VEY A;  3IMX A;  3AAR A;  5C12 A;  4RWT A;  1J6Z A;  3AGK A;  2D2Q A;  5M1P A;  3T69 A;  4IWV A;  3FLC O;  2FSJ A;  1EF1 A;  2P9L A;  3D2F A;  3LL3 A;  3R8E A;  3UKR A;  3VMF B;  3OHR A;  3CHW A;  4B1U B;  4DB3 A;  3CPW M;  3CCU N;  1OVY A;  3U7D A;  3D2E B;  2COP A;  2NRX A;  3R9P A;  4BR4 A;  3QBX A;  3RSE A;  4DKW A;  3AAQ A;  3OW2 M;  4A5B A;  5JLH A;  4BG8 A;  4JK7 A;  1KBL A;  3LDQ A;  5AQM A;  2HST A;  3FGU A;  2OTL N;  5ELZ A;  3CME N;  3ATU A;  3ATV A;  5EX5 A;  4XH4 A;  2YHY A;  5AQI A;  4WF9 L;  1S72 N;  1RGI A;  3H1Q A;  4K41 A;  3R6M A;  2KLA A;  1QZ5 A;  3NVM A;  4DXA B;  2GEM A;  3CCM N;  1SAZ A;  4XH1 A;  4FVU A;  3EN9 A;  4FWS A;  4GV6 A;  3WXL A;  4CZI A;  3MCP A;  5FPE A;  2WBN A;  1ST7 A;  4KH5 A;  3DXM B;  4BGB A;  1KAY A;  1QHA A;  2D0O A;  1BA1 A;  2FXU A;  5AQF A;  1YIJ N;  1RDU A;  4BGA A;  3O9S A;  1WOQ A;  3E66 A;  3MK6 A;  3VGL A;  3VF4 A;  1VQN N;  2EWS A;  1K8K A;  3BF1 A;  1Y19 B;  3CER A;  3TTF A;  1GLC G;  1NGI A;  2QWL A;  5HL7 L;  3VF6 A;  4Y0W A;  5KQ8 A;  4BC4 A;  1Q7Y O;  2CGL A;  4JKG B;  3KK7 A;  3HTV A;  3F5T A;  1MK7 B;  2QTD A;  2ZWH A;  2AP1 A;  2KHO A;  4F7G A;  1LCU A;  1YI2 N;  3BP8 A;  2FSK A;  2P9U A;  4QS7 A;  2I1K A;  4C23 A;  5AQG A;  3CIP A;  5M1N A;  2D10 A;  4H5V A;  1GLJ O;  4JEP A;  1SS6 A;  4H5W A;  1JJ2 M;  2P9I B;  3G6E N;  3MN5 A;  2WC9 A;  3A5N C;  2QWN A;  4O5F A;  1YVN A;  2VCP A;  3LDN A;  2GEL A;  4M7Y A;  4JHD B;  5BRD A;  1ISN A;  3GE1 A;  4IDH A;  1DKG D;  3AGR A;  3C7N B;  1NBW A;  4MO4 A;  3OBY A;  3VOV A;  3K9K A;  2GWK A;  1Y64 A;  5CR4 A;  4KH4 A;  3QDK A;  3U8Z A;  2QM1 A;  1VQO N;  1KAX A;  2ITM A;  1NTI A;  2BUP A;  2P9P A;  1MIX A;  4WFN L;  2ZPY A;  1IG8 A;  2FDQ A;  3P38 A;  3KHY A;  4CBU A;  3R3L A;  2CGK A;  3CC7 N;  5GAD P;  3BF3 A;  4AM6 A;  3CJ9 A;  5B8H A;  2HF3 A;  1LOT B;  2EMS A;  4E1J A;  3FP5 A;  1H1V A;  3D2F B;  2HBL A;  3HBT A;  4BRO A;  3UKR B;  2YHW A;  1MWM A;  4JKE A;  2V51 B;  2HBJ A;  4JHD A;  2D4W A;  3ZYY X;  3HZ6 A;  2YJF A;  5KPZ A;  4K42 A;  1U2V A;  4CBX A;  3AU4 A;  3SAG A;  4IO8 A;  3J7Z O;  2NLX A;  4IEE A;  3GOI A;  5M1F A;  3TSU A;  3B8A X;  1NGB A;  2E2Q A;  2UYT A;  3ZET B;  2QXL A;  2RQ1 A;  3E9O A;  1XQS C;  1Q82 O;  5FPN A;  5BPM A;  4UY8 O;  5AQU A;  1Q18 A;  1HX1 A;  3MX5 A;  2P9U B;  1DIK A;  2CB8 A;  1QZ6 A;  1Z6R A;  2GX9 A;  2E20 A;  3LDO A;  3S41 A;  5EY4 A;  3TU5 A;  1NVL A;  3ZX2 A;  3CC2 N;  2F9T A;  4IZ9 A;  4BRQ A;  3TSQ A;  1X9J A;  4HTL A;  2NRR A;  4JD2 B;  4A5A A;  5AQZ A;  2WH5 A;  4H0Y B;  4JK9 A;  1QVF M;  1HB8 A;  2ZF5 O;  4EIA A;  5AQN A;  4JKF A;  4CYE A;  4BRG A;  3IKM A;  3MWP A;  3UKU B;  3VTI A;  1P8Z A;  2QWO A;  3MWT A;  2YVC A;  3EL2 A;  3SJH A;  4FWN A;  4NY0 A;  3NMU A;  1NLV A;  3WXI A;  1YIT N;  3ZET A;  4MO5 A;  4CZG A;  3LM9 A;  5AQT A;  3WEE A;  4BR7 A;  4K25 A;  2P9P B;  2P9S A;  1JCF A;  2D0P A;  3PZD A;  3O5B A;  3E9L A;  3C65 A;  2CQU A;  1K9M O;  3A0I X;  2QEX N;  1VQ7 N;  4BRL A;  2F9W A;  2NRZ A;  3OBW A;  4FWK A;  3CJ1 A;  3VEX A;  4CZE A;  4JD2 A;  3CCQ N;  3KWI A;  1HJO A;  4IEI A;  1NGF A;  1O13 A;  3IFR A;  3JS6 A;  3IVF A;  4YDU C;  3FZF A;  5ADX A;  2E1Z A;  1E5W A;  5CHI A;  3F9M A;  4H0X B;  2HE7 A;  4O8U A;  5AQY A;  5AQW A;  2OTJ N;  3O80 A;  3VER A;  1GLF O;  1U6Z A;  3FE1 A;  3P31 A;  1G99 A;  3G25 A;  4ILG B;  5M1O A;  4B1W B;  3O9Q A;  4FWL A;  5GAE P;  3EE8 A;  5JVG L;  2E88 A;  2DIK A;  2NNW A;  1IJJ A;  4CZL A;  3KWG A;  5CE3 A;  1HLU A;  5GIP A;  1VQM N;  4YOX A;  1WUA A;  3M1F A;  3EO3 A;  1HBK A;  3O9U A;  4C1N K;  2VWB A;  4A2B A;  2P9N A;  4XH5 A;  4BRC A;  5AZI B;  1M90 O;  1BWF O;  3CPE A;  4JKH A;  2P9K B;  4EFH A;  1RFQ A;  3CJA A;  4A62 A;  4CD1 A;  1ILY A;  4YL8 A;  4CD3 A;  1TUU A;  1ZXO A;  1W97 L;  4A59 A;  3O9R A;  3WQU A;  3L0Q A;  3MX2 A;  2FLO A;  4B1V A;  2YCH A;  5AFU H;  3QBW A;  1JCG A;  5AQS A;  1DT9 A;  3VET A;  3WEE B;  3CCE N;  3ID8 A;  5C2F A;  4IXC A;  4K43 A;  2ZJP L;  2I1J A;  1ZC6 A;  4EAH D;  5JVL A;  4MDA A;  4CZM A;  1BDG A;  2V7Z A;  2AEH A;  3HSC A;  4YOR A;  4H5N A;  1KQS M;  2D11 A;  4FPA A;  3A8Y A;  4B9Q A;  2NZT A;  3CCL N;  5C2D A;  4WQ5 C;  5AQH A;  5DM7 L;  2QWM A;  5M1K A;  1K8A O;  1NGH A;  3WUH A;  1QQN A;  2NRW A;  4G9Z A;  2P9N B;  3A5M C;  3KZB A;  5FPD A;  3K9J A;  2A42 A;  3UKU A;  2P9K A;  2IVP A;  4WFB L;  3EKS A;  3GG4 A;  1VBG A;  5EXW A;  4BRK A;  3VEV A;  3WA0 A;  3FZK A;  1HKG A;  1NMD A;  2CH5 A;  1QQM A;  4YOT A;  4RCH A;  3QIJ A;  3U8X A;  4IO9 L;  1ACA A;  3P39 A;  4ILJ A;  5ADX H;  3DXK A;  2GWJ A;  4ILH A;  5TKW A;  4BRI A;  2P9S B;  2R82 A;  1C0F A;  5E84 A;  3SMS A;  2NRV A;  1JDE A;  4P7I A;  4JKC A;  3H3O B;  4AF1 A;  1T44 A;  4MLH A;  5AQQ A;  3VGK A;  4U7B A;  5AFU A;  2A5X A;  5C0Y A;  5BRF A;  1TUY A;  4ISG A;  5AQL A;  4A57 A;  2I7N A;  3CET A;  3DAW A;  3H45 C;  1DEJ A;  5AQO A;  2PBD A;  3PLA A;  4B1Z A;  3ENH A;  3PVL A;  1QQO A;  1NWK A;  3MN7 A;  3MN9 A;  5AZI A;  5BN8 A;  3J8A A;  4FWQ A;  1T3V A;  4IJN A;  3ULE B;  2LBB A;  4BRA A;  4DQ8 A;  3C7N A;  1KXP A;  4HDQ A;  3CJB A;  1GLD G;  2W40 A;  1BUP A;  1GLL O;  3FZM A;  4FWR A;  1HKC A;  3VEW A;  5KQD A;  3PIO L;  4WFA L;  3SMP A;  4PL8 A;  5AZJ B;  4ISE A;  2DPN A;  2VGN A;  2D1K A;  3SLC A;  2A6A A;  1HPM A;  4BVP A;  5DM6 L;  1S22 A;  4JKA A;  1HUX A;  5LJV A;  1RDW X;  1SGH A;  1BO5 O;  4JKB A;  5AR0 A;  2GUP A;  4WYB A;  3EE9 A;  5AQV A;  4PHT X;  4EHT A;  4PKI A;  3E9P A;  2ZGZ A;  4AM7 A;  3SK3 A;  2RHK A;  3ZX3 A;  5KPR A;  3O1B A;  3ENB A;  1NGJ A;  4OO1 J;  3A5O C;  2IVN A;  3FFK B;  4WQ4 C;  5EOY A;  3CC4 N;  3Q7C A;  2OAN A;  3EKU A;  1NGE A;  1GC7 A;  4RTF D;  4YOY A;  2A3Z A;  1NI2 A;  3DLL L;  4A2A A;  1M1K O;  2BH1 A;  3O4W A;  2CH6 A;  2WFB A;  1U2V B;  1VAZ A;  3L6Q A;  2RE2 A;  2E8A A;  2QWP A;  1VQ6 N;  2V7Y A;  2A41 A;  1NGG A;  1YUW A;  2E2N A;  2YJE A;  3ENO A;  3SBG A;  4BR9 A;  3LM2 A;  3ZEU A;  3HM8 A;  4DCH A;  5E26 A;  3DXK B;  4CZJ A;  4U67 L;  3TTC A;  2HBM A;  4YDU A;  5LY3 A;  2F7T A;  3O6W A;  3X23 A;  3DJC A;  5BPL A;  2YHX A;  3FR0 A;  3QML A;  3M5R A;  1C0G A;  4BC2 A;  3G9W A;  3MDQ A;  2HRJ A;  2E2P A;  4A61 A;  4H5R A;  4BVO A;  3I33 A;  5IJM A;  4GXB A;  4FL9 A;  4OPA A;  4CJ7 A;  4BRN A;  5GAG P;  4MLE A;  3VEN A;  4Z94 A;  3WXJ A;  4FPB A;  1GC6 A;  4CBW A;  1BOT O;  3UE5 A;  4R79 A;  3HOT A;  4IJA A;  4NLB A;  2E2O A;  1YJ9 N;  2Q97 A;  4QS9 A;  3O9T A;  3U9D A;  2NRT A;  3G71 N;  1BU6 O;  2IIR A;  2FF3 B;  2Q0R A;  2VGM A;  3O08 A;  3AU5 A;  3MMV A;  3CQY A;  3QFP A;  4NLC A;  4QS8 A;  3RSE B;  4JK8 A;  4BQL A;  3VEZ A;  5JLF A;  2GTD A;  4FSV A;  2QA4 N;  4IFE A;  5BPN A;  2I7P A;  3PIP L;  4HWI A;  1YHQ N;  1QVG M;  4GV9 A;  1T6C A;  3TSP A;  2HOE A;  4GVE A;  2ZGY A;  4CI6 A;  3GBT A;  3CCS N;  5AQK A;  3WT0 A;  4YOU A;  4BRD A;  3UB5 A;  3A5L C;  1BG3 A;  1R59 O;  3ZDT A;  4XEI A;  4BR5 A;  1VQ5 N;  4CZF A;  3NVK A;  3CJ7 A;  3VPZ A;  3H3N O;  3N4P A;  4BRM A;  1VQK N;  3BUZ B;  3HI0 A;  1GLA G;  5F0X A;  1ZBS A;  2ZJR L;  4B1X B;  5AZJ A;  3C6A A;  1VQ4 N;  1NGC A;  3ZEU B;  3SAF A;  1V4T A;  4I6M A;  5BRH A;  1KD1 O;  1ESV A;  3HRG A;  5JVH L;  5AQX A;  3C6H A;  3N4Q A;  2ASP A;  2HBK A;  5F2R A;  3VEO A;  3CXC M;  3AAP A;  5GIO A;  1MK9 B;  2CGJ A;  3DWL A;  3G4S N;  3I56 N;  3CCV N;  3M6G A;  3OA9 A;  3I55 N;  3FZL A;  2Q0U A;  4EKU A;  1DGK N;  3O1W A;  4YOV A;  4TKN A;  3CCJ N;  4BY9 C;  2NRH A;  3D7E O;  1VQ9 N;  4C1N I;  3R1X A;  2Q31 A;  4JKD A;  3L4Q A;  4H0O A;  4MDB A;  2ASM A;  2H3G X;  4H5T A;  5LJW A;  3FZH A;  2YX6 A;  3LDP A;  1CZA N;  3D6R A;  3VTH A;  3EZW A;  1VQ8 N;  3E1Y A;  4GNI A;  3CJC A;  1ATN A;  3TTD A;  3BEX A;  1TYQ B;  2Q1N A;  1H4R A;  5JIC A;  4GV3 A;  2HMP A;  3MN6 A;  3T7Z A;  3MCA B;  5BR9 A;  1K73 O;  3H46 O;  4JN4 A;  4H03 B;  4ZRJ A;  1X3M A;  1GLE G;  3CI5 A;  3F2K A;  3BIN A;  3WQT A;  5I9E B;  3C0B A;  1NGD A;  4WCE L;  4CZH A;  3W0L A;  1XUP O;  1E4F T;  2X0S A;  3GDQ A;  2J0M A;  5FPM A;  3U9Z A;  1YJW N;  4M63 C;  1NGA A;  4FWO A;  1MA9 B;  2YI1 A;  4J8F A;  1EO1 A;  2AA4 A;  5GAH P;  2VYP A;  2JWK A;  3VES A;  1HB6 A;  2FJ9 A;  3RVC A;  3IUC A;  1J19 A;  1ATR A;  2PFU A;  1NJI O;  1EQY A;  2A40 A;  2V52 B;  1ATS A;  4FWP A;  2E1Y A;  3SBT A;  3IDH A;  4F9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...