4JK7A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk7A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk7A01
3SBTA 3E66A 4JKDA 4ILJA 4ILHA 4JK7A 4JKEA 3E9PA 4JKCA 3SBGA 4JKGA 4JK9A 3ENBA 4JK8A 4JKHA 4ILGB 4JKAA 3E9OA 4JKGB 4JKFA 3E9LA 4JKBA
chains in the Genus database with same CATH superfamily
3CC7N 1RDUA 3CPEA 3PIPL 4M41A 4CGGA 1OH5A 2HHSA 4OGEA 2QEXN 3WXLA 5C10A 3M8RA 4FZZA 1N33K 2YJEA 3ZSOA 4DR6K 1SKWA 2B6AA 5K14A 1NK6A 5DM6L 4N47A 1NK9A 3BINA 3OYNA 3THYB 3LDQA 3VQ4A 1RBRA 3DYAA 3OYFA 3P4IA 3O4WA 2O4GA 1LV5A 1C0TA 1VQNN 2GUPA 3OYBA 2JGUA 4NLCA 2IAJA 3D2FB 1Q7YO 4IJNA 1JLAA 3E1YA 3P83D 4CJFA 2QWPA 1RBSA 4V19S 2W40A 1QQOA 4IFVA 5EOYA 4CFAA 2CQUA 4CD3A 3SUQA 1RTHA 1RT6A 1ZBSA 4W5TA 2W6KA 3H6EA 3O9UA 4J2AA 3VQAA 2D2QA 4CZIA 4DTXA 4BR4A 4BC5A 4DTSA 5KI6A 3WEEA 3L4IA 2HBMA 4FWRA 1NOZA 3S9HA 2OANA 1MIXA 5JS1A 2XRIA 1LWEA 3DLLL 4BDPA 1QSYA 1U48A 4B9QA 2Z1JA 4CF2A 1W2BM 4WFAL 4JRQA 4CHPA 4KB0A 4BRDA 1R0AA 3GL1A 4CJKA 2X74A 4AHSA 1EO1A 1ZBIA 4KHNA 3CI5A 5MLCQ 3G4SN 5GINA 3R8EA 3NF8A 1DTQA 3IUCA 3VQ9A 3IS9A 3WEEB 1NU0A 3NGZA 1DEJA 2E88A 4B9MA 3LANA 4BRQA 1J54A 3F9MA 3E9OA 3OS2A 2BH1A 5CYQA 1O13A 3TAPA 1ZC6A 3AA5X 3AVHA 3SQ1A 5BN9A 3V4IA 1VSLA 4DS5A 4KI4A 4FJNA 3QEIA 3T69A 4CJSA 5C25A 4FLUA 3O4QA 3S3OA 2DIKA 1RBUA 2NRRA 2B4JA 1TK8A 1B9FA 3TI0A 4FW2A 2KFNA 2QWRA 1JLGA 1HBKA 3HPGA 4J2BA 4LFCK 4B1VA 4RW7A 4B9UA 2YCHA 3DLEA 2GEMA 3C95A 5JMVA 4MO5A 5GAEP 2HNYA 3S41A 4LFBK 3U8ZA 3K2PA 3GG4A 3CQXA 1W9HA 3LP2A 3F5TA 1P90A 4FK0A 2DFFA 2HB5A 2UXCK 4OLAA 1GLCG 4A5BA 5C12A 2KZMA 1EP4A 5AQHA 1KAZA 2D1KA 1XI1A 4DHYA 3UE5A 5J2MA 1DLOA 3BDPA 2HVHA 3MMVA 4IFEA 2AEHA 4JKDA 4AH9A 2A1RA 3CERA 3D45A 4CZKA 1S1TA 1HKGA 1F21A 2Z1HA 4W5RA 1M1KO 3MN7A 3U7DA 1JLEA 1NK8A 3DMJA 4JI2K 3QNNA 4PKGA 4KI6A 3MN9A 1K9MO 2HHVA 2V7ZA 3KWGA 4O55A 3AAQA 4O8UA 4JI7K 2I7PA 3PV8A 4BQLA 4E1JA 4CK3A 4B1WB 3VQ6A 4BE2A 1BU6O 3L0QA 3ZYYX 2CGJA 1RFQA 2P1JA 3M8SA 2EWSA 5BR9A 4DKWA 3X23A 1EF1A 1WNSA 4O5FA 4L8RB 4HDQA 1UA0A 3TAEA 3QFPA 4H5VA 1VSMA 4BRHA 3CXCM 4N41A 5KGWA 1NJZA 1O1WA 4M7YA 3R6MA 4YY3K 4R79A 4CJVA 2RHKA 1RT2A 3VGKA 4FZXC 3F2KA 2WC9A 1GOAA 2FBXA 2YI1A 3J8AA 4WE1A 3LP1A 1DIKA 4CJTA 2RPIA 3CMAN 3C6AA 4BWJA 1WSJA 1UOCA 3PUFA 2VYPA 1GC6A 4B3RK 4LSNA 4BGAA 2CGKA 1TK5A 3P38A 1K73O 1L3TA 4QS7A 2YHBA 3TWHA 3VF6A 3CFRA 5KQDA 1X9SA 2KQ2A 2ASOA 4GV3A 4DMNA 5HROA 1QQNA 3KD1E 1I3AA 1S6QA 2HBJA 2P9NA 1Q81O 4DG1A 2IC3A 4CJUA 4ISGA 4CFDA 3OHRA 1JCFA 4BC4A 4OO1J 4CZEA 1TGOA 1U4BA 4EP4A 2A1SA 1X9MA 5EXWA 5IWAK 1WN7A 3Q7BA 4A59A 3ULDA 2XY5A 1S9EA 4IDKA 2CH6A 4E19A 1DKGD 4QS8A 1JXEA 3WNHA 3AVKA 3FZMA 3A5LC 3DAWA 4ZRIA 4ILGB 3SQ4A 3OYGA 4DSIA 1KD1O 4F3OA 3C65A 2RN2A 3KK7A 3DXMB 4YOYA 3P31A 1KVCA 3SV4A 2P9NB 1FW6A 4K0KK 5AQXA 3LAKA 1HPMA 4FJ8A 1HJRA 1S5JA 2HBKA 3RR8A 1RBVA 2OPSA 3HZ6A 4NB4A 4ILHA 2G8FA 1ZBLA 5B8HA 4DR7K 1DT9A 1C6VA 1RBTA 1BDGA 4BE0A 4WQ5C 3FFKB 1C0MA 1ACAA 3VGLA 3HVRA 4RWTA 3EO3A 3SJHA 2AP1A 4I2QA 4CBXA 4DXAB 4NYNA 4F7GA 1WSHA 1GLFO 3QICA 3OBWA 4ZHRA 2P9PA 4JRPA 4K8XA 4CEBA 4FLYA 3ATVA 2IVPA 4KHQA 2F9WA 1T6CA 4YORA 4JV5K 2VG5A 5JICA 3PSFA 5FRMA 1J9AA 5AQUA 4CERA 4FWQA 2ZM6K 3MN5A 5EX5A 3CJ9A 3ZT4A 1RT7A 1XC3A 4PL8A 3VESA 1TVRA 4OKJA 4BRFA 1EXQA 4FJGA 3KLIA 4PKHA 3L2QA 3EZ5A 5DM7L 4LY7A 1IKYA 5FPEA 3LP0A 5ADXH 2CB8A 1NTIA 2ZWHA 3EN9A 4DSJA 3MN6A 4OVLA 4JKFA 2P9PB 1GLAG 1TUUA 3AAPA 1XMQK 4B9TA 4DFPA 4F3TA 1HQEA 4M3RA 4IOAL 4CW7B 5JVHL 5FROA 3R1XA 5EU7A 3SPZA 1NGCA 4JKCA 1WAFA 3Q7CA 4FZYA 5C2DA 2OPRA 5C0YA 3AO1A 2G8VA 2F96A 1V4SA 5FPDA 3KLGA 1QZ6A 2WOMA 2YVCA 5JVLA 2KKZA 4BDYA 2RKIA 4FOIA 4DLEA 1KLMA 3HJFA 4E0DA 1BHLA 2A40A 4Z0UA 3VTIA 2VG7A 3VQQA 4BRLA 3DLBA 1VQ7N 3DRPA 3O80A 3SPYA 2HRJA 2J0JA 4E7KA 4JYAK 3CCRN 5FDLA 4FYDA 3K59A 3DOKA 3EYZA 2GV9A 3VPZA 4X66K 5EVZA 3TTCA 2A6AA 5AQZA 3KD5E 3CM5A 4FJHA 3NVKA 4KTZA 3SUPA 3F9KA 3OYCA 2ZPYA 2V52B 1XQSC 2XO7A 2HF3A 3KK1A 2HSTA 4K8ZA 4LF6K 2O8DB 1IBMK 4DTRA 3E9PA 1FKOA 1GLDG 3FZLA 3L3VA 3CQ8A 1ATNA 3HSTB 1CZ9A 4OPJA 4TKNA 4BREA 2E4LA 4PQUA 3N4PA 3A8YA 3IKMA 4KHUA 4FOEA 1VSHA 2FBVA 5KRTA 3EE9A 3S3NA 2ASPA 4DV5K 1J5OA 1KAXA 1KCFA 5HLFA 4JKEA 1QSLA 4FLXA 2GWKA 3AO4A 1T44A 3H3OB 1BOTO 3AVBA 4FJ7A 1Q18A 4GKJK 4I9LA 3O9TA 4CE9A 1GOBA 1N36K 2RF2A 2Q2RA 2BDPA 4B8AB 4KH6A 1TL1A 2Q36A 3NHGA 2A42A 3GBTA 3L3UA 3BY5A 3TR8A 4Y0WA 3AVMA 3O1WA 3ZETA 5AJ3K 3NBPA 5GAGP 3R3LA 4CGDA 1K8AO 3THXA 4FJIA 3DRSA 1KRPA 4DU4A 3OJSA 1N8RO 3VF2A 4GV6A 1U6ZA 1GC7A 5GAHP 3SJJA 3UIQA 1NKCA 3TSPA 1CZAN 3RWUA 1LW2A 3C94A 4CJ7A 3OS1A 2D0CA 4KBOA 3NH1A 1JDEA 1XNQK 2J0MA 1JCEA 3SUNA 2E2OA 3ID6A 1HB8A 2CGLA 1EETA 1KFDA 4FJLA 3H08A 3TARA 3CJCA 2UUCK 1GLJO 1ZBFA 3C6TA 4HCCA 1MA9B 2O4IA 3V9SA 4ELUA 3ZETB 1IG9A 2NNWA 2P9SA 1SZ2A 3CMEN 1JJ2M 2G8IA 4F8RA 1JL2A 1KC7A 1BGXT 5F2RA 2I1JA 2O8CA 3VA3A 4DTUA 4IDHA 3SYZA 2UUBK 2FSJA 1RDWX 4FWNA 4NO7A 4KKOA 4AHVA 2FC0A 5AFUH 3VMFB 3CFOA 5E41A 2ZGZA 4PWDA 3QBXA 3AA4A 5AZIA 4DSKA 3B6PA 2QXFA 1D4XA 2XY8A 4FWSA 4CYEA 2UXDK 2QW9A 3I8BA 4WQ4C 3HBTA 4DV7K 1ZBHA 4UY8O 5FRNA 4OX9K 5M1PA 3RTVA 3CM6A 1J6ZA 2P9SB 2P9UA 4CJWA 1KSPA 4YDUC 4AF1A 3THVA 4M3ZA 1CXQA 5M1FA 3K9JA 1VRUA 1HYVA 2FBYA 2O8CB 4LH4A 3VQCA 2I5JA 1C0UA 4DTNA 1C1AA 4YFUA 1ILYA 2WTUA 4RW9A 1ST7A 3VQDA 5ADXA 2HHUA 1ATSA 3M3ZA 4K41A 2HNZA 1DTTA 3ENOA 5AZIB 3EPYA 2E2QA 4CGIA 1REVA 5AR0A 1S1VA 1VQ4N 3HPOA 2P9UB 3ZT1A 4W5NA 3FGUA 4KV8A 1EKEA 4CHOA 4N76A 4EZ6A 4AQYK 3TSUA 1HKCA 4FJ9A 5T7BA 1TKXA 3IG1A 1KAYA 1NJXA 5AZJA 3OYKA 1XNRK 1L3UA 4H0YB 1RTIA 1VSIA 4HUFA 3BZCA 2VG6A 4H0TB 4OKEA 4Q5VA 3ENBA 4B9SA 3CCLN 4YOXA 3JXUA 1X9JA 5AQNA 3ZSQA 3R9PA 1VQ8N 4CF8A 3M5RA 2HHHK 4DTJA 1HNXK 2NRVA 3AVNA 1YHQN 1I94K 1S1UA 4CI6A 4CEOA 2FDQA 1MIZB 4H0PA 4CEQA 5E26A 4O0IA 1YJNN 2IS3A 5AZJB 3ZSXA 1UA1A 3AVFA 2NUBA 3KKRA 3IRXA 4WFBL 5F1XA 4UQGA 1NGFA 2ATQA 4WQ5A 1G15A 1Z25A 4CZHA 3FLCO 1KC8O 1OH7A 3CFPA 1WSGA 1YUWA 5JS2A 3M6GA 4NXMK 3S3MA 5SWMA 2ITMA 3ENHA 4NY0A 3G0ZA 3C6HA 5LJVA 2QXLA 4DR3K 1E5WA 5AQMA 2ZJPL 2IVNA 1NK4A 3VGMA 4DR1K 4DQQA 1U45A 1EWQA 1NGHA 3D6RA 3V9ZA 5JLHA 3EEQA 5JVGL 1WUAA 3QMLA 5CYMA 2ZQBA 1YITN 4LSLA 4XIUA 4CK1A 3FP5A 4BDZA 3MWPA 3AO2A 3TSQA 1VRTA 1H4RA 1ZBUA 4EHTA 2OZMA 4KHSA 2P9IB 1L3VA 3ZSRA 3I8DA 3H1QA 1BIUA 5AQTA 3K5LA 4FWLA 2HE7A 3MWTA 1Z6RA 5CHIA 3AVGA 4BRCA 4CIEA 3MDQA 2VWBA 1SGHA 1YTUA 1JLFA 4CEAA 4YOUA 4B3MK 3D0PA 1BO5O 3V81A 3MECA 4J8FA 5BPNA 5C42A 4ISFA 3CQYA 4DUYK 2A5XA 1XHZA 4JS5A 2HOEA 4QCLA 1ASUA 2ZF5O 2YX6A 2YNFA 1XUPO 3J81O 1HX1A 1VSFA 1T05A 3PO5A 4JS4A 4PKIA 2BE2A 3FR0A 4BR9A 1NK7A 1RGIA 3SQ2A 5BPLA 4DWIA 1HLUA 3D2EA 4DR5K 3CCUN 1GLEG 2DY4A 3O9SA 1S1WA 3G25A 1N5YA 4LF7K 1IV0A 4M42A 4Z4HA 4HTLA 1KQSM 2R82A 2ABDA 3KVGA 2JWKA 5DK5A 4JNEA 4DSEA 3HP9A 4H5RA 5KQ8A 1K6YA 3LP3A 4XH1A 5AFUA 1BCOA 2ETJA 4RW8A 5BR8K 3K5NA 1GOCA 4IO9L 3PX4A 1KXPA 3LDOA 1JL1A 3NF7A 1HNWK 3MAQA 4BG9A 4O0JA 2RE2A 3MEEA 2F9TA 1WOQA 3EE8A 2BANA 1JCGA 4A61A 1HNZK 2FJ9A 3D2EB 3NE6A 3SBGA 1ZYQA 3KK3A 1NGJA 3RMCA 3V9UA 4Z4FA 3HM9A 5IT9O 2OZSA 2O8FA 1N34K 1ZXOA 3CCVN 1JLQA 4CK2A 4IOCL 3FLVA 1J19A 3FE1A 4BC2A 3CJ7A 4CCHA 5LY3A 3MCAB 4IOXA 4B1YB 3VOVA 2IDOA 1E4GT 2ZE2A 1LAVA 2ZD1A 3UKUA 5C15A 3T1YK 4RW6A 3PY8A 5BN8A 4CF9A 3DLKA 4CBWA 1ITGA 3DXMA 4JD2A 1X3MA 3WXMB 3ZT3A 4JI6K 3LL3A 2P9KA 4DTMA 2ZGYA 4B3TK 2O8FB 4M63C 2P5GA 4DQ8A 1SS6A 5H1SQ 4X64K 2J0KA 1YVUA 3QLHA 3VQEA 1HR0K 5KTQA 3PSIA 1S9GA 1YIJN 1U49A 3SMPA 1NMDA 4FWPA 1ASVA 4A5AA 3BF3A 3UKUB 1NLVA 3LALA 2WONA 1NKEA 1L5UA 4DV2K 5J1EA 3HOSA 4WYBA 3AGRA 1VAZA 2Q0UA 3ZSYA 3AVLA 4JD2B 4ID5A 3HSCA 3LWMA 2P9KB 1Q8IA 3H45C 2ITGA 2QTDA 4JI0K 4X62K 1HNVA 1NGIA 5BREA 1P8ZA 1LOTB 3QEVA 3DOLA 1RTJA 3VERA 3HO1A 5DMRA 2FXUA 4AHCA 4KPYA 3DLRA 1RTDA 4JKBA 3QEWA 2IGIA 1VHXA 4BRPA 2HHWA 4YOWA 3TTFA 1NKBA 2NRZA 1NGGA 4CGHA 1C0FA 2E8AA 3GDQA 1IH7A 2WUSA 2WH5A 3VQ7A 4KFBA 4DFKA 1TL3A 5AQJA 4AHRA 1U04A 3CCJN 5HRPA 4AM7A 2KFZA 1X3NA 1IJJA 1SV5A 3I0RA 4KO0A 4QAGA 4IBNA 1N6QA 2GX9A 4HVJA 3HK2A 5D3GA 4WQ4A 1NOYA 3FZFA 2VGMA 4H4OA 4EP5A 3I33A 4IO8A 4CEZA 1NBWA 3HI0A 4A62A 3WXJA 1HKBA 1XC9A 2NZTA 4G9ZA 1FXXA 3MX2A 1HPZA 3CJBA 3KWIA 3QBWA 4RW4A 1RT1A 1SKSA 2KLAA 1BI4A 4CBUA 3J7YP 4KB1A 1SUQA 1WLJA 3LM2A 4FPAA 4DR4K 3M8QA 3AU4A 4DQPA 4MFBA 1QHTA 4CF0A 2YHWA 2G8UA 4ZTFA 3BZKA 2XY7A 4YHHK 3IMXA 4GVMA 4ELTA 2KZZA 3MCPA 4CEEA 3JAMO 2XY6A 2QWQA 3L6QA 4BROA 2O8DA 5M1OA 1B92A 3AY9A 3BEXA 1QHAA 1YJWN 1QTMA 5AQVA 1NGDA 4CHQA 1RT4A 3W3DA 3NDKA 1VQMN 2G8HA 2NLXA 4GXBA 1BI4B 3RR7A 3NH2A 2D5RA 2P51A 3KTQA 2HHQA 2BTFA 3HPHA 3OTOK 3DLGA 4IKFA 3CPWM 4PL7A 4DQIA 3W0LA 5HRNA 4KTWA 4DB3A 4MLEA 1VSJA 2F8TA 4BRMA 4PA1A 1BIZA 1YVNA 3OVNA 5GADP 2YNGA 1VQKN 1VQLN 4CFCA 1YAGA 3HT3A 3RRHA 4H0OA 1U2VA 4FLVA 4FLZA 1MWMA 2Q0RA 3V9XA 1BQMA 2P9LA 3T1AA 1UAXA 2KW4A 1IKVA 4CECA 1WSFA 1GG3A 3BF1A 3C6UA 4LF4K 2E2PA 3K57A 2D11A 1KFSA 1EQYA 4DLGA 1Y64A 4IEEA 1NWKA 2CH5A 4E1NA 5LMNK 3WXKA 3O9QA 4IG0A 4AHTA 2WBNA 4OPKA 1IKXA 2VQFK 5I3UA 3SV3A 3NAEA 1U2VB 3ULEA 5FLXO 3ZX3A 3VF4A 4FM2A 2P9LB 2DFHA 1T3VA 3ZCMA 4CZMA 3C0BA 1BG3A 3KLEA 4LFAK 4JN4A 1Q82O 1TV6A 3MXJA 5IJMA 3SAFA 4I6MA 4LF8K 1JLCA 1WBBA 5TKYA 4NXNK 1RDBA 4QS9A 5AQSA 3GOIA 1TK0A 3NVMA 4CZGA 5M1QA 4E1MA 3TABA 3QEPA 3LPUA 3K5OA 1S3XA 3ULEB 3KLFA 1HQUA 3SLCA 1R59O 5FPNA 4B9LA 3TAQA 2HW3A 3AV9A 3TPQA 4DU1A 3L2RA 4BGBA 4FCYA 4X65K 4MDBA 4MLHA 3OYEA 4DV6K 1NG9A 3DM2A 3FFIA 4G1QA 5J2QA 1LWFA 2D0OA 4I6MB 5LMUK 4DV1K 4B1UB 2EMTA 4A57A 3ZT2A 4CJLA 3JSMA 3OYDA 5TKWA 3LDLA 4GW6A 3DXKA 2Q31A 1QE1A 4JHDA 3V1RA 1JLBA 2WFBA 2JWLA 3MXMA 3IAYA 2PY5A 3ZLJA 2BGGA 5ELZA 3V6DA 2D0AA 4BG8A 4EFHA 3C7NA 4Z4EA 4CZFA 4DUZK 3DRRA 4H0XB 3MX5A 5BPMA 1XWLA 3PZDA 5F0XA 2IOCA 2NRWA 4H5WA 2F8SA 3CIPA 4PHTX 2EHGA 3O08A 1TYQA 2D0BA 2Q1NA 1QZ5A 3NF9A 4M3UA 1K8KA 2PZSA 2ZJRL 2XHBA 4OLBA 4P7IA 4XH5A 3HL8A 1C1BA 5I9EB 4BE1A 4KHPK 1GLBG 5AQOA 4Z4GA 3U9DA 3DXKB 3G10A 4JHDB 4FW1A 1X1PA 3VQ8A 1CLQA 4GY2B 2AA4A 2YNIA 3K9KA 3SUOA 4GMJB 1ASWA 1SQKA 1XHXA 2QI2A 5JLFA 1NI2A 4GKKK 2UXBK 3O9RA 3PIOL 2UU9K 3HYFA 1IKWA 4YNQA 3C7NB 2A3ZA 5KGXA 3I0SA 3MEGA 1WSEA 5AQQA 3NF6A 3ZX0A 3O4NA 3VTHA 3SMSA 3BGRA 4DFJA 1TYQB 3M8PA 4E7LA 5J2NA 1K8KB 3K0SA 3AVCA 1DGKN 3QO9A 3G71N 5CR4A 4BRGA 1QVFM 2E6MA 4M7XA 3F73A 1D5AA 1BQNA 4BWMA 2BUPA 3HRGA 2Y1JA 1W97L 1H1VA 1NJIO 3HVTA 4CEFA 3EL2A 4I9QA 4BVPA 4DS4A 3AGKA 2W41A 3RMBA 1TAUA 1JXBA 1D8YA 1J53A 3SQ0A 3AU5A 3U8XA 4JK8A 1OH8A 4KH5A 3QB0A 1TUYA 1LAWA 2NRXA 3ASMA 3OYHA 4C8LA 4FJ5A 2PBDA 3RMDA 1OVQA 1EWRA 2X6NA 1IG8A 4FJXA 4CZLA 4IFYA 2AJQA 3KK2A 1JKHA 5BRFA 4IWVA 5CY4A 1TKTA 3U4LA 1W7AA 4J2DA 4AILC 4JKGA 3SI6A 4CHZA 4I2PA 4LF5K 2E2NA 3O6WA 4H5TA 5KPRA 3WQTA 3ZSZA 3DLHA 5BRHA 1ESVA 2W42A 1T03A 3SK3A 3PX0A 4K43A 5C2FA 3AA3A 4FVUA 2IIRA 1Y97A 4U7BA 1SKRA 1FJGK 4CJRA 2P9IA 3P1GA 4KAZA 3I56N 3KHYA 4FK2A 1VK0A 3H46O 1V4TA 1QQCA 4HCBA 4BY9C 3JYTA 4E7HA 4JKAA 4OPHA 3OYMA 4OGCA 2HVIA 4MDAA 3HXMA 2Z1IA 4KRFA 4JKGB 4CHYA 1YF5L 3LWLA 1Z26A 4Y1CA 3NGYA 4JLHA 4IJAA 4R5PA 5AQGA 4C1NK 2UUAK 2QWNA 3KIOA 4BR7A 4KHWA 3OJUA 2FSNA 1XMOK 1NVLA 4FO0A 2OCEA 1TKDA 3HOTA 5HOOA 4YOVA 4H03B 5KPTA 2OTLN 3BUZB 4AHUA 2Y1IA 3IDHA 1RILA 4BR0A 1T8EA 4BRIA 4DF8A 1YXQA 3QIPA 2OYQA 4C8MA 3TAFA 1HJOA 3VETA 3SAHA 3U3YA 3TANA 3SNNA 3WT0A 4ELVA 2G8WA 3O5BA 4FM0A 3VEVA 4KTQA 3KKSA 2QM1A 4B08A 1Q9YA 1NJYA 4B1XB 1GLLO 4JK7A 4BR5A 4AM6A 3SZ2A 3VN5A 3EKSA 4BC3A 3N4QA 3T19A 3EY1A 4J2EA 4IXCA 2NRTA 4RCHA 2ZJQL 3CD6N 2PFUA 2OA8A 5AQWA 2GBZA 3UB5A 4ZTJA 5AQPA 4FJMA 4Z4CA 1C0GA 4EAHD 4W5QA 2O8BA 4BRNA 2PYLA 4M3XA 4ILJA 4YOTA 3TTDA 1Z05A 1A5XA 5GIPA 2E6LA 2P5OA 1NJWA 3AVIA 1QQMA 1Q9XA 3NCIA 4F4KA 3LM9A 4RTFD 4IEIA 1VSKA 5EY4A 4Y1DA 2QWLA 3T3FA 1RT3A 3SCXA 3LAMA 5A2QO 3LZIA 4OKKA 4JI8K 3WQUA 4B3OA 3E9LA 3TAGA 2EX3A 4E7IA 4CVNE 3CCEN 2PYJA 1VQ6N 4FM1A 1RDAA 4B8CA 4CEDA 3A2FA 1YI2N 2LSNA 1HYSA 2D10A 1BWFO 2QWOA 1MU2A 3PLAA 1UWBA 4B9NA 5E84A 2O8BB 4DTPA 2HMIA 2RQ1A 2YHYA 2VCPA 1ATRA 2O8EA 3NMUA 3PX6A 1VQ9N 2I1KA 2KHOA 3MK6A 5HRSA 2DTUA 4O44A 4FL9A 1HB6A 1S22A 3LDPA 1SL2A 2OPPA 4O4GA 5BRDA 1RNHA 1SAZA 3EKUA 3ALYA 4NLBA 3ZSVA 5AQRA 4C1NI 4JK9A 4JI3K 3CJAA 4JAXA 2NRHA 1E4FT 3L2VA 5AQIA 3PVLA 3CCMN 4KREA 2KTQA 2YHAA 3QETA 4DFMA 1C1CA 3SBTA 2GWJA 3P39A 4ID1A 1CXUA 4GNIA 3OW2M 2O8EB 3RMAA 1NK5A 3P5JA 2AL6A 4CGFA 1VQON 2YHXA 2J4RA 4BACA 3E01A 1YT3A 2E5LK 4BRKA 1VSDA 1HMVA 4DF4A 3TAMA 4FWOA 2VWJA 3B6OA 2QA4N 3WXIA 3CC4N 2JLEA 3D7EO 2EMSA 4HUEA 3AVAA 1CZBA 4DCHA 3V9WA 1WB9A 3U9ZA 1BUPA 1KVBA 1MDUB 3LPTA 4CZJA 4W5OA 2QKKA 3VEWA 1S1XA 1HNIA 2A41A 3LDNA 3ZEUA 1T6DA 1VQPN 4HWIA 1KTQA 1A5VA 2X6SA 5CZ2A 3A5NC 4BRAA 4EZ9A 4CJ4A 3DI6A 1NM1A 1FKPA 4CGJA 1Q86O 4FJJA 2FF3B 2DPNA 4FLWA 3QFUA 3VEZA 1VQ5N 1L3SA 3OS0A 4FWMA 1S6PA 4JKHA 5J2PA 3CF5L 1BISA 1TKZA 4HUGA 1SL1A 1LWCA 3FZHA 2FSKA 3UKRA 4M3TA 4CESA 1X9WA 1J5EK 2W6LA 4HDOA 2FF6A 5HBMA 3QDKA 1RT5A 4IG3A 2GELA 4DU3A 2YJFA 4WF9L 3ZEUB 2FBTA 1IO2A 4HTUA 4JEPA 3CCQN 4M3YA 1BA1A 3THWA 3QNOA 4FJKA 2F7TA 3U3GA 1MWKA 5AQLA 1IBKK 4XH4A 1QSSA 1BCMA 2HHXA 1WAJA 5HRRA 4LC9B 1D9FA 3LDSA 5I42A 4DV0K 4B9VA 5LJWA 1HYZA 3I55N 3CCSN 2YV0X 4H5NA 4C8OA 3DWLA 2UYTA 4YDUA 3UKRB 3FZKA 1WBDA 1GGOA 3AO5A 3QINA 3NH0A 4RG8A 4CHNA 4CF1A 1T7PA 1A5WA 1BL3A 5LL6Z 2VQEK 3OBYA 1IBLK 3VQBA 4M3WA 3NFAA 3T7ZA 1OKJA 3J7ZO 1N32K 3THWB 3ATUA 1VBHA 2QK9A 2PAVA 4DSFA 4DV4K 4FXDA 4PUOA 4EHUA 5AQFA 5M1KA 2H3GX 3CG7A 1E3MA 3OY9A 4WCEL 3HP6A 2QWMA 3QIJA 4FSVA 3L4QA 1B9DA 3CYMA 4IZ9A 1M90O 2YNHA 1NMNA 5AQKA 4C8NA 4E7JA 3VQPA 3H3NO 1YTAA 4N56A 1S72N 5M1NA 3OYIA 3VENA 1Y19B 2D4WA 4BQZA 1MK9B 3L2UA 4EIAA 3CETA 1NGAA 1WSIA 2GUIA 4XEIA 3K5MA 1FK9A 4C23A 4FK4A 4Z4IA 4F9OA 4DTOA 4F2RA 5HP1A 3OA9A 3AA2A 2V7YA 3EZWA 5AQYA 5CE3A 3CHWA 4CIGA 4HHTA 1OH6A 1KLNA 1BA0A 3A5MC 3U6FA 2OPQA 3OYLA 3KZBA 4I7FA 3VEXA 2GTDA 2Q97A 4WFNL 4DQSA 3RVCA 3V1QA 3O3GA 1ISNA 2E1YA 3K58A 2E1ZA 4LF9K 4GVEA 3A0IX 3V1OA 4CD1A 1U47A 3RSEA 2OTJN 1G99A 3GE1A 3J7AP 4DV3K 1KVAA 4JI5K 5C24A 4O8KA 3OYJA 4F2SA 1LCUA 3L2WA 3MXIA 3O1BA 4C8KA 3WNGA 2COPA 2VWKA 2F4VK 3J80O 1D9DA 1LW0A 3VEOA 4A2BA 4Q0BA 5CZ1A 3BP8A 1RDDA 3OYAA 3B8AX 5SZTA 1KBLA 1NK0A 2ASMA 3ISNC 2YKNA 4CJEA 4KHYA 2IVOA 4JI1K 4Z94A 4MO4A 3SAGA 3IFRA 2HHTA 3RSEB 3ZT0A 4CJQA 3KLHA 3H1VX 4LD0A 5FPMA 2DFEA 2G8KA 2X0SA 3A5OC 2YKMA 4FLTA 4M45A 2LBBA 4CJ3A 4EKUA 3O3FA 3IVFA 1VBGA 1HUXA 4CJPA 5KRSA 4DQRA 2R7YA 4OPAA 1W0HA 2B5JA 4ZRJA 4MQ3A 3HTVA 4B1ZA 4FVMA 2HF4A 3ZDTA 1VSEA 3LZJA 4FWKA 3M1FA 1YJ9N 4N5SA 3WUHA 4CIFA 3PO4A 4JI4K 3G6EN 3WNFA 2HBLA 4YL8A 3NGIA 3CC2N 4E89A 4OJRA 2V51B 4ISEA 4K42A 4H4MA 4GV9A 1TAQA 4K25A 3RRGA 3DJCA 3QIOA 4CJ5A 5GIOA 4ICLA 4BR2A 1SL0A 3ID8A 4PY5A 2FLOA 4E3SA 4DR2K 2Z1GA 1RDCA 2QKBA 3TU5A 2X78A 3E66A 4H8KA 1NGEA 2Q3SA 4A2AA 3ZX2A 3WA0A 4NCAA 4ZRKA 3QERA 3MEDA 4O5BA 3CJ1A 3THXB 4H0VB 1QS4A 1NGBA 3AVJA 3HM8A 4NYFA 3AARA 3T1HK 3VQ5A 3ITHA 4FPBA 4KH4A 4TSXA 3WNEA 1OVYA 4NCGA 1HRHA 3QESA 2HNDA 2VGNA 3ZSWA 2HMPA 2I7NA 3VEYA 1NNEA 2E20A 4BVOA 3JS6A 3O8MA 4U67L 5KPZA 3KJVA 2D0PA 1MK7B 4LH5A 1EX4A 3O3HA 1QVGM 3THYA 3G9WA 3VA0A 1I39A 4DSLA 4QOZB 4B3SK 3L8BA 1RCHA 4NCBA 3D2FA 4CFBA 4L3QA 3QEXA 5HL7L 3AO3A
chains in the Genus database with same CATH topology
2ZPYA 3AGRA 1VAZA 2Q0UA 2V52B 3WT0A 3O5BA 1RDUA 3CPEA 1XQSC 4JD2B 2HF3A 3HSCA 2HSTA 3VEVA 3PIPL 2P9KB 2QM1A 2QEXN 3H45C 3WXLA 4B1XB 1GLLO 4JK7A 2QTDA 5C10A 4BR5A 3E9PA 4AM6A 1GLDG 3FZLA 3EKSA 2YJEA 1NGIA 4BC3A 5BREA 1P8ZA 3N4QA 1LOTB 1ATNA 4IXCA 2NRTA 4RCHA 4TKNA 4BREA 2ZJQL 3CD6N 2PFUA 3N4PA 5AQWA 5DM6L 3VERA 3A8YA 3IKMA 3UB5A 3BINA 2FXUA 4FOEA 3LDQA 4JKBA 5AQPA 3P4IA 3O4WA 3EE9A 4BRPA 1C0GA 1VQNN 4YOWA 2GUPA 3TTFA 4NLCA 2ASPA 1NGGA 2NRZA 3D2FB 4EAHD 1C0FA 1Q7YO 2E8AA 1KAXA 4BRNA 3GDQA 4ILJA 4YOTA 3TTDA 4JKEA 2WUSA 2WH5A 1Z05A 4IJNA 3E1YA 2GWKA 1T44A 3CCJN 2QWPA 3H3OB 5AQJA 1BOTO 2W40A 1QQOA 5GIPA 4AM7A 5H1SQ 5EOYA 1Q18A 1QQMA 3LM9A 1X3NA 2CQUA 1IJJA 4IEIA 4RTFD 5EY4A 4CD3A 2QWLA 3O9TA 1ZBSA 2Q2RA 3WQUA 3H6EA 3O9UA 4KH6A 2D2QA 3E9LA 4CZIA 4BR4A 2GX9A 4BC5A 2Q36A 4WQ4A 2A42A 3GBTA 3FZFA 3CCEN 2VGMA 1VQ6N 3WEEA 4Y0WA 3I33A 3L4IA 4IO8A 1YI2N 1NBWA 3HI0A 4A62A 3O1WA 1HKBA 2HBMA 4FWRA 3WXJA 3ZETA 5GAGP 2NZTA 3R3LA 2OANA 1MIXA 2D10A 1BWFO 2QWOA 1K8AO 3PLAA 4G9ZA 3DLLL 5E84A 1N8RO 3MX2A 3VF2A 4GV6A 2RQ1A 1U6ZA 1GC7A 2YHYA 2VCPA 3CJBA 3KWIA 3QBWA 5GAHP 1ATRA 3NMUA 4B9QA 1W2BM 4WFAL 2I1KA 2KHOA 3TSPA 1CZAN 1VQ9N 3MK6A 2KLAA 4CBUA 4CJ7A 4FL9A 4KBOA 1JDEA 3LM2A 4FPAA 4BRDA 1HB6A 2J0MA 1JCEA 3AU4A 1S22A 3GL1A 2E2OA 3ID6A 1HB8A 3LDPA 2CGLA 5BRDA 1EO1A 2YHWA 1SAZA 3EKUA 3CI5A 3CJCA 4NLBA 5MLCQ 3G4SN 5GINA 3IMXA 5AQRA 3R8EA 4C1NI 4JK9A 1GLJO 3CJAA 3IUCA 4JAXA 2NRHA 3WEEB 1E4FT 1MA9B 1DEJA 2E88A 3MCPA 5AQIA 4BRQA 3PVLA 3ZETB 2NNWA 2P9SA 1SZ2A 3F9MA 3E9OA 3CCMN 1JJ2M 3CMEN 2BH1A 2QWQA 3L6QA 1O13A 4BROA 5M1OA 3AY9A 1ZC6A 3BEXA 1KC7A 1QHAA 1YJWN 3SBTA 2GWJA 3P39A 5AQVA 5BN9A 1NGDA 4GNIA 5F2RA 2I1JA 3W3DA 1VQMN 3OW2M 2AL6A 2NLXA 1VQON 4GXBA 4IDHA 2YHXA 2J4RA 4BRKA 2FSJA 1RDWX 4FWNA 4NO7A 3T69A 2BTFA 4FWOA 5AFUH 2QA4N 3VMFB 3WXIA 2DIKA 3CC4N 2ZGZA 3CPWM 3D7EO 3QBXA 2EMSA 4PL7A 5AZIA 1D4XA 3W0LA 4DCHA 4FWSA 4DB3A 4MLEA 2NRRA 4CYEA 3U9ZA 1BUPA 2QW9A 3I8BA 4WQ4C 4BRMA 3HBTA 4UY8O 1MDUB 4CZJA 2QWRA 3VEWA 1HBKA 5F0XA 5M1PA 2A41A 3LDNA 3ZEUA 1J6ZA 1T6DA 2P9SB 2P9UA 1YVNA 1VQPN 4HWIA 4YDUC 4AF1A 4B1VA 5M1FA 5GADP 2YCHA 3K9JA 2GEMA 3A5NC 4BRAA 1VQKN 1VQLN 5JMVA 1YAGA 4MO5A 5GAEP 1NM1A 3S41A 3U8ZA 1U2VA 4H0OA 3GG4A 1Q86O 2FF3B 1MWMA 2Q0RA 2DPNA 3CQXA 3F5TA 3QFUA 3VEZA 1P90A 1ILYA 1VQ5N 2P9LA 4FWMA 1ST7A 4JKHA 5ADXA 1GLCG 4A5BA 3CF5L 1GG3A 5C12A 5AQHA 1ATSA 1KAZA 2D1KA 3M3ZA 3BF1A 4K41A 4DHYA 3ENOA 3UE5A 5AZIB 3FZHA 2E2PA 3MMVA 2FSKA 3UKRA 3EPYA 4IFEA 2E2QA 2AEHA 4JKDA 2D11A 4HDOA 1EQYA 2FF6A 5AR0A 3QDKA 1VQ4N 2GELA 1Y64A 2YJFA 1NWKA 4IEEA 4WF9L 2CH5A 3ZEUB 2P9UB 4JEPA 3CCQN 1BA1A 3CERA 3WXKA 4CZKA 3FGUA 3O9QA 1HKGA 2WBNA 2F7TA 1MWKA 5AQLA 4XH4A 1M1KO 1U2VB 3ULEA 3ZX3A 4LC9B 3MN7A 3U7DA 3TSUA 3VF4A 1HKCA 2P9LB 5LJWA 3I55N 1KAYA 4PKGA 5AZJA 3CCSN 1T3VA 3MN9A 1K9MO 2V7ZA 3KWGA 3AAQA 4H0YB 4O8UA 4CZMA 2I7PA 4H5NA 4BQLA 3C0BA 4E1JA 3DWLA 2UYTA 1BG3A 4YDUA 3UKRB 3FZKA 4B1WB 4JN4A 1Q82O 1GGOA 1BU6O 3L0QA 3ZYYX 4H0TB 5IJMA 3SAFA 4I6MA 2CGJA 3ENBA 5TKYA 1RFQA 3CCLN 4YOXA 3OBYA 3JXUA 1X9JA 2EWSA 5AQNA 4QS9A 5BR9A 3R9PA 3T7ZA 4DKWA 3X23A 1OKJA 1EF1A 5AQSA 1VQ8N 3GOIA 3J7ZO 4O5FA 3ATUA 3M5RA 3NVMA 1VBHA 4HDQA 2NRVA 5M1QA 4CZGA 2PAVA 1YHQN 3QFPA 1S3XA 4H5VA 3ULEB 4EHUA 4CI6A 4BRHA 3SLCA 5AQFA 2FDQA 1R59O 2H3GX 5M1KA 3CXCM 1MIZB 4H0PA 5FPNA 5E26A 4M7YA 4WCEL 3R6MA 1YJNN 5AZJB 4R79A 2QWMA 3QIJA 4FSVA 2RHKA 3TPQA 3L4QA 3VGKA 4BGBA 4WFBL 3F2KA 2WC9A 5F1XA 4IZ9A 1M90O 1NGFA 2YI1A 4WQ5A 4MDBA 4MLHA 4CZHA 3FLCO 1KC8O 3J8AA 2D0OA 1YUWA 4I6MB 3M6GA 5AQKA 1DIKA 4B1UB 3CMAN 3H3NO 2EMTA 4A57A 1S72N 3C6AA 2ITMA 5M1NA 3ENHA 3VENA 4NY0A 3C6HA 1Y19B 2D4WA 2VYPA 5TKWA 3LDLA 1GC6A 2QXLA 1MK9B 3VETA 4BQZA 5LJVA 3DXKA 4BGAA 2Q31A 3CETA 4JHDA 1NGAA 2CGKA 4XEIA 3P38A 4EIAA 1K73O 1E5WA 4QS7A 4C23A 3VF6A 5AQMA 5KQDA 2WFBA 2ZJPL 4F9OA 2ASOA 2IVNA 4GV3A 2JWLA 1QQNA 5ELZA 3OA9A 2HBJA 2P9NA 3VGMA 4BG8A 2V7YA 3EZWA 5AQYA 5CE3A 3CHWA 4EFHA 1Q81O 1NGHA 3C7NA 3D6RA 4CZFA 1BA0A 4H0XB 3MX5A 3A5MC 5BPMA 4ISGA 5JLHA 3PZDA 5JVGL 1WUAA 1JCFA 3OHRA 2NRWA 4BC4A 3KZBA 3QMLA 4H5WA 4CZEA 3CIPA 3VEXA 4OO1J 2GTDA 2Q97A 4PHTX 4WFNL 1YITN 3O08A 1TYQA 2Q1NA 3CC7N 1QZ5A 5EXWA 3RVCA 1K8KA 1ISNA 3FP5A 2E1YA 2E1ZA 4GVEA 3A0IX 3Q7BA 3MWPA 2ZJRL 4CD1A 3TSQA 3RSEA 4P7IA 4XH5A 2OTJN 1G99A 1H4RA 3GE1A 4A59A 4EHTA 5I9EB 1GLBG 5AQOA 2P9IB 3U9DA 3H1QA 2CH6A 4O8KA 1DKGD 3DXKB 4QS8A 5AQTA 4FWLA 3FZMA 2HE7A 3A5LC 1LCUA 4ZRIA 4ILGB 3DAWA 2AA4A 3K9KA 3MWTA 1Z6RA 3O1BA 4GY2B 5CHIA 2COPA 1SQKA 2QI2A 4BRCA 5JLFA 1NI2A 1KD1O 3C65A 3MDQA 3KK7A 2VWBA 3VEOA 4A2BA 3O9RA 3DXMB 4YOYA 3P31A 3PIOL 1SGHA 2P9NB 4YOUA 5AQXA 1HPMA 3C7NB 2HBKA 2A3ZA 3BP8A 1BO5O 3B8AX 4J8FA 4NB4A 3HZ6A 5BPNA 4ILHA 5AQQA 1KBLA 2ASMA 4ISFA 3CQYA 2A5XA 3ZX0A 3VTHA 3SMSA 2HOEA 5B8HA 1DT9A 2IVOA 1TYQB 2ZF5O 1BDGA 2YX6A 1K8KB 4WQ5C 1XUPO 4Z94A 1HX1A 4MO4A 1DGKN 3FFKB 3SAGA 3G71N 3IFRA 5CR4A 4BRGA 1QVFM 5HL7L 4M7XA 4PKIA 3RSEB 1ACAA 3VGLA 3FR0A 3H1VX 4RWTA 3EO3A 2BUPA 4BR9A 3SJHA 3HRGA 2AP1A 1RGIA 5FPMA 5BPLA 1W97L 2X0SA 1HLUA 3A5OC 3D2EA 1H1VA 4CBXA 4DXAB 1NJIO 3CCUN 1GLEG 3O9SA 3G25A 2LBBA 4F7GA 3EL2A 4BVPA 4EKUA 3AGKA 1GLFO 3IVFA 4HTLA 1KQSM 2R82A 2ABDA 2W41A 1VBGA 1HUXA 3KVGA 2JWKA 3QICA 3OBWA 4JNEA 2P9PA 4H5RA 5KQ8A 4OPAA 4XH1A 5AFUA 4ZRJA 3HTVA 3AU5A 4B1ZA 3ATVA 2IVPA 4JK8A 2HF4A 2F9WA 3U8XA 4KH5A 1T6CA 3QB0A 3ZDTA 1TUYA 2NRXA 4YORA 2PBDA 4FWKA 3M1FA 5JICA 4IO9L 1KXPA 3LDOA 4JHDB 1YJ9N 5AQUA 3WUHA 4FWQA 1IG8A 3MN5A 4BG9A 5EX5A 2RE2A 3CJ9A 4CZLA 1XC3A 4PL8A 2F9TA 3G6EN 1WOQA 3VESA 2HBLA 4YL8A 3EE8A 4A61A 1JCGA 4BRFA 3CC2N 5BRFA 4IWVA 2FJ9A 3D2EB 3U4LA 3SBGA 4JKGA 4PKHA 2V51B 1NGJA 4ISEA 4K42A 5DM7L 4GV9A 4K25A 5FPEA 2E2NA 3O6WA 5ADXH 2CB8A 1NTIA 1ZXOA 2ZWHA 3DJCA 4H5TA 5KPRA 3EN9A 5GIOA 3CCVN 3WQTA 5BRHA 3MN6A 4BR2A 1ESVA 4JKFA 2P9PB 1GLAG 4IOCL 1TUUA 3ID8A 3SK3A 2FLOA 3FLVA 3AAPA 1J19A 4K43A 3TU5A 3E66A 5C2FA 3FE1A 4FVUA 1NGEA 2IIRA 4BC2A 4A2AA 3CJ7A 4U7BA 3ZX2A 5LY3A 4IOAL 3MCAB 3WA0A 2P9IA 4IOXA 5JVHL 3I56N 3R1XA 3VOVA 4B1YB 3KHYA 1E4GT 4ZRKA 4JKCA 1NGCA 3Q7CA 3UKUA 5C15A 5C2DA 3H46O 1V4TA 5C0YA 5BN8A 4CBWA 4BY9C 3CJ1A 3DXMA 1V4SA 4JD2A 1X3MA 5FPDA 3WXMB 4JKAA 4OPHA 1QZ6A 3LL3A 4MDAA 2YVCA 5JVLA 2P9KA 4H0VB 4JKGB 1NGBA 1YF5L 2KKZA 3HM8A 3AARA 2ZGYA 4FOIA 4IJAA 4FPBA 4KH4A 4M63C 5AQGA 1OVYA 4DQ8A 4C1NK 2A40A 3VTIA 1SS6A 2QWNA 4BR7A 4BRLA 2VGNA 1VQ7N 2HMPA 2I7NA 3VEYA 2FSNA 3O80A 2HRJA 2E20A 3JS6A 2J0KA 2J0JA 3O8MA 1NVLA 4FO0A 4BVOA 4U67L 5KPZA 3CCRN 2D0PA 1MK7B 3VPZA 5EVZA 3TTCA 1QVGM 2A6AA 5HOOA 4YOVA 3G9WA 4H03B 3SMPA 5KPTA 3HOTA 1YIJN 3BUZB 2OTLN 1NMDA 4FWPA 4A5AA 3BF3A 5AQZA 3IDHA 4BR0A 4BRIA 3UKUB 1NLVA 1YXQA 3D2FA 3NVKA 4L3QA 1HJOA 3SAHA 3HOSA 4WYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBT A;  3E66 A;  4JKD A;  4ILJ A;  4ILH A;  4JK7 A;  4JKE A;  3E9P A;  4JKC A;  3SBG A;  4JKG A;  4JK9 A;  3ENB A;  4JK8 A;  4JKH A;  4ILG B;  4JKA A;  3E9O A;  4JKG B;  4JKF A;  3E9L A;  4JKB A; 
#chains in the Genus database with same CATH topology
 3CC7 N;  1RDU A;  3CPE A;  3PIP L;  4M41 A;  4CGG A;  1OH5 A;  2HHS A;  4OGE A;  2QEX N;  3WXL A;  5C10 A;  3M8R A;  4FZZ A;  1N33 K;  2YJE A;  3ZSO A;  4DR6 K;  1SKW A;  2B6A A;  5K14 A;  1NK6 A;  5DM6 L;  4N47 A;  1NK9 A;  3BIN A;  3OYN A;  3THY B;  3LDQ A;  3VQ4 A;  1RBR A;  3DYA A;  3OYF A;  3P4I A;  3O4W A;  2O4G A;  1LV5 A;  1C0T A;  1VQN N;  2GUP A;  3OYB A;  2JGU A;  4NLC A;  2IAJ A;  3D2F B;  1Q7Y O;  4IJN A;  1JLA A;  3E1Y A;  3P83 D;  4CJF A;  2QWP A;  1RBS A;  4V19 S;  2W40 A;  1QQO A;  4IFV A;  5EOY A;  4CFA A;  2CQU A;  4CD3 A;  3SUQ A;  1RTH A;  1RT6 A;  1ZBS A;  4W5T A;  2W6K A;  3H6E A;  3O9U A;  4J2A A;  3VQA A;  2D2Q A;  4CZI A;  4DTX A;  4BR4 A;  4BC5 A;  4DTS A;  5KI6 A;  3WEE A;  3L4I A;  2HBM A;  4FWR A;  1NOZ A;  3S9H A;  2OAN A;  1MIX A;  5JS1 A;  2XRI A;  1LWE A;  3DLL L;  4BDP A;  1QSY A;  1U48 A;  4B9Q A;  2Z1J A;  4CF2 A;  1W2B M;  4WFA L;  4JRQ A;  4CHP A;  4KB0 A;  4BRD A;  1R0A A;  3GL1 A;  4CJK A;  2X74 A;  4AHS A;  1EO1 A;  1ZBI A;  4KHN A;  3CI5 A;  5MLC Q;  3G4S N;  5GIN A;  3R8E A;  3NF8 A;  1DTQ A;  3IUC A;  3VQ9 A;  3IS9 A;  3WEE B;  1NU0 A;  3NGZ A;  1DEJ A;  2E88 A;  4B9M A;  3LAN A;  4BRQ A;  1J54 A;  3F9M A;  3E9O A;  3OS2 A;  2BH1 A;  5CYQ A;  1O13 A;  3TAP A;  1ZC6 A;  3AA5 X;  3AVH A;  3SQ1 A;  5BN9 A;  3V4I A;  1VSL A;  4DS5 A;  4KI4 A;  4FJN A;  3QEI A;  3T69 A;  4CJS A;  5C25 A;  4FLU A;  3O4Q A;  3S3O A;  2DIK A;  1RBU A;  2NRR A;  2B4J A;  1TK8 A;  1B9F A;  3TI0 A;  4FW2 A;  2KFN A;  2QWR A;  1JLG A;  1HBK A;  3HPG A;  4J2B A;  4LFC K;  4B1V A;  4RW7 A;  4B9U A;  2YCH A;  3DLE A;  2GEM A;  3C95 A;  5JMV A;  4MO5 A;  5GAE P;  2HNY A;  3S41 A;  4LFB K;  3U8Z A;  3K2P A;  3GG4 A;  3CQX A;  1W9H A;  3LP2 A;  3F5T A;  1P90 A;  4FK0 A;  2DFF A;  2HB5 A;  2UXC K;  4OLA A;  1GLC G;  4A5B A;  5C12 A;  2KZM A;  1EP4 A;  5AQH A;  1KAZ A;  2D1K A;  1XI1 A;  4DHY A;  3UE5 A;  5J2M A;  1DLO A;  3BDP A;  2HVH A;  3MMV A;  4IFE A;  2AEH A;  4JKD A;  4AH9 A;  2A1R A;  3CER A;  3D45 A;  4CZK A;  1S1T A;  1HKG A;  1F21 A;  2Z1H A;  4W5R A;  1M1K O;  3MN7 A;  3U7D A;  1JLE A;  1NK8 A;  3DMJ A;  4JI2 K;  3QNN A;  4PKG A;  4KI6 A;  3MN9 A;  1K9M O;  2HHV A;  2V7Z A;  3KWG A;  4O55 A;  3AAQ A;  4O8U A;  4JI7 K;  2I7P A;  3PV8 A;  4BQL A;  4E1J A;  4CK3 A;  4B1W B;  3VQ6 A;  4BE2 A;  1BU6 O;  3L0Q A;  3ZYY X;  2CGJ A;  1RFQ A;  2P1J A;  3M8S A;  2EWS A;  5BR9 A;  4DKW A;  3X23 A;  1EF1 A;  1WNS A;  4O5F A;  4L8R B;  4HDQ A;  1UA0 A;  3TAE A;  3QFP A;  4H5V A;  1VSM A;  4BRH A;  3CXC M;  4N41 A;  5KGW A;  1NJZ A;  1O1W A;  4M7Y A;  3R6M A;  4YY3 K;  4R79 A;  4CJV A;  2RHK A;  1RT2 A;  3VGK A;  4FZX C;  3F2K A;  2WC9 A;  1GOA A;  2FBX A;  2YI1 A;  3J8A A;  4WE1 A;  3LP1 A;  1DIK A;  4CJT A;  2RPI A;  3CMA N;  3C6A A;  4BWJ A;  1WSJ A;  1UOC A;  3PUF A;  2VYP A;  1GC6 A;  4B3R K;  4LSN A;  4BGA A;  2CGK A;  1TK5 A;  3P38 A;  1K73 O;  1L3T A;  4QS7 A;  2YHB A;  3TWH A;  3VF6 A;  3CFR A;  5KQD A;  1X9S A;  2KQ2 A;  2ASO A;  4GV3 A;  4DMN A;  5HRO A;  1QQN A;  3KD1 E;  1I3A A;  1S6Q A;  2HBJ A;  2P9N A;  1Q81 O;  4DG1 A;  2IC3 A;  4CJU A;  4ISG A;  4CFD A;  3OHR A;  1JCF A;  4BC4 A;  4OO1 J;  4CZE A;  1TGO A;  1U4B A;  4EP4 A;  2A1S A;  1X9M A;  5EXW A;  5IWA K;  1WN7 A;  3Q7B A;  4A59 A;  3ULD A;  2XY5 A;  1S9E A;  4IDK A;  2CH6 A;  4E19 A;  1DKG D;  4QS8 A;  1JXE A;  3WNH A;  3AVK A;  3FZM A;  3A5L C;  3DAW A;  4ZRI A;  4ILG B;  3SQ4 A;  3OYG A;  4DSI A;  1KD1 O;  4F3O A;  3C65 A;  2RN2 A;  3KK7 A;  3DXM B;  4YOY A;  3P31 A;  1KVC A;  3SV4 A;  2P9N B;  1FW6 A;  4K0K K;  5AQX A;  3LAK A;  1HPM A;  4FJ8 A;  1HJR A;  1S5J A;  2HBK A;  3RR8 A;  1RBV A;  2OPS A;  3HZ6 A;  4NB4 A;  4ILH A;  2G8F A;  1ZBL A;  5B8H A;  4DR7 K;  1DT9 A;  1C6V A;  1RBT A;  1BDG A;  4BE0 A;  4WQ5 C;  3FFK B;  1C0M A;  1ACA A;  3VGL A;  3HVR A;  4RWT A;  3EO3 A;  3SJH A;  2AP1 A;  4I2Q A;  4CBX A;  4DXA B;  4NYN A;  4F7G A;  1WSH A;  1GLF O;  3QIC A;  3OBW A;  4ZHR A;  2P9P A;  4JRP A;  4K8X A;  4CEB A;  4FLY A;  3ATV A;  2IVP A;  4KHQ A;  2F9W A;  1T6C A;  4YOR A;  4JV5 K;  2VG5 A;  5JIC A;  3PSF A;  5FRM A;  1J9A A;  5AQU A;  4CER A;  4FWQ A;  2ZM6 K;  3MN5 A;  5EX5 A;  3CJ9 A;  3ZT4 A;  1RT7 A;  1XC3 A;  4PL8 A;  3VES A;  1TVR A;  4OKJ A;  4BRF A;  1EXQ A;  4FJG A;  3KLI A;  4PKH A;  3L2Q A;  3EZ5 A;  5DM7 L;  4LY7 A;  1IKY A;  5FPE A;  3LP0 A;  5ADX H;  2CB8 A;  1NTI A;  2ZWH A;  3EN9 A;  4DSJ A;  3MN6 A;  4OVL A;  4JKF A;  2P9P B;  1GLA G;  1TUU A;  3AAP A;  1XMQ K;  4B9T A;  4DFP A;  4F3T A;  1HQE A;  4M3R A;  4IOA L;  4CW7 B;  5JVH L;  5FRO A;  3R1X A;  5EU7 A;  3SPZ A;  1NGC A;  4JKC A;  1WAF A;  3Q7C A;  4FZY A;  5C2D A;  2OPR A;  5C0Y A;  3AO1 A;  2G8V A;  2F96 A;  1V4S A;  5FPD A;  3KLG A;  1QZ6 A;  2WOM A;  2YVC A;  5JVL A;  2KKZ A;  4BDY A;  2RKI A;  4FOI A;  4DLE A;  1KLM A;  3HJF A;  4E0D A;  1BHL A;  2A40 A;  4Z0U A;  3VTI A;  2VG7 A;  3VQQ A;  4BRL A;  3DLB A;  1VQ7 N;  3DRP A;  3O80 A;  3SPY A;  2HRJ A;  2J0J A;  4E7K A;  4JYA K;  3CCR N;  5FDL A;  4FYD A;  3K59 A;  3DOK A;  3EYZ A;  2GV9 A;  3VPZ A;  4X66 K;  5EVZ A;  3TTC A;  2A6A A;  5AQZ A;  3KD5 E;  3CM5 A;  4FJH A;  3NVK A;  4KTZ A;  3SUP A;  3F9K A;  3OYC A;  2ZPY A;  2V52 B;  1XQS C;  2XO7 A;  2HF3 A;  3KK1 A;  2HST A;  4K8Z A;  4LF6 K;  2O8D B;  1IBM K;  4DTR A;  3E9P A;  1FKO A;  1GLD G;  3FZL A;  3L3V A;  3CQ8 A;  1ATN A;  3HST B;  1CZ9 A;  4OPJ A;  4TKN A;  4BRE A;  2E4L A;  4PQU A;  3N4P A;  3A8Y A;  3IKM A;  4KHU A;  4FOE A;  1VSH A;  2FBV A;  5KRT A;  3EE9 A;  3S3N A;  2ASP A;  4DV5 K;  1J5O A;  1KAX A;  1KCF A;  5HLF A;  4JKE A;  1QSL A;  4FLX A;  2GWK A;  3AO4 A;  1T44 A;  3H3O B;  1BOT O;  3AVB A;  4FJ7 A;  1Q18 A;  4GKJ K;  4I9L A;  3O9T A;  4CE9 A;  1GOB A;  1N36 K;  2RF2 A;  2Q2R A;  2BDP A;  4B8A B;  4KH6 A;  1TL1 A;  2Q36 A;  3NHG A;  2A42 A;  3GBT A;  3L3U A;  3BY5 A;  3TR8 A;  4Y0W A;  3AVM A;  3O1W A;  3ZET A;  5AJ3 K;  3NBP A;  5GAG P;  3R3L A;  4CGD A;  1K8A O;  3THX A;  4FJI A;  3DRS A;  1KRP A;  4DU4 A;  3OJS A;  1N8R O;  3VF2 A;  4GV6 A;  1U6Z A;  1GC7 A;  5GAH P;  3SJJ A;  3UIQ A;  1NKC A;  3TSP A;  1CZA N;  3RWU A;  1LW2 A;  3C94 A;  4CJ7 A;  3OS1 A;  2D0C A;  4KBO A;  3NH1 A;  1JDE A;  1XNQ K;  2J0M A;  1JCE A;  3SUN A;  2E2O A;  3ID6 A;  1HB8 A;  2CGL A;  1EET A;  1KFD A;  4FJL A;  3H08 A;  3TAR A;  3CJC A;  2UUC K;  1GLJ O;  1ZBF A;  3C6T A;  4HCC A;  1MA9 B;  2O4I A;  3V9S A;  4ELU A;  3ZET B;  1IG9 A;  2NNW A;  2P9S A;  1SZ2 A;  3CME N;  1JJ2 M;  2G8I A;  4F8R A;  1JL2 A;  1KC7 A;  1BGX T;  5F2R A;  2I1J A;  2O8C A;  3VA3 A;  4DTU A;  4IDH A;  3SYZ A;  2UUB K;  2FSJ A;  1RDW X;  4FWN A;  4NO7 A;  4KKO A;  4AHV A;  2FC0 A;  5AFU H;  3VMF B;  3CFO A;  5E41 A;  2ZGZ A;  4PWD A;  3QBX A;  3AA4 A;  5AZI A;  4DSK A;  3B6P A;  2QXF A;  1D4X A;  2XY8 A;  4FWS A;  4CYE A;  2UXD K;  2QW9 A;  3I8B A;  4WQ4 C;  3HBT A;  4DV7 K;  1ZBH A;  4UY8 O;  5FRN A;  4OX9 K;  5M1P A;  3RTV A;  3CM6 A;  1J6Z A;  2P9S B;  2P9U A;  4CJW A;  1KSP A;  4YDU C;  4AF1 A;  3THV A;  4M3Z A;  1CXQ A;  5M1F A;  3K9J A;  1VRU A;  1HYV A;  2FBY A;  2O8C B;  4LH4 A;  3VQC A;  2I5J A;  1C0U A;  4DTN A;  1C1A A;  4YFU A;  1ILY A;  2WTU A;  4RW9 A;  1ST7 A;  3VQD A;  5ADX A;  2HHU A;  1ATS A;  3M3Z A;  4K41 A;  2HNZ A;  1DTT A;  3ENO A;  5AZI B;  3EPY A;  2E2Q A;  4CGI A;  1REV A;  5AR0 A;  1S1V A;  1VQ4 N;  3HPO A;  2P9U B;  3ZT1 A;  4W5N A;  3FGU A;  4KV8 A;  1EKE A;  4CHO A;  4N76 A;  4EZ6 A;  4AQY K;  3TSU A;  1HKC A;  4FJ9 A;  5T7B A;  1TKX A;  3IG1 A;  1KAY A;  1NJX A;  5AZJ A;  3OYK A;  1XNR K;  1L3U A;  4H0Y B;  1RTI A;  1VSI A;  4HUF A;  3BZC A;  2VG6 A;  4H0T B;  4OKE A;  4Q5V A;  3ENB A;  4B9S A;  3CCL N;  4YOX A;  3JXU A;  1X9J A;  5AQN A;  3ZSQ A;  3R9P A;  1VQ8 N;  4CF8 A;  3M5R A;  2HHH K;  4DTJ A;  1HNX K;  2NRV A;  3AVN A;  1YHQ N;  1I94 K;  1S1U A;  4CI6 A;  4CEO A;  2FDQ A;  1MIZ B;  4H0P A;  4CEQ A;  5E26 A;  4O0I A;  1YJN N;  2IS3 A;  5AZJ B;  3ZSX A;  1UA1 A;  3AVF A;  2NUB A;  3KKR A;  3IRX A;  4WFB L;  5F1X A;  4UQG A;  1NGF A;  2ATQ A;  4WQ5 A;  1G15 A;  1Z25 A;  4CZH A;  3FLC O;  1KC8 O;  1OH7 A;  3CFP A;  1WSG A;  1YUW A;  5JS2 A;  3M6G A;  4NXM K;  3S3M A;  5SWM A;  2ITM A;  3ENH A;  4NY0 A;  3G0Z A;  3C6H A;  5LJV A;  2QXL A;  4DR3 K;  1E5W A;  5AQM A;  2ZJP L;  2IVN A;  1NK4 A;  3VGM A;  4DR1 K;  4DQQ A;  1U45 A;  1EWQ A;  1NGH A;  3D6R A;  3V9Z A;  5JLH A;  3EEQ A;  5JVG L;  1WUA A;  3QML A;  5CYM A;  2ZQB A;  1YIT N;  4LSL A;  4XIU A;  4CK1 A;  3FP5 A;  4BDZ A;  3MWP A;  3AO2 A;  3TSQ A;  1VRT A;  1H4R A;  1ZBU A;  4EHT A;  2OZM A;  4KHS A;  2P9I B;  1L3V A;  3ZSR A;  3I8D A;  3H1Q A;  1BIU A;  5AQT A;  3K5L A;  4FWL A;  2HE7 A;  3MWT A;  1Z6R A;  5CHI A;  3AVG A;  4BRC A;  4CIE A;  3MDQ A;  2VWB A;  1SGH A;  1YTU A;  1JLF A;  4CEA A;  4YOU A;  4B3M K;  3D0P A;  1BO5 O;  3V81 A;  3MEC A;  4J8F A;  5BPN A;  5C42 A;  4ISF A;  3CQY A;  4DUY K;  2A5X A;  1XHZ A;  4JS5 A;  2HOE A;  4QCL A;  1ASU A;  2ZF5 O;  2YX6 A;  2YNF A;  1XUP O;  3J81 O;  1HX1 A;  1VSF A;  1T05 A;  3PO5 A;  4JS4 A;  4PKI A;  2BE2 A;  3FR0 A;  4BR9 A;  1NK7 A;  1RGI A;  3SQ2 A;  5BPL A;  4DWI A;  1HLU A;  3D2E A;  4DR5 K;  3CCU N;  1GLE G;  2DY4 A;  3O9S A;  1S1W A;  3G25 A;  1N5Y A;  4LF7 K;  1IV0 A;  4M42 A;  4Z4H A;  4HTL A;  1KQS M;  2R82 A;  2ABD A;  3KVG A;  2JWK A;  5DK5 A;  4JNE A;  4DSE A;  3HP9 A;  4H5R A;  5KQ8 A;  1K6Y A;  3LP3 A;  4XH1 A;  5AFU A;  1BCO A;  2ETJ A;  4RW8 A;  5BR8 K;  3K5N A;  1GOC A;  4IO9 L;  3PX4 A;  1KXP A;  3LDO A;  1JL1 A;  3NF7 A;  1HNW K;  3MAQ A;  4BG9 A;  4O0J A;  2RE2 A;  3MEE A;  2F9T A;  1WOQ A;  3EE8 A;  2BAN A;  1JCG A;  4A61 A;  1HNZ K;  2FJ9 A;  3D2E B;  3NE6 A;  3SBG A;  1ZYQ A;  3KK3 A;  1NGJ A;  3RMC A;  3V9U A;  4Z4F A;  3HM9 A;  5IT9 O;  2OZS A;  2O8F A;  1N34 K;  1ZXO A;  3CCV N;  1JLQ A;  4CK2 A;  4IOC L;  3FLV A;  1J19 A;  3FE1 A;  4BC2 A;  3CJ7 A;  4CCH A;  5LY3 A;  3MCA B;  4IOX A;  4B1Y B;  3VOV A;  2IDO A;  1E4G T;  2ZE2 A;  1LAV A;  2ZD1 A;  3UKU A;  5C15 A;  3T1Y K;  4RW6 A;  3PY8 A;  5BN8 A;  4CF9 A;  3DLK A;  4CBW A;  1ITG A;  3DXM A;  4JD2 A;  1X3M A;  3WXM B;  3ZT3 A;  4JI6 K;  3LL3 A;  2P9K A;  4DTM A;  2ZGY A;  4B3T K;  2O8F B;  4M63 C;  2P5G A;  4DQ8 A;  1SS6 A;  5H1S Q;  4X64 K;  2J0K A;  1YVU A;  3QLH A;  3VQE A;  1HR0 K;  5KTQ A;  3PSI A;  1S9G A;  1YIJ N;  1U49 A;  3SMP A;  1NMD A;  4FWP A;  1ASV A;  4A5A A;  3BF3 A;  3UKU B;  1NLV A;  3LAL A;  2WON A;  1NKE A;  1L5U A;  4DV2 K;  5J1E A;  3HOS A;  4WYB A;  3AGR A;  1VAZ A;  2Q0U A;  3ZSY A;  3AVL A;  4JD2 B;  4ID5 A;  3HSC A;  3LWM A;  2P9K B;  1Q8I A;  3H45 C;  2ITG A;  2QTD A;  4JI0 K;  4X62 K;  1HNV A;  1NGI A;  5BRE A;  1P8Z A;  1LOT B;  3QEV A;  3DOL A;  1RTJ A;  3VER A;  3HO1 A;  5DMR A;  2FXU A;  4AHC A;  4KPY A;  3DLR A;  1RTD A;  4JKB A;  3QEW A;  2IGI A;  1VHX A;  4BRP A;  2HHW A;  4YOW A;  3TTF A;  1NKB A;  2NRZ A;  1NGG A;  4CGH A;  1C0F A;  2E8A A;  3GDQ A;  1IH7 A;  2WUS A;  2WH5 A;  3VQ7 A;  4KFB A;  4DFK A;  1TL3 A;  5AQJ A;  4AHR A;  1U04 A;  3CCJ N;  5HRP A;  4AM7 A;  2KFZ A;  1X3N A;  1IJJ A;  1SV5 A;  3I0R A;  4KO0 A;  4QAG A;  4IBN A;  1N6Q A;  2GX9 A;  4HVJ A;  3HK2 A;  5D3G A;  4WQ4 A;  1NOY A;  3FZF A;  2VGM A;  4H4O A;  4EP5 A;  3I33 A;  4IO8 A;  4CEZ A;  1NBW A;  3HI0 A;  4A62 A;  3WXJ A;  1HKB A;  1XC9 A;  2NZT A;  4G9Z A;  1FXX A;  3MX2 A;  1HPZ A;  3CJB A;  3KWI A;  3QBW A;  4RW4 A;  1RT1 A;  1SKS A;  2KLA A;  1BI4 A;  4CBU A;  3J7Y P;  4KB1 A;  1SUQ A;  1WLJ A;  3LM2 A;  4FPA A;  4DR4 K;  3M8Q A;  3AU4 A;  4DQP A;  4MFB A;  1QHT A;  4CF0 A;  2YHW A;  2G8U A;  4ZTF A;  3BZK A;  2XY7 A;  4YHH K;  3IMX A;  4GVM A;  4ELT A;  2KZZ A;  3MCP A;  4CEE A;  3JAM O;  2XY6 A;  2QWQ A;  3L6Q A;  4BRO A;  2O8D A;  5M1O A;  1B92 A;  3AY9 A;  3BEX A;  1QHA A;  1YJW N;  1QTM A;  5AQV A;  1NGD A;  4CHQ A;  1RT4 A;  3W3D A;  3NDK A;  1VQM N;  2G8H A;  2NLX A;  4GXB A;  1BI4 B;  3RR7 A;  3NH2 A;  2D5R A;  2P51 A;  3KTQ A;  2HHQ A;  2BTF A;  3HPH A;  3OTO K;  3DLG A;  4IKF A;  3CPW M;  4PL7 A;  4DQI A;  3W0L A;  5HRN A;  4KTW A;  4DB3 A;  4MLE A;  1VSJ A;  2F8T A;  4BRM A;  4PA1 A;  1BIZ A;  1YVN A;  3OVN A;  5GAD P;  2YNG A;  1VQK N;  1VQL N;  4CFC A;  1YAG A;  3HT3 A;  3RRH A;  4H0O A;  1U2V A;  4FLV A;  4FLZ A;  1MWM A;  2Q0R A;  3V9X A;  1BQM A;  2P9L A;  3T1A A;  1UAX A;  2KW4 A;  1IKV A;  4CEC A;  1WSF A;  1GG3 A;  3BF1 A;  3C6U A;  4LF4 K;  2E2P A;  3K57 A;  2D11 A;  1KFS A;  1EQY A;  4DLG A;  1Y64 A;  4IEE A;  1NWK A;  2CH5 A;  4E1N A;  5LMN K;  3WXK A;  3O9Q A;  4IG0 A;  4AHT A;  2WBN A;  4OPK A;  1IKX A;  2VQF K;  5I3U A;  3SV3 A;  3NAE A;  1U2V B;  3ULE A;  5FLX O;  3ZX3 A;  3VF4 A;  4FM2 A;  2P9L B;  2DFH A;  1T3V A;  3ZCM A;  4CZM A;  3C0B A;  1BG3 A;  3KLE A;  4LFA K;  4JN4 A;  1Q82 O;  1TV6 A;  3MXJ A;  5IJM A;  3SAF A;  4I6M A;  4LF8 K;  1JLC A;  1WBB A;  5TKY A;  4NXN K;  1RDB A;  4QS9 A;  5AQS A;  3GOI A;  1TK0 A;  3NVM A;  4CZG A;  5M1Q A;  4E1M A;  3TAB A;  3QEP A;  3LPU A;  3K5O A;  1S3X A;  3ULE B;  3KLF A;  1HQU A;  3SLC A;  1R59 O;  5FPN A;  4B9L A;  3TAQ A;  2HW3 A;  3AV9 A;  3TPQ A;  4DU1 A;  3L2R A;  4BGB A;  4FCY A;  4X65 K;  4MDB A;  4MLH A;  3OYE A;  4DV6 K;  1NG9 A;  3DM2 A;  3FFI A;  4G1Q A;  5J2Q A;  1LWF A;  2D0O A;  4I6M B;  5LMU K;  4DV1 K;  4B1U B;  2EMT A;  4A57 A;  3ZT2 A;  4CJL A;  3JSM A;  3OYD A;  5TKW A;  3LDL A;  4GW6 A;  3DXK A;  2Q31 A;  1QE1 A;  4JHD A;  3V1R A;  1JLB A;  2WFB A;  2JWL A;  3MXM A;  3IAY A;  2PY5 A;  3ZLJ A;  2BGG A;  5ELZ A;  3V6D A;  2D0A A;  4BG8 A;  4EFH A;  3C7N A;  4Z4E A;  4CZF A;  4DUZ K;  3DRR A;  4H0X B;  3MX5 A;  5BPM A;  1XWL A;  3PZD A;  5F0X A;  2IOC A;  2NRW A;  4H5W A;  2F8S A;  3CIP A;  4PHT X;  2EHG A;  3O08 A;  1TYQ A;  2D0B A;  2Q1N A;  1QZ5 A;  3NF9 A;  4M3U A;  1K8K A;  2PZS A;  2ZJR L;  2XHB A;  4OLB A;  4P7I A;  4XH5 A;  3HL8 A;  1C1B A;  5I9E B;  4BE1 A;  4KHP K;  1GLB G;  5AQO A;  4Z4G A;  3U9D A;  3DXK B;  3G10 A;  4JHD B;  4FW1 A;  1X1P A;  3VQ8 A;  1CLQ A;  4GY2 B;  2AA4 A;  2YNI A;  3K9K A;  3SUO A;  4GMJ B;  1ASW A;  1SQK A;  1XHX A;  2QI2 A;  5JLF A;  1NI2 A;  4GKK K;  2UXB K;  3O9R A;  3PIO L;  2UU9 K;  3HYF A;  1IKW A;  4YNQ A;  3C7N B;  2A3Z A;  5KGX A;  3I0S A;  3MEG A;  1WSE A;  5AQQ A;  3NF6 A;  3ZX0 A;  3O4N A;  3VTH A;  3SMS A;  3BGR A;  4DFJ A;  1TYQ B;  3M8P A;  4E7L A;  5J2N A;  1K8K B;  3K0S A;  3AVC A;  1DGK N;  3QO9 A;  3G71 N;  5CR4 A;  4BRG A;  1QVF M;  2E6M A;  4M7X A;  3F73 A;  1D5A A;  1BQN A;  4BWM A;  2BUP A;  3HRG A;  2Y1J A;  1W97 L;  1H1V A;  1NJI O;  3HVT A;  4CEF A;  3EL2 A;  4I9Q A;  4BVP A;  4DS4 A;  3AGK A;  2W41 A;  3RMB A;  1TAU A;  1JXB A;  1D8Y A;  1J53 A;  3SQ0 A;  3AU5 A;  3U8X A;  4JK8 A;  1OH8 A;  4KH5 A;  3QB0 A;  1TUY A;  1LAW A;  2NRX A;  3ASM A;  3OYH A;  4C8L A;  4FJ5 A;  2PBD A;  3RMD A;  1OVQ A;  1EWR A;  2X6N A;  1IG8 A;  4FJX A;  4CZL A;  4IFY A;  2AJQ A;  3KK2 A;  1JKH A;  5BRF A;  4IWV A;  5CY4 A;  1TKT A;  3U4L A;  1W7A A;  4J2D A;  4AIL C;  4JKG A;  3SI6 A;  4CHZ A;  4I2P A;  4LF5 K;  2E2N A;  3O6W A;  4H5T A;  5KPR A;  3WQT A;  3ZSZ A;  3DLH A;  5BRH A;  1ESV A;  2W42 A;  1T03 A;  3SK3 A;  3PX0 A;  4K43 A;  5C2F A;  3AA3 A;  4FVU A;  2IIR A;  1Y97 A;  4U7B A;  1SKR A;  1FJG K;  4CJR A;  2P9I A;  3P1G A;  4KAZ A;  3I56 N;  3KHY A;  4FK2 A;  1VK0 A;  3H46 O;  1V4T A;  1QQC A;  4HCB A;  4BY9 C;  3JYT A;  4E7H A;  4JKA A;  4OPH A;  3OYM A;  4OGC A;  2HVI A;  4MDA A;  3HXM A;  2Z1I A;  4KRF A;  4JKG B;  4CHY A;  1YF5 L;  3LWL A;  1Z26 A;  4Y1C A;  3NGY A;  4JLH A;  4IJA A;  4R5P A;  5AQG A;  4C1N K;  2UUA K;  2QWN A;  3KIO A;  4BR7 A;  4KHW A;  3OJU A;  2FSN A;  1XMO K;  1NVL A;  4FO0 A;  2OCE A;  1TKD A;  3HOT A;  5HOO A;  4YOV A;  4H03 B;  5KPT A;  2OTL N;  3BUZ B;  4AHU A;  2Y1I A;  3IDH A;  1RIL A;  4BR0 A;  1T8E A;  4BRI A;  4DF8 A;  1YXQ A;  3QIP A;  2OYQ A;  4C8M A;  3TAF A;  1HJO A;  3VET A;  3SAH A;  3U3Y A;  3TAN A;  3SNN A;  3WT0 A;  4ELV A;  2G8W A;  3O5B A;  4FM0 A;  3VEV A;  4KTQ A;  3KKS A;  2QM1 A;  4B08 A;  1Q9Y A;  1NJY A;  4B1X B;  1GLL O;  4JK7 A;  4BR5 A;  4AM6 A;  3SZ2 A;  3VN5 A;  3EKS A;  4BC3 A;  3N4Q A;  3T19 A;  3EY1 A;  4J2E A;  4IXC A;  2NRT A;  4RCH A;  2ZJQ L;  3CD6 N;  2PFU A;  2OA8 A;  5AQW A;  2GBZ A;  3UB5 A;  4ZTJ A;  5AQP A;  4FJM A;  4Z4C A;  1C0G A;  4EAH D;  4W5Q A;  2O8B A;  4BRN A;  2PYL A;  4M3X A;  4ILJ A;  4YOT A;  3TTD A;  1Z05 A;  1A5X A;  5GIP A;  2E6L A;  2P5O A;  1NJW A;  3AVI A;  1QQM A;  1Q9X A;  3NCI A;  4F4K A;  3LM9 A;  4RTF D;  4IEI A;  1VSK A;  5EY4 A;  4Y1D A;  2QWL A;  3T3F A;  1RT3 A;  3SCX A;  3LAM A;  5A2Q O;  3LZI A;  4OKK A;  4JI8 K;  3WQU A;  4B3O A;  3E9L A;  3TAG A;  2EX3 A;  4E7I A;  4CVN E;  3CCE N;  2PYJ A;  1VQ6 N;  4FM1 A;  1RDA A;  4B8C A;  4CED A;  3A2F A;  1YI2 N;  2LSN A;  1HYS A;  2D10 A;  1BWF O;  2QWO A;  1MU2 A;  3PLA A;  1UWB A;  4B9N A;  5E84 A;  2O8B B;  4DTP A;  2HMI A;  2RQ1 A;  2YHY A;  2VCP A;  1ATR A;  2O8E A;  3NMU A;  3PX6 A;  1VQ9 N;  2I1K A;  2KHO A;  3MK6 A;  5HRS A;  2DTU A;  4O44 A;  4FL9 A;  1HB6 A;  1S22 A;  3LDP A;  1SL2 A;  2OPP A;  4O4G A;  5BRD A;  1RNH A;  1SAZ A;  3EKU A;  3ALY A;  4NLB A;  3ZSV A;  5AQR A;  4C1N I;  4JK9 A;  4JI3 K;  3CJA A;  4JAX A;  2NRH A;  1E4F T;  3L2V A;  5AQI A;  3PVL A;  3CCM N;  4KRE A;  2KTQ A;  2YHA A;  3QET A;  4DFM A;  1C1C A;  3SBT A;  2GWJ A;  3P39 A;  4ID1 A;  1CXU A;  4GNI A;  3OW2 M;  2O8E B;  3RMA A;  1NK5 A;  3P5J A;  2AL6 A;  4CGF A;  1VQO N;  2YHX A;  2J4R A;  4BAC A;  3E01 A;  1YT3 A;  2E5L K;  4BRK A;  1VSD A;  1HMV A;  4DF4 A;  3TAM A;  4FWO A;  2VWJ A;  3B6O A;  2QA4 N;  3WXI A;  3CC4 N;  2JLE A;  3D7E O;  2EMS A;  4HUE A;  3AVA A;  1CZB A;  4DCH A;  3V9W A;  1WB9 A;  3U9Z A;  1BUP A;  1KVB A;  1MDU B;  3LPT A;  4CZJ A;  4W5O A;  2QKK A;  3VEW A;  1S1X A;  1HNI A;  2A41 A;  3LDN A;  3ZEU A;  1T6D A;  1VQP N;  4HWI A;  1KTQ A;  1A5V A;  2X6S A;  5CZ2 A;  3A5N C;  4BRA A;  4EZ9 A;  4CJ4 A;  3DI6 A;  1NM1 A;  1FKP A;  4CGJ A;  1Q86 O;  4FJJ A;  2FF3 B;  2DPN A;  4FLW A;  3QFU A;  3VEZ A;  1VQ5 N;  1L3S A;  3OS0 A;  4FWM A;  1S6P A;  4JKH A;  5J2P A;  3CF5 L;  1BIS A;  1TKZ A;  4HUG A;  1SL1 A;  1LWC A;  3FZH A;  2FSK A;  3UKR A;  4M3T A;  4CES A;  1X9W A;  1J5E K;  2W6L A;  4HDO A;  2FF6 A;  5HBM A;  3QDK A;  1RT5 A;  4IG3 A;  2GEL A;  4DU3 A;  2YJF A;  4WF9 L;  3ZEU B;  2FBT A;  1IO2 A;  4HTU A;  4JEP A;  3CCQ N;  4M3Y A;  1BA1 A;  3THW A;  3QNO A;  4FJK A;  2F7T A;  3U3G A;  1MWK A;  5AQL A;  1IBK K;  4XH4 A;  1QSS A;  1BCM A;  2HHX A;  1WAJ A;  5HRR A;  4LC9 B;  1D9F A;  3LDS A;  5I42 A;  4DV0 K;  4B9V A;  5LJW A;  1HYZ A;  3I55 N;  3CCS N;  2YV0 X;  4H5N A;  4C8O A;  3DWL A;  2UYT A;  4YDU A;  3UKR B;  3FZK A;  1WBD A;  1GGO A;  3AO5 A;  3QIN A;  3NH0 A;  4RG8 A;  4CHN A;  4CF1 A;  1T7P A;  1A5W A;  1BL3 A;  5LL6 Z;  2VQE K;  3OBY A;  1IBL K;  3VQB A;  4M3W A;  3NFA A;  3T7Z A;  1OKJ A;  3J7Z O;  1N32 K;  3THW B;  3ATU A;  1VBH A;  2QK9 A;  2PAV A;  4DSF A;  4DV4 K;  4FXD A;  4PUO A;  4EHU A;  5AQF A;  5M1K A;  2H3G X;  3CG7 A;  1E3M A;  3OY9 A;  4WCE L;  3HP6 A;  2QWM A;  3QIJ A;  4FSV A;  3L4Q A;  1B9D A;  3CYM A;  4IZ9 A;  1M90 O;  2YNH A;  1NMN A;  5AQK A;  4C8N A;  4E7J A;  3VQP A;  3H3N O;  1YTA A;  4N56 A;  1S72 N;  5M1N A;  3OYI A;  3VEN A;  1Y19 B;  2D4W A;  4BQZ A;  1MK9 B;  3L2U A;  4EIA A;  3CET A;  1NGA A;  1WSI A;  2GUI A;  4XEI A;  3K5M A;  1FK9 A;  4C23 A;  4FK4 A;  4Z4I A;  4F9O A;  4DTO A;  4F2R A;  5HP1 A;  3OA9 A;  3AA2 A;  2V7Y A;  3EZW A;  5AQY A;  5CE3 A;  3CHW A;  4CIG A;  4HHT A;  1OH6 A;  1KLN A;  1BA0 A;  3A5M C;  3U6F A;  2OPQ A;  3OYL A;  3KZB A;  4I7F A;  3VEX A;  2GTD A;  2Q97 A;  4WFN L;  4DQS A;  3RVC A;  3V1Q A;  3O3G A;  1ISN A;  2E1Y A;  3K58 A;  2E1Z A;  4LF9 K;  4GVE A;  3A0I X;  3V1O A;  4CD1 A;  1U47 A;  3RSE A;  2OTJ N;  1G99 A;  3GE1 A;  3J7A P;  4DV3 K;  1KVA A;  4JI5 K;  5C24 A;  4O8K A;  3OYJ A;  4F2S A;  1LCU A;  3L2W A;  3MXI A;  3O1B A;  4C8K A;  3WNG A;  2COP A;  2VWK A;  2F4V K;  3J80 O;  1D9D A;  1LW0 A;  3VEO A;  4A2B A;  4Q0B A;  5CZ1 A;  3BP8 A;  1RDD A;  3OYA A;  3B8A X;  5SZT A;  1KBL A;  1NK0 A;  2ASM A;  3ISN C;  2YKN A;  4CJE A;  4KHY A;  2IVO A;  4JI1 K;  4Z94 A;  4MO4 A;  3SAG A;  3IFR A;  2HHT A;  3RSE B;  3ZT0 A;  4CJQ A;  3KLH A;  3H1V X;  4LD0 A;  5FPM A;  2DFE A;  2G8K A;  2X0S A;  3A5O C;  2YKM A;  4FLT A;  4M45 A;  2LBB A;  4CJ3 A;  4EKU A;  3O3F A;  3IVF A;  1VBG A;  1HUX A;  4CJP A;  5KRS A;  4DQR A;  2R7Y A;  4OPA A;  1W0H A;  2B5J A;  4ZRJ A;  4MQ3 A;  3HTV A;  4B1Z A;  4FVM A;  2HF4 A;  3ZDT A;  1VSE A;  3LZJ A;  4FWK A;  3M1F A;  1YJ9 N;  4N5S A;  3WUH A;  4CIF A;  3PO4 A;  4JI4 K;  3G6E N;  3WNF A;  2HBL A;  4YL8 A;  3NGI A;  3CC2 N;  4E89 A;  4OJR A;  2V51 B;  4ISE A;  4K42 A;  4H4M A;  4GV9 A;  1TAQ A;  4K25 A;  3RRG A;  3DJC A;  3QIO A;  4CJ5 A;  5GIO A;  4ICL A;  4BR2 A;  1SL0 A;  3ID8 A;  4PY5 A;  2FLO A;  4E3S A;  4DR2 K;  2Z1G A;  1RDC A;  2QKB A;  3TU5 A;  2X78 A;  3E66 A;  4H8K A;  1NGE A;  2Q3S A;  4A2A A;  3ZX2 A;  3WA0 A;  4NCA A;  4ZRK A;  3QER A;  3MED A;  4O5B A;  3CJ1 A;  3THX B;  4H0V B;  1QS4 A;  1NGB A;  3AVJ A;  3HM8 A;  4NYF A;  3AAR A;  3T1H K;  3VQ5 A;  3ITH A;  4FPB A;  4KH4 A;  4TSX A;  3WNE A;  1OVY A;  4NCG A;  1HRH A;  3QES A;  2HND A;  2VGN A;  3ZSW A;  2HMP A;  2I7N A;  3VEY A;  1NNE A;  2E20 A;  4BVO A;  3JS6 A;  3O8M A;  4U67 L;  5KPZ A;  3KJV A;  2D0P A;  1MK7 B;  4LH5 A;  1EX4 A;  3O3H A;  1QVG M;  3THY A;  3G9W A;  3VA0 A;  1I39 A;  4DSL A;  4QOZ B;  4B3S K;  3L8B A;  1RCH A;  4NCB A;  3D2F A;  4CFB A;  4L3Q A;  3QEX A;  5HL7 L;  3AO3 A; 
#chains in the Genus database with same CATH homology
 2ZPY A;  3AGR A;  1VAZ A;  2Q0U A;  2V52 B;  3WT0 A;  3O5B A;  1RDU A;  3CPE A;  1XQS C;  4JD2 B;  2HF3 A;  3HSC A;  2HST A;  3VEV A;  3PIP L;  2P9K B;  2QM1 A;  2QEX N;  3H45 C;  3WXL A;  4B1X B;  1GLL O;  4JK7 A;  2QTD A;  5C10 A;  4BR5 A;  3E9P A;  4AM6 A;  1GLD G;  3FZL A;  3EKS A;  2YJE A;  1NGI A;  4BC3 A;  5BRE A;  1P8Z A;  3N4Q A;  1LOT B;  1ATN A;  4IXC A;  2NRT A;  4RCH A;  4TKN A;  4BRE A;  2ZJQ L;  3CD6 N;  2PFU A;  3N4P A;  5AQW A;  5DM6 L;  3VER A;  3A8Y A;  3IKM A;  3UB5 A;  3BIN A;  2FXU A;  4FOE A;  3LDQ A;  4JKB A;  5AQP A;  3P4I A;  3O4W A;  3EE9 A;  4BRP A;  1C0G A;  1VQN N;  4YOW A;  2GUP A;  3TTF A;  4NLC A;  2ASP A;  1NGG A;  2NRZ A;  3D2F B;  4EAH D;  1C0F A;  1Q7Y O;  2E8A A;  1KAX A;  4BRN A;  3GDQ A;  4ILJ A;  4YOT A;  3TTD A;  4JKE A;  2WUS A;  2WH5 A;  1Z05 A;  4IJN A;  3E1Y A;  2GWK A;  1T44 A;  3CCJ N;  2QWP A;  3H3O B;  5AQJ A;  1BOT O;  2W40 A;  1QQO A;  5GIP A;  4AM7 A;  5H1S Q;  5EOY A;  1Q18 A;  1QQM A;  3LM9 A;  1X3N A;  2CQU A;  1IJJ A;  4IEI A;  4RTF D;  5EY4 A;  4CD3 A;  2QWL A;  3O9T A;  1ZBS A;  2Q2R A;  3WQU A;  3H6E A;  3O9U A;  4KH6 A;  2D2Q A;  3E9L A;  4CZI A;  4BR4 A;  2GX9 A;  4BC5 A;  2Q36 A;  4WQ4 A;  2A42 A;  3GBT A;  3FZF A;  3CCE N;  2VGM A;  1VQ6 N;  3WEE A;  4Y0W A;  3I33 A;  3L4I A;  4IO8 A;  1YI2 N;  1NBW A;  3HI0 A;  4A62 A;  3O1W A;  1HKB A;  2HBM A;  4FWR A;  3WXJ A;  3ZET A;  5GAG P;  2NZT A;  3R3L A;  2OAN A;  1MIX A;  2D10 A;  1BWF O;  2QWO A;  1K8A O;  3PLA A;  4G9Z A;  3DLL L;  5E84 A;  1N8R O;  3MX2 A;  3VF2 A;  4GV6 A;  2RQ1 A;  1U6Z A;  1GC7 A;  2YHY A;  2VCP A;  3CJB A;  3KWI A;  3QBW A;  5GAH P;  1ATR A;  3NMU A;  4B9Q A;  1W2B M;  4WFA L;  2I1K A;  2KHO A;  3TSP A;  1CZA N;  1VQ9 N;  3MK6 A;  2KLA A;  4CBU A;  4CJ7 A;  4FL9 A;  4KBO A;  1JDE A;  3LM2 A;  4FPA A;  4BRD A;  1HB6 A;  2J0M A;  1JCE A;  3AU4 A;  1S22 A;  3GL1 A;  2E2O A;  3ID6 A;  1HB8 A;  3LDP A;  2CGL A;  5BRD A;  1EO1 A;  2YHW A;  1SAZ A;  3EKU A;  3CI5 A;  3CJC A;  4NLB A;  5MLC Q;  3G4S N;  5GIN A;  3IMX A;  5AQR A;  3R8E A;  4C1N I;  4JK9 A;  1GLJ O;  3CJA A;  3IUC A;  4JAX A;  2NRH A;  3WEE B;  1E4F T;  1MA9 B;  1DEJ A;  2E88 A;  3MCP A;  5AQI A;  4BRQ A;  3PVL A;  3ZET B;  2NNW A;  2P9S A;  1SZ2 A;  3F9M A;  3E9O A;  3CCM N;  1JJ2 M;  3CME N;  2BH1 A;  2QWQ A;  3L6Q A;  1O13 A;  4BRO A;  5M1O A;  3AY9 A;  1ZC6 A;  3BEX A;  1KC7 A;  1QHA A;  1YJW N;  3SBT A;  2GWJ A;  3P39 A;  5AQV A;  5BN9 A;  1NGD A;  4GNI A;  5F2R A;  2I1J A;  3W3D A;  1VQM N;  3OW2 M;  2AL6 A;  2NLX A;  1VQO N;  4GXB A;  4IDH A;  2YHX A;  2J4R A;  4BRK A;  2FSJ A;  1RDW X;  4FWN A;  4NO7 A;  3T69 A;  2BTF A;  4FWO A;  5AFU H;  2QA4 N;  3VMF B;  3WXI A;  2DIK A;  3CC4 N;  2ZGZ A;  3CPW M;  3D7E O;  3QBX A;  2EMS A;  4PL7 A;  5AZI A;  1D4X A;  3W0L A;  4DCH A;  4FWS A;  4DB3 A;  4MLE A;  2NRR A;  4CYE A;  3U9Z A;  1BUP A;  2QW9 A;  3I8B A;  4WQ4 C;  4BRM A;  3HBT A;  4UY8 O;  1MDU B;  4CZJ A;  2QWR A;  3VEW A;  1HBK A;  5F0X A;  5M1P A;  2A41 A;  3LDN A;  3ZEU A;  1J6Z A;  1T6D A;  2P9S B;  2P9U A;  1YVN A;  1VQP N;  4HWI A;  4YDU C;  4AF1 A;  4B1V A;  5M1F A;  5GAD P;  2YCH A;  3K9J A;  2GEM A;  3A5N C;  4BRA A;  1VQK N;  1VQL N;  5JMV A;  1YAG A;  4MO5 A;  5GAE P;  1NM1 A;  3S41 A;  3U8Z A;  1U2V A;  4H0O A;  3GG4 A;  1Q86 O;  2FF3 B;  1MWM A;  2Q0R A;  2DPN A;  3CQX A;  3F5T A;  3QFU A;  3VEZ A;  1P90 A;  1ILY A;  1VQ5 N;  2P9L A;  4FWM A;  1ST7 A;  4JKH A;  5ADX A;  1GLC G;  4A5B A;  3CF5 L;  1GG3 A;  5C12 A;  5AQH A;  1ATS A;  1KAZ A;  2D1K A;  3M3Z A;  3BF1 A;  4K41 A;  4DHY A;  3ENO A;  3UE5 A;  5AZI B;  3FZH A;  2E2P A;  3MMV A;  2FSK A;  3UKR A;  3EPY A;  4IFE A;  2E2Q A;  2AEH A;  4JKD A;  2D11 A;  4HDO A;  1EQY A;  2FF6 A;  5AR0 A;  3QDK A;  1VQ4 N;  2GEL A;  1Y64 A;  2YJF A;  1NWK A;  4IEE A;  4WF9 L;  2CH5 A;  3ZEU B;  2P9U B;  4JEP A;  3CCQ N;  1BA1 A;  3CER A;  3WXK A;  4CZK A;  3FGU A;  3O9Q A;  1HKG A;  2WBN A;  2F7T A;  1MWK A;  5AQL A;  4XH4 A;  1M1K O;  1U2V B;  3ULE A;  3ZX3 A;  4LC9 B;  3MN7 A;  3U7D A;  3TSU A;  3VF4 A;  1HKC A;  2P9L B;  5LJW A;  3I55 N;  1KAY A;  4PKG A;  5AZJ A;  3CCS N;  1T3V A;  3MN9 A;  1K9M O;  2V7Z A;  3KWG A;  3AAQ A;  4H0Y B;  4O8U A;  4CZM A;  2I7P A;  4H5N A;  4BQL A;  3C0B A;  4E1J A;  3DWL A;  2UYT A;  1BG3 A;  4YDU A;  3UKR B;  3FZK A;  4B1W B;  4JN4 A;  1Q82 O;  1GGO A;  1BU6 O;  3L0Q A;  3ZYY X;  4H0T B;  5IJM A;  3SAF A;  4I6M A;  2CGJ A;  3ENB A;  5TKY A;  1RFQ A;  3CCL N;  4YOX A;  3OBY A;  3JXU A;  1X9J A;  2EWS A;  5AQN A;  4QS9 A;  5BR9 A;  3R9P A;  3T7Z A;  4DKW A;  3X23 A;  1OKJ A;  1EF1 A;  5AQS A;  1VQ8 N;  3GOI A;  3J7Z O;  4O5F A;  3ATU A;  3M5R A;  3NVM A;  1VBH A;  4HDQ A;  2NRV A;  5M1Q A;  4CZG A;  2PAV A;  1YHQ N;  3QFP A;  1S3X A;  4H5V A;  3ULE B;  4EHU A;  4CI6 A;  4BRH A;  3SLC A;  5AQF A;  2FDQ A;  1R59 O;  2H3G X;  5M1K A;  3CXC M;  1MIZ B;  4H0P A;  5FPN A;  5E26 A;  4M7Y A;  4WCE L;  3R6M A;  1YJN N;  5AZJ B;  4R79 A;  2QWM A;  3QIJ A;  4FSV A;  2RHK A;  3TPQ A;  3L4Q A;  3VGK A;  4BGB A;  4WFB L;  3F2K A;  2WC9 A;  5F1X A;  4IZ9 A;  1M90 O;  1NGF A;  2YI1 A;  4WQ5 A;  4MDB A;  4MLH A;  4CZH A;  3FLC O;  1KC8 O;  3J8A A;  2D0O A;  1YUW A;  4I6M B;  3M6G A;  5AQK A;  1DIK A;  4B1U B;  3CMA N;  3H3N O;  2EMT A;  4A57 A;  1S72 N;  3C6A A;  2ITM A;  5M1N A;  3ENH A;  3VEN A;  4NY0 A;  3C6H A;  1Y19 B;  2D4W A;  2VYP A;  5TKW A;  3LDL A;  1GC6 A;  2QXL A;  1MK9 B;  3VET A;  4BQZ A;  5LJV A;  3DXK A;  4BGA A;  2Q31 A;  3CET A;  4JHD A;  1NGA A;  2CGK A;  4XEI A;  3P38 A;  4EIA A;  1K73 O;  1E5W A;  4QS7 A;  4C23 A;  3VF6 A;  5AQM A;  5KQD A;  2WFB A;  2ZJP L;  4F9O A;  2ASO A;  2IVN A;  4GV3 A;  2JWL A;  1QQN A;  5ELZ A;  3OA9 A;  2HBJ A;  2P9N A;  3VGM A;  4BG8 A;  2V7Y A;  3EZW A;  5AQY A;  5CE3 A;  3CHW A;  4EFH A;  1Q81 O;  1NGH A;  3C7N A;  3D6R A;  4CZF A;  1BA0 A;  4H0X B;  3MX5 A;  3A5M C;  5BPM A;  4ISG A;  5JLH A;  3PZD A;  5JVG L;  1WUA A;  1JCF A;  3OHR A;  2NRW A;  4BC4 A;  3KZB A;  3QML A;  4H5W A;  4CZE A;  3CIP A;  3VEX A;  4OO1 J;  2GTD A;  2Q97 A;  4PHT X;  4WFN L;  1YIT N;  3O08 A;  1TYQ A;  2Q1N A;  3CC7 N;  1QZ5 A;  5EXW A;  3RVC A;  1K8K A;  1ISN A;  3FP5 A;  2E1Y A;  2E1Z A;  4GVE A;  3A0I X;  3Q7B A;  3MWP A;  2ZJR L;  4CD1 A;  3TSQ A;  3RSE A;  4P7I A;  4XH5 A;  2OTJ N;  1G99 A;  1H4R A;  3GE1 A;  4A59 A;  4EHT A;  5I9E B;  1GLB G;  5AQO A;  2P9I B;  3U9D A;  3H1Q A;  2CH6 A;  4O8K A;  1DKG D;  3DXK B;  4QS8 A;  5AQT A;  4FWL A;  3FZM A;  2HE7 A;  3A5L C;  1LCU A;  4ZRI A;  4ILG B;  3DAW A;  2AA4 A;  3K9K A;  3MWT A;  1Z6R A;  3O1B A;  4GY2 B;  5CHI A;  2COP A;  1SQK A;  2QI2 A;  4BRC A;  5JLF A;  1NI2 A;  1KD1 O;  3C65 A;  3MDQ A;  3KK7 A;  2VWB A;  3VEO A;  4A2B A;  3O9R A;  3DXM B;  4YOY A;  3P31 A;  3PIO L;  1SGH A;  2P9N B;  4YOU A;  5AQX A;  1HPM A;  3C7N B;  2HBK A;  2A3Z A;  3BP8 A;  1BO5 O;  3B8A X;  4J8F A;  4NB4 A;  3HZ6 A;  5BPN A;  4ILH A;  5AQQ A;  1KBL A;  2ASM A;  4ISF A;  3CQY A;  2A5X A;  3ZX0 A;  3VTH A;  3SMS A;  2HOE A;  5B8H A;  1DT9 A;  2IVO A;  1TYQ B;  2ZF5 O;  1BDG A;  2YX6 A;  1K8K B;  4WQ5 C;  1XUP O;  4Z94 A;  1HX1 A;  4MO4 A;  1DGK N;  3FFK B;  3SAG A;  3G71 N;  3IFR A;  5CR4 A;  4BRG A;  1QVF M;  5HL7 L;  4M7X A;  4PKI A;  3RSE B;  1ACA A;  3VGL A;  3FR0 A;  3H1V X;  4RWT A;  3EO3 A;  2BUP A;  4BR9 A;  3SJH A;  3HRG A;  2AP1 A;  1RGI A;  5FPM A;  5BPL A;  1W97 L;  2X0S A;  1HLU A;  3A5O C;  3D2E A;  1H1V A;  4CBX A;  4DXA B;  1NJI O;  3CCU N;  1GLE G;  3O9S A;  3G25 A;  2LBB A;  4F7G A;  3EL2 A;  4BVP A;  4EKU A;  3AGK A;  1GLF O;  3IVF A;  4HTL A;  1KQS M;  2R82 A;  2ABD A;  2W41 A;  1VBG A;  1HUX A;  3KVG A;  2JWK A;  3QIC A;  3OBW A;  4JNE A;  2P9P A;  4H5R A;  5KQ8 A;  4OPA A;  4XH1 A;  5AFU A;  4ZRJ A;  3HTV A;  3AU5 A;  4B1Z A;  3ATV A;  2IVP A;  4JK8 A;  2HF4 A;  2F9W A;  3U8X A;  4KH5 A;  1T6C A;  3QB0 A;  3ZDT A;  1TUY A;  2NRX A;  4YOR A;  2PBD A;  4FWK A;  3M1F A;  5JIC A;  4IO9 L;  1KXP A;  3LDO A;  4JHD B;  1YJ9 N;  5AQU A;  3WUH A;  4FWQ A;  1IG8 A;  3MN5 A;  4BG9 A;  5EX5 A;  2RE2 A;  3CJ9 A;  4CZL A;  1XC3 A;  4PL8 A;  2F9T A;  3G6E N;  1WOQ A;  3VES A;  2HBL A;  4YL8 A;  3EE8 A;  4A61 A;  1JCG A;  4BRF A;  3CC2 N;  5BRF A;  4IWV A;  2FJ9 A;  3D2E B;  3U4L A;  3SBG A;  4JKG A;  4PKH A;  2V51 B;  1NGJ A;  4ISE A;  4K42 A;  5DM7 L;  4GV9 A;  4K25 A;  5FPE A;  2E2N A;  3O6W A;  5ADX H;  2CB8 A;  1NTI A;  1ZXO A;  2ZWH A;  3DJC A;  4H5T A;  5KPR A;  3EN9 A;  5GIO A;  3CCV N;  3WQT A;  5BRH A;  3MN6 A;  4BR2 A;  1ESV A;  4JKF A;  2P9P B;  1GLA G;  4IOC L;  1TUU A;  3ID8 A;  3SK3 A;  2FLO A;  3FLV A;  3AAP A;  1J19 A;  4K43 A;  3TU5 A;  3E66 A;  5C2F A;  3FE1 A;  4FVU A;  1NGE A;  2IIR A;  4BC2 A;  4A2A A;  3CJ7 A;  4U7B A;  3ZX2 A;  5LY3 A;  4IOA L;  3MCA B;  3WA0 A;  2P9I A;  4IOX A;  5JVH L;  3I56 N;  3R1X A;  3VOV A;  4B1Y B;  3KHY A;  1E4G T;  4ZRK A;  4JKC A;  1NGC A;  3Q7C A;  3UKU A;  5C15 A;  5C2D A;  3H46 O;  1V4T A;  5C0Y A;  5BN8 A;  4CBW A;  4BY9 C;  3CJ1 A;  3DXM A;  1V4S A;  4JD2 A;  1X3M A;  5FPD A;  3WXM B;  4JKA A;  4OPH A;  1QZ6 A;  3LL3 A;  4MDA A;  2YVC A;  5JVL A;  2P9K A;  4H0V B;  4JKG B;  1NGB A;  1YF5 L;  2KKZ A;  3HM8 A;  3AAR A;  2ZGY A;  4FOI A;  4IJA A;  4FPB A;  4KH4 A;  4M63 C;  5AQG A;  1OVY A;  4DQ8 A;  4C1N K;  2A40 A;  3VTI A;  1SS6 A;  2QWN A;  4BR7 A;  4BRL A;  2VGN A;  1VQ7 N;  2HMP A;  2I7N A;  3VEY A;  2FSN A;  3O80 A;  2HRJ A;  2E20 A;  3JS6 A;  2J0K A;  2J0J A;  3O8M A;  1NVL A;  4FO0 A;  4BVO A;  4U67 L;  5KPZ A;  3CCR N;  2D0P A;  1MK7 B;  3VPZ A;  5EVZ A;  3TTC A;  1QVG M;  2A6A A;  5HOO A;  4YOV A;  3G9W A;  4H03 B;  3SMP A;  5KPT A;  3HOT A;  1YIJ N;  3BUZ B;  2OTL N;  1NMD A;  4FWP A;  4A5A A;  3BF3 A;  5AQZ A;  3IDH A;  4BR0 A;  4BRI A;  3UKU B;  1NLV A;  1YXQ A;  3D2F A;  3NVK A;  4L3Q A;  1HJO A;  3SAH A;  3HOS A;  4WYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...