4JK7A

Open and closed forms of wild-type human prp8 rnase h-like domain with bound mg ion
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
221
structure length
221
Chain Sequence
ELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in PRP8 mediates metal ion coordination that promotes pre-mRNA exon ligation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 65
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4jk7A02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jk7A01
4JKGA 4JKAA 3E66A 3SBGA 3ENBA 3E9OA 4JK7A 4JK8A 4JKCA 4JKBA 4JKDA 4ILJA 3E9LA 4JK9A 4JKEA 4ILGB 3E9PA 4JKGB 3SBTA 4ILHA 4JKHA 4JKFA
chains in the Genus database with same CATH superfamily
2E6LA 2YKNA 2GX9A 4JHDB 1CXUA 3DRPA 4FZXC 1JKHA 1ACAA 4FJIA 1YTUA 3DLRA 4CERA 2P9UA 4NXMK 4QAGA 4YFUA 4CZGA 2G8VA 5C2DA 3HSTB 4DR5K 3PIPL 5BR9A 4LFCK 4BQLA 5CZ1A 4DUZK 3ZDTA 3T1HK 5AQWA 4H8KA 1E4FT 4HWIA 2D11A 1J53A 1KAZA 2PZSA 1L3TA 2A40A 2AL6A 4LC9B 3NMUA 1XC3A 2YCHA 5AQYA 2V52B 2W42A 1J6ZA 4E7LA 2OTLN 3KHYA 1VSFA 3VPZA 4G9ZA 4GV6A 2HRJA 1XNQK 3JXUA 5AR0A 4WQ4A 4EIAA 4KHPK 4BG8A 4Y1DA 4I7FA 4AM7A 1HJOA 2ASMA 1JLAA 4C8KA 1T3VA 2G8HA 4CZLA 4DS4A 1VQON 3WQUA 3VQAA 3LZJA 3I0SA 4CZFA 3E9PA 3UKUB 1FW6A 4CGFA 1N6QA 2DPNA 3EEQA 3EO3A 3V6DA 3ZT4A 3U7DA 4XH5A 4AQYK 4PWDA 4TKNA 5BRFA 2RQ1A 4RW8A 4FM1A 3CCQN 1KQSM 1XC9A 3SQ4A 3SBGA 1KSPA 3H1QA 1EQYA 5DM7L 4FJGA 3AV9A 2D4WA 5KGXA 3VQ6A 3OYDA 1U49A 1SGHA 1NWKA 1SS6A 2B5JA 3OY9A 4CJFA 2GUIA 3VENA 4O44A 2PFUA 4FJLA 3ZSVA 3G4SN 3L2UA 1KVBA 3L8BA 4CZIA 4FSVA 2F4VK 2ITGA 4KREA 3N4QA 3DXKA 4BVPA 4B8CA 4DFJA 3MX5A 4GKJK 1QZ6A 3VQDA 5AZJB 5FDLA 2WBNA 4JI8K 1V4TA 4H5VA 4CEEA 2AEHA 1ASVA 1NGGA 4FJ7A 3VEWA 3V9ZA 3OYHA 2A41A 4QS8A 1U45A 5E41A 4ZHRA 1BI4A 3P1GA 5CYQA 1NGFA 5AQNA 3DLGA 3G25A 3VA3A 3EN9A 4YOUA 1BOTO 2I5JA 3RMBA 1JCFA 4CFCA 3OYMA 4H5NA 1EKEA 3RVCA 3L3VA 1GG3A 4BRGA 5HRNA 1RBVA 5HBMA 3ENHA 4CGIA 2HF4A 1BIZA 3FZMA 2Y1IA 4CZJA 4FO0A 3RMCA 2CH6A 4DTXA 1NJIO 1MIXA 3KLHA 3WQTA 1TK5A 5J2QA 2D0CA 4A5BA 4EZ6A 4H0YB 3O5BA 4M42A 5GINA 3E1YA 4GV9A 3X23A 4BQZA 2E4LA 4H5WA 4U67L 1JL2A 3TR8A 1YHQN 4BRAA 1K73O 3TAFA 4IDHA 4J2AA 1ISNA 1S9GA 4L8RB 3TU5A 3NGYA 2J0MA 1TL1A 3M3ZA 1FK9A 2P51A 1IBMK 1RNHA 4ZRKA 4FWKA 1P8ZA 1RT7A 1NJYA 1W7AA 4DR6K 1ESVA 3CERA 1XQSC 2HMIA 4FOIA 1BO5O 3QDKA 4ILJA 2ASOA 1QHAA 4FPAA 3ZYYX 4B1ZA 3BINA 2PAVA 1GLFO 4IG3A 3PUFA 4GY2B 5DMRA 2LSNA 2E2QA 3C7NB 3O3GA 2QEXN 4O0JA 4FL9A 4BE0A 2A1SA 3RMAA 2QM1A 3H45C 1N8RO 1SKSA 4B9NA 3VQ7A 1QSSA 3H3OB 1S3XA 4BR4A 3WXJA 3RSEB 2F8TA 4Z4FA 3JS6A 3D2EB 1EXQA 2O8BB 2JLEA 1NTIA 2QWQA 3I55N 3ALYA 5ELZA 3SBTA 3OYEA 3B8AX 2BUPA 4JD2B 5LY3A 4B9SA 3E01A 4BRCA 3C94A 1HPZA 3MN7A 4MFBA 3AVMA 3VEOA 2KZMA 2O8CA 4MDAA 5SWMA 1SZ2A 4NCGA 5HROA 1YITN 3CCUN 1U6ZA 4FK4A 1MIZB 1EWQA 4JYAK 3H46O 2Q36A 3QBWA 4BWJA 1ZC6A 3F9KA 1S22A 5BPLA 3SI6A 4OKEA 2UYTA 4CEZA 5M1NA 3ZSXA 2LBBA 3HT3A 1Z05A 2P9KB 4K25A 3OBYA 5AQVA 1BI4B 1JLQA 2WOMA 2AJQA 3CETA 3M8PA 3GBTA 2G8KA 4BVOA 1C6VA 2NNWA 4HTLA 1GC6A 4UQGA 2RF2A 5FLXO 5M1FA 3SQ1A 1N32K 1TAUA 3CC7N 4F8RA 1VRTA 3SV4A 3CJ7A 3RTVA 4FWRA 2D1KA 3ZSQA 5CR4A 2O8DA 2JWKA 4Z0UA 4HUEA 1E4GT 3VF2A 4IOCL 4CHOA 3OHRA 2YHXA 1I39A 2D10A 4C8MA 4FJHA 4X66K 4EP5A 2HHHK 3NF8A 1D9FA 3PSIA 3ZSRA 2IVPA 2NUBA 4H0XB 4FLVA 2FSKA 1IG9A 1Q9XA 3K5OA 2HBLA 4DSLA 4CF9A 4XEIA 3PX4A 4CIEA 1CZAN 3FLCO 2W41A 1OVYA 3TARA 4JK7A 2P9PB 3CFPA 4IFYA 1S9EA 3SPZA 4H0VB 2ITMA 1KCFA 5AFUH 4JK9A 1LV5A 3UKUA 5JS1A 1HB8A 4FK2A 1RFQA 4MQ3A 5M1OA 4MDBA 3O9SA 4FLYA 3S3OA 3THWB 1BUPA 3B6PA 1NMNA 3IRXA 2HHWA 1NOZA 5CE3A 4F3OA 1QE1A 4CHYA 4DTRA 3O1WA 3OA9A 4FZZA 4JV5K 4CIFA 5D3GA 1NLVA 2VWJA 1TKZA 5J1EA 4CGJA 3KLIA 2BGGA 2NRXA 4K42A 3OJSA 3CCMN 4O4GA 4MLHA 4C8LA 1T7PA 1N5YA 4CEFA 4FWSA 1GLAG 4IEIA 5E26A 1TUYA 4DQSA 3CCSN 1RBSA 3A8YA 2NRVA 3NFAA 4LH5A 1VQLN 5EXWA 4M3ZA 3QEVA 1KRPA 4N41A 3O08A 2CH5A 4YOXA 4CJPA 4IJNA 1YVNA 4WFAL 3D2FB 4MO5A 1QSYA 3KD5E 2HHXA 3KKRA 1KLNA 4BR7A 4OO1J 1CZ9A 4JKFA 1QQOA 1HKCA 3WEEB 2UUBK 3LP3A 4DCHA 3DRRA 4CJQA 4DR4K 4W5NA 5LJVA 3HOTA 2B4JA 5AQUA 5LJWA 5IWAK 5AZIB 3VQPA 2KKZA 3SUQA 3T19A 4FM2A 3FLVA 3BF3A 4M63C 3SAGA 1EF1A 4LFAK 1T03A 3LDNA 3H3NO 1QTMA 2FLOA 4KHQA 1QQCA 3NH1A 3W0LA 4EKUA 1HBKA 3P31A 3CC4N 4A2AA 3MN5A 2V51B 3S9HA 4JAXA 2I7NA 4H5TA 4AHUA 1DT9A 3QIPA 4JI6K 4M3YA 4OPKA 3HZ6A 4W5QA 3M8QA 1D4XA 4CEQA 3FZHA 3DRSA 3CM5A 4NYFA 2V7ZA 1HNXK 4CD1A 1NGEA 1OH7A 3T1YK 4BR2A 4CZMA 5I3UA 4DSJA 4CFDA 4CK3A 2CGJA 2HOEA 2CQUA 4YL8A 1KTQA 3A2FA 4DKWA 3LANA 2PYJA 1SUQA 3CM6A 4BDYA 3LDQA 1SL2A 2IAJA 4BRDA 3HVRA 4LF9K 4JNEA 3O9QA 2P5GA 1ZBIA 2Q2RA 1HMVA 4DQ8A 4DTPA 4NYNA 1T6DA 2W40A 1KFSA 4CGGA 3NF9A 2CGLA 3QEPA 3R8EA 1KBLA 1IKWA 2IGIA 4DF4A 1X9SA 4A62A 1ST7A 1P90A 4H0OA 4DV7K 1ATRA 1Z25A 1S1TA 2GELA 4BRKA 4BC5A 2XY7A 2QKKA 1WLJA 4QOZB 1RDCA 3RMDA 2H3GX 3CIPA 4C1NK 4AHTA 2QK9A 1GLEG 3V9XA 4DTOA 3CCEN 3HP9A 4C23A 4LF6K 3S3NA 3AVKA 3ZT1A 4WE1A 2P9UB 3AVHA 1Z26A 1MDUB 2P9SB 3THXB 4E3SA 1JLBA 1NBWA 2FSNA 4OKJA 4NCBA 2BANA 2UXBK 1NK7A 2ABDA 3IVFA 3FFIA 4CEDA 3AVFA 5E84A 2FC0A 2P9IB 3I33A 1HQUA 4DV3K 2Z1JA 3ENOA 1HNVA 4RG8A 3OS0A 3UKRB 1WSIA 2D0PA 4QS9A 4RW9A 3D2EA 1E5WA 5J2MA 4IG0A 1B92A 5F1XA 2NZTA 3SPYA 2WUSA 4FWLA 1ATNA 3O9UA 2XY8A 2F7TA 4BDZA 3GG4A 3HSCA 2NRWA 2D0BA 5BR8K 2ZPYA 4CJSA 4J2EA 1GOBA 4RWTA 1NGIA 1HKBA 3PZDA 3NF7A 1DTQA 3QIOA 5AQLA 4J8FA 5HP1A 4O5FA 3KD1E 2ZJQL 3MAQA 4CBXA 1HR0K 2FJ9A 1BWFO 3ULEB 3VMFB 3G0ZA 1L5UA 4KB1A 1HPMA 1WSGA 4IXCA 2DIKA 3O3HA 2O4IA 1NI2A 1JLFA 4IO8A 4BRNA 3AO1A 3H1VX 3R1XA 1SKRA 2KHOA 1JCEA 2CGKA 3KVGA 4BG9A 2QWPA 4JKGA 3KIOA 1TYQA 1MU2A 5GIPA 1LAVA 3AGKA 5A2QO 1IO2A 3SUPA 4WQ5C 2EMSA 1Q86O 3ATVA 2R82A 4GVMA 5CY4A 4CJ7A 3KK3A 1RBTA 3OS1A 1U4BA 4NXNK 3CJBA 4AH9A 4HDQA 5M1QA 3TTDA 3QINA 2HSTA 4I2PA 5FPEA 1FXXA 5KRTA 3O1BA 1GGOA 4I9LA 5KPRA 4FVMA 5HRSA 2Z1HA 1I94K 4Y0WA 1WBBA 1BISA 1YVUA 4F4KA 1C0FA 3DYAA 2ZWHA 4PL7A 1JLEA 4FJXA 3HL8A 1T6CA 3Q7BA 1LAWA 4ELVA 1HNWK 5T7BA 1FKOA 4IO9L 3EKSA 3KLGA 3BZCA 4PY5A 2RKIA 2ZJPL 4FXDA 3IAYA 1XNRK 4ZTFA 1GLDG 3CPEA 1KC8O 4DTNA 3I8BA 2O4GA 3M5RA 4C8NA 5C12A 1S1UA 4YDUA 4M45A 3G71N 5I9EB 3L2VA 1VRUA 1RDUA 4E7JA 3HPOA 1XHXA 4JRPA 1A5VA 2HBJA 2G8IA 3AAPA 1UAXA 4DLGA 4BRLA 3AA4A 4LF7K 1VQ8N 4CCHA 3PSFA 4ISFA 1JXEA 3KWGA 1M90O 4CJVA 4KTQA 2P9IA 3ZT3A 1G99A 5JVGL 2HBKA 2HNYA 3VQBA 1ZBLA 5LL6Z 4XH1A 3NBPA 4OKKA 2QWMA 3O3FA 2XY5A 2RHKA 4YOWA 2P9SA 3THXA 4KHWA 3AVIA 4ZRIA 1E3MA 4M3RA 4KHUA 1D9DA 4JKBA 1KFDA 3U3GA 3TI0A 3O9RA 1ZXOA 3TSUA 3S41A 4H4OA 1ILYA 1DLOA 3THYB 2O8FB 2VG7A 1T05A 4AHRA 5CHIA 3T1AA 4A59A 4FW1A 4CIGA 1K8KA 5I42A 3IFRA 1CZBA 3KZBA 2O8BA 4DQIA 4B3RK 1RTHA 1TGOA 3EZ5A 1DTTA 2I7PA 3ZCMA 3MXJA 2X6SA 1A5WA 4JRQA 4NB4A 4OJRA 4O8KA 3IS9A 1ZBHA 1U2VB 5LMUK 5AQJA 4KV8A 5GAEP 4BR9A 4CHZA 4DHYA 3NGIA 3BZKA 1TKXA 4DS5A 1IJJA 2GWJA 2OCEA 4DQQA 3F73A 1SQKA 2VQFK 2OPSA 3MEEA 2D2QA 5HOOA 1ZYQA 5AQRA 3DMJA 4FLWA 4EZ9A 4OGEA 3SQ2A 5AQGA 3CCRN 1JXBA 3OW2M 1QZ5A 3CPWM 4XIUA 3HO1A 4AHSA 4CZHA 3AU4A 4GXBA 2HHTA 3SCXA 3ID6A 2YNHA 3OTOK 4RW6A 1U47A 4DV5K 1IBKK 4GW6A 2KFNA 3MEDA 5JLHA 1VQMN 1BCMA 2O8FA 1FKPA 4E7HA 4CEBA 3DAWA 4BR0A 4GMJB 4KH5A 1IBLK 2KLAA 3HOSA 2QTDA 4LSLA 1WOQA 3J7YP 4DG1A 1KVCA 3QLHA 3H08A 4KKOA 3CMAN 4PKGA 4B3MK 3M8SA 1CXQA 1NGCA 1BIUA 5AFUA 1L3SA 4N76A 5KPTA 2COPA 4E89A 4NY0A 5GAGP 3O9TA 5FPNA 5AQTA 4DWIA 3I8DA 2E1ZA 4DXAB 3VTIA 5FPMA 3VOVA 2HNZA 1OKJA 2JGUA 1BL3A 4DV4K 4CZEA 4FLXA 3SAHA 3QEXA 3MXMA 4DUYK 4A57A 4KHSA 3O8MA 1V4SA 1VSDA 1MWKA 3O4NA 5KQ8A 4FZYA 3H6EA 3LAKA 4GNIA 3PO5A 2O8EB 1QSLA 4BRPA 4B9UA 4RCHA 2ZJRL 1GC7A 3A5LC 2FXUA 3GOIA 3VEZA 3L0QA 2QI2A 5FPDA 1S1WA 1DKGD 1JCGA 3LDOA 4BRQA 3FFKB 4K43A 1QVFM 3J8AA 3LM9A 4CJKA 4N56A 2ETJA 2P9LB 4CJ4A 4DU1A 2G8UA 2YHYA 1RDBA 3NHGA 3CF5L 3VQQA 4BE2A 1BHLA 4FYDA 1VSIA 4C1NI 5FRNA 4FK0A 5C42A 1MK7B 3ZSZA 4WYBA 2YNGA 3TANA 2D5RA 4E7IA 1W2BM 3EE8A 3SNNA 3ZT2A 2E5LK 1WB9A 3THWA 1GLJO 3CCJN 1N34K 4CJLA 1HKGA 2QKBA 3LP2A 3F5TA 3R3LA 2RPIA 1KD1O 2KFZA 4CVNE 4B9MA 1S5JA 3J81O 3A5MC 4FWOA 3AO2A 3SYZA 5AQPA 1NK8A 3AVBA 4YORA 4E0DA 3FE1A 1HYSA 3WEEA 4NO7A 1TAQA 2FDQA 3LP1A 1RT6A 3AY9A 5HL7L 4LFBK 1HYZA 2NLXA 2X78A 4X62K 2OTJN 3NH0A 3PX6A 4JS4A 3CFOA 3CJAA 3VF4A 1BGXT 3K5MA 4B08A 3CC2N 1C0GA 3ATUA 2O8EA 4H4MA 5K14A 1SL0A 5FRMA 4M3WA 2GUPA 1YT3A 4PKHA 4IOAL 3ZSWA 1C1AA 5JMVA 5AQIA 2ZF5O 1NK5A 4DV0K 4DSEA 2OYQA 2FBYA 1RDAA 1WN7A 3CMEN 1H4RA 4K8ZA 3IG1A 4GV3A 3A0IX 5BRHA 4WQ4C 3ZSYA 2I1KA 3MN9A 1HX1A 1YJWN 1RT1A 3I56N 4FWMA 4Q0BA 2J0KA 3EPYA 1NGAA 1S72N 4CJRA 2A42A 3WA0A 3NAEA 2QWOA 2P9NA 1IH7A 3HK2A 2O8CB 1S1XA 4B1YB 1CLQA 2RE2A 1RTIA 3SJHA 4B1UB 1VQKN 5C15A 3VGLA 4LF4K 2F96A 3MCAB 4F2RA 3OYCA 3BY5A 3VEYA 4EHTA 1IKXA 3OYBA 2XHBA 5AQQA 3D0PA 2EMTA 5BN9A 3K5NA 4FPBA 1NJZA 4KAZA 3LDLA 4JKHA 3UE5A 1BQMA 4B9LA 1QVGM 2UXDK 4H03B 2GV9A 4BC3A 5KI6A 4M3XA 1JLGA 1NK4A 2E2OA 3P83D 2ZGYA 1RGIA 3C0BA 2E6MA 1JLCA 3MWPA 3KK2A 3MWTA 3BUZB 1OH8A 3C95A 4HCCA 1XI1A 2OPPA 4Q5VA 2E88A 2J0JA 1UOCA 4PA1A 2YKMA 4KFBA 3R9PA 2D0OA 5J2NA 4FCYA 4U7BA 1A5XA 3C7NA 1JL1A 3VESA 2QWRA 1NK9A 4ISEA 2OANA 1R0AA 4O5BA 3LL3A 2PBDA 3AO3A 3PX0A 3L2RA 4JKEA 2W6LA 3K9JA 4B3OA 3KLEA 4HDOA 4WQ5A 4PL8A 2ATQA 3DI6A 1VQ7N 2P1JA 3WNGA 4DSKA 3C65A 1HJRA 4Z4HA 5H1SQ 5EOYA 2D0AA 1UA1A 1VBGA 3THYA 3PLAA 2KZZA 3BGRA 4CF8A 2NRTA 3VN5A 2PY5A 4B1VA 4PUOA 3GE1A 1TYQB 4OX9K 4H0PA 5BRDA 3OS2A 3ULDA 3QNNA 1X9JA 2KQ2A 1NGDA 3VQCA 1B9FA 2P9LA 3AGRA 4V19S 3CI5A 3O6WA 3MEGA 4K0KK 1O13A 1NVLA 3HPGA 4FM0A 2IOCA 1YI2N 2E2NA 2WFBA 3RWUA 5AQFA 3LZIA 3P38A 4CESA 1RDWX 1RTJA 4YOTA 5AQSA 1C1CA 2I1JA 4DFMA 2KTQA 1IKYA 2A6AA 3F9MA 3LDPA 2P5OA 1I3AA 1VQNN 1X1PA 1K6YA 4ZTJA 1NNEA 4Z4CA 3RSEA 2HW3A 2ZGZA 1KAYA 5AZJA 5JLFA 3E66A 3U4LA 4CJ3A 5ADXH 1MA9B 1S6QA 3EE9A 3VQ4A 1UA0A 4N5SA 4ZRJA 3QICA 3SUNA 4FVUA 4PQUA 3AVGA 4CI6A 2FF6A 2HVHA 3NF6A 4PHTX 4EHUA 3WXIA 3K2PA 4OGCA 3WT0A 3V4IA 3G9WA 3SQ0A 3P5JA 4LF8K 1W0HA 3ID8A 1O1WA 4DR2K 1SL1A 5EY4A 4JHDA 3VF6A 4NLCA 3ENBA 2UUCK 3V9WA 4QCLA 2NRRA 1W97L 4AHVA 4A61A 1QQNA 4KI4A 1K8AO 1NM1A 2RN2A 1LW2A 2OZSA 4K8XA 3LWLA 1IKVA 4JI2K 1C0UA 3CFRA 4CJTA 3KKSA 2Q0UA 2HF3A 2DFEA 5SZTA 3J7AP 4DR7K 1LW0A 3R6MA 3LWMA 1N36K 1VQ9N 3O4QA 1ASWA 1QHTA 3NCIA 1TL3A 3GDQA 4IDKA 5BPMA 4HUFA 1TKDA 2ZD1A 1ITGA 1NGHA 3CQXA 4IBNA 4JI1K 2GEMA 1U2VA 1HNZK 4BC4A 4JKAA 4OPHA 1DIKA 5KQDA 1WNSA 2QWNA 1J9AA 2NRZA 1NOYA 3UKRA 3VEVA 4MLEA 4M3UA 3DLBA 1RBUA 2IC3A 3WXMB 3DJCA 3EKUA 1YJNN 1RILA 4BC2A 4EP4A 1IG8A 3CCVN 4ILHA 3A5NC 4DV6K 3ZETA 1VQPN 5J2PA 3C6TA 3L6QA 3J80O 2E8AA 4IFVA 5BREA 3RR8A 4CYEA 2QW9A 4IZ9A 1HB6A 4BACA 3TTCA 5C2FA 4JK8A 1YF5L 3K0SA 3P39A 2R7YA 1XHZA 2YHAA 5IT9O 3HRGA 1YJ9N 1L3UA 3IUCA 2WH5A 3KJVA 1GOAA 3QEIA 3ZETB 3DOKA 3QB0A 1XMQK 3SMPA 3TAMA 1VSLA 2YHBA 4PKIA 1K9MO 2VWKA 4B9TA 1EWRA 2NRHA 1TK8A 2FBTA 1MK9B 4EFHA 4LSNA 2FSJA 3VA0A 1BQNA 3ZEUB 2AA4A 4ILGB 1T44A 1YIJN 2A5XA 1VK0A 1BDGA 2HE7A 4MO4A 4DR1K 1RCHA 2VQEK 4FLZA 1VSMA 2HHQA 3IDHA 4DV2K 4FJ8A 3TWHA 4CF1A 3SLCA 4FWNA 3T7ZA 4DTUA 4CFBA 3CHWA 2Q31A 3MMVA 3WUHA 3ZLJA 4JLHA 1XMOK 3DOLA 5GADP 5EVZA 5JVHL 4JKCA 3T3FA 3ZT0A 5KGWA 2F8SA 1HQEA 1OH6A 5TKYA 3E9LA 1X9WA 3NH2A 3TPQA 4B9QA 4BDPA 1N33K 3SAFA 4KH6A 3SUOA 1RDDA 5C10A 2QWLA 2F9WA 3AVAA 3C6AA 4Y1CA 2E20A 4JI0K 1D5AA 4CW7B 2HHUA 4CEAA 2IVOA 3AO5A 4G1QA 3IMXA 3BDPA 3AVJA 3QBXA 5C24A 3WNHA 4JI5K 2IDOA 3OYLA 1WSFA 5AZIA 3OYIA 1TK0A 1Q82O 2HBMA 2P9PA 1VQ6N 4CF2A 4BRIA 2HNDA 1HNIA 4AHCA 1NK0A 2X74A 4KB0A 1TV6A 1RT2A 1C0MA 4E1JA 4CE9A 2Y1JA 1KVAA 1YTAA 5FROA 1VSHA 4CK2A 2OPQA 1H1VA 4M7YA 4FWPA 3TTFA 3QFUA 4ISGA 3WXLA 1U04A 2VG5A 3U8XA 3UB5A 3I0RA 3NDKA 3NE6A 2VGMA 5AQHA 3K9KA 1EETA 4K41A 5KTQA 3CCLN 1REVA 1ZBSA 3AVCA 4QS7A 4YNQA 4KHNA 3O4WA 3CJ9A 4IWVA 3SZ2A 4P7IA 1UWBA 4C8OA 1JJ2M 3QNOA 2YJEA 3LDSA 4CBUA 4FJNA 3N4PA 1RT5A 3B6OA 1M1KO 2P9KA 4KPYA 3L2WA 4BREA 4DU4A 4NCAA 3DLKA 1LWEA 3PIOL 3HM8A 3RR7A 4FLUA 3VGMA 3AA2A 2BDPA 3CJ1A 3VGKA 1TKTA 2YI1A 4BGAA 2BE2A 1BA0A 3VQ8A 2EX3A 4B9VA 1GLBG 3AARA 3S3MA 4KHYA 2HMPA 4BR5A 1WSEA 4YOVA 3FP5A 2XY6A 3U3YA 3CQYA 5CZ2A 3V9UA 1NJWA 1LWCA 1WAFA 3VQ9A 3KWIA 4YOYA 4ICLA 2DFFA 1Y19B 4W5TA 2A3ZA 3AAQA 5BN8A 4BRHA 2FF3B 4FLTA 4RTFD 1DEJA 4LF5K 1Q9YA 2GTDA 1S1VA 5JVLA 3MXIA 4F2SA 3U8ZA 1C1BA 4Z4EA 4M3TA 2HHSA 1VQ4N 3TSQA 3DXMA 2KW4A 4FOEA 4YY3K 4KBOA 4CHNA 4CZKA 4KH4A 3AVLA 3VQ5A 1KXPA 4BRFA 3OYJA 3M1FA 2YJFA 4N47A 1KAXA 3ZX2A 3C6UA 1ZBUA 3FGUA 5GAHP 1NKCA 3KK7A 1J54A 4X64K 2HHVA 2P9NB 4TSXA 3RRHA 2IS3A 2W6KA 2X6NA 3LM2A 3HJFA 4H5RA 3U6FA 3JYTA 3LPUA 4A5AA 1J19A 1SKWA 1FJGK 1ZBFA 3QO9A 1L3VA 2E1YA 4GKKK 3T69A 3MDQA 4DFPA 5AQMA 4DSFA 4O55A 4O0IA 3FZKA 2EHGA 4JI3K 1NGBA 4CBWA 4HCBA 4E1NA 3ASMA 1VHXA 3ITHA 1B9DA 4BY9C 1KC7A 1LCUA 3AA3A 3UIQA 2Z1IA 3D2FA 2IIRA 1EP4A 5MLCQ 3CXCM 4B8AB 4DTMA 4M41A 5EU7A 4AF1A 4JD2A 5CYMA 3HVTA 5C25A 1VSEA 2GBZA 4KTWA 1U48A 1X3MA 5EX5A 3LALA 2DTUA 4CEOA 3TAQA 1WAJA 1GLLO 4HHTA 1NKEA 4F7GA 3CD6N 3FZFA 2WONA 5AJ3K 3VTHA 2BH1A 4WF9L 4BROA 3LP0A 5M1KA 3VETA 4CJUA 4DU3A 4R79A 3EYZA 1VBHA 4FWQA 5IJMA 4DTSA 4WFNL 1BU6O 5B8HA 3L4QA 4R5PA 2VCPA 4DFKA 5AQOA 3CJCA 2YNIA 4OLBA 2OZMA 3K58A 4KRFA 1HRHA 4DTJA 3OJUA 3HP6A 4ELUA 4B1WB 2FBXA 1S6PA 2G8WA 2Q1NA 1NK6A 1LOTB 2XO7A 1EX4A 5JS2A 4DSIA 5JICA 3CQ8A 5TKWA 1C0TA 3TAGA 3A5OC 3FZLA 3K59A 1T8EA 1NMDA 3BEXA 1RBRA 5F2RA 4YDUC 3DM2A 3QEWA 2CB8A 3LAMA 2E2PA 4CECA 4CGDA 4I2QA 5F0XA 1QS4A 2YHWA 3V9SA 3BP8A 4DQRA 4WCEL 1Q7YO 4ID1A 4E7KA 4AILC 3EY1A 1OH5A 1X9MA 1J5OA 3CYMA 4CGHA 2O8DB 3HI0A 3CG7A 1IV0A 4RW4A 2ZQBA 3OYFA 1NU0A 3AA5X 1KLMA 2GWKA 3QIJA 4JKDA 2UU9K 4J2BA 3J7ZO 1TUUA 3C6HA 3EL2A 3HXMA 3W3DA 4FJ5A 3IKMA 4IOXA 4DMNA 4DB3A 4EAHD 3MECA 3D45A 3ZX3A 3TAEA 1GOCA 5DK5A 2JWLA 1SAZA 3U9DA 1NJXA 2Q0RA 3QFPA 4YHHK 3ZSOA 4LD0A 4RW7A 4BRMA 2QXFA 2AP1A 3M6GA 4AM6A 3PV8A 2VGNA 4E1MA 2VG6A 4W5OA 2PYLA 3HTVA 1Q8IA 2UUAK 3DXKB 4DQPA 3QERA 3MCPA 4FJ9A 1DGKN 1J5EK 4JI4K 5KRSA 1YUWA 2J4RA 5HRPA 4HTUA 4JS5A 4BGBA 2YVCA 5ADXA 2VYPA 2ZE2A 3WNEA 3NGZA 3TAPA 1WBDA 3HPHA 3DXMB 2XRIA 3MK6A 3SJJA 2Z1GA 4ELTA 3G10A 3Q7CA 3VERA 2YV0X 3RRGA 3BF1A 4LH4A 4DV1K 5HRRA 1Q81O 1W9HA 3HYFA 1MWMA 1NKBA 4WFBL 4FJMA 1ATSA 2HB5A 3V1OA 1K8KB 4W5RA 1EO1A 1VQ5N 4CJ5A 3DWLA 3HM9A 4JEPA 4Z4IA 3D7EO 2DFHA 4IKFA 1G15A 2YNFA 5LMNK 4HUGA 5C0YA 1RT3A 1VSKA 3OYKA 2FBVA 3AVNA 3NVMA 3SV3A 1Y97A 3FR0A 3MN6A 5KPZA 3K57A 3ZX0A 3LPTA 4IJAA 4DLEA 2A1RA 4JI7K 3JSMA 2G8FA 2WTUA 4GVEA 3QETA 3PY8A 4X65K 4XH4A 3KTQA 1VSJA 3L3UA 3PVLA 4I6MB 3L4IA 1Z6RA 3QESA 1RTDA 3NVKA 4KI6A 4J2DA 4A2BA 4M7XA 4IFEA 2BTFA 3SK3A 4NLBA 3OYAA 4B3SK 3DLEA 3THVA 2X0SA 1XWLA 4JN4A 2OPRA 2B6AA 1SV5A 3WXKA 3AU5A 1RT4A 3TABA 3AO4A 4Z94A 1XUPO 4CFAA 3V81A 4KO0A 3JAMO 4ID5A 3P4IA 4H0TB 4F9OA 4I9QA 5AQXA 3TSPA 1D8YA 3OYNA 3DLLL 5DM6L 3M8RA 4HVJA 3OYGA 4DR3K 5AQKA 1BCOA 3MX2A 3HBTA 2QA4N 3O80A 4FW2A 3KK1A 2ZM6K 2UXCK 4CJEA 1BA1A 3DLHA 2VWBA 4E19A 5BPNA 3QMLA 1HYVA 4KTZA 4DF8A 4OLAA 4CHPA 1WSHA 4CHQA 5M1PA 3OBWA 2Q3SA 4CF0A 5HLFA 4OPJA 5GIOA 4B1XB 1X3NA 4BWMA 3WNFA 1F21A 1NG9A 4CK1A 1BG3A 2WC9A 1NGJA 2ASPA 2YX6A 3V1QA 3K5LA 3E9OA 1OVQA 4I6MA 2Q97A 4Z4GA 4L3QA 2QXLA 1LWFA 4LY7A 1ASUA 1YAGA 4IEEA 3G6EN 2F9TA 5AQZA 2V7YA 3GL1A 3ULEA 2HVIA 1QQMA 1JDEA 4O8UA 4B3TK 1WSJA 1HLUA 1VAZA 2IVNA 4FJKA 4OVLA 2EWSA 3VQEA 4CD3A 4CJWA 3V1RA 3EZWA 2OA8A 3ISNC 1Q18A 1GLCG 1YXQA 3KLFA 4BE1A 1TVRA 2DY4A 3F2KA 1WUAA 1Y64A 4UY8O 1HUXA 4FJJA 4F3TA 3PO4A 3D6RA 3ZEUA 4JKGB 1R59O 3L2QA 4OPAA 3VEXA 3OVNA 3SMSA 3U9ZA
chains in the Genus database with same CATH topology
4EKUA 1HBKA 2GX9A 3P31A 5JMVA 4JHDB 3CC4N 4A2AA 3MN5A 2V51B 2YI1A 5AQIA 2ZF5O 4BGAA 1ACAA 1BA0A 4JAXA 3CMEN 1H4RA 2I7NA 4H5TA 2P9UA 4GV3A 1DT9A 3A0IX 1GLBG 3AARA 3HZ6A 5BRHA 4WQ4C 2HMPA 1D4XA 4BR5A 2I1KA 3MN9A 1HX1A 3FZHA 4CZGA 5C2DA 3I56N 1YJWN 2V7ZA 4FWMA 4CD1A 2J0KA 3FP5A 1NGEA 4YOVA 3PIPL 5BR9A 3EPYA 1NGAA 1S72N 3CQYA 4BR2A 4CZMA 2A42A 3WA0A 4BQLA 2QWOA 3ZDTA 2P9NA 2CGJA 5AQWA 2HOEA 2CQUA 4YL8A 3KWIA 1E4FT 4B1YB 4DKWA 4HWIA 4YOYA 2D11A 1KAZA 1Y19B 2RE2A 2A40A 3SJHA 4B1UB 2AL6A 2A3ZA 3AAQA 4LC9B 3VGLA 5BN8A 5C15A 4BRHA 3MCAB 1XC3A 2FF3B 3NMUA 2YCHA 4RTFD 3VEYA 1DEJA 3LDQA 2GTDA 5AQYA 5JVLA 2V52B 1J6ZA 3U8ZA 4EHTA 4BRDA 4JNEA 2OTLN 3KHYA 3O9QA 3DXMA 3TSQA 1VQ4N 2Q2RA 4DQ8A 4FOEA 5AQQA 4KBOA 3VPZA 1T6DA 2W40A 4CZKA 4KH4A 4G9ZA 4GV6A 2EMTA 5BN9A 4FPBA 2CGLA 2HRJA 1KXPA 3JXUA 3LDLA 4JKHA 1KBLA 3M1FA 2YJFA 4WQ4A 5AR0A 3R8EA 3UE5A 1QVGM 4EIAA 4A62A 1KAXA 1ST7A 1P90A 4H0OA 3ZX2A 3FGUA 4H03B 4BG8A 1ATRA 4BC3A 5GAHP 4AM7A 3KK7A 2GELA 4BRKA 2E2OA 1HJOA 2ASMA 4BC5A 2P9NB 1T3VA 2ZGYA 4CZLA 1RGIA 3C0BA 3LM2A 1VQON 4H5RA 2H3GX 3MWPA 3WQUA 3CIPA 3MWTA 3BUZB 4A5AA 4C1NK 1J19A 1GLEG 3CCEN 4CZFA 4C23A 3E9PA 3UKUB 2E88A 2P9UB 2E1YA 2J0JA 2DPNA 1MDUB 3EO3A 3T69A 2P9SB 3MDQA 3U7DA 1NBWA 2FSNA 4XH5A 5AQMA 4TKNA 3R9PA 2D0OA 2RQ1A 5BRFA 3CCQN 1KQSM 3FZKA 2ABDA 3IVFA 3SBGA 1NGBA 3H1QA 5E84A 2P9IB 3I33A 4CBWA 4U7BA 1EQYA 3ENOA 5DM7L 3C7NA 3VESA 2D4WA 2QWRA 3UKRB 4QS9A 1SGHA 2D0PA 2OANA 1NWKA 3D2EA 1E5WA 1SS6A 4ISEA 4BY9C 3LL3A 5F1XA 2PBDA 2NZTA 3VENA 1KC7A 2PFUA 1ATNA 2WUSA 1LCUA 3O9UA 4FWLA 4JKEA 3D2FA 3K9JA 2IIRA 3G4SN 4HDOA 5MLCQ 2F7TA 4WQ5A 4CZIA 3CXCM 4FSVA 4PL8A 1VQ7N 4AF1A 3GG4A 4JD2A 3HSCA 3C65A 3N4QA 5H1SQ 3DXKA 2NRWA 5EOYA 2ZPYA 4BVPA 1VBGA 3PLAA 4RWTA 1NGIA 1HKBA 1X3MA 3PZDA 3MX5A 1QZ6A 5EX5A 5AQLA 5AZJB 4J8FA 2WBNA 1V4TA 2NRTA 4H5VA 2AEHA 4O5FA 2ZJQL 1NGGA 4B1VA 4CBXA 3GE1A 1TYQB 3VEWA 2FJ9A 1BWFO 1GLLO 4H0PA 3ULEB 5BRDA 3VMFB 2A41A 4QS8A 1X9JA 1HPMA 4F7GA 3CD6N 1NGDA 4IXCA 2DIKA 2P9LA 3FZFA 3AGRA 1NI2A 3CI5A 4IO8A 3VTHA 2BH1A 3O6WA 3H1VX 3R1XA 4BRNA 4WF9L 4BROA 1O13A 1NVLA 2KHOA 1JCEA 2CGKA 2E2NA 2WFBA 1NGFA 3VETA 5AQFA 5AQNA 5M1KA 1YI2N 3P38A 3KVGA 4BG9A 2QWPA 4R79A 4JKGA 3G25A 3EN9A 4YOUA 1RDWX 1VBHA 1BOTO 4FWQA 5IJMA 4YOTA 5AQSA 1TYQA 4WFNL 1JCFA 1BU6O 5B8HA 5GIPA 3L4QA 2I1JA 2VCPA 3AGKA 4H5NA 3CJCA 5AQOA 3RVCA 4WQ5C 2EMSA 2A6AA 1Q86O 1GG3A 3ATVA 3F9MA 2R82A 4CJ7A 3LDPA 4BRGA 3ENHA 2HF4A 1VQNN 3CJBA 3FZMA 4B1WB 4HDQA 5M1QA 3TTDA 4FO0A 4CZJA 2CH6A 2Q1NA 2HSTA 3RSEA 1NJIO 5FPEA 1LOTB 1MIXA 2ZGZA 1KAYA 5AZJA 5JICA 3WQTA 5JLFA 3E66A 5TKWA 3O1BA 3U4LA 1GGOA 3A5OC 3FZLA 5ADXH 1NMDA 5KPRA 1MA9B 4A5BA 4H0YB 3BEXA 3EE9A 4Y0WA 5F2RA 4ZRJA 3O5BA 3QICA 4YDUC 5GINA 1C0FA 3W0LA 4FVUA 3E1YA 2ZWHA 2CB8A 4PL7A 4GV9A 3X23A 2E2PA 4BQZA 1T6CA 4CI6A 3Q7BA 2FF6A 4H5WA 4U67L 4PHTX 4EHUA 1YHQN 3WXIA 4IO9L 4BRAA 1K73O 3WT0A 3EKSA 5F0XA 3G9WA 2YHWA 3ID8A 4IDHA 3BP8A 2ZJPL 1ISNA 4WCEL 1Q7YO 1VQKN 5EY4A 1KC8O 1GLDG 3CPEA 3TU5A 3I8BA 3M5RA 2J0MA 4JHDA 3VF6A 4NLCA 3ENBA 3M3ZA 5C12A 4YDUA 3HI0A 4ZRKA 2NRRA 1P8ZA 4FWKA 5I9EB 3G71N 1RDUA 1W97L 1ESVA 3CERA 1XQSC 4A61A 1QQNA 4FOIA 2GWKA 1BO5O 3QIJA 2HBJA 4JKDA 3QDKA 3AAPA 1K8AO 1NM1A 4ILJA 2ASOA 4BRLA 1QHAA 4FPAA 3ZYYX 3J7ZO 1TUUA 4B1ZA 3BINA 1VQ8N 2PAVA 3C6HA 3EL2A 1GLFO 4GY2B 4ISFA 3W3DA 3KWGA 2E2QA 1M90O 3C7NB 2QEXN 3IKMA 4IOXA 4FL9A 4DB3A 2P9IA 2Q0UA 4EAHD 2HF3A 1G99A 2QM1A 5JVGL 2HBKA 3R6MA 3ZX3A 3H45C 1N8RO 4XH1A 2JWLA 1SAZA 2QWMA 2RHKA 3U9DA 1VQ9N 2Q0RA 2P9SA 3H3OB 1S3XA 4YOWA 3QFPA 3WXJA 3RSEB 4BR4A 4ZRIA 3JS6A 3D2EB 3GDQA 4BRMA 5BPMA 2AP1A 4JKBA 1NTIA 3M6GA 4AM6A 2QWQA 1NGHA 3CQXA 3O9RA 1ZXOA 2VGNA 3TSUA 3I55N 3S41A 1ILYA 5ELZA 3SBTA 3HTVA 2GEMA 1U2VA 3DXKB 5CHIA 3B8AX 2BUPA 4JD2B 4A59A 5LY3A 3MCPA 4BC4A 1K8KA 4BRCA 1DGKN 3IFRA 4JKAA 1YUWA 4OPHA 3KZBA 1DIKA 2J4RA 3MN7A 3VEOA 5KQDA 2QWNA 4BGBA 2YVCA 5ADXA 2NRZA 2VYPA 2I7PA 4MDAA 3UKRA 4MLEA 3VEVA 1SZ2A 4NB4A 4O8KA 3WXMB 1YITN 1U2VB 3DJCA 3EKUA 3DXMB 5AQJA 5GAEP 3CCUN 1YJNN 4BR9A 4BC2A 3MK6A 4DHYA 1IG8A 1U6ZA 1MIZB 3CCVN 4ILHA 1IJJA 3A5NC 2GWJA 3H46O 2Q36A 3ZETA 3Q7CA 1VQPN 3QBWA 3VERA 1ZC6A 3BF1A 1S22A 1SQKA 3L6QA 1Q81O 2D2QA 5BPLA 5HOOA 2E8AA 1MWMA 4WFBL 2UYTA 5BREA 5AQRA 5M1NA 2LBBA 1ATSA 4CYEA 1K8KB 1Z05A 2P9KB 2QW9A 4IZ9A 1HB6A 4K25A 3TTCA 4JK8A 1YF5L 3OBYA 3P39A 5AQVA 5AQGA 5C2FA 3CCRN 3OW2M 3DWLA 1VQ5N 3HRGA 1QZ5A 4JEPA 3CETA 3D7EO 3CPWM 4CZHA 3AU4A 3GBTA 1YJ9N 4GXBA 3IUCA 4BVOA 5C0YA 2NNWA 4HTLA 1GC6A 2WH5A 3ID6A 3NVMA 3FR0A 5M1FA 3CC7N 3MN6A 5KPZA 3ZETB 3CJ7A 3QB0A 4FWRA 3SMPA 3ZX0A 4IJAA 5JLHA 4PKIA 1K9MO 1VQMN 2D1KA 5CR4A 4GVEA 1EO1A 2JWKA 3DAWA 1E4GT 3VF2A 4IOCL 4BR0A 3OHRA 2NRHA 2YHXA 2D10A 4KH5A 4XH4A 4EFHA 2KLAA 1MK9B 3PVLA 4I6MB 2FSJA 3HOSA 2QTDA 3L4IA 1Z6RA 1WOQA 3ZEUB 3NVKA 2AA4A 4A2BA 4ILGB 1T44A 1YIJN 3CMAN 4M7XA 4PKGA 2A5XA 1BDGA 4IFEA 2HE7A 2BTFA 2IVPA 4H0XB 4MO4A 4NLBA 3SK3A 1NGCA 2FSKA 5AFUA 2X0SA 5KPTA 2COPA 4NY0A 3IDHA 4JN4A 5GAGP 3O9TA 5FPNA 3SLCA 5AQTA 2HBLA 4FWNA 4XEIA 3T7ZA 3WXKA 2E1ZA 3AU5A 4DXAB 3CHWA 3VTIA 2Q31A 4Z94A 3MMVA 1CZAN 5FPMA 3VOVA 3FLCO 3WUHA 1XUPO 1OKJA 1OVYA 4JK7A 2W41A 2P9PB 3P4IA 4H0TB 4CZEA 4F9OA 3SAHA 5EVZA 5GADP 4JKCA 5JVHL 4H0VB 5AQXA 2ITMA 3TSPA 4A57A 3O8MA 5AFUH 3DLLL 5TKYA 1V4SA 5DM6L 3E9LA 4JK9A 3UKUA 3TPQA 1MWKA 4B9QA 1HB8A 1RFQA 3SAFA 4KH6A 5M1OA 4MDBA 4BRFA 3O9SA 5KQ8A 5C10A 2QWLA 5AQKA 2F9WA 3H6EA 3MX2A 3HBTA 2QA4N 3C6AA 3O80A 2E20A 4GNIA 1BUPA 1BA1A 2VWBA 5BPNA 3QMLA 4BRPA 2IVOA 4RCHA 2ZJRL 1GC7A 3IMXA 5CE3A 3A5LC 2FXUA 3GOIA 3QBXA 3VEZA 3L0QA 2QI2A 3O1WA 5FPDA 1DKGD 3OA9A 5AZIA 1Q82O 5M1PA 1JCGA 2HBMA 2P9PA 3LDOA 3OBWA 1NLVA 3FFKB 4K43A 4BRQA 4BRIA 1QVFM 1VQ6N 3J8AA 3LM9A 2P9LB 2YHYA 3CF5L 2NRXA 5GIOA 4B1XB 1X3NA 4K42A 3CCMN 4C1NI 4E1JA 4MLHA 1MK7B 1BG3A 2WC9A 1NGJA 2ASPA 4FWSA 1H1VA 4M7YA 1GLAG 2YX6A 4WYBA 4FWPA 3TTFA 1W2BM 3EE8A 3E9OA 3QFUA 4IEIA 5E26A 1TUYA 4I6MA 4ISGA 2Q97A 1GLJO 3CCJN 4L3QA 2QXLA 1HKGA 3WXLA 3UB5A 3U8XA 3CCSN 3A8YA 1VQLN 2NRVA 1YAGA 3F5TA 3R3LA 4IEEA 5EXWA 3G6EN 1KD1O 2F9TA 2VGMA 5AQHA 3K9KA 5AQZA 4K41A 3O08A 2CH5A 2V7YA 3GL1A 3ULEA 4YOXA 4IJNA 3CCLN 1ZBSA 1YVNA 4WFAL 3A5MC 3D2FB 4MO5A 4FWOA 4QS7A 1QQMA 1JDEA 4PKHA 4O8UA 3O4WA 5AQPA 4BR7A 4OO1J 3CJ9A 1HLUA 1VAZA 2IVNA 4IWVA 4JKFA 4P7IA 2EWSA 1QQOA 1HKCA 3WEEB 4YORA 4CD3A 1JJ2M 3FE1A 3EZWA 4DCHA 2YJEA 3WEEA 4NO7A 4CBUA 3N4PA 2FDQA 1Q18A 1M1KO 5LJVA 1GLCG 3HOTA 1YXQA 5AQUA 5LJWA 3AY9A 5HL7L 5AZIB 2NLXA 2P9KA 2KKZA 3F2KA 4BREA 1WUAA 2OTJN 1Y64A 4UY8O 1HUXA 3FLVA 3BF3A 3CJAA 3VF4A 3D6RA 4M63C 3ZEUA 3SAGA 4JKGB 1R59O 3HM8A 3PIOL 1EF1A 3CC2N 4OPAA 1C0GA 3ATUA 3VEXA 3LDNA 3H3NO 3VGMA 2FLOA 3SMSA 2GUPA 3CJ1A 3VGKA 4IOAL 3U9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKG A;  4JKA A;  3E66 A;  3SBG A;  3ENB A;  3E9O A;  4JK7 A;  4JK8 A;  4JKC A;  4JKB A;  4JKD A;  4ILJ A;  3E9L A;  4JK9 A;  4JKE A;  4ILG B;  3E9P A;  4JKG B;  3SBT A;  4ILH A;  4JKH A;  4JKF A; 
#chains in the Genus database with same CATH topology
 2E6L A;  2YKN A;  2GX9 A;  4JHD B;  1CXU A;  3DRP A;  4FZX C;  1JKH A;  1ACA A;  4FJI A;  1YTU A;  3DLR A;  4CER A;  2P9U A;  4NXM K;  4QAG A;  4YFU A;  4CZG A;  2G8V A;  5C2D A;  3HST B;  4DR5 K;  3PIP L;  5BR9 A;  4LFC K;  4BQL A;  5CZ1 A;  4DUZ K;  3ZDT A;  3T1H K;  5AQW A;  4H8K A;  1E4F T;  4HWI A;  2D11 A;  1J53 A;  1KAZ A;  2PZS A;  1L3T A;  2A40 A;  2AL6 A;  4LC9 B;  3NMU A;  1XC3 A;  2YCH A;  5AQY A;  2V52 B;  2W42 A;  1J6Z A;  4E7L A;  2OTL N;  3KHY A;  1VSF A;  3VPZ A;  4G9Z A;  4GV6 A;  2HRJ A;  1XNQ K;  3JXU A;  5AR0 A;  4WQ4 A;  4EIA A;  4KHP K;  4BG8 A;  4Y1D A;  4I7F A;  4AM7 A;  1HJO A;  2ASM A;  1JLA A;  4C8K A;  1T3V A;  2G8H A;  4CZL A;  4DS4 A;  1VQO N;  3WQU A;  3VQA A;  3LZJ A;  3I0S A;  4CZF A;  3E9P A;  3UKU B;  1FW6 A;  4CGF A;  1N6Q A;  2DPN A;  3EEQ A;  3EO3 A;  3V6D A;  3ZT4 A;  3U7D A;  4XH5 A;  4AQY K;  4PWD A;  4TKN A;  5BRF A;  2RQ1 A;  4RW8 A;  4FM1 A;  3CCQ N;  1KQS M;  1XC9 A;  3SQ4 A;  3SBG A;  1KSP A;  3H1Q A;  1EQY A;  5DM7 L;  4FJG A;  3AV9 A;  2D4W A;  5KGX A;  3VQ6 A;  3OYD A;  1U49 A;  1SGH A;  1NWK A;  1SS6 A;  2B5J A;  3OY9 A;  4CJF A;  2GUI A;  3VEN A;  4O44 A;  2PFU A;  4FJL A;  3ZSV A;  3G4S N;  3L2U A;  1KVB A;  3L8B A;  4CZI A;  4FSV A;  2F4V K;  2ITG A;  4KRE A;  3N4Q A;  3DXK A;  4BVP A;  4B8C A;  4DFJ A;  3MX5 A;  4GKJ K;  1QZ6 A;  3VQD A;  5AZJ B;  5FDL A;  2WBN A;  4JI8 K;  1V4T A;  4H5V A;  4CEE A;  2AEH A;  1ASV A;  1NGG A;  4FJ7 A;  3VEW A;  3V9Z A;  3OYH A;  2A41 A;  4QS8 A;  1U45 A;  5E41 A;  4ZHR A;  1BI4 A;  3P1G A;  5CYQ A;  1NGF A;  5AQN A;  3DLG A;  3G25 A;  3VA3 A;  3EN9 A;  4YOU A;  1BOT O;  2I5J A;  3RMB A;  1JCF A;  4CFC A;  3OYM A;  4H5N A;  1EKE A;  3RVC A;  3L3V A;  1GG3 A;  4BRG A;  5HRN A;  1RBV A;  5HBM A;  3ENH A;  4CGI A;  2HF4 A;  1BIZ A;  3FZM A;  2Y1I A;  4CZJ A;  4FO0 A;  3RMC A;  2CH6 A;  4DTX A;  1NJI O;  1MIX A;  3KLH A;  3WQT A;  1TK5 A;  5J2Q A;  2D0C A;  4A5B A;  4EZ6 A;  4H0Y B;  3O5B A;  4M42 A;  5GIN A;  3E1Y A;  4GV9 A;  3X23 A;  4BQZ A;  2E4L A;  4H5W A;  4U67 L;  1JL2 A;  3TR8 A;  1YHQ N;  4BRA A;  1K73 O;  3TAF A;  4IDH A;  4J2A A;  1ISN A;  1S9G A;  4L8R B;  3TU5 A;  3NGY A;  2J0M A;  1TL1 A;  3M3Z A;  1FK9 A;  2P51 A;  1IBM K;  1RNH A;  4ZRK A;  4FWK A;  1P8Z A;  1RT7 A;  1NJY A;  1W7A A;  4DR6 K;  1ESV A;  3CER A;  1XQS C;  2HMI A;  4FOI A;  1BO5 O;  3QDK A;  4ILJ A;  2ASO A;  1QHA A;  4FPA A;  3ZYY X;  4B1Z A;  3BIN A;  2PAV A;  1GLF O;  4IG3 A;  3PUF A;  4GY2 B;  5DMR A;  2LSN A;  2E2Q A;  3C7N B;  3O3G A;  2QEX N;  4O0J A;  4FL9 A;  4BE0 A;  2A1S A;  3RMA A;  2QM1 A;  3H45 C;  1N8R O;  1SKS A;  4B9N A;  3VQ7 A;  1QSS A;  3H3O B;  1S3X A;  4BR4 A;  3WXJ A;  3RSE B;  2F8T A;  4Z4F A;  3JS6 A;  3D2E B;  1EXQ A;  2O8B B;  2JLE A;  1NTI A;  2QWQ A;  3I55 N;  3ALY A;  5ELZ A;  3SBT A;  3OYE A;  3B8A X;  2BUP A;  4JD2 B;  5LY3 A;  4B9S A;  3E01 A;  4BRC A;  3C94 A;  1HPZ A;  3MN7 A;  4MFB A;  3AVM A;  3VEO A;  2KZM A;  2O8C A;  4MDA A;  5SWM A;  1SZ2 A;  4NCG A;  5HRO A;  1YIT N;  3CCU N;  1U6Z A;  4FK4 A;  1MIZ B;  1EWQ A;  4JYA K;  3H46 O;  2Q36 A;  3QBW A;  4BWJ A;  1ZC6 A;  3F9K A;  1S22 A;  5BPL A;  3SI6 A;  4OKE A;  2UYT A;  4CEZ A;  5M1N A;  3ZSX A;  2LBB A;  3HT3 A;  1Z05 A;  2P9K B;  4K25 A;  3OBY A;  5AQV A;  1BI4 B;  1JLQ A;  2WOM A;  2AJQ A;  3CET A;  3M8P A;  3GBT A;  2G8K A;  4BVO A;  1C6V A;  2NNW A;  4HTL A;  1GC6 A;  4UQG A;  2RF2 A;  5FLX O;  5M1F A;  3SQ1 A;  1N32 K;  1TAU A;  3CC7 N;  4F8R A;  1VRT A;  3SV4 A;  3CJ7 A;  3RTV A;  4FWR A;  2D1K A;  3ZSQ A;  5CR4 A;  2O8D A;  2JWK A;  4Z0U A;  4HUE A;  1E4G T;  3VF2 A;  4IOC L;  4CHO A;  3OHR A;  2YHX A;  1I39 A;  2D10 A;  4C8M A;  4FJH A;  4X66 K;  4EP5 A;  2HHH K;  3NF8 A;  1D9F A;  3PSI A;  3ZSR A;  2IVP A;  2NUB A;  4H0X B;  4FLV A;  2FSK A;  1IG9 A;  1Q9X A;  3K5O A;  2HBL A;  4DSL A;  4CF9 A;  4XEI A;  3PX4 A;  4CIE A;  1CZA N;  3FLC O;  2W41 A;  1OVY A;  3TAR A;  4JK7 A;  2P9P B;  3CFP A;  4IFY A;  1S9E A;  3SPZ A;  4H0V B;  2ITM A;  1KCF A;  5AFU H;  4JK9 A;  1LV5 A;  3UKU A;  5JS1 A;  1HB8 A;  4FK2 A;  1RFQ A;  4MQ3 A;  5M1O A;  4MDB A;  3O9S A;  4FLY A;  3S3O A;  3THW B;  1BUP A;  3B6P A;  1NMN A;  3IRX A;  2HHW A;  1NOZ A;  5CE3 A;  4F3O A;  1QE1 A;  4CHY A;  4DTR A;  3O1W A;  3OA9 A;  4FZZ A;  4JV5 K;  4CIF A;  5D3G A;  1NLV A;  2VWJ A;  1TKZ A;  5J1E A;  4CGJ A;  3KLI A;  2BGG A;  2NRX A;  4K42 A;  3OJS A;  3CCM N;  4O4G A;  4MLH A;  4C8L A;  1T7P A;  1N5Y A;  4CEF A;  4FWS A;  1GLA G;  4IEI A;  5E26 A;  1TUY A;  4DQS A;  3CCS N;  1RBS A;  3A8Y A;  2NRV A;  3NFA A;  4LH5 A;  1VQL N;  5EXW A;  4M3Z A;  3QEV A;  1KRP A;  4N41 A;  3O08 A;  2CH5 A;  4YOX A;  4CJP A;  4IJN A;  1YVN A;  4WFA L;  3D2F B;  4MO5 A;  1QSY A;  3KD5 E;  2HHX A;  3KKR A;  1KLN A;  4BR7 A;  4OO1 J;  1CZ9 A;  4JKF A;  1QQO A;  1HKC A;  3WEE B;  2UUB K;  3LP3 A;  4DCH A;  3DRR A;  4CJQ A;  4DR4 K;  4W5N A;  5LJV A;  3HOT A;  2B4J A;  5AQU A;  5LJW A;  5IWA K;  5AZI B;  3VQP A;  2KKZ A;  3SUQ A;  3T19 A;  4FM2 A;  3FLV A;  3BF3 A;  4M63 C;  3SAG A;  1EF1 A;  4LFA K;  1T03 A;  3LDN A;  3H3N O;  1QTM A;  2FLO A;  4KHQ A;  1QQC A;  3NH1 A;  3W0L A;  4EKU A;  1HBK A;  3P31 A;  3CC4 N;  4A2A A;  3MN5 A;  2V51 B;  3S9H A;  4JAX A;  2I7N A;  4H5T A;  4AHU A;  1DT9 A;  3QIP A;  4JI6 K;  4M3Y A;  4OPK A;  3HZ6 A;  4W5Q A;  3M8Q A;  1D4X A;  4CEQ A;  3FZH A;  3DRS A;  3CM5 A;  4NYF A;  2V7Z A;  1HNX K;  4CD1 A;  1NGE A;  1OH7 A;  3T1Y K;  4BR2 A;  4CZM A;  5I3U A;  4DSJ A;  4CFD A;  4CK3 A;  2CGJ A;  2HOE A;  2CQU A;  4YL8 A;  1KTQ A;  3A2F A;  4DKW A;  3LAN A;  2PYJ A;  1SUQ A;  3CM6 A;  4BDY A;  3LDQ A;  1SL2 A;  2IAJ A;  4BRD A;  3HVR A;  4LF9 K;  4JNE A;  3O9Q A;  2P5G A;  1ZBI A;  2Q2R A;  1HMV A;  4DQ8 A;  4DTP A;  4NYN A;  1T6D A;  2W40 A;  1KFS A;  4CGG A;  3NF9 A;  2CGL A;  3QEP A;  3R8E A;  1KBL A;  1IKW A;  2IGI A;  4DF4 A;  1X9S A;  4A62 A;  1ST7 A;  1P90 A;  4H0O A;  4DV7 K;  1ATR A;  1Z25 A;  1S1T A;  2GEL A;  4BRK A;  4BC5 A;  2XY7 A;  2QKK A;  1WLJ A;  4QOZ B;  1RDC A;  3RMD A;  2H3G X;  3CIP A;  4C1N K;  4AHT A;  2QK9 A;  1GLE G;  3V9X A;  4DTO A;  3CCE N;  3HP9 A;  4C23 A;  4LF6 K;  3S3N A;  3AVK A;  3ZT1 A;  4WE1 A;  2P9U B;  3AVH A;  1Z26 A;  1MDU B;  2P9S B;  3THX B;  4E3S A;  1JLB A;  1NBW A;  2FSN A;  4OKJ A;  4NCB A;  2BAN A;  2UXB K;  1NK7 A;  2ABD A;  3IVF A;  3FFI A;  4CED A;  3AVF A;  5E84 A;  2FC0 A;  2P9I B;  3I33 A;  1HQU A;  4DV3 K;  2Z1J A;  3ENO A;  1HNV A;  4RG8 A;  3OS0 A;  3UKR B;  1WSI A;  2D0P A;  4QS9 A;  4RW9 A;  3D2E A;  1E5W A;  5J2M A;  4IG0 A;  1B92 A;  5F1X A;  2NZT A;  3SPY A;  2WUS A;  4FWL A;  1ATN A;  3O9U A;  2XY8 A;  2F7T A;  4BDZ A;  3GG4 A;  3HSC A;  2NRW A;  2D0B A;  5BR8 K;  2ZPY A;  4CJS A;  4J2E A;  1GOB A;  4RWT A;  1NGI A;  1HKB A;  3PZD A;  3NF7 A;  1DTQ A;  3QIO A;  5AQL A;  4J8F A;  5HP1 A;  4O5F A;  3KD1 E;  2ZJQ L;  3MAQ A;  4CBX A;  1HR0 K;  2FJ9 A;  1BWF O;  3ULE B;  3VMF B;  3G0Z A;  1L5U A;  4KB1 A;  1HPM A;  1WSG A;  4IXC A;  2DIK A;  3O3H A;  2O4I A;  1NI2 A;  1JLF A;  4IO8 A;  4BRN A;  3AO1 A;  3H1V X;  3R1X A;  1SKR A;  2KHO A;  1JCE A;  2CGK A;  3KVG A;  4BG9 A;  2QWP A;  4JKG A;  3KIO A;  1TYQ A;  1MU2 A;  5GIP A;  1LAV A;  3AGK A;  5A2Q O;  1IO2 A;  3SUP A;  4WQ5 C;  2EMS A;  1Q86 O;  3ATV A;  2R82 A;  4GVM A;  5CY4 A;  4CJ7 A;  3KK3 A;  1RBT A;  3OS1 A;  1U4B A;  4NXN K;  3CJB A;  4AH9 A;  4HDQ A;  5M1Q A;  3TTD A;  3QIN A;  2HST A;  4I2P A;  5FPE A;  1FXX A;  5KRT A;  3O1B A;  1GGO A;  4I9L A;  5KPR A;  4FVM A;  5HRS A;  2Z1H A;  1I94 K;  4Y0W A;  1WBB A;  1BIS A;  1YVU A;  4F4K A;  1C0F A;  3DYA A;  2ZWH A;  4PL7 A;  1JLE A;  4FJX A;  3HL8 A;  1T6C A;  3Q7B A;  1LAW A;  4ELV A;  1HNW K;  5T7B A;  1FKO A;  4IO9 L;  3EKS A;  3KLG A;  3BZC A;  4PY5 A;  2RKI A;  2ZJP L;  4FXD A;  3IAY A;  1XNR K;  4ZTF A;  1GLD G;  3CPE A;  1KC8 O;  4DTN A;  3I8B A;  2O4G A;  3M5R A;  4C8N A;  5C12 A;  1S1U A;  4YDU A;  4M45 A;  3G71 N;  5I9E B;  3L2V A;  1VRU A;  1RDU A;  4E7J A;  3HPO A;  1XHX A;  4JRP A;  1A5V A;  2HBJ A;  2G8I A;  3AAP A;  1UAX A;  4DLG A;  4BRL A;  3AA4 A;  4LF7 K;  1VQ8 N;  4CCH A;  3PSF A;  4ISF A;  1JXE A;  3KWG A;  1M90 O;  4CJV A;  4KTQ A;  2P9I A;  3ZT3 A;  1G99 A;  5JVG L;  2HBK A;  2HNY A;  3VQB A;  1ZBL A;  5LL6 Z;  4XH1 A;  3NBP A;  4OKK A;  2QWM A;  3O3F A;  2XY5 A;  2RHK A;  4YOW A;  2P9S A;  3THX A;  4KHW A;  3AVI A;  4ZRI A;  1E3M A;  4M3R A;  4KHU A;  1D9D A;  4JKB A;  1KFD A;  3U3G A;  3TI0 A;  3O9R A;  1ZXO A;  3TSU A;  3S41 A;  4H4O A;  1ILY A;  1DLO A;  3THY B;  2O8F B;  2VG7 A;  1T05 A;  4AHR A;  5CHI A;  3T1A A;  4A59 A;  4FW1 A;  4CIG A;  1K8K A;  5I42 A;  3IFR A;  1CZB A;  3KZB A;  2O8B A;  4DQI A;  4B3R K;  1RTH A;  1TGO A;  3EZ5 A;  1DTT A;  2I7P A;  3ZCM A;  3MXJ A;  2X6S A;  1A5W A;  4JRQ A;  4NB4 A;  4OJR A;  4O8K A;  3IS9 A;  1ZBH A;  1U2V B;  5LMU K;  5AQJ A;  4KV8 A;  5GAE P;  4BR9 A;  4CHZ A;  4DHY A;  3NGI A;  3BZK A;  1TKX A;  4DS5 A;  1IJJ A;  2GWJ A;  2OCE A;  4DQQ A;  3F73 A;  1SQK A;  2VQF K;  2OPS A;  3MEE A;  2D2Q A;  5HOO A;  1ZYQ A;  5AQR A;  3DMJ A;  4FLW A;  4EZ9 A;  4OGE A;  3SQ2 A;  5AQG A;  3CCR N;  1JXB A;  3OW2 M;  1QZ5 A;  3CPW M;  4XIU A;  3HO1 A;  4AHS A;  4CZH A;  3AU4 A;  4GXB A;  2HHT A;  3SCX A;  3ID6 A;  2YNH A;  3OTO K;  4RW6 A;  1U47 A;  4DV5 K;  1IBK K;  4GW6 A;  2KFN A;  3MED A;  5JLH A;  1VQM N;  1BCM A;  2O8F A;  1FKP A;  4E7H A;  4CEB A;  3DAW A;  4BR0 A;  4GMJ B;  4KH5 A;  1IBL K;  2KLA A;  3HOS A;  2QTD A;  4LSL A;  1WOQ A;  3J7Y P;  4DG1 A;  1KVC A;  3QLH A;  3H08 A;  4KKO A;  3CMA N;  4PKG A;  4B3M K;  3M8S A;  1CXQ A;  1NGC A;  1BIU A;  5AFU A;  1L3S A;  4N76 A;  5KPT A;  2COP A;  4E89 A;  4NY0 A;  5GAG P;  3O9T A;  5FPN A;  5AQT A;  4DWI A;  3I8D A;  2E1Z A;  4DXA B;  3VTI A;  5FPM A;  3VOV A;  2HNZ A;  1OKJ A;  2JGU A;  1BL3 A;  4DV4 K;  4CZE A;  4FLX A;  3SAH A;  3QEX A;  3MXM A;  4DUY K;  4A57 A;  4KHS A;  3O8M A;  1V4S A;  1VSD A;  1MWK A;  3O4N A;  5KQ8 A;  4FZY A;  3H6E A;  3LAK A;  4GNI A;  3PO5 A;  2O8E B;  1QSL A;  4BRP A;  4B9U A;  4RCH A;  2ZJR L;  1GC7 A;  3A5L C;  2FXU A;  3GOI A;  3VEZ A;  3L0Q A;  2QI2 A;  5FPD A;  1S1W A;  1DKG D;  1JCG A;  3LDO A;  4BRQ A;  3FFK B;  4K43 A;  1QVF M;  3J8A A;  3LM9 A;  4CJK A;  4N56 A;  2ETJ A;  2P9L B;  4CJ4 A;  4DU1 A;  2G8U A;  2YHY A;  1RDB A;  3NHG A;  3CF5 L;  3VQQ A;  4BE2 A;  1BHL A;  4FYD A;  1VSI A;  4C1N I;  5FRN A;  4FK0 A;  5C42 A;  1MK7 B;  3ZSZ A;  4WYB A;  2YNG A;  3TAN A;  2D5R A;  4E7I A;  1W2B M;  3EE8 A;  3SNN A;  3ZT2 A;  2E5L K;  1WB9 A;  3THW A;  1GLJ O;  3CCJ N;  1N34 K;  4CJL A;  1HKG A;  2QKB A;  3LP2 A;  3F5T A;  3R3L A;  2RPI A;  1KD1 O;  2KFZ A;  4CVN E;  4B9M A;  1S5J A;  3J81 O;  3A5M C;  4FWO A;  3AO2 A;  3SYZ A;  5AQP A;  1NK8 A;  3AVB A;  4YOR A;  4E0D A;  3FE1 A;  1HYS A;  3WEE A;  4NO7 A;  1TAQ A;  2FDQ A;  3LP1 A;  1RT6 A;  3AY9 A;  5HL7 L;  4LFB K;  1HYZ A;  2NLX A;  2X78 A;  4X62 K;  2OTJ N;  3NH0 A;  3PX6 A;  4JS4 A;  3CFO A;  3CJA A;  3VF4 A;  1BGX T;  3K5M A;  4B08 A;  3CC2 N;  1C0G A;  3ATU A;  2O8E A;  4H4M A;  5K14 A;  1SL0 A;  5FRM A;  4M3W A;  2GUP A;  1YT3 A;  4PKH A;  4IOA L;  3ZSW A;  1C1A A;  5JMV A;  5AQI A;  2ZF5 O;  1NK5 A;  4DV0 K;  4DSE A;  2OYQ A;  2FBY A;  1RDA A;  1WN7 A;  3CME N;  1H4R A;  4K8Z A;  3IG1 A;  4GV3 A;  3A0I X;  5BRH A;  4WQ4 C;  3ZSY A;  2I1K A;  3MN9 A;  1HX1 A;  1YJW N;  1RT1 A;  3I56 N;  4FWM A;  4Q0B A;  2J0K A;  3EPY A;  1NGA A;  1S72 N;  4CJR A;  2A42 A;  3WA0 A;  3NAE A;  2QWO A;  2P9N A;  1IH7 A;  3HK2 A;  2O8C B;  1S1X A;  4B1Y B;  1CLQ A;  2RE2 A;  1RTI A;  3SJH A;  4B1U B;  1VQK N;  5C15 A;  3VGL A;  4LF4 K;  2F96 A;  3MCA B;  4F2R A;  3OYC A;  3BY5 A;  3VEY A;  4EHT A;  1IKX A;  3OYB A;  2XHB A;  5AQQ A;  3D0P A;  2EMT A;  5BN9 A;  3K5N A;  4FPB A;  1NJZ A;  4KAZ A;  3LDL A;  4JKH A;  3UE5 A;  1BQM A;  4B9L A;  1QVG M;  2UXD K;  4H03 B;  2GV9 A;  4BC3 A;  5KI6 A;  4M3X A;  1JLG A;  1NK4 A;  2E2O A;  3P83 D;  2ZGY A;  1RGI A;  3C0B A;  2E6M A;  1JLC A;  3MWP A;  3KK2 A;  3MWT A;  3BUZ B;  1OH8 A;  3C95 A;  4HCC A;  1XI1 A;  2OPP A;  4Q5V A;  2E88 A;  2J0J A;  1UOC A;  4PA1 A;  2YKM A;  4KFB A;  3R9P A;  2D0O A;  5J2N A;  4FCY A;  4U7B A;  1A5X A;  3C7N A;  1JL1 A;  3VES A;  2QWR A;  1NK9 A;  4ISE A;  2OAN A;  1R0A A;  4O5B A;  3LL3 A;  2PBD A;  3AO3 A;  3PX0 A;  3L2R A;  4JKE A;  2W6L A;  3K9J A;  4B3O A;  3KLE A;  4HDO A;  4WQ5 A;  4PL8 A;  2ATQ A;  3DI6 A;  1VQ7 N;  2P1J A;  3WNG A;  4DSK A;  3C65 A;  1HJR A;  4Z4H A;  5H1S Q;  5EOY A;  2D0A A;  1UA1 A;  1VBG A;  3THY A;  3PLA A;  2KZZ A;  3BGR A;  4CF8 A;  2NRT A;  3VN5 A;  2PY5 A;  4B1V A;  4PUO A;  3GE1 A;  1TYQ B;  4OX9 K;  4H0P A;  5BRD A;  3OS2 A;  3ULD A;  3QNN A;  1X9J A;  2KQ2 A;  1NGD A;  3VQC A;  1B9F A;  2P9L A;  3AGR A;  4V19 S;  3CI5 A;  3O6W A;  3MEG A;  4K0K K;  1O13 A;  1NVL A;  3HPG A;  4FM0 A;  2IOC A;  1YI2 N;  2E2N A;  2WFB A;  3RWU A;  5AQF A;  3LZI A;  3P38 A;  4CES A;  1RDW X;  1RTJ A;  4YOT A;  5AQS A;  1C1C A;  2I1J A;  4DFM A;  2KTQ A;  1IKY A;  2A6A A;  3F9M A;  3LDP A;  2P5O A;  1I3A A;  1VQN N;  1X1P A;  1K6Y A;  4ZTJ A;  1NNE A;  4Z4C A;  3RSE A;  2HW3 A;  2ZGZ A;  1KAY A;  5AZJ A;  5JLF A;  3E66 A;  3U4L A;  4CJ3 A;  5ADX H;  1MA9 B;  1S6Q A;  3EE9 A;  3VQ4 A;  1UA0 A;  4N5S A;  4ZRJ A;  3QIC A;  3SUN A;  4FVU A;  4PQU A;  3AVG A;  4CI6 A;  2FF6 A;  2HVH A;  3NF6 A;  4PHT X;  4EHU A;  3WXI A;  3K2P A;  4OGC A;  3WT0 A;  3V4I A;  3G9W A;  3SQ0 A;  3P5J A;  4LF8 K;  1W0H A;  3ID8 A;  1O1W A;  4DR2 K;  1SL1 A;  5EY4 A;  4JHD A;  3VF6 A;  4NLC A;  3ENB A;  2UUC K;  3V9W A;  4QCL A;  2NRR A;  1W97 L;  4AHV A;  4A61 A;  1QQN A;  4KI4 A;  1K8A O;  1NM1 A;  2RN2 A;  1LW2 A;  2OZS A;  4K8X A;  3LWL A;  1IKV A;  4JI2 K;  1C0U A;  3CFR A;  4CJT A;  3KKS A;  2Q0U A;  2HF3 A;  2DFE A;  5SZT A;  3J7A P;  4DR7 K;  1LW0 A;  3R6M A;  3LWM A;  1N36 K;  1VQ9 N;  3O4Q A;  1ASW A;  1QHT A;  3NCI A;  1TL3 A;  3GDQ A;  4IDK A;  5BPM A;  4HUF A;  1TKD A;  2ZD1 A;  1ITG A;  1NGH A;  3CQX A;  4IBN A;  4JI1 K;  2GEM A;  1U2V A;  1HNZ K;  4BC4 A;  4JKA A;  4OPH A;  1DIK A;  5KQD A;  1WNS A;  2QWN A;  1J9A A;  2NRZ A;  1NOY A;  3UKR A;  3VEV A;  4MLE A;  4M3U A;  3DLB A;  1RBU A;  2IC3 A;  3WXM B;  3DJC A;  3EKU A;  1YJN N;  1RIL A;  4BC2 A;  4EP4 A;  1IG8 A;  3CCV N;  4ILH A;  3A5N C;  4DV6 K;  3ZET A;  1VQP N;  5J2P A;  3C6T A;  3L6Q A;  3J80 O;  2E8A A;  4IFV A;  5BRE A;  3RR8 A;  4CYE A;  2QW9 A;  4IZ9 A;  1HB6 A;  4BAC A;  3TTC A;  5C2F A;  4JK8 A;  1YF5 L;  3K0S A;  3P39 A;  2R7Y A;  1XHZ A;  2YHA A;  5IT9 O;  3HRG A;  1YJ9 N;  1L3U A;  3IUC A;  2WH5 A;  3KJV A;  1GOA A;  3QEI A;  3ZET B;  3DOK A;  3QB0 A;  1XMQ K;  3SMP A;  3TAM A;  1VSL A;  2YHB A;  4PKI A;  1K9M O;  2VWK A;  4B9T A;  1EWR A;  2NRH A;  1TK8 A;  2FBT A;  1MK9 B;  4EFH A;  4LSN A;  2FSJ A;  3VA0 A;  1BQN A;  3ZEU B;  2AA4 A;  4ILG B;  1T44 A;  1YIJ N;  2A5X A;  1VK0 A;  1BDG A;  2HE7 A;  4MO4 A;  4DR1 K;  1RCH A;  2VQE K;  4FLZ A;  1VSM A;  2HHQ A;  3IDH A;  4DV2 K;  4FJ8 A;  3TWH A;  4CF1 A;  3SLC A;  4FWN A;  3T7Z A;  4DTU A;  4CFB A;  3CHW A;  2Q31 A;  3MMV A;  3WUH A;  3ZLJ A;  4JLH A;  1XMO K;  3DOL A;  5GAD P;  5EVZ A;  5JVH L;  4JKC A;  3T3F A;  3ZT0 A;  5KGW A;  2F8S A;  1HQE A;  1OH6 A;  5TKY A;  3E9L A;  1X9W A;  3NH2 A;  3TPQ A;  4B9Q A;  4BDP A;  1N33 K;  3SAF A;  4KH6 A;  3SUO A;  1RDD A;  5C10 A;  2QWL A;  2F9W A;  3AVA A;  3C6A A;  4Y1C A;  2E20 A;  4JI0 K;  1D5A A;  4CW7 B;  2HHU A;  4CEA A;  2IVO A;  3AO5 A;  4G1Q A;  3IMX A;  3BDP A;  3AVJ A;  3QBX A;  5C24 A;  3WNH A;  4JI5 K;  2IDO A;  3OYL A;  1WSF A;  5AZI A;  3OYI A;  1TK0 A;  1Q82 O;  2HBM A;  2P9P A;  1VQ6 N;  4CF2 A;  4BRI A;  2HND A;  1HNI A;  4AHC A;  1NK0 A;  2X74 A;  4KB0 A;  1TV6 A;  1RT2 A;  1C0M A;  4E1J A;  4CE9 A;  2Y1J A;  1KVA A;  1YTA A;  5FRO A;  1VSH A;  4CK2 A;  2OPQ A;  1H1V A;  4M7Y A;  4FWP A;  3TTF A;  3QFU A;  4ISG A;  3WXL A;  1U04 A;  2VG5 A;  3U8X A;  3UB5 A;  3I0R A;  3NDK A;  3NE6 A;  2VGM A;  5AQH A;  3K9K A;  1EET A;  4K41 A;  5KTQ A;  3CCL N;  1REV A;  1ZBS A;  3AVC A;  4QS7 A;  4YNQ A;  4KHN A;  3O4W A;  3CJ9 A;  4IWV A;  3SZ2 A;  4P7I A;  1UWB A;  4C8O A;  1JJ2 M;  3QNO A;  2YJE A;  3LDS A;  4CBU A;  4FJN A;  3N4P A;  1RT5 A;  3B6O A;  1M1K O;  2P9K A;  4KPY A;  3L2W A;  4BRE A;  4DU4 A;  4NCA A;  3DLK A;  1LWE A;  3PIO L;  3HM8 A;  3RR7 A;  4FLU A;  3VGM A;  3AA2 A;  2BDP A;  3CJ1 A;  3VGK A;  1TKT A;  2YI1 A;  4BGA A;  2BE2 A;  1BA0 A;  3VQ8 A;  2EX3 A;  4B9V A;  1GLB G;  3AAR A;  3S3M A;  4KHY A;  2HMP A;  4BR5 A;  1WSE A;  4YOV A;  3FP5 A;  2XY6 A;  3U3Y A;  3CQY A;  5CZ2 A;  3V9U A;  1NJW A;  1LWC A;  1WAF A;  3VQ9 A;  3KWI A;  4YOY A;  4ICL A;  2DFF A;  1Y19 B;  4W5T A;  2A3Z A;  3AAQ A;  5BN8 A;  4BRH A;  2FF3 B;  4FLT A;  4RTF D;  1DEJ A;  4LF5 K;  1Q9Y A;  2GTD A;  1S1V A;  5JVL A;  3MXI A;  4F2S A;  3U8Z A;  1C1B A;  4Z4E A;  4M3T A;  2HHS A;  1VQ4 N;  3TSQ A;  3DXM A;  2KW4 A;  4FOE A;  4YY3 K;  4KBO A;  4CHN A;  4CZK A;  4KH4 A;  3AVL A;  3VQ5 A;  1KXP A;  4BRF A;  3OYJ A;  3M1F A;  2YJF A;  4N47 A;  1KAX A;  3ZX2 A;  3C6U A;  1ZBU A;  3FGU A;  5GAH P;  1NKC A;  3KK7 A;  1J54 A;  4X64 K;  2HHV A;  2P9N B;  4TSX A;  3RRH A;  2IS3 A;  2W6K A;  2X6N A;  3LM2 A;  3HJF A;  4H5R A;  3U6F A;  3JYT A;  3LPU A;  4A5A A;  1J19 A;  1SKW A;  1FJG K;  1ZBF A;  3QO9 A;  1L3V A;  2E1Y A;  4GKK K;  3T69 A;  3MDQ A;  4DFP A;  5AQM A;  4DSF A;  4O55 A;  4O0I A;  3FZK A;  2EHG A;  4JI3 K;  1NGB A;  4CBW A;  4HCB A;  4E1N A;  3ASM A;  1VHX A;  3ITH A;  1B9D A;  4BY9 C;  1KC7 A;  1LCU A;  3AA3 A;  3UIQ A;  2Z1I A;  3D2F A;  2IIR A;  1EP4 A;  5MLC Q;  3CXC M;  4B8A B;  4DTM A;  4M41 A;  5EU7 A;  4AF1 A;  4JD2 A;  5CYM A;  3HVT A;  5C25 A;  1VSE A;  2GBZ A;  4KTW A;  1U48 A;  1X3M A;  5EX5 A;  3LAL A;  2DTU A;  4CEO A;  3TAQ A;  1WAJ A;  1GLL O;  4HHT A;  1NKE A;  4F7G A;  3CD6 N;  3FZF A;  2WON A;  5AJ3 K;  3VTH A;  2BH1 A;  4WF9 L;  4BRO A;  3LP0 A;  5M1K A;  3VET A;  4CJU A;  4DU3 A;  4R79 A;  3EYZ A;  1VBH A;  4FWQ A;  5IJM A;  4DTS A;  4WFN L;  1BU6 O;  5B8H A;  3L4Q A;  4R5P A;  2VCP A;  4DFK A;  5AQO A;  3CJC A;  2YNI A;  4OLB A;  2OZM A;  3K58 A;  4KRF A;  1HRH A;  4DTJ A;  3OJU A;  3HP6 A;  4ELU A;  4B1W B;  2FBX A;  1S6P A;  2G8W A;  2Q1N A;  1NK6 A;  1LOT B;  2XO7 A;  1EX4 A;  5JS2 A;  4DSI A;  5JIC A;  3CQ8 A;  5TKW A;  1C0T A;  3TAG A;  3A5O C;  3FZL A;  3K59 A;  1T8E A;  1NMD A;  3BEX A;  1RBR A;  5F2R A;  4YDU C;  3DM2 A;  3QEW A;  2CB8 A;  3LAM A;  2E2P A;  4CEC A;  4CGD A;  4I2Q A;  5F0X A;  1QS4 A;  2YHW A;  3V9S A;  3BP8 A;  4DQR A;  4WCE L;  1Q7Y O;  4ID1 A;  4E7K A;  4AIL C;  3EY1 A;  1OH5 A;  1X9M A;  1J5O A;  3CYM A;  4CGH A;  2O8D B;  3HI0 A;  3CG7 A;  1IV0 A;  4RW4 A;  2ZQB A;  3OYF A;  1NU0 A;  3AA5 X;  1KLM A;  2GWK A;  3QIJ A;  4JKD A;  2UU9 K;  4J2B A;  3J7Z O;  1TUU A;  3C6H A;  3EL2 A;  3HXM A;  3W3D A;  4FJ5 A;  3IKM A;  4IOX A;  4DMN A;  4DB3 A;  4EAH D;  3MEC A;  3D45 A;  3ZX3 A;  3TAE A;  1GOC A;  5DK5 A;  2JWL A;  1SAZ A;  3U9D A;  1NJX A;  2Q0R A;  3QFP A;  4YHH K;  3ZSO A;  4LD0 A;  4RW7 A;  4BRM A;  2QXF A;  2AP1 A;  3M6G A;  4AM6 A;  3PV8 A;  2VGN A;  4E1M A;  2VG6 A;  4W5O A;  2PYL A;  3HTV A;  1Q8I A;  2UUA K;  3DXK B;  4DQP A;  3QER A;  3MCP A;  4FJ9 A;  1DGK N;  1J5E K;  4JI4 K;  5KRS A;  1YUW A;  2J4R A;  5HRP A;  4HTU A;  4JS5 A;  4BGB A;  2YVC A;  5ADX A;  2VYP A;  2ZE2 A;  3WNE A;  3NGZ A;  3TAP A;  1WBD A;  3HPH A;  3DXM B;  2XRI A;  3MK6 A;  3SJJ A;  2Z1G A;  4ELT A;  3G10 A;  3Q7C A;  3VER A;  2YV0 X;  3RRG A;  3BF1 A;  4LH4 A;  4DV1 K;  5HRR A;  1Q81 O;  1W9H A;  3HYF A;  1MWM A;  1NKB A;  4WFB L;  4FJM A;  1ATS A;  2HB5 A;  3V1O A;  1K8K B;  4W5R A;  1EO1 A;  1VQ5 N;  4CJ5 A;  3DWL A;  3HM9 A;  4JEP A;  4Z4I A;  3D7E O;  2DFH A;  4IKF A;  1G15 A;  2YNF A;  5LMN K;  4HUG A;  5C0Y A;  1RT3 A;  1VSK A;  3OYK A;  2FBV A;  3AVN A;  3NVM A;  3SV3 A;  1Y97 A;  3FR0 A;  3MN6 A;  5KPZ A;  3K57 A;  3ZX0 A;  3LPT A;  4IJA A;  4DLE A;  2A1R A;  4JI7 K;  3JSM A;  2G8F A;  2WTU A;  4GVE A;  3QET A;  3PY8 A;  4X65 K;  4XH4 A;  3KTQ A;  1VSJ A;  3L3U A;  3PVL A;  4I6M B;  3L4I A;  1Z6R A;  3QES A;  1RTD A;  3NVK A;  4KI6 A;  4J2D A;  4A2B A;  4M7X A;  4IFE A;  2BTF A;  3SK3 A;  4NLB A;  3OYA A;  4B3S K;  3DLE A;  3THV A;  2X0S A;  1XWL A;  4JN4 A;  2OPR A;  2B6A A;  1SV5 A;  3WXK A;  3AU5 A;  1RT4 A;  3TAB A;  3AO4 A;  4Z94 A;  1XUP O;  4CFA A;  3V81 A;  4KO0 A;  3JAM O;  4ID5 A;  3P4I A;  4H0T B;  4F9O A;  4I9Q A;  5AQX A;  3TSP A;  1D8Y A;  3OYN A;  3DLL L;  5DM6 L;  3M8R A;  4HVJ A;  3OYG A;  4DR3 K;  5AQK A;  1BCO A;  3MX2 A;  3HBT A;  2QA4 N;  3O80 A;  4FW2 A;  3KK1 A;  2ZM6 K;  2UXC K;  4CJE A;  1BA1 A;  3DLH A;  2VWB A;  4E19 A;  5BPN A;  3QML A;  1HYV A;  4KTZ A;  4DF8 A;  4OLA A;  4CHP A;  1WSH A;  4CHQ A;  5M1P A;  3OBW A;  2Q3S A;  4CF0 A;  5HLF A;  4OPJ A;  5GIO A;  4B1X B;  1X3N A;  4BWM A;  3WNF A;  1F21 A;  1NG9 A;  4CK1 A;  1BG3 A;  2WC9 A;  1NGJ A;  2ASP A;  2YX6 A;  3V1Q A;  3K5L A;  3E9O A;  1OVQ A;  4I6M A;  2Q97 A;  4Z4G A;  4L3Q A;  2QXL A;  1LWF A;  4LY7 A;  1ASU A;  1YAG A;  4IEE A;  3G6E N;  2F9T A;  5AQZ A;  2V7Y A;  3GL1 A;  3ULE A;  2HVI A;  1QQM A;  1JDE A;  4O8U A;  4B3T K;  1WSJ A;  1HLU A;  1VAZ A;  2IVN A;  4FJK A;  4OVL A;  2EWS A;  3VQE A;  4CD3 A;  4CJW A;  3V1R A;  3EZW A;  2OA8 A;  3ISN C;  1Q18 A;  1GLC G;  1YXQ A;  3KLF A;  4BE1 A;  1TVR A;  2DY4 A;  3F2K A;  1WUA A;  1Y64 A;  4UY8 O;  1HUX A;  4FJJ A;  4F3T A;  3PO4 A;  3D6R A;  3ZEU A;  4JKG B;  1R59 O;  3L2Q A;  4OPA A;  3VEX A;  3OVN A;  3SMS A;  3U9Z A; 
#chains in the Genus database with same CATH homology
 4EKU A;  1HBK A;  2GX9 A;  3P31 A;  5JMV A;  4JHD B;  3CC4 N;  4A2A A;  3MN5 A;  2V51 B;  2YI1 A;  5AQI A;  2ZF5 O;  4BGA A;  1ACA A;  1BA0 A;  4JAX A;  3CME N;  1H4R A;  2I7N A;  4H5T A;  2P9U A;  4GV3 A;  1DT9 A;  3A0I X;  1GLB G;  3AAR A;  3HZ6 A;  5BRH A;  4WQ4 C;  2HMP A;  1D4X A;  4BR5 A;  2I1K A;  3MN9 A;  1HX1 A;  3FZH A;  4CZG A;  5C2D A;  3I56 N;  1YJW N;  2V7Z A;  4FWM A;  4CD1 A;  2J0K A;  3FP5 A;  1NGE A;  4YOV A;  3PIP L;  5BR9 A;  3EPY A;  1NGA A;  1S72 N;  3CQY A;  4BR2 A;  4CZM A;  2A42 A;  3WA0 A;  4BQL A;  2QWO A;  3ZDT A;  2P9N A;  2CGJ A;  5AQW A;  2HOE A;  2CQU A;  4YL8 A;  3KWI A;  1E4F T;  4B1Y B;  4DKW A;  4HWI A;  4YOY A;  2D11 A;  1KAZ A;  1Y19 B;  2RE2 A;  2A40 A;  3SJH A;  4B1U B;  2AL6 A;  2A3Z A;  3AAQ A;  4LC9 B;  3VGL A;  5BN8 A;  5C15 A;  4BRH A;  3MCA B;  1XC3 A;  2FF3 B;  3NMU A;  2YCH A;  4RTF D;  3VEY A;  1DEJ A;  3LDQ A;  2GTD A;  5AQY A;  5JVL A;  2V52 B;  1J6Z A;  3U8Z A;  4EHT A;  4BRD A;  4JNE A;  2OTL N;  3KHY A;  3O9Q A;  3DXM A;  3TSQ A;  1VQ4 N;  2Q2R A;  4DQ8 A;  4FOE A;  5AQQ A;  4KBO A;  3VPZ A;  1T6D A;  2W40 A;  4CZK A;  4KH4 A;  4G9Z A;  4GV6 A;  2EMT A;  5BN9 A;  4FPB A;  2CGL A;  2HRJ A;  1KXP A;  3JXU A;  3LDL A;  4JKH A;  1KBL A;  3M1F A;  2YJF A;  4WQ4 A;  5AR0 A;  3R8E A;  3UE5 A;  1QVG M;  4EIA A;  4A62 A;  1KAX A;  1ST7 A;  1P90 A;  4H0O A;  3ZX2 A;  3FGU A;  4H03 B;  4BG8 A;  1ATR A;  4BC3 A;  5GAH P;  4AM7 A;  3KK7 A;  2GEL A;  4BRK A;  2E2O A;  1HJO A;  2ASM A;  4BC5 A;  2P9N B;  1T3V A;  2ZGY A;  4CZL A;  1RGI A;  3C0B A;  3LM2 A;  1VQO N;  4H5R A;  2H3G X;  3MWP A;  3WQU A;  3CIP A;  3MWT A;  3BUZ B;  4A5A A;  4C1N K;  1J19 A;  1GLE G;  3CCE N;  4CZF A;  4C23 A;  3E9P A;  3UKU B;  2E88 A;  2P9U B;  2E1Y A;  2J0J A;  2DPN A;  1MDU B;  3EO3 A;  3T69 A;  2P9S B;  3MDQ A;  3U7D A;  1NBW A;  2FSN A;  4XH5 A;  5AQM A;  4TKN A;  3R9P A;  2D0O A;  2RQ1 A;  5BRF A;  3CCQ N;  1KQS M;  3FZK A;  2ABD A;  3IVF A;  3SBG A;  1NGB A;  3H1Q A;  5E84 A;  2P9I B;  3I33 A;  4CBW A;  4U7B A;  1EQY A;  3ENO A;  5DM7 L;  3C7N A;  3VES A;  2D4W A;  2QWR A;  3UKR B;  4QS9 A;  1SGH A;  2D0P A;  2OAN A;  1NWK A;  3D2E A;  1E5W A;  1SS6 A;  4ISE A;  4BY9 C;  3LL3 A;  5F1X A;  2PBD A;  2NZT A;  3VEN A;  1KC7 A;  2PFU A;  1ATN A;  2WUS A;  1LCU A;  3O9U A;  4FWL A;  4JKE A;  3D2F A;  3K9J A;  2IIR A;  3G4S N;  4HDO A;  5MLC Q;  2F7T A;  4WQ5 A;  4CZI A;  3CXC M;  4FSV A;  4PL8 A;  1VQ7 N;  4AF1 A;  3GG4 A;  4JD2 A;  3HSC A;  3C65 A;  3N4Q A;  5H1S Q;  3DXK A;  2NRW A;  5EOY A;  2ZPY A;  4BVP A;  1VBG A;  3PLA A;  4RWT A;  1NGI A;  1HKB A;  1X3M A;  3PZD A;  3MX5 A;  1QZ6 A;  5EX5 A;  5AQL A;  5AZJ B;  4J8F A;  2WBN A;  1V4T A;  2NRT A;  4H5V A;  2AEH A;  4O5F A;  2ZJQ L;  1NGG A;  4B1V A;  4CBX A;  3GE1 A;  1TYQ B;  3VEW A;  2FJ9 A;  1BWF O;  1GLL O;  4H0P A;  3ULE B;  5BRD A;  3VMF B;  2A41 A;  4QS8 A;  1X9J A;  1HPM A;  4F7G A;  3CD6 N;  1NGD A;  4IXC A;  2DIK A;  2P9L A;  3FZF A;  3AGR A;  1NI2 A;  3CI5 A;  4IO8 A;  3VTH A;  2BH1 A;  3O6W A;  3H1V X;  3R1X A;  4BRN A;  4WF9 L;  4BRO A;  1O13 A;  1NVL A;  2KHO A;  1JCE A;  2CGK A;  2E2N A;  2WFB A;  1NGF A;  3VET A;  5AQF A;  5AQN A;  5M1K A;  1YI2 N;  3P38 A;  3KVG A;  4BG9 A;  2QWP A;  4R79 A;  4JKG A;  3G25 A;  3EN9 A;  4YOU A;  1RDW X;  1VBH A;  1BOT O;  4FWQ A;  5IJM A;  4YOT A;  5AQS A;  1TYQ A;  4WFN L;  1JCF A;  1BU6 O;  5B8H A;  5GIP A;  3L4Q A;  2I1J A;  2VCP A;  3AGK A;  4H5N A;  3CJC A;  5AQO A;  3RVC A;  4WQ5 C;  2EMS A;  2A6A A;  1Q86 O;  1GG3 A;  3ATV A;  3F9M A;  2R82 A;  4CJ7 A;  3LDP A;  4BRG A;  3ENH A;  2HF4 A;  1VQN N;  3CJB A;  3FZM A;  4B1W B;  4HDQ A;  5M1Q A;  3TTD A;  4FO0 A;  4CZJ A;  2CH6 A;  2Q1N A;  2HST A;  3RSE A;  1NJI O;  5FPE A;  1LOT B;  1MIX A;  2ZGZ A;  1KAY A;  5AZJ A;  5JIC A;  3WQT A;  5JLF A;  3E66 A;  5TKW A;  3O1B A;  3U4L A;  1GGO A;  3A5O C;  3FZL A;  5ADX H;  1NMD A;  5KPR A;  1MA9 B;  4A5B A;  4H0Y B;  3BEX A;  3EE9 A;  4Y0W A;  5F2R A;  4ZRJ A;  3O5B A;  3QIC A;  4YDU C;  5GIN A;  1C0F A;  3W0L A;  4FVU A;  3E1Y A;  2ZWH A;  2CB8 A;  4PL7 A;  4GV9 A;  3X23 A;  2E2P A;  4BQZ A;  1T6C A;  4CI6 A;  3Q7B A;  2FF6 A;  4H5W A;  4U67 L;  4PHT X;  4EHU A;  1YHQ N;  3WXI A;  4IO9 L;  4BRA A;  1K73 O;  3WT0 A;  3EKS A;  5F0X A;  3G9W A;  2YHW A;  3ID8 A;  4IDH A;  3BP8 A;  2ZJP L;  1ISN A;  4WCE L;  1Q7Y O;  1VQK N;  5EY4 A;  1KC8 O;  1GLD G;  3CPE A;  3TU5 A;  3I8B A;  3M5R A;  2J0M A;  4JHD A;  3VF6 A;  4NLC A;  3ENB A;  3M3Z A;  5C12 A;  4YDU A;  3HI0 A;  4ZRK A;  2NRR A;  1P8Z A;  4FWK A;  5I9E B;  3G71 N;  1RDU A;  1W97 L;  1ESV A;  3CER A;  1XQS C;  4A61 A;  1QQN A;  4FOI A;  2GWK A;  1BO5 O;  3QIJ A;  2HBJ A;  4JKD A;  3QDK A;  3AAP A;  1K8A O;  1NM1 A;  4ILJ A;  2ASO A;  4BRL A;  1QHA A;  4FPA A;  3ZYY X;  3J7Z O;  1TUU A;  4B1Z A;  3BIN A;  1VQ8 N;  2PAV A;  3C6H A;  3EL2 A;  1GLF O;  4GY2 B;  4ISF A;  3W3D A;  3KWG A;  2E2Q A;  1M90 O;  3C7N B;  2QEX N;  3IKM A;  4IOX A;  4FL9 A;  4DB3 A;  2P9I A;  2Q0U A;  4EAH D;  2HF3 A;  1G99 A;  2QM1 A;  5JVG L;  2HBK A;  3R6M A;  3ZX3 A;  3H45 C;  1N8R O;  4XH1 A;  2JWL A;  1SAZ A;  2QWM A;  2RHK A;  3U9D A;  1VQ9 N;  2Q0R A;  2P9S A;  3H3O B;  1S3X A;  4YOW A;  3QFP A;  3WXJ A;  3RSE B;  4BR4 A;  4ZRI A;  3JS6 A;  3D2E B;  3GDQ A;  4BRM A;  5BPM A;  2AP1 A;  4JKB A;  1NTI A;  3M6G A;  4AM6 A;  2QWQ A;  1NGH A;  3CQX A;  3O9R A;  1ZXO A;  2VGN A;  3TSU A;  3I55 N;  3S41 A;  1ILY A;  5ELZ A;  3SBT A;  3HTV A;  2GEM A;  1U2V A;  3DXK B;  5CHI A;  3B8A X;  2BUP A;  4JD2 B;  4A59 A;  5LY3 A;  3MCP A;  4BC4 A;  1K8K A;  4BRC A;  1DGK N;  3IFR A;  4JKA A;  1YUW A;  4OPH A;  3KZB A;  1DIK A;  2J4R A;  3MN7 A;  3VEO A;  5KQD A;  2QWN A;  4BGB A;  2YVC A;  5ADX A;  2NRZ A;  2VYP A;  2I7P A;  4MDA A;  3UKR A;  4MLE A;  3VEV A;  1SZ2 A;  4NB4 A;  4O8K A;  3WXM B;  1YIT N;  1U2V B;  3DJC A;  3EKU A;  3DXM B;  5AQJ A;  5GAE P;  3CCU N;  1YJN N;  4BR9 A;  4BC2 A;  3MK6 A;  4DHY A;  1IG8 A;  1U6Z A;  1MIZ B;  3CCV N;  4ILH A;  1IJJ A;  3A5N C;  2GWJ A;  3H46 O;  2Q36 A;  3ZET A;  3Q7C A;  1VQP N;  3QBW A;  3VER A;  1ZC6 A;  3BF1 A;  1S22 A;  1SQK A;  3L6Q A;  1Q81 O;  2D2Q A;  5BPL A;  5HOO A;  2E8A A;  1MWM A;  4WFB L;  2UYT A;  5BRE A;  5AQR A;  5M1N A;  2LBB A;  1ATS A;  4CYE A;  1K8K B;  1Z05 A;  2P9K B;  2QW9 A;  4IZ9 A;  1HB6 A;  4K25 A;  3TTC A;  4JK8 A;  1YF5 L;  3OBY A;  3P39 A;  5AQV A;  5AQG A;  5C2F A;  3CCR N;  3OW2 M;  3DWL A;  1VQ5 N;  3HRG A;  1QZ5 A;  4JEP A;  3CET A;  3D7E O;  3CPW M;  4CZH A;  3AU4 A;  3GBT A;  1YJ9 N;  4GXB A;  3IUC A;  4BVO A;  5C0Y A;  2NNW A;  4HTL A;  1GC6 A;  2WH5 A;  3ID6 A;  3NVM A;  3FR0 A;  5M1F A;  3CC7 N;  3MN6 A;  5KPZ A;  3ZET B;  3CJ7 A;  3QB0 A;  4FWR A;  3SMP A;  3ZX0 A;  4IJA A;  5JLH A;  4PKI A;  1K9M O;  1VQM N;  2D1K A;  5CR4 A;  4GVE A;  1EO1 A;  2JWK A;  3DAW A;  1E4G T;  3VF2 A;  4IOC L;  4BR0 A;  3OHR A;  2NRH A;  2YHX A;  2D10 A;  4KH5 A;  4XH4 A;  4EFH A;  2KLA A;  1MK9 B;  3PVL A;  4I6M B;  2FSJ A;  3HOS A;  2QTD A;  3L4I A;  1Z6R A;  1WOQ A;  3ZEU B;  3NVK A;  2AA4 A;  4A2B A;  4ILG B;  1T44 A;  1YIJ N;  3CMA N;  4M7X A;  4PKG A;  2A5X A;  1BDG A;  4IFE A;  2HE7 A;  2BTF A;  2IVP A;  4H0X B;  4MO4 A;  4NLB A;  3SK3 A;  1NGC A;  2FSK A;  5AFU A;  2X0S A;  5KPT A;  2COP A;  4NY0 A;  3IDH A;  4JN4 A;  5GAG P;  3O9T A;  5FPN A;  3SLC A;  5AQT A;  2HBL A;  4FWN A;  4XEI A;  3T7Z A;  3WXK A;  2E1Z A;  3AU5 A;  4DXA B;  3CHW A;  3VTI A;  2Q31 A;  4Z94 A;  3MMV A;  1CZA N;  5FPM A;  3VOV A;  3FLC O;  3WUH A;  1XUP O;  1OKJ A;  1OVY A;  4JK7 A;  2W41 A;  2P9P B;  3P4I A;  4H0T B;  4CZE A;  4F9O A;  3SAH A;  5EVZ A;  5GAD P;  4JKC A;  5JVH L;  4H0V B;  5AQX A;  2ITM A;  3TSP A;  4A57 A;  3O8M A;  5AFU H;  3DLL L;  5TKY A;  1V4S A;  5DM6 L;  3E9L A;  4JK9 A;  3UKU A;  3TPQ A;  1MWK A;  4B9Q A;  1HB8 A;  1RFQ A;  3SAF A;  4KH6 A;  5M1O A;  4MDB A;  4BRF A;  3O9S A;  5KQ8 A;  5C10 A;  2QWL A;  5AQK A;  2F9W A;  3H6E A;  3MX2 A;  3HBT A;  2QA4 N;  3C6A A;  3O80 A;  2E20 A;  4GNI A;  1BUP A;  1BA1 A;  2VWB A;  5BPN A;  3QML A;  4BRP A;  2IVO A;  4RCH A;  2ZJR L;  1GC7 A;  3IMX A;  5CE3 A;  3A5L C;  2FXU A;  3GOI A;  3QBX A;  3VEZ A;  3L0Q A;  2QI2 A;  3O1W A;  5FPD A;  1DKG D;  3OA9 A;  5AZI A;  1Q82 O;  5M1P A;  1JCG A;  2HBM A;  2P9P A;  3LDO A;  3OBW A;  1NLV A;  3FFK B;  4K43 A;  4BRQ A;  4BRI A;  1QVF M;  1VQ6 N;  3J8A A;  3LM9 A;  2P9L B;  2YHY A;  3CF5 L;  2NRX A;  5GIO A;  4B1X B;  1X3N A;  4K42 A;  3CCM N;  4C1N I;  4E1J A;  4MLH A;  1MK7 B;  1BG3 A;  2WC9 A;  1NGJ A;  2ASP A;  4FWS A;  1H1V A;  4M7Y A;  1GLA G;  2YX6 A;  4WYB A;  4FWP A;  3TTF A;  1W2B M;  3EE8 A;  3E9O A;  3QFU A;  4IEI A;  5E26 A;  1TUY A;  4I6M A;  4ISG A;  2Q97 A;  1GLJ O;  3CCJ N;  4L3Q A;  2QXL A;  1HKG A;  3WXL A;  3UB5 A;  3U8X A;  3CCS N;  3A8Y A;  1VQL N;  2NRV A;  1YAG A;  3F5T A;  3R3L A;  4IEE A;  5EXW A;  3G6E N;  1KD1 O;  2F9T A;  2VGM A;  5AQH A;  3K9K A;  5AQZ A;  4K41 A;  3O08 A;  2CH5 A;  2V7Y A;  3GL1 A;  3ULE A;  4YOX A;  4IJN A;  3CCL N;  1ZBS A;  1YVN A;  4WFA L;  3A5M C;  3D2F B;  4MO5 A;  4FWO A;  4QS7 A;  1QQM A;  1JDE A;  4PKH A;  4O8U A;  3O4W A;  5AQP A;  4BR7 A;  4OO1 J;  3CJ9 A;  1HLU A;  1VAZ A;  2IVN A;  4IWV A;  4JKF A;  4P7I A;  2EWS A;  1QQO A;  1HKC A;  3WEE B;  4YOR A;  4CD3 A;  1JJ2 M;  3FE1 A;  3EZW A;  4DCH A;  2YJE A;  3WEE A;  4NO7 A;  4CBU A;  3N4P A;  2FDQ A;  1Q18 A;  1M1K O;  5LJV A;  1GLC G;  3HOT A;  1YXQ A;  5AQU A;  5LJW A;  3AY9 A;  5HL7 L;  5AZI B;  2NLX A;  2P9K A;  2KKZ A;  3F2K A;  4BRE A;  1WUA A;  2OTJ N;  1Y64 A;  4UY8 O;  1HUX A;  3FLV A;  3BF3 A;  3CJA A;  3VF4 A;  3D6R A;  4M63 C;  3ZEU A;  3SAG A;  4JKG B;  1R59 O;  3HM8 A;  3PIO L;  1EF1 A;  3CC2 N;  4OPA A;  1C0G A;  3ATU A;  3VEX A;  3LDN A;  3H3N O;  3VGM A;  2FLO A;  3SMS A;  2GUP A;  3CJ1 A;  3VGK A;  4IOA L;  3U9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...