4JK7A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk7A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk7A01
4JK8A 4JKAA 3ENBA 3E9PA 4JKCA 4JKDA 4JKFA 4JKBA 3E9OA 4JKHA 4JKGA 3E66A 4JKEA 4ILJA 3E9LA 4JK7A 4ILGB 4ILHA 4JKGB 3SBGA 3SBTA 4JK9A
chains in the Genus database with same CATH superfamily
4DLGA 2O8EB 4B8AB 1NG9A 2E2PA 3AVAA 1QTMA 4KKOA 3O08A 1X9SA 5F1XA 3U9DA 3VA0A 3V9XA 4B9TA 2EMTA 4PKIA 3SAFA 1YIJN 2F9TA 3OTOK 3VF2A 2P9UB 3LWLA 4DF4A 1TV6A 1XHXA 4K8XA 3AVNA 1T6DA 3NGYA 4CHYA 4OVLA 2QKBA 3HPGA 3K9KA 2KFZA 4IDHA 5BRHA 1TYQA 3DI6A 5AQWA 3ULEB 4YY3K 2CGKA 3S3OA 3ATVA 4FJLA 3HBTA 2X74A 3AA4A 3C6TA 1KVBA 2YJFA 3WNHA 4YNQA 4JKGA 3MEDA 4X62K 2G8VA 2E8AA 2WC9A 4FO0A 1IG9A 4CZLA 3CCQN 3LZIA 3LL3A 1TK0A 3GDQA 1D4XA 2FXUA 3BZCA 4G1QA 5AFUA 5GIPA 4KI6A 4ID1A 4DV7K 2I1JA 1Z25A 5AR0A 4F8RA 1G15A 4CJUA 3E66A 1DTQA 4W5TA 4JI1K 2HHXA 1HNZK 2W41A 2FBVA 3HRGA 5CYMA 4DS5A 4F3OA 2FC0A 1VBGA 2E4LA 1TVRA 3EO3A 3THWA 3NCIA 3CETA 3ZDTA 1HJRA 2OYQA 4CZIA 1WSHA 3OYJA 3C7NA 2ABDA 3B6PA 3WEEA 4LF8K 3O4NA 3SV4A 4YHHK 4CEQA 5M1FA 4QOZB 2P9NA 3DXKB 4CGGA 2HF4A 3KLFA 3ZSXA 3AVLA 1NOYA 3RRGA 4ZRKA 4KRFA 1TGOA 4GV6A 1BG3A 4A61A 1RTJA 4C8MA 4NXNK 4DQRA 2YHAA 4BWMA 2DPNA 3TU5A 4LF4K 3AV9A 1W2BM 2IVPA 3MXJA 3Q7BA 3MWPA 3VQAA 2OZMA 1U49A 1BCMA 3H3NO 1NGJA 3DLEA 4CGIA 4M41A 2HHQA 1BUPA 2ZWHA 4NB4A 2ZM6K 5AQLA 2HBMA 4K43A 4RCHA 5JMVA 2UXCK 3S9HA 1U2VA 1Q7YO 4DCHA 2UXBK 1IKWA 4BE0A 2JLEA 3NF6A 4IEIA 4H4OA 3VPZA 3O9SA 5AQKA 4H8KA 1X3NA 1LWEA 3UKUB 3SQ2A 3QINA 2P9PA 3U4LA 5LL6Z 3T7ZA 2HBJA 3HZ6A 4JI7K 4BG8A 1Q9YA 3VERA 3HOTA 3TAEA 3SZ2A 2PYLA 4HUEA 5KQ8A 2B5JA 4BR5A 2OTJN 4BY9C 4LH4A 4FLYA 3SUPA 2O4GA 3CJ7A 3ZSZA 4OKJA 3LM9A 2IS3A 3L2VA 4BR2A 3SNNA 3JYTA 3VA3A 2E6MA 1VQKN 1GG3A 1EWRA 4CIGA 1QVFM 4BVPA 3OS1A 2HHUA 4CJQA 1A5VA 1HKCA 1L3VA 3QEWA 4U7BA 3S3MA 5LJWA 3OYAA 5TKWA 2NRRA 1JKHA 1GGOA 4AQYK 3HVRA 3CM6A 1NI2A 4B1WB 4LFAK 3WXMB 5KI6A 2XHBA 3FFKB 4BREA 5MLCQ 2EX3A 3KJVA 4FJMA 2KFNA 3VQCA 4JHDB 4NXMK 4JI6K 4ILHA 4G9ZA 4JI0K 4CBXA 4AHSA 4QS7A 2W42A 3E1YA 3HSCA 2WBNA 3P83D 4FL9A 1QZ5A 3E9PA 4KHWA 1TUYA 4DQPA 5FRNA 1J53A 4Z4HA 1T7PA 3KLIA 1GLLO 2NRTA 3HJFA 4CJTA 5C2FA 3VTHA 1N5YA 5K14A 5T7BA 3L2RA 2FSKA 3VETA 4JK7A 2VQEK 4A5AA 3PIPL 2P9IB 3A0IX 5CZ1A 4HTUA 3AVHA 3J80O 4EP4A 3OYEA 4F3TA 3VEXA 3LPUA 1KAXA 1EWQA 4FJXA 3DRSA 3ZETA 1NKBA 2OPPA 4E1JA 1CXUA 4A57A 4BGAA 2D11A 5HLFA 3LANA 3AO5A 1TUUA 2Z1HA 4GV9A 4ELTA 4JKHA 1ACAA 5KRSA 3KLHA 5C24A 1H4RA 2P9LA 5KPRA 3Q7CA 3P38A 3P1GA 3AU5A 4E7HA 1HLUA 1BA0A 1BDGA 1D9FA 1C0MA 4PKGA 2D10A 3LDOA 4TKNA 2KKZA 1TK5A 4OPAA 3GL1A 2ZJRL 3ZT0A 2CGJA 4BRGA 4KH6A 3MX2A 1T6CA 3SQ1A 1GLDG 2B6AA 4CEDA 4KB1A 4Z0UA 2HNZA 4AM7A 1WSEA 4FVMA 1FKPA 4Z94A 2CH6A 4DR7K 2ZD1A 3M8RA 4JD2B 4CZHA 3L8BA 2HNDA 3QFUA 4DV6K 3FP5A 2F9WA 2J0MA 1GLJO 4M7YA 4AHVA 1RDWX 4IKFA 1ATRA 4BRHA 1IKXA 3TTDA 4FJ7A 2FF3B 3M8QA 1JLAA 1RTHA 4RW6A 2HHTA 4CZEA 4CJSA 2QWRA 2QWOA 1GLBG 3JSMA 1QZ6A 1TL1A 4AHUA 3V1QA 3ZLJA 2E1YA 4E7LA 2D0PA 5AQYA 2ZJQL 3SV3A 5HROA 4O4GA 1QSYA 1EKEA 3KLGA 3D45A 3NH1A 4KHNA 4FJGA 1BWFO 3QIOA 3S3NA 3HP6A 1SS6A 3CQYA 3VEOA 4MQ3A 4DSJA 1FXXA 3S41A 1DIKA 1HX1A 3QBWA 3VEWA 3DLHA 4DF8A 1BU6O 3MXIA 5KPZA 3PIOL 1LAWA 4L8RB 4I6MB 1J54A 1LW2A 3O8MA 3IRXA 2J4RA 4FPBA 4K0KK 1DEJA 3DLRA 2COPA 1I39A 4CEFA 2HBKA 3R6MA 2HHWA 4E7JA 3RMCA 1C1AA 1HKBA 3HM8A 3MCAB 5HOOA 2VG7A 2HRJA 2IDOA 3PO5A 4B9UA 4CHNA 4BE1A 3O1BA 1NGDA 3VQ7A 3RSEA 4DLEA 3C6UA 4JLHA 5HRSA 4KH4A 4U67L 5JVHL 1JXBA 4DUZK 3AO2A 1SQKA 4BRNA 1C0GA 4KHSA 3TTFA 4EKUA 4BR4A 2FDQA 2J0KA 1IBLK 1FK9A 3I55N 1GOAA 1HYZA 4FM2A 1HKGA 2JWLA 3IVFA 5M1KA 4DTMA 2PY5A 4FWKA 3ZYYX 4BRKA 2E88A 4I2QA 4FZZA 4BVOA 2YX6A 3L6QA 5SZTA 1RDAA 1EF1A 1XNQK 3TSPA 3QEXA 1K9MO 4ISGA 3W0LA 3FZFA 4RW9A 4IXCA 1VQPN 4FLUA 3AAPA 3PX6A 3RTVA 1UWBA 2GELA 1K73O 4RTFD 4KHPK 4FLZA 3RVCA 1QVGM 2ZPYA 3LWMA 2Q1NA 3DRPA 2LBBA 3EEQA 3QFPA 4NO7A 2VQFK 2O8EA 4CEBA 4CZFA 4FLVA 2FBYA 5BRFA 4FPAA 4BRPA 1RILA 3SBTA 1OH8A 4BRQA 1GLFO 4B1UB 1ZBSA 4NLBA 1RGIA 2KQ2A 2ASOA 3DJCA 2AJQA 2E6LA 1YJ9N 3SAHA 1OVQA 3AVJA 1M1KO 4FOIA 2WTUA 2YVCA 4C23A 1TK8A 5C0YA 1EETA 1QHAA 2GV9A 4DV0K 3DLLL 4B1YB 2W40A 2UXDK 5EXWA 2O8BA 2D1KA 1IJJA 1NU0A 3RMBA 3KWGA 4N76A 4PWDA 5KPTA 2Q0RA 3QETA 2QWMA 2O4IA 3TPQA 1S1UA 1N34K 2G8HA 3V6DA 1VSMA 1ATSA 2YKMA 5FRMA 1RT2A 3V81A 3R8EA 4X64K 4JI5K 5BREA 3ZSVA 4NCAA 4IOAL 4DSEA 4OKEA 4IDKA 1NK5A 1BOTO 1GOCA 3IDHA 3EL2A 3ZT4A 3UKRA 4E89A 4BR9A 2VWJA 4IG3A 4CJ4A 1XC3A 1IBMK 5AQQA 1NGCA 1WLJA 3CI5A 4IOXA 5AQPA 3IS9A 4E3SA 3D6RA 4FWLA 4DUYK 4CCHA 5LJVA 2BTFA 2O8FB 1U4BA 5JS1A 5DM7L 1HPZA 2QK9A 4CIEA 2GWKA 5BN9A 2HNYA 3MDQA 4IWVA 5JICA 4E19A 2BUPA 4BRIA 1BA1A 2KW4A 4HCCA 4E1MA 4UQGA 1VQ6N 2Q97A 1JLCA 1GC7A 1BGXT 4H5RA 5J2PA 4CEEA 1LWCA 1IKVA 4I7FA 4PHTX 4YOXA 4DS4A 2UU9K 3CM5A 4WQ5A 4BDPA 1GC6A 4DTJA 2ASMA 3EE8A 1JCFA 4H0PA 1SUQA 2YCHA 1V4SA 3QIJA 1RBSA 3V1RA 3J8AA 1Z26A 4DWIA 4J2EA 3AU4A 4AHCA 3CJ9A 4QS8A 3K5NA 3U7DA 1WB9A 3NDKA 2Q36A 4KREA 1O13A 5J1EA 5KQDA 2IOCA 3EKUA 1RTDA 4FJJA 1NK6A 3SQ4A 3KWIA 3O9QA 1RBVA 2OCEA 2YJEA 4MLEA 4F9OA 1XNRK 3C94A 1JL2A 1FKOA 2KHOA 4CF9A 4B3TK 3G10A 1NGIA 4XIUA 5JLHA 4BGBA 3OA9A 3H45C 3LAMA 1SV5A 1NKCA 4JKAA 4C8LA 3ITHA 3HL8A 2XY8A 1NLVA 1WSFA 4DG1A 4JKDA 3K2PA 3HT3A 1K6YA 1VSFA 2HMPA 3TI0A 3ZEUB 4N41A 2DFHA 3T3FA 5AZJB 3CCMN 1X1PA 5AZIB 2CH5A 4LF7K 3HPHA 3HVTA 4OKKA 1SL2A 3DAWA 1U47A 1NJWA 2PBDA 5AQRA 3T1AA 3OJSA 4BR0A 3G9WA 4HDQA 1OKJA 4JS5A 1YXQA 4DV2K 2GX9A 2YNGA 1E3MA 1VBHA 2QW9A 2DTUA 4FXDA 3DOLA 4CJFA 3CIPA 1B9DA 2O8CB 3IAYA 4DR4K 2YNIA 3PV8A 1UOCA 2X6NA 1NTIA 4Y0WA 4GXBA 4E7IA 4M3WA 3A5NC 1VQON 1UA1A 1HYSA 4L3QA 4IFEA 3ENBA 4KPYA 5SWMA 2A5XA 4E1NA 3V4IA 3ZSQA 1ZBUA 4JHDA 1X9JA 4CJVA 1S9EA 3OHRA 5M1NA 3X23A 3VTIA 4HUFA 1W97L 1Q8IA 3M3ZA 1N6QA 4Z4CA 4LSLA 3AVFA 3QEPA 3ENHA 2HBLA 4ZTJA 1ZYQA 1RTIA 3QEIA 1MK7B 3TAPA 1NK0A 3F73A 5C25A 1P8ZA 2P5GA 3HM9A 5I3UA 2X78A 3ENOA 3KK7A 3HXMA 2YNHA 3G25A 3SMSA 4M3XA 5EVZA 4CF8A 1K8KA 1ZBFA 4Y1CA 5CZ2A 3QLHA 1HNXK 2QWQA 4B3SK 5M1OA 4IO8A 3M6GA 5BPLA 1QSLA 4J2DA 4A59A 1NK9A 3CC4N 1J6ZA 3WUHA 2XO7A 4AILC 1YTUA 3O9UA 3CERA 1RDUA 3EZWA 2P9KB 5CE3A 1T44A 3U8XA 1YF5L 5AQVA 4BQLA 5AQMA 1RT5A 3KLEA 2JWKA 1WN7A 5AQZA 2YHWA 3OYCA 4JNEA 3QO9A 1WAFA 4DR6K 4DR1K 3BZKA 2JGUA 3R1XA 1E4GT 4Z4FA 4DTXA 4AM6A 1L3UA 4CZMA 4OJRA 5C42A 1V4TA 3G4SN 1NKEA 5LMNK 3HYFA 1F21A 4MDAA 3SQ0A 1NOZA 4FK0A 3CJCA 2ITGA 3AVIA 4WQ4C 4YOYA 4DSLA 1TL3A 1YVNA 2F96A 5CHIA 5GINA 1LCUA 2DY4A 2P9SB 4H0OA 3SUNA 2HMIA 3VEVA 3ID6A 5KTQA 2AL6A 1YJWN 1CZ9A 2Z1IA 5FPMA 3NHGA 1WSIA 2RKIA 3MK6A 4RG8A 2NRWA 4FJ5A 4F2SA 1BQNA 3DLGA 1KD1O 5BR8K 1DKGD 4ZRIA 1IBKK 4UY8O 4B9QA 5C2DA 3U3GA 1KRPA 3IKMA 4I6MA 3A2FA 3H3OB 4FOEA 4TSXA 2VCPA 3KVGA 2E20A 5HP1A 5BRDA 2OZSA 3AA2A 4H5VA 3FZMA 1D5AA 1QQNA 4LFBK 1E5WA 3IUCA 3HTVA 1VSHA 3MN7A 4YL8A 1ITGA 3ALYA 4ELVA 1NBWA 3O1WA 4OO1J 4IJAA 3TANA 1VRUA 4BRAA 4Z4EA 2Q31A 4WFNL 1NK7A 5ELZA 3PSIA 1EQYA 3EZ5A 4CZGA 1S72N 3LP0A 4EIAA 3HK2A 3H46O 1KLNA 2HHVA 3LDLA 4ID5A 4M7XA 4CJKA 3KK1A 5LMUK 4CZJA 3D7EO 3V1OA 4FJ9A 2OANA 3IMXA 4W5RA 4FLWA 4CF2A 4NCBA 1VQMN 1Q86O 3SUOA 3THWB 1NVLA 3ULDA 3MWTA 3F2KA 2YHBA 3E9OA 1W9HA 4PA1A 4BQZA 1XHZA 4KH5A 3FFIA 1MWKA 4CHOA 3ZSRA 3SPYA 3C7NB 5F0XA 4CVNE 5CY4A 1KLMA 4RWTA 3TSQA 4DFKA 3KHYA 3WEEB 3O3FA 3VGKA 4H0XB 4YDUA 3VN5A 5I9EB 4KHYA 3F9MA 3DLKA 2WUSA 4IJNA 3L0QA 5EOYA 2QWPA 2AEHA 4B1VA 2Q2RA 2PAVA 4ZTFA 4KTZA 3A5LC 1QE1A 3PY8A 4PKHA 1S1VA 4BRCA 4WCEL 3ZX0A 2I5JA 4NCGA 1FJGK 3WXIA 3JS6A 3GG4A 4X66K 3M8SA 4FWSA 2YV0X 3ZT2A 3OBYA 4Z4GA 3DOKA 3L2WA 2KTQA 2D4WA 1IO2A 3TTCA 3BEXA 3U8ZA 3O5BA 5I42A 3C6AA 1U2VB 3THVA 1DTTA 3J7ZO 1W7AA 3HO1A 2G8KA 2NLXA 3I0RA 1C1CA 1XI1A 3MEGA 1RDBA 3WNEA 4K42A 1N8RO 4EP5A 4RW4A 4I2PA 3J7AP 5C12A 4AHRA 4MDBA 5AQJA 4IBNA 3LP1A 3THYB 3LDSA 1HYVA 3E01A 4CF0A 1BL3A 3CCEN 1DT9A 3EKSA 2QA4N 2CQUA 3OY9A 1VSKA 1BQMA 2PFUA 4B8CA 1C0TA 1RBTA 5AQFA 3AAQA 1VQ9N 4XH5A 3LAKA 1HUXA 4QS9A 1RDCA 4FWOA 3VQ5A 3SJHA 1S1TA 4DTUA 3OYMA 3I8DA 1C0FA 3C95A 3A5OC 3VOVA 1JXEA 4GVMA 3VMFB 2HHSA 3OYHA 3NVMA 5A2QO 1ZBIA 2A6AA 4KTQA 4EHUA 3I8BA 4C1NI 4YORA 3CFOA 3LP2A 4GVEA 1R59O 3CJ1A 2FBXA 3AO3A 1C0UA 3VQ4A 3WXKA 1T03A 3CCJN 1JLEA 1VSEA 4KAZA 4BR7A 3D2EB 3M8PA 3VF6A 2XY5A 2UUAK 3AVCA 2DFEA 3NF7A 4O8UA 4O8KA 4WYBA 3PO4A 3N4PA 3K57A 2BE2A 4N5SA 3FZHA 5GAGP 2OTLN 3CCSN 4HUGA 1TAQA 3BINA 2J0JA 3TWHA 2DIKA 1DGKN 1JLBA 4CGDA 5B8HA 4Z4IA 1D9DA 3KKRA 5HRRA 2E2NA 4B9LA 1ASUA 1EP4A 1TKTA 5IT9O 4F7GA 4E7KA 1BISA 3WQUA 4WF9L 2QEXN 2HF3A 3CYMA 2F8SA 3WQTA 3MEEA 4XH4A 4CGHA 3KK2A 5BN8A 3NAEA 4DXAB 4GV3A 3DXMB 2PZSA 4GNIA 4M3ZA 4CFBA 3HOSA 1M90O 3P39A 4CK2A 2QXFA 3VQ6A 1VRTA 4H03B 1OH6A 5AZJA 2OA8A 2P9LB 2P9UA 3CD6N 2H3GX 3BUZB 2AP1A 5AZIA 3CCUN 1GLEG 2IIRA 4DFMA 2NRZA 2EHGA 3I0SA 2ETJA 3K5OA 3NBPA 4CD3A 3NH0A 4CW7B 4EAHD 1VSLA 2RPIA 3VQ9A 3GBTA 2GWJA 3MX5A 1SL0A 1ZBLA 3ULEA 4EZ6A 4OPKA 3OYIA 3CFPA 2P5OA 1JLGA 4OPHA 3RMAA 1XMQK 3SK3A 5KGXA 3NF8A 4B1XB 1FW6A 2R7YA 1BI4B 5AQSA 1BIUA 3LDQA 3THXB 1ZC6A 4C8KA 4JI4K 3AGRA 4CE9A 4CJEA 4YOTA 4PQUA 1N32K 3GOIA 4A62A 1W0HA 4C8OA 4FK4A 4OPJA 1TAUA 3JXUA 2HSTA 1Y64A 4ZHRA 3AA3A 4FLTA 4FJNA 3J7YP 1VQ4N 2GBZA 2PYJA 4KB0A 4H0TB 1RT4A 3BF1A 4DHYA 2P51A 1NGEA 1NK4A 3NF9A 3TR8A 4JKCA 3OYKA 4KTWA 4YOUA 1BCOA 4CFCA 1YUWA 3SPZA 1RBUA 2XY7A 3M1FA 3TABA 4DTSA 4BWJA 3ASMA 2D5RA 2ATQA 4FLXA 1NWKA 4DR2K 2RHKA 4BRMA 4M3UA 3VQBA 3OYGA 5CR4A 1WBBA 4JRQA 4DQ8A 1HR0K 3JAMO 4DR5K 1CZBA 4H0YB 4FVUA 5FPEA 1L5UA 3K5MA 1ASVA 4RW7A 2QXLA 3AVGA 3DXKA 1NK8A 3P4IA 1HNWK 1BIZA 4CECA 3I56N 3V9SA 1G99A 4JKEA 3CJAA 3L2QA 4BE2A 3U6FA 4FK2A 1QSSA 2RN2A 3NH2A 1J5EK 2F4VK 3RRHA 3SYZA 3CG7A 5HRNA 3NMUA 3FR0A 4H5WA 4DB3A 3UIQA 2VWBA 1YT3A 3D0PA 3DRRA 4GMJB 5E41A 3NGIA 4NLCA 4WQ4A 2AA4A 1XC9A 4PY5A 4PL7A 4BRLA 4DTRA 4BDYA 4ILJA 3LDPA 2OPSA 3L3VA 2IVNA 1C1BA 3LZJA 3G71N 2G8UA 3O6WA 3R3LA 2QI2A 3UKUA 3AVMA 3CHWA 3AGKA 2IC3A 3SUQA 4FYDA 2A42A 5ADXH 3BP8A 2Y1JA 4FWMA 5GAEP 4M45A 2G8IA 4EFHA 2UUBK 2UUCK 3CMEN 3OVNA 4KHQA 3WNFA 3GE1A 3M5RA 1X9MA 1CZAN 4YOVA 4H5NA 5BR9A 2XY6A 3KTQA 1S6QA 2LSNA 4JK9A 4JAXA 3EYZA 2E2QA 3CC7N 5AQNA 3O3HA 1HQEA 3BY5A 4M63C 3N4QA 1C6VA 1A5WA 3H1QA 1LOTB 4KI4A 1EX4A 4CJWA 3LALA 3W3DA 2FF6A 2BH1A 1WBDA 1XQSC 2FSNA 4CHPA 4H0VB 5FPDA 4CGJA 4CJLA 4B9SA 3T69A 3SBGA 2VWKA 1WOQA 2FLOA 4B3RK 1RNHA 4FSVA 1RT7A 4J8FA 4YOWA 4BG9A 4DV1K 3PVLA 4AHTA 3VGLA 2O8BB 3QNNA 4LD0A 4ELUA 3KZBA 1NMDA 1P90A 2NRXA 1JLQA 1KVAA 3QICA 1Z05A 3K59A 3H1VX 3VF4A 4FW2A 3A5MC 2WH5A 1IKYA 1VQ8N 2YHXA 1YVUA 3OYNA 2IAJA 3KD5E 3D2FB 3NVKA 2DFFA 1RDDA 3ID8A 4GW6A 3IG1A 3EPYA 5DK5A 4JI3K 3UKRB 4H5TA 3CCLN 4KV8A 3UB5A 1OH7A 3HPOA 1MIXA 3CC2N 2P9IA 3T1YK 1T3VA 1LV5A 5JVGL 1JJ2M 4XEIA 4O55A 4J2AA 5FDLA 4CHQA 3WA0A 1NJZA 4QCLA 4DV5K 5FLXO 2Y1IA 4K25A 2GEMA 3AVKA 1SKSA 3DYAA 5FPNA 2VGNA 4JKFA 2D0CA 1YAGA 4CI6A 3O9RA 3ZX2A 2CGLA 5HL7L 1Z6RA 3ZT1A 1VQ7N 2YI1A 3CQXA 1YITN 4B9VA 3VESA 2G8FA 1X3MA 3RMDA 1SL1A 4MO4A 3AVBA 1ASWA 1S1WA 4M3TA 1Q9XA 4ISFA 2ZF5O 4DU1A 3CPWM 3OW2M 3QEVA 2KLAA 3MCPA 4O5BA 5EY4A 4FJHA 2O8DB 3WXJA 2R82A 4FJKA 5JS2A 4IEEA 3O80A 2HE7A 2FBTA 1RCHA 5AFUH 4JD2A 2QTDA 4LY7A 4DSFA 3PX4A 2ZGZA 1HNVA 3RWUA 5E84A 3BDPA 4B3MK 3MN9A 4WQ5C 2OPQA 2HB5A 2GUIA 1RT6A 1VSIA 4DTPA 4DFJA 1RT1A 4CJ5A 1SZ2A 3SI6A 4ZRJA 4JRPA 2HVIA 5D3GA 3QBXA 2GTDA 4O5FA 3CCVN 4DTNA 1ZXOA 3LDNA 4CBUA 2QKKA 1B9FA 4DSKA 1KAYA 3R9PA 4CJ3A 2KZZA 5LY3A 2NUBA 3ZSYA 4DKWA 3THYA 3CMAN 2WONA 2QWLA 1YI2N 3FZKA 1HB8A 3P31A 3CXCM 4X65K 3O4QA 4W5OA 3SLCA 1KVCA 3VEYA 3AO4A 1IV0A 4CEZA 4C8NA 3MECA 3ZX3A 5EX5A 1TYQB 2F8TA 5AJ3K 1HNIA 1T05A 1HMVA 4DV3K 1S6PA 2ZJPL 4I9QA 4DV4K 4EHTA 1WUAA 1UA0A 2NRHA 4JKGB 3OS2A 1ESVA 1QQOA 3RR8A 1OH5A 2P1JA 3VQ8A 2HHHK 4K41A 5KGWA 5M1PA 1NGFA 1REVA 3CCRN 1KSPA 1GLAG 2YKNA 1Q82O 1X9WA 1NM1A 2BDPA 1HBKA 3TAMA 3TAGA 5JVLA 3HI0A 3AO1A 4CIFA 3NE6A 4FJ8A 4CK3A 4KO0A 5FROA 3OYDA 1QQCA 1U48A 2WFBA 1WSJA 1UAXA 3O9TA 1EXQA 1JL1A 4BC5A 4OLBA 3J81O 1Y97A 1XUPO 2NNWA 5J2MA 4J2BA 2WOMA 2X6SA 2A1RA 1LWFA 4DQQA 3D2EA 3EY1A 1NJYA 3KIOA 1WNSA 4CHZA 3SCXA 3QERA 1NGAA 1OVYA 2IVOA 1CXQA 1MWMA 3ATUA 2Q0UA 3A8YA 4CJ7A 3PSFA 3K5LA 3EE9A 4B08A 4BC3A 4HVJA 4CF1A 4JI2K 5KRTA 4GKKK 5AQTA 1K8KB 2P9NB 3C65A 1KTQA 3BF3A 4N56A 3DXMA 4LC9B 3QB0A 2HOEA 4DU3A 4CGFA 1J9AA 4FW1A 5H1SQ 1HB6A 3QIPA 5TKYA 1HJOA 3DLBA 2Z1GA 5J2NA 1LW0A 2E5LK 4DFPA 4PUOA 3FE1A 4FZXC 1TKZA 3HP9A 3OBWA 2KZMA 4CFDA 2Z1JA 1Y19B 2V52B 3H6EA 1J19A 3C0BA 3ZSOA 5JLFA 4JN4A 3V9ZA 2D0BA 3QESA 3MXMA 2ZE2A 1KBLA 4AF1A 1XMOK 4PL8A 5AQUA 3ZSWA 2YNFA 3U9ZA 1BI4A 2W6KA 2B4JA 1VK0A 3FZLA 4MLHA 2P9PB 4BRDA 3PX0A 1TKDA 3THXA 4BACA 3IFRA 4MO5A 3T19A 2D0AA 5CYQA 4F4KA 4CJRA 1NJXA 4DSIA 3MMVA 4E0DA 1DLOA 5BPNA 3K0SA 2G8WA 1RBRA 4AH9A 1SKRA 5HRPA 1R0AA 4DR3K 4DQIA 5GADP 2I7PA 3TAQA 4OX9K 3L4QA 5DMRA 1VQNN 5DM6L 1S22A 3V9WA 2NRVA 3P5JA 4XH1A 2VYPA 1VSJA 2O8FA 3OS0A 1IG8A 1RT3A 1KFSA 1LAVA 4RW8A 1VSDA 4I9LA 4CBWA 1S3XA 2I7NA 3TARA 1HQUA 3BGRA 4NYFA 3FGUA 2BGGA 2A40A 2W6LA 3G0ZA 3DM2A 1I3AA 1IH7A 3B8AX 5M1QA 4BC2A 2FJ9A 4F2RA 3QMLA 3EN9A 1NNEA 3I33A 3ZT3A 4WFAL 2CB8A 4R5PA 3KK3A 5E26A 4GKJK 3VQQA 1B92A 3CQ8A 3VQPA 5J2QA 1Q18A 1N36K 3RR7A 4NY0A 2QWNA 3DWLA 1JLFA 3K9JA 3F9KA 4BC4A 1NMNA 4LF9K 2HW3A 4W5NA 1YJNN 1NGGA 2RQ1A 2A41A 2RE2A 2VGMA 5IWAK 3KD1E 4C1NK 4A2BA 2D2QA 2I1KA 1VHXA 3VGMA 4CZKA 3MN5A 5AQXA 1L3SA 1Q81O 4FZYA 3L4IA 4IG0A 1T8EA 3K58A 2NZTA 5EU7A 1TKXA 4JKBA 4M3RA 1D8YA 4ICLA 3OYFA 1GOBA 5C15A 3AA5X 4DMNA 4DQSA 4IO9L 1NGBA 3ZETB 1CLQA 2ZQBA 2FSJA 3AARA 1MA9B 2XRIA 4FM0A 1MDUB 4HWIA 4DTOA 1U6ZA 4B9MA 3ZEUA 1XWLA 4FWPA 3LPTA 4B9NA 4CESA 1J5OA 3ISNC 2E2OA 4CJPA 1KXPA 4HDOA 4LF6K 2VG6A 3LM2A 1VAZA 2V51B 3CJBA 3QNOA 3VENA 1SGHA 1U04A 2HVHA 4M3YA 3FLVA 5AQGA 5GAHP 2OPRA 1RFQA 1SAZA 2V7ZA 1NJIO 4IFVA 3MN6A 3H08A 4QAGA 4HCBA 2GUPA 3WNGA 4LH5A 1QHTA 4NYNA 2ITMA 3T1HK 2UYTA 3MAQA 4FWRA 4CEOA 4JI8K 1MU2A 2O8CA 1U45A 4O44A 1JCEA 5GIOA 3TSUA 1O1WA 4BROA 2F7TA 2YHYA 4O0IA 4JV5K 3CFRA 5AQHA 2E1ZA 3L3UA 3VQDA 1ISNA 4Q0BA 3FLCO 4YDUC 2ZGYA 4OGCA 1BHLA 2Q3SA 1ILYA 3CF5L 1ZBHA 2EMSA 2A1SA 1N33K 1JCGA 4CYEA 4CD1A 4HHTA 3U3YA 4WE1A 1S1XA 1A5XA 4ISEA 4JS4A 1JDEA 3KKSA 4DU4A 3SMPA 3TAFA 3F5TA 2D0OA 4LSNA 3D2FA 3QDKA 3O4WA 4MFBA 3PUFA 4W5QA 1WAJA 5ADXA 1I94K 4P7IA 1GLCG 4Q5VA 4H4MA 3E9LA 3PZDA 3UE5A 4CFAA 4KBOA 1QS4A 1HPMA 4BRFA 1KC8O 3SJJA 1KFDA 1KAZA 3CPEA 5AQOA 4JK8A 4CERA 1E4FT 3LP3A 4FM1A 4YFUA 2EWSA 4N47A 3DMJA 1ATNA 4Y1DA 1K8AO 4V19S 3G6EN 5BPMA 4IOCL 3NFAA 4OLAA 5C10A 1S9GA 4GY2B 2V7YA 3SAGA 4LF5K 3RSEB 5F2RA 4LFCK 3HSTB 4JEPA 2VG5A 3WXLA 3V9UA 4FWNA 4KFBA 4R79A 1KQSM 2X0SA 1H1VA 1KCFA 2QM1A 3WT0A 2ASPA 4EZ9A 4WFBL 4JYAK 5IJMA 3OYLA 2P9KA 3L2UA 4BDZA 1BO5O 1NGHA 3VQEA 4B1ZA 3PLAA 3NGZA 4CK1A 4CEAA 1L3TA 4HTLA 4KHUA 4FCYA 5HBMA 2O8DA 4M42A 1SKWA 3C6HA 3AY9A 5AQIA 3VEZA 1YHQN 4K8ZA 3OJUA 1WSGA 3B6OA 1VQ5N 2IGIA 4B3OA 1EO1A 2RF2A 2A3ZA 1HRHA 1ST7A 4A2AA 2BANA 4O0JA 3ZCMA 1QQMA 1KC7A 4OGEA 1S5JA 4IZ9A 3OYBA 1YTAA 4FJIA 4FWQA 4ILGB 1MIZB 4A5BA 3O3GA 1MK9B 2P9SA 1VQLN 4IFYA
chains in the Genus database with same CATH topology
3MN9A 4WQ5C 4BRQA 2E2PA 2D4WA 1GLFO 4B1UB 1ZBSA 4NLBA 3TTCA 3BEXA 1RGIA 3O08A 3U8ZA 3O5BA 2ASOA 3DJCA 1SZ2A 3U9DA 5F1XA 3C6AA 1U2VB 4ZRJA 2EMTA 3J7ZO 4PKIA 3SAFA 3QBXA 1YIJN 2F9TA 1YJ9N 3VF2A 2P9UB 3SAHA 2GTDA 4O5FA 4FOIA 3CCVN 1ZXOA 2NLXA 1M1KO 3LDNA 4CBUA 2YVCA 4C23A 1T6DA 5C0YA 1KAYA 1QHAA 3R9PA 3DLLL 3K9KA 2W40A 4B1YB 5LY3A 4K42A 4DKWA 5EXWA 1N8RO 4IDHA 2D1KA 3CMAN 1IJJA 5BRHA 1TYQA 2QWLA 1YI2N 3FZKA 1HB8A 3P31A 5AQWA 3CXCM 3ULEB 3KWGA 5C12A 2CGKA 2Q0RA 3ATVA 2QWMA 4MDBA 5AQJA 3SLCA 3VEYA 3HBTA 3TPQA 3ZX3A 5EX5A 1TYQB 1ATSA 2YJFA 4JKGA 3R8EA 2E8AA 1DT9A 2WC9A 3EKSA 4FO0A 2QA4N 3CCEN 5BREA 2ZJPL 2CQUA 4CZLA 4IOAL 3CCQN 4EHTA 1WUAA 2NRHA 1BOTO 3IDHA 4JKGB 2PFUA 3EL2A 3LL3A 1ESVA 1QQOA 3UKRA 3VF4A 3GDQA 1D4XA 2FXUA 4BR9A 1XC3A 5AQQA 1NGCA 5AQFA 4K41A 3AAQA 5M1PA 3CI5A 1NGFA 4IOXA 4XH5A 5AQPA 5AFUA 3D6RA 4FWLA 5GIPA 3CCRN 1GLAG 1HUXA 4QS9A 1Q82O 1NM1A 4FWOA 5LJVA 2I1JA 2BTFA 1HBKA 5AR0A 3SJHA 5DM7L 5JVLA 3E66A 3HI0A 2GWKA 5BN9A 1C0FA 3A5OC 3MDQA 3VOVA 2W41A 3HRGA 4IWVA 3VMFB 5JICA 2WFBA 2BUPA 3NVMA 3O9TA 4BRIA 1BA1A 4BC5A 1VQ6N 2Q97A 2A6AA 1VBGA 1XUPO 1GC7A 2NNWA 4EHUA 3I8BA 3EO3A 4C1NI 4H5RA 4YORA 3CETA 3ZDTA 1R59O 3CJ1A 4GVEA 3D2EA 4PHTX 4CZIA 4YOXA 3WXKA 3CCJN 4WQ5A 1NGAA 3C7NA 1OVYA 2IVOA 1GC6A 1MWMA 2ABDA 3ATUA 2ASMA 2Q0UA 3A8YA 1JCFA 3EE8A 3WEEA 4H0PA 4CJ7A 4BR7A 3D2EB 3VF6A 2YCHA 3EE9A 4O8UA 4O8KA 4WYBA 1V4SA 3QIJA 5M1FA 4BC3A 2P9NA 3N4PA 3DXKB 3FZHA 2HF4A 5GAGP 3J8AA 2OTLN 3CCSN 3AU4A 3BINA 2J0JA 3CJ9A 2DIKA 4QS8A 3U7DA 4ZRKA 1DGKN 5B8HA 2Q36A 4GV6A 5AQTA 1K8KB 2P9NB 1BG3A 1O13A 3C65A 4A61A 3BF3A 5KQDA 2E2NA 3EKUA 4F7GA 2DPNA 3TU5A 3DXMA 4LC9B 3WQUA 3QB0A 4WF9L 1W2BM 2HOEA 3KWIA 3O9QA 2HF3A 2IVPA 2QEXN 3Q7BA 2YJEA 3MWPA 4MLEA 3WQTA 4F9OA 5H1SQ 1HB6A 4XH4A 3H3NO 1NGJA 5BN8A 1BUPA 2ZWHA 4NB4A 1HJOA 5TKYA 4DXAB 2KHOA 4GV3A 3DXMB 5AQLA 1NGIA 2HBMA 4K43A 4RCHA 4GNIA 4BGBA 5JLHA 3FE1A 5JMVA 3HOSA 1M90O 3P39A 1U2VA 3OA9A 3OBWA 3H45C 4H03B 1Q7YO 1Y19B 2V52B 3H6EA 1J19A 4DCHA 5AZJA 4JKAA 2P9LB 2P9UA 3C0BA 3CD6N 2H3GX 3BUZB 2AP1A 4IEIA 5AZIA 3CCUN 3VPZA 3O9SA 5AQKA 1NLVA 1GLEG 2IIRA 5JLFA 4JN4A 4JKDA 2NRZA 1X3NA 2HMPA 3ZEUB 3UKUB 4CD3A 5AZJB 3CCMN 2P9PA 1KBLA 5AZIB 4EAHD 2CH5A 3U4LA 4AF1A 3GBTA 2GWJA 3MX5A 2HBJA 3T7ZA 4PL8A 5AQUA 3HZ6A 3ULEA 3U9ZA 4BG8A 3FZLA 4MLHA 2P9PB 4BRDA 4OPHA 3VERA 3DAWA 3HOTA 2PBDA 3IFRA 5AQRA 3SK3A 4MO5A 4B1XB 4BR0A 3G9WA 5KQ8A 4HDQA 1OKJA 1YXQA 4BR5A 3MMVA 2OTJN 4BY9C 5AQSA 3LDQA 2GX9A 5BPNA 1VBHA 2QW9A 1ZC6A 3AGRA 3CJ7A 3CIPA 3LM9A 4YOTA 5GADP 2I7PA 3GOIA 3L4QA 4A62A 4BR2A 1VQNN 1NTIA 5DM6L 1S22A 2NRVA 4Y0WA 3JXUA 1VQKN 4GXBA 4XH1A 1GG3A 2HSTA 1Y64A 2VYPA 3A5NC 1VQON 1QVFM 1VQ4N 4L3QA 4BVPA 1IG8A 4IFEA 4H0TB 3ENBA 3BF1A 4DHYA 4CBWA 1S3XA 2I7NA 1K9MO 1NGEA 2A5XA 1HKCA 3FGUA 4JKCA 2A40A 4U7BA 4YOUA 5LJWA 5M1KA 2NRRA 1YUWA 1GGOA 1X9JA 4JHDA 5TKWA 3B8AX 5M1QA 3M1FA 4BC2A 1NI2A 2FJ9A 4B1WB 4CI6A 3OHRA 1KQSM 5M1NA 3X23A 3QMLA 3EN9A 3VTIA 3WXMB 1NWKA 2RHKA 3FFKB 4BRMA 1W97L 3I33A 3M3ZA 4BREA 5MLCQ 5CR4A 4WFAL 2CB8A 4DQ8A 4JHDB 3ENHA 2HBLA 4ILHA 4G9ZA 5E26A 4CBXA 4QS7A 4H0YB 3E1YA 1MK7B 3HSCA 4FVUA 2WBNA 5FPEA 1P8ZA 1Q18A 4FL9A 4NY0A 2QWNA 2QXLA 1QZ5A 3DWLA 3E9PA 1TUYA 3ENOA 3K9JA 1GLLO 2NRTA 3DXKA 3KK7A 3G25A 3P4IA 5C2FA 4BC4A 3VTHA 3SMSA 5EVZA 3I56N 1YJNN 1G99A 4JKEA 1NGGA 2FSKA 3CJAA 2RQ1A 3VETA 5KPTA 2A41A 2RE2A 1K8KA 2VGMA 4JK7A 4A5AA 3PIPL 4C1NK 2P9IB 3A0IX 3NMUA 3FR0A 4H5WA 4A2BA 4DB3A 2D2QA 2I1KA 2QWQA 2VWBA 3VGMA 3VEXA 3MN5A 5AQXA 1KAXA 4IO8A 5M1OA 4CZKA 3M6GA 1Q81O 5BPLA 3L4IA 4A59A 4NLCA 3ZETA 4WQ4A 2AA4A 4E1JA 3CC4N 1J6ZA 2NZTA 4A57A 4BGAA 2D11A 3WUHA 4PL7A 4JKBA 1TUUA 4GV9A 4JKHA 1ACAA 5C15A 4BRLA 4IO9L 3O9UA 1NGBA 3CERA 3ZETB 1H4RA 1RDUA 4ILJA 2P9LA 3EZWA 5KPRA 3Q7CA 2FSJA 3LDPA 3AARA 3P38A 1MA9B 3AU5A 2P9KB 2IVNA 5CE3A 1MDUB 4HWIA 1HLUA 1T44A 3U8XA 3G71N 1YF5L 1U6ZA 5AQVA 4BQLA 1BA0A 1BDGA 3O6WA 3ZEUA 3R3LA 5AQMA 2QI2A 3UKUA 4PKGA 4FWPA 2JWKA 2D10A 3CHWA 3AGKA 5AQZA 2A42A 2YHWA 4JNEA 3LDOA 5ADXH 2E2OA 4TKNA 2KKZA 1KXPA 3BP8A 4HDOA 4OPAA 3GL1A 3LM2A 2ZJRL 2CGJA 4BRGA 4FWMA 4KH6A 1VAZA 5GAEP 3MX2A 2V51B 1E4GT 1T6CA 3CJBA 3R1XA 1GLDG 4EFHA 3VENA 4AM6A 1SGHA 4CZMA 3CMEN 1V4TA 3G4SN 3FLVA 3GE1A 5AQGA 3M5RA 4AM7A 5GAHP 1CZAN 4YOVA 1RFQA 1SAZA 2V7ZA 4MDAA 4H5NA 1NJIO 5BR9A 3MN6A 2CH6A 4Z94A 3CJCA 2GUPA 4JK9A 2ITMA 4JAXA 2E2QA 2UYTA 3CC7N 4WQ4C 4FWRA 4JD2B 4YOYA 5AQNA 1YVNA 4CZHA 5CHIA 3QFUA 5GINA 4M63C 1LCUA 2P9SB 3N4QA 3FP5A 1JCEA 2F9WA 2J0MA 5GIOA 3TSUA 1GLJO 4H0OA 4M7YA 4BROA 3H1QA 3VEVA 1LOTB 1RDWX 2F7TA 2YHYA 1ATRA 4BRHA 5AQHA 2E1ZA 3TTDA 3ID6A 1ISNA 2FF3B 2FF6A 2AL6A 3FLCO 2ZGYA 2BH1A 4YDUC 3W3DA 4CZEA 1XQSC 1YJWN 2QWRA 1ILYA 2FSNA 3CF5L 4H0VB 5FPMA 2QWOA 5FPDA 1GLBG 1QZ6A 3MK6A 2E1YA 2EMSA 1JCGA 2D0PA 3SBGA 4CYEA 2NRWA 1WOQA 2FLOA 5AQYA 3T69A 4CD1A 2ZJQL 4ISEA 1JDEA 4FSVA 4J8FA 4YOWA 3SMPA 4BG9A 1KD1O 3PVLA 1DKGD 3VGLA 4ZRIA 1BWFO 4B9QA 4UY8O 3KZBA 1NMDA 5C2DA 1P90A 2NRXA 3F5TA 1SS6A 3CQYA 3QICA 3IKMA 4I6MA 3VEOA 1Z05A 3H1VX 2D0OA 1DIKA 1HX1A 3D2FA 3H3OB 3O4WA 3A5MC 3QBWA 3QDKA 4FOEA 3VEWA 2WH5A 1BU6O 2VCPA 5KPZA 3KVGA 2E20A 5ADXA 4P7IA 1GLCG 3PIOL 1VQ8N 5BRDA 3E9LA 3PZDA 3UE5A 2YHXA 4H5VA 4KBOA 4I6MB 3FZMA 1HPMA 4BRFA 3O8MA 3D2FB 3NVKA 1KC8O 2J4RA 4FPBA 1KAZA 1QQNA 3CPEA 4JK8A 1DEJA 1E5WA 3ID8A 5AQOA 2COPA 3IUCA 3HTVA 2HBKA 3MN7A 1E4FT 3R6MA 4YL8A 3EPYA 1HKBA 1NBWA 4H5TA 3UKRB 3CCLN 2EWSA 3HM8A 3UB5A 3MCAB 3O1WA 4OO1J 4IJAA 5HOOA 1MIXA 2HRJA 4BRAA 2Q31A 1ATNA 2P9IA 4WFNL 1K8AO 3CC2N 5ELZA 1T3VA 3O1BA 1NGDA 1EQYA 4CZGA 5JVGL 3G6EN 1S72N 3RSEA 4EIAA 1JJ2M 3H46O 4KH4A 4U67L 4XEIA 5BPMA 4IOCL 5JVHL 1VQ9N 3LDLA 3WA0A 4M7XA 1SQKA 4BRNA 1C0GA 3TTFA 5C10A 4EKUA 4BR4A 4GY2B 2V7YA 4CZJA 2FDQA 2J0KA 3D7EO 3SAGA 2OANA 3IMXA 4K25A 3RSEB 3I55N 2GEMA 5F2RA 4JEPA 3WXLA 1VQMN 1HKGA 1Q86O 4FWNA 2VGNA 5FPNA 4R79A 1NVLA 2JWLA 2X0SA 4JKFA 1H1VA 2QM1A 3IVFA 1YAGA 2ASPA 3F2KA 3MWTA 3WT0A 3E9OA 5IJMA 2P9KA 3O9RA 3ZX2A 2CGLA 4KH5A 4BQZA 5HL7L 4FWKA 3ZYYX 1Z6RA 1MWKA 1VQ7N 2YI1A 3CQXA 1BO5O 1NGHA 2E88A 4BRKA 1YITN 3C7NB 4B1ZA 3VESA 4BVOA 5F0XA 3PLAA 2YX6A 4RWTA 1X3MA 3L6QA 3TSQA 4HTLA 3KHYA 3WEEB 3VGKA 1EF1A 4H0XB 4MO4A 3TSPA 4YDUA 5I9EB 3F9MA 2WUSA 4IJNA 3L0QA 5EOYA 2QWPA 4ISGA 3FZFA 4ISFA 2ZF5O 2AEHA 3S41A 3W0LA 4IXCA 4B1VA 3CPWM 2Q2RA 2PAVA 3C6HA 3OW2M 3AY9A 5AQIA 3VEZA 1YHQN 3A5LC 2KLAA 3MCPA 3AAPA 5EY4A 1VQPN 2GELA 1K73O 4PKHA 4RTFD 1VQ5N 3RVCA 2R82A 3WXJA 3ZX0A 4BRCA 4WCEL 1QVGM 1EO1A 2ZPYA 2A3ZA 4IEEA 1ST7A 3O80A 2HE7A 3WXIA 2Q1NA 3JS6A 4A2AA 2LBBA 3QFPA 4NO7A 1QQMA 1KC7A 4CZFA 3GG4A 5AFUH 4IZ9A 4JD2A 2QTDA 4FWQA 4ILGB 1MIZB 4FWSA 5BRFA 4A5BA 1MK9B 2ZGZA 3OBYA 4FPAA 2P9SA 5E84A 4BRPA 1VQLN 4WFBL 3SBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK8 A;  4JKA A;  3ENB A;  3E9P A;  4JKC A;  4JKD A;  4JKF A;  4JKB A;  3E9O A;  4JKH A;  4JKG A;  3E66 A;  4JKE A;  4ILJ A;  3E9L A;  4JK7 A;  4ILG B;  4ILH A;  4JKG B;  3SBG A;  3SBT A;  4JK9 A; 
#chains in the Genus database with same CATH topology
 4DLG A;  2O8E B;  4B8A B;  1NG9 A;  2E2P A;  3AVA A;  1QTM A;  4KKO A;  3O08 A;  1X9S A;  5F1X A;  3U9D A;  3VA0 A;  3V9X A;  4B9T A;  2EMT A;  4PKI A;  3SAF A;  1YIJ N;  2F9T A;  3OTO K;  3VF2 A;  2P9U B;  3LWL A;  4DF4 A;  1TV6 A;  1XHX A;  4K8X A;  3AVN A;  1T6D A;  3NGY A;  4CHY A;  4OVL A;  2QKB A;  3HPG A;  3K9K A;  2KFZ A;  4IDH A;  5BRH A;  1TYQ A;  3DI6 A;  5AQW A;  3ULE B;  4YY3 K;  2CGK A;  3S3O A;  3ATV A;  4FJL A;  3HBT A;  2X74 A;  3AA4 A;  3C6T A;  1KVB A;  2YJF A;  3WNH A;  4YNQ A;  4JKG A;  3MED A;  4X62 K;  2G8V A;  2E8A A;  2WC9 A;  4FO0 A;  1IG9 A;  4CZL A;  3CCQ N;  3LZI A;  3LL3 A;  1TK0 A;  3GDQ A;  1D4X A;  2FXU A;  3BZC A;  4G1Q A;  5AFU A;  5GIP A;  4KI6 A;  4ID1 A;  4DV7 K;  2I1J A;  1Z25 A;  5AR0 A;  4F8R A;  1G15 A;  4CJU A;  3E66 A;  1DTQ A;  4W5T A;  4JI1 K;  2HHX A;  1HNZ K;  2W41 A;  2FBV A;  3HRG A;  5CYM A;  4DS5 A;  4F3O A;  2FC0 A;  1VBG A;  2E4L A;  1TVR A;  3EO3 A;  3THW A;  3NCI A;  3CET A;  3ZDT A;  1HJR A;  2OYQ A;  4CZI A;  1WSH A;  3OYJ A;  3C7N A;  2ABD A;  3B6P A;  3WEE A;  4LF8 K;  3O4N A;  3SV4 A;  4YHH K;  4CEQ A;  5M1F A;  4QOZ B;  2P9N A;  3DXK B;  4CGG A;  2HF4 A;  3KLF A;  3ZSX A;  3AVL A;  1NOY A;  3RRG A;  4ZRK A;  4KRF A;  1TGO A;  4GV6 A;  1BG3 A;  4A61 A;  1RTJ A;  4C8M A;  4NXN K;  4DQR A;  2YHA A;  4BWM A;  2DPN A;  3TU5 A;  4LF4 K;  3AV9 A;  1W2B M;  2IVP A;  3MXJ A;  3Q7B A;  3MWP A;  3VQA A;  2OZM A;  1U49 A;  1BCM A;  3H3N O;  1NGJ A;  3DLE A;  4CGI A;  4M41 A;  2HHQ A;  1BUP A;  2ZWH A;  4NB4 A;  2ZM6 K;  5AQL A;  2HBM A;  4K43 A;  4RCH A;  5JMV A;  2UXC K;  3S9H A;  1U2V A;  1Q7Y O;  4DCH A;  2UXB K;  1IKW A;  4BE0 A;  2JLE A;  3NF6 A;  4IEI A;  4H4O A;  3VPZ A;  3O9S A;  5AQK A;  4H8K A;  1X3N A;  1LWE A;  3UKU B;  3SQ2 A;  3QIN A;  2P9P A;  3U4L A;  5LL6 Z;  3T7Z A;  2HBJ A;  3HZ6 A;  4JI7 K;  4BG8 A;  1Q9Y A;  3VER A;  3HOT A;  3TAE A;  3SZ2 A;  2PYL A;  4HUE A;  5KQ8 A;  2B5J A;  4BR5 A;  2OTJ N;  4BY9 C;  4LH4 A;  4FLY A;  3SUP A;  2O4G A;  3CJ7 A;  3ZSZ A;  4OKJ A;  3LM9 A;  2IS3 A;  3L2V A;  4BR2 A;  3SNN A;  3JYT A;  3VA3 A;  2E6M A;  1VQK N;  1GG3 A;  1EWR A;  4CIG A;  1QVF M;  4BVP A;  3OS1 A;  2HHU A;  4CJQ A;  1A5V A;  1HKC A;  1L3V A;  3QEW A;  4U7B A;  3S3M A;  5LJW A;  3OYA A;  5TKW A;  2NRR A;  1JKH A;  1GGO A;  4AQY K;  3HVR A;  3CM6 A;  1NI2 A;  4B1W B;  4LFA K;  3WXM B;  5KI6 A;  2XHB A;  3FFK B;  4BRE A;  5MLC Q;  2EX3 A;  3KJV A;  4FJM A;  2KFN A;  3VQC A;  4JHD B;  4NXM K;  4JI6 K;  4ILH A;  4G9Z A;  4JI0 K;  4CBX A;  4AHS A;  4QS7 A;  2W42 A;  3E1Y A;  3HSC A;  2WBN A;  3P83 D;  4FL9 A;  1QZ5 A;  3E9P A;  4KHW A;  1TUY A;  4DQP A;  5FRN A;  1J53 A;  4Z4H A;  1T7P A;  3KLI A;  1GLL O;  2NRT A;  3HJF A;  4CJT A;  5C2F A;  3VTH A;  1N5Y A;  5K14 A;  5T7B A;  3L2R A;  2FSK A;  3VET A;  4JK7 A;  2VQE K;  4A5A A;  3PIP L;  2P9I B;  3A0I X;  5CZ1 A;  4HTU A;  3AVH A;  3J80 O;  4EP4 A;  3OYE A;  4F3T A;  3VEX A;  3LPU A;  1KAX A;  1EWQ A;  4FJX A;  3DRS A;  3ZET A;  1NKB A;  2OPP A;  4E1J A;  1CXU A;  4A57 A;  4BGA A;  2D11 A;  5HLF A;  3LAN A;  3AO5 A;  1TUU A;  2Z1H A;  4GV9 A;  4ELT A;  4JKH A;  1ACA A;  5KRS A;  3KLH A;  5C24 A;  1H4R A;  2P9L A;  5KPR A;  3Q7C A;  3P38 A;  3P1G A;  3AU5 A;  4E7H A;  1HLU A;  1BA0 A;  1BDG A;  1D9F A;  1C0M A;  4PKG A;  2D10 A;  3LDO A;  4TKN A;  2KKZ A;  1TK5 A;  4OPA A;  3GL1 A;  2ZJR L;  3ZT0 A;  2CGJ A;  4BRG A;  4KH6 A;  3MX2 A;  1T6C A;  3SQ1 A;  1GLD G;  2B6A A;  4CED A;  4KB1 A;  4Z0U A;  2HNZ A;  4AM7 A;  1WSE A;  4FVM A;  1FKP A;  4Z94 A;  2CH6 A;  4DR7 K;  2ZD1 A;  3M8R A;  4JD2 B;  4CZH A;  3L8B A;  2HND A;  3QFU A;  4DV6 K;  3FP5 A;  2F9W A;  2J0M A;  1GLJ O;  4M7Y A;  4AHV A;  1RDW X;  4IKF A;  1ATR A;  4BRH A;  1IKX A;  3TTD A;  4FJ7 A;  2FF3 B;  3M8Q A;  1JLA A;  1RTH A;  4RW6 A;  2HHT A;  4CZE A;  4CJS A;  2QWR A;  2QWO A;  1GLB G;  3JSM A;  1QZ6 A;  1TL1 A;  4AHU A;  3V1Q A;  3ZLJ A;  2E1Y A;  4E7L A;  2D0P A;  5AQY A;  2ZJQ L;  3SV3 A;  5HRO A;  4O4G A;  1QSY A;  1EKE A;  3KLG A;  3D45 A;  3NH1 A;  4KHN A;  4FJG A;  1BWF O;  3QIO A;  3S3N A;  3HP6 A;  1SS6 A;  3CQY A;  3VEO A;  4MQ3 A;  4DSJ A;  1FXX A;  3S41 A;  1DIK A;  1HX1 A;  3QBW A;  3VEW A;  3DLH A;  4DF8 A;  1BU6 O;  3MXI A;  5KPZ A;  3PIO L;  1LAW A;  4L8R B;  4I6M B;  1J54 A;  1LW2 A;  3O8M A;  3IRX A;  2J4R A;  4FPB A;  4K0K K;  1DEJ A;  3DLR A;  2COP A;  1I39 A;  4CEF A;  2HBK A;  3R6M A;  2HHW A;  4E7J A;  3RMC A;  1C1A A;  1HKB A;  3HM8 A;  3MCA B;  5HOO A;  2VG7 A;  2HRJ A;  2IDO A;  3PO5 A;  4B9U A;  4CHN A;  4BE1 A;  3O1B A;  1NGD A;  3VQ7 A;  3RSE A;  4DLE A;  3C6U A;  4JLH A;  5HRS A;  4KH4 A;  4U67 L;  5JVH L;  1JXB A;  4DUZ K;  3AO2 A;  1SQK A;  4BRN A;  1C0G A;  4KHS A;  3TTF A;  4EKU A;  4BR4 A;  2FDQ A;  2J0K A;  1IBL K;  1FK9 A;  3I55 N;  1GOA A;  1HYZ A;  4FM2 A;  1HKG A;  2JWL A;  3IVF A;  5M1K A;  4DTM A;  2PY5 A;  4FWK A;  3ZYY X;  4BRK A;  2E88 A;  4I2Q A;  4FZZ A;  4BVO A;  2YX6 A;  3L6Q A;  5SZT A;  1RDA A;  1EF1 A;  1XNQ K;  3TSP A;  3QEX A;  1K9M O;  4ISG A;  3W0L A;  3FZF A;  4RW9 A;  4IXC A;  1VQP N;  4FLU A;  3AAP A;  3PX6 A;  3RTV A;  1UWB A;  2GEL A;  1K73 O;  4RTF D;  4KHP K;  4FLZ A;  3RVC A;  1QVG M;  2ZPY A;  3LWM A;  2Q1N A;  3DRP A;  2LBB A;  3EEQ A;  3QFP A;  4NO7 A;  2VQF K;  2O8E A;  4CEB A;  4CZF A;  4FLV A;  2FBY A;  5BRF A;  4FPA A;  4BRP A;  1RIL A;  3SBT A;  1OH8 A;  4BRQ A;  1GLF O;  4B1U B;  1ZBS A;  4NLB A;  1RGI A;  2KQ2 A;  2ASO A;  3DJC A;  2AJQ A;  2E6L A;  1YJ9 N;  3SAH A;  1OVQ A;  3AVJ A;  1M1K O;  4FOI A;  2WTU A;  2YVC A;  4C23 A;  1TK8 A;  5C0Y A;  1EET A;  1QHA A;  2GV9 A;  4DV0 K;  3DLL L;  4B1Y B;  2W40 A;  2UXD K;  5EXW A;  2O8B A;  2D1K A;  1IJJ A;  1NU0 A;  3RMB A;  3KWG A;  4N76 A;  4PWD A;  5KPT A;  2Q0R A;  3QET A;  2QWM A;  2O4I A;  3TPQ A;  1S1U A;  1N34 K;  2G8H A;  3V6D A;  1VSM A;  1ATS A;  2YKM A;  5FRM A;  1RT2 A;  3V81 A;  3R8E A;  4X64 K;  4JI5 K;  5BRE A;  3ZSV A;  4NCA A;  4IOA L;  4DSE A;  4OKE A;  4IDK A;  1NK5 A;  1BOT O;  1GOC A;  3IDH A;  3EL2 A;  3ZT4 A;  3UKR A;  4E89 A;  4BR9 A;  2VWJ A;  4IG3 A;  4CJ4 A;  1XC3 A;  1IBM K;  5AQQ A;  1NGC A;  1WLJ A;  3CI5 A;  4IOX A;  5AQP A;  3IS9 A;  4E3S A;  3D6R A;  4FWL A;  4DUY K;  4CCH A;  5LJV A;  2BTF A;  2O8F B;  1U4B A;  5JS1 A;  5DM7 L;  1HPZ A;  2QK9 A;  4CIE A;  2GWK A;  5BN9 A;  2HNY A;  3MDQ A;  4IWV A;  5JIC A;  4E19 A;  2BUP A;  4BRI A;  1BA1 A;  2KW4 A;  4HCC A;  4E1M A;  4UQG A;  1VQ6 N;  2Q97 A;  1JLC A;  1GC7 A;  1BGX T;  4H5R A;  5J2P A;  4CEE A;  1LWC A;  1IKV A;  4I7F A;  4PHT X;  4YOX A;  4DS4 A;  2UU9 K;  3CM5 A;  4WQ5 A;  4BDP A;  1GC6 A;  4DTJ A;  2ASM A;  3EE8 A;  1JCF A;  4H0P A;  1SUQ A;  2YCH A;  1V4S A;  3QIJ A;  1RBS A;  3V1R A;  3J8A A;  1Z26 A;  4DWI A;  4J2E A;  3AU4 A;  4AHC A;  3CJ9 A;  4QS8 A;  3K5N A;  3U7D A;  1WB9 A;  3NDK A;  2Q36 A;  4KRE A;  1O13 A;  5J1E A;  5KQD A;  2IOC A;  3EKU A;  1RTD A;  4FJJ A;  1NK6 A;  3SQ4 A;  3KWI A;  3O9Q A;  1RBV A;  2OCE A;  2YJE A;  4MLE A;  4F9O A;  1XNR K;  3C94 A;  1JL2 A;  1FKO A;  2KHO A;  4CF9 A;  4B3T K;  3G10 A;  1NGI A;  4XIU A;  5JLH A;  4BGB A;  3OA9 A;  3H45 C;  3LAM A;  1SV5 A;  1NKC A;  4JKA A;  4C8L A;  3ITH A;  3HL8 A;  2XY8 A;  1NLV A;  1WSF A;  4DG1 A;  4JKD A;  3K2P A;  3HT3 A;  1K6Y A;  1VSF A;  2HMP A;  3TI0 A;  3ZEU B;  4N41 A;  2DFH A;  3T3F A;  5AZJ B;  3CCM N;  1X1P A;  5AZI B;  2CH5 A;  4LF7 K;  3HPH A;  3HVT A;  4OKK A;  1SL2 A;  3DAW A;  1U47 A;  1NJW A;  2PBD A;  5AQR A;  3T1A A;  3OJS A;  4BR0 A;  3G9W A;  4HDQ A;  1OKJ A;  4JS5 A;  1YXQ A;  4DV2 K;  2GX9 A;  2YNG A;  1E3M A;  1VBH A;  2QW9 A;  2DTU A;  4FXD A;  3DOL A;  4CJF A;  3CIP A;  1B9D A;  2O8C B;  3IAY A;  4DR4 K;  2YNI A;  3PV8 A;  1UOC A;  2X6N A;  1NTI A;  4Y0W A;  4GXB A;  4E7I A;  4M3W A;  3A5N C;  1VQO N;  1UA1 A;  1HYS A;  4L3Q A;  4IFE A;  3ENB A;  4KPY A;  5SWM A;  2A5X A;  4E1N A;  3V4I A;  3ZSQ A;  1ZBU A;  4JHD A;  1X9J A;  4CJV A;  1S9E A;  3OHR A;  5M1N A;  3X23 A;  3VTI A;  4HUF A;  1W97 L;  1Q8I A;  3M3Z A;  1N6Q A;  4Z4C A;  4LSL A;  3AVF A;  3QEP A;  3ENH A;  2HBL A;  4ZTJ A;  1ZYQ A;  1RTI A;  3QEI A;  1MK7 B;  3TAP A;  1NK0 A;  3F73 A;  5C25 A;  1P8Z A;  2P5G A;  3HM9 A;  5I3U A;  2X78 A;  3ENO A;  3KK7 A;  3HXM A;  2YNH A;  3G25 A;  3SMS A;  4M3X A;  5EVZ A;  4CF8 A;  1K8K A;  1ZBF A;  4Y1C A;  5CZ2 A;  3QLH A;  1HNX K;  2QWQ A;  4B3S K;  5M1O A;  4IO8 A;  3M6G A;  5BPL A;  1QSL A;  4J2D A;  4A59 A;  1NK9 A;  3CC4 N;  1J6Z A;  3WUH A;  2XO7 A;  4AIL C;  1YTU A;  3O9U A;  3CER A;  1RDU A;  3EZW A;  2P9K B;  5CE3 A;  1T44 A;  3U8X A;  1YF5 L;  5AQV A;  4BQL A;  5AQM A;  1RT5 A;  3KLE A;  2JWK A;  1WN7 A;  5AQZ A;  2YHW A;  3OYC A;  4JNE A;  3QO9 A;  1WAF A;  4DR6 K;  4DR1 K;  3BZK A;  2JGU A;  3R1X A;  1E4G T;  4Z4F A;  4DTX A;  4AM6 A;  1L3U A;  4CZM A;  4OJR A;  5C42 A;  1V4T A;  3G4S N;  1NKE A;  5LMN K;  3HYF A;  1F21 A;  4MDA A;  3SQ0 A;  1NOZ A;  4FK0 A;  3CJC A;  2ITG A;  3AVI A;  4WQ4 C;  4YOY A;  4DSL A;  1TL3 A;  1YVN A;  2F96 A;  5CHI A;  5GIN A;  1LCU A;  2DY4 A;  2P9S B;  4H0O A;  3SUN A;  2HMI A;  3VEV A;  3ID6 A;  5KTQ A;  2AL6 A;  1YJW N;  1CZ9 A;  2Z1I A;  5FPM A;  3NHG A;  1WSI A;  2RKI A;  3MK6 A;  4RG8 A;  2NRW A;  4FJ5 A;  4F2S A;  1BQN A;  3DLG A;  1KD1 O;  5BR8 K;  1DKG D;  4ZRI A;  1IBK K;  4UY8 O;  4B9Q A;  5C2D A;  3U3G A;  1KRP A;  3IKM A;  4I6M A;  3A2F A;  3H3O B;  4FOE A;  4TSX A;  2VCP A;  3KVG A;  2E20 A;  5HP1 A;  5BRD A;  2OZS A;  3AA2 A;  4H5V A;  3FZM A;  1D5A A;  1QQN A;  4LFB K;  1E5W A;  3IUC A;  3HTV A;  1VSH A;  3MN7 A;  4YL8 A;  1ITG A;  3ALY A;  4ELV A;  1NBW A;  3O1W A;  4OO1 J;  4IJA A;  3TAN A;  1VRU A;  4BRA A;  4Z4E A;  2Q31 A;  4WFN L;  1NK7 A;  5ELZ A;  3PSI A;  1EQY A;  3EZ5 A;  4CZG A;  1S72 N;  3LP0 A;  4EIA A;  3HK2 A;  3H46 O;  1KLN A;  2HHV A;  3LDL A;  4ID5 A;  4M7X A;  4CJK A;  3KK1 A;  5LMU K;  4CZJ A;  3D7E O;  3V1O A;  4FJ9 A;  2OAN A;  3IMX A;  4W5R A;  4FLW A;  4CF2 A;  4NCB A;  1VQM N;  1Q86 O;  3SUO A;  3THW B;  1NVL A;  3ULD A;  3MWT A;  3F2K A;  2YHB A;  3E9O A;  1W9H A;  4PA1 A;  4BQZ A;  1XHZ A;  4KH5 A;  3FFI A;  1MWK A;  4CHO A;  3ZSR A;  3SPY A;  3C7N B;  5F0X A;  4CVN E;  5CY4 A;  1KLM A;  4RWT A;  3TSQ A;  4DFK A;  3KHY A;  3WEE B;  3O3F A;  3VGK A;  4H0X B;  4YDU A;  3VN5 A;  5I9E B;  4KHY A;  3F9M A;  3DLK A;  2WUS A;  4IJN A;  3L0Q A;  5EOY A;  2QWP A;  2AEH A;  4B1V A;  2Q2R A;  2PAV A;  4ZTF A;  4KTZ A;  3A5L C;  1QE1 A;  3PY8 A;  4PKH A;  1S1V A;  4BRC A;  4WCE L;  3ZX0 A;  2I5J A;  4NCG A;  1FJG K;  3WXI A;  3JS6 A;  3GG4 A;  4X66 K;  3M8S A;  4FWS A;  2YV0 X;  3ZT2 A;  3OBY A;  4Z4G A;  3DOK A;  3L2W A;  2KTQ A;  2D4W A;  1IO2 A;  3TTC A;  3BEX A;  3U8Z A;  3O5B A;  5I42 A;  3C6A A;  1U2V B;  3THV A;  1DTT A;  3J7Z O;  1W7A A;  3HO1 A;  2G8K A;  2NLX A;  3I0R A;  1C1C A;  1XI1 A;  3MEG A;  1RDB A;  3WNE A;  4K42 A;  1N8R O;  4EP5 A;  4RW4 A;  4I2P A;  3J7A P;  5C12 A;  4AHR A;  4MDB A;  5AQJ A;  4IBN A;  3LP1 A;  3THY B;  3LDS A;  1HYV A;  3E01 A;  4CF0 A;  1BL3 A;  3CCE N;  1DT9 A;  3EKS A;  2QA4 N;  2CQU A;  3OY9 A;  1VSK A;  1BQM A;  2PFU A;  4B8C A;  1C0T A;  1RBT A;  5AQF A;  3AAQ A;  1VQ9 N;  4XH5 A;  3LAK A;  1HUX A;  4QS9 A;  1RDC A;  4FWO A;  3VQ5 A;  3SJH A;  1S1T A;  4DTU A;  3OYM A;  3I8D A;  1C0F A;  3C95 A;  3A5O C;  3VOV A;  1JXE A;  4GVM A;  3VMF B;  2HHS A;  3OYH A;  3NVM A;  5A2Q O;  1ZBI A;  2A6A A;  4KTQ A;  4EHU A;  3I8B A;  4C1N I;  4YOR A;  3CFO A;  3LP2 A;  4GVE A;  1R59 O;  3CJ1 A;  2FBX A;  3AO3 A;  1C0U A;  3VQ4 A;  3WXK A;  1T03 A;  3CCJ N;  1JLE A;  1VSE A;  4KAZ A;  4BR7 A;  3D2E B;  3M8P A;  3VF6 A;  2XY5 A;  2UUA K;  3AVC A;  2DFE A;  3NF7 A;  4O8U A;  4O8K A;  4WYB A;  3PO4 A;  3N4P A;  3K57 A;  2BE2 A;  4N5S A;  3FZH A;  5GAG P;  2OTL N;  3CCS N;  4HUG A;  1TAQ A;  3BIN A;  2J0J A;  3TWH A;  2DIK A;  1DGK N;  1JLB A;  4CGD A;  5B8H A;  4Z4I A;  1D9D A;  3KKR A;  5HRR A;  2E2N A;  4B9L A;  1ASU A;  1EP4 A;  1TKT A;  5IT9 O;  4F7G A;  4E7K A;  1BIS A;  3WQU A;  4WF9 L;  2QEX N;  2HF3 A;  3CYM A;  2F8S A;  3WQT A;  3MEE A;  4XH4 A;  4CGH A;  3KK2 A;  5BN8 A;  3NAE A;  4DXA B;  4GV3 A;  3DXM B;  2PZS A;  4GNI A;  4M3Z A;  4CFB A;  3HOS A;  1M90 O;  3P39 A;  4CK2 A;  2QXF A;  3VQ6 A;  1VRT A;  4H03 B;  1OH6 A;  5AZJ A;  2OA8 A;  2P9L B;  2P9U A;  3CD6 N;  2H3G X;  3BUZ B;  2AP1 A;  5AZI A;  3CCU N;  1GLE G;  2IIR A;  4DFM A;  2NRZ A;  2EHG A;  3I0S A;  2ETJ A;  3K5O A;  3NBP A;  4CD3 A;  3NH0 A;  4CW7 B;  4EAH D;  1VSL A;  2RPI A;  3VQ9 A;  3GBT A;  2GWJ A;  3MX5 A;  1SL0 A;  1ZBL A;  3ULE A;  4EZ6 A;  4OPK A;  3OYI A;  3CFP A;  2P5O A;  1JLG A;  4OPH A;  3RMA A;  1XMQ K;  3SK3 A;  5KGX A;  3NF8 A;  4B1X B;  1FW6 A;  2R7Y A;  1BI4 B;  5AQS A;  1BIU A;  3LDQ A;  3THX B;  1ZC6 A;  4C8K A;  4JI4 K;  3AGR A;  4CE9 A;  4CJE A;  4YOT A;  4PQU A;  1N32 K;  3GOI A;  4A62 A;  1W0H A;  4C8O A;  4FK4 A;  4OPJ A;  1TAU A;  3JXU A;  2HST A;  1Y64 A;  4ZHR A;  3AA3 A;  4FLT A;  4FJN A;  3J7Y P;  1VQ4 N;  2GBZ A;  2PYJ A;  4KB0 A;  4H0T B;  1RT4 A;  3BF1 A;  4DHY A;  2P51 A;  1NGE A;  1NK4 A;  3NF9 A;  3TR8 A;  4JKC A;  3OYK A;  4KTW A;  4YOU A;  1BCO A;  4CFC A;  1YUW A;  3SPZ A;  1RBU A;  2XY7 A;  3M1F A;  3TAB A;  4DTS A;  4BWJ A;  3ASM A;  2D5R A;  2ATQ A;  4FLX A;  1NWK A;  4DR2 K;  2RHK A;  4BRM A;  4M3U A;  3VQB A;  3OYG A;  5CR4 A;  1WBB A;  4JRQ A;  4DQ8 A;  1HR0 K;  3JAM O;  4DR5 K;  1CZB A;  4H0Y B;  4FVU A;  5FPE A;  1L5U A;  3K5M A;  1ASV A;  4RW7 A;  2QXL A;  3AVG A;  3DXK A;  1NK8 A;  3P4I A;  1HNW K;  1BIZ A;  4CEC A;  3I56 N;  3V9S A;  1G99 A;  4JKE A;  3CJA A;  3L2Q A;  4BE2 A;  3U6F A;  4FK2 A;  1QSS A;  2RN2 A;  3NH2 A;  1J5E K;  2F4V K;  3RRH A;  3SYZ A;  3CG7 A;  5HRN A;  3NMU A;  3FR0 A;  4H5W A;  4DB3 A;  3UIQ A;  2VWB A;  1YT3 A;  3D0P A;  3DRR A;  4GMJ B;  5E41 A;  3NGI A;  4NLC A;  4WQ4 A;  2AA4 A;  1XC9 A;  4PY5 A;  4PL7 A;  4BRL A;  4DTR A;  4BDY A;  4ILJ A;  3LDP A;  2OPS A;  3L3V A;  2IVN A;  1C1B A;  3LZJ A;  3G71 N;  2G8U A;  3O6W A;  3R3L A;  2QI2 A;  3UKU A;  3AVM A;  3CHW A;  3AGK A;  2IC3 A;  3SUQ A;  4FYD A;  2A42 A;  5ADX H;  3BP8 A;  2Y1J A;  4FWM A;  5GAE P;  4M45 A;  2G8I A;  4EFH A;  2UUB K;  2UUC K;  3CME N;  3OVN A;  4KHQ A;  3WNF A;  3GE1 A;  3M5R A;  1X9M A;  1CZA N;  4YOV A;  4H5N A;  5BR9 A;  2XY6 A;  3KTQ A;  1S6Q A;  2LSN A;  4JK9 A;  4JAX A;  3EYZ A;  2E2Q A;  3CC7 N;  5AQN A;  3O3H A;  1HQE A;  3BY5 A;  4M63 C;  3N4Q A;  1C6V A;  1A5W A;  3H1Q A;  1LOT B;  4KI4 A;  1EX4 A;  4CJW A;  3LAL A;  3W3D A;  2FF6 A;  2BH1 A;  1WBD A;  1XQS C;  2FSN A;  4CHP A;  4H0V B;  5FPD A;  4CGJ A;  4CJL A;  4B9S A;  3T69 A;  3SBG A;  2VWK A;  1WOQ A;  2FLO A;  4B3R K;  1RNH A;  4FSV A;  1RT7 A;  4J8F A;  4YOW A;  4BG9 A;  4DV1 K;  3PVL A;  4AHT A;  3VGL A;  2O8B B;  3QNN A;  4LD0 A;  4ELU A;  3KZB A;  1NMD A;  1P90 A;  2NRX A;  1JLQ A;  1KVA A;  3QIC A;  1Z05 A;  3K59 A;  3H1V X;  3VF4 A;  4FW2 A;  3A5M C;  2WH5 A;  1IKY A;  1VQ8 N;  2YHX A;  1YVU A;  3OYN A;  2IAJ A;  3KD5 E;  3D2F B;  3NVK A;  2DFF A;  1RDD A;  3ID8 A;  4GW6 A;  3IG1 A;  3EPY A;  5DK5 A;  4JI3 K;  3UKR B;  4H5T A;  3CCL N;  4KV8 A;  3UB5 A;  1OH7 A;  3HPO A;  1MIX A;  3CC2 N;  2P9I A;  3T1Y K;  1T3V A;  1LV5 A;  5JVG L;  1JJ2 M;  4XEI A;  4O55 A;  4J2A A;  5FDL A;  4CHQ A;  3WA0 A;  1NJZ A;  4QCL A;  4DV5 K;  5FLX O;  2Y1I A;  4K25 A;  2GEM A;  3AVK A;  1SKS A;  3DYA A;  5FPN A;  2VGN A;  4JKF A;  2D0C A;  1YAG A;  4CI6 A;  3O9R A;  3ZX2 A;  2CGL A;  5HL7 L;  1Z6R A;  3ZT1 A;  1VQ7 N;  2YI1 A;  3CQX A;  1YIT N;  4B9V A;  3VES A;  2G8F A;  1X3M A;  3RMD A;  1SL1 A;  4MO4 A;  3AVB A;  1ASW A;  1S1W A;  4M3T A;  1Q9X A;  4ISF A;  2ZF5 O;  4DU1 A;  3CPW M;  3OW2 M;  3QEV A;  2KLA A;  3MCP A;  4O5B A;  5EY4 A;  4FJH A;  2O8D B;  3WXJ A;  2R82 A;  4FJK A;  5JS2 A;  4IEE A;  3O80 A;  2HE7 A;  2FBT A;  1RCH A;  5AFU H;  4JD2 A;  2QTD A;  4LY7 A;  4DSF A;  3PX4 A;  2ZGZ A;  1HNV A;  3RWU A;  5E84 A;  3BDP A;  4B3M K;  3MN9 A;  4WQ5 C;  2OPQ A;  2HB5 A;  2GUI A;  1RT6 A;  1VSI A;  4DTP A;  4DFJ A;  1RT1 A;  4CJ5 A;  1SZ2 A;  3SI6 A;  4ZRJ A;  4JRP A;  2HVI A;  5D3G A;  3QBX A;  2GTD A;  4O5F A;  3CCV N;  4DTN A;  1ZXO A;  3LDN A;  4CBU A;  2QKK A;  1B9F A;  4DSK A;  1KAY A;  3R9P A;  4CJ3 A;  2KZZ A;  5LY3 A;  2NUB A;  3ZSY A;  4DKW A;  3THY A;  3CMA N;  2WON A;  2QWL A;  1YI2 N;  3FZK A;  1HB8 A;  3P31 A;  3CXC M;  4X65 K;  3O4Q A;  4W5O A;  3SLC A;  1KVC A;  3VEY A;  3AO4 A;  1IV0 A;  4CEZ A;  4C8N A;  3MEC A;  3ZX3 A;  5EX5 A;  1TYQ B;  2F8T A;  5AJ3 K;  1HNI A;  1T05 A;  1HMV A;  4DV3 K;  1S6P A;  2ZJP L;  4I9Q A;  4DV4 K;  4EHT A;  1WUA A;  1UA0 A;  2NRH A;  4JKG B;  3OS2 A;  1ESV A;  1QQO A;  3RR8 A;  1OH5 A;  2P1J A;  3VQ8 A;  2HHH K;  4K41 A;  5KGW A;  5M1P A;  1NGF A;  1REV A;  3CCR N;  1KSP A;  1GLA G;  2YKN A;  1Q82 O;  1X9W A;  1NM1 A;  2BDP A;  1HBK A;  3TAM A;  3TAG A;  5JVL A;  3HI0 A;  3AO1 A;  4CIF A;  3NE6 A;  4FJ8 A;  4CK3 A;  4KO0 A;  5FRO A;  3OYD A;  1QQC A;  1U48 A;  2WFB A;  1WSJ A;  1UAX A;  3O9T A;  1EXQ A;  1JL1 A;  4BC5 A;  4OLB A;  3J81 O;  1Y97 A;  1XUP O;  2NNW A;  5J2M A;  4J2B A;  2WOM A;  2X6S A;  2A1R A;  1LWF A;  4DQQ A;  3D2E A;  3EY1 A;  1NJY A;  3KIO A;  1WNS A;  4CHZ A;  3SCX A;  3QER A;  1NGA A;  1OVY A;  2IVO A;  1CXQ A;  1MWM A;  3ATU A;  2Q0U A;  3A8Y A;  4CJ7 A;  3PSF A;  3K5L A;  3EE9 A;  4B08 A;  4BC3 A;  4HVJ A;  4CF1 A;  4JI2 K;  5KRT A;  4GKK K;  5AQT A;  1K8K B;  2P9N B;  3C65 A;  1KTQ A;  3BF3 A;  4N56 A;  3DXM A;  4LC9 B;  3QB0 A;  2HOE A;  4DU3 A;  4CGF A;  1J9A A;  4FW1 A;  5H1S Q;  1HB6 A;  3QIP A;  5TKY A;  1HJO A;  3DLB A;  2Z1G A;  5J2N A;  1LW0 A;  2E5L K;  4DFP A;  4PUO A;  3FE1 A;  4FZX C;  1TKZ A;  3HP9 A;  3OBW A;  2KZM A;  4CFD A;  2Z1J A;  1Y19 B;  2V52 B;  3H6E A;  1J19 A;  3C0B A;  3ZSO A;  5JLF A;  4JN4 A;  3V9Z A;  2D0B A;  3QES A;  3MXM A;  2ZE2 A;  1KBL A;  4AF1 A;  1XMO K;  4PL8 A;  5AQU A;  3ZSW A;  2YNF A;  3U9Z A;  1BI4 A;  2W6K A;  2B4J A;  1VK0 A;  3FZL A;  4MLH A;  2P9P B;  4BRD A;  3PX0 A;  1TKD A;  3THX A;  4BAC A;  3IFR A;  4MO5 A;  3T19 A;  2D0A A;  5CYQ A;  4F4K A;  4CJR A;  1NJX A;  4DSI A;  3MMV A;  4E0D A;  1DLO A;  5BPN A;  3K0S A;  2G8W A;  1RBR A;  4AH9 A;  1SKR A;  5HRP A;  1R0A A;  4DR3 K;  4DQI A;  5GAD P;  2I7P A;  3TAQ A;  4OX9 K;  3L4Q A;  5DMR A;  1VQN N;  5DM6 L;  1S22 A;  3V9W A;  2NRV A;  3P5J A;  4XH1 A;  2VYP A;  1VSJ A;  2O8F A;  3OS0 A;  1IG8 A;  1RT3 A;  1KFS A;  1LAV A;  4RW8 A;  1VSD A;  4I9L A;  4CBW A;  1S3X A;  2I7N A;  3TAR A;  1HQU A;  3BGR A;  4NYF A;  3FGU A;  2BGG A;  2A40 A;  2W6L A;  3G0Z A;  3DM2 A;  1I3A A;  1IH7 A;  3B8A X;  5M1Q A;  4BC2 A;  2FJ9 A;  4F2R A;  3QML A;  3EN9 A;  1NNE A;  3I33 A;  3ZT3 A;  4WFA L;  2CB8 A;  4R5P A;  3KK3 A;  5E26 A;  4GKJ K;  3VQQ A;  1B92 A;  3CQ8 A;  3VQP A;  5J2Q A;  1Q18 A;  1N36 K;  3RR7 A;  4NY0 A;  2QWN A;  3DWL A;  1JLF A;  3K9J A;  3F9K A;  4BC4 A;  1NMN A;  4LF9 K;  2HW3 A;  4W5N A;  1YJN N;  1NGG A;  2RQ1 A;  2A41 A;  2RE2 A;  2VGM A;  5IWA K;  3KD1 E;  4C1N K;  4A2B A;  2D2Q A;  2I1K A;  1VHX A;  3VGM A;  4CZK A;  3MN5 A;  5AQX A;  1L3S A;  1Q81 O;  4FZY A;  3L4I A;  4IG0 A;  1T8E A;  3K58 A;  2NZT A;  5EU7 A;  1TKX A;  4JKB A;  4M3R A;  1D8Y A;  4ICL A;  3OYF A;  1GOB A;  5C15 A;  3AA5 X;  4DMN A;  4DQS A;  4IO9 L;  1NGB A;  3ZET B;  1CLQ A;  2ZQB A;  2FSJ A;  3AAR A;  1MA9 B;  2XRI A;  4FM0 A;  1MDU B;  4HWI A;  4DTO A;  1U6Z A;  4B9M A;  3ZEU A;  1XWL A;  4FWP A;  3LPT A;  4B9N A;  4CES A;  1J5O A;  3ISN C;  2E2O A;  4CJP A;  1KXP A;  4HDO A;  4LF6 K;  2VG6 A;  3LM2 A;  1VAZ A;  2V51 B;  3CJB A;  3QNO A;  3VEN A;  1SGH A;  1U04 A;  2HVH A;  4M3Y A;  3FLV A;  5AQG A;  5GAH P;  2OPR A;  1RFQ A;  1SAZ A;  2V7Z A;  1NJI O;  4IFV A;  3MN6 A;  3H08 A;  4QAG A;  4HCB A;  2GUP A;  3WNG A;  4LH5 A;  1QHT A;  4NYN A;  2ITM A;  3T1H K;  2UYT A;  3MAQ A;  4FWR A;  4CEO A;  4JI8 K;  1MU2 A;  2O8C A;  1U45 A;  4O44 A;  1JCE A;  5GIO A;  3TSU A;  1O1W A;  4BRO A;  2F7T A;  2YHY A;  4O0I A;  4JV5 K;  3CFR A;  5AQH A;  2E1Z A;  3L3U A;  3VQD A;  1ISN A;  4Q0B A;  3FLC O;  4YDU C;  2ZGY A;  4OGC A;  1BHL A;  2Q3S A;  1ILY A;  3CF5 L;  1ZBH A;  2EMS A;  2A1S A;  1N33 K;  1JCG A;  4CYE A;  4CD1 A;  4HHT A;  3U3Y A;  4WE1 A;  1S1X A;  1A5X A;  4ISE A;  4JS4 A;  1JDE A;  3KKS A;  4DU4 A;  3SMP A;  3TAF A;  3F5T A;  2D0O A;  4LSN A;  3D2F A;  3QDK A;  3O4W A;  4MFB A;  3PUF A;  4W5Q A;  1WAJ A;  5ADX A;  1I94 K;  4P7I A;  1GLC G;  4Q5V A;  4H4M A;  3E9L A;  3PZD A;  3UE5 A;  4CFA A;  4KBO A;  1QS4 A;  1HPM A;  4BRF A;  1KC8 O;  3SJJ A;  1KFD A;  1KAZ A;  3CPE A;  5AQO A;  4JK8 A;  4CER A;  1E4F T;  3LP3 A;  4FM1 A;  4YFU A;  2EWS A;  4N47 A;  3DMJ A;  1ATN A;  4Y1D A;  1K8A O;  4V19 S;  3G6E N;  5BPM A;  4IOC L;  3NFA A;  4OLA A;  5C10 A;  1S9G A;  4GY2 B;  2V7Y A;  3SAG A;  4LF5 K;  3RSE B;  5F2R A;  4LFC K;  3HST B;  4JEP A;  2VG5 A;  3WXL A;  3V9U A;  4FWN A;  4KFB A;  4R79 A;  1KQS M;  2X0S A;  1H1V A;  1KCF A;  2QM1 A;  3WT0 A;  2ASP A;  4EZ9 A;  4WFB L;  4JYA K;  5IJM A;  3OYL A;  2P9K A;  3L2U A;  4BDZ A;  1BO5 O;  1NGH A;  3VQE A;  4B1Z A;  3PLA A;  3NGZ A;  4CK1 A;  4CEA A;  1L3T A;  4HTL A;  4KHU A;  4FCY A;  5HBM A;  2O8D A;  4M42 A;  1SKW A;  3C6H A;  3AY9 A;  5AQI A;  3VEZ A;  1YHQ N;  4K8Z A;  3OJU A;  1WSG A;  3B6O A;  1VQ5 N;  2IGI A;  4B3O A;  1EO1 A;  2RF2 A;  2A3Z A;  1HRH A;  1ST7 A;  4A2A A;  2BAN A;  4O0J A;  3ZCM A;  1QQM A;  1KC7 A;  4OGE A;  1S5J A;  4IZ9 A;  3OYB A;  1YTA A;  4FJI A;  4FWQ A;  4ILG B;  1MIZ B;  4A5B A;  3O3G A;  1MK9 B;  2P9S A;  1VQL N;  4IFY A; 
#chains in the Genus database with same CATH homology
 3MN9 A;  4WQ5 C;  4BRQ A;  2E2P A;  2D4W A;  1GLF O;  4B1U B;  1ZBS A;  4NLB A;  3TTC A;  3BEX A;  1RGI A;  3O08 A;  3U8Z A;  3O5B A;  2ASO A;  3DJC A;  1SZ2 A;  3U9D A;  5F1X A;  3C6A A;  1U2V B;  4ZRJ A;  2EMT A;  3J7Z O;  4PKI A;  3SAF A;  3QBX A;  1YIJ N;  2F9T A;  1YJ9 N;  3VF2 A;  2P9U B;  3SAH A;  2GTD A;  4O5F A;  4FOI A;  3CCV N;  1ZXO A;  2NLX A;  1M1K O;  3LDN A;  4CBU A;  2YVC A;  4C23 A;  1T6D A;  5C0Y A;  1KAY A;  1QHA A;  3R9P A;  3DLL L;  3K9K A;  2W40 A;  4B1Y B;  5LY3 A;  4K42 A;  4DKW A;  5EXW A;  1N8R O;  4IDH A;  2D1K A;  3CMA N;  1IJJ A;  5BRH A;  1TYQ A;  2QWL A;  1YI2 N;  3FZK A;  1HB8 A;  3P31 A;  5AQW A;  3CXC M;  3ULE B;  3KWG A;  5C12 A;  2CGK A;  2Q0R A;  3ATV A;  2QWM A;  4MDB A;  5AQJ A;  3SLC A;  3VEY A;  3HBT A;  3TPQ A;  3ZX3 A;  5EX5 A;  1TYQ B;  1ATS A;  2YJF A;  4JKG A;  3R8E A;  2E8A A;  1DT9 A;  2WC9 A;  3EKS A;  4FO0 A;  2QA4 N;  3CCE N;  5BRE A;  2ZJP L;  2CQU A;  4CZL A;  4IOA L;  3CCQ N;  4EHT A;  1WUA A;  2NRH A;  1BOT O;  3IDH A;  4JKG B;  2PFU A;  3EL2 A;  3LL3 A;  1ESV A;  1QQO A;  3UKR A;  3VF4 A;  3GDQ A;  1D4X A;  2FXU A;  4BR9 A;  1XC3 A;  5AQQ A;  1NGC A;  5AQF A;  4K41 A;  3AAQ A;  5M1P A;  3CI5 A;  1NGF A;  4IOX A;  4XH5 A;  5AQP A;  5AFU A;  3D6R A;  4FWL A;  5GIP A;  3CCR N;  1GLA G;  1HUX A;  4QS9 A;  1Q82 O;  1NM1 A;  4FWO A;  5LJV A;  2I1J A;  2BTF A;  1HBK A;  5AR0 A;  3SJH A;  5DM7 L;  5JVL A;  3E66 A;  3HI0 A;  2GWK A;  5BN9 A;  1C0F A;  3A5O C;  3MDQ A;  3VOV A;  2W41 A;  3HRG A;  4IWV A;  3VMF B;  5JIC A;  2WFB A;  2BUP A;  3NVM A;  3O9T A;  4BRI A;  1BA1 A;  4BC5 A;  1VQ6 N;  2Q97 A;  2A6A A;  1VBG A;  1XUP O;  1GC7 A;  2NNW A;  4EHU A;  3I8B A;  3EO3 A;  4C1N I;  4H5R A;  4YOR A;  3CET A;  3ZDT A;  1R59 O;  3CJ1 A;  4GVE A;  3D2E A;  4PHT X;  4CZI A;  4YOX A;  3WXK A;  3CCJ N;  4WQ5 A;  1NGA A;  3C7N A;  1OVY A;  2IVO A;  1GC6 A;  1MWM A;  2ABD A;  3ATU A;  2ASM A;  2Q0U A;  3A8Y A;  1JCF A;  3EE8 A;  3WEE A;  4H0P A;  4CJ7 A;  4BR7 A;  3D2E B;  3VF6 A;  2YCH A;  3EE9 A;  4O8U A;  4O8K A;  4WYB A;  1V4S A;  3QIJ A;  5M1F A;  4BC3 A;  2P9N A;  3N4P A;  3DXK B;  3FZH A;  2HF4 A;  5GAG P;  3J8A A;  2OTL N;  3CCS N;  3AU4 A;  3BIN A;  2J0J A;  3CJ9 A;  2DIK A;  4QS8 A;  3U7D A;  4ZRK A;  1DGK N;  5B8H A;  2Q36 A;  4GV6 A;  5AQT A;  1K8K B;  2P9N B;  1BG3 A;  1O13 A;  3C65 A;  4A61 A;  3BF3 A;  5KQD A;  2E2N A;  3EKU A;  4F7G A;  2DPN A;  3TU5 A;  3DXM A;  4LC9 B;  3WQU A;  3QB0 A;  4WF9 L;  1W2B M;  2HOE A;  3KWI A;  3O9Q A;  2HF3 A;  2IVP A;  2QEX N;  3Q7B A;  2YJE A;  3MWP A;  4MLE A;  3WQT A;  4F9O A;  5H1S Q;  1HB6 A;  4XH4 A;  3H3N O;  1NGJ A;  5BN8 A;  1BUP A;  2ZWH A;  4NB4 A;  1HJO A;  5TKY A;  4DXA B;  2KHO A;  4GV3 A;  3DXM B;  5AQL A;  1NGI A;  2HBM A;  4K43 A;  4RCH A;  4GNI A;  4BGB A;  5JLH A;  3FE1 A;  5JMV A;  3HOS A;  1M90 O;  3P39 A;  1U2V A;  3OA9 A;  3OBW A;  3H45 C;  4H03 B;  1Q7Y O;  1Y19 B;  2V52 B;  3H6E A;  1J19 A;  4DCH A;  5AZJ A;  4JKA A;  2P9L B;  2P9U A;  3C0B A;  3CD6 N;  2H3G X;  3BUZ B;  2AP1 A;  4IEI A;  5AZI A;  3CCU N;  3VPZ A;  3O9S A;  5AQK A;  1NLV A;  1GLE G;  2IIR A;  5JLF A;  4JN4 A;  4JKD A;  2NRZ A;  1X3N A;  2HMP A;  3ZEU B;  3UKU B;  4CD3 A;  5AZJ B;  3CCM N;  2P9P A;  1KBL A;  5AZI B;  4EAH D;  2CH5 A;  3U4L A;  4AF1 A;  3GBT A;  2GWJ A;  3MX5 A;  2HBJ A;  3T7Z A;  4PL8 A;  5AQU A;  3HZ6 A;  3ULE A;  3U9Z A;  4BG8 A;  3FZL A;  4MLH A;  2P9P B;  4BRD A;  4OPH A;  3VER A;  3DAW A;  3HOT A;  2PBD A;  3IFR A;  5AQR A;  3SK3 A;  4MO5 A;  4B1X B;  4BR0 A;  3G9W A;  5KQ8 A;  4HDQ A;  1OKJ A;  1YXQ A;  4BR5 A;  3MMV A;  2OTJ N;  4BY9 C;  5AQS A;  3LDQ A;  2GX9 A;  5BPN A;  1VBH A;  2QW9 A;  1ZC6 A;  3AGR A;  3CJ7 A;  3CIP A;  3LM9 A;  4YOT A;  5GAD P;  2I7P A;  3GOI A;  3L4Q A;  4A62 A;  4BR2 A;  1VQN N;  1NTI A;  5DM6 L;  1S22 A;  2NRV A;  4Y0W A;  3JXU A;  1VQK N;  4GXB A;  4XH1 A;  1GG3 A;  2HST A;  1Y64 A;  2VYP A;  3A5N C;  1VQO N;  1QVF M;  1VQ4 N;  4L3Q A;  4BVP A;  1IG8 A;  4IFE A;  4H0T B;  3ENB A;  3BF1 A;  4DHY A;  4CBW A;  1S3X A;  2I7N A;  1K9M O;  1NGE A;  2A5X A;  1HKC A;  3FGU A;  4JKC A;  2A40 A;  4U7B A;  4YOU A;  5LJW A;  5M1K A;  2NRR A;  1YUW A;  1GGO A;  1X9J A;  4JHD A;  5TKW A;  3B8A X;  5M1Q A;  3M1F A;  4BC2 A;  1NI2 A;  2FJ9 A;  4B1W B;  4CI6 A;  3OHR A;  1KQS M;  5M1N A;  3X23 A;  3QML A;  3EN9 A;  3VTI A;  3WXM B;  1NWK A;  2RHK A;  3FFK B;  4BRM A;  1W97 L;  3I33 A;  3M3Z A;  4BRE A;  5MLC Q;  5CR4 A;  4WFA L;  2CB8 A;  4DQ8 A;  4JHD B;  3ENH A;  2HBL A;  4ILH A;  4G9Z A;  5E26 A;  4CBX A;  4QS7 A;  4H0Y B;  3E1Y A;  1MK7 B;  3HSC A;  4FVU A;  2WBN A;  5FPE A;  1P8Z A;  1Q18 A;  4FL9 A;  4NY0 A;  2QWN A;  2QXL A;  1QZ5 A;  3DWL A;  3E9P A;  1TUY A;  3ENO A;  3K9J A;  1GLL O;  2NRT A;  3DXK A;  3KK7 A;  3G25 A;  3P4I A;  5C2F A;  4BC4 A;  3VTH A;  3SMS A;  5EVZ A;  3I56 N;  1YJN N;  1G99 A;  4JKE A;  1NGG A;  2FSK A;  3CJA A;  2RQ1 A;  3VET A;  5KPT A;  2A41 A;  2RE2 A;  1K8K A;  2VGM A;  4JK7 A;  4A5A A;  3PIP L;  4C1N K;  2P9I B;  3A0I X;  3NMU A;  3FR0 A;  4H5W A;  4A2B A;  4DB3 A;  2D2Q A;  2I1K A;  2QWQ A;  2VWB A;  3VGM A;  3VEX A;  3MN5 A;  5AQX A;  1KAX A;  4IO8 A;  5M1O A;  4CZK A;  3M6G A;  1Q81 O;  5BPL A;  3L4I A;  4A59 A;  4NLC A;  3ZET A;  4WQ4 A;  2AA4 A;  4E1J A;  3CC4 N;  1J6Z A;  2NZT A;  4A57 A;  4BGA A;  2D11 A;  3WUH A;  4PL7 A;  4JKB A;  1TUU A;  4GV9 A;  4JKH A;  1ACA A;  5C15 A;  4BRL A;  4IO9 L;  3O9U A;  1NGB A;  3CER A;  3ZET B;  1H4R A;  1RDU A;  4ILJ A;  2P9L A;  3EZW A;  5KPR A;  3Q7C A;  2FSJ A;  3LDP A;  3AAR A;  3P38 A;  1MA9 B;  3AU5 A;  2P9K B;  2IVN A;  5CE3 A;  1MDU B;  4HWI A;  1HLU A;  1T44 A;  3U8X A;  3G71 N;  1YF5 L;  1U6Z A;  5AQV A;  4BQL A;  1BA0 A;  1BDG A;  3O6W A;  3ZEU A;  3R3L A;  5AQM A;  2QI2 A;  3UKU A;  4PKG A;  4FWP A;  2JWK A;  2D10 A;  3CHW A;  3AGK A;  5AQZ A;  2A42 A;  2YHW A;  4JNE A;  3LDO A;  5ADX H;  2E2O A;  4TKN A;  2KKZ A;  1KXP A;  3BP8 A;  4HDO A;  4OPA A;  3GL1 A;  3LM2 A;  2ZJR L;  2CGJ A;  4BRG A;  4FWM A;  4KH6 A;  1VAZ A;  5GAE P;  3MX2 A;  2V51 B;  1E4G T;  1T6C A;  3CJB A;  3R1X A;  1GLD G;  4EFH A;  3VEN A;  4AM6 A;  1SGH A;  4CZM A;  3CME N;  1V4T A;  3G4S N;  3FLV A;  3GE1 A;  5AQG A;  3M5R A;  4AM7 A;  5GAH P;  1CZA N;  4YOV A;  1RFQ A;  1SAZ A;  2V7Z A;  4MDA A;  4H5N A;  1NJI O;  5BR9 A;  3MN6 A;  2CH6 A;  4Z94 A;  3CJC A;  2GUP A;  4JK9 A;  2ITM A;  4JAX A;  2E2Q A;  2UYT A;  3CC7 N;  4WQ4 C;  4FWR A;  4JD2 B;  4YOY A;  5AQN A;  1YVN A;  4CZH A;  5CHI A;  3QFU A;  5GIN A;  4M63 C;  1LCU A;  2P9S B;  3N4Q A;  3FP5 A;  1JCE A;  2F9W A;  2J0M A;  5GIO A;  3TSU A;  1GLJ O;  4H0O A;  4M7Y A;  4BRO A;  3H1Q A;  3VEV A;  1LOT B;  1RDW X;  2F7T A;  2YHY A;  1ATR A;  4BRH A;  5AQH A;  2E1Z A;  3TTD A;  3ID6 A;  1ISN A;  2FF3 B;  2FF6 A;  2AL6 A;  3FLC O;  2ZGY A;  2BH1 A;  4YDU C;  3W3D A;  4CZE A;  1XQS C;  1YJW N;  2QWR A;  1ILY A;  2FSN A;  3CF5 L;  4H0V B;  5FPM A;  2QWO A;  5FPD A;  1GLB G;  1QZ6 A;  3MK6 A;  2E1Y A;  2EMS A;  1JCG A;  2D0P A;  3SBG A;  4CYE A;  2NRW A;  1WOQ A;  2FLO A;  5AQY A;  3T69 A;  4CD1 A;  2ZJQ L;  4ISE A;  1JDE A;  4FSV A;  4J8F A;  4YOW A;  3SMP A;  4BG9 A;  1KD1 O;  3PVL A;  1DKG D;  3VGL A;  4ZRI A;  1BWF O;  4B9Q A;  4UY8 O;  3KZB A;  1NMD A;  5C2D A;  1P90 A;  2NRX A;  3F5T A;  1SS6 A;  3CQY A;  3QIC A;  3IKM A;  4I6M A;  3VEO A;  1Z05 A;  3H1V X;  2D0O A;  1DIK A;  1HX1 A;  3D2F A;  3H3O B;  3O4W A;  3A5M C;  3QBW A;  3QDK A;  4FOE A;  3VEW A;  2WH5 A;  1BU6 O;  2VCP A;  5KPZ A;  3KVG A;  2E20 A;  5ADX A;  4P7I A;  1GLC G;  3PIO L;  1VQ8 N;  5BRD A;  3E9L A;  3PZD A;  3UE5 A;  2YHX A;  4H5V A;  4KBO A;  4I6M B;  3FZM A;  1HPM A;  4BRF A;  3O8M A;  3D2F B;  3NVK A;  1KC8 O;  2J4R A;  4FPB A;  1KAZ A;  1QQN A;  3CPE A;  4JK8 A;  1DEJ A;  1E5W A;  3ID8 A;  5AQO A;  2COP A;  3IUC A;  3HTV A;  2HBK A;  3MN7 A;  1E4F T;  3R6M A;  4YL8 A;  3EPY A;  1HKB A;  1NBW A;  4H5T A;  3UKR B;  3CCL N;  2EWS A;  3HM8 A;  3UB5 A;  3MCA B;  3O1W A;  4OO1 J;  4IJA A;  5HOO A;  1MIX A;  2HRJ A;  4BRA A;  2Q31 A;  1ATN A;  2P9I A;  4WFN L;  1K8A O;  3CC2 N;  5ELZ A;  1T3V A;  3O1B A;  1NGD A;  1EQY A;  4CZG A;  5JVG L;  3G6E N;  1S72 N;  3RSE A;  4EIA A;  1JJ2 M;  3H46 O;  4KH4 A;  4U67 L;  4XEI A;  5BPM A;  4IOC L;  5JVH L;  1VQ9 N;  3LDL A;  3WA0 A;  4M7X A;  1SQK A;  4BRN A;  1C0G A;  3TTF A;  5C10 A;  4EKU A;  4BR4 A;  4GY2 B;  2V7Y A;  4CZJ A;  2FDQ A;  2J0K A;  3D7E O;  3SAG A;  2OAN A;  3IMX A;  4K25 A;  3RSE B;  3I55 N;  2GEM A;  5F2R A;  4JEP A;  3WXL A;  1VQM N;  1HKG A;  1Q86 O;  4FWN A;  2VGN A;  5FPN A;  4R79 A;  1NVL A;  2JWL A;  2X0S A;  4JKF A;  1H1V A;  2QM1 A;  3IVF A;  1YAG A;  2ASP A;  3F2K A;  3MWT A;  3WT0 A;  3E9O A;  5IJM A;  2P9K A;  3O9R A;  3ZX2 A;  2CGL A;  4KH5 A;  4BQZ A;  5HL7 L;  4FWK A;  3ZYY X;  1Z6R A;  1MWK A;  1VQ7 N;  2YI1 A;  3CQX A;  1BO5 O;  1NGH A;  2E88 A;  4BRK A;  1YIT N;  3C7N B;  4B1Z A;  3VES A;  4BVO A;  5F0X A;  3PLA A;  2YX6 A;  4RWT A;  1X3M A;  3L6Q A;  3TSQ A;  4HTL A;  3KHY A;  3WEE B;  3VGK A;  1EF1 A;  4H0X B;  4MO4 A;  3TSP A;  4YDU A;  5I9E B;  3F9M A;  2WUS A;  4IJN A;  3L0Q A;  5EOY A;  2QWP A;  4ISG A;  3FZF A;  4ISF A;  2ZF5 O;  2AEH A;  3S41 A;  3W0L A;  4IXC A;  4B1V A;  3CPW M;  2Q2R A;  2PAV A;  3C6H A;  3OW2 M;  3AY9 A;  5AQI A;  3VEZ A;  1YHQ N;  3A5L C;  2KLA A;  3MCP A;  3AAP A;  5EY4 A;  1VQP N;  2GEL A;  1K73 O;  4PKH A;  4RTF D;  1VQ5 N;  3RVC A;  2R82 A;  3WXJ A;  3ZX0 A;  4BRC A;  4WCE L;  1QVG M;  1EO1 A;  2ZPY A;  2A3Z A;  4IEE A;  1ST7 A;  3O80 A;  2HE7 A;  3WXI A;  2Q1N A;  3JS6 A;  4A2A A;  2LBB A;  3QFP A;  4NO7 A;  1QQM A;  1KC7 A;  4CZF A;  3GG4 A;  5AFU H;  4IZ9 A;  4JD2 A;  2QTD A;  4FWQ A;  4ILG B;  1MIZ B;  4FWS A;  5BRF A;  4A5B A;  1MK9 B;  2ZGZ A;  3OBY A;  4FPA A;  2P9S A;  5E84 A;  4BRP A;  1VQL N;  4WFB L;  3SBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...