1SGHA

Moesin ferm domain bound to ebp50 c-terminal peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
294
structure length
294
Chain Sequence
b'TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Moesin
publication title The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 71
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1sghA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1sghA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1sghA01
4F7GA 4IFSA 2G4SA 2MWSB 1FHWA 2B3AA 3P6AA 2HTHB 5JHHA 1QQGA 2AL6A 3ZRFA 3V61A 4K2OA 1WJUA 3M62B 3O96A 3W1SC 1GUAB 3PT2B 2DX5A 1MKEA 2LKOA 1KZGA 2Z0QA 3PS6A 4E71A 1DDVA 4MK0A 2MFQA 1AQCA 2LGDA 1SHCA 5EFXA 4ANXA 1P1AA 2DKPA 3I3TB 1IRSA 3RZWC 2BKFA 2IY0B 3PPAA 1E8WA 4HPLB 3APFA 3PVWA 2DFKA 1LXDA 3ML4A 3PVUA 2LI5A 1WX7A 2Y8FA 1L2NA 1MIZB 2MQJA 2KLCA 4IOYX 4G3XB 3ONSA 3IFWB 3F5RA 3QX1A 4IW0A 1M94A 5L95C 2V1YA 2ZPYA 5JH5C 2DZKA 1R4MI 2WWZA 1IYFA 3KYCD 1NTYA 3Q3FA 2WYQA 2LVQA 1WH3A 2P0FA 1EUVB 2KJ6A 2D11A 2CQUA 2M17A 3A8PA 1X1GA 1HE8A 2D07B 1XCGA 2LYDA 2XEWA 5GOWB 1WJ6A 2D9XA 3GOEA 3CSTA 4FN2A 5GMVA 4G50A 2LRUA 4B6WA 2M4NA 1D3ZA 3U7DA 1EAZA 3MPXA 5JHAA 4GMVA 4HAUB 5CHWA 4GOCA 1WGUA 3ZNID 1UBQA 1MIXA 2L2IA 4EMOA 1L7YA 2JF5A 3VUYA 5E6PA 2KZRA 4E74A 1BTKA 2ASQA 1MK9B 2KANA 4GZUA 2Z0EB 1WJNA 3PREA 3NSUA 3KUZA 1OEYJ 2D3GA 4OVVA 3L08A 1FHOA 4DDGD 1KOTA 1OMWA 3KUCB 4HDOA 2DAFA 5HE1A 2JRHA 3FP5A 3UQAA 4KSKC 3ODOA 3ZRCA 1HB8A 4DHZB 4K81A 1Q1OA 4EZKA 4EZLA 4MDKE 1P9DU 1LQBA 1RLFA 2JVCA 3MDBC 4B6HA 1MAIA 2KMCA 4I6LB 2JXXA 2KWVB 3AXCA 2LWPA 2N1VA 1WJMA 5J2RA 3VXWA 3OLMD 3R66C 2GBRA 3QWMA 2LXCA 1ZVRA 1XD3B 2BPSA 3ALBA 4HAVB 1J8CA 4HCNB 3SHQA 3V6EB 1UNPA 1WM3A 2W2XC 4WVFB 4ZRJA 4HB0B 3CIKA 3R3MA 2RQ1A 1OY2A 1EVHA 4HAXB 4C0AA 2NCNA 4XWXA 3UQBA 1KM7A 2KX0A 4ZRIA 3ODWA 1NBFC 3MTNB 4EUTA 2DLWA 4HVBA 4MM3A 1WX9A 2H7DA 3VH4B 1V6EA 2IO0B 4DBGA 2IZVB 4ASWC 4B95A 4FJVB 5LLIA 2COCA 2YT0A 2FCSA 2OJRA 2ADZA 2ZVOA 1WGGA 5G55A 3TL5A 1ZC4B 3KZ1A 3AU5A 3SNHA 1P3RA 2KCJA 3A9JA 4ICVA 4M8MA 1TJ6A 3JVZX 2K39A 2M38A 2REXA 2W2WA 2MWNB 4ANVA 3HHMA 2CU1A 4RMAA 2OTXA 2KDBA 2L00B 4HAZB 5C1ZA 3PRZA 5D27A 3DXDA 3JW0X 3SU8X 3FLVA 3L17A 3TCAA 2C7NB 4DHJD 1ZM0A 2DYMA 4FJZA 5CTRC 2NBVB 4GB9A 2Y5BB 4IWOA 1P98A 3ZKJC 4MEMA 2DHKA 3DCGA 2BF8B 4HK2A 3N7CA 4HDQA 5D2MB 2Z59B 4KIKA 4W9CA 4F7ZA 5IJMA 3W1SA 4K2PA 4HLEA 2Y7BA 2H7EA 4KHOA 5JZEB 3UIOB 1OEYA 5LXHA 4FA6A 3T8MA 2K2JA 2N9XA 4BOSC 1E7UA 3S2AA 3U8ZA 4I6NB 2GCLA 3R7RA 1B55A 3VHTC 4MGZE 5L81A 2WDTB 3V60A 2MKRA 2LUEA 4HB4B 2ZCBA 1ZKHA 3RUIB 2MP2A 2KFKB 4W9DA 3VTVA 1GC7A 2EC1A 4KDIC 1ZC3B 4XZ4A 3JSVB 5HE0A 5C5BB 2KTFA 4PS3A 1WMHB 1P6SA 2C7MB 2OOBB 2I1JA 3UGBB 2EMTA 4MH0E 4BBKA 2JY6A 2IO3B 3D8DA 4B9KA 2LVPA 4A3PA 2NBUA 1P3QU 3L13A 3N32A 5CHVC 5C6RA 1J0GA 1EO6A 3PRMB 4MT7A 2N7EA 2IY1B 3IBEA 2DAJA 1SE9A 2M1MA 5KCVA 2L8JA 1U5DA 4MSQB 3ZNGC 2FCMA 3WAOA 2MBQA 1PLSA 4G11A 2W2XD 2RSGA 3QIJA 4II3B 4CHMA 1BWNA 1LFDA 1P0RA 4IM0A 5DPTA 3SYXA 3CMMB 5JLJB 3GZNI 2GJYA 3P2BA 4XX5A 3H7SA 2DYNA 1FGYA 1UELA 4TUUA 2CR5A 2XQNM 3VVWB 3QC8B 2BGFA 1BTNA 1VCBA 1ZSQA 3MJWA 5J3QA 1YX6B 3DPDA 1XX0A 3WA0A 3DBRI 1WE6A 3B0AA 4KZCA 1Q0WB 2IFSA 3C0RB 3H7PA 2CKHB 4A6KA 3B08A 4A6HA 2AL3A 3PSEB 2DA0A 1YD8U 2O6VD 1RAXA 3WYFB 5D3WA 1YIWA 4F8CB 4K17A 4K7SA 3D8EA 2MCNB 3DBLI 3VQIA 3K9OB 5E6OA 3TW1A 4CHKA 5D7GA 2X18A 2CS4A 4GSWA 2BWES 2DHIA 4G0NB 5HE2A 5DPSA 2LJ5A 4KAXB 5LXIB 4M0WB 3VDZA 4FHKA 2C5LC 5KQ4A 4DK5A 4GMXB 2RGFA 1ISNA 3M95A 4IAPA 2LGYA 2A5UA 2FNJB 1J19A 1DYNA 4XC2A 2IO1B 1KZ7A 3EECA 1VD2A 3KRWA 2CRFA 3BJIA 4FJYA 5AEKB 3KUDB 3QK0A 3ODXA 1UGMA 1UZXB 1WXMA 3L16A 2YRYA 4EKUA 1XT9B 2VKIA 5AZHA 2I5FA 4WWNA 4EEWA 3ZUNA 1WG7A 3A1QB 2MBBB 1X05A 2K8CA 4MY6A 2GBMA 2R09A 2COPA 2N4FA 2E2XA 4WJOA 4DWFA 2O6VA 4AJWA 1W1DA 2LVOA 3PGEA 3RZFA 3ZNHB 1XD4A 3GYPA 2G4DB 1FB8A 4PNKA 2FIDA 5CLQB 1ACAA 1MK7B 1LW3A 4DBBA 1U27A 4GXBA 5LOPB 1M7RA 3VUWA 4GDKB 3AULA 4A20A 1AARA 2IBIB 2O2VB 2DZMA 4HPMB 4WQOB 4BFRA 2KLGA 2HTHA 1NDDA 3PEGA 1ST7A 2MRPA 2K6QA 2KHWB 2L0TA 2DHJA 2P0DA 2YT1A 2ELBA 3PLVA 1YJ1A 2LXAA 2WX0A 3N30A 2D9WA 2HRJA 4IC7B 2D4QA 1CMXB 4KHAA 1Q67A 3EPYA 3HIZA 4F1SA 1FOEA 1K8RB 5L83A 3TO1A 2KMAA 1WR6E 3A9KB 1WJ4A 3KW5B 2PZ1A 2JZ3B 3DVNU 1WIAA 2D2QA 2CY4A 3UZTA 4PS8A 3QA8A 3W1YA 3DXEA 3BY4B 2KN5A 1A5RA 3PTFC 4JQWC 4IWPA 4M8NA 1RFAA 1AWEA 2NBWB 2L3ZA 1IPGA 1BAKA 1LB1A 3O65B 1V5UA 4W9GA 2LRWA 3A33B 4KHBB 5DHFB 5DCNA 4HJKA 4JL9A 4DHZE 4F7UP 1E8ZA 2KQ7A 2JWZA 2GCJA 2KTRB 1E8YA 2KJHB 2ZEQA 4MSMB 4AWJA 2IO2B 2IYBA 2D9ZA 4FLHA 2HJ8A 5KHQA 4W9IA 2ZVNA 1F9JA 2RVBB 2K25A 2C9WB 4DXAB 2QKLA 5DIFB 2PE6B 1NTIA 3IHPC 4GDLB 5J17A 1H10A 1YQBA 1FAOA 1TGZB 3A4RA 2ZNVC 4GPTB 4GN1A 2PJHA 4K7WA 1WGHA 1MG8A 3R7QA 1BT0A 3PSCA 4HAWB 2L1CA 2N7DA 2FCNA 5D94A 1WXSA 3QHTA 2COFA 3D32A 2J7QB 2KK8A 2KDEB 2ROZB 4NAWB 2ELAA 3AJ4A 3H9DA 3WAPA 2A4ZA 4KDLB 4EFOA 2RR9A 4WJPA 2N9PC 2KDIA 5DHAB 4N9F4 1X86A 2N0YA 2DX1A 1TBEA 2J59M 1UPRA 2RLOA 1WVHA 3V62A 1V5TA 2VRRB 4D0NB 3K9PB 4KV2A 1WE7A 2K8BA 4TQ1A 2EMSA 1OQNA 5HE3A 1DDWA 2Z0PA 1W1HA 2P0HA 2M8SA 5CX3A 1M7EA 4WWPA 2JPHA 2FCQA 3A4SC 4A3OA 2PPHA 4NPNA 4WSFA 1Y19B 4NQKE 2J0MA 1Y8RC 3KY9A 3QAQA 2UZRA 1FGZA 3HM3A 4FHJA 5AZGA 4AJYB 4HAYB 3ZVVA 2NVUI 4GU2A 2KVRA 3HQCA 4RM8A 2I5CA 3KH0A 1OQYA 3M3JA 2MX2A 2KWUB 1TTNA 1WXAA 5JP4A 4WAAA 5AZFA 4TYZA 3KYDD 3P7ZA 3KRXA 2JRIB 3VH3B 3SDLC 2EJ8A 2UYZB 3ULCA 3FEHA 1T0YA 3ZDMC 2UZSA 1PFJA 1WX8A 5KQ1A 4LDTD 3M1IB 5JHGA 2FJLA 1V5MA 1UNQA 2NPTB 1V86A 2FDQA 3OAWA 3JYUA 1GC6A 2V76A 5J3TA 2FJ9A 3DVGY 4LJOB 3OANA 4LDTB 2RNRB 2KDFB 5DH9B 2ZPNA 2V3SA 4A6FB 4CYEA 2KUPA 2LZ6A 3CXBB 5JHBA 3ZDTA 3ULBA 3BINA 5J18A 4PYUA 2DTCA 5FI1A 1WZ0A 2KFJA 3ML8A 4ZRKA 2YS3A 4BOZB 3DQVA 3TBLD 1HB6A 2YF0A 3L0WB 5IA7A 1I35A 2KFKA 4OVUA 1E90A 2MBHA 3JSVA 2NS5A 3HK0A 5C5BA 1V2YA 4K7UA 3QCAA 4J6IA 3M63B 2YVCA 1G6JA 1WMHA 4EOYA 2M0XA 2WH5A 3CSFA 1GJZA 4KVGB 1X11A 1OGWA 1I7AA 3IG3A 4BKSD 2N9EB 1WM2A 2M14A 5EDSA 2NMBA 2ZNVB 2HE7A 5TR5A 5D3VA 1TXDA 3HW2B 3TMPB 2L76A 2ROVA 2XK5B 2R2OA 4IUMB 3NY5A 2GBJA 3ZW3A 2YS5A 3SO6A 5C79A 2K1FA 3VFKA 3WAMA 3IVFA 2BYEA 1KI1B 2FIFA 3H1UA 2RD0A 4KZ0A 2KOXA 2G3QB 3ZTCA 1I2HA 1WZ3A 4TV3A 4CHJA 1FXTB 2DX5B 2D9VA 2MBEA 5LONB 2KKCA 1PQSA 3VTWA 3NZSA 4JLCA 3WANA 4W9FA 2EKEC 3ZVRA 3RULA 3UIPB 3Q3JA 4HXDA 2GBNA 4K1RB 4NY0A 1V88A 4HCPB 2K2UA 1EGXA 1E5WA 2G45B 2RUKB 1DBHA 3H6NA 2LG1A 4BKSA 3TIXA 3WIMA 4NJ6A 3A8QA 1DDMA 4X57B 1V61A 3DVNV 3UINB 4BKGA 3APDA 3RD2A 1RJ2A 1WF9A 4L6EA 4FBJB 4ZDVA 2KNBA 4MGYE 2DN6A 3T06A 1GG3A 5IAAC 3RCZA 2J0KA 2UWQA 2KO3A 4HB3B 2MLBA 4Z2MB 3U30A 3ECIA 3PLUA 4MJSA 3VOQA 3NS8A 3PRPB 1XR0B 1H4RA 3LJUX 4GIVA 4RM9A 1LM8B 4IM3A 3KSYA 3TFMA 4PYZA 3RCPA 4DX90 5D3YA 1WJ1A 5HKHA 4BBNF 2BYFA 2FUHB 2YLMA 5DI9B 2DYOA 1R4NI 3AU4A 2ABDA 3DOWA 4W9KA 1SIFA 3D8FA 4DDID 4HATB 1E7VA 1WRDB 4LCDE 5E6NA 4NQLB 2LGXA 2KGXB 3DDCB 2KQSA 2LOXA 4PS7A 5C23A 4YONA 3A1QA 2KC1A 1X1MA 1C1YB 3ZNZB 5FR6A 2CODA 4E3CA 2KD0A 3KVFB 1IP9A 2NZ8B 4BBNC 1UH6A 3DXCA 2JT4B 3N3KB 1V9JA 4IG7B 1V5OA 1OTRB 4I6PA 4GDKA 3LDZE 3PP2A 2O2VA 3WALA 2Q13A 4KSLC 1V49A 3V6CB 2MBOA 2COAA 5J3YA 3QARA 4WJNA 2L05A 3NZUA 4MGIE 1KJTA 2YSZA 2MSED 3ZIMA 1TQZA 1WYWB 1ZGUB 1S3SG 3AI5A 4W9HA 4DX8A 2AEHA 3F0WA 1UD7A 2P8VA 3NHEB 4WJQA 1TZ1A 2D10A 3EFUA 3OJ3A 2ZZPB 1QZEA 1EF5A 2CY5A 5BO4B 2AYOB 1U5GA 1W1GA 2YS1A 3A9KA 1U2BA 2K00A 2DZJA 2Z0DB 1QC6A 4FULA 1U5FA 4MGKE 2DENB 2KWCA 2DKQA 3SD5A 4P7IA 3A9JB 2CHWA 2JP2A 4CO7A 5DPWA 2C60A 4Y94A 2R2QA 3APCA 1P5TA 2AWTA 2C7HA 2CHZA 1UPQA 1U4AA 2JZZA 4HB2B 2DZIA 2L0FA 2MA9B 1NU2A 2BWFA 4H8SA 2NR2A 2L7RA 1NI2A 2KTRA 1DROA 2JUOA 4KIKB 1UBIA 4FADA 2GMIC 3QJZA 3L10B 2XBBC 2N1WA 1WI1A 2WX1A 3PG7A 2GOWA 4GDLA 4Z2NA 1GNUA 3NOBA 3CF6E 1UEFA 2CHXA 1K5GB 2MP2B 4ICUA 3FM8C 1XKEA 1U29A 5KHOA 3A98B 3V5WA 3HM6X 3DBHI 3DBSA 2QHOA 2FAZA 1X1FA 1V80A 2KX3A 3RT3B 2LULA 2RGNB 4NAWA 2BKRB 1H8CA 2GS0A 4W9EA 4AOFA 2DYQA 3L54A 3G9WA 3PZDA 1WGDA 4YL8A 4WJ7A 3MHSD 1Z5SB 4DHJB 1I42A 2GBKA 2BYVE 1V5PA 1MPHA 3ZO5B 1C3TA 1V89A 2V4LA 3QQ8B 2VRWB 1WXVA 2UVMA 2RSUA 4URKA 4LJPB 5C16A 3OJ4B 1RRPB 3TJPA 1WY8A 1NTVA 2OQBA 2MW5A 3EHVA 1WGQA 3PV1A 2Y8GA 3PVLA 2D9YA 2MDXA 3TVVA 3QBVB 1Z87A 1YX5B 2QKMA 1WR1A 4II2B 3RYTA 4ANWA 4EZJA 1KLVA 1Y5OA 5CHFA 4TKNA 4A5KA 5D3XA 3VIAA 3GYOA 4BKTA 4IWQA 4JGHB 3FSSA 3SV1A 1Z2MA 4JIOU 4NNJB 2J0JA 2I1KA 1EF1A 3H7PB 3QWZB 5FI0A 4AUQC 2KC2A 2PEAA 2G35A 1FHXA 3T9LA 3LJ3A 2LBBA 2ZCCA 5CLLB 3VTUA 5DPRA 2IYDB 2RPQA 4AP4C 2CB8A 2K8HA 4NSWA 1ZW7A 4ANUA 2HD5B 5D6JB 3B1LX 3DVGX 2NPTA 1E8XA 2ZJDA 2CAYA 1XODA 2VSZA 4IM2A 1HBKA 4NJ7A 1U5EA 2LOZA 3ZLZA 4W9JA 3X23A 4F7HA 4A6FA 4BVUC 1WI0A 1UNRA 4MELA 4HWIB 1J0WA 1WFYA 5G2NA 4HHVA 1K5DB 3PHWB 3X0WA 2W9NA 4EJNA 1WGRA 1PMSA 2BCJA 2KXJA 3ZTDA 3UF8A 2LASA 4TQ0A 1V81A 1JRUA 1Q5WB 2DHZA 1N3HA 1NVLA 1XQQA 4MJSB 2O6VB 3PHXB 3VAWA 3SUZA 2R0DA 1SGHA 3ML9A 4W9LA 3ENEA 1S1QB 2K6DB 4GGQA 2LD9A 2KJRA 2Z0OA 2XK5A 2DYBA 1RRBA 2PE9A 2N23A 4WWOA 4PQ0A 3EC8A 1WGYA 4ZYNA 3VUXA
chains in the Genus database with same CATH superfamily
4F7GA 2LJIA 4IFSA 2LUMA 2G4SA 3DHGC 2MWSB 1B1ZA 2W54A 1FHWA 2B3AA 3P6AA 2HTHB 1PGBA 2IPKD 3BVZA 5JHHA 2SEBD 1QQGA 2AL6A 3ZRFA 3V61A 4K2OA 1ESFA 1WJUA 1RYJA 4US9A 3ZJTA 3M62B 1I7HA 3O96A 3W1SC 1GUAB 3PT2B 2DX5A 1J7CA 1MKEA 2LKOA 1KZGA 2Z0QA 3PS6A 4E71A 1DDVA 2CJOA 5IO9A 3TEWA 4MK0A 2MFQA 1AQCA 2LGDA 1SHCA 3AE9B 2V4IB 3P42A 2BB5A 5EFXA 1DIKA 4ANXA 1P1AA 2DKPA 3I3TB 3DCXA 1IRSA 3RZWC 2BKFA 2IY0B 1JQ4A 3PPAA 1E8WA 4HPLB 3APFA 3W2DA 1TS5A 3PVWA 2DFKA 1LXDA 3ML4A 3PVUA 2JXTA 2LI5A 3VR9B 4EE2A 1WX7A 2Y8FA 1L2NA 1MIZB 2MQJA 4N59A 2KLCA 4DIXA 4IOYX 4G3XB 1CZPA 3ONSA 3IFWB 3F5RA 3QX1A 4QAYA 2X8XX 4JK7A 4XYCA 4IW0A 2KYWA 1M94A 5L95C 2DWQA 2WXGA 2V1YA 2ZPYA 5JH5C 2DZKA 1R4MI 2WWZA 1IYFA 3ETRA 3KYCD 1NTYA 3SBGA 4PT5A 2KACA 3Q3FA 2WYQA 2LVQA 1WH3A 3FILB 2P0FA 1EUVB 2KJ6A 2D11A 2CQUA 2M17A 5EE9A 3A8PA 1X1GA 1HE8A 1BXTA 1K51A 1XF5L 2D07B 1XCGA 2QILA 2LYDA 3B2GA 2XEWA 1UF0A 5GOWB 1WJ6A 2BVCA 2D9XA 3GOEA 3CSTA 4FN2A 1SE4A 1JALA 4P1CC 5GMVA 4G50A 2LRUA 3J9CA 3NVVA 4B6WA 2Y5CA 1EM7A 2M4NA 4XE0A 4JKDA 3U7DA 1EAZA 4YSXB 1D3ZA 3MPXA 1EWCA 5JHAA 4JKHA 2K22A 4GMVA 4HAUB 1YN4A 5CHWA 5GXGB 2INPE 2J53A 4GOCA 1NEKB 2KMMA 1WGUA 3ZNID 1UBQA 1MIXA 2L2IA 4EMOA 1L7YA 2JF5A 3VUYA 3AEBB 2KUQA 1TZOA 2KZRA 2Y5PA 5E6PA 5JXVA 4WQMA 3MJ5A 4E74A 1BTKA 1GGOA 2ASQA 4ILJA 1MK9B 1ENFA 1D5MC 2KANA 2PKOA 4REZA 4GZUA 2Z0EB 1WJNA 1E6EB 3PREA 3RN9C 3BIID 5BYSA 3NSUA 3KUZA 1OEYJ 1BMLC 2D3GA 2X38A 3AE5B 4OVVA 3BVGA 3L08A 1FHOA 4DDGD 1FIQA 3DWMA 1KOTA 1OMWA 1MI0A 1C78A 2MJ3A 3KUCB 4HDOA 3AM9A 1OQRA 4M02A 2DAFA 2VH1A 1L6VA 2BS2B 5HE1A 3N9YC 2JRHA 1JMLA 2JYEA 3FP5A 2I2YA 5TSSA 3UQAA 4KSKC 4IKGA 3ODOA 3ZRCA 1HB8A 1XLNA 4DHZB 4K81A 1Q1OA 4EZKA 4EZLA 4MDKE 1P9DU 2N0SB 3LXFA 1F1HA 1QF6A 1NVID 1LQBA 1RLFA 2JVCA 3MDBC 4B6HA 1MAIA 2KMCA 4I6LB 2JXXA 2QCZA 2KWVB 3AXCA 2LWPA 2N1VA 4KGSA 3DHIC 1WJMA 5J2RA 1KRHA 3VXWA 3OLMD 3R66C 1VBGA 2GBRA 2WXQA 3QWMA 2LXCA 3N20C 1ZVRA 1XD3B 2BPSA 2N9LA 4YSYB 3ALBA 4HAVB 1J8CA 4HCNB 3SHQA 3V6EB 1TS2A 1N5WA 1UNPA 4UDUC 5H8YE 1WM3A 2W2XC 4WVFB 2K9XA 4ZRJA 4HB0B 4B0EA 3CIKA 2WGSA 3R3MA 2RQ1A 1OY2A 1EVHA 1STEA 4HAXB 4C0AA 1IBXB 2NCNA 1YJIA 1BUIC 4XWXA 3UQBA 1KM7A 2KX0A 3FC4A 4ZRIA 3ODWA 4JKEA 1ZDXA 2RPVA 2PTLA 1PFDA 1NBFC 3MTNB 1FM0D 4EUTA 1ZP0B 2DLWA 1ZYIA 4HVBA 1TS3A 4MM3A 1WX9A 2H7DA 1SJED 2PVGC 3VH4B 4JK9A 1V6EA 2IO0B 4DBGA 2IZVB 4ASWC 4B95A 4FJVB 1XLPA 4MT5A 1ZUD2 2WXHA 1KH0A 1T77A 5D3DA 2COCA 1VLBA 5LLIA 1VZ8A 2EKIA 3MC8A 2YT0A 3FVCA 2FCSA 2OJRA 2ADZA 2ZVOA 1PUTA 1WGGA 5G55A 2CJNA 2YEPB 2EELA 2FBWB 4ZRQA 3TL5A 1ZC4B 3KLSX 3KZ1A 3AU5A 3SNHA 1P3RA 2KCJA 2INDC 4USAA 3A9JA 4ICVA 1SSNA 4M8MA 3HVZA 4US8A 1TJ6A 4P6VF 1UWMA 2K39A 3JVZX 2M38A 2REXA 2W2WA 2MWNB 4ANVA 2R2YA 1I4GA 3HHMA 3V05A 2CU1A 1SXTA 4RMAA 2OTXA 2KDBA 2L00B 4HAZB 2VH2A 2WS3B 3EFCA 5C1ZA 3PRZA 5D27A 4ZYSA 3DXDA 3JW0X 3SU8X 3FLVA 2HTME 3L17A 3TCAA 2C7NB 4DHJD 1ZM0A 2DYMA 4FJZA 5CTRC 2TSSA 2NBVB 4GB9A 2Y5BB 4IWOA 5C3JB 1P98A 2R82A 3ZKJC 2LFIA 4MEMA 2DHKA 3DCGA 2BF8B 4OSNA 4XDDA 1SE3A 4HK2A 3N7CA 4HPPA 4HDQA 4JKBA 5D2MB 2Z59B 4KIKA 1N62A 4W9CA 4F7ZA 5IJMA 3W1SA 4K2PA 4YTMB 2BTEA 4HLEA 2Y7BA 2PVOD 3GE8C 2H7EA 4KHOA 5JZEB 3UIOB 1OEYA 5LXHA 4FA6A 1TKGA 2K3UA 3T8MA 2K2JA 1HQRD 2N9XA 1E7UA 4BOSC 3S2AA 4XWWA 3U8ZA 2INCC 5BMIA 2KAJA 1K50A 4I6NB 2GCLA 3R7RA 1B55A 3VHTC 4MGZE 5L81A 1ZXIA 1I4HA 2WDTB 3V60A 2MKRA 2LUEA 4HB4B 1FXAA 2ZCBA 1F2RC 1ZKHA 3RUIB 2MP2A 3EUB2 4RGOS 2KFKB 4W9DA 3VTVA 1GC7A 2KDMA 2EC1A 4KDIC 1ZC3B 1C77A 4JK8A 4XZ4A 3JSVB 1D6EC 5HE0A 5C5BB 1YQ4B 3TEXA 2KTFA 4PS3A 1WMHB 1YQ3B 2WU2B 1P6SA 1XO3A 2C7MB 2OOBB 2I1JA 3UGBB 2EMTA 4RNAA 4A9AA 1FO4A 1JWSD 1AN8A 3SEBA 1VR9A 4MH0E 4BBKA 2JY6A 2IO3B 3D8DA 4B9KA 2LVPA 1JWUD 4A3PA 2NBUA 1P3QU 4IDIA 3L13A 3N32A 2OJWA 5CHVC 5C6RA 3BK1A 1J0GA 1EO6A 5HFYA 3PRMB 4MT7A 1NYRA 2N7EA 2H88B 2IY1B 3IBEA 2DAJA 1SE9A 1WYGA 2M1MA 5KCVA 2L8JA 1U5DA 4MSQB 3ZNGC 2FCMA 1KLUD 1TY0A 2BS3B 1T6BX 4LNNA 3W5VB 2MBQA 3WAOA 3URYA 3T3OA 2NMQA 1PLSA 4G11A 1FRDA 1JRPA 2W2XD 2RSGA 3QIJA 4II3B 4CHMA 1BWNA 1LFDA 1P0RA 4IM0A 5DPTA 1KFYB 4YTNB 3ZJUA 3SYXA 4HEA1 1K53A 3CMMB 2L83A 5JLJB 3GZNI 2GJYA 3P2BA 5FKAC 3LB8C 4XX5A 1I4QA 2DYNA 3H7SA 1FGYA 1UELA 4TUUA 3MFGA 2CR5A 3N1ZC 2XQNM 3VVWB 5LNK1 3MC0B 1SB3C 1J7AA 3QC8B 2KN4A 2Z4DA 5BMGA 2FE8A 3IAS1 2BGFA 1P7EA 1BTNA 4QJ4B 1VBHA 1VCBA 1ZSQA 3MJWA 4RCOA 5EE1A 3SR6A 5J3QA 1YX6B 3DPDA 3I57A 1XX0A 3WA0A 3DBRI 3I63C 1WE6A 1MFWA 3B0AA 2GUMA 4KZCA 1HTOA 1Q0WB 2IFSA 2J52A 3C0RB 3H7PA 5M4YB 2CKHB 4A6KA 3B08A 4A6HA 2M56B 2AL3A 1V97A 3PSEB 2DA0A 3EA6A 1YD8U 2O6VD 1RAXA 3WYFB 5D3WA 1YIWA 4ARCA 2CU3A 4F8CB 4K17A 4K7SA 3D8EA 2MCNB 3DBLI 3VQIA 1XEEA 3K9OB 5E6OA 1VZ6A 4YT0B 3TW1A 4CHKA 4RGMA 5D7GA 2X18A 3E9SA 2CS4A 4GSWA 5C2TB 2BWES 2Y3AA 2DHIA 1TYGB 3P4RB 4G0NB 4LNOA 5HE2A 5DPSA 3ZXVA 2LJ5A 1B9RA 2YEPF 4KAXB 2MH7A 5LXIB 4M0WB 3VDZA 4FHKA 1T0QC 2C5LC 3Q8CA 4HJGE 5KQ4A 1DOIA 4KGRA 3A58A 4AS1A 4DK5A 3U4EG 4GMXB 2RGFA 1ISNA 2YT2A 3M95A 4IAPA 2LGYA 2A5UA 2FNJB 1J19A 1DYNA 3R2IA 1TKYA 4XC2A 3RNAC 3RFZB 2IO1B 1KZ7A 3EECA 4KGTA 1VD2A 4JPSA 3KRWA 4DQOC 2CRFA 3BJIA 4FJYA 3KWVA 5BYQA 4C4VA 1Q10A 5AEKB 3KUDB 3QK0A 3ODXA 1UGMA 1UZXB 1WXMA 3L16A 3Q8AA 3O13A 2YRYA 2Z8LA 4EKUA 1XT9B 2VKIA 3ABVB 5AZHA 2I5FA 4WWNA 4EEWA 3ZUNA 1WG7A 2ZKMX 3A1QB 2MBBB 1X05A 2K8CA 4MY6A 2FJUB 2GBMA 2R09A 2COPA 2N4FA 1N60A 2E2XA 4WJOA 4DWFA 2O6VA 3BYTB 1HTQA 4AJWA 1W1DA 4A55A 2LVOA 3PGEA 3RZFA 3ZNHB 1XD4A 3GYPA 2G4DB 1FB8A 4PNKA 2AQ3B 4XDCA 5IOIA 1D5ZC 2KR0A 3BZDB 2FIDA 4NZLB 5CLQB 1ACAA 1MK7B 1LW3A 4DBBA 1U27A 2IDYA 4GXBA 1LGRA 3DWGC 1F77A 5LOPB 4C56C 1M7RA 2X0SA 1TS4A 2B76B 4P1BC 3VUWA 1JWBD 4GDKB 3AULA 1KTKA 4A20A 3EGRA 1AARA 2IBIB 2O2VB 3T3NA 4D2KA 1RM6C 2DZMA 4HPMB 1HA5A 4WQOB 4BFRA 3VR8B 5BMHA 2KLGA 4MACA 2HTHA 4ACFA 1NDDA 2Z13A 4HKQA 3PEGA 3OG5A 3AB5A 1ST7A 4YSZB 4RGNA 3ZJVA 2MRPA 2K6QA 2KHWB 2LGSA 2L0TA 5BYRA 2DHJA 1ACCA 1GOZA 2P0DA 2YT1A 3AMZA 4QXAB 2ELBA 2QDFA 3PLVA 1KLGD 1YJ1A 2LXAA 2WX0A 3N30A 2D9WA 2HRJA 4IC7B 2D4QA 1CK1A 3TUOA 1QILA 2DBYA 1C76A 1CMXB 4KHAA 1Q67A 4M01A 3EPYA 3HIZA 4F1SA 3DBHB 1FOEA 1D5XC 1ZOYB 1K8RB 2VZKB 3AE1B 3R2TA 5L83A 3TO1A 3B2FA 1L4ZB 2KMAA 1WR6E 3NG0A 3A9KB 1WJ4A 3KW5B 1Y56A 2PZ1A 2JZ3B 3DVNU 1AYFA 1WIAA 2D2QA 2CY4A 3UZTA 3L4PA 4PS8A 4DXFA 3QA8A 1OFFA 3W1YA 3DXEA 3BY4B 2KN5A 2LGIA 1A5RA 3PTFC 4JQWC 4IWPA 1L5PA 4M8NA 4YXDB 1N5XA 3FILA 4GOUA 4TSSA 1RFAA 2WXRA 1AWEA 2NBWB 2L3ZA 1IPGA 2JX5A 1AWDA 1BAKA 1LB1A 2BW2A 3O65B 1SIJA 1XCQL 5EE0A 1V5UA 4W9GA 2LRWA 3A33B 4KHBB 5DHFB 5DCNA 4HJKA 4JL9A 2V9HA 4DHZE 5I2SA 4F7UP 1E8ZA 1SBBB 1L0VB 2KQ7A 2RDBC 2JWZA 2GCJA 2KTRB 1E8YA 3MC9A 2KJHB 2ZEQA 1MVKA 2V3PA 4MSMB 1ROEA 2WNMA 4AWJA 1FCLA 2IO2B 2IYBA 1I4XA 2UU7A 3RNBC 2D9ZA 4FLHA 2HJ8A 2J42A 5KHQA 4W9IA 2ZVNA 1F9JA 2W3SA 2RVBB 3HUIA 2K25A 2C9WB 4DXAB 2QKLA 4OW0A 5DIFB 2PE6B 1NTIA 3LYYA 3IHPC 4GDLB 5J17A 1H10A 1YQBA 4HKZE 1FAOA 1TGZB 3A4RA 2ZNVC 1F2RI 5FR3A 4GPTB 4GN1A 1WXQA 2PJHA 3OWEB 3I9V1 2LHEA 3SFDB 2RRFA 1WGHA 4K7WA 2W82A 1MG8A 3R7QA 1ZXHA 1PGXA 2D5GA 1BT0A 1XXGA 3PSCA 4HAWB 4KX6B 1FCCC 3I5JC 2L1CA 2N7DA 2FCNA 5D94A 2M19A 1WXSA 3QHTA 2COFA 1GPXA 3D32A 2J7QB 2BS4B 2KK8A 2KDEB 2ROZB 4ILHA 3AE6B 3TEYA 2ZW1A 4NAWB 3E9LA 2ELAA 1M4VA 3AJ4A 3H9DA 4ITKA 3WAPA 5I4DA 1GAQB 1NENB 2A4ZA 2JU6X 4QJ5B 4KDLB 4EFOA 2RR9A 4WJPA 2N9PC 2KDIA 1TIFA 5DHAB 1C9FA 4FXCA 4N9F4 1X86A 4ZRPA 2N0YA 1KBLA 2DX1A 1TBEA 3Q6BA 2J59M 1UPRA 2RLOA 4JKCA 1WVHA 3NUHB 3BWUD 3V62A 1V5TA 2VRRB 1YNTE 4D0NB 3AECB 3K9PB 2BT6A 4LLGM 1UWXA 3GB1A 1IBXA 4KV2A 1E9MA 1TJEA 2WXNA 1WE7A 2WXMA 2G9HD 2K8BA 2JYTA 4TQ1A 2EMSA 1OQNA 3AE2B 5HE3A 1DDWA 4JWUC 2Z0PA 2LMCA 1W1HA 1QOAA 4DXGA 2P0HA 2M8SA 5CX3A 3V3XA 2WHIA 1M7EA 4WWPA 2JPHA 2FCQA 3A4SC 4A3OA 2PPHA 2RDGA 4HRSA 4NPNA 4WSFA 1Y19B 4NQKE 1V1OA 1TKEA 2J0MA 4JKFA 1VRAB 1Y8RC 3KY9A 1JWAD 3QAQA 2UZRA 1FGZA 3HM3A 4FHJA 3Q3MC 3H8HA 5AZGA 4Q2JA 1E7PB 4OZBA 4AJYB 2KWDA 3IT4B 4HAYB 2V3NA 3VRAB 3ZVVA 2NVUI 4L1RA 3NW8A 4GU2A 2KVRA 3HQCA 4RM8A 2I5CA 3KH0A 4GLSC 1OQYA 3M3JA 2MX2A 2KWUB 1TTNA 1WXAA 5JP4A 4WAAA 5LG4B 5IP4D 5T8IA 5AZFA 4TYZA 3KYDD 1L4DB 3P7ZA 3KRXA 1C4AA 3AV8A 1FNUA 2JRIB 3VH3B 5HHDG 3SDLC 2EJ8A 2UYZB 2JSVX 3ULCA 3FEHA 1T0YA 3ZDMC 2UZSA 3N1YC 1TT5B 5MPOA 1QOBA 1PFJA 3MP9A 3CIRB 1WX8A 1F52A 2NBVA 5KQ1A 4LDTD 3M1IB 5JHGA 2FJLA 1V5MA 1UNQA 2NPTB 1V86A 5G5GA 2FDQA 1C4PA 3AE7B 3OAWA 3JYUA 1GC6A 1QLBB 1QOGA 1MI1A 2IGDA 2V76A 5J3TA 2L52A 5H92C 2FJ9A 3HIEA 3DVGY 1IGCA 4LJOB 3OANA 2W55A 4LDTB 2RNRB 2KDFB 3P4PB 3IXSA 2NTTA 3Q8EA 5DH9B 2ZPNA 1JWMD 2V3SA 4A6FB 4CYEA 2KUPA 2LZ6A 3CXBB 2K8EA 5JHBA 3DHHC 3ZDTA 3ULBA 3BINA 3RNFC 5J18A 3E66A 4PYUA 2DTCA 5FI1A 1WZ0A 2KFJA 1SF0A 3ML8A 4ZRKA 3P4SB 2MJEA 2YS3A 4BOZB 3DQVA 3TBLD 1HB6A 3SBTA 2YF0A 2I38A 2QSDA 2GI9A 3L0WB 5IA7A 1I35A 2KFKA 4OVUA 4KKJA 3NVWA 1E90A 2MBHA 1R4NB 3JSVA 2NS5A 3HK0A 5C5BA 1WWTA 3P1MA 2KIEA 1LO5D 1V2YA 3QCAA 4K7UA 2IGHA 4J6IA 1IUEA 3M63B 2YVCA 1G6JA 1WMHA 4EOYA 2M0XA 2WH5A 2D3AA 3CSFA 1GJZA 4KVGB 1R4MB 4JKGB 2W3RA 1X11A 1T5XD 1OGWA 3NZ3A 2ON8A 4M00A 1I7AA 3IG3A 4BKSD 2N9EB 1WM2A 2M14A 5EDSA 2NMBA 2ZNVB 2E3TA 4N58A 1CJEA 4LNKA 4NAMA 3HRDD 2FUG1 2HE7A 1QQRA 2QJLA 3RNEC 1ZPSA 4RGTA 5TR5A 5D3VA 5AUIA 1TXDA 2BQQA 3HW2B 3TMPB 2L76A 1ET9A 2ROVA 2XK5B 2R2OA 1JROA 2SAKA 4IUMB 2J4XA 3NY5A 2GBJA 2IGGA 1T3QA 3ZW3A 2NTSA 2YS5A 1VDVA 3E9PA 3Q69A 2K5PA 2K0PA 4A90A 3SO6A 1V1PB 5C79A 4N6EB 2BYTA 2K1FA 3VFKA 3WAMA 3IVFA 3IT6B 4ZOHC 1FFUA 2BYEA 1KI1B 2QIEB 2FIFA 3H1UA 2RD0A 3TSSA 4KZ0A 2KOXA 4KKIA 2G3QB 3ZTCA 1I2HA 1WZ3A 4TV3A 4CHJA 1FXTB 2DX5B 2D9VA 2MBEA 5LONB 2WDQB 1DOXA 2KKCA 1PQSA 1JW9D 3VTWA 2N7JA 1FPYA 3NZSA 4JLCA 3WANA 4W9FA 2EKEC 3NWDA 3ZVRA 3RULA 3UIPB 1T0SC 3Q3JA 4HXDA 2GBNA 4K1RB 1QT9A 1VZ7A 2JWUA 4NY0A 1V88A 4HCPB 2K2UA 1EGXA 1E5WA 2G45B 2BBCA 2WU5B 2KVZA 2RUKB 1DBHA 3H6NA 2LG1A 4BKSA 3TIXA 3WIMA 4NJ6A 3A8QA 1DDMA 1PYWD 4X57B 1V61A 3WCQA 4ZHPA 3DVNV 3UINB 2AX5A 3C8YA 3ZQ4A 4BKGA 4CQNA 3APDA 3RD2A 1RJ2A 1WF9A 4IOIE 4L6EA 3AEGB 5JVLA 4FBJB 4ZDVA 2KNBA 4MGYE 2DN6A 3T06A 1GG3A 2HDEA 2MEKA 5IAAC 1YN5A 3RCZA 2J0KA 2UWQA 4RFBA 2KO3A 2R61A 1UNSA 3W9CB 4HB3B 3B9JA 2MLBA 2K49A 4XWTA 1NI3A 4Z2MB 3U30A 3ECIA 4L2YA 3PLUA 3GS2A 4MJSA 3B77A 3VOQA 3NS8A 3FAHA 4QJ3B 3PRPB 1XR0B 1YN3A 1H4RA 3LJUX 3HVDA 4B0MA 4GIVA 4RM9A 1LM8B 4IM3A 4M0WA 2WXJA 3KSYA 2GLSA 2WXOA 3TFMA 4PYZA 3RCPA 2HJ1A 3Q3OC 4HROA 2WDVB 4DX90 1L0YB 5D3IB 5D3YA 3VRBB 1WJ1A 5HKHA 4BBNF 2DIKA 2BYFA 2FUHB 3ENBA 1A70A 4RH6A 2YLMA 3GE3C 5DI9B 2DYOA 1R4NI 3AU4A 2ABDA 3AEAB 3DOWA 1CQVA 4W9KA 1SIFA 3D8FA 4DDID 4HSIA 4YTPB 4HATB 1E7VA 1WRDB 3NS1A 4LCDE 5E6NA 4NQLB 2LGXA 5G5HA 2KGXB 3MHZA 1YJJA 2RDHA 1EWYC 1MJDA 4L1BA 1ET6A 2VZKD 2Q5WD 3DDCB 1DGJA 1WSPA 2KQSA 2LOXA 4PS7A 5C23A 4YONA 3A1QA 2KC1A 1X1MA 2INNE 2IJ0A 1C1YB 3ZNZB 5FR6A 2PMVA 2CODA 1IGDA 2XN9C 1OQQA 4E3CA 4JX1C 1I4PA 2KD0A 1MPEA 3KVFB 1QOFA 1JDEA 1IP9A 2NZ8B 4BBNC 4OZCA 2GRIA 1UH6A 3DXCA 2JT4B 3N3KB 3PZ8A 4A8XC 1V9JA 4IG7B 1V5OA 1OTRB 4I6PA 2G1EA 2L32A 4WURA 3C19A 1HZ6A 1L6UA 4GDKA 4XGAB 3U2SC 3LDZE 3PP2A 2O2VA 3WALA 4WH4A 2Q13A 4KSLC 1V49A 3TEZA 1RFKA 2WXPA 3W5UB 2KQ4X 3V6CB 1MHXA 2MBOA 2COAA 5J3YA 2WXLA 3QARA 1T0RC 4WJNA 4O1NA 2L05A 4C7YA 3NZUA 3OHMB 4MGIE 1KJTA 2YSZA 2MSED 3ZIMA 1TQZA 1WYWB 1ZGUB 4JKAA 4LK0M 1VJKA 1S3SG 3AI5A 4W9HA 4DX8A 2AEHA 3F0WA 4MM3B 1UD7A 2P8VA 2WXKA 3NHEB 4WJQA 1P7FA 1EU4A 4C7ZA 2MHJA 1TZ1A 2D10A 3EFUA 3OJ3A 2ZZPB 1QZEA 1EF5A 2CY5A 4OT1A 5BO4B 2AYOB 3AEDB 1U5GA 1W1GA 2YS1A 3A9KA 2WP9B 1U2BA 2K00A 4R3DA 1XLOA 2DZJA 2Z0DB 1QC6A 2M0AA 1U5FA 4FULA 4MGKE 2DENB 2QMTA 3NWFA 2KWCA 2DKQA 1FD6A 3SD5A 4P7IA 1YOVB 2PIAA 3A9JB 2CHWA 1ZE3D 2JP2A 4CO7A 2OHFA 5DPWA 2C60A 1UUPA 4Y94A 2R2QA 3APCA 4J3OD 1P5TA 2AWTA 2D3BA 2OEDA 2C7HA 2CHZA 1KF6B 5HG2A 1UPQA 1U4AA 2JZZA 4P16A 2JQRB 4KHBA 4HB2B 3RNGC 2WDRB 1WGKA 1UGJA 2DZIA 2L0FA 2MA9B 1NU2A 2BWFA 4H8SA 3RI7C 2NR2A 1DOYA 2L7RA 5HI1A 1NI2A 2KTRA 3ZGZA 4LNIA 1DROA 3U52E 3GZNB 4D6WA 4LNFA 3E9OA 1GB4A 2JUOA 4KIKB 1UBIA 4FADA 3BVMA 1JCKB 1FXIA 4WIPA 2GMIC 3QJZA 4MH8A 2QC8A 3L10B 1N61A 2XBBC 1N6ZA 3AEFB 2N1WA 1FEHA 1XCTL 2AQ2B 2WXFA 1WI1A 2DNFA 2WX1A 2MJDA 3PG7A 4AQ7A 4LTUA 2GOWA 4GDLA 3CWIA 4Z2NA 2JZPA 3NRZA 1GNUA 3NOBA 3CF6E 3DBRB 1UEFA 2CHXA 5EE3A 1K5GB 2MP2B 1HXYD 3UI3A 4ICUA 3FM8C 1XKEA 1U29A 5KHOA 3A98B 3U7ZA 3V5WA 2GB1A 1SE2A 1C79A 3HM6X 3DBHI 1L0XB 4A6QA 1PDXA 2D3CA 3DBSA 1N63A 2QHOA 2FAZA 3SFEB 1X1FA 1V80A 2KX3A 3RT3B 2LULA 2RGNB 2H89B 5IN7A 4OZAA 4NAWA 3ZXRA 2BKRB 1NYQA 1H8CA 2GS0A 4W9EA 4AOFA 2DYQA 3L54A 2Z14A 3DBLB 3G9WA 3PZDA 1WGDA 1XLQA 4TMAB 4OVZA 4YL8A 4WJ7A 5IRSA 3MHSD 1Z5SB 1FNVA 4DHJB 1FMAD 1I42A 2GBKA 1PGAA 2BYVE 1V5PA 1MPHA 2WXIA 3ZO5B 3IAM1 1C3TA 2AQ1B 1V89A 4YWGG 3RNCC 4BAXA 1FFVA 3PO0A 2V4LA 1HEZE 3RPFC 1EU3A 3QQ8B 2VRWB 4H2AA 1FRRA 1WXVA 2DLBA 2UVMA 1ZDVA 2RSUA 4URKA 4LJPB 2BB6A 4C00A 3Q8BA 5C16A 3AE4B 4JWSC 1TY2A 3OJ4B 2PLPA 4NJCA 1RRPB 3TJPA 1WY8A 2LHDA 2QEJC 1NTVA 2OQBA 2MW5A 3EHVA 3Q14C 1WGQA 3PV1A 2KIGA 2Y8GA 3PVLA 2D9YA 2MDXA 1DYQA 3TVVA 4RF0A 4PK1A 2Z59A 3QBVB 1Z87A 2WQYB 1YX5B 2QKMA 1WR1A 1F0ZA 3AN1A 4II2B 3RYTA 4ANWA 4ZHOA 3AEEB 4EZJA 1KLVA 1V8CA 1Y5OA 5CHFA 4K3BA 1MG4A 4TKNA 4A5KA 5D3XA 3VIAA 3GYOA 4BKTA 4IWQA 4OHJA 4JGHB 4GNKB 1I4RA 3PZ7A 3P4QB 2XNAC 4L23A 1KC7A 3FSSA 3SV1A 1Z2MA 4JIOU 2RMMA 4NNJB 3AE3B 2L1AA 3U12A 2J0JA 1WRIA 3BK2A 4CSQA 2I1KA 1EF1A 4RF1A 3H7PB 3RMKC 3QWZB 5FI0A 4AUQC 2KC2A 2PEAA 2G35A 1SEBD 1FHXA 3NVZA 3T9LA 4ARIA 1YMHE 3LJ3A 2LBBA 1MHHE 2ZCCA 5CLLB 3VTUA 3NWAA 2IYDB 5DPRA 2RPQA 4AP4C 2E6XA 4S0RA 2CB8A 2K8HA 3E56A 4NSWA 1ZW7A 4ANUA 2HD5B 4C80A 4K3CA 5D6JB 3R8BA 3KQ4A 3B1LX 3DVGX 3AH7A 2NPTA 3Q2AC 1E8XA 2ZJDA 2CAYA 1XODA 2VSZA 1R7SA 2ICIA 1K52A 4IM2A 1HBKA 4NJ7A 1U5EA 3NJTA 2LOZA 3ZLZA 3P63A 1QKZA 4W9JA 3X23A 5E6JA 5I2MA 4F7HA 4A6FA 4BVUC 1WI0A 1UNRA 1FNWA 3N1XC 4MELA 4HWIB 1RWSA 2ONQA 3GP7A 2PW9A 5IKCM 1E0ZA 2ACZB 3HSAA 1J0WA 1WFYA 4WWMA 5G2NA 3AE8B 1D4BA 3NVYA 4HHVA 2WLBA 4S17A 4JE3B 3KWLA 4C4VB 1K5DB 5AUKA 3PHWB 1C4CA 4ILGB 3X0WA 2W9NA 4EJNA 1WGRA 1PMSA 2LEKA 2BCJA 2KXJA 3ZTDA 4JKGA 3UF8A 1HZ5A 3Q8FA 2LASA 2ZW0A 4TQ0A 1V81A 3ZYYX 1JRUA 1Q5WB 2DHZA 1N3HA 1NVLA 1XQQA 4MJSB 2O6VB 3PHXB 3VAWA 3SUZA 2R0DA 1SGHA 3ML9A 2KT7A 4W9LA 3ENEA 1S1QB 3Q3NC 2K6DB 4GGQA 1GB1A 1AW7A 2LD9A 2KJRA 2Z0OA 2XK5A 2DYBA 1RRBA 1E10A 2PE9A 2N23A 4WWOA 3BYYB 4PQ0A 3EC8A 2N9KA 2V0GA 1WGYA 4WAFA 1V1PA 5FK9C 4ZYNA 1SJHD 4BZAA 3VUXA 3FKYA 1J7BA
chains in the Genus database with same CATH topology
4F7GA 4IFSA 2G4SA 2MWSB 1FHWA 2B3AA 3P6AA 2HTHB 5JHHA 1QQGA 2AL6A 3ZRFA 3V61A 4K2OA 1WJUA 3M62B 3O96A 3W1SC 1GUAB 3PT2B 2DX5A 1MKEA 2LKOA 1KZGA 2Z0QA 3PS6A 4E71A 1DDVA 4MK0A 2MFQA 1AQCA 2LGDA 1SHCA 5EFXA 1DIKA 4ANXA 1P1AA 2DKPA 3I3TB 1IRSA 3RZWC 2BKFA 2IY0B 3PPAA 1E8WA 4HPLB 3APFA 3PVWA 2DFKA 1LXDA 3ML4A 3PVUA 2LI5A 1WX7A 2Y8FA 1L2NA 1MIZB 2MQJA 2KLCA 4IOYX 4G3XB 3ONSA 3IFWB 3F5RA 3QX1A 4JK7A 4IW0A 1M94A 5L95C 2V1YA 2ZPYA 5JH5C 2DZKA 1R4MI 2WWZA 1IYFA 3KYCD 1NTYA 3SBGA 3Q3FA 2WYQA 2LVQA 1WH3A 2P0FA 1EUVB 2KJ6A 2D11A 2CQUA 2M17A 3A8PA 1X1GA 1HE8A 2D07B 1XCGA 2LYDA 2XEWA 5GOWB 1WJ6A 2D9XA 3GOEA 3CSTA 4FN2A 5GMVA 4G50A 2LRUA 4B6WA 2M4NA 1D3ZA 4JKDA 3U7DA 1EAZA 3MPXA 5JHAA 4JKHA 4GMVA 4HAUB 5CHWA 4GOCA 1WGUA 3ZNID 1UBQA 1MIXA 2L2IA 4EMOA 1L7YA 2JF5A 3VUYA 5E6PA 2KZRA 4E74A 1BTKA 1GGOA 2ASQA 4ILJA 1MK9B 2KANA 4GZUA 2Z0EB 1WJNA 3PREA 3NSUA 3KUZA 1OEYJ 2D3GA 4OVVA 3L08A 1FHOA 4DDGD 1KOTA 1OMWA 3KUCB 4HDOA 2DAFA 5HE1A 2JRHA 3FP5A 3UQAA 4KSKC 3ODOA 3ZRCA 1HB8A 4DHZB 4K81A 1Q1OA 4EZKA 4EZLA 4MDKE 1P9DU 1LQBA 1RLFA 2JVCA 3MDBC 4B6HA 1MAIA 2KMCA 4I6LB 2JXXA 2KWVB 3AXCA 2LWPA 2N1VA 1WJMA 5J2RA 3VXWA 3OLMD 3R66C 1VBGA 2GBRA 3QWMA 2LXCA 1ZVRA 1XD3B 2BPSA 3ALBA 4HAVB 1J8CA 4HCNB 3SHQA 3V6EB 1UNPA 1WM3A 2W2XC 4WVFB 4ZRJA 4HB0B 3CIKA 3R3MA 2RQ1A 1OY2A 1EVHA 4HAXB 4C0AA 2NCNA 4XWXA 3UQBA 1KM7A 2KX0A 4ZRIA 3ODWA 4JKEA 1NBFC 3MTNB 4EUTA 2DLWA 4HVBA 4MM3A 1WX9A 2H7DA 3VH4B 4JK9A 1V6EA 2IO0B 4DBGA 2IZVB 4ASWC 4B95A 4FJVB 5LLIA 2COCA 2YT0A 2FCSA 2OJRA 2ADZA 2ZVOA 1WGGA 5G55A 3TL5A 1ZC4B 3KZ1A 3AU5A 3SNHA 1P3RA 2KCJA 3A9JA 4ICVA 4M8MA 1TJ6A 3JVZX 2K39A 2M38A 2REXA 2W2WA 2MWNB 4ANVA 3HHMA 2CU1A 4RMAA 2OTXA 2KDBA 2L00B 4HAZB 5C1ZA 3PRZA 5D27A 3DXDA 3JW0X 3SU8X 3FLVA 3L17A 3TCAA 2C7NB 4DHJD 1ZM0A 2DYMA 4FJZA 5CTRC 2NBVB 4GB9A 2Y5BB 4IWOA 1P98A 2R82A 3ZKJC 4MEMA 2DHKA 3DCGA 2BF8B 4HK2A 3N7CA 4HDQA 4JKBA 5D2MB 2Z59B 4KIKA 4W9CA 4F7ZA 5IJMA 3W1SA 4K2PA 4HLEA 2Y7BA 2H7EA 4KHOA 5JZEB 3UIOB 1OEYA 5LXHA 4FA6A 3T8MA 2K2JA 2N9XA 4BOSC 1E7UA 3S2AA 3U8ZA 4I6NB 2GCLA 3R7RA 1B55A 3VHTC 4MGZE 5L81A 2WDTB 3V60A 2MKRA 2LUEA 4HB4B 2ZCBA 1ZKHA 3RUIB 2MP2A 2KFKB 4W9DA 3VTVA 1GC7A 2EC1A 4KDIC 1ZC3B 4JK8A 4XZ4A 3JSVB 5HE0A 5C5BB 2KTFA 4PS3A 1WMHB 1P6SA 2C7MB 2OOBB 2I1JA 3UGBB 2EMTA 4MH0E 4BBKA 2JY6A 2IO3B 3D8DA 4B9KA 2LVPA 4A3PA 2NBUA 1P3QU 3L13A 3N32A 5CHVC 5C6RA 1J0GA 1EO6A 3PRMB 4MT7A 2N7EA 2IY1B 3IBEA 2DAJA 1SE9A 2M1MA 5KCVA 2L8JA 1U5DA 4MSQB 3ZNGC 2FCMA 3WAOA 2MBQA 1PLSA 4G11A 2W2XD 2RSGA 3QIJA 4II3B 4CHMA 1BWNA 1LFDA 1P0RA 4IM0A 5DPTA 3SYXA 3CMMB 5JLJB 3GZNI 2GJYA 3P2BA 4XX5A 3H7SA 2DYNA 1FGYA 1UELA 4TUUA 2CR5A 2XQNM 3VVWB 3QC8B 2BGFA 1BTNA 1VBHA 1VCBA 1ZSQA 3MJWA 5J3QA 1YX6B 3DPDA 1XX0A 3WA0A 3DBRI 1WE6A 3B0AA 4KZCA 1Q0WB 2IFSA 3C0RB 3H7PA 2CKHB 4A6KA 3B08A 4A6HA 2AL3A 3PSEB 2DA0A 1YD8U 2O6VD 1RAXA 3WYFB 5D3WA 1YIWA 4F8CB 4K17A 4K7SA 3D8EA 2MCNB 3DBLI 3VQIA 3K9OB 5E6OA 3TW1A 4CHKA 5D7GA 2X18A 2CS4A 4GSWA 2BWES 2DHIA 4G0NB 5HE2A 5DPSA 2LJ5A 4KAXB 5LXIB 4M0WB 3VDZA 4FHKA 2C5LC 5KQ4A 4DK5A 4GMXB 2RGFA 1ISNA 3M95A 4IAPA 2LGYA 2A5UA 2FNJB 1J19A 1DYNA 4XC2A 2IO1B 1KZ7A 3EECA 1VD2A 3KRWA 2CRFA 3BJIA 4FJYA 5AEKB 3KUDB 3QK0A 3ODXA 1UGMA 1UZXB 1WXMA 3L16A 2YRYA 4EKUA 1XT9B 2VKIA 5AZHA 2I5FA 4WWNA 4EEWA 3ZUNA 1WG7A 3A1QB 2MBBB 1X05A 2K8CA 4MY6A 2GBMA 2R09A 2COPA 2N4FA 2E2XA 4WJOA 4DWFA 2O6VA 4AJWA 1W1DA 2LVOA 3PGEA 3RZFA 3ZNHB 1XD4A 3GYPA 2G4DB 1FB8A 4PNKA 2FIDA 5CLQB 1ACAA 1MK7B 1LW3A 4DBBA 1U27A 4GXBA 5LOPB 1M7RA 2X0SA 3VUWA 4GDKB 3AULA 4A20A 1AARA 2IBIB 2O2VB 2DZMA 4HPMB 4WQOB 4BFRA 2KLGA 2HTHA 1NDDA 3PEGA 1ST7A 2MRPA 2K6QA 2KHWB 2L0TA 2DHJA 2P0DA 2YT1A 2ELBA 3PLVA 1YJ1A 2LXAA 2WX0A 3N30A 2D9WA 2HRJA 4IC7B 2D4QA 1CMXB 4KHAA 1Q67A 3EPYA 3HIZA 4F1SA 1FOEA 1K8RB 5L83A 3TO1A 2KMAA 1WR6E 3A9KB 1WJ4A 3KW5B 2PZ1A 2JZ3B 3DVNU 1WIAA 2D2QA 2CY4A 3UZTA 4PS8A 3QA8A 3W1YA 3DXEA 3BY4B 2KN5A 1A5RA 3PTFC 4JQWC 4IWPA 4M8NA 1RFAA 1AWEA 2NBWB 2L3ZA 1IPGA 1BAKA 1LB1A 3O65B 1V5UA 4W9GA 2LRWA 3A33B 4KHBB 5DHFB 5DCNA 4HJKA 4JL9A 4DHZE 4F7UP 1E8ZA 2KQ7A 2JWZA 2GCJA 2KTRB 1E8YA 2KJHB 2ZEQA 4MSMB 4AWJA 2IO2B 2IYBA 2D9ZA 4FLHA 2HJ8A 5KHQA 4W9IA 2ZVNA 1F9JA 2RVBB 2K25A 2C9WB 4DXAB 2QKLA 5DIFB 2PE6B 1NTIA 3IHPC 4GDLB 5J17A 1H10A 1YQBA 1FAOA 1TGZB 3A4RA 2ZNVC 4GPTB 4GN1A 2PJHA 4K7WA 1WGHA 1MG8A 3R7QA 1BT0A 3PSCA 4HAWB 2L1CA 2N7DA 2FCNA 5D94A 1WXSA 3QHTA 2COFA 3D32A 2J7QB 2KK8A 2KDEB 2ROZB 4ILHA 4NAWB 3E9LA 2ELAA 3AJ4A 3H9DA 3WAPA 2A4ZA 4KDLB 4EFOA 2RR9A 4WJPA 2N9PC 2KDIA 5DHAB 4N9F4 1X86A 2N0YA 1KBLA 2DX1A 1TBEA 2J59M 1UPRA 2RLOA 4JKCA 1WVHA 3V62A 1V5TA 2VRRB 4D0NB 3K9PB 4KV2A 1WE7A 2K8BA 4TQ1A 2EMSA 1OQNA 5HE3A 1DDWA 2Z0PA 1W1HA 2P0HA 2M8SA 5CX3A 1M7EA 4WWPA 2JPHA 2FCQA 3A4SC 4A3OA 2PPHA 4NPNA 4WSFA 1Y19B 4NQKE 2J0MA 4JKFA 1Y8RC 3KY9A 3QAQA 2UZRA 1FGZA 3HM3A 4FHJA 5AZGA 4AJYB 4HAYB 3ZVVA 2NVUI 4GU2A 2KVRA 3HQCA 4RM8A 2I5CA 3KH0A 1OQYA 3M3JA 2MX2A 2KWUB 1TTNA 1WXAA 5JP4A 4WAAA 5AZFA 4TYZA 3KYDD 3P7ZA 3KRXA 2JRIB 3VH3B 3SDLC 2EJ8A 2UYZB 3ULCA 3FEHA 1T0YA 3ZDMC 2UZSA 1PFJA 1WX8A 5KQ1A 4LDTD 3M1IB 5JHGA 2FJLA 1V5MA 1UNQA 2NPTB 1V86A 2FDQA 3OAWA 3JYUA 1GC6A 2V76A 5J3TA 2FJ9A 3DVGY 4LJOB 3OANA 4LDTB 2RNRB 2KDFB 5DH9B 2ZPNA 2V3SA 4A6FB 4CYEA 2KUPA 2LZ6A 3CXBB 5JHBA 3ZDTA 3ULBA 3BINA 5J18A 3E66A 4PYUA 2DTCA 5FI1A 1WZ0A 2KFJA 3ML8A 4ZRKA 2YS3A 4BOZB 3DQVA 3TBLD 1HB6A 3SBTA 2YF0A 3L0WB 5IA7A 1I35A 2KFKA 4OVUA 1E90A 2MBHA 3JSVA 2NS5A 3HK0A 5C5BA 1V2YA 4K7UA 3QCAA 4J6IA 3M63B 2YVCA 1G6JA 1WMHA 4EOYA 2M0XA 2WH5A 3CSFA 1GJZA 4KVGB 4JKGB 1X11A 1OGWA 1I7AA 3IG3A 4BKSD 2N9EB 1WM2A 2M14A 5EDSA 2NMBA 2ZNVB 2HE7A 5TR5A 5D3VA 1TXDA 3HW2B 3TMPB 2L76A 2ROVA 2XK5B 2R2OA 4IUMB 3NY5A 2GBJA 3ZW3A 2YS5A 3E9PA 3SO6A 5C79A 2K1FA 3VFKA 3WAMA 3IVFA 2BYEA 1KI1B 2FIFA 3H1UA 2RD0A 4KZ0A 2KOXA 2G3QB 3ZTCA 1I2HA 1WZ3A 4TV3A 4CHJA 1FXTB 2DX5B 2D9VA 2MBEA 5LONB 2KKCA 1PQSA 3VTWA 3NZSA 4JLCA 3WANA 4W9FA 2EKEC 3ZVRA 3RULA 3UIPB 3Q3JA 4HXDA 2GBNA 4K1RB 4NY0A 1V88A 4HCPB 2K2UA 1EGXA 1E5WA 2G45B 2RUKB 1DBHA 3H6NA 2LG1A 4BKSA 3TIXA 3WIMA 4NJ6A 3A8QA 1DDMA 4X57B 1V61A 3DVNV 3UINB 4BKGA 3APDA 3RD2A 1RJ2A 1WF9A 4L6EA 5JVLA 4FBJB 4ZDVA 2KNBA 4MGYE 2DN6A 3T06A 1GG3A 5IAAC 3RCZA 2J0KA 2UWQA 2KO3A 4HB3B 2MLBA 4Z2MB 3U30A 3ECIA 3PLUA 4MJSA 3VOQA 3NS8A 3PRPB 1XR0B 1H4RA 3LJUX 4GIVA 4RM9A 1LM8B 4IM3A 3KSYA 3TFMA 4PYZA 3RCPA 4DX90 5D3YA 1WJ1A 5HKHA 4BBNF 2DIKA 2BYFA 2FUHB 3ENBA 2YLMA 5DI9B 2DYOA 1R4NI 3AU4A 2ABDA 3DOWA 4W9KA 1SIFA 3D8FA 4DDID 4HATB 1E7VA 1WRDB 4LCDE 5E6NA 4NQLB 2LGXA 2KGXB 3DDCB 2KQSA 2LOXA 4PS7A 5C23A 4YONA 3A1QA 2KC1A 1X1MA 1C1YB 3ZNZB 5FR6A 2CODA 4E3CA 2KD0A 3KVFB 1JDEA 1IP9A 2NZ8B 4BBNC 1UH6A 3DXCA 2JT4B 3N3KB 1V9JA 4IG7B 1V5OA 1OTRB 4I6PA 4GDKA 3LDZE 3PP2A 2O2VA 3WALA 2Q13A 4KSLC 1V49A 3V6CB 2MBOA 2COAA 5J3YA 3QARA 4WJNA 2L05A 3NZUA 4MGIE 1KJTA 2YSZA 2MSED 3ZIMA 1TQZA 1WYWB 1ZGUB 4JKAA 1S3SG 3AI5A 4W9HA 4DX8A 2AEHA 3F0WA 1UD7A 2P8VA 3NHEB 4WJQA 1TZ1A 2D10A 3EFUA 3OJ3A 2ZZPB 1QZEA 1EF5A 2CY5A 5BO4B 2AYOB 1U5GA 1W1GA 2YS1A 3A9KA 1U2BA 2K00A 2DZJA 2Z0DB 1QC6A 4FULA 1U5FA 4MGKE 2DENB 2KWCA 2DKQA 3SD5A 4P7IA 3A9JB 2CHWA 2JP2A 4CO7A 5DPWA 2C60A 4Y94A 2R2QA 3APCA 1P5TA 2AWTA 2C7HA 2CHZA 1UPQA 1U4AA 2JZZA 4HB2B 2DZIA 2L0FA 2MA9B 1NU2A 2BWFA 4H8SA 2NR2A 2L7RA 1NI2A 2KTRA 1DROA 3E9OA 2JUOA 4KIKB 1UBIA 4FADA 2GMIC 3QJZA 3L10B 2XBBC 2N1WA 1WI1A 2WX1A 3PG7A 2GOWA 4GDLA 4Z2NA 1GNUA 3NOBA 3CF6E 1UEFA 2CHXA 1K5GB 2MP2B 4ICUA 3FM8C 1XKEA 1U29A 5KHOA 3A98B 3V5WA 3HM6X 3DBHI 3DBSA 2QHOA 2FAZA 1X1FA 1V80A 2KX3A 3RT3B 2LULA 2RGNB 4NAWA 2BKRB 1H8CA 2GS0A 4W9EA 4AOFA 2DYQA 3L54A 3G9WA 3PZDA 1WGDA 4YL8A 4WJ7A 3MHSD 1Z5SB 4DHJB 1I42A 2GBKA 2BYVE 1V5PA 1MPHA 3ZO5B 1C3TA 1V89A 2V4LA 3QQ8B 2VRWB 1WXVA 2UVMA 2RSUA 4URKA 4LJPB 5C16A 3OJ4B 1RRPB 3TJPA 1WY8A 1NTVA 2OQBA 2MW5A 3EHVA 1WGQA 3PV1A 2Y8GA 3PVLA 2D9YA 2MDXA 3TVVA 3QBVB 1Z87A 1YX5B 2QKMA 1WR1A 4II2B 3RYTA 4ANWA 4EZJA 1KLVA 1Y5OA 5CHFA 4TKNA 4A5KA 5D3XA 3VIAA 3GYOA 4BKTA 4IWQA 4JGHB 1KC7A 3FSSA 3SV1A 1Z2MA 4JIOU 4NNJB 2J0JA 2I1KA 1EF1A 3H7PB 3QWZB 5FI0A 4AUQC 2KC2A 2PEAA 2G35A 1FHXA 3T9LA 3LJ3A 2LBBA 2ZCCA 5CLLB 3VTUA 5DPRA 2IYDB 2RPQA 4AP4C 2CB8A 2K8HA 4NSWA 1ZW7A 4ANUA 2HD5B 5D6JB 3B1LX 3DVGX 2NPTA 1E8XA 2ZJDA 2CAYA 1XODA 2VSZA 4IM2A 1HBKA 4NJ7A 1U5EA 2LOZA 3ZLZA 4W9JA 3X23A 4F7HA 4A6FA 4BVUC 1WI0A 1UNRA 4MELA 4HWIB 1J0WA 1WFYA 5G2NA 4HHVA 1K5DB 3PHWB 4ILGB 3X0WA 2W9NA 4EJNA 1WGRA 1PMSA 2BCJA 2KXJA 3ZTDA 4JKGA 3UF8A 2LASA 4TQ0A 1V81A 1JRUA 1Q5WB 2DHZA 1N3HA 1NVLA 1XQQA 4MJSB 2O6VB 3PHXB 3VAWA 3SUZA 2R0DA 1SGHA 3ML9A 4W9LA 3ENEA 1S1QB 2K6DB 4GGQA 2LD9A 2KJRA 2Z0OA 2XK5A 2DYBA 1RRBA 2PE9A 2N23A 4WWOA 4PQ0A 3EC8A 1WGYA 4ZYNA 3VUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7G A;  4IFS A;  2G4S A;  2MWS B;  1FHW A;  2B3A A;  3P6A A;  2HTH B;  5JHH A;  1QQG A;  2AL6 A;  3ZRF A;  3V61 A;  4K2O A;  1WJU A;  3M62 B;  3O96 A;  3W1S C;  1GUA B;  3PT2 B;  2DX5 A;  1MKE A;  2LKO A;  1KZG A;  2Z0Q A;  3PS6 A;  4E71 A;  1DDV A;  4MK0 A;  2MFQ A;  1AQC A;  2LGD A;  1SHC A;  5EFX A;  4ANX A;  1P1A A;  2DKP A;  3I3T B;  1IRS A;  3RZW C;  2BKF A;  2IY0 B;  3PPA A;  1E8W A;  4HPL B;  3APF A;  3PVW A;  2DFK A;  1LXD A;  3ML4 A;  3PVU A;  2LI5 A;  1WX7 A;  2Y8F A;  1L2N A;  1MIZ B;  2MQJ A;  2KLC A;  4IOY X;  4G3X B;  3ONS A;  3IFW B;  3F5R A;  3QX1 A;  4IW0 A;  1M94 A;  5L95 C;  2V1Y A;  2ZPY A;  5JH5 C;  2DZK A;  1R4M I;  2WWZ A;  1IYF A;  3KYC D;  1NTY A;  3Q3F A;  2WYQ A;  2LVQ A;  1WH3 A;  2P0F A;  1EUV B;  2KJ6 A;  2D11 A;  2CQU A;  2M17 A;  3A8P A;  1X1G A;  1HE8 A;  2D07 B;  1XCG A;  2LYD A;  2XEW A;  5GOW B;  1WJ6 A;  2D9X A;  3GOE A;  3CST A;  4FN2 A;  5GMV A;  4G50 A;  2LRU A;  4B6W A;  2M4N A;  1D3Z A;  3U7D A;  1EAZ A;  3MPX A;  5JHA A;  4GMV A;  4HAU B;  5CHW A;  4GOC A;  1WGU A;  3ZNI D;  1UBQ A;  1MIX A;  2L2I A;  4EMO A;  1L7Y A;  2JF5 A;  3VUY A;  5E6P A;  2KZR A;  4E74 A;  1BTK A;  2ASQ A;  1MK9 B;  2KAN A;  4GZU A;  2Z0E B;  1WJN A;  3PRE A;  3NSU A;  3KUZ A;  1OEY J;  2D3G A;  4OVV A;  3L08 A;  1FHO A;  4DDG D;  1KOT A;  1OMW A;  3KUC B;  4HDO A;  2DAF A;  5HE1 A;  2JRH A;  3FP5 A;  3UQA A;  4KSK C;  3ODO A;  3ZRC A;  1HB8 A;  4DHZ B;  4K81 A;  1Q1O A;  4EZK A;  4EZL A;  4MDK E;  1P9D U;  1LQB A;  1RLF A;  2JVC A;  3MDB C;  4B6H A;  1MAI A;  2KMC A;  4I6L B;  2JXX A;  2KWV B;  3AXC A;  2LWP A;  2N1V A;  1WJM A;  5J2R A;  3VXW A;  3OLM D;  3R66 C;  2GBR A;  3QWM A;  2LXC A;  1ZVR A;  1XD3 B;  2BPS A;  3ALB A;  4HAV B;  1J8C A;  4HCN B;  3SHQ A;  3V6E B;  1UNP A;  1WM3 A;  2W2X C;  4WVF B;  4ZRJ A;  4HB0 B;  3CIK A;  3R3M A;  2RQ1 A;  1OY2 A;  1EVH A;  4HAX B;  4C0A A;  2NCN A;  4XWX A;  3UQB A;  1KM7 A;  2KX0 A;  4ZRI A;  3ODW A;  1NBF C;  3MTN B;  4EUT A;  2DLW A;  4HVB A;  4MM3 A;  1WX9 A;  2H7D A;  3VH4 B;  1V6E A;  2IO0 B;  4DBG A;  2IZV B;  4ASW C;  4B95 A;  4FJV B;  5LLI A;  2COC A;  2YT0 A;  2FCS A;  2OJR A;  2ADZ A;  2ZVO A;  1WGG A;  5G55 A;  3TL5 A;  1ZC4 B;  3KZ1 A;  3AU5 A;  3SNH A;  1P3R A;  2KCJ A;  3A9J A;  4ICV A;  4M8M A;  1TJ6 A;  3JVZ X;  2K39 A;  2M38 A;  2REX A;  2W2W A;  2MWN B;  4ANV A;  3HHM A;  2CU1 A;  4RMA A;  2OTX A;  2KDB A;  2L00 B;  4HAZ B;  5C1Z A;  3PRZ A;  5D27 A;  3DXD A;  3JW0 X;  3SU8 X;  3FLV A;  3L17 A;  3TCA A;  2C7N B;  4DHJ D;  1ZM0 A;  2DYM A;  4FJZ A;  5CTR C;  2NBV B;  4GB9 A;  2Y5B B;  4IWO A;  1P98 A;  3ZKJ C;  4MEM A;  2DHK A;  3DCG A;  2BF8 B;  4HK2 A;  3N7C A;  4HDQ A;  5D2M B;  2Z59 B;  4KIK A;  4W9C A;  4F7Z A;  5IJM A;  3W1S A;  4K2P A;  4HLE A;  2Y7B A;  2H7E A;  4KHO A;  5JZE B;  3UIO B;  1OEY A;  5LXH A;  4FA6 A;  3T8M A;  2K2J A;  2N9X A;  4BOS C;  1E7U A;  3S2A A;  3U8Z A;  4I6N B;  2GCL A;  3R7R A;  1B55 A;  3VHT C;  4MGZ E;  5L81 A;  2WDT B;  3V60 A;  2MKR A;  2LUE A;  4HB4 B;  2ZCB A;  1ZKH A;  3RUI B;  2MP2 A;  2KFK B;  4W9D A;  3VTV A;  1GC7 A;  2EC1 A;  4KDI C;  1ZC3 B;  4XZ4 A;  3JSV B;  5HE0 A;  5C5B B;  2KTF A;  4PS3 A;  1WMH B;  1P6S A;  2C7M B;  2OOB B;  2I1J A;  3UGB B;  2EMT A;  4MH0 E;  4BBK A;  2JY6 A;  2IO3 B;  3D8D A;  4B9K A;  2LVP A;  4A3P A;  2NBU A;  1P3Q U;  3L13 A;  3N32 A;  5CHV C;  5C6R A;  1J0G A;  1EO6 A;  3PRM B;  4MT7 A;  2N7E A;  2IY1 B;  3IBE A;  2DAJ A;  1SE9 A;  2M1M A;  5KCV A;  2L8J A;  1U5D A;  4MSQ B;  3ZNG C;  2FCM A;  3WAO A;  2MBQ A;  1PLS A;  4G11 A;  2W2X D;  2RSG A;  3QIJ A;  4II3 B;  4CHM A;  1BWN A;  1LFD A;  1P0R A;  4IM0 A;  5DPT A;  3SYX A;  3CMM B;  5JLJ B;  3GZN I;  2GJY A;  3P2B A;  4XX5 A;  3H7S A;  2DYN A;  1FGY A;  1UEL A;  4TUU A;  2CR5 A;  2XQN M;  3VVW B;  3QC8 B;  2BGF A;  1BTN A;  1VCB A;  1ZSQ A;  3MJW A;  5J3Q A;  1YX6 B;  3DPD A;  1XX0 A;  3WA0 A;  3DBR I;  1WE6 A;  3B0A A;  4KZC A;  1Q0W B;  2IFS A;  3C0R B;  3H7P A;  2CKH B;  4A6K A;  3B08 A;  4A6H A;  2AL3 A;  3PSE B;  2DA0 A;  1YD8 U;  2O6V D;  1RAX A;  3WYF B;  5D3W A;  1YIW A;  4F8C B;  4K17 A;  4K7S A;  3D8E A;  2MCN B;  3DBL I;  3VQI A;  3K9O B;  5E6O A;  3TW1 A;  4CHK A;  5D7G A;  2X18 A;  2CS4 A;  4GSW A;  2BWE S;  2DHI A;  4G0N B;  5HE2 A;  5DPS A;  2LJ5 A;  4KAX B;  5LXI B;  4M0W B;  3VDZ A;  4FHK A;  2C5L C;  5KQ4 A;  4DK5 A;  4GMX B;  2RGF A;  1ISN A;  3M95 A;  4IAP A;  2LGY A;  2A5U A;  2FNJ B;  1J19 A;  1DYN A;  4XC2 A;  2IO1 B;  1KZ7 A;  3EEC A;  1VD2 A;  3KRW A;  2CRF A;  3BJI A;  4FJY A;  5AEK B;  3KUD B;  3QK0 A;  3ODX A;  1UGM A;  1UZX B;  1WXM A;  3L16 A;  2YRY A;  4EKU A;  1XT9 B;  2VKI A;  5AZH A;  2I5F A;  4WWN A;  4EEW A;  3ZUN A;  1WG7 A;  3A1Q B;  2MBB B;  1X05 A;  2K8C A;  4MY6 A;  2GBM A;  2R09 A;  2COP A;  2N4F A;  2E2X A;  4WJO A;  4DWF A;  2O6V A;  4AJW A;  1W1D A;  2LVO A;  3PGE A;  3RZF A;  3ZNH B;  1XD4 A;  3GYP A;  2G4D B;  1FB8 A;  4PNK A;  2FID A;  5CLQ B;  1ACA A;  1MK7 B;  1LW3 A;  4DBB A;  1U27 A;  4GXB A;  5LOP B;  1M7R A;  3VUW A;  4GDK B;  3AUL A;  4A20 A;  1AAR A;  2IBI B;  2O2V B;  2DZM A;  4HPM B;  4WQO B;  4BFR A;  2KLG A;  2HTH A;  1NDD A;  3PEG A;  1ST7 A;  2MRP A;  2K6Q A;  2KHW B;  2L0T A;  2DHJ A;  2P0D A;  2YT1 A;  2ELB A;  3PLV A;  1YJ1 A;  2LXA A;  2WX0 A;  3N30 A;  2D9W A;  2HRJ A;  4IC7 B;  2D4Q A;  1CMX B;  4KHA A;  1Q67 A;  3EPY A;  3HIZ A;  4F1S A;  1FOE A;  1K8R B;  5L83 A;  3TO1 A;  2KMA A;  1WR6 E;  3A9K B;  1WJ4 A;  3KW5 B;  2PZ1 A;  2JZ3 B;  3DVN U;  1WIA A;  2D2Q A;  2CY4 A;  3UZT A;  4PS8 A;  3QA8 A;  3W1Y A;  3DXE A;  3BY4 B;  2KN5 A;  1A5R A;  3PTF C;  4JQW C;  4IWP A;  4M8N A;  1RFA A;  1AWE A;  2NBW B;  2L3Z A;  1IPG A;  1BAK A;  1LB1 A;  3O65 B;  1V5U A;  4W9G A;  2LRW A;  3A33 B;  4KHB B;  5DHF B;  5DCN A;  4HJK A;  4JL9 A;  4DHZ E;  4F7U P;  1E8Z A;  2KQ7 A;  2JWZ A;  2GCJ A;  2KTR B;  1E8Y A;  2KJH B;  2ZEQ A;  4MSM B;  4AWJ A;  2IO2 B;  2IYB A;  2D9Z A;  4FLH A;  2HJ8 A;  5KHQ A;  4W9I A;  2ZVN A;  1F9J A;  2RVB B;  2K25 A;  2C9W B;  4DXA B;  2QKL A;  5DIF B;  2PE6 B;  1NTI A;  3IHP C;  4GDL B;  5J17 A;  1H10 A;  1YQB A;  1FAO A;  1TGZ B;  3A4R A;  2ZNV C;  4GPT B;  4GN1 A;  2PJH A;  4K7W A;  1WGH A;  1MG8 A;  3R7Q A;  1BT0 A;  3PSC A;  4HAW B;  2L1C A;  2N7D A;  2FCN A;  5D94 A;  1WXS A;  3QHT A;  2COF A;  3D32 A;  2J7Q B;  2KK8 A;  2KDE B;  2ROZ B;  4NAW B;  2ELA A;  3AJ4 A;  3H9D A;  3WAP A;  2A4Z A;  4KDL B;  4EFO A;  2RR9 A;  4WJP A;  2N9P C;  2KDI A;  5DHA B;  4N9F 4;  1X86 A;  2N0Y A;  2DX1 A;  1TBE A;  2J59 M;  1UPR A;  2RLO A;  1WVH A;  3V62 A;  1V5T A;  2VRR B;  4D0N B;  3K9P B;  4KV2 A;  1WE7 A;  2K8B A;  4TQ1 A;  2EMS A;  1OQN A;  5HE3 A;  1DDW A;  2Z0P A;  1W1H A;  2P0H A;  2M8S A;  5CX3 A;  1M7E A;  4WWP A;  2JPH A;  2FCQ A;  3A4S C;  4A3O A;  2PPH A;  4NPN A;  4WSF A;  1Y19 B;  4NQK E;  2J0M A;  1Y8R C;  3KY9 A;  3QAQ A;  2UZR A;  1FGZ A;  3HM3 A;  4FHJ A;  5AZG A;  4AJY B;  4HAY B;  3ZVV A;  2NVU I;  4GU2 A;  2KVR A;  3HQC A;  4RM8 A;  2I5C A;  3KH0 A;  1OQY A;  3M3J A;  2MX2 A;  2KWU B;  1TTN A;  1WXA A;  5JP4 A;  4WAA A;  5AZF A;  4TYZ A;  3KYD D;  3P7Z A;  3KRX A;  2JRI B;  3VH3 B;  3SDL C;  2EJ8 A;  2UYZ B;  3ULC A;  3FEH A;  1T0Y A;  3ZDM C;  2UZS A;  1PFJ A;  1WX8 A;  5KQ1 A;  4LDT D;  3M1I B;  5JHG A;  2FJL A;  1V5M A;  1UNQ A;  2NPT B;  1V86 A;  2FDQ A;  3OAW A;  3JYU A;  1GC6 A;  2V76 A;  5J3T A;  2FJ9 A;  3DVG Y;  4LJO B;  3OAN A;  4LDT B;  2RNR B;  2KDF B;  5DH9 B;  2ZPN A;  2V3S A;  4A6F B;  4CYE A;  2KUP A;  2LZ6 A;  3CXB B;  5JHB A;  3ZDT A;  3ULB A;  3BIN A;  5J18 A;  4PYU A;  2DTC A;  5FI1 A;  1WZ0 A;  2KFJ A;  3ML8 A;  4ZRK A;  2YS3 A;  4BOZ B;  3DQV A;  3TBL D;  1HB6 A;  2YF0 A;  3L0W B;  5IA7 A;  1I35 A;  2KFK A;  4OVU A;  1E90 A;  2MBH A;  3JSV A;  2NS5 A;  3HK0 A;  5C5B A;  1V2Y A;  4K7U A;  3QCA A;  4J6I A;  3M63 B;  2YVC A;  1G6J A;  1WMH A;  4EOY A;  2M0X A;  2WH5 A;  3CSF A;  1GJZ A;  4KVG B;  1X11 A;  1OGW A;  1I7A A;  3IG3 A;  4BKS D;  2N9E B;  1WM2 A;  2M14 A;  5EDS A;  2NMB A;  2ZNV B;  2HE7 A;  5TR5 A;  5D3V A;  1TXD A;  3HW2 B;  3TMP B;  2L76 A;  2ROV A;  2XK5 B;  2R2O A;  4IUM B;  3NY5 A;  2GBJ A;  3ZW3 A;  2YS5 A;  3SO6 A;  5C79 A;  2K1F A;  3VFK A;  3WAM A;  3IVF A;  2BYE A;  1KI1 B;  2FIF A;  3H1U A;  2RD0 A;  4KZ0 A;  2KOX A;  2G3Q B;  3ZTC A;  1I2H A;  1WZ3 A;  4TV3 A;  4CHJ A;  1FXT B;  2DX5 B;  2D9V A;  2MBE A;  5LON B;  2KKC A;  1PQS A;  3VTW A;  3NZS A;  4JLC A;  3WAN A;  4W9F A;  2EKE C;  3ZVR A;  3RUL A;  3UIP B;  3Q3J A;  4HXD A;  2GBN A;  4K1R B;  4NY0 A;  1V88 A;  4HCP B;  2K2U A;  1EGX A;  1E5W A;  2G45 B;  2RUK B;  1DBH A;  3H6N A;  2LG1 A;  4BKS A;  3TIX A;  3WIM A;  4NJ6 A;  3A8Q A;  1DDM A;  4X57 B;  1V61 A;  3DVN V;  3UIN B;  4BKG A;  3APD A;  3RD2 A;  1RJ2 A;  1WF9 A;  4L6E A;  4FBJ B;  4ZDV A;  2KNB A;  4MGY E;  2DN6 A;  3T06 A;  1GG3 A;  5IAA C;  3RCZ A;  2J0K A;  2UWQ A;  2KO3 A;  4HB3 B;  2MLB A;  4Z2M B;  3U30 A;  3ECI A;  3PLU A;  4MJS A;  3VOQ A;  3NS8 A;  3PRP B;  1XR0 B;  1H4R A;  3LJU X;  4GIV A;  4RM9 A;  1LM8 B;  4IM3 A;  3KSY A;  3TFM A;  4PYZ A;  3RCP A;  4DX9 0;  5D3Y A;  1WJ1 A;  5HKH A;  4BBN F;  2BYF A;  2FUH B;  2YLM A;  5DI9 B;  2DYO A;  1R4N I;  3AU4 A;  2ABD A;  3DOW A;  4W9K A;  1SIF A;  3D8F A;  4DDI D;  4HAT B;  1E7V A;  1WRD B;  4LCD E;  5E6N A;  4NQL B;  2LGX A;  2KGX B;  3DDC B;  2KQS A;  2LOX A;  4PS7 A;  5C23 A;  4YON A;  3A1Q A;  2KC1 A;  1X1M A;  1C1Y B;  3ZNZ B;  5FR6 A;  2COD A;  4E3C A;  2KD0 A;  3KVF B;  1IP9 A;  2NZ8 B;  4BBN C;  1UH6 A;  3DXC A;  2JT4 B;  3N3K B;  1V9J A;  4IG7 B;  1V5O A;  1OTR B;  4I6P A;  4GDK A;  3LDZ E;  3PP2 A;  2O2V A;  3WAL A;  2Q13 A;  4KSL C;  1V49 A;  3V6C B;  2MBO A;  2COA A;  5J3Y A;  3QAR A;  4WJN A;  2L05 A;  3NZU A;  4MGI E;  1KJT A;  2YSZ A;  2MSE D;  3ZIM A;  1TQZ A;  1WYW B;  1ZGU B;  1S3S G;  3AI5 A;  4W9H A;  4DX8 A;  2AEH A;  3F0W A;  1UD7 A;  2P8V A;  3NHE B;  4WJQ A;  1TZ1 A;  2D10 A;  3EFU A;  3OJ3 A;  2ZZP B;  1QZE A;  1EF5 A;  2CY5 A;  5BO4 B;  2AYO B;  1U5G A;  1W1G A;  2YS1 A;  3A9K A;  1U2B A;  2K00 A;  2DZJ A;  2Z0D B;  1QC6 A;  4FUL A;  1U5F A;  4MGK E;  2DEN B;  2KWC A;  2DKQ A;  3SD5 A;  4P7I A;  3A9J B;  2CHW A;  2JP2 A;  4CO7 A;  5DPW A;  2C60 A;  4Y94 A;  2R2Q A;  3APC A;  1P5T A;  2AWT A;  2C7H A;  2CHZ A;  1UPQ A;  1U4A A;  2JZZ A;  4HB2 B;  2DZI A;  2L0F A;  2MA9 B;  1NU2 A;  2BWF A;  4H8S A;  2NR2 A;  2L7R A;  1NI2 A;  2KTR A;  1DRO A;  2JUO A;  4KIK B;  1UBI A;  4FAD A;  2GMI C;  3QJZ A;  3L10 B;  2XBB C;  2N1W A;  1WI1 A;  2WX1 A;  3PG7 A;  2GOW A;  4GDL A;  4Z2N A;  1GNU A;  3NOB A;  3CF6 E;  1UEF A;  2CHX A;  1K5G B;  2MP2 B;  4ICU A;  3FM8 C;  1XKE A;  1U29 A;  5KHO A;  3A98 B;  3V5W A;  3HM6 X;  3DBH I;  3DBS A;  2QHO A;  2FAZ A;  1X1F A;  1V80 A;  2KX3 A;  3RT3 B;  2LUL A;  2RGN B;  4NAW A;  2BKR B;  1H8C A;  2GS0 A;  4W9E A;  4AOF A;  2DYQ A;  3L54 A;  3G9W A;  3PZD A;  1WGD A;  4YL8 A;  4WJ7 A;  3MHS D;  1Z5S B;  4DHJ B;  1I42 A;  2GBK A;  2BYV E;  1V5P A;  1MPH A;  3ZO5 B;  1C3T A;  1V89 A;  2V4L A;  3QQ8 B;  2VRW B;  1WXV A;  2UVM A;  2RSU A;  4URK A;  4LJP B;  5C16 A;  3OJ4 B;  1RRP B;  3TJP A;  1WY8 A;  1NTV A;  2OQB A;  2MW5 A;  3EHV A;  1WGQ A;  3PV1 A;  2Y8G A;  3PVL A;  2D9Y A;  2MDX A;  3TVV A;  3QBV B;  1Z87 A;  1YX5 B;  2QKM A;  1WR1 A;  4II2 B;  3RYT A;  4ANW A;  4EZJ A;  1KLV A;  1Y5O A;  5CHF A;  4TKN A;  4A5K A;  5D3X A;  3VIA A;  3GYO A;  4BKT A;  4IWQ A;  4JGH B;  3FSS A;  3SV1 A;  1Z2M A;  4JIO U;  4NNJ B;  2J0J A;  2I1K A;  1EF1 A;  3H7P B;  3QWZ B;  5FI0 A;  4AUQ C;  2KC2 A;  2PEA A;  2G35 A;  1FHX A;  3T9L A;  3LJ3 A;  2LBB A;  2ZCC A;  5CLL B;  3VTU A;  5DPR A;  2IYD B;  2RPQ A;  4AP4 C;  2CB8 A;  2K8H A;  4NSW A;  1ZW7 A;  4ANU A;  2HD5 B;  5D6J B;  3B1L X;  3DVG X;  2NPT A;  1E8X A;  2ZJD A;  2CAY A;  1XOD A;  2VSZ A;  4IM2 A;  1HBK A;  4NJ7 A;  1U5E A;  2LOZ A;  3ZLZ A;  4W9J A;  3X23 A;  4F7H A;  4A6F A;  4BVU C;  1WI0 A;  1UNR A;  4MEL A;  4HWI B;  1J0W A;  1WFY A;  5G2N A;  4HHV A;  1K5D B;  3PHW B;  3X0W A;  2W9N A;  4EJN A;  1WGR A;  1PMS A;  2BCJ A;  2KXJ A;  3ZTD A;  3UF8 A;  2LAS A;  4TQ0 A;  1V81 A;  1JRU A;  1Q5W B;  2DHZ A;  1N3H A;  1NVL A;  1XQQ A;  4MJS B;  2O6V B;  3PHX B;  3VAW A;  3SUZ A;  2R0D A;  1SGH A;  3ML9 A;  4W9L A;  3ENE A;  1S1Q B;  2K6D B;  4GGQ A;  2LD9 A;  2KJR A;  2Z0O A;  2XK5 A;  2DYB A;  1RRB A;  2PE9 A;  2N23 A;  4WWO A;  4PQ0 A;  3EC8 A;  1WGY A;  4ZYN A;  3VUX A; 
#chains in the Genus database with same CATH topology
 4F7G A;  2LJI A;  4IFS A;  2LUM A;  2G4S A;  3DHG C;  2MWS B;  1B1Z A;  2W54 A;  1FHW A;  2B3A A;  3P6A A;  2HTH B;  1PGB A;  2IPK D;  3BVZ A;  5JHH A;  2SEB D;  1QQG A;  2AL6 A;  3ZRF A;  3V61 A;  4K2O A;  1ESF A;  1WJU A;  1RYJ A;  4US9 A;  3ZJT A;  3M62 B;  1I7H A;  3O96 A;  3W1S C;  1GUA B;  3PT2 B;  2DX5 A;  1J7C A;  1MKE A;  2LKO A;  1KZG A;  2Z0Q A;  3PS6 A;  4E71 A;  1DDV A;  2CJO A;  5IO9 A;  3TEW A;  4MK0 A;  2MFQ A;  1AQC A;  2LGD A;  1SHC A;  3AE9 B;  2V4I B;  3P42 A;  2BB5 A;  5EFX A;  1DIK A;  4ANX A;  1P1A A;  2DKP A;  3I3T B;  3DCX A;  1IRS A;  3RZW C;  2BKF A;  2IY0 B;  1JQ4 A;  3PPA A;  1E8W A;  4HPL B;  3APF A;  3W2D A;  1TS5 A;  3PVW A;  2DFK A;  1LXD A;  3ML4 A;  3PVU A;  2JXT A;  2LI5 A;  3VR9 B;  4EE2 A;  1WX7 A;  2Y8F A;  1L2N A;  1MIZ B;  2MQJ A;  4N59 A;  2KLC A;  4DIX A;  4IOY X;  4G3X B;  1CZP A;  3ONS A;  3IFW B;  3F5R A;  3QX1 A;  4QAY A;  2X8X X;  4JK7 A;  4XYC A;  4IW0 A;  2KYW A;  1M94 A;  5L95 C;  2DWQ A;  2WXG A;  2V1Y A;  2ZPY A;  5JH5 C;  2DZK A;  1R4M I;  2WWZ A;  1IYF A;  3ETR A;  3KYC D;  1NTY A;  3SBG A;  4PT5 A;  2KAC A;  3Q3F A;  2WYQ A;  2LVQ A;  1WH3 A;  3FIL B;  2P0F A;  1EUV B;  2KJ6 A;  2D11 A;  2CQU A;  2M17 A;  5EE9 A;  3A8P A;  1X1G A;  1HE8 A;  1BXT A;  1K51 A;  1XF5 L;  2D07 B;  1XCG A;  2QIL A;  2LYD A;  3B2G A;  2XEW A;  1UF0 A;  5GOW B;  1WJ6 A;  2BVC A;  2D9X A;  3GOE A;  3CST A;  4FN2 A;  1SE4 A;  1JAL A;  4P1C C;  5GMV A;  4G50 A;  2LRU A;  3J9C A;  3NVV A;  4B6W A;  2Y5C A;  1EM7 A;  2M4N A;  4XE0 A;  4JKD A;  3U7D A;  1EAZ A;  4YSX B;  1D3Z A;  3MPX A;  1EWC A;  5JHA A;  4JKH A;  2K22 A;  4GMV A;  4HAU B;  1YN4 A;  5CHW A;  5GXG B;  2INP E;  2J53 A;  4GOC A;  1NEK B;  2KMM A;  1WGU A;  3ZNI D;  1UBQ A;  1MIX A;  2L2I A;  4EMO A;  1L7Y A;  2JF5 A;  3VUY A;  3AEB B;  2KUQ A;  1TZO A;  2KZR A;  2Y5P A;  5E6P A;  5JXV A;  4WQM A;  3MJ5 A;  4E74 A;  1BTK A;  1GGO A;  2ASQ A;  4ILJ A;  1MK9 B;  1ENF A;  1D5M C;  2KAN A;  2PKO A;  4REZ A;  4GZU A;  2Z0E B;  1WJN A;  1E6E B;  3PRE A;  3RN9 C;  3BII D;  5BYS A;  3NSU A;  3KUZ A;  1OEY J;  1BML C;  2D3G A;  2X38 A;  3AE5 B;  4OVV A;  3BVG A;  3L08 A;  1FHO A;  4DDG D;  1FIQ A;  3DWM A;  1KOT A;  1OMW A;  1MI0 A;  1C78 A;  2MJ3 A;  3KUC B;  4HDO A;  3AM9 A;  1OQR A;  4M02 A;  2DAF A;  2VH1 A;  1L6V A;  2BS2 B;  5HE1 A;  3N9Y C;  2JRH A;  1JML A;  2JYE A;  3FP5 A;  2I2Y A;  5TSS A;  3UQA A;  4KSK C;  4IKG A;  3ODO A;  3ZRC A;  1HB8 A;  1XLN A;  4DHZ B;  4K81 A;  1Q1O A;  4EZK A;  4EZL A;  4MDK E;  1P9D U;  2N0S B;  3LXF A;  1F1H A;  1QF6 A;  1NVI D;  1LQB A;  1RLF A;  2JVC A;  3MDB C;  4B6H A;  1MAI A;  2KMC A;  4I6L B;  2JXX A;  2QCZ A;  2KWV B;  3AXC A;  2LWP A;  2N1V A;  4KGS A;  3DHI C;  1WJM A;  5J2R A;  1KRH A;  3VXW A;  3OLM D;  3R66 C;  1VBG A;  2GBR A;  2WXQ A;  3QWM A;  2LXC A;  3N20 C;  1ZVR A;  1XD3 B;  2BPS A;  2N9L A;  4YSY B;  3ALB A;  4HAV B;  1J8C A;  4HCN B;  3SHQ A;  3V6E B;  1TS2 A;  1N5W A;  1UNP A;  4UDU C;  5H8Y E;  1WM3 A;  2W2X C;  4WVF B;  2K9X A;  4ZRJ A;  4HB0 B;  4B0E A;  3CIK A;  2WGS A;  3R3M A;  2RQ1 A;  1OY2 A;  1EVH A;  1STE A;  4HAX B;  4C0A A;  1IBX B;  2NCN A;  1YJI A;  1BUI C;  4XWX A;  3UQB A;  1KM7 A;  2KX0 A;  3FC4 A;  4ZRI A;  3ODW A;  4JKE A;  1ZDX A;  2RPV A;  2PTL A;  1PFD A;  1NBF C;  3MTN B;  1FM0 D;  4EUT A;  1ZP0 B;  2DLW A;  1ZYI A;  4HVB A;  1TS3 A;  4MM3 A;  1WX9 A;  2H7D A;  1SJE D;  2PVG C;  3VH4 B;  4JK9 A;  1V6E A;  2IO0 B;  4DBG A;  2IZV B;  4ASW C;  4B95 A;  4FJV B;  1XLP A;  4MT5 A;  1ZUD 2;  2WXH A;  1KH0 A;  1T77 A;  5D3D A;  2COC A;  1VLB A;  5LLI A;  1VZ8 A;  2EKI A;  3MC8 A;  2YT0 A;  3FVC A;  2FCS A;  2OJR A;  2ADZ A;  2ZVO A;  1PUT A;  1WGG A;  5G55 A;  2CJN A;  2YEP B;  2EEL A;  2FBW B;  4ZRQ A;  3TL5 A;  1ZC4 B;  3KLS X;  3KZ1 A;  3AU5 A;  3SNH A;  1P3R A;  2KCJ A;  2IND C;  4USA A;  3A9J A;  4ICV A;  1SSN A;  4M8M A;  3HVZ A;  4US8 A;  1TJ6 A;  4P6V F;  1UWM A;  2K39 A;  3JVZ X;  2M38 A;  2REX A;  2W2W A;  2MWN B;  4ANV A;  2R2Y A;  1I4G A;  3HHM A;  3V05 A;  2CU1 A;  1SXT A;  4RMA A;  2OTX A;  2KDB A;  2L00 B;  4HAZ B;  2VH2 A;  2WS3 B;  3EFC A;  5C1Z A;  3PRZ A;  5D27 A;  4ZYS A;  3DXD A;  3JW0 X;  3SU8 X;  3FLV A;  2HTM E;  3L17 A;  3TCA A;  2C7N B;  4DHJ D;  1ZM0 A;  2DYM A;  4FJZ A;  5CTR C;  2TSS A;  2NBV B;  4GB9 A;  2Y5B B;  4IWO A;  5C3J B;  1P98 A;  2R82 A;  3ZKJ C;  2LFI A;  4MEM A;  2DHK A;  3DCG A;  2BF8 B;  4OSN A;  4XDD A;  1SE3 A;  4HK2 A;  3N7C A;  4HPP A;  4HDQ A;  4JKB A;  5D2M B;  2Z59 B;  4KIK A;  1N62 A;  4W9C A;  4F7Z A;  5IJM A;  3W1S A;  4K2P A;  4YTM B;  2BTE A;  4HLE A;  2Y7B A;  2PVO D;  3GE8 C;  2H7E A;  4KHO A;  5JZE B;  3UIO B;  1OEY A;  5LXH A;  4FA6 A;  1TKG A;  2K3U A;  3T8M A;  2K2J A;  1HQR D;  2N9X A;  1E7U A;  4BOS C;  3S2A A;  4XWW A;  3U8Z A;  2INC C;  5BMI A;  2KAJ A;  1K50 A;  4I6N B;  2GCL A;  3R7R A;  1B55 A;  3VHT C;  4MGZ E;  5L81 A;  1ZXI A;  1I4H A;  2WDT B;  3V60 A;  2MKR A;  2LUE A;  4HB4 B;  1FXA A;  2ZCB A;  1F2R C;  1ZKH A;  3RUI B;  2MP2 A;  3EUB 2;  4RGO S;  2KFK B;  4W9D A;  3VTV A;  1GC7 A;  2KDM A;  2EC1 A;  4KDI C;  1ZC3 B;  1C77 A;  4JK8 A;  4XZ4 A;  3JSV B;  1D6E C;  5HE0 A;  5C5B B;  1YQ4 B;  3TEX A;  2KTF A;  4PS3 A;  1WMH B;  1YQ3 B;  2WU2 B;  1P6S A;  1XO3 A;  2C7M B;  2OOB B;  2I1J A;  3UGB B;  2EMT A;  4RNA A;  4A9A A;  1FO4 A;  1JWS D;  1AN8 A;  3SEB A;  1VR9 A;  4MH0 E;  4BBK A;  2JY6 A;  2IO3 B;  3D8D A;  4B9K A;  2LVP A;  1JWU D;  4A3P A;  2NBU A;  1P3Q U;  4IDI A;  3L13 A;  3N32 A;  2OJW A;  5CHV C;  5C6R A;  3BK1 A;  1J0G A;  1EO6 A;  5HFY A;  3PRM B;  4MT7 A;  1NYR A;  2N7E A;  2H88 B;  2IY1 B;  3IBE A;  2DAJ A;  1SE9 A;  1WYG A;  2M1M A;  5KCV A;  2L8J A;  1U5D A;  4MSQ B;  3ZNG C;  2FCM A;  1KLU D;  1TY0 A;  2BS3 B;  1T6B X;  4LNN A;  3W5V B;  2MBQ A;  3WAO A;  3URY A;  3T3O A;  2NMQ A;  1PLS A;  4G11 A;  1FRD A;  1JRP A;  2W2X D;  2RSG A;  3QIJ A;  4II3 B;  4CHM A;  1BWN A;  1LFD A;  1P0R A;  4IM0 A;  5DPT A;  1KFY B;  4YTN B;  3ZJU A;  3SYX A;  4HEA 1;  1K53 A;  3CMM B;  2L83 A;  5JLJ B;  3GZN I;  2GJY A;  3P2B A;  5FKA C;  3LB8 C;  4XX5 A;  1I4Q A;  2DYN A;  3H7S A;  1FGY A;  1UEL A;  4TUU A;  3MFG A;  2CR5 A;  3N1Z C;  2XQN M;  3VVW B;  5LNK 1;  3MC0 B;  1SB3 C;  1J7A A;  3QC8 B;  2KN4 A;  2Z4D A;  5BMG A;  2FE8 A;  3IAS 1;  2BGF A;  1P7E A;  1BTN A;  4QJ4 B;  1VBH A;  1VCB A;  1ZSQ A;  3MJW A;  4RCO A;  5EE1 A;  3SR6 A;  5J3Q A;  1YX6 B;  3DPD A;  3I57 A;  1XX0 A;  3WA0 A;  3DBR I;  3I63 C;  1WE6 A;  1MFW A;  3B0A A;  2GUM A;  4KZC A;  1HTO A;  1Q0W B;  2IFS A;  2J52 A;  3C0R B;  3H7P A;  5M4Y B;  2CKH B;  4A6K A;  3B08 A;  4A6H A;  2M56 B;  2AL3 A;  1V97 A;  3PSE B;  2DA0 A;  3EA6 A;  1YD8 U;  2O6V D;  1RAX A;  3WYF B;  5D3W A;  1YIW A;  4ARC A;  2CU3 A;  4F8C B;  4K17 A;  4K7S A;  3D8E A;  2MCN B;  3DBL I;  3VQI A;  1XEE A;  3K9O B;  5E6O A;  1VZ6 A;  4YT0 B;  3TW1 A;  4CHK A;  4RGM A;  5D7G A;  2X18 A;  3E9S A;  2CS4 A;  4GSW A;  5C2T B;  2BWE S;  2Y3A A;  2DHI A;  1TYG B;  3P4R B;  4G0N B;  4LNO A;  5HE2 A;  5DPS A;  3ZXV A;  2LJ5 A;  1B9R A;  2YEP F;  4KAX B;  2MH7 A;  5LXI B;  4M0W B;  3VDZ A;  4FHK A;  1T0Q C;  2C5L C;  3Q8C A;  4HJG E;  5KQ4 A;  1DOI A;  4KGR A;  3A58 A;  4AS1 A;  4DK5 A;  3U4E G;  4GMX B;  2RGF A;  1ISN A;  2YT2 A;  3M95 A;  4IAP A;  2LGY A;  2A5U A;  2FNJ B;  1J19 A;  1DYN A;  3R2I A;  1TKY A;  4XC2 A;  3RNA C;  3RFZ B;  2IO1 B;  1KZ7 A;  3EEC A;  4KGT A;  1VD2 A;  4JPS A;  3KRW A;  4DQO C;  2CRF A;  3BJI A;  4FJY A;  3KWV A;  5BYQ A;  4C4V A;  1Q10 A;  5AEK B;  3KUD B;  3QK0 A;  3ODX A;  1UGM A;  1UZX B;  1WXM A;  3L16 A;  3Q8A A;  3O13 A;  2YRY A;  2Z8L A;  4EKU A;  1XT9 B;  2VKI A;  3ABV B;  5AZH A;  2I5F A;  4WWN A;  4EEW A;  3ZUN A;  1WG7 A;  2ZKM X;  3A1Q B;  2MBB B;  1X05 A;  2K8C A;  4MY6 A;  2FJU B;  2GBM A;  2R09 A;  2COP A;  2N4F A;  1N60 A;  2E2X A;  4WJO A;  4DWF A;  2O6V A;  3BYT B;  1HTQ A;  4AJW A;  1W1D A;  4A55 A;  2LVO A;  3PGE A;  3RZF A;  3ZNH B;  1XD4 A;  3GYP A;  2G4D B;  1FB8 A;  4PNK A;  2AQ3 B;  4XDC A;  5IOI A;  1D5Z C;  2KR0 A;  3BZD B;  2FID A;  4NZL B;  5CLQ B;  1ACA A;  1MK7 B;  1LW3 A;  4DBB A;  1U27 A;  2IDY A;  4GXB A;  1LGR A;  3DWG C;  1F77 A;  5LOP B;  4C56 C;  1M7R A;  2X0S A;  1TS4 A;  2B76 B;  4P1B C;  3VUW A;  1JWB D;  4GDK B;  3AUL A;  1KTK A;  4A20 A;  3EGR A;  1AAR A;  2IBI B;  2O2V B;  3T3N A;  4D2K A;  1RM6 C;  2DZM A;  4HPM B;  1HA5 A;  4WQO B;  4BFR A;  3VR8 B;  5BMH A;  2KLG A;  4MAC A;  2HTH A;  4ACF A;  1NDD A;  2Z13 A;  4HKQ A;  3PEG A;  3OG5 A;  3AB5 A;  1ST7 A;  4YSZ B;  4RGN A;  3ZJV A;  2MRP A;  2K6Q A;  2KHW B;  2LGS A;  2L0T A;  5BYR A;  2DHJ A;  1ACC A;  1GOZ A;  2P0D A;  2YT1 A;  3AMZ A;  4QXA B;  2ELB A;  2QDF A;  3PLV A;  1KLG D;  1YJ1 A;  2LXA A;  2WX0 A;  3N30 A;  2D9W A;  2HRJ A;  4IC7 B;  2D4Q A;  1CK1 A;  3TUO A;  1QIL A;  2DBY A;  1C76 A;  1CMX B;  4KHA A;  1Q67 A;  4M01 A;  3EPY A;  3HIZ A;  4F1S A;  3DBH B;  1FOE A;  1D5X C;  1ZOY B;  1K8R B;  2VZK B;  3AE1 B;  3R2T A;  5L83 A;  3TO1 A;  3B2F A;  1L4Z B;  2KMA A;  1WR6 E;  3NG0 A;  3A9K B;  1WJ4 A;  3KW5 B;  1Y56 A;  2PZ1 A;  2JZ3 B;  3DVN U;  1AYF A;  1WIA A;  2D2Q A;  2CY4 A;  3UZT A;  3L4P A;  4PS8 A;  4DXF A;  3QA8 A;  1OFF A;  3W1Y A;  3DXE A;  3BY4 B;  2KN5 A;  2LGI A;  1A5R A;  3PTF C;  4JQW C;  4IWP A;  1L5P A;  4M8N A;  4YXD B;  1N5X A;  3FIL A;  4GOU A;  4TSS A;  1RFA A;  2WXR A;  1AWE A;  2NBW B;  2L3Z A;  1IPG A;  2JX5 A;  1AWD A;  1BAK A;  1LB1 A;  2BW2 A;  3O65 B;  1SIJ A;  1XCQ L;  5EE0 A;  1V5U A;  4W9G A;  2LRW A;  3A33 B;  4KHB B;  5DHF B;  5DCN A;  4HJK A;  4JL9 A;  2V9H A;  4DHZ E;  5I2S A;  4F7U P;  1E8Z A;  1SBB B;  1L0V B;  2KQ7 A;  2RDB C;  2JWZ A;  2GCJ A;  2KTR B;  1E8Y A;  3MC9 A;  2KJH B;  2ZEQ A;  1MVK A;  2V3P A;  4MSM B;  1ROE A;  2WNM A;  4AWJ A;  1FCL A;  2IO2 B;  2IYB A;  1I4X A;  2UU7 A;  3RNB C;  2D9Z A;  4FLH A;  2HJ8 A;  2J42 A;  5KHQ A;  4W9I A;  2ZVN A;  1F9J A;  2W3S A;  2RVB B;  3HUI A;  2K25 A;  2C9W B;  4DXA B;  2QKL A;  4OW0 A;  5DIF B;  2PE6 B;  1NTI A;  3LYY A;  3IHP C;  4GDL B;  5J17 A;  1H10 A;  1YQB A;  4HKZ E;  1FAO A;  1TGZ B;  3A4R A;  2ZNV C;  1F2R I;  5FR3 A;  4GPT B;  4GN1 A;  1WXQ A;  2PJH A;  3OWE B;  3I9V 1;  2LHE A;  3SFD B;  2RRF A;  1WGH A;  4K7W A;  2W82 A;  1MG8 A;  3R7Q A;  1ZXH A;  1PGX A;  2D5G A;  1BT0 A;  1XXG A;  3PSC A;  4HAW B;  4KX6 B;  1FCC C;  3I5J C;  2L1C A;  2N7D A;  2FCN A;  5D94 A;  2M19 A;  1WXS A;  3QHT A;  2COF A;  1GPX A;  3D32 A;  2J7Q B;  2BS4 B;  2KK8 A;  2KDE B;  2ROZ B;  4ILH A;  3AE6 B;  3TEY A;  2ZW1 A;  4NAW B;  3E9L A;  2ELA A;  1M4V A;  3AJ4 A;  3H9D A;  4ITK A;  3WAP A;  5I4D A;  1GAQ B;  1NEN B;  2A4Z A;  2JU6 X;  4QJ5 B;  4KDL B;  4EFO A;  2RR9 A;  4WJP A;  2N9P C;  2KDI A;  1TIF A;  5DHA B;  1C9F A;  4FXC A;  4N9F 4;  1X86 A;  4ZRP A;  2N0Y A;  1KBL A;  2DX1 A;  1TBE A;  3Q6B A;  2J59 M;  1UPR A;  2RLO A;  4JKC A;  1WVH A;  3NUH B;  3BWU D;  3V62 A;  1V5T A;  2VRR B;  1YNT E;  4D0N B;  3AEC B;  3K9P B;  2BT6 A;  4LLG M;  1UWX A;  3GB1 A;  1IBX A;  4KV2 A;  1E9M A;  1TJE A;  2WXN A;  1WE7 A;  2WXM A;  2G9H D;  2K8B A;  2JYT A;  4TQ1 A;  2EMS A;  1OQN A;  3AE2 B;  5HE3 A;  1DDW A;  4JWU C;  2Z0P A;  2LMC A;  1W1H A;  1QOA A;  4DXG A;  2P0H A;  2M8S A;  5CX3 A;  3V3X A;  2WHI A;  1M7E A;  4WWP A;  2JPH A;  2FCQ A;  3A4S C;  4A3O A;  2PPH A;  2RDG A;  4HRS A;  4NPN A;  4WSF A;  1Y19 B;  4NQK E;  1V1O A;  1TKE A;  2J0M A;  4JKF A;  1VRA B;  1Y8R C;  3KY9 A;  1JWA D;  3QAQ A;  2UZR A;  1FGZ A;  3HM3 A;  4FHJ A;  3Q3M C;  3H8H A;  5AZG A;  4Q2J A;  1E7P B;  4OZB A;  4AJY B;  2KWD A;  3IT4 B;  4HAY B;  2V3N A;  3VRA B;  3ZVV A;  2NVU I;  4L1R A;  3NW8 A;  4GU2 A;  2KVR A;  3HQC A;  4RM8 A;  2I5C A;  3KH0 A;  4GLS C;  1OQY A;  3M3J A;  2MX2 A;  2KWU B;  1TTN A;  1WXA A;  5JP4 A;  4WAA A;  5LG4 B;  5IP4 D;  5T8I A;  5AZF A;  4TYZ A;  3KYD D;  1L4D B;  3P7Z A;  3KRX A;  1C4A A;  3AV8 A;  1FNU A;  2JRI B;  3VH3 B;  5HHD G;  3SDL C;  2EJ8 A;  2UYZ B;  2JSV X;  3ULC A;  3FEH A;  1T0Y A;  3ZDM C;  2UZS A;  3N1Y C;  1TT5 B;  5MPO A;  1QOB A;  1PFJ A;  3MP9 A;  3CIR B;  1WX8 A;  1F52 A;  2NBV A;  5KQ1 A;  4LDT D;  3M1I B;  5JHG A;  2FJL A;  1V5M A;  1UNQ A;  2NPT B;  1V86 A;  5G5G A;  2FDQ A;  1C4P A;  3AE7 B;  3OAW A;  3JYU A;  1GC6 A;  1QLB B;  1QOG A;  1MI1 A;  2IGD A;  2V76 A;  5J3T A;  2L52 A;  5H92 C;  2FJ9 A;  3HIE A;  3DVG Y;  1IGC A;  4LJO B;  3OAN A;  2W55 A;  4LDT B;  2RNR B;  2KDF B;  3P4P B;  3IXS A;  2NTT A;  3Q8E A;  5DH9 B;  2ZPN A;  1JWM D;  2V3S A;  4A6F B;  4CYE A;  2KUP A;  2LZ6 A;  3CXB B;  2K8E A;  5JHB A;  3DHH C;  3ZDT A;  3ULB A;  3BIN A;  3RNF C;  5J18 A;  3E66 A;  4PYU A;  2DTC A;  5FI1 A;  1WZ0 A;  2KFJ A;  1SF0 A;  3ML8 A;  4ZRK A;  3P4S B;  2MJE A;  2YS3 A;  4BOZ B;  3DQV A;  3TBL D;  1HB6 A;  3SBT A;  2YF0 A;  2I38 A;  2QSD A;  2GI9 A;  3L0W B;  5IA7 A;  1I35 A;  2KFK A;  4OVU A;  4KKJ A;  3NVW A;  1E90 A;  2MBH A;  1R4N B;  3JSV A;  2NS5 A;  3HK0 A;  5C5B A;  1WWT A;  3P1M A;  2KIE A;  1LO5 D;  1V2Y A;  3QCA A;  4K7U A;  2IGH A;  4J6I A;  1IUE A;  3M63 B;  2YVC A;  1G6J A;  1WMH A;  4EOY A;  2M0X A;  2WH5 A;  2D3A A;  3CSF A;  1GJZ A;  4KVG B;  1R4M B;  4JKG B;  2W3R A;  1X11 A;  1T5X D;  1OGW A;  3NZ3 A;  2ON8 A;  4M00 A;  1I7A A;  3IG3 A;  4BKS D;  2N9E B;  1WM2 A;  2M14 A;  5EDS A;  2NMB A;  2ZNV B;  2E3T A;  4N58 A;  1CJE A;  4LNK A;  4NAM A;  3HRD D;  2FUG 1;  2HE7 A;  1QQR A;  2QJL A;  3RNE C;  1ZPS A;  4RGT A;  5TR5 A;  5D3V A;  5AUI A;  1TXD A;  2BQQ A;  3HW2 B;  3TMP B;  2L76 A;  1ET9 A;  2ROV A;  2XK5 B;  2R2O A;  1JRO A;  2SAK A;  4IUM B;  2J4X A;  3NY5 A;  2GBJ A;  2IGG A;  1T3Q A;  3ZW3 A;  2NTS A;  2YS5 A;  1VDV A;  3E9P A;  3Q69 A;  2K5P A;  2K0P A;  4A90 A;  3SO6 A;  1V1P B;  5C79 A;  4N6E B;  2BYT A;  2K1F A;  3VFK A;  3WAM A;  3IVF A;  3IT6 B;  4ZOH C;  1FFU A;  2BYE A;  1KI1 B;  2QIE B;  2FIF A;  3H1U A;  2RD0 A;  3TSS A;  4KZ0 A;  2KOX A;  4KKI A;  2G3Q B;  3ZTC A;  1I2H A;  1WZ3 A;  4TV3 A;  4CHJ A;  1FXT B;  2DX5 B;  2D9V A;  2MBE A;  5LON B;  2WDQ B;  1DOX A;  2KKC A;  1PQS A;  1JW9 D;  3VTW A;  2N7J A;  1FPY A;  3NZS A;  4JLC A;  3WAN A;  4W9F A;  2EKE C;  3NWD A;  3ZVR A;  3RUL A;  3UIP B;  1T0S C;  3Q3J A;  4HXD A;  2GBN A;  4K1R B;  1QT9 A;  1VZ7 A;  2JWU A;  4NY0 A;  1V88 A;  4HCP B;  2K2U A;  1EGX A;  1E5W A;  2G45 B;  2BBC A;  2WU5 B;  2KVZ A;  2RUK B;  1DBH A;  3H6N A;  2LG1 A;  4BKS A;  3TIX A;  3WIM A;  4NJ6 A;  3A8Q A;  1DDM A;  1PYW D;  4X57 B;  1V61 A;  3WCQ A;  4ZHP A;  3DVN V;  3UIN B;  2AX5 A;  3C8Y A;  3ZQ4 A;  4BKG A;  4CQN A;  3APD A;  3RD2 A;  1RJ2 A;  1WF9 A;  4IOI E;  4L6E A;  3AEG B;  5JVL A;  4FBJ B;  4ZDV A;  2KNB A;  4MGY E;  2DN6 A;  3T06 A;  1GG3 A;  2HDE A;  2MEK A;  5IAA C;  1YN5 A;  3RCZ A;  2J0K A;  2UWQ A;  4RFB A;  2KO3 A;  2R61 A;  1UNS A;  3W9C B;  4HB3 B;  3B9J A;  2MLB A;  2K49 A;  4XWT A;  1NI3 A;  4Z2M B;  3U30 A;  3ECI A;  4L2Y A;  3PLU A;  3GS2 A;  4MJS A;  3B77 A;  3VOQ A;  3NS8 A;  3FAH A;  4QJ3 B;  3PRP B;  1XR0 B;  1YN3 A;  1H4R A;  3LJU X;  3HVD A;  4B0M A;  4GIV A;  4RM9 A;  1LM8 B;  4IM3 A;  4M0W A;  2WXJ A;  3KSY A;  2GLS A;  2WXO A;  3TFM A;  4PYZ A;  3RCP A;  2HJ1 A;  3Q3O C;  4HRO A;  2WDV B;  4DX9 0;  1L0Y B;  5D3I B;  5D3Y A;  3VRB B;  1WJ1 A;  5HKH A;  4BBN F;  2DIK A;  2BYF A;  2FUH B;  3ENB A;  1A70 A;  4RH6 A;  2YLM A;  3GE3 C;  5DI9 B;  2DYO A;  1R4N I;  3AU4 A;  2ABD A;  3AEA B;  3DOW A;  1CQV A;  4W9K A;  1SIF A;  3D8F A;  4DDI D;  4HSI A;  4YTP B;  4HAT B;  1E7V A;  1WRD B;  3NS1 A;  4LCD E;  5E6N A;  4NQL B;  2LGX A;  5G5H A;  2KGX B;  3MHZ A;  1YJJ A;  2RDH A;  1EWY C;  1MJD A;  4L1B A;  1ET6 A;  2VZK D;  2Q5W D;  3DDC B;  1DGJ A;  1WSP A;  2KQS A;  2LOX A;  4PS7 A;  5C23 A;  4YON A;  3A1Q A;  2KC1 A;  1X1M A;  2INN E;  2IJ0 A;  1C1Y B;  3ZNZ B;  5FR6 A;  2PMV A;  2COD A;  1IGD A;  2XN9 C;  1OQQ A;  4E3C A;  4JX1 C;  1I4P A;  2KD0 A;  1MPE A;  3KVF B;  1QOF A;  1JDE A;  1IP9 A;  2NZ8 B;  4BBN C;  4OZC A;  2GRI A;  1UH6 A;  3DXC A;  2JT4 B;  3N3K B;  3PZ8 A;  4A8X C;  1V9J A;  4IG7 B;  1V5O A;  1OTR B;  4I6P A;  2G1E A;  2L32 A;  4WUR A;  3C19 A;  1HZ6 A;  1L6U A;  4GDK A;  4XGA B;  3U2S C;  3LDZ E;  3PP2 A;  2O2V A;  3WAL A;  4WH4 A;  2Q13 A;  4KSL C;  1V49 A;  3TEZ A;  1RFK A;  2WXP A;  3W5U B;  2KQ4 X;  3V6C B;  1MHX A;  2MBO A;  2COA A;  5J3Y A;  2WXL A;  3QAR A;  1T0R C;  4WJN A;  4O1N A;  2L05 A;  4C7Y A;  3NZU A;  3OHM B;  4MGI E;  1KJT A;  2YSZ A;  2MSE D;  3ZIM A;  1TQZ A;  1WYW B;  1ZGU B;  4JKA A;  4LK0 M;  1VJK A;  1S3S G;  3AI5 A;  4W9H A;  4DX8 A;  2AEH A;  3F0W A;  4MM3 B;  1UD7 A;  2P8V A;  2WXK A;  3NHE B;  4WJQ A;  1P7F A;  1EU4 A;  4C7Z A;  2MHJ A;  1TZ1 A;  2D10 A;  3EFU A;  3OJ3 A;  2ZZP B;  1QZE A;  1EF5 A;  2CY5 A;  4OT1 A;  5BO4 B;  2AYO B;  3AED B;  1U5G A;  1W1G A;  2YS1 A;  3A9K A;  2WP9 B;  1U2B A;  2K00 A;  4R3D A;  1XLO A;  2DZJ A;  2Z0D B;  1QC6 A;  2M0A A;  1U5F A;  4FUL A;  4MGK E;  2DEN B;  2QMT A;  3NWF A;  2KWC A;  2DKQ A;  1FD6 A;  3SD5 A;  4P7I A;  1YOV B;  2PIA A;  3A9J B;  2CHW A;  1ZE3 D;  2JP2 A;  4CO7 A;  2OHF A;  5DPW A;  2C60 A;  1UUP A;  4Y94 A;  2R2Q A;  3APC A;  4J3O D;  1P5T A;  2AWT A;  2D3B A;  2OED A;  2C7H A;  2CHZ A;  1KF6 B;  5HG2 A;  1UPQ A;  1U4A A;  2JZZ A;  4P16 A;  2JQR B;  4KHB A;  4HB2 B;  3RNG C;  2WDR B;  1WGK A;  1UGJ A;  2DZI A;  2L0F A;  2MA9 B;  1NU2 A;  2BWF A;  4H8S A;  3RI7 C;  2NR2 A;  1DOY A;  2L7R A;  5HI1 A;  1NI2 A;  2KTR A;  3ZGZ A;  4LNI A;  1DRO A;  3U52 E;  3GZN B;  4D6W A;  4LNF A;  3E9O A;  1GB4 A;  2JUO A;  4KIK B;  1UBI A;  4FAD A;  3BVM A;  1JCK B;  1FXI A;  4WIP A;  2GMI C;  3QJZ A;  4MH8 A;  2QC8 A;  3L10 B;  1N61 A;  2XBB C;  1N6Z A;  3AEF B;  2N1W A;  1FEH A;  1XCT L;  2AQ2 B;  2WXF A;  1WI1 A;  2DNF A;  2WX1 A;  2MJD A;  3PG7 A;  4AQ7 A;  4LTU A;  2GOW A;  4GDL A;  3CWI A;  4Z2N A;  2JZP A;  3NRZ A;  1GNU A;  3NOB A;  3CF6 E;  3DBR B;  1UEF A;  2CHX A;  5EE3 A;  1K5G B;  2MP2 B;  1HXY D;  3UI3 A;  4ICU A;  3FM8 C;  1XKE A;  1U29 A;  5KHO A;  3A98 B;  3U7Z A;  3V5W A;  2GB1 A;  1SE2 A;  1C79 A;  3HM6 X;  3DBH I;  1L0X B;  4A6Q A;  1PDX A;  2D3C A;  3DBS A;  1N63 A;  2QHO A;  2FAZ A;  3SFE B;  1X1F A;  1V80 A;  2KX3 A;  3RT3 B;  2LUL A;  2RGN B;  2H89 B;  5IN7 A;  4OZA A;  4NAW A;  3ZXR A;  2BKR B;  1NYQ A;  1H8C A;  2GS0 A;  4W9E A;  4AOF A;  2DYQ A;  3L54 A;  2Z14 A;  3DBL B;  3G9W A;  3PZD A;  1WGD A;  1XLQ A;  4TMA B;  4OVZ A;  4YL8 A;  4WJ7 A;  5IRS A;  3MHS D;  1Z5S B;  1FNV A;  4DHJ B;  1FMA D;  1I42 A;  2GBK A;  1PGA A;  2BYV E;  1V5P A;  1MPH A;  2WXI A;  3ZO5 B;  3IAM 1;  1C3T A;  2AQ1 B;  1V89 A;  4YWG G;  3RNC C;  4BAX A;  1FFV A;  3PO0 A;  2V4L A;  1HEZ E;  3RPF C;  1EU3 A;  3QQ8 B;  2VRW B;  4H2A A;  1FRR A;  1WXV A;  2DLB A;  2UVM A;  1ZDV A;  2RSU A;  4URK A;  4LJP B;  2BB6 A;  4C00 A;  3Q8B A;  5C16 A;  3AE4 B;  4JWS C;  1TY2 A;  3OJ4 B;  2PLP A;  4NJC A;  1RRP B;  3TJP A;  1WY8 A;  2LHD A;  2QEJ C;  1NTV A;  2OQB A;  2MW5 A;  3EHV A;  3Q14 C;  1WGQ A;  3PV1 A;  2KIG A;  2Y8G A;  3PVL A;  2D9Y A;  2MDX A;  1DYQ A;  3TVV A;  4RF0 A;  4PK1 A;  2Z59 A;  3QBV B;  1Z87 A;  2WQY B;  1YX5 B;  2QKM A;  1WR1 A;  1F0Z A;  3AN1 A;  4II2 B;  3RYT A;  4ANW A;  4ZHO A;  3AEE B;  4EZJ A;  1KLV A;  1V8C A;  1Y5O A;  5CHF A;  4K3B A;  1MG4 A;  4TKN A;  4A5K A;  5D3X A;  3VIA A;  3GYO A;  4BKT A;  4IWQ A;  4OHJ A;  4JGH B;  4GNK B;  1I4R A;  3PZ7 A;  3P4Q B;  2XNA C;  4L23 A;  1KC7 A;  3FSS A;  3SV1 A;  1Z2M A;  4JIO U;  2RMM A;  4NNJ B;  3AE3 B;  2L1A A;  3U12 A;  2J0J A;  1WRI A;  3BK2 A;  4CSQ A;  2I1K A;  1EF1 A;  4RF1 A;  3H7P B;  3RMK C;  3QWZ B;  5FI0 A;  4AUQ C;  2KC2 A;  2PEA A;  2G35 A;  1SEB D;  1FHX A;  3NVZ A;  3T9L A;  4ARI A;  1YMH E;  3LJ3 A;  2LBB A;  1MHH E;  2ZCC A;  5CLL B;  3VTU A;  3NWA A;  2IYD B;  5DPR A;  2RPQ A;  4AP4 C;  2E6X A;  4S0R A;  2CB8 A;  2K8H A;  3E56 A;  4NSW A;  1ZW7 A;  4ANU A;  2HD5 B;  4C80 A;  4K3C A;  5D6J B;  3R8B A;  3KQ4 A;  3B1L X;  3DVG X;  3AH7 A;  2NPT A;  3Q2A C;  1E8X A;  2ZJD A;  2CAY A;  1XOD A;  2VSZ A;  1R7S A;  2ICI A;  1K52 A;  4IM2 A;  1HBK A;  4NJ7 A;  1U5E A;  3NJT A;  2LOZ A;  3ZLZ A;  3P63 A;  1QKZ A;  4W9J A;  3X23 A;  5E6J A;  5I2M A;  4F7H A;  4A6F A;  4BVU C;  1WI0 A;  1UNR A;  1FNW A;  3N1X C;  4MEL A;  4HWI B;  1RWS A;  2ONQ A;  3GP7 A;  2PW9 A;  5IKC M;  1E0Z A;  2ACZ B;  3HSA A;  1J0W A;  1WFY A;  4WWM A;  5G2N A;  3AE8 B;  1D4B A;  3NVY A;  4HHV A;  2WLB A;  4S17 A;  4JE3 B;  3KWL A;  4C4V B;  1K5D B;  5AUK A;  3PHW B;  1C4C A;  4ILG B;  3X0W A;  2W9N A;  4EJN A;  1WGR A;  1PMS A;  2LEK A;  2BCJ A;  2KXJ A;  3ZTD A;  4JKG A;  3UF8 A;  1HZ5 A;  3Q8F A;  2LAS A;  2ZW0 A;  4TQ0 A;  1V81 A;  3ZYY X;  1JRU A;  1Q5W B;  2DHZ A;  1N3H A;  1NVL A;  1XQQ A;  4MJS B;  2O6V B;  3PHX B;  3VAW A;  3SUZ A;  2R0D A;  1SGH A;  3ML9 A;  2KT7 A;  4W9L A;  3ENE A;  1S1Q B;  3Q3N C;  2K6D B;  4GGQ A;  1GB1 A;  1AW7 A;  2LD9 A;  2KJR A;  2Z0O A;  2XK5 A;  2DYB A;  1RRB A;  1E10 A;  2PE9 A;  2N23 A;  4WWO A;  3BYY B;  4PQ0 A;  3EC8 A;  2N9K A;  2V0G A;  1WGY A;  4WAF A;  1V1P A;  5FK9 C;  4ZYN A;  1SJH D;  4BZA A;  3VUX A;  3FKY A;  1J7B A; 
#chains in the Genus database with same CATH homology
 4F7G A;  4IFS A;  2G4S A;  2MWS B;  1FHW A;  2B3A A;  3P6A A;  2HTH B;  5JHH A;  1QQG A;  2AL6 A;  3ZRF A;  3V61 A;  4K2O A;  1WJU A;  3M62 B;  3O96 A;  3W1S C;  1GUA B;  3PT2 B;  2DX5 A;  1MKE A;  2LKO A;  1KZG A;  2Z0Q A;  3PS6 A;  4E71 A;  1DDV A;  4MK0 A;  2MFQ A;  1AQC A;  2LGD A;  1SHC A;  5EFX A;  1DIK A;  4ANX A;  1P1A A;  2DKP A;  3I3T B;  1IRS A;  3RZW C;  2BKF A;  2IY0 B;  3PPA A;  1E8W A;  4HPL B;  3APF A;  3PVW A;  2DFK A;  1LXD A;  3ML4 A;  3PVU A;  2LI5 A;  1WX7 A;  2Y8F A;  1L2N A;  1MIZ B;  2MQJ A;  2KLC A;  4IOY X;  4G3X B;  3ONS A;  3IFW B;  3F5R A;  3QX1 A;  4JK7 A;  4IW0 A;  1M94 A;  5L95 C;  2V1Y A;  2ZPY A;  5JH5 C;  2DZK A;  1R4M I;  2WWZ A;  1IYF A;  3KYC D;  1NTY A;  3SBG A;  3Q3F A;  2WYQ A;  2LVQ A;  1WH3 A;  2P0F A;  1EUV B;  2KJ6 A;  2D11 A;  2CQU A;  2M17 A;  3A8P A;  1X1G A;  1HE8 A;  2D07 B;  1XCG A;  2LYD A;  2XEW A;  5GOW B;  1WJ6 A;  2D9X A;  3GOE A;  3CST A;  4FN2 A;  5GMV A;  4G50 A;  2LRU A;  4B6W A;  2M4N A;  1D3Z A;  4JKD A;  3U7D A;  1EAZ A;  3MPX A;  5JHA A;  4JKH A;  4GMV A;  4HAU B;  5CHW A;  4GOC A;  1WGU A;  3ZNI D;  1UBQ A;  1MIX A;  2L2I A;  4EMO A;  1L7Y A;  2JF5 A;  3VUY A;  5E6P A;  2KZR A;  4E74 A;  1BTK A;  1GGO A;  2ASQ A;  4ILJ A;  1MK9 B;  2KAN A;  4GZU A;  2Z0E B;  1WJN A;  3PRE A;  3NSU A;  3KUZ A;  1OEY J;  2D3G A;  4OVV A;  3L08 A;  1FHO A;  4DDG D;  1KOT A;  1OMW A;  3KUC B;  4HDO A;  2DAF A;  5HE1 A;  2JRH A;  3FP5 A;  3UQA A;  4KSK C;  3ODO A;  3ZRC A;  1HB8 A;  4DHZ B;  4K81 A;  1Q1O A;  4EZK A;  4EZL A;  4MDK E;  1P9D U;  1LQB A;  1RLF A;  2JVC A;  3MDB C;  4B6H A;  1MAI A;  2KMC A;  4I6L B;  2JXX A;  2KWV B;  3AXC A;  2LWP A;  2N1V A;  1WJM A;  5J2R A;  3VXW A;  3OLM D;  3R66 C;  1VBG A;  2GBR A;  3QWM A;  2LXC A;  1ZVR A;  1XD3 B;  2BPS A;  3ALB A;  4HAV B;  1J8C A;  4HCN B;  3SHQ A;  3V6E B;  1UNP A;  1WM3 A;  2W2X C;  4WVF B;  4ZRJ A;  4HB0 B;  3CIK A;  3R3M A;  2RQ1 A;  1OY2 A;  1EVH A;  4HAX B;  4C0A A;  2NCN A;  4XWX A;  3UQB A;  1KM7 A;  2KX0 A;  4ZRI A;  3ODW A;  4JKE A;  1NBF C;  3MTN B;  4EUT A;  2DLW A;  4HVB A;  4MM3 A;  1WX9 A;  2H7D A;  3VH4 B;  4JK9 A;  1V6E A;  2IO0 B;  4DBG A;  2IZV B;  4ASW C;  4B95 A;  4FJV B;  5LLI A;  2COC A;  2YT0 A;  2FCS A;  2OJR A;  2ADZ A;  2ZVO A;  1WGG A;  5G55 A;  3TL5 A;  1ZC4 B;  3KZ1 A;  3AU5 A;  3SNH A;  1P3R A;  2KCJ A;  3A9J A;  4ICV A;  4M8M A;  1TJ6 A;  3JVZ X;  2K39 A;  2M38 A;  2REX A;  2W2W A;  2MWN B;  4ANV A;  3HHM A;  2CU1 A;  4RMA A;  2OTX A;  2KDB A;  2L00 B;  4HAZ B;  5C1Z A;  3PRZ A;  5D27 A;  3DXD A;  3JW0 X;  3SU8 X;  3FLV A;  3L17 A;  3TCA A;  2C7N B;  4DHJ D;  1ZM0 A;  2DYM A;  4FJZ A;  5CTR C;  2NBV B;  4GB9 A;  2Y5B B;  4IWO A;  1P98 A;  2R82 A;  3ZKJ C;  4MEM A;  2DHK A;  3DCG A;  2BF8 B;  4HK2 A;  3N7C A;  4HDQ A;  4JKB A;  5D2M B;  2Z59 B;  4KIK A;  4W9C A;  4F7Z A;  5IJM A;  3W1S A;  4K2P A;  4HLE A;  2Y7B A;  2H7E A;  4KHO A;  5JZE B;  3UIO B;  1OEY A;  5LXH A;  4FA6 A;  3T8M A;  2K2J A;  2N9X A;  4BOS C;  1E7U A;  3S2A A;  3U8Z A;  4I6N B;  2GCL A;  3R7R A;  1B55 A;  3VHT C;  4MGZ E;  5L81 A;  2WDT B;  3V60 A;  2MKR A;  2LUE A;  4HB4 B;  2ZCB A;  1ZKH A;  3RUI B;  2MP2 A;  2KFK B;  4W9D A;  3VTV A;  1GC7 A;  2EC1 A;  4KDI C;  1ZC3 B;  4JK8 A;  4XZ4 A;  3JSV B;  5HE0 A;  5C5B B;  2KTF A;  4PS3 A;  1WMH B;  1P6S A;  2C7M B;  2OOB B;  2I1J A;  3UGB B;  2EMT A;  4MH0 E;  4BBK A;  2JY6 A;  2IO3 B;  3D8D A;  4B9K A;  2LVP A;  4A3P A;  2NBU A;  1P3Q U;  3L13 A;  3N32 A;  5CHV C;  5C6R A;  1J0G A;  1EO6 A;  3PRM B;  4MT7 A;  2N7E A;  2IY1 B;  3IBE A;  2DAJ A;  1SE9 A;  2M1M A;  5KCV A;  2L8J A;  1U5D A;  4MSQ B;  3ZNG C;  2FCM A;  3WAO A;  2MBQ A;  1PLS A;  4G11 A;  2W2X D;  2RSG A;  3QIJ A;  4II3 B;  4CHM A;  1BWN A;  1LFD A;  1P0R A;  4IM0 A;  5DPT A;  3SYX A;  3CMM B;  5JLJ B;  3GZN I;  2GJY A;  3P2B A;  4XX5 A;  3H7S A;  2DYN A;  1FGY A;  1UEL A;  4TUU A;  2CR5 A;  2XQN M;  3VVW B;  3QC8 B;  2BGF A;  1BTN A;  1VBH A;  1VCB A;  1ZSQ A;  3MJW A;  5J3Q A;  1YX6 B;  3DPD A;  1XX0 A;  3WA0 A;  3DBR I;  1WE6 A;  3B0A A;  4KZC A;  1Q0W B;  2IFS A;  3C0R B;  3H7P A;  2CKH B;  4A6K A;  3B08 A;  4A6H A;  2AL3 A;  3PSE B;  2DA0 A;  1YD8 U;  2O6V D;  1RAX A;  3WYF B;  5D3W A;  1YIW A;  4F8C B;  4K17 A;  4K7S A;  3D8E A;  2MCN B;  3DBL I;  3VQI A;  3K9O B;  5E6O A;  3TW1 A;  4CHK A;  5D7G A;  2X18 A;  2CS4 A;  4GSW A;  2BWE S;  2DHI A;  4G0N B;  5HE2 A;  5DPS A;  2LJ5 A;  4KAX B;  5LXI B;  4M0W B;  3VDZ A;  4FHK A;  2C5L C;  5KQ4 A;  4DK5 A;  4GMX B;  2RGF A;  1ISN A;  3M95 A;  4IAP A;  2LGY A;  2A5U A;  2FNJ B;  1J19 A;  1DYN A;  4XC2 A;  2IO1 B;  1KZ7 A;  3EEC A;  1VD2 A;  3KRW A;  2CRF A;  3BJI A;  4FJY A;  5AEK B;  3KUD B;  3QK0 A;  3ODX A;  1UGM A;  1UZX B;  1WXM A;  3L16 A;  2YRY A;  4EKU A;  1XT9 B;  2VKI A;  5AZH A;  2I5F A;  4WWN A;  4EEW A;  3ZUN A;  1WG7 A;  3A1Q B;  2MBB B;  1X05 A;  2K8C A;  4MY6 A;  2GBM A;  2R09 A;  2COP A;  2N4F A;  2E2X A;  4WJO A;  4DWF A;  2O6V A;  4AJW A;  1W1D A;  2LVO A;  3PGE A;  3RZF A;  3ZNH B;  1XD4 A;  3GYP A;  2G4D B;  1FB8 A;  4PNK A;  2FID A;  5CLQ B;  1ACA A;  1MK7 B;  1LW3 A;  4DBB A;  1U27 A;  4GXB A;  5LOP B;  1M7R A;  2X0S A;  3VUW A;  4GDK B;  3AUL A;  4A20 A;  1AAR A;  2IBI B;  2O2V B;  2DZM A;  4HPM B;  4WQO B;  4BFR A;  2KLG A;  2HTH A;  1NDD A;  3PEG A;  1ST7 A;  2MRP A;  2K6Q A;  2KHW B;  2L0T A;  2DHJ A;  2P0D A;  2YT1 A;  2ELB A;  3PLV A;  1YJ1 A;  2LXA A;  2WX0 A;  3N30 A;  2D9W A;  2HRJ A;  4IC7 B;  2D4Q A;  1CMX B;  4KHA A;  1Q67 A;  3EPY A;  3HIZ A;  4F1S A;  1FOE A;  1K8R B;  5L83 A;  3TO1 A;  2KMA A;  1WR6 E;  3A9K B;  1WJ4 A;  3KW5 B;  2PZ1 A;  2JZ3 B;  3DVN U;  1WIA A;  2D2Q A;  2CY4 A;  3UZT A;  4PS8 A;  3QA8 A;  3W1Y A;  3DXE A;  3BY4 B;  2KN5 A;  1A5R A;  3PTF C;  4JQW C;  4IWP A;  4M8N A;  1RFA A;  1AWE A;  2NBW B;  2L3Z A;  1IPG A;  1BAK A;  1LB1 A;  3O65 B;  1V5U A;  4W9G A;  2LRW A;  3A33 B;  4KHB B;  5DHF B;  5DCN A;  4HJK A;  4JL9 A;  4DHZ E;  4F7U P;  1E8Z A;  2KQ7 A;  2JWZ A;  2GCJ A;  2KTR B;  1E8Y A;  2KJH B;  2ZEQ A;  4MSM B;  4AWJ A;  2IO2 B;  2IYB A;  2D9Z A;  4FLH A;  2HJ8 A;  5KHQ A;  4W9I A;  2ZVN A;  1F9J A;  2RVB B;  2K25 A;  2C9W B;  4DXA B;  2QKL A;  5DIF B;  2PE6 B;  1NTI A;  3IHP C;  4GDL B;  5J17 A;  1H10 A;  1YQB A;  1FAO A;  1TGZ B;  3A4R A;  2ZNV C;  4GPT B;  4GN1 A;  2PJH A;  4K7W A;  1WGH A;  1MG8 A;  3R7Q A;  1BT0 A;  3PSC A;  4HAW B;  2L1C A;  2N7D A;  2FCN A;  5D94 A;  1WXS A;  3QHT A;  2COF A;  3D32 A;  2J7Q B;  2KK8 A;  2KDE B;  2ROZ B;  4ILH A;  4NAW B;  3E9L A;  2ELA A;  3AJ4 A;  3H9D A;  3WAP A;  2A4Z A;  4KDL B;  4EFO A;  2RR9 A;  4WJP A;  2N9P C;  2KDI A;  5DHA B;  4N9F 4;  1X86 A;  2N0Y A;  1KBL A;  2DX1 A;  1TBE A;  2J59 M;  1UPR A;  2RLO A;  4JKC A;  1WVH A;  3V62 A;  1V5T A;  2VRR B;  4D0N B;  3K9P B;  4KV2 A;  1WE7 A;  2K8B A;  4TQ1 A;  2EMS A;  1OQN A;  5HE3 A;  1DDW A;  2Z0P A;  1W1H A;  2P0H A;  2M8S A;  5CX3 A;  1M7E A;  4WWP A;  2JPH A;  2FCQ A;  3A4S C;  4A3O A;  2PPH A;  4NPN A;  4WSF A;  1Y19 B;  4NQK E;  2J0M A;  4JKF A;  1Y8R C;  3KY9 A;  3QAQ A;  2UZR A;  1FGZ A;  3HM3 A;  4FHJ A;  5AZG A;  4AJY B;  4HAY B;  3ZVV A;  2NVU I;  4GU2 A;  2KVR A;  3HQC A;  4RM8 A;  2I5C A;  3KH0 A;  1OQY A;  3M3J A;  2MX2 A;  2KWU B;  1TTN A;  1WXA A;  5JP4 A;  4WAA A;  5AZF A;  4TYZ A;  3KYD D;  3P7Z A;  3KRX A;  2JRI B;  3VH3 B;  3SDL C;  2EJ8 A;  2UYZ B;  3ULC A;  3FEH A;  1T0Y A;  3ZDM C;  2UZS A;  1PFJ A;  1WX8 A;  5KQ1 A;  4LDT D;  3M1I B;  5JHG A;  2FJL A;  1V5M A;  1UNQ A;  2NPT B;  1V86 A;  2FDQ A;  3OAW A;  3JYU A;  1GC6 A;  2V76 A;  5J3T A;  2FJ9 A;  3DVG Y;  4LJO B;  3OAN A;  4LDT B;  2RNR B;  2KDF B;  5DH9 B;  2ZPN A;  2V3S A;  4A6F B;  4CYE A;  2KUP A;  2LZ6 A;  3CXB B;  5JHB A;  3ZDT A;  3ULB A;  3BIN A;  5J18 A;  3E66 A;  4PYU A;  2DTC A;  5FI1 A;  1WZ0 A;  2KFJ A;  3ML8 A;  4ZRK A;  2YS3 A;  4BOZ B;  3DQV A;  3TBL D;  1HB6 A;  3SBT A;  2YF0 A;  3L0W B;  5IA7 A;  1I35 A;  2KFK A;  4OVU A;  1E90 A;  2MBH A;  3JSV A;  2NS5 A;  3HK0 A;  5C5B A;  1V2Y A;  4K7U A;  3QCA A;  4J6I A;  3M63 B;  2YVC A;  1G6J A;  1WMH A;  4EOY A;  2M0X A;  2WH5 A;  3CSF A;  1GJZ A;  4KVG B;  4JKG B;  1X11 A;  1OGW A;  1I7A A;  3IG3 A;  4BKS D;  2N9E B;  1WM2 A;  2M14 A;  5EDS A;  2NMB A;  2ZNV B;  2HE7 A;  5TR5 A;  5D3V A;  1TXD A;  3HW2 B;  3TMP B;  2L76 A;  2ROV A;  2XK5 B;  2R2O A;  4IUM B;  3NY5 A;  2GBJ A;  3ZW3 A;  2YS5 A;  3E9P A;  3SO6 A;  5C79 A;  2K1F A;  3VFK A;  3WAM A;  3IVF A;  2BYE A;  1KI1 B;  2FIF A;  3H1U A;  2RD0 A;  4KZ0 A;  2KOX A;  2G3Q B;  3ZTC A;  1I2H A;  1WZ3 A;  4TV3 A;  4CHJ A;  1FXT B;  2DX5 B;  2D9V A;  2MBE A;  5LON B;  2KKC A;  1PQS A;  3VTW A;  3NZS A;  4JLC A;  3WAN A;  4W9F A;  2EKE C;  3ZVR A;  3RUL A;  3UIP B;  3Q3J A;  4HXD A;  2GBN A;  4K1R B;  4NY0 A;  1V88 A;  4HCP B;  2K2U A;  1EGX A;  1E5W A;  2G45 B;  2RUK B;  1DBH A;  3H6N A;  2LG1 A;  4BKS A;  3TIX A;  3WIM A;  4NJ6 A;  3A8Q A;  1DDM A;  4X57 B;  1V61 A;  3DVN V;  3UIN B;  4BKG A;  3APD A;  3RD2 A;  1RJ2 A;  1WF9 A;  4L6E A;  5JVL A;  4FBJ B;  4ZDV A;  2KNB A;  4MGY E;  2DN6 A;  3T06 A;  1GG3 A;  5IAA C;  3RCZ A;  2J0K A;  2UWQ A;  2KO3 A;  4HB3 B;  2MLB A;  4Z2M B;  3U30 A;  3ECI A;  3PLU A;  4MJS A;  3VOQ A;  3NS8 A;  3PRP B;  1XR0 B;  1H4R A;  3LJU X;  4GIV A;  4RM9 A;  1LM8 B;  4IM3 A;  3KSY A;  3TFM A;  4PYZ A;  3RCP A;  4DX9 0;  5D3Y A;  1WJ1 A;  5HKH A;  4BBN F;  2DIK A;  2BYF A;  2FUH B;  3ENB A;  2YLM A;  5DI9 B;  2DYO A;  1R4N I;  3AU4 A;  2ABD A;  3DOW A;  4W9K A;  1SIF A;  3D8F A;  4DDI D;  4HAT B;  1E7V A;  1WRD B;  4LCD E;  5E6N A;  4NQL B;  2LGX A;  2KGX B;  3DDC B;  2KQS A;  2LOX A;  4PS7 A;  5C23 A;  4YON A;  3A1Q A;  2KC1 A;  1X1M A;  1C1Y B;  3ZNZ B;  5FR6 A;  2COD A;  4E3C A;  2KD0 A;  3KVF B;  1JDE A;  1IP9 A;  2NZ8 B;  4BBN C;  1UH6 A;  3DXC A;  2JT4 B;  3N3K B;  1V9J A;  4IG7 B;  1V5O A;  1OTR B;  4I6P A;  4GDK A;  3LDZ E;  3PP2 A;  2O2V A;  3WAL A;  2Q13 A;  4KSL C;  1V49 A;  3V6C B;  2MBO A;  2COA A;  5J3Y A;  3QAR A;  4WJN A;  2L05 A;  3NZU A;  4MGI E;  1KJT A;  2YSZ A;  2MSE D;  3ZIM A;  1TQZ A;  1WYW B;  1ZGU B;  4JKA A;  1S3S G;  3AI5 A;  4W9H A;  4DX8 A;  2AEH A;  3F0W A;  1UD7 A;  2P8V A;  3NHE B;  4WJQ A;  1TZ1 A;  2D10 A;  3EFU A;  3OJ3 A;  2ZZP B;  1QZE A;  1EF5 A;  2CY5 A;  5BO4 B;  2AYO B;  1U5G A;  1W1G A;  2YS1 A;  3A9K A;  1U2B A;  2K00 A;  2DZJ A;  2Z0D B;  1QC6 A;  4FUL A;  1U5F A;  4MGK E;  2DEN B;  2KWC A;  2DKQ A;  3SD5 A;  4P7I A;  3A9J B;  2CHW A;  2JP2 A;  4CO7 A;  5DPW A;  2C60 A;  4Y94 A;  2R2Q A;  3APC A;  1P5T A;  2AWT A;  2C7H A;  2CHZ A;  1UPQ A;  1U4A A;  2JZZ A;  4HB2 B;  2DZI A;  2L0F A;  2MA9 B;  1NU2 A;  2BWF A;  4H8S A;  2NR2 A;  2L7R A;  1NI2 A;  2KTR A;  1DRO A;  3E9O A;  2JUO A;  4KIK B;  1UBI A;  4FAD A;  2GMI C;  3QJZ A;  3L10 B;  2XBB C;  2N1W A;  1WI1 A;  2WX1 A;  3PG7 A;  2GOW A;  4GDL A;  4Z2N A;  1GNU A;  3NOB A;  3CF6 E;  1UEF A;  2CHX A;  1K5G B;  2MP2 B;  4ICU A;  3FM8 C;  1XKE A;  1U29 A;  5KHO A;  3A98 B;  3V5W A;  3HM6 X;  3DBH I;  3DBS A;  2QHO A;  2FAZ A;  1X1F A;  1V80 A;  2KX3 A;  3RT3 B;  2LUL A;  2RGN B;  4NAW A;  2BKR B;  1H8C A;  2GS0 A;  4W9E A;  4AOF A;  2DYQ A;  3L54 A;  3G9W A;  3PZD A;  1WGD A;  4YL8 A;  4WJ7 A;  3MHS D;  1Z5S B;  4DHJ B;  1I42 A;  2GBK A;  2BYV E;  1V5P A;  1MPH A;  3ZO5 B;  1C3T A;  1V89 A;  2V4L A;  3QQ8 B;  2VRW B;  1WXV A;  2UVM A;  2RSU A;  4URK A;  4LJP B;  5C16 A;  3OJ4 B;  1RRP B;  3TJP A;  1WY8 A;  1NTV A;  2OQB A;  2MW5 A;  3EHV A;  1WGQ A;  3PV1 A;  2Y8G A;  3PVL A;  2D9Y A;  2MDX A;  3TVV A;  3QBV B;  1Z87 A;  1YX5 B;  2QKM A;  1WR1 A;  4II2 B;  3RYT A;  4ANW A;  4EZJ A;  1KLV A;  1Y5O A;  5CHF A;  4TKN A;  4A5K A;  5D3X A;  3VIA A;  3GYO A;  4BKT A;  4IWQ A;  4JGH B;  1KC7 A;  3FSS A;  3SV1 A;  1Z2M A;  4JIO U;  4NNJ B;  2J0J A;  2I1K A;  1EF1 A;  3H7P B;  3QWZ B;  5FI0 A;  4AUQ C;  2KC2 A;  2PEA A;  2G35 A;  1FHX A;  3T9L A;  3LJ3 A;  2LBB A;  2ZCC A;  5CLL B;  3VTU A;  5DPR A;  2IYD B;  2RPQ A;  4AP4 C;  2CB8 A;  2K8H A;  4NSW A;  1ZW7 A;  4ANU A;  2HD5 B;  5D6J B;  3B1L X;  3DVG X;  2NPT A;  1E8X A;  2ZJD A;  2CAY A;  1XOD A;  2VSZ A;  4IM2 A;  1HBK A;  4NJ7 A;  1U5E A;  2LOZ A;  3ZLZ A;  4W9J A;  3X23 A;  4F7H A;  4A6F A;  4BVU C;  1WI0 A;  1UNR A;  4MEL A;  4HWI B;  1J0W A;  1WFY A;  5G2N A;  4HHV A;  1K5D B;  3PHW B;  4ILG B;  3X0W A;  2W9N A;  4EJN A;  1WGR A;  1PMS A;  2BCJ A;  2KXJ A;  3ZTD A;  4JKG A;  3UF8 A;  2LAS A;  4TQ0 A;  1V81 A;  1JRU A;  1Q5W B;  2DHZ A;  1N3H A;  1NVL A;  1XQQ A;  4MJS B;  2O6V B;  3PHX B;  3VAW A;  3SUZ A;  2R0D A;  1SGH A;  3ML9 A;  4W9L A;  3ENE A;  1S1Q B;  2K6D B;  4GGQ A;  2LD9 A;  2KJR A;  2Z0O A;  2XK5 A;  2DYB A;  1RRB A;  2PE9 A;  2N23 A;  4WWO A;  4PQ0 A;  3EC8 A;  1WGY A;  4ZYN A;  3VUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...