1SGHA

Moesin ferm domain bound to ebp50 c-terminal peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Moesin
total genus 71
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1sghA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1sghA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1sghA01
3AU5A 3N7CA 5E6PA 5GMVA 2NBUA 2GBNA 2DYOA 3ZRCA 4IW0A 2KDBA 5D3VA 4W9HA 3UQBA 3NHEB 4LJPB 2D3GA 4OVUA 4DHJD 4HDQA 3VQIA 2DKQA 3X23A 3B1LX 5J2RA 2MBQA 3QQ8B 4CHKA 3FLVA 2JXXA 2K39A 3PGEA 1EAZA 4PYUA 1UEFA 1MIXA 4F7HA 4WJPA 3V60A 2MBOA 3WANA 4HWIB 1JRUA 2LVOA 2OTXA 2HJ8A 2O2VB 4HK2A 3HIZA 4W9JA 2CQUA 1XX0A 3M1IB 4I6PA 2XQNM 3VH4B 2IO3B 4IG7B 2C7HA 2LWPA 3KSYA 2N1VA 2RLOA 2JT4B 4AUQC 2CRFA 4WVFB 2BKRB 4DHZE 1IYFA 4ANVA 2CAYA 4NNJB 1RRBA 1MAIA 4WWPA 1UNPA 2KTFA 1I2HA 4TYZA 1K5GB 4DX8A 4NQKE 2VSZA 4W9GA 3TBLD 4BKSA 2ZVNA 4ANXA 4I6LB 4E74A 4HDOA 1S1QB 4JGHB 3VFKA 4JLCA 3ONSA 4M8MA 1M7RA 1UGMA 1NTIA 2XK5A 2P0DA 1Y19B 3LJUX 4EUTA 3SYXA 2LVQA 5IA7A 3WYFB 3QCAA 4GXBA 3EC8A 3SDLC 1EF1A 2HE7A 2XEWA 1XODA 4K2PA 4NJ6A 1P1AA 5EFXA 2H7EA 4GZUA 1XD3B 3RCZA 3ALBA 3WAMA 4IC7B 1KZGA 4A6HA 3P2BA 5L83A 5G55A 2ZPYA 3DDCB 2M17A 5D94A 1WMHB 1PFJA 3VHTC 2DHZA 3EPYA 5FI0A 3B08A 2LGYA 4K7UA 4KDLB 5CHFA 3DXCA 5AZFA 2BCJA 3M63B 2DHJA 3N32A 3QWZB 3T06A 2NR2A 1ZM0A 1ZSQA 1GUAB 1IRSA 2L3ZA 2MRPA 3DQVA 1UBIA 1I7AA 2IZVB 2N1WA 3QARA 4NY0A 5D27A 3ZUNA 4HB4B 1TQZA 2OQBA 1RFAA 1E8ZA 2J0MA 1OTRB 4B6HA 2CODA 3FM8C 2Z0DB 4NJ7A 2DHKA 2J59M 2KKCA 3UF8A 4HXDA 2D11A 2KMAA 4GU2A 2BYEA 3ZNHB 2LYDA 2DTCA 1H8CA 2W2XD 4Y94A 1QZEA 1E7UA 3ZO5B 4F1SA 4WJQA 4MJSA 3TCAA 4F8CB 2LXCA 3CSFA 3ZDMC 2NVUI 4BBNC 4FULA 1V9JA 1LXDA 1XD4A 3TFMA 2L7RA 1U5DA 2M0XA 2N7EA 3PSEB 3R3MA 1SHCA 4IUMB 2DYQA 1T0YA 4ZYNA 2DA0A 3R7QA 4LCDE 2B3AA 5DPSA 2KLCA 3IBEA 4EEWA 2KDIA 1Q67A 2CHXA 3ZVRA 2M4NA 5DIFB 1PQSA 3I3TB 3DXDA 3M62B 3ML8A 1AARA 2KX0A 3SU8X 4AJYB 4EFOA 1W1DA 3HW2B 4A6FA 4ZRJA 2Y8FA 5FR6A 2YS5A 1WJNA 3IFWB 1C1YB 3IHPC 3D32A 3JVZX 2LASA 2KWUB 3WA0A 3A9JB 4LDTD 1MKEA 2GJYA 2D9VA 2X18A 1WJ4A 2CU1A 4DK5A 2IO0B 3H7SA 3M95A 4ZRIA 2LUEA 2COCA 2YSZA 3PSCA 1E8WA 4IFSA 2BYFA 2ZCCA 3EHVA 4ANUA 4BFRA 5HE2A 4N9F4 3HHMA 2I1KA 2DKPA 3PV1A 2MX2A 2D10A 3KW5B 4KIKA 1V89A 5J3TA 1V61A 4PS3A 5EDSA 4HAVB 2NBWB 1Y5OA 2W2WA 1V5OA 2KTRA 2V4LA 2NPTB 5LXIB 2RGFA 1E8YA 3K9PB 3WIMA 4HB2B 5CX3A 4MY6A 5DCNA 5LXHA 4A6FB 2WX0A 2YS3A 2HTHA 4K81A 1V5TA 2BF8B 2Z0EB 1UNRA 3QHTA 1R4MI 5C5BB 2RUKB 2BGFA 2O2VA 3OAWA 5KQ1A 3L10B 2ELBA 3PEGA 2JRIB 4FHJA 1WFYA 3L13A 1BT0A 1WF9A 4FJYA 2K6DB 2YF0A 3VUYA 3APDA 2Z0PA 4FJVB 5DH9B 2YLMA 4A3PA 2GMIC 3WALA 5C23A 5J17A 4W9LA 2G4SA 1B55A 3PRMB 1U2BA 4MGKE 4KHOA 4W9IA 3RCPA 2DX5A 3A33B 2BPSA 2I5FA 2J0KA 2LG1A 4GDLB 1QC6A 2JRHA 4GDKA 4KIKB 1OQNA 1Y8RC 3H1UA 3MJWA 4MGZE 1N3HA 1WX8A 2MBEA 5LLIA 3GOEA 2V76A 2RPQA 4TUUA 4PNKA 1F9JA 3KUDB 4JIOU 4L6EA 2IYDB 3TIXA 2P8VA 3EFUA 3NY5A 2G4DB 2D9WA 1E7VA 1YJ1A 4HCNB 5DPRA 2MWSB 3MTNB 4IWQA 3RUIB 3UQAA 2L05A 2KGXB 3PVUA 5D3YA 5L81A 3PRZA 3QBVB 4G3XB 1V49A 2JF5A 1V81A 4EJNA 1WJUA 1R4NI 1WIAA 1UH6A 2DAFA 2QKMA 1UNQA 2JPHA 2KWCA 3VVWB 2FNJB 2KLGA 3ULBA 1J0GA 2XK5B 5GOWB 4Z2MB 2L1CA 4D0NB 2DZJA 1Q0WB 2DX5B 3OLMD 1EGXA 1WXVA 2ZJDA 4GDLA 4M0WB 3OANA 5HKHA 2A5UA 3GZNI 3PP2A 4F7ZA 1WY8A 2JP2A 1TXDA 3EECA 1J0WA 3VOQA 2K25A 4NPNA 4ASWC 2FIDA 1OQYA 3PTFC 4HLEA 3U8ZA 1FGZA 3OJ3A 3ZNGC 4GMXB 2KOXA 4MM3A 3QIJA 3UINB 4NAWB 2EKEC 1WI0A 2ELAA 3MHSD 3AXCA 3N3KB 4KSLC 1ZVRA 2FCQA 3V5WA 2N9XA 4HPLB 5JHBA 2GS0A 3ULCA 2ASQA 1FGYA 2VRWB 4DDGD 4HAWB 1DDWA 3VIAA 2IO1B 1WYWB 4WWOA 2KC2A 3H7PB 3H9DA 4A6KA 4GOCA 2K2JA 5HE3A 3A9KA 4K7WA 3DBSA 4IM3A 3RZFA 4JQWC 2R2OA 3BINA 1U5EA 2NCNA 3T9LA 2R2QA 1W1HA 3DCGA 3ZDTA 2L00B 3KUZA 4KZCA 3NZSA 2LGDA 3AI5A 2LKOA 4MT7A 4W9DA 2KJRA 2C9WB 2MP2A 1AQCA 2QHOA 3WAPA 4CO7A 1E5WA 1HE8A 1E8XA 4DDID 3VTWA 4FADA 5LOPB 3JW0X 3DVNV 2KC1A 3KYDD 1KLVA 1MPHA 1K8RB 2AYOB 3VH3B 4K17A 4DXAB 2NPTA 1BTKA 2CY4A 3CXBB 3NZUA 1MG8A 2IY0B 5JH5C 5JHGA 5KHQA 4MK0A 2H7DA 2RD0A 3PPAA 4HVBA 1P6SA 2MSED 2HTHB 2JZ3B 4EZKA 2FJLA 2WYQA 3X0WA 3ZW3A 3DVNU 3PG7A 4H8SA 1P5TA 1OY2A 1U4AA 1WZ0A 5L95C 1LW3A 2KWVB 5DHFB 3PZDA 5FI1A 3VXWA 2RQ1A 2Y7BA 2JWZA 3A98B 2KFKB 4II3B 2MCNB 5J18A 3DVGY 5CTRC 3DXEA 3F5RA 1U5FA 1WJMA 1ZKHA 3R66C 4FLHA 5BO4B 2G3QB 2COPA 1SIFA 4FHKA 4A20A 1RLFA 2GCLA 1WX9A 2HRJA 1XCGA 2FCNA 4B6WA 5CLQB 4F7UP 2KXJA 1P3RA 4MH0E 1VD2A 4E71A 1H4RA 4K7SA 1SGHA 3IVFA 2ROVA 3MPXA 4MGYE 3ZLZA 3CMMB 4AOFA 1WRDB 2KQ7A 4WAAA 4MDKE 3VAWA 4C0AA 3VTVA 2BKFA 1IPGA 2AL6A 2AEHA 1OEYA 3TJPA 1PMSA 2I5CA 2KZRA 4URKA 1YX5B 3VUXA 3DBHI 1GJZA 3RT3B 3A8PA 2K1FA 3QAQA 4W9KA 3BJIA 3FP5A 1FHWA 1M94A 4LDTB 3KH0A 3SD5A 3L08A 2COFA 3KY9A 1BAKA 2GOWA 4AWJA 1WGYA 1TZ1A 4FN2A 4TQ0A 2LXAA 3FSSA 4JL9A 2KVRA 2YVCA 4G0NB 4DHZB 3PVLA 3NSUA 3IG3A 4IOYX 4EZJA 3FEHA 2C60A 3KVFB 3U30A 2YT0A 1Q5WB 4HAZB 2Q13A 1GG3A 1Z5SB 1DYNA 5JHHA 2KANA 3CF6E 4KZ0A 1V5MA 1J8CA 4BKTA 3UZTA 2DX1A 3UIPB 1TBEA 4W9EA 2G35A 2NS5A 3WAOA 2MKRA 2LOXA 3F0WA 4HHVA 2KDFB 3MDBC 1WJ6A 1NVLA 2KMCA 3GYPA 1QQGA 2M1MA 4GPTB 2ZPNA 4A3OA 1DDVA 2D4QA 4HJKA 4II2B 4GIVA 1I35A 1P9DU 4M8NA 3R7RA 4HAXB 4KV2A 1EUVB 2CHWA 2DZKA 5D7GA 3W1YA 3M3JA 4KDIC 3PT2B 2DHIA 4NAWA 4HCPB 1FHXA 2RSGA 3ODXA 1DBHA 2VKIA 1LQBA 1VCBA 2WWZA 4P7IA 4Z2NA 2LJ5A 1UPQA 3H7PA 3W1SA 4DWFA 2GBKA 1W1GA 3A1QB 2RNRB 2DZIA 4BOZB 2M38A 5AEKB 2K8BA 2DAJA 4NSWA 5JP4A 1MK7B 2LGXA 1WGGA 2LULA 1WE6A 2MP2B 3AU4A 2K8HA 5JHAA 2NZ8B 1HB8A 3SHQA 4ZDVA 3A4SC 4OVVA 3C0RB 4KHAA 3JYUA 1FOEA 1NTYA 4KAXB 3SUZA 5JLJB 2DFKA 1CMXB 2KX3A 3HM3A 3NOBA 1WVHA 1X05A 2ABDA 1XKEA 4TV3A 1BWNA 3DBRI 1UZXB 2FCMA 4GSWA 2EMSA 2N0YA 4ANWA 2O6VD 2KUPA 3KRXA 4EKUA 2ADZA 2O6VA 3RYTA 5D6JB 2CR5A 4B9KA 2YRYA 4F7GA 3N30A 1XQQA 1WGDA 1RJ2A 1WR1A 3ODOA 1WI1A 1UBQA 1TGZB 2KJHB 2ZNVB 4GDKB 2RGNB 5D2MB 3APFA 5DHAB 5E6OA 4WJNA 2YT1A 2DLWA 2K6QA 2PE6B 3L17A 2AL3A 2PJHA 3ZRFA 4IM0A 1GC7A 4E3CA 2KJ6A 2KCJA 4ICUA 4MSQB 2HD5B 4BBNF 4FJZA 2MQJA 4YONA 1NDDA 2LRWA 2N9EB 5CHWA 1L2NA 2OJRA 3V61A 4DHJB 3D8DA 3ZKJC 2IY1B 4RMAA 4XWXA 2KNBA 3HM6X 4LJOB 1DDMA 3QK0A 3VTUA 1GC6A 1Z87A 3B0AA 4KHBB 1ACAA 4HB0B 1GNUA 3JSVA 1K5DB 4AP4C 3KRWA 3VUWA 5C1ZA 2D9XA 3HK0A 2REXA 4GB9A 4RM8A 4XZ4A 4GMVA 3K9OB 5DPWA 1WGHA 1OGWA 2D9YA 2KFKA 5J3YA 1XT9B 4MSMB 1HB6A 3KZ1A 2FIFA 2V3SA 1S3SG 1WXSA 1BTNA 2KD0A 5G2NA 1EF5A 4PS7A 1NI2A 2NMBA 3L16A 1P98A 3ML9A 4XC2A 1TJ6A 2BYVE 3ECIA 2LBBA 3PREA 3QA8A 3RZWC 3HQCA 4K2OA 2Z0OA 2E2XA 2BWFA 2WDTB 2LRUA 2ZZPB 3ZTCA 1KM7A 4EOYA 3L54A 1L7YA 1IP9A 4G50A 4CHMA 3Q3FA 3T8MA 1WGUA 1V80A 2CS4A 2KQSA 3AULA 1TTNA 3PRPB 1P3QU 1ISNA 3V6CB 4BVUC 1PLSA 1U5GA 1FHOA 3PLVA 2YS1A 3ZTDA 2W9NA 4GGQA 2NBVB 2UZRA 5HE0A 2DZMA 3LJ3A 2FJ9A 1KZ7A 3SNHA 2Z59B 4KVGB 1WX7A 2ZVOA 4IAPA 1WXAA 2OOBB 3ENEA 3PHWB 5E6NA 4HAYB 2JUOA 3UIOB 2J0JA 2K00A 2C7NB 2L0TA 2L8JA 2K8CA 2N4FA 1KOTA 4TKNA 2WH5A 1M7EA 2DYMA 1LB1A 3ML4A 4MEMA 4I6NB 5KHOA 2EC1A 3DOWA 1V86A 2G45B 4WWNA 2VRRB 1WM2A 3PHXB 2EJ8A 4DBBA 4X57B 5J3QA 1WGRA 3A9KB 3UGBB 4IM2A 2GCJA 2GBRA 2Y5BB 3O96A 5D3XA 2R0DA 5TR5A 2DYNA 2GBJA 3AJ4A 2MBBB 2I1JA 2MBHA 4CHJA 2JY6A 2N9PC 1XR0B 2RSUA 1D3ZA 3P7ZA 4ICVA 2KN5A 4CYEA 1WH3A 1AWEA 5C16A 4BKGA 2KO3A 5KCVA 1WM3A 3ZNID 2Z0QA 3TO1A 2CY5A 3ZNZB 1YIWA 3QX1A 4MGIE 2PZ1A 3ZIMA 1ST7A 3TMPB 3O65B 2M14A 2LD9A 4PQ0A 2KFJA 3GYOA 1OEYJ 3NS8A 4YL8A 1EVHA 5D3WA 1ZC3B 3D8EA 2L76A 2D2QA 4K1RB 2FAZA 3RD2A 2UZSA 2LOZA 1KJTA 4MELA 4G11A 4KSKC 3ZVVA 1C3TA 1I42A 1OMWA 1Q1OA 1YX6B 1WR6E 2WX1A 2KK8A 1UPRA 1EO6A 2ZNVC 5DI9B 3A8QA 2IYBA 5C5BA 3A1QA 5C6RA 3TL5A 2KHWB 4AJWA 1H10A 1NTVA 2N23A 4WJ7A 5HE1A 1V5PA 5KQ4A 1DROA 4TQ1A 2GBMA 4EMOA 5IAAC 2PEAA 1MK9B 5DPTA 3W1SC 2RR9A 1YD8U 1WE7A 2MW5A 3LDZE 2ROZB 3U7DA 1NBFC 1V5UA 2V1YA 4FBJB 3OJ4B 2MWNB 4WSFA 2Y8GA 3DPDA 4XX5A 1FAOA 1V6EA 5IJMA 2C5LC 1WJ1A 2ZEQA 3Q3JA 2UYZB 3RULA 2DYBA 2UVMA 5CLLB 3PVWA 1LFDA 2UWQA 2XBBC 3BY4B 2C7MB 4HPMB 2EMTA 4HAUB 2DENB 2N7DA 3A4RA 3QWMA 1ZW7A 1P0RA 1FXTB 1YQBA 1WMHA 2FDQA 2PE9A 3P6AA 2MFQA 1MIZB 1U27A 2W2XC 3H6NA 3PLUA 3TW1A 2M8SA 3KYCD 2P0FA 2O6VB 2P0HA 2MLBA 3QJZA 2FUHB 4WJOA 3V62A 1NU2A 2IFSA 4J6IA 4EZLA 1X11A 2CHZA 1A5RA 3VDZA 3JSVB 3TVVA 1LM8B 3PS6A 4B95A 4RM9A 4BOSC 4A5KA 1V2YA 1Z2MA 2QKLA 1J19A 3KUCB 2DN6A 4DBGA 5AZHA 1X1GA 2MA9B 2MDXA 1SE9A 3DBLI 1WGQA 1UD7A 4IWOA 4PS8A 2PPHA 2ZCBA 4MJSB 4BBKA 2A4ZA 3S2AA 3CIKA 4DX90 1E90A 2LZ6A 4HB3B 1U29A 1X1FA 2K2UA 1X86A 2CKHB 2IO2B 3CSTA 2IBIB 3DVGX 3A9JA 4HATB 4BKSD 3D8FA 4WQOB 1RAXA 2L2IA 4ZRKA 2JVCA 1UELA 5LONB 5CHVC 2D07B 3SO6A 2LVPA 4W9CA 1G6JA 3APCA 5JZEB 2R09A 4GN1A 3L0WB 3ODWA 1V88A 2BWES 4NQLB 1FB8A 1X1MA 2FCSA 2KDEB 4W9FA 1WXMA 2AWTA 1HBKA 5AZGA 2J7QB 4IWPA 1ZC4B 2JZZA 2LI5A 3QC8B 2COAA 2D9ZA 1RRPB 1WG7A 3G9WA 1ZGUB 2KTRB 3V6EB 4FA6A 4PYZA 2RVBB 1WZ3A 2CB8A 3SV1A 2L0FA 5C79A 1KI1B
chains in the Genus database with same CATH superfamily
3AU5A 1FNVA 3N7CA 2NBUA 5C2TB 2DYOA 1EU3A 4RGTA 5D3VA 4P1CC 4HKQA 2GRIA 1D6EC 2J53A 3UI3A 5J2RA 3QQ8B 3RNBC 1UEFA 4F7HA 2LVOA 2OTXA 4W9JA 1QILA 2GI9A 2W82A 2XQNM 2IO3B 4IG7B 2BKRB 2LGSA 2CAYA 4ANVA 4NNJB 1RRBA 2DIKA 1UF0A 1MAIA 1UNPA 2KTFA 1I2HA 4DX8A 4NQKE 2WDVB 4ANXA 3VFKA 4OZCA 4XGAB 1HA5A 3DBLB 3LJUX 1Y19B 2WQYB 3RNGC 3P4RB 3BWUD 1DGJA 1P1AA 1XD3B 5C3JB 4GZUA 4M01A 5JVLA 4L1BA 2H89B 2BS2B 4ARCA 2ON8A 1WMHB 4PK1A 3EPYA 2DHJA 3QWZB 3QARA 2W55A 1I7AA 4NY0A 5D27A 1TQZA 2DBYA 4L2YA 2OQBA 2Z0DB 1JCKB 2ZW1A 2D11A 2H88B 2BYEA 2PLPA 2LYDA 1TY0A 1E7UA 3TCAA 3ZDMC 2NVUI 4BBNC 2N7EA 4IUMB 3EA6A 2NBVA 2DYQA 3TEWA 5D3DA 2B3AA 2KYWA 2KDIA 2M4NA 2CHXA 4A8XC 5M4YB 1AARA 2KX0A 3SU8X 2PVGC 1KH0A 1J7CA 4CQNA 3P63A 2WXRA 2JQRB 1XLNA 3D32A 1JWAD 2X18A 1WJ4A 2CU1A 2IO0B 2ZCCA 3HHMA 3PV1A 1XO3A 3KW5B 2AX5A 4PS3A 4HAVB 1Y5OA 2W2WA 2WXMA 1E8YA 4HB2B 4OHJA 5LXHA 4A6FB 1R4MI 2RUKB 2RDHA 3AM9A 3L10B 4FHJA 1WF9A 4FJVB 5J17A 3WALA 3IXSA 3PRMB 2BPSA 1Y8RC 4MGZE 1N3HA 1YJIA 4TUUA 1F9JA 3KUDB 2P8VA 4JKEA 3NY5A 3I63C 1XEEA 1V49A 2JPHA 1UH6A 3NVZA 2BS3B 1DOIA 3ULBA 1YQ4B 1J0GA 5GOWB 2DZJA 4D0NB 1Q0WB 1A70A 5HKHA 2KDMA 1JWMD 3GZNI 5LNK1 2QCZA 4F7ZA 2GLSA 1TXDA 3VOQA 2K25A 1OQYA 1FGZA 4YSYB 5FKAC 3Q2AC 3MC0B 1WI0A 3NWAA 5H92C 2N9XA 3V5WA 4HPLB 2GS0A 4NZLB 3AEGB 1K51A 3E9SA 5BMGA 4WWOA 2KC2A 4JWUC 4JKBA 2R61A 4IM3A 3RZFA 2R2OA 2NCNA 1W1HA 2G1EA 4WURA 2B76B 1XLPA 1FXAA 1GB1A 3N20C 4GOUA 4DDID 1FRDA 4FADA 2KC1A 1KLVA 4K17A 2CY4A 1MG8A 3VRAB 5JHGA 1MHXA 5KHQA 4MK0A 1P6SA 1HEZE 3T3OA 3DVNU 2WXFA 1WWTA 1WZ0A 5L95C 1LW3A 3AV8A 2KWVB 3SBTA 5FI1A 2NMQA 5H8YE 2KFKB 3AB5A 3F5RA 4FLHA 2G3QB 2COPA 4FHKA 1C4CA 3NVWA 2FCNA 1WX9A 1KFYB 1P3RA 4MH0E 4K7SA 1SGHA 2ROVA 1ZXIA 2WDRB 1WRDB 2KQ7A 4WAAA 3HIEA 4MDKE 5LG4B 1PDXA 2HTME 4HSIA 1YX5B 3LXFA 3A8PA 2K1FA 4LDTB 1FHWA 4A9AA 2MHJA 1BAKA 3DWGC 4FN2A 2KQ4X 1DYQA 3AE8B 2RDGA 4IOYX 4EZJA 3KVFB 3MHZA 4KZ0A 1IBXA 1DYNA 1CK1A 4A90A 4YTNB 4M00A 3UIPB 1TBEA 2G35A 3F0WA 2D3CA 1WJ6A 4HJKA 1L6VA 1SB3C 4RF0A 3W1YA 4P1BC 1EU4A 4KDIC 1FM0D 1DOXA 2W54A 2MEKA 4P7IA 2LJ5A 1UPQA 3H7PA 1L4ZB 3TEYA 1LGRA 3A1QB 4BOZB 2M38A 3HVZA 4L1RA 3HSAA 5JP4A 1WGGA 1MI1A 1HB8A 3SHQA 4OVVA 3HM3A 1MHHE 2ABDA 4TV3A 3AEAB 4ANWA 1UZXB 4JKFA 2N0YA 1R7SA 1WXQA 2O6VD 2WXGA 3KRXA 3RYTA 2HJ1A 3N30A 2KJHB 3ODOA 3LYYA 1UBQA 3AE3B 1L0XB 1MFWA 3W5UB 1GC7A 1JW9D 1TY2A 2E6XA 2KJ6A 2HD5B 1NDDA 5CHWA 3ZKJC 2QEJC 2V0GA 1MI0A 4LJOB 3Q8FA 1QQRA 4KHBB 1ACAA 1K5DB 2KMMA 2Z59A 2RPVA 4DIXA 1VR9A 4RM8A 3RNCC 4XZ4A 3KQ4A 1SBBB 1WGHA 4PS7A 3R7RA 1AW7A 4XC2A 3ECIA 2BYVE 3PREA 5I4DA 4K2OA 2ZZPB 3L54A 3N1YC 2Z14A 3T8MA 2INCC 4JKCA 2KQSA 3ZQ4A 1F77A 3PRPB 3V6CB 4XWTA 2FJ9A 3SNHA 4HAYB 2JUOA 3DHIC 4FXCA 2J0JA 3UIOB 1GB4A 4TKNA 1LB1A 4WWNA 2Z4DA 2VRRB 3NJTA 3PHXB 1C79A 4LTUA 2EKIA 1OFFA 2L52A 2GBRA 2Y5BB 2DYNA 2I1JA 1FMAD 2V3NA 1UNSA 1MG4A 2ACZB 1WH3A 2IJ0A 4LLGM 4BKGA 5KCVA 3ZNID 3ENBA 3TMPB 2Z13A 3NS8A 2WP9B 2L76A 2D2QA 1I42A 3DHGC 3ZJVA 1Q1OA 1C77A 2KK8A 4UDUC 5C6RA 4TQ1A 5EE3A 5KQ4A 2WU2B 4EMOA 2PEAA 1MK9B 1T6BX 1YD8U 1WE7A 3AEBB 3U7DA 1V5UA 2V1YA 3BZDB 5IJMA 2C5LC 1XCTL 2DYBA 1LFDA 3PVWA 3Q8CA 3BY4B 4HPMB 2D3BA 3A4RA 1YQBA 4LCDE 1WMHA 3OG5A 1MIZB 3TW1A 3NG0A 1BUIC 2FUHB 1NU2A 4J6IA 3NW8A 4KGSA 1PGXA 2K5PA 4RM9A 1V2YA 2QKLA 4D6WA 2DN6A 3PZ8A 2MA9B 2MDXA 4IWOA 2ZCBA 4LNOA 4LK0M 1IBXB 2LZ6A 4HB3B 1X1FA 3CSTA 2IO2B 3DVGX 4BKSD 2L2IA 4ZRKA 1TKGA 5CHVC 2D07B 3SO6A 4RGOS 5JZEB 2R09A 1X1MA 1N62A 2V4IB 4ZRPA 2J7QB 2LI5A 3QC8B 4BFRA 2COAA 1RYJA 2L0FA 4ACFA 1L4DB 4WH4A 5GMVA 4MH8A 4W9HA 4WIPA 1EWCA 4N59A 1FO4A 3NHEB 4DHJD 1IGDA 2MBQA 4CHKA 2K39A 3PGEA 4PYUA 4WJPA 1TS4A 3WANA 3ZXRA 2CQUA 4I6PA 2LWPA 2RLOA 3W5VB 5IRSA 4WWPA 4W9GA 4BKSA 2VSZA 4IDIA 4JGHB 4JLCA 1B1ZA 2QC8A 1M7RA 1UGMA 3AE2B 1NTIA 4ZYSA 4EUTA 5IA7A 3SDLC 1EF1A 3W2DA 1QF6A 2PVOD 1KZGA 4A6HA 3PZ7A 3DDCB 2M17A 3B08A 2LGYA 4K7UA 3DXCA 3ZNHB 2WNMA 1GUAB 3ZUNA 4R3DA 2J0MA 1OTRB 4B6HA 2SAKA 2J59M 4HXDA 2D5GA 1UWXA 2DTCA 1XXGA 1H8CA 1QZEA 4F1SA 4WJQA 2BT6A 2WXHA 2M0XA 1LXDA 4MELA 3TFMA 1U5DA 1YNTE 3PSEB 5MPOA 4ZYNA 3VR8B 5DPSA 1C9FA 3M62B 5DIFB 1PQSA 4AJYB 4EFOA 1W1DA 2KUQA 1WJNA 2K49A 5I2MA 3E9PA 3WA0A 3A9JB 1D5ZC 3M95A 2KIEA 2YSZA 3PSCA 2GB1A 4HRSA 2D10A 1V61A 2NBWB 1V5OA 2KTRA 2V4LA 1VRAB 3K9PB 4MY6A 1F1HA 2YS3A 1KRHA 1V5TA 2Z0EB 3QHTA 2KT7A 2O2VA 3OAWA 2ELBA 3PEGA 4FJYA 1WFYA 3L13A 1Q10A 2K6DB 2YF0A 3VUYA 3APDA 3IT4B 2GMIC 5C23A 4W9LA 1SXTA 3A33B 2DX5A 2LG1A 1OQNA 3MJWA 4WQMA 2RPQA 4PNKA 4JIOU 4L6EA 3EFUA 1I4XA 1E7VA 1YJ1A 2L05A 3PVUA 2EELA 3QBVB 1AN8A 2JF5A 1V81A 4EJNA 1WJUA 1WIAA 1UNQA 2FNJB 2KLGA 1F2RC 5BMHA 2XK5B 3RNFC 2L1CA 3OLMD 1EGXA 1FCCC 2Q5WD 1CJEA 4JKDA 2MH7A 1WY8A 3EECA 4NPNA 5HHDG 1I4PA 3GZNB 3OJ3A 4GMXB 1TJEA 2DNFA 2KOXA 2UU7A 2EKEC 3AXCA 4KSLC 1YN4A 1XLOA 4LNFA 1TT5B 4DDGD 2DLBA 3Q69A 1WYWB 3LB8C 4A6KA 4C4VB 5EE0A 4TMAB 4JKAA 1U5EA 3DCGA 1VBHA 2L00B 2LUMA 4MT7A 2X8XX 4W9DA 1WSPA 2KJRA 2J4XA 4JX1C 1QT9A 2C9WB 2MP2A 1AQCA 3E66A 1JDEA 2QHOA 3HUIA 1E5WA 3U52E 1HE8A 4OZBA 1FEHA 4JKHA 1T77A 5LOPB 3KYDD 1VZ7A 1K8RB 1V1OA 2AYOB 4NJCA 1BTKA 4H2AA 1STEA 4JE3B 2RD0A 4IOIE 2RDBC 1U4AA 3VR9B 3W9CB 5IKCM 4Q2JA 1HTOA 4AQ7A 2Y7BA 5J18A 5CTRC 1U5FA 4OVZA 3EFCA 5CLQB 4F7UP 3KLSX 1VD2A 4E71A 3GE8C 3VAWA 3VTVA 4C0AA 2BKFA 4D2KA 4URKA 3VUXA 3AE9B 3QAQA 3FP5A 1ESFA 3KH0A 2AQ1B 2GOWA 1WGYA 3FSSA 1ZXHA 2KVRA 1AYFA 3IG3A 3IT6B 2C60A 1V8CA 3CF6E 2ONQA 1JRPA 1J8CA 2WDQB 3KWLA 3GP7A 4EE2A 2WS3B 2MKRA 4HHVA 3MDBC 3GYPA 3FILA 4ITKA 4A3OA 1VZ6A 4GIVA 4QJ4B 4HAXB 4KV2A 2CHWA 1VJKA 2DZKA 2IGHA 1FPYA 4A55A 1TZOA 3M3JA 3PT2B 4NAWA 3C8YA 2MJDA 3ODXA 1DBHA 2VKIA 1LQBA 2FJUB 3W1SA 2KR0A 4S17A 2E3TA 3R8BA 5AEKB 4NSWA 2LFIA 1MK7B 3B2GA 3TEZA 2LULA 3SFEB 3AU4A 2K8HA 4ZDVA 4DQOC 4KHAA 2KX3A 5JLJB 1CMXB 3NOBA 1WVHA 1BWNA 2EMSA 2ADZA 1EM7A 2L1AA 5D6JB 2W3SA 1WI1A 2ZNVB 5E6OA 2RGNB 3APFA 2DLWA 3ZRFA 1LO5D 4IM0A 4E3CA 2KCJA 4BBNF 1L2NA 2MQJA 1YOVB 2LRWA 2OJRA 2QMTA 3D8DA 4RMAA 4XWXA 3HM6X 1DDMA 4AP4C 4HB0B 3KRWA 2D9XA 1P7EA 4HEA1 4GB9A 4KKJA 4N58A 3FAHA 1FIQA 4M02A 3KZ1A 1F0ZA 2KACA 1NI2A 3AE7B 1E0ZA 1P98A 3ML9A 2LBBA 3QA8A 3HQCA 2WDTB 5FK9C 3BYTB 3Q3FA 1V80A 1P3QU 1PLSA 2UZRA 2XN9C 5HG2A 2ZVOA 3Q3OC 4FULA 5E6NA 1GPXA 2L8JA 2K8CA 3KWVA 1V86A 1FRRA 4C00A 4ARIA 4DBBA 4X57B 3UGBB 1HQRD 1C4PA 1FNWA 2GCJA 4IM2A 3N9YC 2MBBB 2JY6A 1D3ZA 1XR0B 1QOBA 2JWUA 2LD9A 2KFJA 2QJLA 2MJ3A 4K1RB 4NAWB 1E9MA 1KJTA 4G11A 3BVGA 5DI9B 5C5BA 3TSSA 2N23A 1T0SC 2N9LA 3W1SC 3B9JA 1QLBB 3LDZE 2ROZB 4YWGG 1JWSD 1XF5L 1NYRA 4C7YA 1WJ1A 3Q3JA 2UVMA 4OT1A 2JXTA 4DXFA 2DENB 2N7DA 1ZW7A 1QOFA 3H6NA 2FDQA 3R2TA 3ZVVA 2MJEA 3PLUA 4WJOA 2P0FA 1WGKA 4XE0A 2VZKD 2CHZA 3VDZA 3JSVB 1EWYC 4ZHPA 2K9XA 1C76A 3DBLI 1WGQA 2L32A 4BBKA 3AECB 1ZOYB 2CKHB 1NEKB 2IBIB 3A9JA 1YQ3B 1CQVA 5LONB 1G6JA 3APCA 1N5WA 5I2SA 1V88A 2BWES 1KTKA 2KDEB 2AWTA 1HBKA 1PGBA 4RCOA 1C78A 1ZGUB 2D9ZA 1TYGB 2KTRB 4JPSA 4FA6A 1WZ3A 2CB8A 3SV1A 4LNKA 4C7ZA 1BMLC 4BAXA 4KX6B 3P42A 1K50A 4A6QA 1ZE3D 3UQBA 1L5PA 3VQIA 3BVZA 1FD6A 2JU6X 4RH6A 1HXYD 2MBOA 1JRUA 2O2VB 1XX0A 4ILGB 1SF0A 2N1VA 4AUQC 4WVFB 1WYGA 4DHZE 4TYZA 4LNIA 4E74A 2ZVNA 3ETRA 2INPE 4I6LB 3ONSA 4M8MA 3GE3C 2XK5A 2P0DA 2R82A 4XWWA 3WYFB 3QCAA 4GXBA 3RFZB 2XEWA 1XODA 4K2PA 4NJ6A 2H7EA 3RCZA 1BXTA 3WAMA 1I4QA 4IC7B 3P2BA 4KHBA 1V97A 2NTTA 5D94A 3U7ZA 2DHZA 4KDLB 5CHFA 5AZFA 2BYTA 2NR2A 1ZM0A 1ZSQA 3L17A 1IRSA 2L3ZA 1UBIA 4HB4B 1RFAA 3SBGA 4NJ7A 3UF8A 2DHKA 2KKCA 2KMAA 1GGOA 1T0RC 3Q8AA 3DCXA 1PUTA 2W2XD 4YT0B 4MJSA 3CSFA 1XD4A 2L7RA 2KIGA 2J52A 4IKGA 2DA0A 1OQQA 3R7QA 2INNE 1Q67A 3ZVRA 3I3TB 3DXDA 4ZRJA 2YS5A 3IFWB 1C1YB 3IHPC 3JVZX 2LASA 2KWUB 4LDTD 2GJYA 1T5XD 1DIKA 1SJHD 3H7SA 4ZRIA 2R2YA 1FXIA 4YTMB 4JKGB 4N9F4 1WRIA 2WHIA 2DKPA 4P6VF 4KIKA 5J3TA 5EDSA 1PYWD 2QSDA 1QOAA 3GS2A 2RGFA 5BYQA 5CX3A 4RFBA 3V3XA 2BF8B 2X0SA 1UNRA 1SEBD 2JYTA 5C5BB 4OW0A 5KQ1A 2JRIB 1BT0A 2Z0PA 2YLMA 2G4SA 1U2BA 4GDLB 2I5FA 2J0KA 4GDKA 1OQRA 1QC6A 2JRHA 1WX8A 5LLIA 2WXIA 3GOEA 2V76A 5EE1A 2G4DB 2D9WA 2Z8LA 5DPRA 5BYSA 1D4BA 3MTNB 3UQAA 2KGXB 1L0VB 5D3YA 5L81A 3PRZA 4HROA 4G3XB 2DAFA 3VVWB 2KAJA 3NUHB 3MC9A 1MJDA 3WCQA 1JROA 3NS1A 3PP2A 2PMVA 1I4GA 3AEFB 4ASWC 3N1XC 3PTFC 3A58A 1GAQB 4HLEA 4HPPA 4WAFA 3QIJA 1VDVA 3UINB 1ET6A 3BVMA 3MHSD 4N6EB 2WXKA 5JHBA 3ULCA 3OWEB 1FGYA 2VRWB 4HAWB 1DDWA 3VIAA 3H7PB 4GOCA 4K7WA 3RMKC 3J9CA 3HRDD 4JQWC 3BINA 3T9LA 2R2QA 3ZDTA 3KUZA 4KZCA 3NZSA 3AI5A 2YEPF 1KF6B 4CO7A 2SEBD 3AE1B 1E8XA 3JW0X 1K53A 2K3UA 3HVDA 3L4PA 4DXAB 1IUEA 2NPTA 4JK8A 2IY0B 3SR6A 2HTHB 2WYQA 3X0WA 3ZW3A 1P7FA 3PG7A 4H8SA 4J3OD 1OY2A 1T3QA 4MACA 5DHFB 3PZDA 1MVKA 2RQ1A 3VXWA 2JWZA 4II3B 3ABVB 1CZPA 3R66C 5BO4B 3Q3NC 3IAM1 4A20A 1RLFA 2GCLA 2HRJA 1XCGA 4B6WA 3PO0A 1ACCA 2BB5A 4AOFA 5G5HA 3CMMB 2LHEA 1SJED 2AL6A 2AEHA 1OEYA 3BK1A 4US8A 1PMSA 2I5CA 2KZRA 1GJZA 3ZJUA 1YMHE 3RT3B 3BJIA 2LJIA 4AWJA 1FNUA 2LXAA 2YVCA 4DHZB 3PVLA 3NSUA 3FEHA 2YT0A 1Q5WB 4HAZB 5JHHA 3UZTA 3I57A 2Y5PA 3WAOA 2KDFB 3MC8A 4OSNA 1NVLA 2M1MA 4GPTB 2ZPNA 2D4QA 1P9DU 4M8NA 1JWBD 1FCLA 5D7GA 2DHIA 4Z2NA 2I38A 2RRFA 3Q8EA 1R4NB 4REZA 4DWFA 3MP9A 2RNRB 2DZIA 4QJ3B 2DAJA 2LGXA 1Y56A 2K8EA 3A4SC 4KAXB 1XKEA 2FCMA 4GSWA 3AMZA 4AS1A 1SE4A 2WXJA 2CR5A 2YRYA 1WR1A 4GDKB 4LNNA 1TGZB 2YT1A 2PE6B 4ZOHC 2PJHA 1HTQA 1KBLA 1L0YB 1NI3A 2ZKMX 2IY1B 1FFUA 2KNBA 3VTUA 3QK0A 1GC6A 5C1ZA 3HK0A 2REXA 1PGAA 5DPWA 3K9OB 5J3YA 1N61A 1WXSA 1BTNA 2NMBA 3L16A 1TJ6A 1B9RA 2E2XA 2BWFA 1KM7A 4EOYA 2INDC 3ZXVA 4G50A 1L6UA 1MPEA 2CS4A 3AULA 4F8CB 1I4HA 1TTNA 1ISNA 3PLVA 1FHOA 2J42A 2NBVB 5HE0A 2DZMA 1KZ7A 2Z59B 4KVGB 1WX7A 4IAPA 1WXAA 3PHWB 2K00A 2C7NB 2PW9A 5IP4D 2WH5A 2DYMA 4I6NB 5KHOA 2EC1A 2G45B 5J3QA 1WGRA 3I9V1 3OHMB 3O96A 2R0DA 2GBJA 1QOGA 2MBHA 2RSUA 2N9PC 4ICVA 2CJOA 2KN5A 4CYEA 5BYRA 2N0SB 2Z0QA 2CY5A 5EE9A 3O65B 5AUIA 1EVHA 3SEBA 5D3WA 1ZC3B 2JYEA 2FAZA 2UZSA 1C3TA 4XYCA 4DXGA 1OMWA 2LHDA 1EO6A 3A8QA 2IYBA 3TL5A 4AJWA 1NTVA 1DROA 1VLBA 4WJ7A 3P1MA 5GXGB 5IAAC 2GBMA 1J7BA 3MJ5A 4XDCA 5DPTA 2V9HA 1NBFC 4FBJB 3OJ4B 2MWNB 3N1ZC 4XX5A 2ZEQA 2UYZB 4KGTA 4GLSC 4HAUB 2IGGA 3QWMA 1P0RA 3U12A 1FXTB 2ICIA 2PE9A 3P6AA 2MFQA 3V62A 3ZRCA 3RULA 2M8SA 3KYCD 2O6VB 2P0HA 3QJZA 3TEXA 2IFSA 1V1PB 5JXVA 1A5RA 4JWSC 3TVVA 2WLBA 3TUOA 2WU5B 4BOSC 1Z2MA 1J19A 3KUCB 2QILA 1X1GA 1SE9A 1UD7A 2PPHA 4TSSA 3S2AA 3P4QB 4DX90 1E90A 1U29A 3U4EG 1X86A 4HATB 4O1NA 3D8FA 1RAXA 2JVCA 3L0WB 3ODWA 5E6JA 4NQLB 1FB8A 3AEDB 4W9FA 3E56A 5AZGA 1ZC4B 2JZZA 3B2FA 4HJGE 4PYZA 2KN4A 4WWMA 5C79A 1KLGD 4RNAA 4IFSA 1KI1B 2NTSA 5E6PA 4QAYA 1JALA 2GBNA 2BBCA 3NVVA 4IW0A 2KDBA 3MFGA 3ZGZA 4KGRA 4LJPB 2D3GA 4OVUA 4HDQA 2DKQA 3X23A 3B1LX 3FLVA 2JXXA 2QDFA 1EAZA 1MIXA 2LGIA 1YN3A 3BYYB 3V60A 2Y5CA 3NRZA 4HWIB 2HJ8A 4HK2A 3HIZA 1SSNA 3RN9C 3VH4B 3M1IB 2BW2A 1GOZA 2C7HA 3KSYA 1R4MB 2JT4B 3DHHC 2CRFA 1IYFA 3V05A 1K5GB 4HDOA 1S1QB 3RPFC 3SYXA 2LVQA 3EC8A 2HE7A 1D5XC 5EFXA 3U2SC 1D5MC 1YJJA 3ALBA 3AE5B 2WXLA 2BTEA 5L83A 5G55A 2ZPYA 4MT5A 1PFJA 4B95A 5FI0A 2PKOA 3R2IA 2BCJA 3M63B 3N32A 1RWSA 4M0WB 3T06A 3DQVA 4MM3B 4HCPB 4HVBA 4ILJA 2MRPA 2IZVB 2N1WA 1PFDA 3NVYA 1E8ZA 1N5XA 2CODA 3FM8C 5TSSA 4GU2A 5AUKA 3URYA 2YEPB 4Y94A 3ZO5B 2LXCA 4C80A 1V9JA 3R3MA 2WXPA 1SHCA 1T0YA 2KLCA 3IBEA 4EEWA 1TKYA 2WGSA 3ML8A 1NYQA 5FR6A 3HW2B 4A6FA 2Y8FA 1YN5A 4C4VA 4L23A 2PIAA 4HKZE 2IPKD 1MKEA 2D9VA 4USAA 4DK5A 4NAMA 2LUEA 4RGNA 2COCA 2BYFA 1E8WA 4ANUA 4GNKB 1T0QC 3EHVA 2TSSA 5HE2A 2I1KA 1NENB 1XCQL 2MX2A 4YXDB 1V89A 2M56B 1SIJA 3P4PB 4US9A 3EGRA 2NPTB 5LXIB 2VH1A 3WIMA 5FR3A 5DCNA 3SFDB 2WX0A 2HTHA 2I2YA 4K81A 2BGFA 1NVID 3RNEC 4JK7A 4A3PA 5DH9B 2OEDA 4JKGA 3AH7A 2JX5A 1B55A 4MGKE 4W9IA 4KHOA 3RCPA 4KIKB 3H1UA 2MBEA 2LEKA 2IYDB 3TIXA 2FBWB 3NWFA 3V6EB 3TBLD 4HCNB 3T3NA 2MWSB 4IWQA 3RUIB 2WXQA 1QKZA 1R4NI 1AWDA 2QKMA 2BS4B 2KWCA 2W3RA 1C4AA 4Z2MB 2DX5B 4B0EA 4GDLA 1WXVA 2ZJDA 3OANA 1FFVA 5HFYA 3B77A 5IOIA 2A5UA 2BQQA 2JP2A 1J0WA 1TKEA 1IGCA 2FIDA 2N7JA 3U8ZA 3ZNGC 4M0WA 4MM3A 2D3AA 4ZRQA 2ELAA 3N3KB 1ZVRA 2FCQA 2ASQA 1ET9A 4QJ5B 2GUMA 2IO1B 4QXAB 1UUPA 3H9DA 2K2JA 5HE3A 1HZ5A 2KVZA 3A9KA 3DBSA 2RMMA 3CIRB 3NZ3A 2LGDA 2LKOA 1ZDXA 3FKYA 3VTWA 1RFKA 3DVNV 1M4VA 1MPHA 3VH3B 1KC7A 3BIID 3GB1A 4K3CA 5JH5C 4S0RA 3CXBB 2CJNA 3NZUA 3PPAA 2H7DA 4K3BA 2MSED 2JZ3B 2FJLA 1JWUD 1P5TA 4OZAA 1ROEA 5BMIA 2AQ2B 3A98B 2MCNB 3DVGY 3DXEA 1WJMA 1ZKHA 1SIFA 2JZPA 2KXJA 5G5GA 3DBHB 1H4RA 2WXNA 4MGYE 3IVFA 3MPXA 3ZLZA 5IN7A 1IPGA 3TJPA 1K52A 4YSXB 1KLUD 3DBHI 4W9KA 3SD5A 2K22A 1M94A 1F52A 3L08A 2COFA 3KY9A 3E9OA 3O13A 2DWQA 4TQ0A 1TZ1A 4JL9A 3CWIA 4G0NB 3BK2A 3U30A 3IAS1 2Q13A 1GG3A 1Z5SB 2KANA 1V5MA 4BKTA 2DX1A 3FC4A 3P4SB 4W9EA 2NS5A 4CSQA 4ICUA 2LOXA 1E7PB 2X38A 2KMCA 1QQGA 1DDVA 4II2B 1I35A 1UGJA 2M0AA 1EUVB 3ZJTA 3I5JC 2LMCA 1FHXA 2RSGA 2WWZA 1VCBA 2GBKA 1W1GA 3H8HA 1I4RA 2V3PA 2K8BA 4ILHA 3FILB 2L83A 1WE6A 2MP2B 5JHAA 2NZ8B 3Q14C 3C0RB 1VZ8A 5HI1A 3JYUA 2JSVX 1FOEA 1NTYA 3SUZA 2DFKA 1SE2A 3Q3MC 1X05A 3DBRI 1F2RI 4B0MA 1I7HA 2OJWA 2KUPA 2AQ3B 4EKUA 2O6VA 2QIEB 1V1PA 2XNAC 4JK9A 4B9KA 4F7GA 1XQQA 1WGDA 1RJ2A 5D2MB 5DHAB 4WJNA 2K6QA 1SE3A 2AL3A 3RI7C 2FE8A 4MSQB 3VRBB 4FJZA 4YONA 2N9EB 1N60A 1UWMA 2M19A 3V61A 4DHJB 1HZ6A 1E6EB 3NWDA 1Z87A 3B0AA 2HDEA 3JSVA 1GNUA 4BZAA 3VUWA 2ZW0A 4GMVA 2KFKA 1OGWA 2D9YA 1ENFA 1XT9B 1ZP0B 4MSMB 1HB6A 2FIFA 3RNAC 2V3SA 1S3SG 2KD0A 5G2NA 1EF5A 4ZHOA 3AE6B 5T8IA 3RZWC 2Z0OA 3AEEB 2LRUA 4KKIA 3ZTCA 2G9HD 2BB6A 3AE4B 1L7YA 1IP9A 4CHMA 3Q8BA 1WGUA 1XLQA 3AN1A 4BVUC 1U5GA 3ZTDA 2YS1A 2W9NA 4GGQA 3LJ3A 3ENEA 3Q6BA 2OOBB 2L0TA 1KOTA 2N4FA 1VBGA 1M7EA 4MEMA 3ML4A 3DOWA 1RM6C 2OHFA 1WM2A 2EJ8A 5D3IB 3A9KB 2YT2A 5D3XA 5TR5A 3AJ4A 1JQ4A 2VZKB 4CHJA 3P7ZA 1AWEA 1E10A 5C16A 2KO3A 1WM3A 3TO1A 4YSZB 4PT5A 3ZNZB 1YIWA 3QX1A 4MGIE 2PZ1A 1ZDVA 1ST7A 3ZIMA 2M14A 3WAPA 4PQ0A 3GYOA 1OEYJ 3FVCA 4YL8A 2WXOA 3D8EA 3RD2A 4EZKA 1TS3A 2LOZA 4RGMA 3E9LA 4KSKC 1YX6B 1WR6E 2WX1A 1UPRA 2ZNVC 1TS5A 3A1QA 2KHWB 1H10A 5HE1A 1V5PA 1TIFA 1N6ZA 2RR9A 2MW5A 2BVCA 4WSFA 2Y8GA 3DPDA 1FAOA 1TS2A 1V6EA 4XDDA 2UWQA 5CLLB 2VH2A 2XBBC 1JMLA 2C7MB 2EMTA 1U27A 2W2XC 3DWMA 5IO9A 2Y3AA 2MLBA 1N63A 4EZLA 1X11A 1LM8B 3PS6A 2K0PA 4A5KA 2CU3A 2IDYA 1ZPSA 3C19A 4DBGA 5AZHA 4P16A 4PS8A 4MJSB 2A4ZA 3CIKA 3VHTC 2K2UA 3ZYYX 2PTLA 4C56C 4RF1A 4WQOB 4YTPB 1UELA 2LVPA 4W9CA 3EUB2 4GN1A 2FUG1 1DOYA 2KWDA 2FCSA 3DBRB 1WXMA 1J7AA 4IWPA 2N9KA 1ZYIA 1RRPB 1WG7A 3G9WA 2RVBB 2IGDA 1ZUD2
chains in the Genus database with same CATH topology
3AU5A 3N7CA 2NBUA 2DYOA 5D3VA 5J2RA 3QQ8B 1UEFA 4F7HA 2LVOA 2OTXA 4W9JA 2XQNM 2IO3B 4IG7B 2BKRB 4ANVA 2CAYA 4NNJB 1RRBA 2DIKA 1MAIA 1UNPA 2KTFA 1I2HA 4DX8A 4NQKE 4ANXA 3VFKA 3LJUX 1Y19B 1P1AA 1XD3B 4GZUA 5JVLA 1WMHB 3EPYA 2DHJA 3QWZB 3QARA 1I7AA 4NY0A 5D27A 1TQZA 2OQBA 2Z0DB 2D11A 2BYEA 2LYDA 1E7UA 3TCAA 3ZDMC 2NVUI 4BBNC 2N7EA 4IUMB 2DYQA 2B3AA 2KDIA 2M4NA 2CHXA 1AARA 2KX0A 3SU8X 3D32A 2X18A 1WJ4A 2CU1A 2IO0B 2ZCCA 3HHMA 3PV1A 3KW5B 4PS3A 4HAVB 1Y5OA 2W2WA 1E8YA 4HB2B 5LXHA 4A6FB 1R4MI 2RUKB 3L10B 4FHJA 1WF9A 4FJVB 5J17A 3WALA 3PRMB 2BPSA 1Y8RC 4MGZE 1N3HA 4TUUA 1F9JA 3KUDB 2P8VA 4JKEA 3NY5A 1V49A 2JPHA 1UH6A 3ULBA 1J0GA 5GOWB 2DZJA 4D0NB 1Q0WB 5HKHA 3GZNI 4F7ZA 1TXDA 3VOQA 2K25A 1OQYA 1FGZA 1WI0A 2N9XA 3V5WA 4HPLB 2GS0A 4WWOA 2KC2A 4JKBA 4IM3A 3RZFA 2R2OA 2NCNA 1W1HA 4DDID 4FADA 2KC1A 1KLVA 4K17A 2CY4A 1MG8A 5JHGA 5KHQA 4MK0A 1P6SA 3DVNU 1WZ0A 5L95C 1LW3A 2KWVB 3SBTA 5FI1A 2KFKB 3F5RA 4FLHA 2G3QB 2COPA 4FHKA 2FCNA 1WX9A 1P3RA 4MH0E 4K7SA 1SGHA 2ROVA 1WRDB 2KQ7A 4WAAA 4MDKE 1YX5B 3A8PA 2K1FA 4LDTB 1FHWA 1BAKA 4FN2A 4IOYX 4EZJA 3KVFB 4KZ0A 1DYNA 3UIPB 1TBEA 2G35A 3F0WA 1WJ6A 4HJKA 3W1YA 4KDIC 4P7IA 2LJ5A 1UPQA 3H7PA 3A1QB 4BOZB 2M38A 5JP4A 1WGGA 1HB8A 3SHQA 4OVVA 3HM3A 2ABDA 4TV3A 4ANWA 1UZXB 4JKFA 2N0YA 2O6VD 3KRXA 3RYTA 3N30A 2KJHB 3ODOA 1UBQA 1GC7A 2KJ6A 2HD5B 1NDDA 5CHWA 3ZKJC 4LJOB 4KHBB 1ACAA 1K5DB 4RM8A 4XZ4A 1WGHA 4PS7A 3R7RA 4XC2A 3ECIA 2BYVE 3PREA 4K2OA 2ZZPB 3L54A 3T8MA 4JKCA 2KQSA 3PRPB 3V6CB 2FJ9A 3SNHA 4HAYB 2JUOA 3UIOB 2J0JA 4TKNA 1LB1A 4WWNA 2VRRB 3PHXB 2GBRA 2Y5BB 2DYNA 2I1JA 1WH3A 4BKGA 5KCVA 3ZNID 3ENBA 3TMPB 3NS8A 2L76A 2D2QA 1I42A 1Q1OA 2KK8A 5C6RA 4TQ1A 5KQ4A 4EMOA 2PEAA 1MK9B 1YD8U 1WE7A 3U7DA 1V5UA 2V1YA 5IJMA 2C5LC 2DYBA 1LFDA 3PVWA 3BY4B 4HPMB 3A4RA 4LCDE 1YQBA 1WMHA 1MIZB 3TW1A 2FUHB 1NU2A 4J6IA 4RM9A 1V2YA 2QKLA 2DN6A 2MA9B 2MDXA 4IWOA 2ZCBA 2LZ6A 4HB3B 1X1FA 3CSTA 2IO2B 3DVGX 4BKSD 2L2IA 4ZRKA 5CHVC 2D07B 3SO6A 5JZEB 2R09A 1X1MA 2J7QB 2LI5A 4BFRA 3QC8B 2COAA 2L0FA 5GMVA 4W9HA 3NHEB 4DHJD 2MBQA 4CHKA 2K39A 3PGEA 4PYUA 4WJPA 3WANA 2CQUA 4I6PA 2LWPA 2RLOA 4WWPA 4W9GA 4BKSA 2VSZA 4JGHB 4JLCA 1M7RA 1UGMA 1NTIA 4EUTA 5IA7A 3SDLC 1EF1A 1KZGA 4A6HA 3DDCB 2M17A 3B08A 2LGYA 4K7UA 3DXCA 3ZNHB 1GUAB 3ZUNA 2J0MA 1OTRB 4B6HA 2J59M 4HXDA 2DTCA 1H8CA 1QZEA 4F1SA 4WJQA 2M0XA 1LXDA 4MELA 3TFMA 1U5DA 3PSEB 4ZYNA 5DPSA 3M62B 5DIFB 1PQSA 4AJYB 4EFOA 1W1DA 1WJNA 3E9PA 3WA0A 3A9JB 3M95A 2YSZA 3PSCA 2D10A 1V61A 2NBWB 1V5OA 2KTRA 2V4LA 3K9PB 4MY6A 2YS3A 1V5TA 2Z0EB 3QHTA 2O2VA 3OAWA 2ELBA 3PEGA 4FJYA 1WFYA 3L13A 2K6DB 2YF0A 3VUYA 3APDA 2GMIC 5C23A 4W9LA 3A33B 2DX5A 2LG1A 1OQNA 3MJWA 2RPQA 4PNKA 4JIOU 4L6EA 3EFUA 1E7VA 1YJ1A 2L05A 3PVUA 3QBVB 2JF5A 1V81A 4EJNA 1WJUA 1WIAA 1UNQA 2FNJB 2KLGA 2XK5B 2L1CA 3OLMD 1EGXA 4JKDA 1WY8A 3EECA 4NPNA 3OJ3A 4GMXB 2KOXA 2EKEC 3AXCA 4KSLC 4DDGD 1WYWB 4A6KA 4JKAA 1U5EA 3DCGA 1VBHA 2L00B 4MT7A 4W9DA 2KJRA 2C9WB 2MP2A 1AQCA 3E66A 1JDEA 2QHOA 1E5WA 1HE8A 4JKHA 5LOPB 3KYDD 1K8RB 2AYOB 1BTKA 2RD0A 1U4AA 2Y7BA 5J18A 5CTRC 1U5FA 5CLQB 4F7UP 4E71A 1VD2A 3VAWA 3VTVA 4C0AA 2BKFA 4URKA 3VUXA 3QAQA 3FP5A 3KH0A 2GOWA 1WGYA 3FSSA 2KVRA 3IG3A 2C60A 3CF6E 1J8CA 2MKRA 4HHVA 3MDBC 3GYPA 4A3OA 4GIVA 4HAXB 4KV2A 2CHWA 2DZKA 3M3JA 3PT2B 4NAWA 3ODXA 1DBHA 2VKIA 1LQBA 3W1SA 5AEKB 4NSWA 1MK7B 2LULA 3AU4A 2K8HA 4ZDVA 4KHAA 2KX3A 5JLJB 1CMXB 3NOBA 1WVHA 1BWNA 2EMSA 2ADZA 5D6JB 1WI1A 2ZNVB 5E6OA 2RGNB 3APFA 2DLWA 3ZRFA 4IM0A 4E3CA 2KCJA 4BBNF 1L2NA 2MQJA 2LRWA 2OJRA 3D8DA 4RMAA 4XWXA 3HM6X 1DDMA 4AP4C 4HB0B 3KRWA 2D9XA 4GB9A 3KZ1A 1NI2A 1P98A 3ML9A 2LBBA 3QA8A 3HQCA 2WDTB 3Q3FA 1V80A 1P3QU 1PLSA 2UZRA 4FULA 2ZVOA 5E6NA 2L8JA 2K8CA 1V86A 4DBBA 4X57B 3UGBB 4IM2A 2GCJA 2MBBB 2JY6A 1D3ZA 1XR0B 2LD9A 2KFJA 4NAWB 4K1RB 1KJTA 4G11A 5DI9B 5C5BA 2N23A 3W1SC 3LDZE 2ROZB 1WJ1A 3Q3JA 2UVMA 2DENB 2N7DA 1ZW7A 3H6NA 2FDQA 3ZVVA 3PLUA 4WJOA 2P0FA 2CHZA 3VDZA 3JSVB 3DBLI 1WGQA 4BBKA 2CKHB 2IBIB 3A9JA 5LONB 1G6JA 3APCA 1V88A 2BWES 2KDEB 2AWTA 1HBKA 1ZGUB 2D9ZA 2KTRB 4FA6A 1WZ3A 2CB8A 3SV1A 3UQBA 3VQIA 2MBOA 1JRUA 2O2VB 1XX0A 4ILGB 2N1VA 4AUQC 4WVFB 4DHZE 4TYZA 4E74A 2ZVNA 4I6LB 3ONSA 4M8MA 2XK5A 2P0DA 2R82A 3WYFB 3QCAA 4GXBA 2XEWA 1XODA 4K2PA 4NJ6A 2H7EA 3RCZA 3WAMA 4IC7B 3P2BA 5D94A 2DHZA 4KDLB 5CHFA 5AZFA 2NR2A 1ZM0A 1ZSQA 3L17A 1IRSA 2L3ZA 1UBIA 4HB4B 1RFAA 3SBGA 4NJ7A 3UF8A 2DHKA 2KKCA 2KMAA 1GGOA 2W2XD 4MJSA 3CSFA 1XD4A 2L7RA 2DA0A 3R7QA 1Q67A 3ZVRA 3I3TB 3DXDA 4ZRJA 2YS5A 3IFWB 1C1YB 3IHPC 3JVZX 2LASA 2KWUB 4LDTD 2GJYA 1DIKA 3H7SA 4ZRIA 4JKGB 4N9F4 2DKPA 4KIKA 5J3TA 5EDSA 2RGFA 5CX3A 2BF8B 2X0SA 1UNRA 5C5BB 5KQ1A 2JRIB 1BT0A 2Z0PA 2YLMA 2G4SA 1U2BA 4GDLB 2I5FA 2J0KA 4GDKA 1QC6A 2JRHA 1WX8A 5LLIA 3GOEA 2V76A 2G4DB 2D9WA 5DPRA 3MTNB 3UQAA 2KGXB 5D3YA 5L81A 3PRZA 4G3XB 2DAFA 3VVWB 3PP2A 4ASWC 3PTFC 4HLEA 3QIJA 3UINB 3MHSD 5JHBA 3ULCA 1FGYA 2VRWB 4HAWB 1DDWA 3VIAA 3H7PB 4GOCA 4K7WA 4JQWC 3BINA 3T9LA 2R2QA 3ZDTA 3KUZA 4KZCA 3NZSA 3AI5A 4CO7A 1E8XA 3JW0X 4DXAB 2NPTA 4JK8A 2IY0B 2HTHB 2WYQA 3X0WA 3ZW3A 3PG7A 4H8SA 1OY2A 5DHFB 3PZDA 3VXWA 2RQ1A 2JWZA 4II3B 3R66C 5BO4B 4A20A 1RLFA 2GCLA 2HRJA 1XCGA 4B6WA 4AOFA 3CMMB 2AL6A 2AEHA 1OEYA 1PMSA 2I5CA 2KZRA 1GJZA 3RT3B 3BJIA 4AWJA 2LXAA 2YVCA 4DHZB 3PVLA 3NSUA 3FEHA 2YT0A 1Q5WB 4HAZB 5JHHA 3UZTA 3WAOA 2KDFB 1NVLA 2M1MA 4GPTB 2ZPNA 2D4QA 1P9DU 4M8NA 5D7GA 2DHIA 4Z2NA 4DWFA 2RNRB 2DZIA 2DAJA 2LGXA 3A4SC 4KAXB 1XKEA 2FCMA 4GSWA 2CR5A 2YRYA 1WR1A 4GDKB 1TGZB 2YT1A 2PE6B 2PJHA 1KBLA 2IY1B 2KNBA 3VTUA 3QK0A 1GC6A 5C1ZA 3HK0A 2REXA 5DPWA 3K9OB 5J3YA 1WXSA 1BTNA 2NMBA 3L16A 1TJ6A 2E2XA 2BWFA 1KM7A 4EOYA 4G50A 2CS4A 3AULA 4F8CB 1TTNA 1ISNA 3PLVA 1FHOA 2NBVB 5HE0A 2DZMA 1KZ7A 2Z59B 4KVGB 1WX7A 4IAPA 1WXAA 3PHWB 2K00A 2C7NB 2WH5A 2DYMA 4I6NB 5KHOA 2EC1A 2G45B 5J3QA 1WGRA 3O96A 2R0DA 2GBJA 2MBHA 2RSUA 2N9PC 4ICVA 2KN5A 4CYEA 2Z0QA 2CY5A 3O65B 1EVHA 5D3WA 1ZC3B 2FAZA 2UZSA 1C3TA 1OMWA 1EO6A 3A8QA 2IYBA 3TL5A 4AJWA 1NTVA 1DROA 4WJ7A 5IAAC 2GBMA 5DPTA 1NBFC 4FBJB 3OJ4B 2MWNB 4XX5A 2ZEQA 2UYZB 4HAUB 3QWMA 1P0RA 1FXTB 2PE9A 3P6AA 2MFQA 3V62A 3ZRCA 3RULA 2M8SA 3KYCD 2O6VB 2P0HA 3QJZA 2IFSA 1A5RA 3TVVA 4BOSC 1Z2MA 1J19A 3KUCB 1X1GA 1SE9A 1UD7A 2PPHA 3S2AA 4DX90 1E90A 1U29A 1X86A 4HATB 3D8FA 1RAXA 2JVCA 3L0WB 3ODWA 4NQLB 1FB8A 4W9FA 5AZGA 1ZC4B 2JZZA 4PYZA 5C79A 4IFSA 1KI1B 5E6PA 2GBNA 4IW0A 2KDBA 4LJPB 2D3GA 4OVUA 4HDQA 2DKQA 3X23A 3B1LX 3FLVA 2JXXA 1EAZA 1MIXA 3V60A 4HWIB 2HJ8A 4HK2A 3HIZA 3VH4B 3M1IB 2C7HA 3KSYA 2JT4B 2CRFA 1IYFA 1K5GB 4HDOA 1S1QB 3SYXA 2LVQA 3EC8A 2HE7A 5EFXA 3ALBA 5L83A 5G55A 2ZPYA 1PFJA 4B95A 5FI0A 2BCJA 3M63B 3N32A 4M0WB 4HVBA 3T06A 3DQVA 4HCPB 4ILJA 2MRPA 2IZVB 2N1WA 1E8ZA 2CODA 3FM8C 4GU2A 4Y94A 3ZO5B 2LXCA 1V9JA 3R3MA 1SHCA 1T0YA 2KLCA 3IBEA 4EEWA 3ML8A 5FR6A 3HW2B 4A6FA 2Y8FA 1MKEA 2D9VA 4DK5A 2LUEA 2COCA 2BYFA 1E8WA 4ANUA 3EHVA 5HE2A 2I1KA 2MX2A 1V89A 2NPTB 5LXIB 3WIMA 5DCNA 2WX0A 2HTHA 4K81A 2BGFA 4JK7A 4A3PA 5DH9B 4JKGA 1B55A 4MGKE 4W9IA 4KHOA 3RCPA 4KIKB 3H1UA 2MBEA 2IYDB 3TIXA 3V6EB 3TBLD 4HCNB 2MWSB 4IWQA 3RUIB 1R4NI 2QKMA 2KWCA 4Z2MB 2DX5B 4GDLA 1WXVA 2ZJDA 3OANA 2A5UA 2JP2A 1J0WA 2FIDA 3U8ZA 3ZNGC 4MM3A 2ELAA 3N3KB 1ZVRA 2FCQA 2ASQA 2IO1B 3H9DA 2K2JA 5HE3A 3A9KA 3DBSA 2LGDA 2LKOA 3VTWA 3DVNV 1MPHA 3VH3B 1KC7A 5JH5C 3CXBB 3NZUA 3PPAA 2H7DA 2MSED 2JZ3B 2FJLA 1P5TA 3A98B 2MCNB 3DVGY 3DXEA 1WJMA 1ZKHA 1SIFA 2KXJA 1H4RA 4MGYE 3IVFA 3MPXA 3ZLZA 1IPGA 3TJPA 3DBHI 4W9KA 3SD5A 1M94A 3L08A 2COFA 3KY9A 3E9OA 4TQ0A 1TZ1A 4JL9A 4G0NB 3U30A 2Q13A 1GG3A 1Z5SB 2KANA 1V5MA 4BKTA 2DX1A 4W9EA 2NS5A 4ICUA 2LOXA 2KMCA 1QQGA 1DDVA 4II2B 1I35A 1EUVB 1FHXA 2RSGA 2WWZA 1VCBA 2GBKA 1W1GA 2K8BA 4ILHA 1WE6A 2MP2B 5JHAA 2NZ8B 3C0RB 3JYUA 1FOEA 1NTYA 3SUZA 2DFKA 1X05A 3DBRI 2KUPA 4EKUA 2O6VA 4B9KA 4JK9A 4F7GA 1XQQA 1WGDA 1RJ2A 5D2MB 5DHAB 4WJNA 2K6QA 2AL3A 4MSQB 4FJZA 4YONA 2N9EB 3V61A 4DHJB 1Z87A 3B0AA 3JSVA 1GNUA 3VUWA 4GMVA 2KFKA 1OGWA 2D9YA 1XT9B 4MSMB 1HB6A 2FIFA 2V3SA 1S3SG 2KD0A 5G2NA 1EF5A 3RZWC 2Z0OA 2LRUA 3ZTCA 1L7YA 1IP9A 4CHMA 1WGUA 4BVUC 1U5GA 3ZTDA 2YS1A 2W9NA 4GGQA 3LJ3A 3ENEA 2OOBB 2L0TA 1KOTA 2N4FA 1VBGA 1M7EA 4MEMA 3ML4A 3DOWA 1WM2A 2EJ8A 3A9KB 5D3XA 5TR5A 3AJ4A 4CHJA 3P7ZA 1AWEA 5C16A 2KO3A 1WM3A 3TO1A 3ZNZB 1YIWA 3QX1A 4MGIE 2PZ1A 3ZIMA 1ST7A 2M14A 3WAPA 4PQ0A 3GYOA 1OEYJ 4YL8A 3D8EA 3RD2A 4EZKA 2LOZA 3E9LA 4KSKC 1YX6B 1WR6E 2WX1A 1UPRA 2ZNVC 3A1QA 2KHWB 1H10A 5HE1A 1V5PA 2RR9A 2MW5A 4WSFA 2Y8GA 3DPDA 1FAOA 1V6EA 2UWQA 5CLLB 2XBBC 2C7MB 2EMTA 1U27A 2W2XC 2MLBA 4EZLA 1X11A 1LM8B 3PS6A 4A5KA 4DBGA 5AZHA 4PS8A 4MJSB 2A4ZA 3VHTC 3CIKA 2K2UA 4WQOB 1UELA 2LVPA 4W9CA 4GN1A 2FCSA 1WXMA 4IWPA 1RRPB 1WG7A 3G9WA 2RVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  3N7C A;  5E6P A;  5GMV A;  2NBU A;  2GBN A;  2DYO A;  3ZRC A;  4IW0 A;  2KDB A;  5D3V A;  4W9H A;  3UQB A;  3NHE B;  4LJP B;  2D3G A;  4OVU A;  4DHJ D;  4HDQ A;  3VQI A;  2DKQ A;  3X23 A;  3B1L X;  5J2R A;  2MBQ A;  3QQ8 B;  4CHK A;  3FLV A;  2JXX A;  2K39 A;  3PGE A;  1EAZ A;  4PYU A;  1UEF A;  1MIX A;  4F7H A;  4WJP A;  3V60 A;  2MBO A;  3WAN A;  4HWI B;  1JRU A;  2LVO A;  2OTX A;  2HJ8 A;  2O2V B;  4HK2 A;  3HIZ A;  4W9J A;  2CQU A;  1XX0 A;  3M1I B;  4I6P A;  2XQN M;  3VH4 B;  2IO3 B;  4IG7 B;  2C7H A;  2LWP A;  3KSY A;  2N1V A;  2RLO A;  2JT4 B;  4AUQ C;  2CRF A;  4WVF B;  2BKR B;  4DHZ E;  1IYF A;  4ANV A;  2CAY A;  4NNJ B;  1RRB A;  1MAI A;  4WWP A;  1UNP A;  2KTF A;  1I2H A;  4TYZ A;  1K5G B;  4DX8 A;  4NQK E;  2VSZ A;  4W9G A;  3TBL D;  4BKS A;  2ZVN A;  4ANX A;  4I6L B;  4E74 A;  4HDO A;  1S1Q B;  4JGH B;  3VFK A;  4JLC A;  3ONS A;  4M8M A;  1M7R A;  1UGM A;  1NTI A;  2XK5 A;  2P0D A;  1Y19 B;  3LJU X;  4EUT A;  3SYX A;  2LVQ A;  5IA7 A;  3WYF B;  3QCA A;  4GXB A;  3EC8 A;  3SDL C;  1EF1 A;  2HE7 A;  2XEW A;  1XOD A;  4K2P A;  4NJ6 A;  1P1A A;  5EFX A;  2H7E A;  4GZU A;  1XD3 B;  3RCZ A;  3ALB A;  3WAM A;  4IC7 B;  1KZG A;  4A6H A;  3P2B A;  5L83 A;  5G55 A;  2ZPY A;  3DDC B;  2M17 A;  5D94 A;  1WMH B;  1PFJ A;  3VHT C;  2DHZ A;  3EPY A;  5FI0 A;  3B08 A;  2LGY A;  4K7U A;  4KDL B;  5CHF A;  3DXC A;  5AZF A;  2BCJ A;  3M63 B;  2DHJ A;  3N32 A;  3QWZ B;  3T06 A;  2NR2 A;  1ZM0 A;  1ZSQ A;  1GUA B;  1IRS A;  2L3Z A;  2MRP A;  3DQV A;  1UBI A;  1I7A A;  2IZV B;  2N1W A;  3QAR A;  4NY0 A;  5D27 A;  3ZUN A;  4HB4 B;  1TQZ A;  2OQB A;  1RFA A;  1E8Z A;  2J0M A;  1OTR B;  4B6H A;  2COD A;  3FM8 C;  2Z0D B;  4NJ7 A;  2DHK A;  2J59 M;  2KKC A;  3UF8 A;  4HXD A;  2D11 A;  2KMA A;  4GU2 A;  2BYE A;  3ZNH B;  2LYD A;  2DTC A;  1H8C A;  2W2X D;  4Y94 A;  1QZE A;  1E7U A;  3ZO5 B;  4F1S A;  4WJQ A;  4MJS A;  3TCA A;  4F8C B;  2LXC A;  3CSF A;  3ZDM C;  2NVU I;  4BBN C;  4FUL A;  1V9J A;  1LXD A;  1XD4 A;  3TFM A;  2L7R A;  1U5D A;  2M0X A;  2N7E A;  3PSE B;  3R3M A;  1SHC A;  4IUM B;  2DYQ A;  1T0Y A;  4ZYN A;  2DA0 A;  3R7Q A;  4LCD E;  2B3A A;  5DPS A;  2KLC A;  3IBE A;  4EEW A;  2KDI A;  1Q67 A;  2CHX A;  3ZVR A;  2M4N A;  5DIF B;  1PQS A;  3I3T B;  3DXD A;  3M62 B;  3ML8 A;  1AAR A;  2KX0 A;  3SU8 X;  4AJY B;  4EFO A;  1W1D A;  3HW2 B;  4A6F A;  4ZRJ A;  2Y8F A;  5FR6 A;  2YS5 A;  1WJN A;  3IFW B;  1C1Y B;  3IHP C;  3D32 A;  3JVZ X;  2LAS A;  2KWU B;  3WA0 A;  3A9J B;  4LDT D;  1MKE A;  2GJY A;  2D9V A;  2X18 A;  1WJ4 A;  2CU1 A;  4DK5 A;  2IO0 B;  3H7S A;  3M95 A;  4ZRI A;  2LUE A;  2COC A;  2YSZ A;  3PSC A;  1E8W A;  4IFS A;  2BYF A;  2ZCC A;  3EHV A;  4ANU A;  4BFR A;  5HE2 A;  4N9F 4;  3HHM A;  2I1K A;  2DKP A;  3PV1 A;  2MX2 A;  2D10 A;  3KW5 B;  4KIK A;  1V89 A;  5J3T A;  1V61 A;  4PS3 A;  5EDS A;  4HAV B;  2NBW B;  1Y5O A;  2W2W A;  1V5O A;  2KTR A;  2V4L A;  2NPT B;  5LXI B;  2RGF A;  1E8Y A;  3K9P B;  3WIM A;  4HB2 B;  5CX3 A;  4MY6 A;  5DCN A;  5LXH A;  4A6F B;  2WX0 A;  2YS3 A;  2HTH A;  4K81 A;  1V5T A;  2BF8 B;  2Z0E B;  1UNR A;  3QHT A;  1R4M I;  5C5B B;  2RUK B;  2BGF A;  2O2V A;  3OAW A;  5KQ1 A;  3L10 B;  2ELB A;  3PEG A;  2JRI B;  4FHJ A;  1WFY A;  3L13 A;  1BT0 A;  1WF9 A;  4FJY A;  2K6D B;  2YF0 A;  3VUY A;  3APD A;  2Z0P A;  4FJV B;  5DH9 B;  2YLM A;  4A3P A;  2GMI C;  3WAL A;  5C23 A;  5J17 A;  4W9L A;  2G4S A;  1B55 A;  3PRM B;  1U2B A;  4MGK E;  4KHO A;  4W9I A;  3RCP A;  2DX5 A;  3A33 B;  2BPS A;  2I5F A;  2J0K A;  2LG1 A;  4GDL B;  1QC6 A;  2JRH A;  4GDK A;  4KIK B;  1OQN A;  1Y8R C;  3H1U A;  3MJW A;  4MGZ E;  1N3H A;  1WX8 A;  2MBE A;  5LLI A;  3GOE A;  2V76 A;  2RPQ A;  4TUU A;  4PNK A;  1F9J A;  3KUD B;  4JIO U;  4L6E A;  2IYD B;  3TIX A;  2P8V A;  3EFU A;  3NY5 A;  2G4D B;  2D9W A;  1E7V A;  1YJ1 A;  4HCN B;  5DPR A;  2MWS B;  3MTN B;  4IWQ A;  3RUI B;  3UQA A;  2L05 A;  2KGX B;  3PVU A;  5D3Y A;  5L81 A;  3PRZ A;  3QBV B;  4G3X B;  1V49 A;  2JF5 A;  1V81 A;  4EJN A;  1WJU A;  1R4N I;  1WIA A;  1UH6 A;  2DAF A;  2QKM A;  1UNQ A;  2JPH A;  2KWC A;  3VVW B;  2FNJ B;  2KLG A;  3ULB A;  1J0G A;  2XK5 B;  5GOW B;  4Z2M B;  2L1C A;  4D0N B;  2DZJ A;  1Q0W B;  2DX5 B;  3OLM D;  1EGX A;  1WXV A;  2ZJD A;  4GDL A;  4M0W B;  3OAN A;  5HKH A;  2A5U A;  3GZN I;  3PP2 A;  4F7Z A;  1WY8 A;  2JP2 A;  1TXD A;  3EEC A;  1J0W A;  3VOQ A;  2K25 A;  4NPN A;  4ASW C;  2FID A;  1OQY A;  3PTF C;  4HLE A;  3U8Z A;  1FGZ A;  3OJ3 A;  3ZNG C;  4GMX B;  2KOX A;  4MM3 A;  3QIJ A;  3UIN B;  4NAW B;  2EKE C;  1WI0 A;  2ELA A;  3MHS D;  3AXC A;  3N3K B;  4KSL C;  1ZVR A;  2FCQ A;  3V5W A;  2N9X A;  4HPL B;  5JHB A;  2GS0 A;  3ULC A;  2ASQ A;  1FGY A;  2VRW B;  4DDG D;  4HAW B;  1DDW A;  3VIA A;  2IO1 B;  1WYW B;  4WWO A;  2KC2 A;  3H7P B;  3H9D A;  4A6K A;  4GOC A;  2K2J A;  5HE3 A;  3A9K A;  4K7W A;  3DBS A;  4IM3 A;  3RZF A;  4JQW C;  2R2O A;  3BIN A;  1U5E A;  2NCN A;  3T9L A;  2R2Q A;  1W1H A;  3DCG A;  3ZDT A;  2L00 B;  3KUZ A;  4KZC A;  3NZS A;  2LGD A;  3AI5 A;  2LKO A;  4MT7 A;  4W9D A;  2KJR A;  2C9W B;  2MP2 A;  1AQC A;  2QHO A;  3WAP A;  4CO7 A;  1E5W A;  1HE8 A;  1E8X A;  4DDI D;  3VTW A;  4FAD A;  5LOP B;  3JW0 X;  3DVN V;  2KC1 A;  3KYD D;  1KLV A;  1MPH A;  1K8R B;  2AYO B;  3VH3 B;  4K17 A;  4DXA B;  2NPT A;  1BTK A;  2CY4 A;  3CXB B;  3NZU A;  1MG8 A;  2IY0 B;  5JH5 C;  5JHG A;  5KHQ A;  4MK0 A;  2H7D A;  2RD0 A;  3PPA A;  4HVB A;  1P6S A;  2MSE D;  2HTH B;  2JZ3 B;  4EZK A;  2FJL A;  2WYQ A;  3X0W A;  3ZW3 A;  3DVN U;  3PG7 A;  4H8S A;  1P5T A;  1OY2 A;  1U4A A;  1WZ0 A;  5L95 C;  1LW3 A;  2KWV B;  5DHF B;  3PZD A;  5FI1 A;  3VXW A;  2RQ1 A;  2Y7B A;  2JWZ A;  3A98 B;  2KFK B;  4II3 B;  2MCN B;  5J18 A;  3DVG Y;  5CTR C;  3DXE A;  3F5R A;  1U5F A;  1WJM A;  1ZKH A;  3R66 C;  4FLH A;  5BO4 B;  2G3Q B;  2COP A;  1SIF A;  4FHK A;  4A20 A;  1RLF A;  2GCL A;  1WX9 A;  2HRJ A;  1XCG A;  2FCN A;  4B6W A;  5CLQ B;  4F7U P;  2KXJ A;  1P3R A;  4MH0 E;  1VD2 A;  4E71 A;  1H4R A;  4K7S A;  1SGH A;  3IVF A;  2ROV A;  3MPX A;  4MGY E;  3ZLZ A;  3CMM B;  4AOF A;  1WRD B;  2KQ7 A;  4WAA A;  4MDK E;  3VAW A;  4C0A A;  3VTV A;  2BKF A;  1IPG A;  2AL6 A;  2AEH A;  1OEY A;  3TJP A;  1PMS A;  2I5C A;  2KZR A;  4URK A;  1YX5 B;  3VUX A;  3DBH I;  1GJZ A;  3RT3 B;  3A8P A;  2K1F A;  3QAQ A;  4W9K A;  3BJI A;  3FP5 A;  1FHW A;  1M94 A;  4LDT B;  3KH0 A;  3SD5 A;  3L08 A;  2COF A;  3KY9 A;  1BAK A;  2GOW A;  4AWJ A;  1WGY A;  1TZ1 A;  4FN2 A;  4TQ0 A;  2LXA A;  3FSS A;  4JL9 A;  2KVR A;  2YVC A;  4G0N B;  4DHZ B;  3PVL A;  3NSU A;  3IG3 A;  4IOY X;  4EZJ A;  3FEH A;  2C60 A;  3KVF B;  3U30 A;  2YT0 A;  1Q5W B;  4HAZ B;  2Q13 A;  1GG3 A;  1Z5S B;  1DYN A;  5JHH A;  2KAN A;  3CF6 E;  4KZ0 A;  1V5M A;  1J8C A;  4BKT A;  3UZT A;  2DX1 A;  3UIP B;  1TBE A;  4W9E A;  2G35 A;  2NS5 A;  3WAO A;  2MKR A;  2LOX A;  3F0W A;  4HHV A;  2KDF B;  3MDB C;  1WJ6 A;  1NVL A;  2KMC A;  3GYP A;  1QQG A;  2M1M A;  4GPT B;  2ZPN A;  4A3O A;  1DDV A;  2D4Q A;  4HJK A;  4II2 B;  4GIV A;  1I35 A;  1P9D U;  4M8N A;  3R7R A;  4HAX B;  4KV2 A;  1EUV B;  2CHW A;  2DZK A;  5D7G A;  3W1Y A;  3M3J A;  4KDI C;  3PT2 B;  2DHI A;  4NAW A;  4HCP B;  1FHX A;  2RSG A;  3ODX A;  1DBH A;  2VKI A;  1LQB A;  1VCB A;  2WWZ A;  4P7I A;  4Z2N A;  2LJ5 A;  1UPQ A;  3H7P A;  3W1S A;  4DWF A;  2GBK A;  1W1G A;  3A1Q B;  2RNR B;  2DZI A;  4BOZ B;  2M38 A;  5AEK B;  2K8B A;  2DAJ A;  4NSW A;  5JP4 A;  1MK7 B;  2LGX A;  1WGG A;  2LUL A;  1WE6 A;  2MP2 B;  3AU4 A;  2K8H A;  5JHA A;  2NZ8 B;  1HB8 A;  3SHQ A;  4ZDV A;  3A4S C;  4OVV A;  3C0R B;  4KHA A;  3JYU A;  1FOE A;  1NTY A;  4KAX B;  3SUZ A;  5JLJ B;  2DFK A;  1CMX B;  2KX3 A;  3HM3 A;  3NOB A;  1WVH A;  1X05 A;  2ABD A;  1XKE A;  4TV3 A;  1BWN A;  3DBR I;  1UZX B;  2FCM A;  4GSW A;  2EMS A;  2N0Y A;  4ANW A;  2O6V D;  2KUP A;  3KRX A;  4EKU A;  2ADZ A;  2O6V A;  3RYT A;  5D6J B;  2CR5 A;  4B9K A;  2YRY A;  4F7G A;  3N30 A;  1XQQ A;  1WGD A;  1RJ2 A;  1WR1 A;  3ODO A;  1WI1 A;  1UBQ A;  1TGZ B;  2KJH B;  2ZNV B;  4GDK B;  2RGN B;  5D2M B;  3APF A;  5DHA B;  5E6O A;  4WJN A;  2YT1 A;  2DLW A;  2K6Q A;  2PE6 B;  3L17 A;  2AL3 A;  2PJH A;  3ZRF A;  4IM0 A;  1GC7 A;  4E3C A;  2KJ6 A;  2KCJ A;  4ICU A;  4MSQ B;  2HD5 B;  4BBN F;  4FJZ A;  2MQJ A;  4YON A;  1NDD A;  2LRW A;  2N9E B;  5CHW A;  1L2N A;  2OJR A;  3V61 A;  4DHJ B;  3D8D A;  3ZKJ C;  2IY1 B;  4RMA A;  4XWX A;  2KNB A;  3HM6 X;  4LJO B;  1DDM A;  3QK0 A;  3VTU A;  1GC6 A;  1Z87 A;  3B0A A;  4KHB B;  1ACA A;  4HB0 B;  1GNU A;  3JSV A;  1K5D B;  4AP4 C;  3KRW A;  3VUW A;  5C1Z A;  2D9X A;  3HK0 A;  2REX A;  4GB9 A;  4RM8 A;  4XZ4 A;  4GMV A;  3K9O B;  5DPW A;  1WGH A;  1OGW A;  2D9Y A;  2KFK A;  5J3Y A;  1XT9 B;  4MSM B;  1HB6 A;  3KZ1 A;  2FIF A;  2V3S A;  1S3S G;  1WXS A;  1BTN A;  2KD0 A;  5G2N A;  1EF5 A;  4PS7 A;  1NI2 A;  2NMB A;  3L16 A;  1P98 A;  3ML9 A;  4XC2 A;  1TJ6 A;  2BYV E;  3ECI A;  2LBB A;  3PRE A;  3QA8 A;  3RZW C;  3HQC A;  4K2O A;  2Z0O A;  2E2X A;  2BWF A;  2WDT B;  2LRU A;  2ZZP B;  3ZTC A;  1KM7 A;  4EOY A;  3L54 A;  1L7Y A;  1IP9 A;  4G50 A;  4CHM A;  3Q3F A;  3T8M A;  1WGU A;  1V80 A;  2CS4 A;  2KQS A;  3AUL A;  1TTN A;  3PRP B;  1P3Q U;  1ISN A;  3V6C B;  4BVU C;  1PLS A;  1U5G A;  1FHO A;  3PLV A;  2YS1 A;  3ZTD A;  2W9N A;  4GGQ A;  2NBV B;  2UZR A;  5HE0 A;  2DZM A;  3LJ3 A;  2FJ9 A;  1KZ7 A;  3SNH A;  2Z59 B;  4KVG B;  1WX7 A;  2ZVO A;  4IAP A;  1WXA A;  2OOB B;  3ENE A;  3PHW B;  5E6N A;  4HAY B;  2JUO A;  3UIO B;  2J0J A;  2K00 A;  2C7N B;  2L0T A;  2L8J A;  2K8C A;  2N4F A;  1KOT A;  4TKN A;  2WH5 A;  1M7E A;  2DYM A;  1LB1 A;  3ML4 A;  4MEM A;  4I6N B;  5KHO A;  2EC1 A;  3DOW A;  1V86 A;  2G45 B;  4WWN A;  2VRR B;  1WM2 A;  3PHX B;  2EJ8 A;  4DBB A;  4X57 B;  5J3Q A;  1WGR A;  3A9K B;  3UGB B;  4IM2 A;  2GCJ A;  2GBR A;  2Y5B B;  3O96 A;  5D3X A;  2R0D A;  5TR5 A;  2DYN A;  2GBJ A;  3AJ4 A;  2MBB B;  2I1J A;  2MBH A;  4CHJ A;  2JY6 A;  2N9P C;  1XR0 B;  2RSU A;  1D3Z A;  3P7Z A;  4ICV A;  2KN5 A;  4CYE A;  1WH3 A;  1AWE A;  5C16 A;  4BKG A;  2KO3 A;  5KCV A;  1WM3 A;  3ZNI D;  2Z0Q A;  3TO1 A;  2CY5 A;  3ZNZ B;  1YIW A;  3QX1 A;  4MGI E;  2PZ1 A;  3ZIM A;  1ST7 A;  3TMP B;  3O65 B;  2M14 A;  2LD9 A;  4PQ0 A;  2KFJ A;  3GYO A;  1OEY J;  3NS8 A;  4YL8 A;  1EVH A;  5D3W A;  1ZC3 B;  3D8E A;  2L76 A;  2D2Q A;  4K1R B;  2FAZ A;  3RD2 A;  2UZS A;  2LOZ A;  1KJT A;  4MEL A;  4G11 A;  4KSK C;  3ZVV A;  1C3T A;  1I42 A;  1OMW A;  1Q1O A;  1YX6 B;  1WR6 E;  2WX1 A;  2KK8 A;  1UPR A;  1EO6 A;  2ZNV C;  5DI9 B;  3A8Q A;  2IYB A;  5C5B A;  3A1Q A;  5C6R A;  3TL5 A;  2KHW B;  4AJW A;  1H10 A;  1NTV A;  2N23 A;  4WJ7 A;  5HE1 A;  1V5P A;  5KQ4 A;  1DRO A;  4TQ1 A;  2GBM A;  4EMO A;  5IAA C;  2PEA A;  1MK9 B;  5DPT A;  3W1S C;  2RR9 A;  1YD8 U;  1WE7 A;  2MW5 A;  3LDZ E;  2ROZ B;  3U7D A;  1NBF C;  1V5U A;  2V1Y A;  4FBJ B;  3OJ4 B;  2MWN B;  4WSF A;  2Y8G A;  3DPD A;  4XX5 A;  1FAO A;  1V6E A;  5IJM A;  2C5L C;  1WJ1 A;  2ZEQ A;  3Q3J A;  2UYZ B;  3RUL A;  2DYB A;  2UVM A;  5CLL B;  3PVW A;  1LFD A;  2UWQ A;  2XBB C;  3BY4 B;  2C7M B;  4HPM B;  2EMT A;  4HAU B;  2DEN B;  2N7D A;  3A4R A;  3QWM A;  1ZW7 A;  1P0R A;  1FXT B;  1YQB A;  1WMH A;  2FDQ A;  2PE9 A;  3P6A A;  2MFQ A;  1MIZ B;  1U27 A;  2W2X C;  3H6N A;  3PLU A;  3TW1 A;  2M8S A;  3KYC D;  2P0F A;  2O6V B;  2P0H A;  2MLB A;  3QJZ A;  2FUH B;  4WJO A;  3V62 A;  1NU2 A;  2IFS A;  4J6I A;  4EZL A;  1X11 A;  2CHZ A;  1A5R A;  3VDZ A;  3JSV B;  3TVV A;  1LM8 B;  3PS6 A;  4B95 A;  4RM9 A;  4BOS C;  4A5K A;  1V2Y A;  1Z2M A;  2QKL A;  1J19 A;  3KUC B;  2DN6 A;  4DBG A;  5AZH A;  1X1G A;  2MA9 B;  2MDX A;  1SE9 A;  3DBL I;  1WGQ A;  1UD7 A;  4IWO A;  4PS8 A;  2PPH A;  2ZCB A;  4MJS B;  4BBK A;  2A4Z A;  3S2A A;  3CIK A;  4DX9 0;  1E90 A;  2LZ6 A;  4HB3 B;  1U29 A;  1X1F A;  2K2U A;  1X86 A;  2CKH B;  2IO2 B;  3CST A;  2IBI B;  3DVG X;  3A9J A;  4HAT B;  4BKS D;  3D8F A;  4WQO B;  1RAX A;  2L2I A;  4ZRK A;  2JVC A;  1UEL A;  5LON B;  5CHV C;  2D07 B;  3SO6 A;  2LVP A;  4W9C A;  1G6J A;  3APC A;  5JZE B;  2R09 A;  4GN1 A;  3L0W B;  3ODW A;  1V88 A;  2BWE S;  4NQL B;  1FB8 A;  1X1M A;  2FCS A;  2KDE B;  4W9F A;  1WXM A;  2AWT A;  1HBK A;  5AZG A;  2J7Q B;  4IWP A;  1ZC4 B;  2JZZ A;  2LI5 A;  3QC8 B;  2COA A;  2D9Z A;  1RRP B;  1WG7 A;  3G9W A;  1ZGU B;  2KTR B;  3V6E B;  4FA6 A;  4PYZ A;  2RVB B;  1WZ3 A;  2CB8 A;  3SV1 A;  2L0F A;  5C79 A;  1KI1 B; 
#chains in the Genus database with same CATH topology
 3AU5 A;  1FNV A;  3N7C A;  2NBU A;  5C2T B;  2DYO A;  1EU3 A;  4RGT A;  5D3V A;  4P1C C;  4HKQ A;  2GRI A;  1D6E C;  2J53 A;  3UI3 A;  5J2R A;  3QQ8 B;  3RNB C;  1UEF A;  4F7H A;  2LVO A;  2OTX A;  4W9J A;  1QIL A;  2GI9 A;  2W82 A;  2XQN M;  2IO3 B;  4IG7 B;  2BKR B;  2LGS A;  2CAY A;  4ANV A;  4NNJ B;  1RRB A;  2DIK A;  1UF0 A;  1MAI A;  1UNP A;  2KTF A;  1I2H A;  4DX8 A;  4NQK E;  2WDV B;  4ANX A;  3VFK A;  4OZC A;  4XGA B;  1HA5 A;  3DBL B;  3LJU X;  1Y19 B;  2WQY B;  3RNG C;  3P4R B;  3BWU D;  1DGJ A;  1P1A A;  1XD3 B;  5C3J B;  4GZU A;  4M01 A;  5JVL A;  4L1B A;  2H89 B;  2BS2 B;  4ARC A;  2ON8 A;  1WMH B;  4PK1 A;  3EPY A;  2DHJ A;  3QWZ B;  3QAR A;  2W55 A;  1I7A A;  4NY0 A;  5D27 A;  1TQZ A;  2DBY A;  4L2Y A;  2OQB A;  2Z0D B;  1JCK B;  2ZW1 A;  2D11 A;  2H88 B;  2BYE A;  2PLP A;  2LYD A;  1TY0 A;  1E7U A;  3TCA A;  3ZDM C;  2NVU I;  4BBN C;  2N7E A;  4IUM B;  3EA6 A;  2NBV A;  2DYQ A;  3TEW A;  5D3D A;  2B3A A;  2KYW A;  2KDI A;  2M4N A;  2CHX A;  4A8X C;  5M4Y B;  1AAR A;  2KX0 A;  3SU8 X;  2PVG C;  1KH0 A;  1J7C A;  4CQN A;  3P63 A;  2WXR A;  2JQR B;  1XLN A;  3D32 A;  1JWA D;  2X18 A;  1WJ4 A;  2CU1 A;  2IO0 B;  2ZCC A;  3HHM A;  3PV1 A;  1XO3 A;  3KW5 B;  2AX5 A;  4PS3 A;  4HAV B;  1Y5O A;  2W2W A;  2WXM A;  1E8Y A;  4HB2 B;  4OHJ A;  5LXH A;  4A6F B;  1R4M I;  2RUK B;  2RDH A;  3AM9 A;  3L10 B;  4FHJ A;  1WF9 A;  4FJV B;  5J17 A;  3WAL A;  3IXS A;  3PRM B;  2BPS A;  1Y8R C;  4MGZ E;  1N3H A;  1YJI A;  4TUU A;  1F9J A;  3KUD B;  2P8V A;  4JKE A;  3NY5 A;  3I63 C;  1XEE A;  1V49 A;  2JPH A;  1UH6 A;  3NVZ A;  2BS3 B;  1DOI A;  3ULB A;  1YQ4 B;  1J0G A;  5GOW B;  2DZJ A;  4D0N B;  1Q0W B;  1A70 A;  5HKH A;  2KDM A;  1JWM D;  3GZN I;  5LNK 1;  2QCZ A;  4F7Z A;  2GLS A;  1TXD A;  3VOQ A;  2K25 A;  1OQY A;  1FGZ A;  4YSY B;  5FKA C;  3Q2A C;  3MC0 B;  1WI0 A;  3NWA A;  5H92 C;  2N9X A;  3V5W A;  4HPL B;  2GS0 A;  4NZL B;  3AEG B;  1K51 A;  3E9S A;  5BMG A;  4WWO A;  2KC2 A;  4JWU C;  4JKB A;  2R61 A;  4IM3 A;  3RZF A;  2R2O A;  2NCN A;  1W1H A;  2G1E A;  4WUR A;  2B76 B;  1XLP A;  1FXA A;  1GB1 A;  3N20 C;  4GOU A;  4DDI D;  1FRD A;  4FAD A;  2KC1 A;  1KLV A;  4K17 A;  2CY4 A;  1MG8 A;  3VRA B;  5JHG A;  1MHX A;  5KHQ A;  4MK0 A;  1P6S A;  1HEZ E;  3T3O A;  3DVN U;  2WXF A;  1WWT A;  1WZ0 A;  5L95 C;  1LW3 A;  3AV8 A;  2KWV B;  3SBT A;  5FI1 A;  2NMQ A;  5H8Y E;  2KFK B;  3AB5 A;  3F5R A;  4FLH A;  2G3Q B;  2COP A;  4FHK A;  1C4C A;  3NVW A;  2FCN A;  1WX9 A;  1KFY B;  1P3R A;  4MH0 E;  4K7S A;  1SGH A;  2ROV A;  1ZXI A;  2WDR B;  1WRD B;  2KQ7 A;  4WAA A;  3HIE A;  4MDK E;  5LG4 B;  1PDX A;  2HTM E;  4HSI A;  1YX5 B;  3LXF A;  3A8P A;  2K1F A;  4LDT B;  1FHW A;  4A9A A;  2MHJ A;  1BAK A;  3DWG C;  4FN2 A;  2KQ4 X;  1DYQ A;  3AE8 B;  2RDG A;  4IOY X;  4EZJ A;  3KVF B;  3MHZ A;  4KZ0 A;  1IBX A;  1DYN A;  1CK1 A;  4A90 A;  4YTN B;  4M00 A;  3UIP B;  1TBE A;  2G35 A;  3F0W A;  2D3C A;  1WJ6 A;  4HJK A;  1L6V A;  1SB3 C;  4RF0 A;  3W1Y A;  4P1B C;  1EU4 A;  4KDI C;  1FM0 D;  1DOX A;  2W54 A;  2MEK A;  4P7I A;  2LJ5 A;  1UPQ A;  3H7P A;  1L4Z B;  3TEY A;  1LGR A;  3A1Q B;  4BOZ B;  2M38 A;  3HVZ A;  4L1R A;  3HSA A;  5JP4 A;  1WGG A;  1MI1 A;  1HB8 A;  3SHQ A;  4OVV A;  3HM3 A;  1MHH E;  2ABD A;  4TV3 A;  3AEA B;  4ANW A;  1UZX B;  4JKF A;  2N0Y A;  1R7S A;  1WXQ A;  2O6V D;  2WXG A;  3KRX A;  3RYT A;  2HJ1 A;  3N30 A;  2KJH B;  3ODO A;  3LYY A;  1UBQ A;  3AE3 B;  1L0X B;  1MFW A;  3W5U B;  1GC7 A;  1JW9 D;  1TY2 A;  2E6X A;  2KJ6 A;  2HD5 B;  1NDD A;  5CHW A;  3ZKJ C;  2QEJ C;  2V0G A;  1MI0 A;  4LJO B;  3Q8F A;  1QQR A;  4KHB B;  1ACA A;  1K5D B;  2KMM A;  2Z59 A;  2RPV A;  4DIX A;  1VR9 A;  4RM8 A;  3RNC C;  4XZ4 A;  3KQ4 A;  1SBB B;  1WGH A;  4PS7 A;  3R7R A;  1AW7 A;  4XC2 A;  3ECI A;  2BYV E;  3PRE A;  5I4D A;  4K2O A;  2ZZP B;  3L54 A;  3N1Y C;  2Z14 A;  3T8M A;  2INC C;  4JKC A;  2KQS A;  3ZQ4 A;  1F77 A;  3PRP B;  3V6C B;  4XWT A;  2FJ9 A;  3SNH A;  4HAY B;  2JUO A;  3DHI C;  4FXC A;  2J0J A;  3UIO B;  1GB4 A;  4TKN A;  1LB1 A;  4WWN A;  2Z4D A;  2VRR B;  3NJT A;  3PHX B;  1C79 A;  4LTU A;  2EKI A;  1OFF A;  2L52 A;  2GBR A;  2Y5B B;  2DYN A;  2I1J A;  1FMA D;  2V3N A;  1UNS A;  1MG4 A;  2ACZ B;  1WH3 A;  2IJ0 A;  4LLG M;  4BKG A;  5KCV A;  3ZNI D;  3ENB A;  3TMP B;  2Z13 A;  3NS8 A;  2WP9 B;  2L76 A;  2D2Q A;  1I42 A;  3DHG C;  3ZJV A;  1Q1O A;  1C77 A;  2KK8 A;  4UDU C;  5C6R A;  4TQ1 A;  5EE3 A;  5KQ4 A;  2WU2 B;  4EMO A;  2PEA A;  1MK9 B;  1T6B X;  1YD8 U;  1WE7 A;  3AEB B;  3U7D A;  1V5U A;  2V1Y A;  3BZD B;  5IJM A;  2C5L C;  1XCT L;  2DYB A;  1LFD A;  3PVW A;  3Q8C A;  3BY4 B;  4HPM B;  2D3B A;  3A4R A;  1YQB A;  4LCD E;  1WMH A;  3OG5 A;  1MIZ B;  3TW1 A;  3NG0 A;  1BUI C;  2FUH B;  1NU2 A;  4J6I A;  3NW8 A;  4KGS A;  1PGX A;  2K5P A;  4RM9 A;  1V2Y A;  2QKL A;  4D6W A;  2DN6 A;  3PZ8 A;  2MA9 B;  2MDX A;  4IWO A;  2ZCB A;  4LNO A;  4LK0 M;  1IBX B;  2LZ6 A;  4HB3 B;  1X1F A;  3CST A;  2IO2 B;  3DVG X;  4BKS D;  2L2I A;  4ZRK A;  1TKG A;  5CHV C;  2D07 B;  3SO6 A;  4RGO S;  5JZE B;  2R09 A;  1X1M A;  1N62 A;  2V4I B;  4ZRP A;  2J7Q B;  2LI5 A;  3QC8 B;  4BFR A;  2COA A;  1RYJ A;  2L0F A;  4ACF A;  1L4D B;  4WH4 A;  5GMV A;  4MH8 A;  4W9H A;  4WIP A;  1EWC A;  4N59 A;  1FO4 A;  3NHE B;  4DHJ D;  1IGD A;  2MBQ A;  4CHK A;  2K39 A;  3PGE A;  4PYU A;  4WJP A;  1TS4 A;  3WAN A;  3ZXR A;  2CQU A;  4I6P A;  2LWP A;  2RLO A;  3W5V B;  5IRS A;  4WWP A;  4W9G A;  4BKS A;  2VSZ A;  4IDI A;  4JGH B;  4JLC A;  1B1Z A;  2QC8 A;  1M7R A;  1UGM A;  3AE2 B;  1NTI A;  4ZYS A;  4EUT A;  5IA7 A;  3SDL C;  1EF1 A;  3W2D A;  1QF6 A;  2PVO D;  1KZG A;  4A6H A;  3PZ7 A;  3DDC B;  2M17 A;  3B08 A;  2LGY A;  4K7U A;  3DXC A;  3ZNH B;  2WNM A;  1GUA B;  3ZUN A;  4R3D A;  2J0M A;  1OTR B;  4B6H A;  2SAK A;  2J59 M;  4HXD A;  2D5G A;  1UWX A;  2DTC A;  1XXG A;  1H8C A;  1QZE A;  4F1S A;  4WJQ A;  2BT6 A;  2WXH A;  2M0X A;  1LXD A;  4MEL A;  3TFM A;  1U5D A;  1YNT E;  3PSE B;  5MPO A;  4ZYN A;  3VR8 B;  5DPS A;  1C9F A;  3M62 B;  5DIF B;  1PQS A;  4AJY B;  4EFO A;  1W1D A;  2KUQ A;  1WJN A;  2K49 A;  5I2M A;  3E9P A;  3WA0 A;  3A9J B;  1D5Z C;  3M95 A;  2KIE A;  2YSZ A;  3PSC A;  2GB1 A;  4HRS A;  2D10 A;  1V61 A;  2NBW B;  1V5O A;  2KTR A;  2V4L A;  1VRA B;  3K9P B;  4MY6 A;  1F1H A;  2YS3 A;  1KRH A;  1V5T A;  2Z0E B;  3QHT A;  2KT7 A;  2O2V A;  3OAW A;  2ELB A;  3PEG A;  4FJY A;  1WFY A;  3L13 A;  1Q10 A;  2K6D B;  2YF0 A;  3VUY A;  3APD A;  3IT4 B;  2GMI C;  5C23 A;  4W9L A;  1SXT A;  3A33 B;  2DX5 A;  2LG1 A;  1OQN A;  3MJW A;  4WQM A;  2RPQ A;  4PNK A;  4JIO U;  4L6E A;  3EFU A;  1I4X A;  1E7V A;  1YJ1 A;  2L05 A;  3PVU A;  2EEL A;  3QBV B;  1AN8 A;  2JF5 A;  1V81 A;  4EJN A;  1WJU A;  1WIA A;  1UNQ A;  2FNJ B;  2KLG A;  1F2R C;  5BMH A;  2XK5 B;  3RNF C;  2L1C A;  3OLM D;  1EGX A;  1FCC C;  2Q5W D;  1CJE A;  4JKD A;  2MH7 A;  1WY8 A;  3EEC A;  4NPN A;  5HHD G;  1I4P A;  3GZN B;  3OJ3 A;  4GMX B;  1TJE A;  2DNF A;  2KOX A;  2UU7 A;  2EKE C;  3AXC A;  4KSL C;  1YN4 A;  1XLO A;  4LNF A;  1TT5 B;  4DDG D;  2DLB A;  3Q69 A;  1WYW B;  3LB8 C;  4A6K A;  4C4V B;  5EE0 A;  4TMA B;  4JKA A;  1U5E A;  3DCG A;  1VBH A;  2L00 B;  2LUM A;  4MT7 A;  2X8X X;  4W9D A;  1WSP A;  2KJR A;  2J4X A;  4JX1 C;  1QT9 A;  2C9W B;  2MP2 A;  1AQC A;  3E66 A;  1JDE A;  2QHO A;  3HUI A;  1E5W A;  3U52 E;  1HE8 A;  4OZB A;  1FEH A;  4JKH A;  1T77 A;  5LOP B;  3KYD D;  1VZ7 A;  1K8R B;  1V1O A;  2AYO B;  4NJC A;  1BTK A;  4H2A A;  1STE A;  4JE3 B;  2RD0 A;  4IOI E;  2RDB C;  1U4A A;  3VR9 B;  3W9C B;  5IKC M;  4Q2J A;  1HTO A;  4AQ7 A;  2Y7B A;  5J18 A;  5CTR C;  1U5F A;  4OVZ A;  3EFC A;  5CLQ B;  4F7U P;  3KLS X;  1VD2 A;  4E71 A;  3GE8 C;  3VAW A;  3VTV A;  4C0A A;  2BKF A;  4D2K A;  4URK A;  3VUX A;  3AE9 B;  3QAQ A;  3FP5 A;  1ESF A;  3KH0 A;  2AQ1 B;  2GOW A;  1WGY A;  3FSS A;  1ZXH A;  2KVR A;  1AYF A;  3IG3 A;  3IT6 B;  2C60 A;  1V8C A;  3CF6 E;  2ONQ A;  1JRP A;  1J8C A;  2WDQ B;  3KWL A;  3GP7 A;  4EE2 A;  2WS3 B;  2MKR A;  4HHV A;  3MDB C;  3GYP A;  3FIL A;  4ITK A;  4A3O A;  1VZ6 A;  4GIV A;  4QJ4 B;  4HAX B;  4KV2 A;  2CHW A;  1VJK A;  2DZK A;  2IGH A;  1FPY A;  4A55 A;  1TZO A;  3M3J A;  3PT2 B;  4NAW A;  3C8Y A;  2MJD A;  3ODX A;  1DBH A;  2VKI A;  1LQB A;  2FJU B;  3W1S A;  2KR0 A;  4S17 A;  2E3T A;  3R8B A;  5AEK B;  4NSW A;  2LFI A;  1MK7 B;  3B2G A;  3TEZ A;  2LUL A;  3SFE B;  3AU4 A;  2K8H A;  4ZDV A;  4DQO C;  4KHA A;  2KX3 A;  5JLJ B;  1CMX B;  3NOB A;  1WVH A;  1BWN A;  2EMS A;  2ADZ A;  1EM7 A;  2L1A A;  5D6J B;  2W3S A;  1WI1 A;  2ZNV B;  5E6O A;  2RGN B;  3APF A;  2DLW A;  3ZRF A;  1LO5 D;  4IM0 A;  4E3C A;  2KCJ A;  4BBN F;  1L2N A;  2MQJ A;  1YOV B;  2LRW A;  2OJR A;  2QMT A;  3D8D A;  4RMA A;  4XWX A;  3HM6 X;  1DDM A;  4AP4 C;  4HB0 B;  3KRW A;  2D9X A;  1P7E A;  4HEA 1;  4GB9 A;  4KKJ A;  4N58 A;  3FAH A;  1FIQ A;  4M02 A;  3KZ1 A;  1F0Z A;  2KAC A;  1NI2 A;  3AE7 B;  1E0Z A;  1P98 A;  3ML9 A;  2LBB A;  3QA8 A;  3HQC A;  2WDT B;  5FK9 C;  3BYT B;  3Q3F A;  1V80 A;  1P3Q U;  1PLS A;  2UZR A;  2XN9 C;  5HG2 A;  2ZVO A;  3Q3O C;  4FUL A;  5E6N A;  1GPX A;  2L8J A;  2K8C A;  3KWV A;  1V86 A;  1FRR A;  4C00 A;  4ARI A;  4DBB A;  4X57 B;  3UGB B;  1HQR D;  1C4P A;  1FNW A;  2GCJ A;  4IM2 A;  3N9Y C;  2MBB B;  2JY6 A;  1D3Z A;  1XR0 B;  1QOB A;  2JWU A;  2LD9 A;  2KFJ A;  2QJL A;  2MJ3 A;  4K1R B;  4NAW B;  1E9M A;  1KJT A;  4G11 A;  3BVG A;  5DI9 B;  5C5B A;  3TSS A;  2N23 A;  1T0S C;  2N9L A;  3W1S C;  3B9J A;  1QLB B;  3LDZ E;  2ROZ B;  4YWG G;  1JWS D;  1XF5 L;  1NYR A;  4C7Y A;  1WJ1 A;  3Q3J A;  2UVM A;  4OT1 A;  2JXT A;  4DXF A;  2DEN B;  2N7D A;  1ZW7 A;  1QOF A;  3H6N A;  2FDQ A;  3R2T A;  3ZVV A;  2MJE A;  3PLU A;  4WJO A;  2P0F A;  1WGK A;  4XE0 A;  2VZK D;  2CHZ A;  3VDZ A;  3JSV B;  1EWY C;  4ZHP A;  2K9X A;  1C76 A;  3DBL I;  1WGQ A;  2L32 A;  4BBK A;  3AEC B;  1ZOY B;  2CKH B;  1NEK B;  2IBI B;  3A9J A;  1YQ3 B;  1CQV A;  5LON B;  1G6J A;  3APC A;  1N5W A;  5I2S A;  1V88 A;  2BWE S;  1KTK A;  2KDE B;  2AWT A;  1HBK A;  1PGB A;  4RCO A;  1C78 A;  1ZGU B;  2D9Z A;  1TYG B;  2KTR B;  4JPS A;  4FA6 A;  1WZ3 A;  2CB8 A;  3SV1 A;  4LNK A;  4C7Z A;  1BML C;  4BAX A;  4KX6 B;  3P42 A;  1K50 A;  4A6Q A;  1ZE3 D;  3UQB A;  1L5P A;  3VQI A;  3BVZ A;  1FD6 A;  2JU6 X;  4RH6 A;  1HXY D;  2MBO A;  1JRU A;  2O2V B;  1XX0 A;  4ILG B;  1SF0 A;  2N1V A;  4AUQ C;  4WVF B;  1WYG A;  4DHZ E;  4TYZ A;  4LNI A;  4E74 A;  2ZVN A;  3ETR A;  2INP E;  4I6L B;  3ONS A;  4M8M A;  3GE3 C;  2XK5 A;  2P0D A;  2R82 A;  4XWW A;  3WYF B;  3QCA A;  4GXB A;  3RFZ B;  2XEW A;  1XOD A;  4K2P A;  4NJ6 A;  2H7E A;  3RCZ A;  1BXT A;  3WAM A;  1I4Q A;  4IC7 B;  3P2B A;  4KHB A;  1V97 A;  2NTT A;  5D94 A;  3U7Z A;  2DHZ A;  4KDL B;  5CHF A;  5AZF A;  2BYT A;  2NR2 A;  1ZM0 A;  1ZSQ A;  3L17 A;  1IRS A;  2L3Z A;  1UBI A;  4HB4 B;  1RFA A;  3SBG A;  4NJ7 A;  3UF8 A;  2DHK A;  2KKC A;  2KMA A;  1GGO A;  1T0R C;  3Q8A A;  3DCX A;  1PUT A;  2W2X D;  4YT0 B;  4MJS A;  3CSF A;  1XD4 A;  2L7R A;  2KIG A;  2J52 A;  4IKG A;  2DA0 A;  1OQQ A;  3R7Q A;  2INN E;  1Q67 A;  3ZVR A;  3I3T B;  3DXD A;  4ZRJ A;  2YS5 A;  3IFW B;  1C1Y B;  3IHP C;  3JVZ X;  2LAS A;  2KWU B;  4LDT D;  2GJY A;  1T5X D;  1DIK A;  1SJH D;  3H7S A;  4ZRI A;  2R2Y A;  1FXI A;  4YTM B;  4JKG B;  4N9F 4;  1WRI A;  2WHI A;  2DKP A;  4P6V F;  4KIK A;  5J3T A;  5EDS A;  1PYW D;  2QSD A;  1QOA A;  3GS2 A;  2RGF A;  5BYQ A;  5CX3 A;  4RFB A;  3V3X A;  2BF8 B;  2X0S A;  1UNR A;  1SEB D;  2JYT A;  5C5B B;  4OW0 A;  5KQ1 A;  2JRI B;  1BT0 A;  2Z0P A;  2YLM A;  2G4S A;  1U2B A;  4GDL B;  2I5F A;  2J0K A;  4GDK A;  1OQR A;  1QC6 A;  2JRH A;  1WX8 A;  5LLI A;  2WXI A;  3GOE A;  2V76 A;  5EE1 A;  2G4D B;  2D9W A;  2Z8L A;  5DPR A;  5BYS A;  1D4B A;  3MTN B;  3UQA A;  2KGX B;  1L0V B;  5D3Y A;  5L81 A;  3PRZ A;  4HRO A;  4G3X B;  2DAF A;  3VVW B;  2KAJ A;  3NUH B;  3MC9 A;  1MJD A;  3WCQ A;  1JRO A;  3NS1 A;  3PP2 A;  2PMV A;  1I4G A;  3AEF B;  4ASW C;  3N1X C;  3PTF C;  3A58 A;  1GAQ B;  4HLE A;  4HPP A;  4WAF A;  3QIJ A;  1VDV A;  3UIN B;  1ET6 A;  3BVM A;  3MHS D;  4N6E B;  2WXK A;  5JHB A;  3ULC A;  3OWE B;  1FGY A;  2VRW B;  4HAW B;  1DDW A;  3VIA A;  3H7P B;  4GOC A;  4K7W A;  3RMK C;  3J9C A;  3HRD D;  4JQW C;  3BIN A;  3T9L A;  2R2Q A;  3ZDT A;  3KUZ A;  4KZC A;  3NZS A;  3AI5 A;  2YEP F;  1KF6 B;  4CO7 A;  2SEB D;  3AE1 B;  1E8X A;  3JW0 X;  1K53 A;  2K3U A;  3HVD A;  3L4P A;  4DXA B;  1IUE A;  2NPT A;  4JK8 A;  2IY0 B;  3SR6 A;  2HTH B;  2WYQ A;  3X0W A;  3ZW3 A;  1P7F A;  3PG7 A;  4H8S A;  4J3O D;  1OY2 A;  1T3Q A;  4MAC A;  5DHF B;  3PZD A;  1MVK A;  2RQ1 A;  3VXW A;  2JWZ A;  4II3 B;  3ABV B;  1CZP A;  3R66 C;  5BO4 B;  3Q3N C;  3IAM 1;  4A20 A;  1RLF A;  2GCL A;  2HRJ A;  1XCG A;  4B6W A;  3PO0 A;  1ACC A;  2BB5 A;  4AOF A;  5G5H A;  3CMM B;  2LHE A;  1SJE D;  2AL6 A;  2AEH A;  1OEY A;  3BK1 A;  4US8 A;  1PMS A;  2I5C A;  2KZR A;  1GJZ A;  3ZJU A;  1YMH E;  3RT3 B;  3BJI A;  2LJI A;  4AWJ A;  1FNU A;  2LXA A;  2YVC A;  4DHZ B;  3PVL A;  3NSU A;  3FEH A;  2YT0 A;  1Q5W B;  4HAZ B;  5JHH A;  3UZT A;  3I57 A;  2Y5P A;  3WAO A;  2KDF B;  3MC8 A;  4OSN A;  1NVL A;  2M1M A;  4GPT B;  2ZPN A;  2D4Q A;  1P9D U;  4M8N A;  1JWB D;  1FCL A;  5D7G A;  2DHI A;  4Z2N A;  2I38 A;  2RRF A;  3Q8E A;  1R4N B;  4REZ A;  4DWF A;  3MP9 A;  2RNR B;  2DZI A;  4QJ3 B;  2DAJ A;  2LGX A;  1Y56 A;  2K8E A;  3A4S C;  4KAX B;  1XKE A;  2FCM A;  4GSW A;  3AMZ A;  4AS1 A;  1SE4 A;  2WXJ A;  2CR5 A;  2YRY A;  1WR1 A;  4GDK B;  4LNN A;  1TGZ B;  2YT1 A;  2PE6 B;  4ZOH C;  2PJH A;  1HTQ A;  1KBL A;  1L0Y B;  1NI3 A;  2ZKM X;  2IY1 B;  1FFU A;  2KNB A;  3VTU A;  3QK0 A;  1GC6 A;  5C1Z A;  3HK0 A;  2REX A;  1PGA A;  5DPW A;  3K9O B;  5J3Y A;  1N61 A;  1WXS A;  1BTN A;  2NMB A;  3L16 A;  1TJ6 A;  1B9R A;  2E2X A;  2BWF A;  1KM7 A;  4EOY A;  2IND C;  3ZXV A;  4G50 A;  1L6U A;  1MPE A;  2CS4 A;  3AUL A;  4F8C B;  1I4H A;  1TTN A;  1ISN A;  3PLV A;  1FHO A;  2J42 A;  2NBV B;  5HE0 A;  2DZM A;  1KZ7 A;  2Z59 B;  4KVG B;  1WX7 A;  4IAP A;  1WXA A;  3PHW B;  2K00 A;  2C7N B;  2PW9 A;  5IP4 D;  2WH5 A;  2DYM A;  4I6N B;  5KHO A;  2EC1 A;  2G45 B;  5J3Q A;  1WGR A;  3I9V 1;  3OHM B;  3O96 A;  2R0D A;  2GBJ A;  1QOG A;  2MBH A;  2RSU A;  2N9P C;  4ICV A;  2CJO A;  2KN5 A;  4CYE A;  5BYR A;  2N0S B;  2Z0Q A;  2CY5 A;  5EE9 A;  3O65 B;  5AUI A;  1EVH A;  3SEB A;  5D3W A;  1ZC3 B;  2JYE A;  2FAZ A;  2UZS A;  1C3T A;  4XYC A;  4DXG A;  1OMW A;  2LHD A;  1EO6 A;  3A8Q A;  2IYB A;  3TL5 A;  4AJW A;  1NTV A;  1DRO A;  1VLB A;  4WJ7 A;  3P1M A;  5GXG B;  5IAA C;  2GBM A;  1J7B A;  3MJ5 A;  4XDC A;  5DPT A;  2V9H A;  1NBF C;  4FBJ B;  3OJ4 B;  2MWN B;  3N1Z C;  4XX5 A;  2ZEQ A;  2UYZ B;  4KGT A;  4GLS C;  4HAU B;  2IGG A;  3QWM A;  1P0R A;  3U12 A;  1FXT B;  2ICI A;  2PE9 A;  3P6A A;  2MFQ A;  3V62 A;  3ZRC A;  3RUL A;  2M8S A;  3KYC D;  2O6V B;  2P0H A;  3QJZ A;  3TEX A;  2IFS A;  1V1P B;  5JXV A;  1A5R A;  4JWS C;  3TVV A;  2WLB A;  3TUO A;  2WU5 B;  4BOS C;  1Z2M A;  1J19 A;  3KUC B;  2QIL A;  1X1G A;  1SE9 A;  1UD7 A;  2PPH A;  4TSS A;  3S2A A;  3P4Q B;  4DX9 0;  1E90 A;  1U29 A;  3U4E G;  1X86 A;  4HAT B;  4O1N A;  3D8F A;  1RAX A;  2JVC A;  3L0W B;  3ODW A;  5E6J A;  4NQL B;  1FB8 A;  3AED B;  4W9F A;  3E56 A;  5AZG A;  1ZC4 B;  2JZZ A;  3B2F A;  4HJG E;  4PYZ A;  2KN4 A;  4WWM A;  5C79 A;  1KLG D;  4RNA A;  4IFS A;  1KI1 B;  2NTS A;  5E6P A;  4QAY A;  1JAL A;  2GBN A;  2BBC A;  3NVV A;  4IW0 A;  2KDB A;  3MFG A;  3ZGZ A;  4KGR A;  4LJP B;  2D3G A;  4OVU A;  4HDQ A;  2DKQ A;  3X23 A;  3B1L X;  3FLV A;  2JXX A;  2QDF A;  1EAZ A;  1MIX A;  2LGI A;  1YN3 A;  3BYY B;  3V60 A;  2Y5C A;  3NRZ A;  4HWI B;  2HJ8 A;  4HK2 A;  3HIZ A;  1SSN A;  3RN9 C;  3VH4 B;  3M1I B;  2BW2 A;  1GOZ A;  2C7H A;  3KSY A;  1R4M B;  2JT4 B;  3DHH C;  2CRF A;  1IYF A;  3V05 A;  1K5G B;  4HDO A;  1S1Q B;  3RPF C;  3SYX A;  2LVQ A;  3EC8 A;  2HE7 A;  1D5X C;  5EFX A;  3U2S C;  1D5M C;  1YJJ A;  3ALB A;  3AE5 B;  2WXL A;  2BTE A;  5L83 A;  5G55 A;  2ZPY A;  4MT5 A;  1PFJ A;  4B95 A;  5FI0 A;  2PKO A;  3R2I A;  2BCJ A;  3M63 B;  3N32 A;  1RWS A;  4M0W B;  3T06 A;  3DQV A;  4MM3 B;  4HCP B;  4HVB A;  4ILJ A;  2MRP A;  2IZV B;  2N1W A;  1PFD A;  3NVY A;  1E8Z A;  1N5X A;  2COD A;  3FM8 C;  5TSS A;  4GU2 A;  5AUK A;  3URY A;  2YEP B;  4Y94 A;  3ZO5 B;  2LXC A;  4C80 A;  1V9J A;  3R3M A;  2WXP A;  1SHC A;  1T0Y A;  2KLC A;  3IBE A;  4EEW A;  1TKY A;  2WGS A;  3ML8 A;  1NYQ A;  5FR6 A;  3HW2 B;  4A6F A;  2Y8F A;  1YN5 A;  4C4V A;  4L23 A;  2PIA A;  4HKZ E;  2IPK D;  1MKE A;  2D9V A;  4USA A;  4DK5 A;  4NAM A;  2LUE A;  4RGN A;  2COC A;  2BYF A;  1E8W A;  4ANU A;  4GNK B;  1T0Q C;  3EHV A;  2TSS A;  5HE2 A;  2I1K A;  1NEN B;  1XCQ L;  2MX2 A;  4YXD B;  1V89 A;  2M56 B;  1SIJ A;  3P4P B;  4US9 A;  3EGR A;  2NPT B;  5LXI B;  2VH1 A;  3WIM A;  5FR3 A;  5DCN A;  3SFD B;  2WX0 A;  2HTH A;  2I2Y A;  4K81 A;  2BGF A;  1NVI D;  3RNE C;  4JK7 A;  4A3P A;  5DH9 B;  2OED A;  4JKG A;  3AH7 A;  2JX5 A;  1B55 A;  4MGK E;  4W9I A;  4KHO A;  3RCP A;  4KIK B;  3H1U A;  2MBE A;  2LEK A;  2IYD B;  3TIX A;  2FBW B;  3NWF A;  3V6E B;  3TBL D;  4HCN B;  3T3N A;  2MWS B;  4IWQ A;  3RUI B;  2WXQ A;  1QKZ A;  1R4N I;  1AWD A;  2QKM A;  2BS4 B;  2KWC A;  2W3R A;  1C4A A;  4Z2M B;  2DX5 B;  4B0E A;  4GDL A;  1WXV A;  2ZJD A;  3OAN A;  1FFV A;  5HFY A;  3B77 A;  5IOI A;  2A5U A;  2BQQ A;  2JP2 A;  1J0W A;  1TKE A;  1IGC A;  2FID A;  2N7J A;  3U8Z A;  3ZNG C;  4M0W A;  4MM3 A;  2D3A A;  4ZRQ A;  2ELA A;  3N3K B;  1ZVR A;  2FCQ A;  2ASQ A;  1ET9 A;  4QJ5 B;  2GUM A;  2IO1 B;  4QXA B;  1UUP A;  3H9D A;  2K2J A;  5HE3 A;  1HZ5 A;  2KVZ A;  3A9K A;  3DBS A;  2RMM A;  3CIR B;  3NZ3 A;  2LGD A;  2LKO A;  1ZDX A;  3FKY A;  3VTW A;  1RFK A;  3DVN V;  1M4V A;  1MPH A;  3VH3 B;  1KC7 A;  3BII D;  3GB1 A;  4K3C A;  5JH5 C;  4S0R A;  3CXB B;  2CJN A;  3NZU A;  3PPA A;  2H7D A;  4K3B A;  2MSE D;  2JZ3 B;  2FJL A;  1JWU D;  1P5T A;  4OZA A;  1ROE A;  5BMI A;  2AQ2 B;  3A98 B;  2MCN B;  3DVG Y;  3DXE A;  1WJM A;  1ZKH A;  1SIF A;  2JZP A;  2KXJ A;  5G5G A;  3DBH B;  1H4R A;  2WXN A;  4MGY E;  3IVF A;  3MPX A;  3ZLZ A;  5IN7 A;  1IPG A;  3TJP A;  1K52 A;  4YSX B;  1KLU D;  3DBH I;  4W9K A;  3SD5 A;  2K22 A;  1M94 A;  1F52 A;  3L08 A;  2COF A;  3KY9 A;  3E9O A;  3O13 A;  2DWQ A;  4TQ0 A;  1TZ1 A;  4JL9 A;  3CWI A;  4G0N B;  3BK2 A;  3U30 A;  3IAS 1;  2Q13 A;  1GG3 A;  1Z5S B;  2KAN A;  1V5M A;  4BKT A;  2DX1 A;  3FC4 A;  3P4S B;  4W9E A;  2NS5 A;  4CSQ A;  4ICU A;  2LOX A;  1E7P B;  2X38 A;  2KMC A;  1QQG A;  1DDV A;  4II2 B;  1I35 A;  1UGJ A;  2M0A A;  1EUV B;  3ZJT A;  3I5J C;  2LMC A;  1FHX A;  2RSG A;  2WWZ A;  1VCB A;  2GBK A;  1W1G A;  3H8H A;  1I4R A;  2V3P A;  2K8B A;  4ILH A;  3FIL B;  2L83 A;  1WE6 A;  2MP2 B;  5JHA A;  2NZ8 B;  3Q14 C;  3C0R B;  1VZ8 A;  5HI1 A;  3JYU A;  2JSV X;  1FOE A;  1NTY A;  3SUZ A;  2DFK A;  1SE2 A;  3Q3M C;  1X05 A;  3DBR I;  1F2R I;  4B0M A;  1I7H A;  2OJW A;  2KUP A;  2AQ3 B;  4EKU A;  2O6V A;  2QIE B;  1V1P A;  2XNA C;  4JK9 A;  4B9K A;  4F7G A;  1XQQ A;  1WGD A;  1RJ2 A;  5D2M B;  5DHA B;  4WJN A;  2K6Q A;  1SE3 A;  2AL3 A;  3RI7 C;  2FE8 A;  4MSQ B;  3VRB B;  4FJZ A;  4YON A;  2N9E B;  1N60 A;  1UWM A;  2M19 A;  3V61 A;  4DHJ B;  1HZ6 A;  1E6E B;  3NWD A;  1Z87 A;  3B0A A;  2HDE A;  3JSV A;  1GNU A;  4BZA A;  3VUW A;  2ZW0 A;  4GMV A;  2KFK A;  1OGW A;  2D9Y A;  1ENF A;  1XT9 B;  1ZP0 B;  4MSM B;  1HB6 A;  2FIF A;  3RNA C;  2V3S A;  1S3S G;  2KD0 A;  5G2N A;  1EF5 A;  4ZHO A;  3AE6 B;  5T8I A;  3RZW C;  2Z0O A;  3AEE B;  2LRU A;  4KKI A;  3ZTC A;  2G9H D;  2BB6 A;  3AE4 B;  1L7Y A;  1IP9 A;  4CHM A;  3Q8B A;  1WGU A;  1XLQ A;  3AN1 A;  4BVU C;  1U5G A;  3ZTD A;  2YS1 A;  2W9N A;  4GGQ A;  3LJ3 A;  3ENE A;  3Q6B A;  2OOB B;  2L0T A;  1KOT A;  2N4F A;  1VBG A;  1M7E A;  4MEM A;  3ML4 A;  3DOW A;  1RM6 C;  2OHF A;  1WM2 A;  2EJ8 A;  5D3I B;  3A9K B;  2YT2 A;  5D3X A;  5TR5 A;  3AJ4 A;  1JQ4 A;  2VZK B;  4CHJ A;  3P7Z A;  1AWE A;  1E10 A;  5C16 A;  2KO3 A;  1WM3 A;  3TO1 A;  4YSZ B;  4PT5 A;  3ZNZ B;  1YIW A;  3QX1 A;  4MGI E;  2PZ1 A;  1ZDV A;  1ST7 A;  3ZIM A;  2M14 A;  3WAP A;  4PQ0 A;  3GYO A;  1OEY J;  3FVC A;  4YL8 A;  2WXO A;  3D8E A;  3RD2 A;  4EZK A;  1TS3 A;  2LOZ A;  4RGM A;  3E9L A;  4KSK C;  1YX6 B;  1WR6 E;  2WX1 A;  1UPR A;  2ZNV C;  1TS5 A;  3A1Q A;  2KHW B;  1H10 A;  5HE1 A;  1V5P A;  1TIF A;  1N6Z A;  2RR9 A;  2MW5 A;  2BVC A;  4WSF A;  2Y8G A;  3DPD A;  1FAO A;  1TS2 A;  1V6E A;  4XDD A;  2UWQ A;  5CLL B;  2VH2 A;  2XBB C;  1JML A;  2C7M B;  2EMT A;  1U27 A;  2W2X C;  3DWM A;  5IO9 A;  2Y3A A;  2MLB A;  1N63 A;  4EZL A;  1X11 A;  1LM8 B;  3PS6 A;  2K0P A;  4A5K A;  2CU3 A;  2IDY A;  1ZPS A;  3C19 A;  4DBG A;  5AZH A;  4P16 A;  4PS8 A;  4MJS B;  2A4Z A;  3CIK A;  3VHT C;  2K2U A;  3ZYY X;  2PTL A;  4C56 C;  4RF1 A;  4WQO B;  4YTP B;  1UEL A;  2LVP A;  4W9C A;  3EUB 2;  4GN1 A;  2FUG 1;  1DOY A;  2KWD A;  2FCS A;  3DBR B;  1WXM A;  1J7A A;  4IWP A;  2N9K A;  1ZYI A;  1RRP B;  1WG7 A;  3G9W A;  2RVB B;  2IGD A;  1ZUD 2; 
#chains in the Genus database with same CATH homology
 3AU5 A;  3N7C A;  2NBU A;  2DYO A;  5D3V A;  5J2R A;  3QQ8 B;  1UEF A;  4F7H A;  2LVO A;  2OTX A;  4W9J A;  2XQN M;  2IO3 B;  4IG7 B;  2BKR B;  4ANV A;  2CAY A;  4NNJ B;  1RRB A;  2DIK A;  1MAI A;  1UNP A;  2KTF A;  1I2H A;  4DX8 A;  4NQK E;  4ANX A;  3VFK A;  3LJU X;  1Y19 B;  1P1A A;  1XD3 B;  4GZU A;  5JVL A;  1WMH B;  3EPY A;  2DHJ A;  3QWZ B;  3QAR A;  1I7A A;  4NY0 A;  5D27 A;  1TQZ A;  2OQB A;  2Z0D B;  2D11 A;  2BYE A;  2LYD A;  1E7U A;  3TCA A;  3ZDM C;  2NVU I;  4BBN C;  2N7E A;  4IUM B;  2DYQ A;  2B3A A;  2KDI A;  2M4N A;  2CHX A;  1AAR A;  2KX0 A;  3SU8 X;  3D32 A;  2X18 A;  1WJ4 A;  2CU1 A;  2IO0 B;  2ZCC A;  3HHM A;  3PV1 A;  3KW5 B;  4PS3 A;  4HAV B;  1Y5O A;  2W2W A;  1E8Y A;  4HB2 B;  5LXH A;  4A6F B;  1R4M I;  2RUK B;  3L10 B;  4FHJ A;  1WF9 A;  4FJV B;  5J17 A;  3WAL A;  3PRM B;  2BPS A;  1Y8R C;  4MGZ E;  1N3H A;  4TUU A;  1F9J A;  3KUD B;  2P8V A;  4JKE A;  3NY5 A;  1V49 A;  2JPH A;  1UH6 A;  3ULB A;  1J0G A;  5GOW B;  2DZJ A;  4D0N B;  1Q0W B;  5HKH A;  3GZN I;  4F7Z A;  1TXD A;  3VOQ A;  2K25 A;  1OQY A;  1FGZ A;  1WI0 A;  2N9X A;  3V5W A;  4HPL B;  2GS0 A;  4WWO A;  2KC2 A;  4JKB A;  4IM3 A;  3RZF A;  2R2O A;  2NCN A;  1W1H A;  4DDI D;  4FAD A;  2KC1 A;  1KLV A;  4K17 A;  2CY4 A;  1MG8 A;  5JHG A;  5KHQ A;  4MK0 A;  1P6S A;  3DVN U;  1WZ0 A;  5L95 C;  1LW3 A;  2KWV B;  3SBT A;  5FI1 A;  2KFK B;  3F5R A;  4FLH A;  2G3Q B;  2COP A;  4FHK A;  2FCN A;  1WX9 A;  1P3R A;  4MH0 E;  4K7S A;  1SGH A;  2ROV A;  1WRD B;  2KQ7 A;  4WAA A;  4MDK E;  1YX5 B;  3A8P A;  2K1F A;  4LDT B;  1FHW A;  1BAK A;  4FN2 A;  4IOY X;  4EZJ A;  3KVF B;  4KZ0 A;  1DYN A;  3UIP B;  1TBE A;  2G35 A;  3F0W A;  1WJ6 A;  4HJK A;  3W1Y A;  4KDI C;  4P7I A;  2LJ5 A;  1UPQ A;  3H7P A;  3A1Q B;  4BOZ B;  2M38 A;  5JP4 A;  1WGG A;  1HB8 A;  3SHQ A;  4OVV A;  3HM3 A;  2ABD A;  4TV3 A;  4ANW A;  1UZX B;  4JKF A;  2N0Y A;  2O6V D;  3KRX A;  3RYT A;  3N30 A;  2KJH B;  3ODO A;  1UBQ A;  1GC7 A;  2KJ6 A;  2HD5 B;  1NDD A;  5CHW A;  3ZKJ C;  4LJO B;  4KHB B;  1ACA A;  1K5D B;  4RM8 A;  4XZ4 A;  1WGH A;  4PS7 A;  3R7R A;  4XC2 A;  3ECI A;  2BYV E;  3PRE A;  4K2O A;  2ZZP B;  3L54 A;  3T8M A;  4JKC A;  2KQS A;  3PRP B;  3V6C B;  2FJ9 A;  3SNH A;  4HAY B;  2JUO A;  3UIO B;  2J0J A;  4TKN A;  1LB1 A;  4WWN A;  2VRR B;  3PHX B;  2GBR A;  2Y5B B;  2DYN A;  2I1J A;  1WH3 A;  4BKG A;  5KCV A;  3ZNI D;  3ENB A;  3TMP B;  3NS8 A;  2L76 A;  2D2Q A;  1I42 A;  1Q1O A;  2KK8 A;  5C6R A;  4TQ1 A;  5KQ4 A;  4EMO A;  2PEA A;  1MK9 B;  1YD8 U;  1WE7 A;  3U7D A;  1V5U A;  2V1Y A;  5IJM A;  2C5L C;  2DYB A;  1LFD A;  3PVW A;  3BY4 B;  4HPM B;  3A4R A;  4LCD E;  1YQB A;  1WMH A;  1MIZ B;  3TW1 A;  2FUH B;  1NU2 A;  4J6I A;  4RM9 A;  1V2Y A;  2QKL A;  2DN6 A;  2MA9 B;  2MDX A;  4IWO A;  2ZCB A;  2LZ6 A;  4HB3 B;  1X1F A;  3CST A;  2IO2 B;  3DVG X;  4BKS D;  2L2I A;  4ZRK A;  5CHV C;  2D07 B;  3SO6 A;  5JZE B;  2R09 A;  1X1M A;  2J7Q B;  2LI5 A;  4BFR A;  3QC8 B;  2COA A;  2L0F A;  5GMV A;  4W9H A;  3NHE B;  4DHJ D;  2MBQ A;  4CHK A;  2K39 A;  3PGE A;  4PYU A;  4WJP A;  3WAN A;  2CQU A;  4I6P A;  2LWP A;  2RLO A;  4WWP A;  4W9G A;  4BKS A;  2VSZ A;  4JGH B;  4JLC A;  1M7R A;  1UGM A;  1NTI A;  4EUT A;  5IA7 A;  3SDL C;  1EF1 A;  1KZG A;  4A6H A;  3DDC B;  2M17 A;  3B08 A;  2LGY A;  4K7U A;  3DXC A;  3ZNH B;  1GUA B;  3ZUN A;  2J0M A;  1OTR B;  4B6H A;  2J59 M;  4HXD A;  2DTC A;  1H8C A;  1QZE A;  4F1S A;  4WJQ A;  2M0X A;  1LXD A;  4MEL A;  3TFM A;  1U5D A;  3PSE B;  4ZYN A;  5DPS A;  3M62 B;  5DIF B;  1PQS A;  4AJY B;  4EFO A;  1W1D A;  1WJN A;  3E9P A;  3WA0 A;  3A9J B;  3M95 A;  2YSZ A;  3PSC A;  2D10 A;  1V61 A;  2NBW B;  1V5O A;  2KTR A;  2V4L A;  3K9P B;  4MY6 A;  2YS3 A;  1V5T A;  2Z0E B;  3QHT A;  2O2V A;  3OAW A;  2ELB A;  3PEG A;  4FJY A;  1WFY A;  3L13 A;  2K6D B;  2YF0 A;  3VUY A;  3APD A;  2GMI C;  5C23 A;  4W9L A;  3A33 B;  2DX5 A;  2LG1 A;  1OQN A;  3MJW A;  2RPQ A;  4PNK A;  4JIO U;  4L6E A;  3EFU A;  1E7V A;  1YJ1 A;  2L05 A;  3PVU A;  3QBV B;  2JF5 A;  1V81 A;  4EJN A;  1WJU A;  1WIA A;  1UNQ A;  2FNJ B;  2KLG A;  2XK5 B;  2L1C A;  3OLM D;  1EGX A;  4JKD A;  1WY8 A;  3EEC A;  4NPN A;  3OJ3 A;  4GMX B;  2KOX A;  2EKE C;  3AXC A;  4KSL C;  4DDG D;  1WYW B;  4A6K A;  4JKA A;  1U5E A;  3DCG A;  1VBH A;  2L00 B;  4MT7 A;  4W9D A;  2KJR A;  2C9W B;  2MP2 A;  1AQC A;  3E66 A;  1JDE A;  2QHO A;  1E5W A;  1HE8 A;  4JKH A;  5LOP B;  3KYD D;  1K8R B;  2AYO B;  1BTK A;  2RD0 A;  1U4A A;  2Y7B A;  5J18 A;  5CTR C;  1U5F A;  5CLQ B;  4F7U P;  4E71 A;  1VD2 A;  3VAW A;  3VTV A;  4C0A A;  2BKF A;  4URK A;  3VUX A;  3QAQ A;  3FP5 A;  3KH0 A;  2GOW A;  1WGY A;  3FSS A;  2KVR A;  3IG3 A;  2C60 A;  3CF6 E;  1J8C A;  2MKR A;  4HHV A;  3MDB C;  3GYP A;  4A3O A;  4GIV A;  4HAX B;  4KV2 A;  2CHW A;  2DZK A;  3M3J A;  3PT2 B;  4NAW A;  3ODX A;  1DBH A;  2VKI A;  1LQB A;  3W1S A;  5AEK B;  4NSW A;  1MK7 B;  2LUL A;  3AU4 A;  2K8H A;  4ZDV A;  4KHA A;  2KX3 A;  5JLJ B;  1CMX B;  3NOB A;  1WVH A;  1BWN A;  2EMS A;  2ADZ A;  5D6J B;  1WI1 A;  2ZNV B;  5E6O A;  2RGN B;  3APF A;  2DLW A;  3ZRF A;  4IM0 A;  4E3C A;  2KCJ A;  4BBN F;  1L2N A;  2MQJ A;  2LRW A;  2OJR A;  3D8D A;  4RMA A;  4XWX A;  3HM6 X;  1DDM A;  4AP4 C;  4HB0 B;  3KRW A;  2D9X A;  4GB9 A;  3KZ1 A;  1NI2 A;  1P98 A;  3ML9 A;  2LBB A;  3QA8 A;  3HQC A;  2WDT B;  3Q3F A;  1V80 A;  1P3Q U;  1PLS A;  2UZR A;  4FUL A;  2ZVO A;  5E6N A;  2L8J A;  2K8C A;  1V86 A;  4DBB A;  4X57 B;  3UGB B;  4IM2 A;  2GCJ A;  2MBB B;  2JY6 A;  1D3Z A;  1XR0 B;  2LD9 A;  2KFJ A;  4NAW B;  4K1R B;  1KJT A;  4G11 A;  5DI9 B;  5C5B A;  2N23 A;  3W1S C;  3LDZ E;  2ROZ B;  1WJ1 A;  3Q3J A;  2UVM A;  2DEN B;  2N7D A;  1ZW7 A;  3H6N A;  2FDQ A;  3ZVV A;  3PLU A;  4WJO A;  2P0F A;  2CHZ A;  3VDZ A;  3JSV B;  3DBL I;  1WGQ A;  4BBK A;  2CKH B;  2IBI B;  3A9J A;  5LON B;  1G6J A;  3APC A;  1V88 A;  2BWE S;  2KDE B;  2AWT A;  1HBK A;  1ZGU B;  2D9Z A;  2KTR B;  4FA6 A;  1WZ3 A;  2CB8 A;  3SV1 A;  3UQB A;  3VQI A;  2MBO A;  1JRU A;  2O2V B;  1XX0 A;  4ILG B;  2N1V A;  4AUQ C;  4WVF B;  4DHZ E;  4TYZ A;  4E74 A;  2ZVN A;  4I6L B;  3ONS A;  4M8M A;  2XK5 A;  2P0D A;  2R82 A;  3WYF B;  3QCA A;  4GXB A;  2XEW A;  1XOD A;  4K2P A;  4NJ6 A;  2H7E A;  3RCZ A;  3WAM A;  4IC7 B;  3P2B A;  5D94 A;  2DHZ A;  4KDL B;  5CHF A;  5AZF A;  2NR2 A;  1ZM0 A;  1ZSQ A;  3L17 A;  1IRS A;  2L3Z A;  1UBI A;  4HB4 B;  1RFA A;  3SBG A;  4NJ7 A;  3UF8 A;  2DHK A;  2KKC A;  2KMA A;  1GGO A;  2W2X D;  4MJS A;  3CSF A;  1XD4 A;  2L7R A;  2DA0 A;  3R7Q A;  1Q67 A;  3ZVR A;  3I3T B;  3DXD A;  4ZRJ A;  2YS5 A;  3IFW B;  1C1Y B;  3IHP C;  3JVZ X;  2LAS A;  2KWU B;  4LDT D;  2GJY A;  1DIK A;  3H7S A;  4ZRI A;  4JKG B;  4N9F 4;  2DKP A;  4KIK A;  5J3T A;  5EDS A;  2RGF A;  5CX3 A;  2BF8 B;  2X0S A;  1UNR A;  5C5B B;  5KQ1 A;  2JRI B;  1BT0 A;  2Z0P A;  2YLM A;  2G4S A;  1U2B A;  4GDL B;  2I5F A;  2J0K A;  4GDK A;  1QC6 A;  2JRH A;  1WX8 A;  5LLI A;  3GOE A;  2V76 A;  2G4D B;  2D9W A;  5DPR A;  3MTN B;  3UQA A;  2KGX B;  5D3Y A;  5L81 A;  3PRZ A;  4G3X B;  2DAF A;  3VVW B;  3PP2 A;  4ASW C;  3PTF C;  4HLE A;  3QIJ A;  3UIN B;  3MHS D;  5JHB A;  3ULC A;  1FGY A;  2VRW B;  4HAW B;  1DDW A;  3VIA A;  3H7P B;  4GOC A;  4K7W A;  4JQW C;  3BIN A;  3T9L A;  2R2Q A;  3ZDT A;  3KUZ A;  4KZC A;  3NZS A;  3AI5 A;  4CO7 A;  1E8X A;  3JW0 X;  4DXA B;  2NPT A;  4JK8 A;  2IY0 B;  2HTH B;  2WYQ A;  3X0W A;  3ZW3 A;  3PG7 A;  4H8S A;  1OY2 A;  5DHF B;  3PZD A;  3VXW A;  2RQ1 A;  2JWZ A;  4II3 B;  3R66 C;  5BO4 B;  4A20 A;  1RLF A;  2GCL A;  2HRJ A;  1XCG A;  4B6W A;  4AOF A;  3CMM B;  2AL6 A;  2AEH A;  1OEY A;  1PMS A;  2I5C A;  2KZR A;  1GJZ A;  3RT3 B;  3BJI A;  4AWJ A;  2LXA A;  2YVC A;  4DHZ B;  3PVL A;  3NSU A;  3FEH A;  2YT0 A;  1Q5W B;  4HAZ B;  5JHH A;  3UZT A;  3WAO A;  2KDF B;  1NVL A;  2M1M A;  4GPT B;  2ZPN A;  2D4Q A;  1P9D U;  4M8N A;  5D7G A;  2DHI A;  4Z2N A;  4DWF A;  2RNR B;  2DZI A;  2DAJ A;  2LGX A;  3A4S C;  4KAX B;  1XKE A;  2FCM A;  4GSW A;  2CR5 A;  2YRY A;  1WR1 A;  4GDK B;  1TGZ B;  2YT1 A;  2PE6 B;  2PJH A;  1KBL A;  2IY1 B;  2KNB A;  3VTU A;  3QK0 A;  1GC6 A;  5C1Z A;  3HK0 A;  2REX A;  5DPW A;  3K9O B;  5J3Y A;  1WXS A;  1BTN A;  2NMB A;  3L16 A;  1TJ6 A;  2E2X A;  2BWF A;  1KM7 A;  4EOY A;  4G50 A;  2CS4 A;  3AUL A;  4F8C B;  1TTN A;  1ISN A;  3PLV A;  1FHO A;  2NBV B;  5HE0 A;  2DZM A;  1KZ7 A;  2Z59 B;  4KVG B;  1WX7 A;  4IAP A;  1WXA A;  3PHW B;  2K00 A;  2C7N B;  2WH5 A;  2DYM A;  4I6N B;  5KHO A;  2EC1 A;  2G45 B;  5J3Q A;  1WGR A;  3O96 A;  2R0D A;  2GBJ A;  2MBH A;  2RSU A;  2N9P C;  4ICV A;  2KN5 A;  4CYE A;  2Z0Q A;  2CY5 A;  3O65 B;  1EVH A;  5D3W A;  1ZC3 B;  2FAZ A;  2UZS A;  1C3T A;  1OMW A;  1EO6 A;  3A8Q A;  2IYB A;  3TL5 A;  4AJW A;  1NTV A;  1DRO A;  4WJ7 A;  5IAA C;  2GBM A;  5DPT A;  1NBF C;  4FBJ B;  3OJ4 B;  2MWN B;  4XX5 A;  2ZEQ A;  2UYZ B;  4HAU B;  3QWM A;  1P0R A;  1FXT B;  2PE9 A;  3P6A A;  2MFQ A;  3V62 A;  3ZRC A;  3RUL A;  2M8S A;  3KYC D;  2O6V B;  2P0H A;  3QJZ A;  2IFS A;  1A5R A;  3TVV A;  4BOS C;  1Z2M A;  1J19 A;  3KUC B;  1X1G A;  1SE9 A;  1UD7 A;  2PPH A;  3S2A A;  4DX9 0;  1E90 A;  1U29 A;  1X86 A;  4HAT B;  3D8F A;  1RAX A;  2JVC A;  3L0W B;  3ODW A;  4NQL B;  1FB8 A;  4W9F A;  5AZG A;  1ZC4 B;  2JZZ A;  4PYZ A;  5C79 A;  4IFS A;  1KI1 B;  5E6P A;  2GBN A;  4IW0 A;  2KDB A;  4LJP B;  2D3G A;  4OVU A;  4HDQ A;  2DKQ A;  3X23 A;  3B1L X;  3FLV A;  2JXX A;  1EAZ A;  1MIX A;  3V60 A;  4HWI B;  2HJ8 A;  4HK2 A;  3HIZ A;  3VH4 B;  3M1I B;  2C7H A;  3KSY A;  2JT4 B;  2CRF A;  1IYF A;  1K5G B;  4HDO A;  1S1Q B;  3SYX A;  2LVQ A;  3EC8 A;  2HE7 A;  5EFX A;  3ALB A;  5L83 A;  5G55 A;  2ZPY A;  1PFJ A;  4B95 A;  5FI0 A;  2BCJ A;  3M63 B;  3N32 A;  4M0W B;  4HVB A;  3T06 A;  3DQV A;  4HCP B;  4ILJ A;  2MRP A;  2IZV B;  2N1W A;  1E8Z A;  2COD A;  3FM8 C;  4GU2 A;  4Y94 A;  3ZO5 B;  2LXC A;  1V9J A;  3R3M A;  1SHC A;  1T0Y A;  2KLC A;  3IBE A;  4EEW A;  3ML8 A;  5FR6 A;  3HW2 B;  4A6F A;  2Y8F A;  1MKE A;  2D9V A;  4DK5 A;  2LUE A;  2COC A;  2BYF A;  1E8W A;  4ANU A;  3EHV A;  5HE2 A;  2I1K A;  2MX2 A;  1V89 A;  2NPT B;  5LXI B;  3WIM A;  5DCN A;  2WX0 A;  2HTH A;  4K81 A;  2BGF A;  4JK7 A;  4A3P A;  5DH9 B;  4JKG A;  1B55 A;  4MGK E;  4W9I A;  4KHO A;  3RCP A;  4KIK B;  3H1U A;  2MBE A;  2IYD B;  3TIX A;  3V6E B;  3TBL D;  4HCN B;  2MWS B;  4IWQ A;  3RUI B;  1R4N I;  2QKM A;  2KWC A;  4Z2M B;  2DX5 B;  4GDL A;  1WXV A;  2ZJD A;  3OAN A;  2A5U A;  2JP2 A;  1J0W A;  2FID A;  3U8Z A;  3ZNG C;  4MM3 A;  2ELA A;  3N3K B;  1ZVR A;  2FCQ A;  2ASQ A;  2IO1 B;  3H9D A;  2K2J A;  5HE3 A;  3A9K A;  3DBS A;  2LGD A;  2LKO A;  3VTW A;  3DVN V;  1MPH A;  3VH3 B;  1KC7 A;  5JH5 C;  3CXB B;  3NZU A;  3PPA A;  2H7D A;  2MSE D;  2JZ3 B;  2FJL A;  1P5T A;  3A98 B;  2MCN B;  3DVG Y;  3DXE A;  1WJM A;  1ZKH A;  1SIF A;  2KXJ A;  1H4R A;  4MGY E;  3IVF A;  3MPX A;  3ZLZ A;  1IPG A;  3TJP A;  3DBH I;  4W9K A;  3SD5 A;  1M94 A;  3L08 A;  2COF A;  3KY9 A;  3E9O A;  4TQ0 A;  1TZ1 A;  4JL9 A;  4G0N B;  3U30 A;  2Q13 A;  1GG3 A;  1Z5S B;  2KAN A;  1V5M A;  4BKT A;  2DX1 A;  4W9E A;  2NS5 A;  4ICU A;  2LOX A;  2KMC A;  1QQG A;  1DDV A;  4II2 B;  1I35 A;  1EUV B;  1FHX A;  2RSG A;  2WWZ A;  1VCB A;  2GBK A;  1W1G A;  2K8B A;  4ILH A;  1WE6 A;  2MP2 B;  5JHA A;  2NZ8 B;  3C0R B;  3JYU A;  1FOE A;  1NTY A;  3SUZ A;  2DFK A;  1X05 A;  3DBR I;  2KUP A;  4EKU A;  2O6V A;  4B9K A;  4JK9 A;  4F7G A;  1XQQ A;  1WGD A;  1RJ2 A;  5D2M B;  5DHA B;  4WJN A;  2K6Q A;  2AL3 A;  4MSQ B;  4FJZ A;  4YON A;  2N9E B;  3V61 A;  4DHJ B;  1Z87 A;  3B0A A;  3JSV A;  1GNU A;  3VUW A;  4GMV A;  2KFK A;  1OGW A;  2D9Y A;  1XT9 B;  4MSM B;  1HB6 A;  2FIF A;  2V3S A;  1S3S G;  2KD0 A;  5G2N A;  1EF5 A;  3RZW C;  2Z0O A;  2LRU A;  3ZTC A;  1L7Y A;  1IP9 A;  4CHM A;  1WGU A;  4BVU C;  1U5G A;  3ZTD A;  2YS1 A;  2W9N A;  4GGQ A;  3LJ3 A;  3ENE A;  2OOB B;  2L0T A;  1KOT A;  2N4F A;  1VBG A;  1M7E A;  4MEM A;  3ML4 A;  3DOW A;  1WM2 A;  2EJ8 A;  3A9K B;  5D3X A;  5TR5 A;  3AJ4 A;  4CHJ A;  3P7Z A;  1AWE A;  5C16 A;  2KO3 A;  1WM3 A;  3TO1 A;  3ZNZ B;  1YIW A;  3QX1 A;  4MGI E;  2PZ1 A;  3ZIM A;  1ST7 A;  2M14 A;  3WAP A;  4PQ0 A;  3GYO A;  1OEY J;  4YL8 A;  3D8E A;  3RD2 A;  4EZK A;  2LOZ A;  3E9L A;  4KSK C;  1YX6 B;  1WR6 E;  2WX1 A;  1UPR A;  2ZNV C;  3A1Q A;  2KHW B;  1H10 A;  5HE1 A;  1V5P A;  2RR9 A;  2MW5 A;  4WSF A;  2Y8G A;  3DPD A;  1FAO A;  1V6E A;  2UWQ A;  5CLL B;  2XBB C;  2C7M B;  2EMT A;  1U27 A;  2W2X C;  2MLB A;  4EZL A;  1X11 A;  1LM8 B;  3PS6 A;  4A5K A;  4DBG A;  5AZH A;  4PS8 A;  4MJS B;  2A4Z A;  3VHT C;  3CIK A;  2K2U A;  4WQO B;  1UEL A;  2LVP A;  4W9C A;  4GN1 A;  2FCS A;  1WXM A;  4IWP A;  1RRP B;  1WG7 A;  3G9W A;  2RVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...