1SGHA

Moesin ferm domain bound to ebp50 c-terminal peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Moesin
publication title The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1sghA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1sghA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1sghA01
4F7ZA 2LYDA 4NSWA 1UNRA 2IYBA 3MDBC 4HAYB 3HM3A 2Y8GA 3CXBB 1XD4A 3EECA 3F5RA 2MP2B 1V86A 2I1JA 3H7PA 2K39A 3PSEB 2XK5A 2VRRB 4FJZA 1W1DA 1X05A 4K7UA 4G50A 3QWZB 5LXIB 4IAPA 1E8WA 4D0NB 2KDBA 2L2IA 4JIOU 4MELA 1HE8A 3KW5B 4P7IA 3SNHA 2LRUA 2FUHB 2BKFA 2DFKA 2MBQA 5KQ4A 3KUDB 3DBSA 3QIJA 2C7HA 2CAYA 2L1CA 1UNPA 2D9YA 3NS8A 5HE0A 2X18A 1SE9A 3SU8X 2Z0QA 1LB1A 2BPSA 3PHXB 1XCGA 2IO1B 4B6HA 4BKSD 2V76A 4ANWA 2LBBA 2WWZA 4GDKA 3RULA 2IYDB 1SGHA 4W9DA 3L10B 4F7UP 1TXDA 2PZ1A 3LJUX 4ASWC 1NVLA 2L00B 1U4AA 2HJ8A 2CY4A 1E8XA 3A4RA 3PEGA 4HJKA 2C60A 3RUIB 3T8MA 3A8QA 3H1UA 3TVVA 2K8CA 1YX5B 2MFQA 3D8FA 4H8SA 4A3OA 2N7DA 2RNRB 5GOWB 4WSFA 3UGBB 4PYUA 1TQZA 4DBBA 3PT2B 1XR0B 3M3JA 2DHIA 5KHOA 4W9FA 2KGXB 1NU2A 1E7UA 1X1MA 1EGXA 2J59M 1UBIA 2JRIB 4NPNA 2LKOA 1FOEA 2LG1A 1XQQA 2P8VA 5C6RA 2D11A 1V89A 3N7CA 4CYEA 2QKLA 1OEYA 4GOCA 3D8EA 3SUZA 5GMVA 3QJZA 1R4NI 3KVFB 3A9KA 1E7VA 2GBKA 4F1SA 1V5MA 2KD0A 3WANA 2LUEA 5C5BB 3NZSA 2NBWB 4W9JA 1W1HA 1OEYJ 5FI0A 1V5UA 4WWNA 1KOTA 1IP9A 2LXAA 2G3QB 2J7QB 1IPGA 2DZIA 2K6QA 3QQ8B 4KDIC 4FA6A 1WXSA 5JHAA 1XD3B 5C23A 2LOXA 4AP4C 2KLCA 4WQOB 3V62A 1EF1A 1V88A 2CS4A 3AULA 3V6EB 3SV1A 4GMXB 4PYZA 2GS0A 1WJUA 4B9KA 3MTNB 3ONSA 4B6WA 4I6PA 3V5WA 3WAOA 2E2XA 2ROZB 4KAXB 3B1LX 4HPMB 1WJ4A 4WJNA 3QAQA 2N9XA 2LOZA 1ZW7A 2R0DA 3UF8A 1DYNA 1KI1B 4F8CB 1GC7A 3WYFB 4FADA 4WWPA 2D9ZA 1NI2A 2P0FA 2ZZPB 4X57B 3EPYA 2ELBA 1C3TA 1P9DU 1Z2MA 4K2PA 2R2OA 1NBFC 2HTHA 2ZVOA 2G45B 2DHZA 2KO3A 3H7SA 4HDQA 3VH3B 3U30A 2K2JA 5HKHA 1OY2A 1QZEA 2D9WA 1WGYA 3F0WA 1V5TA 3IHPC 2FCNA 1P3RA 3NHEB 2MWSB 1IYFA 5CLLB 3PRPB 1WF9A 1EAZA 3UINB 2MCNB 3BY4B 4BKGA 4N9F4 5AZGA 2MLBA 5JHBA 4KHBB 2FCQA 2UZSA 4HCPB 1FXTB 3EC8A 5EDSA 1WY8A 4HVBA 2ZCCA 2DYMA 1UELA 1M94A 1E90A 2KTRA 5IJMA 5DHFB 3UIPB 2EKEC 2GCLA 3PTFC 4PS7A 3SHQA 3KYDD 2D9VA 4MDKE 2W2XC 3QBVB 1J0WA 3IVFA 2PPHA 3KSYA 1LW3A 4JGHB 2R09A 1U29A 2DLWA 1MIXA 2VRWB 3IG3A 2MBBB 2I1KA 3ZO5B 4KHOA 3MHSD 5D27A 2FCMA 3X0WA 2KJ6A 3OJ4B 2OTXA 2DYNA 2COFA 3M62B 4I6LB 4MY6A 4II2B 3ZW3A 4EUTA 4W9LA 1CMXB 1I42A 2RGFA 2CB8A 1P6SA 2R2QA 3DPDA 3VOQA 2KOXA 4A6KA 2V1YA 4II3B 3R66C 2J0JA 4LDTD 5CHFA 1I35A 2CY5A 4HPLB 2PJHA 4RM8A 1WGHA 1WX9A 5D94A 4TV3A 4EMOA 4HDOA 2LD9A 2JP2A 4K1RB 2M1MA 4AJYB 1GNUA 4PS3A 3A1QB 4FJVB 2YF0A 1GUAB 4EZJA 4GMVA 1KJTA 4BBNF 4HB0B 2BYEA 3IBEA 4GIVA 1ZSQA 2G35A 4DX90 3Q3JA 4AUQC 2KLGA 4CHMA 4KIKB 2DENB 4NJ7A 2CR5A 3NSUA 5J17A 3MJWA 1WZ3A 2Z0PA 5L95C 2EMTA 2KQ7A 3L54A 1EUVB 3JSVA 1RJ2A 2PE9A 4GU2A 1ZKHA 1WRDB 2A5UA 4MGKE 1M7EA 3DCGA 1Z5SB 2FDQA 2ADZA 2NZ8B 4DHZE 2C7NB 3H7PB 2C7MB 3TCAA 2RUKB 2YS5A 3PV1A 5DI9B 2DX5A 2BWES 2EC1A 1UZXB 1V6EA 2Z59B 2JPHA 2JXXA 3TFMA 1XODA 1MPHA 2O6VA 5DIFB 2LI5A 3DOWA 4GSWA 3HK0A 5DHAB 2DKPA 2WX1A 2VKIA 1P0RA 2K6DB 4WJOA 4LJOB 3CSTA 3AI5A 4G3XB 1V9JA 2M0XA 3KRWA 2GBRA 2EJ8A 5BO4B 2KXJA 3HM6X 3WAMA 1ZC3B 1WMHA 2RGNB 4XC2A 3A9JA 2MW5A 5AZFA 4EZKA 1P98A 3Q3FA 3VFKA 2D10A 2KJHB 4ZRJA 2J0MA 4GDKB 2GBJA 1P5TA 3ZVVA 2N9EB 2UYZB 2XQNM 1VD2A 4HWIB 1W1GA 2RSUA 5J18A 4GDLA 2KWUB 3PSCA 4W9GA 2HD5B 2V4LA 1NTIA 3ULCA 1X86A 5D3WA 4IWOA 1EF5A 1IRSA 2AYOB 4MGZE 3U7DA 4DDGD 3DXCA 3NY5A 5J3QA 3T06A 3OJ3A 4DDID 2W9NA 3ZNGC 4LCDE 3UIOB 3P7ZA 2JRHA 1LQBA 2O6VD 2KJRA 2C5LC 3VTVA 2BYFA 1X1FA 2N4FA 3B0AA 1V5PA 1UH6A 2HE7A 2ELAA 1R4MI 1ZC4B 3VQIA 3N32A 2IO3B 2N1WA 2FAZA 2DAFA 1WX8A 2M4NA 2KZRA 4HXDA 2KDFB 1XT9B 3U8ZA 3ML9A 1T0YA 2ZVNA 3PHWB 1SHCA 1KZ7A 2J0KA 3K9OB 4EJNA 2P0DA 1TGZB 2KQSA 4G0NB 4J6IA 2LVOA 4WJ7A 1WGDA 3DQVA 1QQGA 2GJYA 1AWEA 1MAIA 5D3YA 4M8NA 3FP5A 4HAWB 4MGYE 3G9WA 2Z0DB 4NQKE 1Y19B 4IOYX 2AL3A 1PMSA 3PZDA 1RRPB 2OJRA 4XWXA 4MSMB 4CHJA 3PG7A 1Y5OA 1TJ6A 1KLVA 1H10A 4RMAA 1I7AA 3CSFA 2CHXA 3KUZA 1WGUA 3HW2B 4BOZB 1DDWA 3VUWA 2DHKA 1V80A 1OQNA 3JW0X 1XKEA 3MPXA 4MJSB 4IM0A 2COPA 2WH5A 2DYQA 4K81A 2WDTB 4EFOA 4BVUC 5HE3A 3KUCB 4HLEA 2K2UA 3SO6A 1MKEA 2IY0B 1K5GB 5CHWA 3DDCB 3DVNU 1C1YB 4HB3B 4IC7B 1LXDA 1YX6B 3VIAA 5DPTA 2KK8A 4ZRIA 4EZLA 4GZUA 1U5DA 2KCJA 1M7RA 1HB6A 5AEKB 3P6AA 2FIFA 4JLCA 5D3VA 3EFUA 1GJZA 2FJ9A 1OTRB 3PVLA 5JP4A 1N3HA 4WVFB 4RM9A 3HIZA 4WJPA 1Q0WB 3LDZE 2JT4B 1U27A 2MX2A 3K9PB 2ZJDA 2YT0A 4DBGA 4KZCA 3RCZA 4M8MA 2JF5A 1FHXA 2DN6A 4IFSA 2W2WA 4M0WB 5D7GA 5IAAC 3VH4B 2KANA 2KVRA 1V61A 3PLUA 3TMPB 3DBLI 4ANXA 3VTWA 1ZGUB 4K7WA 5C5BA 4A6FA 3DVGY 1P3QU 2KWVB 2P0HA 3ZLZA 4CO7A 3UQAA 4Z2NA 2GMIC 5DPSA 3BJIA 1BTKA 3A4SC 3R7QA 1X1GA 1X11A 4AOFA 2K25A 3PREA 2RD0A 1BAKA 2ZNVB 3OANA 1AARA 5DPRA 2CKHB 2N1VA 4GPTB 2IFSA 4A6HA 1Y8RC 1OQYA 1TBEA 3ML4A 2A4ZA 2KC2A 3V6CB 1XX0A 4DX8A 1WJ1A 3ZNID 1L2NA 3GOEA 3GYPA 4K17A 4URKA 4HAVB 5LOPB 2NPTB 3OLMD 3VXWA 2G4DB 1V49A 2CRFA 2FCSA 3A33B 3PVWA 1UBQA 3W1SC 5KHQA 3N30A 2L0FA 3ZRFA 2COAA 1RFAA 2RPQA 4XX5A 4IG7B 4PQ0A 1EO6A 3ZTCA 3KYCD 2KX3A 4PNKA 5LONB 4BBNC 3TIXA 5CLQB 3QCAA 2XEWA 3H9DA 2KFKB 2QHOA 3P2BA 2LVPA 3RT3B 2DKQA 3GZNI 2KMAA 4NY0A 2IY1B 3WAPA 2YVCA 3GYOA 1TZ1A 4DHZB 1DDMA 2O2VB 4EEWA 2NVUI 4WJQA 3ODOA 4LJPB 5FR6A 2GOWA 2KDIA 2UVMA 2COCA 4G11A 5E6PA 3ZNZB 2BKRB 4TYZA 2DAJA 4DHJD 3RZFA 3DXEA 3L17A 3ECIA 3ZDMC 2N0YA 4Z2MB 1NTYA 2N7EA 1DROA 3QA8A 4FBJB 2YS1A 4HHVA 1BT0A 2DZJA 4GN1A 4YONA 1E5WA 3JSVB 2MRPA 2K8BA 2BWFA 3VUYA 1G6JA 3CIKA 3KZ1A 3DVNV 2NMBA 4IM2A 4NAWA 2ASQA 3TBLD 1A5RA 1MG8A 2FJLA 3W1SA 4E3CA 2AEHA 2KUPA 1FHWA 4ZYNA 4A5KA 1Q5WB 1OGWA 2LWPA 4AJWA 3QC8B 2N23A 2GBMA 4FHJA 3PS6A 1V81A 2CHZA 4DK5A 2YT1A 1MK7B 1J0GA 5J3YA 1WR1A 3RD2A 3ZDTA 4A3PA 4TKNA 2GBNA 3NZUA 4MSQB 1FB8A 2DZMA 2HRJA 4KSLC 2FNJB 1WXMA 3LJ3A 4FLHA 1B55A 1K8RB 3A9JB 2XK5B 3A8PA 4CHKA 2Z0EB 1WXVA 1VCBA 4NJ6A 2DYOA 1OMWA 1AQCA 4KV2A 3A1QA 3DVGX 4W9EA 4MGIE 2KC1A 3O65B 4F7HA 3L08A 1S3SG 3VVWB 1U5GA 1KZGA 1Q1OA 1FHOA 4KVGB 2JZ3B 1WIAA 4KIKA 2M17A 2PEAA 4BKSA 3SDLC 5KQ1A 4JQWC 2LZ6A 3WIMA 2RVBB 1S1QB 3KRXA 2JUOA 2H7EA 3QARA 2LGYA 3ALBA 4K2OA 3VDZA 2KHWB 2DA0A 3EHVA 2DX1A 3I3TB 4MT7A 1WM3A 2REXA 3APCA 3D8DA 2D2QA 4KZ0A 2D3GA 2W2XD 2MSED 3PRZA 1LM8B 3V60A 3M95A 2IO2B 3DBHI 2MDXA 4JL9A 1J19A 3L0WB 4TQ0A 3HHMA 3A98B 4HCNB 2ZCBA 1GC6A 1I2HA 4FN2A 5CX3A 3VTUA 3NOBA 1WJNA 2RSGA 2KTFA 2D07B 2NBVB 2LRWA 4HB4B 3QHTA 2KFJA 3OAWA 3ZVRA 2MP2A 4A20A 1WH3A 5C1ZA 2NS5A 4ICUA 2CQUA 3ZIMA 3R7RA 4PS8A 3AU5A 2KX0A 1FGYA 1WM2A 2L76A 2LXCA 4ANVA 5JHHA 3R3MA 1P1AA 2B3AA 5D2MB 4GXBA 1WE6A 4BKTA 2K00A 4MK0A 2L7RA 1WFYA 1SIFA 1GG3A 4MM3A 4OVUA 1PFJA 2LASA 3L16A 5LXHA 3A9KB 3ODWA 3IFWB 4BOSC 3FEHA 3X23A 2Z0OA 2LVQA 2H7DA 5JH5C 3ZRCA 3FM8C 2IZVB 2L0TA 3ZTDA 3VUXA 1UGMA 5DCNA 3ZUNA 1Q67A 1WYWB 4ANUA 1EVHA 1YD8U 3UZTA 2XBBC 3DBRI 3B08A 4ZRKA 2GCJA 2UWQA 2K1FA 1WJMA 1K5DB 2NR2A 2Y8FA 5JZEB 2D4QA 1WI1A 1KM7A 3QWMA 1E8ZA 2BYVE 1F9JA 3ZNHB 1HBKA 1WGGA 5DH9B 1V5OA 2IBIB 2YRYA 2C9WB 4I6NB 4C0AA 1WGQA 4IW0A 5HE2A 1ZVRA 4EKUA 2MWNB 2MBEA 1WJ6A 1YJ1A 4A6FB 1H4RA 2DHJA 3TO1A 4IWPA 4FULA 4EOYA 4AWJA 1UNQA 2M8SA 1PQSA 4HAZB 3V61A 4NQLB 4MJSA 1UPRA 2ZNVC 2MKRA 2HTHB 1ST7A 4IUMB 2BCJA 5E6NA 4MH0E 2LGXA 4DWFA 3O96A 5G55A 2LJ5A 5DPWA 1YQBA 2YSZA 2AL6A 2JWZA 1UPQA 4E74A 2CU1A 2KWCA 5KCVA 2K8HA 1MIZB 5IA7A 5CHVC 4DHJB 2KNBA 2WX0A 4W9KA 2FIDA 4W9CA 4HAUB 2MQJA 1WGRA 5D6JB 2KMCA 1DDVA 1WR6E 4HK2A 4LDTB 3KH0A 1WX7A 4BBKA 3PGEA 3RZWC 2Q13A 2L8JA 1WE7A 5LLIA 3TL5A 4IWQA 1LFDA 1WXAA 3AJ4A 5HE1A 2KTRB 2BGFA 2IO0B 3UQBA 4K7SA 1QC6A 1BWNA 4ICVA 2D9XA 3ZKJC 3M63B 4NNJB 4FJYA 1ISNA 2MBHA 3RCPA 1NDDA 2CODA 1NTVA 1WVHA 2M14A 3M1IB 5J3TA 2WYQA 2KDEB 1BTNA 5FI1A 4WAAA 4GB9A 4HATB 4W9IA 3N3KB 2JVCA 5AZHA 3PRMB 2CHWA 2KN5A 3WALA 2OOBB 2YLMA 1RRBA 5D3XA 3C0RB 2DYBA 4WWOA 4BFRA 3L13A 3KY9A 2ABDA 3AXCA 1TTNA 2DZKA 3SYXA 5G2NA 2AWTA 3CF6E 2LULA 1FAOA 2Y7BA 4F7GA 2RQ1A 2RR9A 3PLVA 3T9LA 3DXDA 3JYUA 3SD5A 1MK9B 2NBUA 4MEMA 2NPTA 3BINA 3ML8A 1PLSA 3AU4A 1JRUA 4HAXB 1ZM0A 2VSZA 1E8YA 2MBOA 3VHTC 4NAWB 4TQ1A 2JZZA 2BF8B 2QKMA 2OQBA 1HB8A 2ZEQA 3H6NA 2M38A 2PE6B 5C16A 5CTRC 3FSSA 1J8CA 3APDA 1D3ZA 3JVZX 5L81A 1U2BA 3VAWA 2KFKA 1V2YA 4XZ4A 2N9PC 3PPAA 2I5CA 5JHGA 5J2RA 5E6OA 2ZPNA 5EFXA 4L6EA 2O2VA 1UD7A 4W9HA 1ACAA 2L05A 3PVUA 4KHAA 3ODXA 5C79A 2DX5B 4TUUA 2DTCA 1H8CA 2NCNA 2LGDA 2O6VB 1YIWA 1WG7A 2ROVA 1FGZA 4FHKA 5TR5A 2KKCA 1WI0A 1U5FA 3APFA 4DXAB 2JY6A 2L3ZA 4IM3A 3HQCA 2EMSA 3TW1A 3CMMB 3ENEA 1WZ0A 3QK0A 1L7YA 2Y5BB 3D32A 3WA0A 3RYTA 2RLOA 4KDLB 1WMHB 5JLJB 2YS3A 3W1YA 1UEFA 2G4SA 4B95A 1U5EA 4HB2B 3QX1A 1RAXA 3PP2A 4ZDVA 2V3SA 4GGQA 1DBHA 1Z87A 3ULBA 4YL8A 1RLFA 5L83A 2ZPYA 4E71A 4OVVA 4Y94A 4GDLB 2UZRA 2MA9B 3FLVA 4KSKC 3TJPA 2I5FA 3S2AA
chains in the Genus database with same CATH superfamily
1TY0A 4F7ZA 2LYDA 4NSWA 1QOBA 1UNRA 2K3UA 1L0YB 2IYBA 3H8HA 2FE8A 3I63C 3MDBC 4HAYB 5IN7A 3HM3A 2Y8GA 3CXBB 1XD4A 3EECA 3DHIC 3F5RA 2MP2B 4RFBA 4ZHOA 3URYA 3AE3B 1V86A 2I1JA 1FRDA 3H7PA 2K39A 3PSEB 2XK5A 2VRRB 4FJZA 1W1DA 2AQ2B 1X05A 2LMCA 4K7UA 5I2MA 4PT5A 4G50A 3QWZB 5LXIB 1RYJA 4IAPA 1E8WA 4O1NA 4D0NB 1PGBA 2KDBA 2L2IA 4JIOU 4MELA 1HE8A 3KW5B 4P7IA 3SNHA 2LRUA 2FUHB 5BYQA 4HROA 2BKFA 2DFKA 2MBQA 5KQ4A 5G5GA 3KUDB 3DBSA 3QIJA 4JKCA 2C7HA 1EWYC 5C2TB 2RMMA 2CAYA 2L1CA 1UNPA 2D9YA 3NS8A 4LNFA 2QEJC 5HE0A 1VDVA 2X18A 1ZDVA 1SE9A 3SU8X 1SIJA 3P4SB 1C4CA 1XF5L 2Z0QA 1LB1A 1WWTA 2BPSA 3PHXB 1XCGA 3BWUD 4TSSA 1I4GA 2IO1B 4B6HA 4XE0A 2V76A 1AYFA 4BKSD 4ANWA 2LBBA 2L52A 2WXNA 2WWZA 4GDKA 2PLPA 2KIEA 3RULA 3DBRB 2IYDB 1SGHA 4W9DA 3RNAC 1PFDA 3L10B 4F7UP 2SAKA 1TXDA 2PZ1A 3LJUX 3AECB 2ONQA 4ASWC 4Q2JA 1NVLA 3GE3C 2L00B 3E9LA 3OHMB 1U4AA 2HJ8A 3EGRA 2JZPA 1JDEA 3VR9B 3AEDB 2CY4A 1E8XA 2Q5WD 4OHJA 3A4RA 3PEGA 3TEYA 1V1PA 4HJKA 2C60A 2WXLA 5FK9C 3RUIB 3T8MA 2CJNA 3A8QA 3H1UA 2J4XA 5IKCM 2EKIA 3TVVA 2DLBA 3MJ5A 2K8CA 1MI0A 1YX5B 3NS1A 3Q69A 2MFQA 3D8FA 1FPYA 2BTEA 2BS3B 4H8SA 3ZXVA 1ESFA 4ARIA 4A3OA 2N7DA 2RNRB 3Q14C 5GOWB 4WSFA 2OEDA 1SB3C 1OFFA 1MJDA 3Q8EA 3UGBB 1XEEA 4PYUA 1TQZA 1CK1A 4DBBA 5IP4D 1D5MC 3AM9A 3PT2B 2MJ3A 1XR0B 3M3JA 2DHIA 5KHOA 4W9FA 2KGXB 1NU2A 1YQ4B 2QJLA 3N1XC 1E7UA 1TKGA 1X1MA 3ENBA 1EGXA 2J59M 1UBIA 2JRIB 2WDQB 4NPNA 2LKOA 1FOEA 2LG1A 1FMAD 3DCXA 1XQQA 2P8VA 5C6RA 1L6UA 2D11A 1T0RC 1V89A 3N7CA 1L4ZB 3P63A 4CYEA 2QKLA 4L1BA 1OEYA 4GOCA 4IKGA 3D8EA 3SUZA 5IOIA 5GMVA 3QJZA 1R4NI 3KVFB 3A9KA 1E7VA 2GBKA 4F1SA 1V5MA 2KD0A 3WANA 1ZYIA 2LUEA 4MH8A 4JKGA 5C5BB 3NZSA 1IBXB 2NBWB 4W9JA 1W1HA 1OEYJ 5FI0A 1MFWA 1V5UA 4WWNA 1KOTA 4OZAA 1ZXIA 1IP9A 1EM7A 2LXAA 2FBWB 2G3QB 2J7QB 1IPGA 2RRFA 2DZIA 2K6QA 3NVWA 3U52E 3QQ8B 4YXDB 4KDIC 4FA6A 1WXSA 2LFIA 4MT5A 5I2SA 5JHAA 1XD3B 5C23A 3MC0B 1DOXA 1YJIA 4XDCA 2V9HA 4YSZB 2LOXA 4AP4C 3NVYA 2KLCA 4WQOB 3V62A 1EF1A 5C3JB 1V88A 2CS4A 3AULA 2AQ3B 3V6EB 2VH1A 3U2SC 3SV1A 4GMXB 4PYZA 1L6VA 2ON8A 3Q3MC 1YMHE 2GS0A 1WJUA 4JK8A 4B9KA 3MTNB 2D5GA 3ONSA 2G9HD 4B6WA 1QF6A 2M56B 2QIEB 4I6PA 2OHFA 2M0AA 3V5WA 3WAOA 2W82A 4BZAA 2E2XA 2ROZB 4KAXB 3B1LX 2VZKD 4HPMB 1WJ4A 4WJNA 3QAQA 2N9XA 2LOZA 2WDVB 1ZW7A 2R0DA 3UF8A 1DYNA 1KI1B 2MJEA 1SF0A 4HJGE 4F8CB 1GC7A 3WYFB 2KAJA 4FADA 4WWPA 2D9ZA 1NI2A 2AQ1B 4C7ZA 2P0FA 2V3NA 1V1OA 2FJUB 2ZZPB 4X57B 3EPYA 3AV8A 3RPFC 2HJ1A 2ELBA 2BW2A 4WQMA 1FXIA 4QXAB 1NYQA 1P9DU 1TKEA 1C3TA 1Z2MA 4K2PA 2R2OA 1NBFC 1PGXA 1ZDXA 2HTHA 2ZVOA 3AE7B 2KR0A 2G45B 2DHZA 2KO3A 2K5PA 3H7SA 4M0WA 4HDQA 3VH3B 3BIID 3U30A 2K2JA 5HKHA 1OY2A 3RN9C 2BT6A 1QZEA 4HEA1 2D9WA 4USAA 2K8EA 3ZXRA 1WGYA 3F0WA 1XLNA 1K53A 1C79A 1V5TA 3IHPC 2FCNA 1P3RA 2N7JA 3NHEB 5IO9A 2MWSB 1IYFA 5CLLB 3PRPB 1WF9A 1EAZA 2XNAC 3UINB 4QJ5B 2MCNB 3BY4B 4BKGA 4QJ4B 3MHZA 2WXOA 4N9F4 5AZGA 2MLBA 5JHBA 3BVGA 1MG4A 3AEFB 3E66A 4KHBB 2FCQA 2UZSA 4OW0A 4HCPB 3Q6BA 1FXTB 3EC8A 5EDSA 1WY8A 1I4HA 4HVBA 4RNAA 1QT9A 2ZCCA 3C19A 2DYMA 1UELA 1M94A 3R8BA 1E90A 2KTRA 5IJMA 5DHFB 3UIPB 4K3BA 2EKEC 2GCLA 1VJKA 3PTFC 1L0VB 4C7YA 4PS7A 3SHQA 3KYDD 2GI9A 2D9VA 4MDKE 2W2XC 1KTKA 3QBVB 1JW9D 2WP9B 4N59A 1J0WA 3IVFA 2PPHA 3HVDA 3KSYA 5EE1A 1LW3A 4JGHB 4JK9A 2R09A 2INCC 1U29A 2DLWA 1MIXA 3HSAA 2PKOA 4HPPA 3AE4B 5FKAC 2VRWB 4XWWA 3IG3A 1V97A 4S17A 2MBBB 3TSSA 4P6VF 3AEAB 2I1KA 3AEGB 4CSQA 3ZO5B 4KHOA 3MHSD 3I5JC 1CJEA 5D27A 2FCMA 2KIGA 3X0WA 1SE4A 2KJ6A 3OJ4B 2GUMA 4N6EB 2OTXA 2DYNA 2COFA 3M62B 4I6LB 4MY6A 4II2B 1ZPSA 3ZW3A 4EUTA 3BK2A 4JWUC 4W9LA 1CMXB 1I42A 3ZJUA 3MP9A 3FC4A 2RGFA 2CB8A 1P6SA 2R2QA 3KLSX 3DPDA 4M00A 3VOQA 2KOXA 4C4VB 4A6KA 1SE3A 4C00A 2V1YA 4II3B 3R66C 4LTUA 2J0JA 4LDTD 5CHFA 4K3CA 1I35A 3SFDB 2WU5B 1FCLA 2CY5A 1XLOA 1R7SA 4HPLB 2HTME 2PJHA 3EFCA 1DOYA 4RM8A 1WGHA 2SEBD 1WX9A 5D94A 4TV3A 2XN9C 4EMOA 4HDOA 2LD9A 2JP2A 4K1RB 2M1MA 3N1ZC 4AJYB 2V0GA 1GNUA 4PS3A 3A1QB 4FJVB 2YF0A 1GUAB 2L1AA 4EZJA 4GMVA 2KYWA 1NYRA 1KJTA 1OQQA 4BBNF 1YQ3B 4HB0B 2BYEA 4NJCA 3IBEA 2I38A 4GIVA 1ZSQA 2WXQA 2G35A 4A55A 2V3PA 4WWMA 3TEZA 3B9JA 3RMKC 4DX90 3Q3JA 4AUQC 2KLGA 1SEBD 4CHMA 4ILGB 4KIKB 2DENB 1F77A 4NJ7A 2CR5A 3NSUA 5J17A 3MJWA 3FAHA 1WZ3A 2Z0PA 5L95C 2EMTA 1ENFA 2KQ7A 2R2YA 2WDRB 3L54A 1EUVB 3JSVA 1RJ2A 2PE9A 2W55A 2INDC 4GU2A 1ZKHA 1WRDB 2A5UA 4MGKE 1M7EA 1A70A 3DCGA 1Z5SB 2FDQA 2ADZA 2NZ8B 4DHZE 2WS3B 4EE2A 1YN4A 1D6EC 3NWDA 2C7NB 3H7PB 5FR3A 1FNUA 2C7MB 3GS2A 2D3AA 3TCAA 2RUKB 2YS5A 3PV1A 5DI9B 2K22A 4WAFA 2DX5A 2BWES 2EC1A 2WQYB 3BYTB 3UI3A 1UZXB 1V6EA 2Z59B 2JPHA 2JXXA 4IDIA 3TFMA 1XODA 2IGHA 1MPHA 2O6VA 5DIFB 1NENB 2LI5A 3DOWA 4GSWA 3PO0A 3HK0A 2X8XX 5DHAB 1MHHE 2DKPA 1FRRA 1D4BA 2WX1A 1SXTA 3ABVB 2VKIA 1P0RA 2K6DB 4WJOA 4OSNA 3KWLA 1CQVA 4LJOB 3CSTA 3AI5A 4G3XB 2ZKMX 3MC8A 1V9JA 1M4VA 2WXRA 2W3RA 2M0XA 3KRWA 2GBRA 2EJ8A 5BO4B 2KXJA 1YOVB 1JRPA 3HM6X 3WAMA 1ZC3B 1WMHA 2RGNB 2KWDA 4XC2A 3A9JA 1HXYD 1DOIA 2VH2A 4WURA 2MW5A 5AZFA 4EZKA 1IGCA 1P98A 3Q3FA 3VFKA 2D10A 4YTPB 2KJHB 2HDEA 4ZRJA 2J0MA 4GDKB 3AE6B 2GBJA 1P5TA 3ZVVA 2N9EB 2UYZB 2XQNM 1VD2A 2QSDA 4HWIB 2BB6A 1W1GA 1VR9A 2RSUA 5J18A 3LXFA 4GDLA 2KWUB 2MJDA 3PSCA 4W9GA 4ITKA 2HD5B 2V4LA 1NTIA 3ULCA 4UDUC 2LEKA 1X86A 4RGOS 5D3WA 4IWOA 1EF5A 2I2YA 1IRSA 2AYOB 5AUIA 4MGZE 4MM3B 3FILB 3U7DA 3HVZA 4DDGD 3DXCA 4JKHA 2B76B 3NY5A 2PVGC 5J3QA 3T06A 1FNWA 3OJ3A 4DDID 2W9NA 3ZNGC 3GB1A 4LCDE 1TS4A 4ACFA 2KT7A 3UIOB 3P7ZA 1RWSA 2LHDA 2JRHA 1IUEA 1LQBA 2O6VD 3P4PB 2KJRA 2C5LC 3VTVA 3GE8C 5BMHA 4WH4A 1F2RC 1KLGD 2BYFA 3SFEB 2L83A 1UUPA 1X1FA 2N4FA 1E9MA 3B0AA 1V5PA 1SJED 1UH6A 2HE7A 1JWSD 2WXHA 2ELAA 1R4MI 1QOFA 1ZC4B 3VQIA 3N32A 2IO3B 3WCQA 2N1WA 2FAZA 2DAFA 1T6BX 1WX8A 2M4NA 2KZRA 3E9OA 2G1EA 2WXMA 4HXDA 1YN3A 1ZP0B 2KDFB 4HKQA 1XT9B 3U8ZA 3ML9A 3NRZA 1T0YA 1MVKA 2ZVNA 3PHWB 1SHCA 1KZ7A 2J0KA 3K9OB 4EJNA 4KGTA 2P0DA 2JSVX 1TGZB 2K0PA 2KQSA 1SBBB 1VZ6A 4G0NB 4J6IA 2JYTA 2LVOA 2NBVA 4WJ7A 1WGDA 4YWGG 3DQVA 1QQGA 2RDBC 4A90A 2GJYA 2K49A 1AWEA 1MAIA 5D3YA 5BMIA 4M8NA 3FP5A 4HAWB 4MGYE 2MHJA 3G9WA 3SBGA 2Z0DB 3NG0A 4NQKE 1ACCA 1Y19B 3ZJVA 3RNGC 4IOYX 2AL3A 4RF0A 1PMSA 3PZDA 1RRPB 2OJRA 4JX1C 4XWXA 4MSMB 4CHJA 4RCOA 3PG7A 1PUTA 1KF6B 3W9CB 1Y5OA 3EUB2 1TJ6A 2X0SA 1KLVA 1H10A 1I7HA 4RMAA 3AB5A 1I7AA 3CSFA 1C76A 2CHXA 3KUZA 1WGUA 3HW2B 4BOZB 1DDWA 3VUWA 2DHKA 1TZOA 1V80A 1WYGA 1OQNA 1KC7A 3JW0X 1XKEA 2LGIA 2WXFA 3MPXA 4MJSB 4IM0A 2COPA 2WH5A 2DYQA 2H89B 4RGTA 4K81A 1E0ZA 2WDTB 3CIRB 4EFOA 1FXAA 4WIPA 4BVUC 5HE3A 3KUCB 4HLEA 1KLUD 2K2UA 3SO6A 1J7BA 1MKEA 2JYEA 2IY0B 2Z8LA 1K5GB 5CHWA 3DDCB 3DVNU 1P7FA 1C1YB 4HB3B 4IC7B 1TJEA 1LXDA 1YX6B 3VIAA 5DPTA 2KK8A 1TS2A 4ZRIA 1JWBD 4EZLA 2WXJA 4GZUA 4JKBA 1U5DA 1UWXA 2KCJA 1M7RA 1HB6A 5AEKB 3P6AA 2FIFA 3RFZB 4JLCA 5D3VA 3EFUA 1GJZA 1ROEA 2FJ9A 2DIKA 1MPEA 1NI3A 3AEBB 1FFVA 1K52A 1OTRB 4BAXA 3PVLA 1FCCC 5JP4A 1N3HA 4WVFB 4RM9A 3HIZA 4WJPA 1Q0WB 3LDZE 1B9RA 3TEXA 4US8A 2JT4B 4XDDA 1U27A 2MX2A 3K9PB 2ZJDA 2YT0A 4DBGA 4KZCA 3RCZA 5D3DA 4M8MA 3NZ3A 3AEEB 4HSIA 2JF5A 1FHXA 2DN6A 4IFSA 3AE2B 3BVMA 2W2WA 4M0WB 5D7GA 5IAAC 3VH4B 2KANA 2KVRA 1V61A 4RGNA 1BMLC 3PLUA 3TMPB 3DBLI 4ANXA 3VTWA 4OZBA 1ZGUB 2QMTA 4K7WA 4P1CC 5C5BA 1ET6A 4NAMA 4A6FA 3DVGY 5HHDG 1P3QU 2INNE 1IBXA 1UNSA 1VZ7A 2KWVB 2P0HA 2PMVA 3DHHC 4DXFA 3ZLZA 4CO7A 1JROA 3UQAA 4LLGM 4Z2NA 2GMIC 5DPSA 3BJIA 3N20C 1ET9A 3ETRA 1BTKA 3P1MA 3Q2AC 3A4SC 3R7QA 1X1GA 3AE1B 2BVCA 1X11A 4J3OD 1TKYA 3NW8A 3LB8C 4AOFA 2K25A 2RD0A 3PREA 1BAKA 2ZNVB 3OANA 1AARA 5DPRA 2CKHB 2N1VA 4GPTB 2IFSA 1CZPA 4A6HA 1Y8RC 1OQYA 1TBEA 3ML4A 2A4ZA 2KC2A 4JWSC 1TT5B 3V6CB 2OJWA 1XX0A 4DX8A 2WXGA 1HA5A 1WJ1A 3ZNID 1L2NA 4YSXB 1T77A 3GOEA 3GYPA 4GNKB 4K17A 4HAVB 5LOPB 2ICIA 4URKA 2NPTB 3OLMD 3VXWA 2G4DB 4KX6B 3A58A 3ZQ4A 2X38A 1V49A 2CRFA 4KGRA 2QDFA 2FCSA 4YTMB 2J52A 3A33B 3PVWA 1UBQA 2Z14A 2GLSA 3W1SC 5KHQA 5EE3A 4R3DA 3N30A 1MHXA 3NUHB 2L0FA 3ZRFA 5MPOA 4NZLB 2COAA 5T8IA 1RFAA 2RPQA 4XX5A 4IG7B 1AW7A 4PQ0A 4D2KA 4CQNA 1EO6A 3ZTCA 3KYCD 2KX3A 4PNKA 5LONB 4BBNC 3TIXA 5CLQB 3QCAA 2XEWA 3H9DA 2KFKB 1TIFA 1YN5A 2JU6X 2QHOA 3L4PA 3P2BA 2LVPA 3BZDB 3RT3B 2DKQA 2Z4DA 3GZNI 1VBHA 2KMAA 2K9XA 4NY0A 2QC8A 1N60A 2IY1B 4LNIA 3WAPA 2YVCA 3GYOA 1TZ1A 4DHZB 1DDMA 1QOGA 2O2VB 4EEWA 2NVUI 1GB1A 2UU7A 4WJQA 3ODOA 1BXTA 4LJPB 5FR6A 2GOWA 2KDIA 2D3CA 3ZJTA 5TSSA 2UVMA 3C8YA 4KHBA 2COCA 4G11A 5E6PA 3ZNZB 2BKRB 2WHIA 3RI7C 2KUQA 4TYZA 3DHGC 2DAJA 4DHJD 3Q8CA 3RZFA 2RPVA 3DXEA 3L17A 3MC9A 3ECIA 3BK1A 3ZDMC 2WGSA 2QILA 1NVID 2N0YA 4Z2MB 1NTYA 1F1HA 3RNBC 5HFYA 2N7EA 1DROA 1XCTL 3QA8A 4FBJB 3E56A 2YS1A 4HHVA 2DBYA 1BT0A 2DZJA 4GN1A 1D5XC 1T0QC 4YONA 1E5WA 2JWUA 3JSVB 2KVZA 2MRPA 4ILHA 1J7AA 1JCKB 2K8BA 2BWFA 3VUYA 2R61A 2ACZB 1G6JA 4DIXA 3CIKA 3KZ1A 3DVNV 2NMBA 1HTOA 3IT4B 1GAQB 4IM2A 4NAWA 1N6ZA 3V05A 2N9KA 1KRHA 2ASQA 2R82A 3TBLD 4QJ3B 3SR6A 1A5RA 1MG8A 2WLBA 3T3OA 2FJLA 4P16A 5HG2A 3W1SA 4E3CA 2AEHA 2KUPA 1FHWA 4ZYNA 4A5KA 1Q5WB 1OGWA 2LWPA 4AJWA 3QC8B 3TEWA 3R2TA 2N23A 2DNFA 2GBMA 4FHJA 3PS6A 1V81A 2CHZA 4DK5A 1I4XA 1KBLA 2YT1A 2IDYA 1DYQA 1MK7B 1J0GA 3Q3NC 5J3YA 1WR1A 3U7ZA 3AN1A 3RD2A 3ZDTA 2YEPF 1C9FA 4A3PA 3DWGC 4TKNA 2GBNA 3NZUA 4MSQB 3W5UB 1FB8A 2DZMA 3NJTA 2HRJA 4KSLC 2FNJB 1WXMA 2Y3AA 3LJ3A 4FLHA 1B55A 1K8RB 3A9JB 3IT6B 3U4EG 2XK5B 3A8PA 4CHKA 2Z0EB 2ZW1A 1TYGB 1WXVA 1VCBA 3RNCC 1RM6C 4NJ6A 1JQ4A 1L0XB 1GGOA 2DYOA 1OMWA 1AQCA 4KV2A 3A1QA 3DVGX 4W9EA 4MGIE 1KFYB 2KC1A 3O65B 3ZYYX 1E7PB 5BYSA 1TS5A 4F7HA 3L08A 3P4QB 4OVZA 1T5XD 1S3SG 3VVWB 1U5GA 5D3IB 1KZGA 1Q1OA 4C80A 3ZGZA 2LJIA 1FHOA 4KVGB 2JZ3B 3AE9B 1WIAA 4KIKA 2M17A 2IGGA 2PEAA 2BQQA 4BKSA 3SDLC 5KQ1A 2CU3A 4JQWC 4XGAB 2LZ6A 3WIMA 2RVBB 1S1QB 1EU3A 3KRXA 2JUOA 2H7EA 3QARA 4DQOC 2LGYA 3ALBA 2TSSA 4K2OA 3V3XA 1VZ8A 2KHWB 3SEBA 3VDZA 2DA0A 3EHVA 2DX1A 3I3TB 4MT7A 1WM3A 1R4MB 2REXA 3APCA 3D8DA 2D2QA 4KZ0A 1Q10A 1V8CA 1JWUD 4LK0M 3AE5B 1UGJA 3Q8FA 2D3GA 2PIAA 1JWMD 2W2XD 2MSED 4REZA 3PRZA 2BYTA 1LM8B 3V60A 3M95A 2IO2B 3DBHI 1N62A 2MDXA 2Z59A 4JL9A 1J19A 3L0WB 4TQ0A 3HHMA 3A98B 4HCNB 2ZCBA 1GC6A 3CWIA 4OT1A 1V1PB 1I2HA 3AMZA 4ZOHC 4FN2A 5CX3A 3VTUA 3NOBA 5JVLA 1WJNA 2RSGA 3MFGA 2KTFA 1QLBB 2D07B 2NBVB 4KGSA 2LRWA 4HB4B 3QHTA 2KFJA 1C78A 4PK1A 2AX5A 4JK7A 3OAWA 4XYCA 3ZVRA 2MP2A 3KQ4A 1GB4A 4A20A 2GRIA 4YSYB 1WH3A 1FIQA 5C1ZA 2NS5A 3FVCA 2CQUA 4ICUA 3ZIMA 5I4DA 1VRAB 3R7RA 4PS8A 4ZRPA 1YJJA 1JMLA 3AU5A 4S0RA 2KX0A 3VR8B 2MEKA 1FGYA 3PZ7A 1HZ5A 1WM2A 2PW9A 2L76A 2LXCA 1QQRA 4ANVA 5JHHA 1C4PA 1VLBA 1FD6A 3R3MA 3EA6A 4ILJA 1P1AA 2B3AA 1HTQA 1HQRD 2VZKB 5LG4B 3GP7A 5D2MB 4GXBA 1WE6A 4YT0B 1R4NB 2H88B 4BKTA 4LNKA 2K00A 4MK0A 2L7RA 4L1RA 1T0SC 3B2GA 2BBCA 1WFYA 1SIFA 1GG3A 4LNOA 4MM3A 3FILA 4OVUA 5H92C 1PFJA 4A8XC 2LGSA 4N58A 2LASA 5G5HA 3L16A 5LXHA 3P42A 1PGAA 3A9KB 3ODWA 3IFWB 4BOSC 4GLSC 4JKGB 3FEHA 3X23A 2Z0OA 1AN8A 1BUIC 2LVQA 2H7DA 5JH5C 1DGJA 3ZRCA 3FM8C 2IZVB 2L0TA 1UWMA 3ZTDA 1YNTE 3VUXA 1TS3A 1UGMA 5DCNA 1D5ZC 3ZUNA 1Q67A 5HI1A 1WYWB 4ANUA 1EVHA 1YD8U 3T3NA 3UZTA 2XBBC 3DBRI 3B08A 4ZRKA 2GCJA 2UWQA 3J9CA 2K1FA 1WJMA 1FNVA 1K5DB 2NR2A 5BYRA 2Y8FA 4A6QA 5JZEB 1STEA 2QCZA 2JQRB 4D6WA 2D4QA 4JKAA 2NTTA 1WI1A 3DBLB 1KM7A 3QWMA 1E8ZA 2BYVE 1F9JA 3ZNHB 1HBKA 1WGGA 5DH9B 4C56C 1V5OA 1XCQL 2IBIB 2YRYA 3P4RB 2C9WB 4I6NB 4C0AA 1WGQA 1XLPA 5JXVA 4ZRQA 2BS4B 3IXSA 4IW0A 5HE2A 3W2DA 1ZVRA 3Q3OC 4EKUA 4B0EA 2MWNB 4GOUA 2WXPA 2MBEA 1T3QA 1E6EB 2V4IB 2IJ0A 1WJ6A 1YJ1A 4A6FB 1F2RI 2KN4A 1H4RA 1IGDA 2DHJA 2W3SA 3TO1A 5EE0A 4IWPA 2E6XA 4FULA 4EOYA 4B0MA 4OZCA 4AWJA 1F52A 1UNQA 2M8SA 3Q8BA 1RFKA 3E9SA 1PQSA 4MACA 4HAZB 1ZOYB 3V61A 4JKDA 4L2YA 4NQLB 1N5WA 4JE3B 4MJSA 4FXCA 2W54A 2BS2B 3DWMA 1UPRA 2N0SB 2ZNVC 2MKRA 2HTHB 1ST7A 4IUMB 1KH0A 2BCJA 5E6NA 4MH0E 4DXGA 2LGXA 3NVVA 4DWFA 1C4AA 4RF1A 3O96A 5G55A 2LJ5A 5DPWA 3I57A 1YQBA 1DIKA 3HIEA 2LUMA 1B1ZA 4M02A 4ZYSA 2YSZA 3NWFA 2RDHA 3LYYA 1GPXA 2AL6A 1P7EA 2JWZA 1UPQA 4E74A 3OWEB 2NMQA 2CU1A 4H2AA 2KWCA 5KCVA 3PZ8A 2K8HA 1MIZB 5IA7A 5CHVC 4DHJB 5EE9A 1GOZA 2KNBA 2WX0A 4W9KA 2FIDA 4W9CA 2MH7A 2DWQA 4HAUB 3O13A 2MQJA 1WGRA 5D6JB 2KMCA 1HZ6A 1DDVA 1WR6E 1TY2A 4HK2A 2EELA 4LDTB 4KKJA 3KH0A 1WX7A 2KACA 2WXIA 4BBKA 1XO3A 3PGEA 3RZWC 5AUKA 2Q13A 2L8JA 1WE7A 5LLIA 3TL5A 3HUIA 4IWQA 1LFDA 1WXAA 3B2FA 3NWAA 3AJ4A 5HE1A 2KTRB 1EWCA 3BYYB 1FFUA 2BGFA 3GZNB 2IO0B 3UQBA 4K7SA 3I9V1 4RGMA 1XLQA 2BB5A 2WU2B 3NVZA 1QC6A 1BWNA 3U12A 4ICVA 2D9XA 3ZKJC 5IRSA 3M63B 4JKFA 1WSPA 4NNJB 4FJYA 4L23A 1ISNA 2MBHA 3RCPA 1NDDA 2CODA 1NTVA 1WVHA 1N63A 1ZE3D 2L32A 2M14A 3M1IB 5J3TA 2WYQA 1QILA 2KDEB 1BTNA 3W5VB 2M19A 5FI1A 2N9LA 1I4PA 3Q8AA 4WAAA 4GB9A 4HATB 1WRIA 4W9IA 3N3KB 2JVCA 1WGKA 1ZXHA 5AZHA 3PRMB 2CHWA 2KN5A 4ARCA 3WALA 2OOBB 2YLMA 1RRBA 1LGRA 5D3XA 3C0RB 2DYBA 4WWOA 4BFRA 3L13A 3AE8B 4JPSA 3KY9A 2JX5A 1XXGA 2ABDA 3AXCA 3AH7A 1TTNA 2YT2A 2DZKA 3SYXA 1I4QA 5G2NA 3FKYA 4YTNB 1EU4A 2AWTA 2PTLA 1FM0D 3CF6E 1PDXA 2LULA 2NTSA 1FAOA 3IAM1 5M4YB 2Y7BA 4F7GA 2RQ1A 2RR9A 3PLVA 1OQRA 3T9LA 3DXDA 3JYUA 3SD5A 1L5PA 3BVZA 1QOAA 1MK9B 2NBUA 2IGDA 4MEMA 2Y5PA 1PYWD 3N1YC 2NPTA 4KKIA 3BINA 3ML8A 1PLSA 3AU4A 4XWTA 1JRUA 4HAXB 4M01A 4TMAB 1ZM0A 4US9A 2VSZA 2J42A 1C77A 1E8YA 3IAS1 2MBOA 3VHTC 4NAWB 4IOIE 2JXTA 2Y5CA 2WNMA 4TQ1A 1QKZA 3RNFC 4HRSA 2JZZA 2BF8B 2QKMA 2OQBA 3OG5A 1HB8A 2ZEQA 1K50A 3H6NA 3HRDD 2M38A 2PE6B 5C16A 5CTRC 1FO4A 3FSSA 1J8CA 3APDA 1Y56A 1D3ZA 3JVZX 2RDGA 1SSNA 2ZW0A 5L81A 1U2BA 3VAWA 2KFKA 1V2YA 1NEKB 4XZ4A 2KQ4X 2N9PC 3PPAA 1J7CA 1JWAD 3TUOA 1N5XA 2I5CA 3N9YC 5JHGA 1SJHD 5J2RA 5E6OA 2YEPB 2ZPNA 5EFXA 4L6EA 3R2IA 2FUG1 2O2VA 1UD7A 1E10A 4W9HA 1ACAA 2L05A 5H8YE 3PVUA 1K51A 4KHAA 5LNK1 3ODXA 1WXQA 5C79A 2DX5B 4TUUA 2DTCA 1H8CA 2NCNA 3SBTA 4QAYA 1UF0A 2LGDA 4JKEA 2IPKD 2O6VB 1YIWA 1WG7A 3VRAB 2ROVA 1FGZA 4FHKA 1LO5D 1VBGA 2KKCA 5TR5A 1WI0A 1U5FA 3APFA 4DXAB 4LNNA 2JY6A 3E9PA 2KMMA 2L3ZA 4AQ7A 2Z13A 3RNEC 3B77A 4IM3A 4HKZE 4C4VA 3HQCA 2EMSA 3TW1A 2KDMA 2PVOD 1HEZE 3CMMB 3ENEA 1WZ0A 3QK0A 4RH6A 1L7YA 2LHEA 2Y5BB 2WXKA 3D32A 3WA0A 3RYTA 2RLOA 4KDLB 4P1BC 1WMHB 2D3BA 5JLJB 2YS3A 1FEHA 1MI1A 3W1YA 1AWDA 3DBHB 1N61A 1ZUD2 1UEFA 2G4SA 4B95A 1L4DB 5BMGA 1U5EA 4HB2B 1JALA 2INPE 3KWVA 5E6JA 3QX1A 1RAXA 3PP2A 4ZDVA 2V3SA 1F0ZA 2CJOA 4GGQA 3VRBB 1DBHA 5GXGB 1Z87A 3ULBA 4YL8A 2E3TA 1RLFA 5L83A 2ZPYA 4E71A 4OVVA 4Y94A 1I4RA 2GB1A 2UZRA 2MA9B 4GDLB 4ZHPA 3FLVA 4AS1A 1SE2A 4KSKC 2J53A 3TJPA 4A9AA 2I5FA 3S2AA
chains in the Genus database with same CATH topology
4F7ZA 2LYDA 4NSWA 1UNRA 2IYBA 3MDBC 4HAYB 3HM3A 2Y8GA 3CXBB 1XD4A 3EECA 3F5RA 2MP2B 1V86A 2I1JA 3H7PA 2K39A 3PSEB 2XK5A 2VRRB 4FJZA 1W1DA 1X05A 4K7UA 4G50A 3QWZB 5LXIB 4IAPA 1E8WA 4D0NB 2KDBA 2L2IA 4JIOU 4MELA 1HE8A 3KW5B 4P7IA 3SNHA 2LRUA 2FUHB 2BKFA 2DFKA 2MBQA 5KQ4A 3KUDB 3DBSA 3QIJA 4JKCA 2C7HA 2CAYA 2L1CA 1UNPA 2D9YA 3NS8A 5HE0A 2X18A 1SE9A 3SU8X 2Z0QA 1LB1A 2BPSA 3PHXB 1XCGA 2IO1B 4B6HA 4BKSD 2V76A 4ANWA 2LBBA 2WWZA 4GDKA 3RULA 2IYDB 1SGHA 4W9DA 3L10B 4F7UP 1TXDA 2PZ1A 3LJUX 4ASWC 1NVLA 2L00B 3E9LA 1U4AA 2HJ8A 1JDEA 2CY4A 1E8XA 3A4RA 3PEGA 4HJKA 2C60A 3RUIB 3T8MA 3A8QA 3H1UA 3TVVA 2K8CA 1YX5B 2MFQA 3D8FA 4H8SA 4A3OA 2N7DA 2RNRB 5GOWB 4WSFA 3UGBB 4PYUA 1TQZA 4DBBA 3PT2B 1XR0B 3M3JA 2DHIA 5KHOA 4W9FA 2KGXB 1NU2A 1E7UA 1X1MA 3ENBA 1EGXA 2J59M 1UBIA 2JRIB 4NPNA 2LKOA 1FOEA 2LG1A 1XQQA 2P8VA 5C6RA 2D11A 1V89A 3N7CA 4CYEA 2QKLA 1OEYA 4GOCA 3D8EA 3SUZA 5GMVA 3QJZA 1R4NI 3KVFB 3A9KA 1E7VA 2GBKA 4F1SA 1V5MA 2KD0A 3WANA 2LUEA 4JKGA 5C5BB 3NZSA 2NBWB 4W9JA 1W1HA 1OEYJ 5FI0A 1V5UA 4WWNA 1KOTA 1IP9A 2LXAA 2G3QB 2J7QB 1IPGA 2DZIA 2K6QA 3QQ8B 4KDIC 4FA6A 1WXSA 5JHAA 1XD3B 5C23A 2LOXA 4AP4C 2KLCA 4WQOB 3V62A 1EF1A 1V88A 2CS4A 3AULA 3V6EB 3SV1A 4GMXB 4PYZA 2GS0A 1WJUA 4JK8A 4B9KA 3MTNB 3ONSA 4B6WA 4I6PA 3V5WA 3WAOA 2E2XA 2ROZB 4KAXB 3B1LX 4HPMB 1WJ4A 4WJNA 3QAQA 2N9XA 2LOZA 1ZW7A 2R0DA 3UF8A 1DYNA 1KI1B 4F8CB 1GC7A 3WYFB 4FADA 4WWPA 2D9ZA 1NI2A 2P0FA 2ZZPB 4X57B 3EPYA 2ELBA 1C3TA 1P9DU 1Z2MA 4K2PA 2R2OA 1NBFC 2HTHA 2ZVOA 2G45B 2DHZA 2KO3A 3H7SA 4HDQA 3VH3B 3U30A 2K2JA 5HKHA 1OY2A 1QZEA 2D9WA 1WGYA 3F0WA 1V5TA 3IHPC 2FCNA 1P3RA 3NHEB 2MWSB 1IYFA 5CLLB 3PRPB 1WF9A 1EAZA 3UINB 2MCNB 3BY4B 4BKGA 4N9F4 5AZGA 2MLBA 5JHBA 3E66A 4KHBB 2FCQA 2UZSA 4HCPB 1FXTB 3EC8A 5EDSA 1WY8A 4HVBA 2ZCCA 2DYMA 1UELA 1M94A 1E90A 2KTRA 5IJMA 5DHFB 3UIPB 2EKEC 2GCLA 3PTFC 4PS7A 3SHQA 3KYDD 2D9VA 4MDKE 2W2XC 3QBVB 1J0WA 3IVFA 2PPHA 3KSYA 1LW3A 4JGHB 4JK9A 2R09A 1U29A 2DLWA 1MIXA 2VRWB 3IG3A 2MBBB 2I1KA 3ZO5B 4KHOA 3MHSD 5D27A 2FCMA 3X0WA 2KJ6A 3OJ4B 2OTXA 2DYNA 2COFA 3M62B 4I6LB 4MY6A 4II2B 3ZW3A 4EUTA 4W9LA 1CMXB 1I42A 2RGFA 2CB8A 1P6SA 2R2QA 3DPDA 3VOQA 2KOXA 4A6KA 2V1YA 4II3B 3R66C 2J0JA 4LDTD 5CHFA 1I35A 2CY5A 4HPLB 2PJHA 4RM8A 1WGHA 1WX9A 5D94A 4TV3A 4EMOA 4HDOA 2LD9A 2JP2A 4K1RB 2M1MA 4AJYB 1GNUA 4PS3A 3A1QB 4FJVB 2YF0A 1GUAB 4EZJA 4GMVA 1KJTA 4BBNF 4HB0B 2BYEA 3IBEA 4GIVA 1ZSQA 2G35A 4DX90 3Q3JA 4AUQC 2KLGA 4CHMA 4ILGB 4KIKB 2DENB 4NJ7A 2CR5A 3NSUA 5J17A 3MJWA 1WZ3A 2Z0PA 5L95C 2EMTA 2KQ7A 3L54A 1EUVB 3JSVA 1RJ2A 2PE9A 4GU2A 1ZKHA 1WRDB 2A5UA 4MGKE 1M7EA 3DCGA 1Z5SB 2FDQA 2ADZA 2NZ8B 4DHZE 2C7NB 3H7PB 2C7MB 3TCAA 2RUKB 2YS5A 3PV1A 5DI9B 2DX5A 2BWES 2EC1A 1UZXB 1V6EA 2Z59B 2JPHA 2JXXA 3TFMA 1XODA 1MPHA 2O6VA 5DIFB 2LI5A 3DOWA 4GSWA 3HK0A 5DHAB 2DKPA 2WX1A 2VKIA 1P0RA 2K6DB 4WJOA 4LJOB 3CSTA 3AI5A 4G3XB 1V9JA 2M0XA 3KRWA 2GBRA 2EJ8A 5BO4B 2KXJA 3HM6X 3WAMA 1ZC3B 1WMHA 2RGNB 4XC2A 3A9JA 2MW5A 5AZFA 4EZKA 1P98A 3Q3FA 3VFKA 2D10A 2KJHB 4ZRJA 2J0MA 4GDKB 2GBJA 1P5TA 3ZVVA 2N9EB 2UYZB 2XQNM 1VD2A 4HWIB 1W1GA 2RSUA 5J18A 4GDLA 2KWUB 3PSCA 4W9GA 2HD5B 2V4LA 1NTIA 3ULCA 1X86A 5D3WA 4IWOA 1EF5A 1IRSA 2AYOB 4MGZE 3U7DA 4DDGD 3DXCA 4JKHA 3NY5A 5J3QA 3T06A 3OJ3A 4DDID 2W9NA 3ZNGC 4LCDE 3UIOB 3P7ZA 2JRHA 1LQBA 2O6VD 2KJRA 2C5LC 3VTVA 2BYFA 1X1FA 2N4FA 3B0AA 1V5PA 1UH6A 2HE7A 2ELAA 1R4MI 1ZC4B 3VQIA 3N32A 2IO3B 2N1WA 2FAZA 2DAFA 1WX8A 2M4NA 2KZRA 3E9OA 4HXDA 2KDFB 1XT9B 3U8ZA 3ML9A 1T0YA 2ZVNA 3PHWB 1SHCA 1KZ7A 2J0KA 3K9OB 4EJNA 2P0DA 1TGZB 2KQSA 4G0NB 4J6IA 2LVOA 4WJ7A 1WGDA 3DQVA 1QQGA 2GJYA 1AWEA 1MAIA 5D3YA 4M8NA 3FP5A 4HAWB 4MGYE 3G9WA 3SBGA 2Z0DB 4NQKE 1Y19B 4IOYX 2AL3A 1PMSA 3PZDA 1RRPB 2OJRA 4XWXA 4MSMB 4CHJA 3PG7A 1Y5OA 1TJ6A 2X0SA 1KLVA 1H10A 4RMAA 1I7AA 3CSFA 2CHXA 3KUZA 1WGUA 3HW2B 4BOZB 1DDWA 3VUWA 2DHKA 1V80A 1OQNA 1KC7A 3JW0X 1XKEA 3MPXA 4MJSB 4IM0A 2COPA 2WH5A 2DYQA 4K81A 2WDTB 4EFOA 4BVUC 5HE3A 3KUCB 4HLEA 2K2UA 3SO6A 1MKEA 2IY0B 1K5GB 5CHWA 3DDCB 3DVNU 1C1YB 4HB3B 4IC7B 1LXDA 1YX6B 3VIAA 5DPTA 2KK8A 4ZRIA 4EZLA 4GZUA 4JKBA 1U5DA 2KCJA 1M7RA 1HB6A 5AEKB 3P6AA 2FIFA 4JLCA 5D3VA 3EFUA 1GJZA 2FJ9A 2DIKA 1OTRB 3PVLA 5JP4A 1N3HA 4WVFB 4RM9A 3HIZA 4WJPA 1Q0WB 3LDZE 2JT4B 1U27A 2MX2A 3K9PB 2ZJDA 2YT0A 4DBGA 4KZCA 3RCZA 4M8MA 2JF5A 1FHXA 2DN6A 4IFSA 2W2WA 4M0WB 5D7GA 5IAAC 3VH4B 2KANA 2KVRA 1V61A 3PLUA 3TMPB 3DBLI 4ANXA 3VTWA 1ZGUB 4K7WA 5C5BA 4A6FA 3DVGY 1P3QU 2KWVB 2P0HA 3ZLZA 4CO7A 3UQAA 4Z2NA 2GMIC 5DPSA 3BJIA 1BTKA 3A4SC 3R7QA 1X1GA 1X11A 4AOFA 2K25A 3PREA 2RD0A 1BAKA 2ZNVB 3OANA 1AARA 5DPRA 2CKHB 2N1VA 4GPTB 2IFSA 4A6HA 1Y8RC 1OQYA 1TBEA 3ML4A 2A4ZA 2KC2A 3V6CB 1XX0A 4DX8A 1WJ1A 3ZNID 1L2NA 3GOEA 3GYPA 4K17A 4URKA 4HAVB 5LOPB 2NPTB 3OLMD 3VXWA 2G4DB 1V49A 2CRFA 2FCSA 3A33B 3PVWA 1UBQA 3W1SC 5KHQA 3N30A 2L0FA 3ZRFA 2COAA 1RFAA 2RPQA 4XX5A 4IG7B 4PQ0A 1EO6A 3ZTCA 3KYCD 2KX3A 4PNKA 5LONB 4BBNC 3TIXA 5CLQB 3QCAA 2XEWA 3H9DA 2KFKB 2QHOA 3P2BA 2LVPA 3RT3B 2DKQA 3GZNI 1VBHA 2KMAA 4NY0A 2IY1B 3WAPA 2YVCA 3GYOA 1TZ1A 4DHZB 1DDMA 2O2VB 4EEWA 2NVUI 4WJQA 3ODOA 4LJPB 5FR6A 2GOWA 2KDIA 2UVMA 2COCA 4G11A 5E6PA 3ZNZB 2BKRB 4TYZA 2DAJA 4DHJD 3RZFA 3DXEA 3L17A 3ECIA 3ZDMC 2N0YA 4Z2MB 1NTYA 2N7EA 1DROA 3QA8A 4FBJB 2YS1A 4HHVA 1BT0A 2DZJA 4GN1A 4YONA 1E5WA 3JSVB 2MRPA 4ILHA 2K8BA 2BWFA 3VUYA 1G6JA 3CIKA 3KZ1A 3DVNV 2NMBA 4IM2A 4NAWA 2ASQA 2R82A 3TBLD 1A5RA 1MG8A 2FJLA 3W1SA 4E3CA 2AEHA 2KUPA 1FHWA 4ZYNA 4A5KA 1Q5WB 1OGWA 2LWPA 4AJWA 3QC8B 2N23A 2GBMA 4FHJA 3PS6A 1V81A 2CHZA 4DK5A 1KBLA 2YT1A 1MK7B 1J0GA 5J3YA 1WR1A 3RD2A 3ZDTA 4A3PA 4TKNA 2GBNA 3NZUA 4MSQB 1FB8A 2DZMA 2HRJA 4KSLC 2FNJB 1WXMA 3LJ3A 4FLHA 1B55A 1K8RB 3A9JB 2XK5B 3A8PA 4CHKA 2Z0EB 1WXVA 1VCBA 4NJ6A 1GGOA 2DYOA 1OMWA 1AQCA 4KV2A 3A1QA 3DVGX 4W9EA 4MGIE 2KC1A 3O65B 4F7HA 3L08A 1S3SG 3VVWB 1U5GA 1KZGA 1Q1OA 1FHOA 4KVGB 2JZ3B 1WIAA 4KIKA 2M17A 2PEAA 4BKSA 3SDLC 5KQ1A 4JQWC 2LZ6A 3WIMA 2RVBB 1S1QB 3KRXA 2JUOA 2H7EA 3QARA 2LGYA 3ALBA 4K2OA 3VDZA 2KHWB 2DA0A 3EHVA 2DX1A 3I3TB 4MT7A 1WM3A 2REXA 3APCA 3D8DA 2D2QA 4KZ0A 2D3GA 2W2XD 2MSED 3PRZA 1LM8B 3V60A 3M95A 2IO2B 3DBHI 2MDXA 4JL9A 1J19A 3L0WB 4TQ0A 3HHMA 3A98B 4HCNB 2ZCBA 1GC6A 1I2HA 4FN2A 5CX3A 3VTUA 3NOBA 5JVLA 1WJNA 2RSGA 2KTFA 2D07B 2NBVB 2LRWA 4HB4B 3QHTA 2KFJA 4JK7A 3OAWA 3ZVRA 2MP2A 4A20A 1WH3A 5C1ZA 2NS5A 4ICUA 2CQUA 3ZIMA 3R7RA 4PS8A 3AU5A 2KX0A 1FGYA 1WM2A 2L76A 2LXCA 4ANVA 5JHHA 3R3MA 4ILJA 1P1AA 2B3AA 5D2MB 4GXBA 1WE6A 4BKTA 2K00A 4MK0A 2L7RA 1WFYA 1SIFA 1GG3A 4MM3A 4OVUA 1PFJA 2LASA 3L16A 5LXHA 3A9KB 3ODWA 3IFWB 4BOSC 4JKGB 3FEHA 3X23A 2Z0OA 2LVQA 2H7DA 5JH5C 3ZRCA 3FM8C 2IZVB 2L0TA 3ZTDA 3VUXA 1UGMA 5DCNA 3ZUNA 1Q67A 1WYWB 4ANUA 1EVHA 1YD8U 3UZTA 2XBBC 3DBRI 3B08A 4ZRKA 2GCJA 2UWQA 2K1FA 1WJMA 1K5DB 2NR2A 2Y8FA 5JZEB 2D4QA 4JKAA 1WI1A 1KM7A 3QWMA 1E8ZA 2BYVE 1F9JA 3ZNHB 1HBKA 1WGGA 5DH9B 1V5OA 2IBIB 2YRYA 2C9WB 4I6NB 4C0AA 1WGQA 4IW0A 5HE2A 1ZVRA 4EKUA 2MWNB 2MBEA 1WJ6A 1YJ1A 4A6FB 1H4RA 2DHJA 3TO1A 4IWPA 4FULA 4EOYA 4AWJA 1UNQA 2M8SA 1PQSA 4HAZB 3V61A 4JKDA 4NQLB 4MJSA 1UPRA 2ZNVC 2MKRA 2HTHB 1ST7A 4IUMB 2BCJA 5E6NA 4MH0E 2LGXA 4DWFA 3O96A 5G55A 2LJ5A 5DPWA 1YQBA 1DIKA 2YSZA 2AL6A 2JWZA 1UPQA 4E74A 2CU1A 2KWCA 5KCVA 2K8HA 1MIZB 5IA7A 5CHVC 4DHJB 2KNBA 2WX0A 4W9KA 2FIDA 4W9CA 4HAUB 2MQJA 1WGRA 5D6JB 2KMCA 1DDVA 1WR6E 4HK2A 4LDTB 3KH0A 1WX7A 4BBKA 3PGEA 3RZWC 2Q13A 2L8JA 1WE7A 5LLIA 3TL5A 4IWQA 1LFDA 1WXAA 3AJ4A 5HE1A 2KTRB 2BGFA 2IO0B 3UQBA 4K7SA 1QC6A 1BWNA 4ICVA 2D9XA 3ZKJC 3M63B 4JKFA 4NNJB 4FJYA 1ISNA 2MBHA 3RCPA 1NDDA 2CODA 1NTVA 1WVHA 2M14A 3M1IB 5J3TA 2WYQA 2KDEB 1BTNA 5FI1A 4WAAA 4GB9A 4HATB 4W9IA 3N3KB 2JVCA 5AZHA 3PRMB 2CHWA 2KN5A 3WALA 2OOBB 2YLMA 1RRBA 5D3XA 3C0RB 2DYBA 4WWOA 4BFRA 3L13A 3KY9A 2ABDA 3AXCA 1TTNA 2DZKA 3SYXA 5G2NA 2AWTA 3CF6E 2LULA 1FAOA 2Y7BA 4F7GA 2RQ1A 2RR9A 3PLVA 3T9LA 3DXDA 3JYUA 3SD5A 1MK9B 2NBUA 4MEMA 2NPTA 3BINA 3ML8A 1PLSA 3AU4A 1JRUA 4HAXB 1ZM0A 2VSZA 1E8YA 2MBOA 3VHTC 4NAWB 4TQ1A 2JZZA 2BF8B 2QKMA 2OQBA 1HB8A 2ZEQA 3H6NA 2M38A 2PE6B 5C16A 5CTRC 3FSSA 1J8CA 3APDA 1D3ZA 3JVZX 5L81A 1U2BA 3VAWA 2KFKA 1V2YA 4XZ4A 2N9PC 3PPAA 2I5CA 5JHGA 5J2RA 5E6OA 2ZPNA 5EFXA 4L6EA 2O2VA 1UD7A 4W9HA 1ACAA 2L05A 3PVUA 4KHAA 3ODXA 5C79A 2DX5B 4TUUA 2DTCA 1H8CA 2NCNA 3SBTA 2LGDA 4JKEA 2O6VB 1YIWA 1WG7A 2ROVA 1FGZA 4FHKA 1VBGA 5TR5A 2KKCA 1WI0A 1U5FA 3APFA 4DXAB 2JY6A 3E9PA 2L3ZA 4IM3A 3HQCA 2EMSA 3TW1A 3CMMB 3ENEA 1WZ0A 3QK0A 1L7YA 2Y5BB 3D32A 3WA0A 3RYTA 2RLOA 4KDLB 1WMHB 5JLJB 2YS3A 3W1YA 1UEFA 2G4SA 4B95A 1U5EA 4HB2B 3QX1A 1RAXA 3PP2A 4ZDVA 2V3SA 4GGQA 1DBHA 1Z87A 3ULBA 4YL8A 1RLFA 5L83A 2ZPYA 4E71A 4OVVA 4Y94A 4GDLB 2UZRA 2MA9B 3FLVA 4KSKC 3TJPA 2I5FA 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  2LYD A;  4NSW A;  1UNR A;  2IYB A;  3MDB C;  4HAY B;  3HM3 A;  2Y8G A;  3CXB B;  1XD4 A;  3EEC A;  3F5R A;  2MP2 B;  1V86 A;  2I1J A;  3H7P A;  2K39 A;  3PSE B;  2XK5 A;  2VRR B;  4FJZ A;  1W1D A;  1X05 A;  4K7U A;  4G50 A;  3QWZ B;  5LXI B;  4IAP A;  1E8W A;  4D0N B;  2KDB A;  2L2I A;  4JIO U;  4MEL A;  1HE8 A;  3KW5 B;  4P7I A;  3SNH A;  2LRU A;  2FUH B;  2BKF A;  2DFK A;  2MBQ A;  5KQ4 A;  3KUD B;  3DBS A;  3QIJ A;  2C7H A;  2CAY A;  2L1C A;  1UNP A;  2D9Y A;  3NS8 A;  5HE0 A;  2X18 A;  1SE9 A;  3SU8 X;  2Z0Q A;  1LB1 A;  2BPS A;  3PHX B;  1XCG A;  2IO1 B;  4B6H A;  4BKS D;  2V76 A;  4ANW A;  2LBB A;  2WWZ A;  4GDK A;  3RUL A;  2IYD B;  1SGH A;  4W9D A;  3L10 B;  4F7U P;  1TXD A;  2PZ1 A;  3LJU X;  4ASW C;  1NVL A;  2L00 B;  1U4A A;  2HJ8 A;  2CY4 A;  1E8X A;  3A4R A;  3PEG A;  4HJK A;  2C60 A;  3RUI B;  3T8M A;  3A8Q A;  3H1U A;  3TVV A;  2K8C A;  1YX5 B;  2MFQ A;  3D8F A;  4H8S A;  4A3O A;  2N7D A;  2RNR B;  5GOW B;  4WSF A;  3UGB B;  4PYU A;  1TQZ A;  4DBB A;  3PT2 B;  1XR0 B;  3M3J A;  2DHI A;  5KHO A;  4W9F A;  2KGX B;  1NU2 A;  1E7U A;  1X1M A;  1EGX A;  2J59 M;  1UBI A;  2JRI B;  4NPN A;  2LKO A;  1FOE A;  2LG1 A;  1XQQ A;  2P8V A;  5C6R A;  2D11 A;  1V89 A;  3N7C A;  4CYE A;  2QKL A;  1OEY A;  4GOC A;  3D8E A;  3SUZ A;  5GMV A;  3QJZ A;  1R4N I;  3KVF B;  3A9K A;  1E7V A;  2GBK A;  4F1S A;  1V5M A;  2KD0 A;  3WAN A;  2LUE A;  5C5B B;  3NZS A;  2NBW B;  4W9J A;  1W1H A;  1OEY J;  5FI0 A;  1V5U A;  4WWN A;  1KOT A;  1IP9 A;  2LXA A;  2G3Q B;  2J7Q B;  1IPG A;  2DZI A;  2K6Q A;  3QQ8 B;  4KDI C;  4FA6 A;  1WXS A;  5JHA A;  1XD3 B;  5C23 A;  2LOX A;  4AP4 C;  2KLC A;  4WQO B;  3V62 A;  1EF1 A;  1V88 A;  2CS4 A;  3AUL A;  3V6E B;  3SV1 A;  4GMX B;  4PYZ A;  2GS0 A;  1WJU A;  4B9K A;  3MTN B;  3ONS A;  4B6W A;  4I6P A;  3V5W A;  3WAO A;  2E2X A;  2ROZ B;  4KAX B;  3B1L X;  4HPM B;  1WJ4 A;  4WJN A;  3QAQ A;  2N9X A;  2LOZ A;  1ZW7 A;  2R0D A;  3UF8 A;  1DYN A;  1KI1 B;  4F8C B;  1GC7 A;  3WYF B;  4FAD A;  4WWP A;  2D9Z A;  1NI2 A;  2P0F A;  2ZZP B;  4X57 B;  3EPY A;  2ELB A;  1C3T A;  1P9D U;  1Z2M A;  4K2P A;  2R2O A;  1NBF C;  2HTH A;  2ZVO A;  2G45 B;  2DHZ A;  2KO3 A;  3H7S A;  4HDQ A;  3VH3 B;  3U30 A;  2K2J A;  5HKH A;  1OY2 A;  1QZE A;  2D9W A;  1WGY A;  3F0W A;  1V5T A;  3IHP C;  2FCN A;  1P3R A;  3NHE B;  2MWS B;  1IYF A;  5CLL B;  3PRP B;  1WF9 A;  1EAZ A;  3UIN B;  2MCN B;  3BY4 B;  4BKG A;  4N9F 4;  5AZG A;  2MLB A;  5JHB A;  4KHB B;  2FCQ A;  2UZS A;  4HCP B;  1FXT B;  3EC8 A;  5EDS A;  1WY8 A;  4HVB A;  2ZCC A;  2DYM A;  1UEL A;  1M94 A;  1E90 A;  2KTR A;  5IJM A;  5DHF B;  3UIP B;  2EKE C;  2GCL A;  3PTF C;  4PS7 A;  3SHQ A;  3KYD D;  2D9V A;  4MDK E;  2W2X C;  3QBV B;  1J0W A;  3IVF A;  2PPH A;  3KSY A;  1LW3 A;  4JGH B;  2R09 A;  1U29 A;  2DLW A;  1MIX A;  2VRW B;  3IG3 A;  2MBB B;  2I1K A;  3ZO5 B;  4KHO A;  3MHS D;  5D27 A;  2FCM A;  3X0W A;  2KJ6 A;  3OJ4 B;  2OTX A;  2DYN A;  2COF A;  3M62 B;  4I6L B;  4MY6 A;  4II2 B;  3ZW3 A;  4EUT A;  4W9L A;  1CMX B;  1I42 A;  2RGF A;  2CB8 A;  1P6S A;  2R2Q A;  3DPD A;  3VOQ A;  2KOX A;  4A6K A;  2V1Y A;  4II3 B;  3R66 C;  2J0J A;  4LDT D;  5CHF A;  1I35 A;  2CY5 A;  4HPL B;  2PJH A;  4RM8 A;  1WGH A;  1WX9 A;  5D94 A;  4TV3 A;  4EMO A;  4HDO A;  2LD9 A;  2JP2 A;  4K1R B;  2M1M A;  4AJY B;  1GNU A;  4PS3 A;  3A1Q B;  4FJV B;  2YF0 A;  1GUA B;  4EZJ A;  4GMV A;  1KJT A;  4BBN F;  4HB0 B;  2BYE A;  3IBE A;  4GIV A;  1ZSQ A;  2G35 A;  4DX9 0;  3Q3J A;  4AUQ C;  2KLG A;  4CHM A;  4KIK B;  2DEN B;  4NJ7 A;  2CR5 A;  3NSU A;  5J17 A;  3MJW A;  1WZ3 A;  2Z0P A;  5L95 C;  2EMT A;  2KQ7 A;  3L54 A;  1EUV B;  3JSV A;  1RJ2 A;  2PE9 A;  4GU2 A;  1ZKH A;  1WRD B;  2A5U A;  4MGK E;  1M7E A;  3DCG A;  1Z5S B;  2FDQ A;  2ADZ A;  2NZ8 B;  4DHZ E;  2C7N B;  3H7P B;  2C7M B;  3TCA A;  2RUK B;  2YS5 A;  3PV1 A;  5DI9 B;  2DX5 A;  2BWE S;  2EC1 A;  1UZX B;  1V6E A;  2Z59 B;  2JPH A;  2JXX A;  3TFM A;  1XOD A;  1MPH A;  2O6V A;  5DIF B;  2LI5 A;  3DOW A;  4GSW A;  3HK0 A;  5DHA B;  2DKP A;  2WX1 A;  2VKI A;  1P0R A;  2K6D B;  4WJO A;  4LJO B;  3CST A;  3AI5 A;  4G3X B;  1V9J A;  2M0X A;  3KRW A;  2GBR A;  2EJ8 A;  5BO4 B;  2KXJ A;  3HM6 X;  3WAM A;  1ZC3 B;  1WMH A;  2RGN B;  4XC2 A;  3A9J A;  2MW5 A;  5AZF A;  4EZK A;  1P98 A;  3Q3F A;  3VFK A;  2D10 A;  2KJH B;  4ZRJ A;  2J0M A;  4GDK B;  2GBJ A;  1P5T A;  3ZVV A;  2N9E B;  2UYZ B;  2XQN M;  1VD2 A;  4HWI B;  1W1G A;  2RSU A;  5J18 A;  4GDL A;  2KWU B;  3PSC A;  4W9G A;  2HD5 B;  2V4L A;  1NTI A;  3ULC A;  1X86 A;  5D3W A;  4IWO A;  1EF5 A;  1IRS A;  2AYO B;  4MGZ E;  3U7D A;  4DDG D;  3DXC A;  3NY5 A;  5J3Q A;  3T06 A;  3OJ3 A;  4DDI D;  2W9N A;  3ZNG C;  4LCD E;  3UIO B;  3P7Z A;  2JRH A;  1LQB A;  2O6V D;  2KJR A;  2C5L C;  3VTV A;  2BYF A;  1X1F A;  2N4F A;  3B0A A;  1V5P A;  1UH6 A;  2HE7 A;  2ELA A;  1R4M I;  1ZC4 B;  3VQI A;  3N32 A;  2IO3 B;  2N1W A;  2FAZ A;  2DAF A;  1WX8 A;  2M4N A;  2KZR A;  4HXD A;  2KDF B;  1XT9 B;  3U8Z A;  3ML9 A;  1T0Y A;  2ZVN A;  3PHW B;  1SHC A;  1KZ7 A;  2J0K A;  3K9O B;  4EJN A;  2P0D A;  1TGZ B;  2KQS A;  4G0N B;  4J6I A;  2LVO A;  4WJ7 A;  1WGD A;  3DQV A;  1QQG A;  2GJY A;  1AWE A;  1MAI A;  5D3Y A;  4M8N A;  3FP5 A;  4HAW B;  4MGY E;  3G9W A;  2Z0D B;  4NQK E;  1Y19 B;  4IOY X;  2AL3 A;  1PMS A;  3PZD A;  1RRP B;  2OJR A;  4XWX A;  4MSM B;  4CHJ A;  3PG7 A;  1Y5O A;  1TJ6 A;  1KLV A;  1H10 A;  4RMA A;  1I7A A;  3CSF A;  2CHX A;  3KUZ A;  1WGU A;  3HW2 B;  4BOZ B;  1DDW A;  3VUW A;  2DHK A;  1V80 A;  1OQN A;  3JW0 X;  1XKE A;  3MPX A;  4MJS B;  4IM0 A;  2COP A;  2WH5 A;  2DYQ A;  4K81 A;  2WDT B;  4EFO A;  4BVU C;  5HE3 A;  3KUC B;  4HLE A;  2K2U A;  3SO6 A;  1MKE A;  2IY0 B;  1K5G B;  5CHW A;  3DDC B;  3DVN U;  1C1Y B;  4HB3 B;  4IC7 B;  1LXD A;  1YX6 B;  3VIA A;  5DPT A;  2KK8 A;  4ZRI A;  4EZL A;  4GZU A;  1U5D A;  2KCJ A;  1M7R A;  1HB6 A;  5AEK B;  3P6A A;  2FIF A;  4JLC A;  5D3V A;  3EFU A;  1GJZ A;  2FJ9 A;  1OTR B;  3PVL A;  5JP4 A;  1N3H A;  4WVF B;  4RM9 A;  3HIZ A;  4WJP A;  1Q0W B;  3LDZ E;  2JT4 B;  1U27 A;  2MX2 A;  3K9P B;  2ZJD A;  2YT0 A;  4DBG A;  4KZC A;  3RCZ A;  4M8M A;  2JF5 A;  1FHX A;  2DN6 A;  4IFS A;  2W2W A;  4M0W B;  5D7G A;  5IAA C;  3VH4 B;  2KAN A;  2KVR A;  1V61 A;  3PLU A;  3TMP B;  3DBL I;  4ANX A;  3VTW A;  1ZGU B;  4K7W A;  5C5B A;  4A6F A;  3DVG Y;  1P3Q U;  2KWV B;  2P0H A;  3ZLZ A;  4CO7 A;  3UQA A;  4Z2N A;  2GMI C;  5DPS A;  3BJI A;  1BTK A;  3A4S C;  3R7Q A;  1X1G A;  1X11 A;  4AOF A;  2K25 A;  3PRE A;  2RD0 A;  1BAK A;  2ZNV B;  3OAN A;  1AAR A;  5DPR A;  2CKH B;  2N1V A;  4GPT B;  2IFS A;  4A6H A;  1Y8R C;  1OQY A;  1TBE A;  3ML4 A;  2A4Z A;  2KC2 A;  3V6C B;  1XX0 A;  4DX8 A;  1WJ1 A;  3ZNI D;  1L2N A;  3GOE A;  3GYP A;  4K17 A;  4URK A;  4HAV B;  5LOP B;  2NPT B;  3OLM D;  3VXW A;  2G4D B;  1V49 A;  2CRF A;  2FCS A;  3A33 B;  3PVW A;  1UBQ A;  3W1S C;  5KHQ A;  3N30 A;  2L0F A;  3ZRF A;  2COA A;  1RFA A;  2RPQ A;  4XX5 A;  4IG7 B;  4PQ0 A;  1EO6 A;  3ZTC A;  3KYC D;  2KX3 A;  4PNK A;  5LON B;  4BBN C;  3TIX A;  5CLQ B;  3QCA A;  2XEW A;  3H9D A;  2KFK B;  2QHO A;  3P2B A;  2LVP A;  3RT3 B;  2DKQ A;  3GZN I;  2KMA A;  4NY0 A;  2IY1 B;  3WAP A;  2YVC A;  3GYO A;  1TZ1 A;  4DHZ B;  1DDM A;  2O2V B;  4EEW A;  2NVU I;  4WJQ A;  3ODO A;  4LJP B;  5FR6 A;  2GOW A;  2KDI A;  2UVM A;  2COC A;  4G11 A;  5E6P A;  3ZNZ B;  2BKR B;  4TYZ A;  2DAJ A;  4DHJ D;  3RZF A;  3DXE A;  3L17 A;  3ECI A;  3ZDM C;  2N0Y A;  4Z2M B;  1NTY A;  2N7E A;  1DRO A;  3QA8 A;  4FBJ B;  2YS1 A;  4HHV A;  1BT0 A;  2DZJ A;  4GN1 A;  4YON A;  1E5W A;  3JSV B;  2MRP A;  2K8B A;  2BWF A;  3VUY A;  1G6J A;  3CIK A;  3KZ1 A;  3DVN V;  2NMB A;  4IM2 A;  4NAW A;  2ASQ A;  3TBL D;  1A5R A;  1MG8 A;  2FJL A;  3W1S A;  4E3C A;  2AEH A;  2KUP A;  1FHW A;  4ZYN A;  4A5K A;  1Q5W B;  1OGW A;  2LWP A;  4AJW A;  3QC8 B;  2N23 A;  2GBM A;  4FHJ A;  3PS6 A;  1V81 A;  2CHZ A;  4DK5 A;  2YT1 A;  1MK7 B;  1J0G A;  5J3Y A;  1WR1 A;  3RD2 A;  3ZDT A;  4A3P A;  4TKN A;  2GBN A;  3NZU A;  4MSQ B;  1FB8 A;  2DZM A;  2HRJ A;  4KSL C;  2FNJ B;  1WXM A;  3LJ3 A;  4FLH A;  1B55 A;  1K8R B;  3A9J B;  2XK5 B;  3A8P A;  4CHK A;  2Z0E B;  1WXV A;  1VCB A;  4NJ6 A;  2DYO A;  1OMW A;  1AQC A;  4KV2 A;  3A1Q A;  3DVG X;  4W9E A;  4MGI E;  2KC1 A;  3O65 B;  4F7H A;  3L08 A;  1S3S G;  3VVW B;  1U5G A;  1KZG A;  1Q1O A;  1FHO A;  4KVG B;  2JZ3 B;  1WIA A;  4KIK A;  2M17 A;  2PEA A;  4BKS A;  3SDL C;  5KQ1 A;  4JQW C;  2LZ6 A;  3WIM A;  2RVB B;  1S1Q B;  3KRX A;  2JUO A;  2H7E A;  3QAR A;  2LGY A;  3ALB A;  4K2O A;  3VDZ A;  2KHW B;  2DA0 A;  3EHV A;  2DX1 A;  3I3T B;  4MT7 A;  1WM3 A;  2REX A;  3APC A;  3D8D A;  2D2Q A;  4KZ0 A;  2D3G A;  2W2X D;  2MSE D;  3PRZ A;  1LM8 B;  3V60 A;  3M95 A;  2IO2 B;  3DBH I;  2MDX A;  4JL9 A;  1J19 A;  3L0W B;  4TQ0 A;  3HHM A;  3A98 B;  4HCN B;  2ZCB A;  1GC6 A;  1I2H A;  4FN2 A;  5CX3 A;  3VTU A;  3NOB A;  1WJN A;  2RSG A;  2KTF A;  2D07 B;  2NBV B;  2LRW A;  4HB4 B;  3QHT A;  2KFJ A;  3OAW A;  3ZVR A;  2MP2 A;  4A20 A;  1WH3 A;  5C1Z A;  2NS5 A;  4ICU A;  2CQU A;  3ZIM A;  3R7R A;  4PS8 A;  3AU5 A;  2KX0 A;  1FGY A;  1WM2 A;  2L76 A;  2LXC A;  4ANV A;  5JHH A;  3R3M A;  1P1A A;  2B3A A;  5D2M B;  4GXB A;  1WE6 A;  4BKT A;  2K00 A;  4MK0 A;  2L7R A;  1WFY A;  1SIF A;  1GG3 A;  4MM3 A;  4OVU A;  1PFJ A;  2LAS A;  3L16 A;  5LXH A;  3A9K B;  3ODW A;  3IFW B;  4BOS C;  3FEH A;  3X23 A;  2Z0O A;  2LVQ A;  2H7D A;  5JH5 C;  3ZRC A;  3FM8 C;  2IZV B;  2L0T A;  3ZTD A;  3VUX A;  1UGM A;  5DCN A;  3ZUN A;  1Q67 A;  1WYW B;  4ANU A;  1EVH A;  1YD8 U;  3UZT A;  2XBB C;  3DBR I;  3B08 A;  4ZRK A;  2GCJ A;  2UWQ A;  2K1F A;  1WJM A;  1K5D B;  2NR2 A;  2Y8F A;  5JZE B;  2D4Q A;  1WI1 A;  1KM7 A;  3QWM A;  1E8Z A;  2BYV E;  1F9J A;  3ZNH B;  1HBK A;  1WGG A;  5DH9 B;  1V5O A;  2IBI B;  2YRY A;  2C9W B;  4I6N B;  4C0A A;  1WGQ A;  4IW0 A;  5HE2 A;  1ZVR A;  4EKU A;  2MWN B;  2MBE A;  1WJ6 A;  1YJ1 A;  4A6F B;  1H4R A;  2DHJ A;  3TO1 A;  4IWP A;  4FUL A;  4EOY A;  4AWJ A;  1UNQ A;  2M8S A;  1PQS A;  4HAZ B;  3V61 A;  4NQL B;  4MJS A;  1UPR A;  2ZNV C;  2MKR A;  2HTH B;  1ST7 A;  4IUM B;  2BCJ A;  5E6N A;  4MH0 E;  2LGX A;  4DWF A;  3O96 A;  5G55 A;  2LJ5 A;  5DPW A;  1YQB A;  2YSZ A;  2AL6 A;  2JWZ A;  1UPQ A;  4E74 A;  2CU1 A;  2KWC A;  5KCV A;  2K8H A;  1MIZ B;  5IA7 A;  5CHV C;  4DHJ B;  2KNB A;  2WX0 A;  4W9K A;  2FID A;  4W9C A;  4HAU B;  2MQJ A;  1WGR A;  5D6J B;  2KMC A;  1DDV A;  1WR6 E;  4HK2 A;  4LDT B;  3KH0 A;  1WX7 A;  4BBK A;  3PGE A;  3RZW C;  2Q13 A;  2L8J A;  1WE7 A;  5LLI A;  3TL5 A;  4IWQ A;  1LFD A;  1WXA A;  3AJ4 A;  5HE1 A;  2KTR B;  2BGF A;  2IO0 B;  3UQB A;  4K7S A;  1QC6 A;  1BWN A;  4ICV A;  2D9X A;  3ZKJ C;  3M63 B;  4NNJ B;  4FJY A;  1ISN A;  2MBH A;  3RCP A;  1NDD A;  2COD A;  1NTV A;  1WVH A;  2M14 A;  3M1I B;  5J3T A;  2WYQ A;  2KDE B;  1BTN A;  5FI1 A;  4WAA A;  4GB9 A;  4HAT B;  4W9I A;  3N3K B;  2JVC A;  5AZH A;  3PRM B;  2CHW A;  2KN5 A;  3WAL A;  2OOB B;  2YLM A;  1RRB A;  5D3X A;  3C0R B;  2DYB A;  4WWO A;  4BFR A;  3L13 A;  3KY9 A;  2ABD A;  3AXC A;  1TTN A;  2DZK A;  3SYX A;  5G2N A;  2AWT A;  3CF6 E;  2LUL A;  1FAO A;  2Y7B A;  4F7G A;  2RQ1 A;  2RR9 A;  3PLV A;  3T9L A;  3DXD A;  3JYU A;  3SD5 A;  1MK9 B;  2NBU A;  4MEM A;  2NPT A;  3BIN A;  3ML8 A;  1PLS A;  3AU4 A;  1JRU A;  4HAX B;  1ZM0 A;  2VSZ A;  1E8Y A;  2MBO A;  3VHT C;  4NAW B;  4TQ1 A;  2JZZ A;  2BF8 B;  2QKM A;  2OQB A;  1HB8 A;  2ZEQ A;  3H6N A;  2M38 A;  2PE6 B;  5C16 A;  5CTR C;  3FSS A;  1J8C A;  3APD A;  1D3Z A;  3JVZ X;  5L81 A;  1U2B A;  3VAW A;  2KFK A;  1V2Y A;  4XZ4 A;  2N9P C;  3PPA A;  2I5C A;  5JHG A;  5J2R A;  5E6O A;  2ZPN A;  5EFX A;  4L6E A;  2O2V A;  1UD7 A;  4W9H A;  1ACA A;  2L05 A;  3PVU A;  4KHA A;  3ODX A;  5C79 A;  2DX5 B;  4TUU A;  2DTC A;  1H8C A;  2NCN A;  2LGD A;  2O6V B;  1YIW A;  1WG7 A;  2ROV A;  1FGZ A;  4FHK A;  5TR5 A;  2KKC A;  1WI0 A;  1U5F A;  3APF A;  4DXA B;  2JY6 A;  2L3Z A;  4IM3 A;  3HQC A;  2EMS A;  3TW1 A;  3CMM B;  3ENE A;  1WZ0 A;  3QK0 A;  1L7Y A;  2Y5B B;  3D32 A;  3WA0 A;  3RYT A;  2RLO A;  4KDL B;  1WMH B;  5JLJ B;  2YS3 A;  3W1Y A;  1UEF A;  2G4S A;  4B95 A;  1U5E A;  4HB2 B;  3QX1 A;  1RAX A;  3PP2 A;  4ZDV A;  2V3S A;  4GGQ A;  1DBH A;  1Z87 A;  3ULB A;  4YL8 A;  1RLF A;  5L83 A;  2ZPY A;  4E71 A;  4OVV A;  4Y94 A;  4GDL B;  2UZR A;  2MA9 B;  3FLV A;  4KSK C;  3TJP A;  2I5F A;  3S2A A; 
#chains in the Genus database with same CATH topology
 1TY0 A;  4F7Z A;  2LYD A;  4NSW A;  1QOB A;  1UNR A;  2K3U A;  1L0Y B;  2IYB A;  3H8H A;  2FE8 A;  3I63 C;  3MDB C;  4HAY B;  5IN7 A;  3HM3 A;  2Y8G A;  3CXB B;  1XD4 A;  3EEC A;  3DHI C;  3F5R A;  2MP2 B;  4RFB A;  4ZHO A;  3URY A;  3AE3 B;  1V86 A;  2I1J A;  1FRD A;  3H7P A;  2K39 A;  3PSE B;  2XK5 A;  2VRR B;  4FJZ A;  1W1D A;  2AQ2 B;  1X05 A;  2LMC A;  4K7U A;  5I2M A;  4PT5 A;  4G50 A;  3QWZ B;  5LXI B;  1RYJ A;  4IAP A;  1E8W A;  4O1N A;  4D0N B;  1PGB A;  2KDB A;  2L2I A;  4JIO U;  4MEL A;  1HE8 A;  3KW5 B;  4P7I A;  3SNH A;  2LRU A;  2FUH B;  5BYQ A;  4HRO A;  2BKF A;  2DFK A;  2MBQ A;  5KQ4 A;  5G5G A;  3KUD B;  3DBS A;  3QIJ A;  4JKC A;  2C7H A;  1EWY C;  5C2T B;  2RMM A;  2CAY A;  2L1C A;  1UNP A;  2D9Y A;  3NS8 A;  4LNF A;  2QEJ C;  5HE0 A;  1VDV A;  2X18 A;  1ZDV A;  1SE9 A;  3SU8 X;  1SIJ A;  3P4S B;  1C4C A;  1XF5 L;  2Z0Q A;  1LB1 A;  1WWT A;  2BPS A;  3PHX B;  1XCG A;  3BWU D;  4TSS A;  1I4G A;  2IO1 B;  4B6H A;  4XE0 A;  2V76 A;  1AYF A;  4BKS D;  4ANW A;  2LBB A;  2L52 A;  2WXN A;  2WWZ A;  4GDK A;  2PLP A;  2KIE A;  3RUL A;  3DBR B;  2IYD B;  1SGH A;  4W9D A;  3RNA C;  1PFD A;  3L10 B;  4F7U P;  2SAK A;  1TXD A;  2PZ1 A;  3LJU X;  3AEC B;  2ONQ A;  4ASW C;  4Q2J A;  1NVL A;  3GE3 C;  2L00 B;  3E9L A;  3OHM B;  1U4A A;  2HJ8 A;  3EGR A;  2JZP A;  1JDE A;  3VR9 B;  3AED B;  2CY4 A;  1E8X A;  2Q5W D;  4OHJ A;  3A4R A;  3PEG A;  3TEY A;  1V1P A;  4HJK A;  2C60 A;  2WXL A;  5FK9 C;  3RUI B;  3T8M A;  2CJN A;  3A8Q A;  3H1U A;  2J4X A;  5IKC M;  2EKI A;  3TVV A;  2DLB A;  3MJ5 A;  2K8C A;  1MI0 A;  1YX5 B;  3NS1 A;  3Q69 A;  2MFQ A;  3D8F A;  1FPY A;  2BTE A;  2BS3 B;  4H8S A;  3ZXV A;  1ESF A;  4ARI A;  4A3O A;  2N7D A;  2RNR B;  3Q14 C;  5GOW B;  4WSF A;  2OED A;  1SB3 C;  1OFF A;  1MJD A;  3Q8E A;  3UGB B;  1XEE A;  4PYU A;  1TQZ A;  1CK1 A;  4DBB A;  5IP4 D;  1D5M C;  3AM9 A;  3PT2 B;  2MJ3 A;  1XR0 B;  3M3J A;  2DHI A;  5KHO A;  4W9F A;  2KGX B;  1NU2 A;  1YQ4 B;  2QJL A;  3N1X C;  1E7U A;  1TKG A;  1X1M A;  3ENB A;  1EGX A;  2J59 M;  1UBI A;  2JRI B;  2WDQ B;  4NPN A;  2LKO A;  1FOE A;  2LG1 A;  1FMA D;  3DCX A;  1XQQ A;  2P8V A;  5C6R A;  1L6U A;  2D11 A;  1T0R C;  1V89 A;  3N7C A;  1L4Z B;  3P63 A;  4CYE A;  2QKL A;  4L1B A;  1OEY A;  4GOC A;  4IKG A;  3D8E A;  3SUZ A;  5IOI A;  5GMV A;  3QJZ A;  1R4N I;  3KVF B;  3A9K A;  1E7V A;  2GBK A;  4F1S A;  1V5M A;  2KD0 A;  3WAN A;  1ZYI A;  2LUE A;  4MH8 A;  4JKG A;  5C5B B;  3NZS A;  1IBX B;  2NBW B;  4W9J A;  1W1H A;  1OEY J;  5FI0 A;  1MFW A;  1V5U A;  4WWN A;  1KOT A;  4OZA A;  1ZXI A;  1IP9 A;  1EM7 A;  2LXA A;  2FBW B;  2G3Q B;  2J7Q B;  1IPG A;  2RRF A;  2DZI A;  2K6Q A;  3NVW A;  3U52 E;  3QQ8 B;  4YXD B;  4KDI C;  4FA6 A;  1WXS A;  2LFI A;  4MT5 A;  5I2S A;  5JHA A;  1XD3 B;  5C23 A;  3MC0 B;  1DOX A;  1YJI A;  4XDC A;  2V9H A;  4YSZ B;  2LOX A;  4AP4 C;  3NVY A;  2KLC A;  4WQO B;  3V62 A;  1EF1 A;  5C3J B;  1V88 A;  2CS4 A;  3AUL A;  2AQ3 B;  3V6E B;  2VH1 A;  3U2S C;  3SV1 A;  4GMX B;  4PYZ A;  1L6V A;  2ON8 A;  3Q3M C;  1YMH E;  2GS0 A;  1WJU A;  4JK8 A;  4B9K A;  3MTN B;  2D5G A;  3ONS A;  2G9H D;  4B6W A;  1QF6 A;  2M56 B;  2QIE B;  4I6P A;  2OHF A;  2M0A A;  3V5W A;  3WAO A;  2W82 A;  4BZA A;  2E2X A;  2ROZ B;  4KAX B;  3B1L X;  2VZK D;  4HPM B;  1WJ4 A;  4WJN A;  3QAQ A;  2N9X A;  2LOZ A;  2WDV B;  1ZW7 A;  2R0D A;  3UF8 A;  1DYN A;  1KI1 B;  2MJE A;  1SF0 A;  4HJG E;  4F8C B;  1GC7 A;  3WYF B;  2KAJ A;  4FAD A;  4WWP A;  2D9Z A;  1NI2 A;  2AQ1 B;  4C7Z A;  2P0F A;  2V3N A;  1V1O A;  2FJU B;  2ZZP B;  4X57 B;  3EPY A;  3AV8 A;  3RPF C;  2HJ1 A;  2ELB A;  2BW2 A;  4WQM A;  1FXI A;  4QXA B;  1NYQ A;  1P9D U;  1TKE A;  1C3T A;  1Z2M A;  4K2P A;  2R2O A;  1NBF C;  1PGX A;  1ZDX A;  2HTH A;  2ZVO A;  3AE7 B;  2KR0 A;  2G45 B;  2DHZ A;  2KO3 A;  2K5P A;  3H7S A;  4M0W A;  4HDQ A;  3VH3 B;  3BII D;  3U30 A;  2K2J A;  5HKH A;  1OY2 A;  3RN9 C;  2BT6 A;  1QZE A;  4HEA 1;  2D9W A;  4USA A;  2K8E A;  3ZXR A;  1WGY A;  3F0W A;  1XLN A;  1K53 A;  1C79 A;  1V5T A;  3IHP C;  2FCN A;  1P3R A;  2N7J A;  3NHE B;  5IO9 A;  2MWS B;  1IYF A;  5CLL B;  3PRP B;  1WF9 A;  1EAZ A;  2XNA C;  3UIN B;  4QJ5 B;  2MCN B;  3BY4 B;  4BKG A;  4QJ4 B;  3MHZ A;  2WXO A;  4N9F 4;  5AZG A;  2MLB A;  5JHB A;  3BVG A;  1MG4 A;  3AEF B;  3E66 A;  4KHB B;  2FCQ A;  2UZS A;  4OW0 A;  4HCP B;  3Q6B A;  1FXT B;  3EC8 A;  5EDS A;  1WY8 A;  1I4H A;  4HVB A;  4RNA A;  1QT9 A;  2ZCC A;  3C19 A;  2DYM A;  1UEL A;  1M94 A;  3R8B A;  1E90 A;  2KTR A;  5IJM A;  5DHF B;  3UIP B;  4K3B A;  2EKE C;  2GCL A;  1VJK A;  3PTF C;  1L0V B;  4C7Y A;  4PS7 A;  3SHQ A;  3KYD D;  2GI9 A;  2D9V A;  4MDK E;  2W2X C;  1KTK A;  3QBV B;  1JW9 D;  2WP9 B;  4N59 A;  1J0W A;  3IVF A;  2PPH A;  3HVD A;  3KSY A;  5EE1 A;  1LW3 A;  4JGH B;  4JK9 A;  2R09 A;  2INC C;  1U29 A;  2DLW A;  1MIX A;  3HSA A;  2PKO A;  4HPP A;  3AE4 B;  5FKA C;  2VRW B;  4XWW A;  3IG3 A;  1V97 A;  4S17 A;  2MBB B;  3TSS A;  4P6V F;  3AEA B;  2I1K A;  3AEG B;  4CSQ A;  3ZO5 B;  4KHO A;  3MHS D;  3I5J C;  1CJE A;  5D27 A;  2FCM A;  2KIG A;  3X0W A;  1SE4 A;  2KJ6 A;  3OJ4 B;  2GUM A;  4N6E B;  2OTX A;  2DYN A;  2COF A;  3M62 B;  4I6L B;  4MY6 A;  4II2 B;  1ZPS A;  3ZW3 A;  4EUT A;  3BK2 A;  4JWU C;  4W9L A;  1CMX B;  1I42 A;  3ZJU A;  3MP9 A;  3FC4 A;  2RGF A;  2CB8 A;  1P6S A;  2R2Q A;  3KLS X;  3DPD A;  4M00 A;  3VOQ A;  2KOX A;  4C4V B;  4A6K A;  1SE3 A;  4C00 A;  2V1Y A;  4II3 B;  3R66 C;  4LTU A;  2J0J A;  4LDT D;  5CHF A;  4K3C A;  1I35 A;  3SFD B;  2WU5 B;  1FCL A;  2CY5 A;  1XLO A;  1R7S A;  4HPL B;  2HTM E;  2PJH A;  3EFC A;  1DOY A;  4RM8 A;  1WGH A;  2SEB D;  1WX9 A;  5D94 A;  4TV3 A;  2XN9 C;  4EMO A;  4HDO A;  2LD9 A;  2JP2 A;  4K1R B;  2M1M A;  3N1Z C;  4AJY B;  2V0G A;  1GNU A;  4PS3 A;  3A1Q B;  4FJV B;  2YF0 A;  1GUA B;  2L1A A;  4EZJ A;  4GMV A;  2KYW A;  1NYR A;  1KJT A;  1OQQ A;  4BBN F;  1YQ3 B;  4HB0 B;  2BYE A;  4NJC A;  3IBE A;  2I38 A;  4GIV A;  1ZSQ A;  2WXQ A;  2G35 A;  4A55 A;  2V3P A;  4WWM A;  3TEZ A;  3B9J A;  3RMK C;  4DX9 0;  3Q3J A;  4AUQ C;  2KLG A;  1SEB D;  4CHM A;  4ILG B;  4KIK B;  2DEN B;  1F77 A;  4NJ7 A;  2CR5 A;  3NSU A;  5J17 A;  3MJW A;  3FAH A;  1WZ3 A;  2Z0P A;  5L95 C;  2EMT A;  1ENF A;  2KQ7 A;  2R2Y A;  2WDR B;  3L54 A;  1EUV B;  3JSV A;  1RJ2 A;  2PE9 A;  2W55 A;  2IND C;  4GU2 A;  1ZKH A;  1WRD B;  2A5U A;  4MGK E;  1M7E A;  1A70 A;  3DCG A;  1Z5S B;  2FDQ A;  2ADZ A;  2NZ8 B;  4DHZ E;  2WS3 B;  4EE2 A;  1YN4 A;  1D6E C;  3NWD A;  2C7N B;  3H7P B;  5FR3 A;  1FNU A;  2C7M B;  3GS2 A;  2D3A A;  3TCA A;  2RUK B;  2YS5 A;  3PV1 A;  5DI9 B;  2K22 A;  4WAF A;  2DX5 A;  2BWE S;  2EC1 A;  2WQY B;  3BYT B;  3UI3 A;  1UZX B;  1V6E A;  2Z59 B;  2JPH A;  2JXX A;  4IDI A;  3TFM A;  1XOD A;  2IGH A;  1MPH A;  2O6V A;  5DIF B;  1NEN B;  2LI5 A;  3DOW A;  4GSW A;  3PO0 A;  3HK0 A;  2X8X X;  5DHA B;  1MHH E;  2DKP A;  1FRR A;  1D4B A;  2WX1 A;  1SXT A;  3ABV B;  2VKI A;  1P0R A;  2K6D B;  4WJO A;  4OSN A;  3KWL A;  1CQV A;  4LJO B;  3CST A;  3AI5 A;  4G3X B;  2ZKM X;  3MC8 A;  1V9J A;  1M4V A;  2WXR A;  2W3R A;  2M0X A;  3KRW A;  2GBR A;  2EJ8 A;  5BO4 B;  2KXJ A;  1YOV B;  1JRP A;  3HM6 X;  3WAM A;  1ZC3 B;  1WMH A;  2RGN B;  2KWD A;  4XC2 A;  3A9J A;  1HXY D;  1DOI A;  2VH2 A;  4WUR A;  2MW5 A;  5AZF A;  4EZK A;  1IGC A;  1P98 A;  3Q3F A;  3VFK A;  2D10 A;  4YTP B;  2KJH B;  2HDE A;  4ZRJ A;  2J0M A;  4GDK B;  3AE6 B;  2GBJ A;  1P5T A;  3ZVV A;  2N9E B;  2UYZ B;  2XQN M;  1VD2 A;  2QSD A;  4HWI B;  2BB6 A;  1W1G A;  1VR9 A;  2RSU A;  5J18 A;  3LXF A;  4GDL A;  2KWU B;  2MJD A;  3PSC A;  4W9G A;  4ITK A;  2HD5 B;  2V4L A;  1NTI A;  3ULC A;  4UDU C;  2LEK A;  1X86 A;  4RGO S;  5D3W A;  4IWO A;  1EF5 A;  2I2Y A;  1IRS A;  2AYO B;  5AUI A;  4MGZ E;  4MM3 B;  3FIL B;  3U7D A;  3HVZ A;  4DDG D;  3DXC A;  4JKH A;  2B76 B;  3NY5 A;  2PVG C;  5J3Q A;  3T06 A;  1FNW A;  3OJ3 A;  4DDI D;  2W9N A;  3ZNG C;  3GB1 A;  4LCD E;  1TS4 A;  4ACF A;  2KT7 A;  3UIO B;  3P7Z A;  1RWS A;  2LHD A;  2JRH A;  1IUE A;  1LQB A;  2O6V D;  3P4P B;  2KJR A;  2C5L C;  3VTV A;  3GE8 C;  5BMH A;  4WH4 A;  1F2R C;  1KLG D;  2BYF A;  3SFE B;  2L83 A;  1UUP A;  1X1F A;  2N4F A;  1E9M A;  3B0A A;  1V5P A;  1SJE D;  1UH6 A;  2HE7 A;  1JWS D;  2WXH A;  2ELA A;  1R4M I;  1QOF A;  1ZC4 B;  3VQI A;  3N32 A;  2IO3 B;  3WCQ A;  2N1W A;  2FAZ A;  2DAF A;  1T6B X;  1WX8 A;  2M4N A;  2KZR A;  3E9O A;  2G1E A;  2WXM A;  4HXD A;  1YN3 A;  1ZP0 B;  2KDF B;  4HKQ A;  1XT9 B;  3U8Z A;  3ML9 A;  3NRZ A;  1T0Y A;  1MVK A;  2ZVN A;  3PHW B;  1SHC A;  1KZ7 A;  2J0K A;  3K9O B;  4EJN A;  4KGT A;  2P0D A;  2JSV X;  1TGZ B;  2K0P A;  2KQS A;  1SBB B;  1VZ6 A;  4G0N B;  4J6I A;  2JYT A;  2LVO A;  2NBV A;  4WJ7 A;  1WGD A;  4YWG G;  3DQV A;  1QQG A;  2RDB C;  4A90 A;  2GJY A;  2K49 A;  1AWE A;  1MAI A;  5D3Y A;  5BMI A;  4M8N A;  3FP5 A;  4HAW B;  4MGY E;  2MHJ A;  3G9W A;  3SBG A;  2Z0D B;  3NG0 A;  4NQK E;  1ACC A;  1Y19 B;  3ZJV A;  3RNG C;  4IOY X;  2AL3 A;  4RF0 A;  1PMS A;  3PZD A;  1RRP B;  2OJR A;  4JX1 C;  4XWX A;  4MSM B;  4CHJ A;  4RCO A;  3PG7 A;  1PUT A;  1KF6 B;  3W9C B;  1Y5O A;  3EUB 2;  1TJ6 A;  2X0S A;  1KLV A;  1H10 A;  1I7H A;  4RMA A;  3AB5 A;  1I7A A;  3CSF A;  1C76 A;  2CHX A;  3KUZ A;  1WGU A;  3HW2 B;  4BOZ B;  1DDW A;  3VUW A;  2DHK A;  1TZO A;  1V80 A;  1WYG A;  1OQN A;  1KC7 A;  3JW0 X;  1XKE A;  2LGI A;  2WXF A;  3MPX A;  4MJS B;  4IM0 A;  2COP A;  2WH5 A;  2DYQ A;  2H89 B;  4RGT A;  4K81 A;  1E0Z A;  2WDT B;  3CIR B;  4EFO A;  1FXA A;  4WIP A;  4BVU C;  5HE3 A;  3KUC B;  4HLE A;  1KLU D;  2K2U A;  3SO6 A;  1J7B A;  1MKE A;  2JYE A;  2IY0 B;  2Z8L A;  1K5G B;  5CHW A;  3DDC B;  3DVN U;  1P7F A;  1C1Y B;  4HB3 B;  4IC7 B;  1TJE A;  1LXD A;  1YX6 B;  3VIA A;  5DPT A;  2KK8 A;  1TS2 A;  4ZRI A;  1JWB D;  4EZL A;  2WXJ A;  4GZU A;  4JKB A;  1U5D A;  1UWX A;  2KCJ A;  1M7R A;  1HB6 A;  5AEK B;  3P6A A;  2FIF A;  3RFZ B;  4JLC A;  5D3V A;  3EFU A;  1GJZ A;  1ROE A;  2FJ9 A;  2DIK A;  1MPE A;  1NI3 A;  3AEB B;  1FFV A;  1K52 A;  1OTR B;  4BAX A;  3PVL A;  1FCC C;  5JP4 A;  1N3H A;  4WVF B;  4RM9 A;  3HIZ A;  4WJP A;  1Q0W B;  3LDZ E;  1B9R A;  3TEX A;  4US8 A;  2JT4 B;  4XDD A;  1U27 A;  2MX2 A;  3K9P B;  2ZJD A;  2YT0 A;  4DBG A;  4KZC A;  3RCZ A;  5D3D A;  4M8M A;  3NZ3 A;  3AEE B;  4HSI A;  2JF5 A;  1FHX A;  2DN6 A;  4IFS A;  3AE2 B;  3BVM A;  2W2W A;  4M0W B;  5D7G A;  5IAA C;  3VH4 B;  2KAN A;  2KVR A;  1V61 A;  4RGN A;  1BML C;  3PLU A;  3TMP B;  3DBL I;  4ANX A;  3VTW A;  4OZB A;  1ZGU B;  2QMT A;  4K7W A;  4P1C C;  5C5B A;  1ET6 A;  4NAM A;  4A6F A;  3DVG Y;  5HHD G;  1P3Q U;  2INN E;  1IBX A;  1UNS A;  1VZ7 A;  2KWV B;  2P0H A;  2PMV A;  3DHH C;  4DXF A;  3ZLZ A;  4CO7 A;  1JRO A;  3UQA A;  4LLG M;  4Z2N A;  2GMI C;  5DPS A;  3BJI A;  3N20 C;  1ET9 A;  3ETR A;  1BTK A;  3P1M A;  3Q2A C;  3A4S C;  3R7Q A;  1X1G A;  3AE1 B;  2BVC A;  1X11 A;  4J3O D;  1TKY A;  3NW8 A;  3LB8 C;  4AOF A;  2K25 A;  2RD0 A;  3PRE A;  1BAK A;  2ZNV B;  3OAN A;  1AAR A;  5DPR A;  2CKH B;  2N1V A;  4GPT B;  2IFS A;  1CZP A;  4A6H A;  1Y8R C;  1OQY A;  1TBE A;  3ML4 A;  2A4Z A;  2KC2 A;  4JWS C;  1TT5 B;  3V6C B;  2OJW A;  1XX0 A;  4DX8 A;  2WXG A;  1HA5 A;  1WJ1 A;  3ZNI D;  1L2N A;  4YSX B;  1T77 A;  3GOE A;  3GYP A;  4GNK B;  4K17 A;  4HAV B;  5LOP B;  2ICI A;  4URK A;  2NPT B;  3OLM D;  3VXW A;  2G4D B;  4KX6 B;  3A58 A;  3ZQ4 A;  2X38 A;  1V49 A;  2CRF A;  4KGR A;  2QDF A;  2FCS A;  4YTM B;  2J52 A;  3A33 B;  3PVW A;  1UBQ A;  2Z14 A;  2GLS A;  3W1S C;  5KHQ A;  5EE3 A;  4R3D A;  3N30 A;  1MHX A;  3NUH B;  2L0F A;  3ZRF A;  5MPO A;  4NZL B;  2COA A;  5T8I A;  1RFA A;  2RPQ A;  4XX5 A;  4IG7 B;  1AW7 A;  4PQ0 A;  4D2K A;  4CQN A;  1EO6 A;  3ZTC A;  3KYC D;  2KX3 A;  4PNK A;  5LON B;  4BBN C;  3TIX A;  5CLQ B;  3QCA A;  2XEW A;  3H9D A;  2KFK B;  1TIF A;  1YN5 A;  2JU6 X;  2QHO A;  3L4P A;  3P2B A;  2LVP A;  3BZD B;  3RT3 B;  2DKQ A;  2Z4D A;  3GZN I;  1VBH A;  2KMA A;  2K9X A;  4NY0 A;  2QC8 A;  1N60 A;  2IY1 B;  4LNI A;  3WAP A;  2YVC A;  3GYO A;  1TZ1 A;  4DHZ B;  1DDM A;  1QOG A;  2O2V B;  4EEW A;  2NVU I;  1GB1 A;  2UU7 A;  4WJQ A;  3ODO A;  1BXT A;  4LJP B;  5FR6 A;  2GOW A;  2KDI A;  2D3C A;  3ZJT A;  5TSS A;  2UVM A;  3C8Y A;  4KHB A;  2COC A;  4G11 A;  5E6P A;  3ZNZ B;  2BKR B;  2WHI A;  3RI7 C;  2KUQ A;  4TYZ A;  3DHG C;  2DAJ A;  4DHJ D;  3Q8C A;  3RZF A;  2RPV A;  3DXE A;  3L17 A;  3MC9 A;  3ECI A;  3BK1 A;  3ZDM C;  2WGS A;  2QIL A;  1NVI D;  2N0Y A;  4Z2M B;  1NTY A;  1F1H A;  3RNB C;  5HFY A;  2N7E A;  1DRO A;  1XCT L;  3QA8 A;  4FBJ B;  3E56 A;  2YS1 A;  4HHV A;  2DBY A;  1BT0 A;  2DZJ A;  4GN1 A;  1D5X C;  1T0Q C;  4YON A;  1E5W A;  2JWU A;  3JSV B;  2KVZ A;  2MRP A;  4ILH A;  1J7A A;  1JCK B;  2K8B A;  2BWF A;  3VUY A;  2R61 A;  2ACZ B;  1G6J A;  4DIX A;  3CIK A;  3KZ1 A;  3DVN V;  2NMB A;  1HTO A;  3IT4 B;  1GAQ B;  4IM2 A;  4NAW A;  1N6Z A;  3V05 A;  2N9K A;  1KRH A;  2ASQ A;  2R82 A;  3TBL D;  4QJ3 B;  3SR6 A;  1A5R A;  1MG8 A;  2WLB A;  3T3O A;  2FJL A;  4P16 A;  5HG2 A;  3W1S A;  4E3C A;  2AEH A;  2KUP A;  1FHW A;  4ZYN A;  4A5K A;  1Q5W B;  1OGW A;  2LWP A;  4AJW A;  3QC8 B;  3TEW A;  3R2T A;  2N23 A;  2DNF A;  2GBM A;  4FHJ A;  3PS6 A;  1V81 A;  2CHZ A;  4DK5 A;  1I4X A;  1KBL A;  2YT1 A;  2IDY A;  1DYQ A;  1MK7 B;  1J0G A;  3Q3N C;  5J3Y A;  1WR1 A;  3U7Z A;  3AN1 A;  3RD2 A;  3ZDT A;  2YEP F;  1C9F A;  4A3P A;  3DWG C;  4TKN A;  2GBN A;  3NZU A;  4MSQ B;  3W5U B;  1FB8 A;  2DZM A;  3NJT A;  2HRJ A;  4KSL C;  2FNJ B;  1WXM A;  2Y3A A;  3LJ3 A;  4FLH A;  1B55 A;  1K8R B;  3A9J B;  3IT6 B;  3U4E G;  2XK5 B;  3A8P A;  4CHK A;  2Z0E B;  2ZW1 A;  1TYG B;  1WXV A;  1VCB A;  3RNC C;  1RM6 C;  4NJ6 A;  1JQ4 A;  1L0X B;  1GGO A;  2DYO A;  1OMW A;  1AQC A;  4KV2 A;  3A1Q A;  3DVG X;  4W9E A;  4MGI E;  1KFY B;  2KC1 A;  3O65 B;  3ZYY X;  1E7P B;  5BYS A;  1TS5 A;  4F7H A;  3L08 A;  3P4Q B;  4OVZ A;  1T5X D;  1S3S G;  3VVW B;  1U5G A;  5D3I B;  1KZG A;  1Q1O A;  4C80 A;  3ZGZ A;  2LJI A;  1FHO A;  4KVG B;  2JZ3 B;  3AE9 B;  1WIA A;  4KIK A;  2M17 A;  2IGG A;  2PEA A;  2BQQ A;  4BKS A;  3SDL C;  5KQ1 A;  2CU3 A;  4JQW C;  4XGA B;  2LZ6 A;  3WIM A;  2RVB B;  1S1Q B;  1EU3 A;  3KRX A;  2JUO A;  2H7E A;  3QAR A;  4DQO C;  2LGY A;  3ALB A;  2TSS A;  4K2O A;  3V3X A;  1VZ8 A;  2KHW B;  3SEB A;  3VDZ A;  2DA0 A;  3EHV A;  2DX1 A;  3I3T B;  4MT7 A;  1WM3 A;  1R4M B;  2REX A;  3APC A;  3D8D A;  2D2Q A;  4KZ0 A;  1Q10 A;  1V8C A;  1JWU D;  4LK0 M;  3AE5 B;  1UGJ A;  3Q8F A;  2D3G A;  2PIA A;  1JWM D;  2W2X D;  2MSE D;  4REZ A;  3PRZ A;  2BYT A;  1LM8 B;  3V60 A;  3M95 A;  2IO2 B;  3DBH I;  1N62 A;  2MDX A;  2Z59 A;  4JL9 A;  1J19 A;  3L0W B;  4TQ0 A;  3HHM A;  3A98 B;  4HCN B;  2ZCB A;  1GC6 A;  3CWI A;  4OT1 A;  1V1P B;  1I2H A;  3AMZ A;  4ZOH C;  4FN2 A;  5CX3 A;  3VTU A;  3NOB A;  5JVL A;  1WJN A;  2RSG A;  3MFG A;  2KTF A;  1QLB B;  2D07 B;  2NBV B;  4KGS A;  2LRW A;  4HB4 B;  3QHT A;  2KFJ A;  1C78 A;  4PK1 A;  2AX5 A;  4JK7 A;  3OAW A;  4XYC A;  3ZVR A;  2MP2 A;  3KQ4 A;  1GB4 A;  4A20 A;  2GRI A;  4YSY B;  1WH3 A;  1FIQ A;  5C1Z A;  2NS5 A;  3FVC A;  2CQU A;  4ICU A;  3ZIM A;  5I4D A;  1VRA B;  3R7R A;  4PS8 A;  4ZRP A;  1YJJ A;  1JML A;  3AU5 A;  4S0R A;  2KX0 A;  3VR8 B;  2MEK A;  1FGY A;  3PZ7 A;  1HZ5 A;  1WM2 A;  2PW9 A;  2L76 A;  2LXC A;  1QQR A;  4ANV A;  5JHH A;  1C4P A;  1VLB A;  1FD6 A;  3R3M A;  3EA6 A;  4ILJ A;  1P1A A;  2B3A A;  1HTQ A;  1HQR D;  2VZK B;  5LG4 B;  3GP7 A;  5D2M B;  4GXB A;  1WE6 A;  4YT0 B;  1R4N B;  2H88 B;  4BKT A;  4LNK A;  2K00 A;  4MK0 A;  2L7R A;  4L1R A;  1T0S C;  3B2G A;  2BBC A;  1WFY A;  1SIF A;  1GG3 A;  4LNO A;  4MM3 A;  3FIL A;  4OVU A;  5H92 C;  1PFJ A;  4A8X C;  2LGS A;  4N58 A;  2LAS A;  5G5H A;  3L16 A;  5LXH A;  3P42 A;  1PGA A;  3A9K B;  3ODW A;  3IFW B;  4BOS C;  4GLS C;  4JKG B;  3FEH A;  3X23 A;  2Z0O A;  1AN8 A;  1BUI C;  2LVQ A;  2H7D A;  5JH5 C;  1DGJ A;  3ZRC A;  3FM8 C;  2IZV B;  2L0T A;  1UWM A;  3ZTD A;  1YNT E;  3VUX A;  1TS3 A;  1UGM A;  5DCN A;  1D5Z C;  3ZUN A;  1Q67 A;  5HI1 A;  1WYW B;  4ANU A;  1EVH A;  1YD8 U;  3T3N A;  3UZT A;  2XBB C;  3DBR I;  3B08 A;  4ZRK A;  2GCJ A;  2UWQ A;  3J9C A;  2K1F A;  1WJM A;  1FNV A;  1K5D B;  2NR2 A;  5BYR A;  2Y8F A;  4A6Q A;  5JZE B;  1STE A;  2QCZ A;  2JQR B;  4D6W A;  2D4Q A;  4JKA A;  2NTT A;  1WI1 A;  3DBL B;  1KM7 A;  3QWM A;  1E8Z A;  2BYV E;  1F9J A;  3ZNH B;  1HBK A;  1WGG A;  5DH9 B;  4C56 C;  1V5O A;  1XCQ L;  2IBI B;  2YRY A;  3P4R B;  2C9W B;  4I6N B;  4C0A A;  1WGQ A;  1XLP A;  5JXV A;  4ZRQ A;  2BS4 B;  3IXS A;  4IW0 A;  5HE2 A;  3W2D A;  1ZVR A;  3Q3O C;  4EKU A;  4B0E A;  2MWN B;  4GOU A;  2WXP A;  2MBE A;  1T3Q A;  1E6E B;  2V4I B;  2IJ0 A;  1WJ6 A;  1YJ1 A;  4A6F B;  1F2R I;  2KN4 A;  1H4R A;  1IGD A;  2DHJ A;  2W3S A;  3TO1 A;  5EE0 A;  4IWP A;  2E6X A;  4FUL A;  4EOY A;  4B0M A;  4OZC A;  4AWJ A;  1F52 A;  1UNQ A;  2M8S A;  3Q8B A;  1RFK A;  3E9S A;  1PQS A;  4MAC A;  4HAZ B;  1ZOY B;  3V61 A;  4JKD A;  4L2Y A;  4NQL B;  1N5W A;  4JE3 B;  4MJS A;  4FXC A;  2W54 A;  2BS2 B;  3DWM A;  1UPR A;  2N0S B;  2ZNV C;  2MKR A;  2HTH B;  1ST7 A;  4IUM B;  1KH0 A;  2BCJ A;  5E6N A;  4MH0 E;  4DXG A;  2LGX A;  3NVV A;  4DWF A;  1C4A A;  4RF1 A;  3O96 A;  5G55 A;  2LJ5 A;  5DPW A;  3I57 A;  1YQB A;  1DIK A;  3HIE A;  2LUM A;  1B1Z A;  4M02 A;  4ZYS A;  2YSZ A;  3NWF A;  2RDH A;  3LYY A;  1GPX A;  2AL6 A;  1P7E A;  2JWZ A;  1UPQ A;  4E74 A;  3OWE B;  2NMQ A;  2CU1 A;  4H2A A;  2KWC A;  5KCV A;  3PZ8 A;  2K8H A;  1MIZ B;  5IA7 A;  5CHV C;  4DHJ B;  5EE9 A;  1GOZ A;  2KNB A;  2WX0 A;  4W9K A;  2FID A;  4W9C A;  2MH7 A;  2DWQ A;  4HAU B;  3O13 A;  2MQJ A;  1WGR A;  5D6J B;  2KMC A;  1HZ6 A;  1DDV A;  1WR6 E;  1TY2 A;  4HK2 A;  2EEL A;  4LDT B;  4KKJ A;  3KH0 A;  1WX7 A;  2KAC A;  2WXI A;  4BBK A;  1XO3 A;  3PGE A;  3RZW C;  5AUK A;  2Q13 A;  2L8J A;  1WE7 A;  5LLI A;  3TL5 A;  3HUI A;  4IWQ A;  1LFD A;  1WXA A;  3B2F A;  3NWA A;  3AJ4 A;  5HE1 A;  2KTR B;  1EWC A;  3BYY B;  1FFU A;  2BGF A;  3GZN B;  2IO0 B;  3UQB A;  4K7S A;  3I9V 1;  4RGM A;  1XLQ A;  2BB5 A;  2WU2 B;  3NVZ A;  1QC6 A;  1BWN A;  3U12 A;  4ICV A;  2D9X A;  3ZKJ C;  5IRS A;  3M63 B;  4JKF A;  1WSP A;  4NNJ B;  4FJY A;  4L23 A;  1ISN A;  2MBH A;  3RCP A;  1NDD A;  2COD A;  1NTV A;  1WVH A;  1N63 A;  1ZE3 D;  2L32 A;  2M14 A;  3M1I B;  5J3T A;  2WYQ A;  1QIL A;  2KDE B;  1BTN A;  3W5V B;  2M19 A;  5FI1 A;  2N9L A;  1I4P A;  3Q8A A;  4WAA A;  4GB9 A;  4HAT B;  1WRI A;  4W9I A;  3N3K B;  2JVC A;  1WGK A;  1ZXH A;  5AZH A;  3PRM B;  2CHW A;  2KN5 A;  4ARC A;  3WAL A;  2OOB B;  2YLM A;  1RRB A;  1LGR A;  5D3X A;  3C0R B;  2DYB A;  4WWO A;  4BFR A;  3L13 A;  3AE8 B;  4JPS A;  3KY9 A;  2JX5 A;  1XXG A;  2ABD A;  3AXC A;  3AH7 A;  1TTN A;  2YT2 A;  2DZK A;  3SYX A;  1I4Q A;  5G2N A;  3FKY A;  4YTN B;  1EU4 A;  2AWT A;  2PTL A;  1FM0 D;  3CF6 E;  1PDX A;  2LUL A;  2NTS A;  1FAO A;  3IAM 1;  5M4Y B;  2Y7B A;  4F7G A;  2RQ1 A;  2RR9 A;  3PLV A;  1OQR A;  3T9L A;  3DXD A;  3JYU A;  3SD5 A;  1L5P A;  3BVZ A;  1QOA A;  1MK9 B;  2NBU A;  2IGD A;  4MEM A;  2Y5P A;  1PYW D;  3N1Y C;  2NPT A;  4KKI A;  3BIN A;  3ML8 A;  1PLS A;  3AU4 A;  4XWT A;  1JRU A;  4HAX B;  4M01 A;  4TMA B;  1ZM0 A;  4US9 A;  2VSZ A;  2J42 A;  1C77 A;  1E8Y A;  3IAS 1;  2MBO A;  3VHT C;  4NAW B;  4IOI E;  2JXT A;  2Y5C A;  2WNM A;  4TQ1 A;  1QKZ A;  3RNF C;  4HRS A;  2JZZ A;  2BF8 B;  2QKM A;  2OQB A;  3OG5 A;  1HB8 A;  2ZEQ A;  1K50 A;  3H6N A;  3HRD D;  2M38 A;  2PE6 B;  5C16 A;  5CTR C;  1FO4 A;  3FSS A;  1J8C A;  3APD A;  1Y56 A;  1D3Z A;  3JVZ X;  2RDG A;  1SSN A;  2ZW0 A;  5L81 A;  1U2B A;  3VAW A;  2KFK A;  1V2Y A;  1NEK B;  4XZ4 A;  2KQ4 X;  2N9P C;  3PPA A;  1J7C A;  1JWA D;  3TUO A;  1N5X A;  2I5C A;  3N9Y C;  5JHG A;  1SJH D;  5J2R A;  5E6O A;  2YEP B;  2ZPN A;  5EFX A;  4L6E A;  3R2I A;  2FUG 1;  2O2V A;  1UD7 A;  1E10 A;  4W9H A;  1ACA A;  2L05 A;  5H8Y E;  3PVU A;  1K51 A;  4KHA A;  5LNK 1;  3ODX A;  1WXQ A;  5C79 A;  2DX5 B;  4TUU A;  2DTC A;  1H8C A;  2NCN A;  3SBT A;  4QAY A;  1UF0 A;  2LGD A;  4JKE A;  2IPK D;  2O6V B;  1YIW A;  1WG7 A;  3VRA B;  2ROV A;  1FGZ A;  4FHK A;  1LO5 D;  1VBG A;  2KKC A;  5TR5 A;  1WI0 A;  1U5F A;  3APF A;  4DXA B;  4LNN A;  2JY6 A;  3E9P A;  2KMM A;  2L3Z A;  4AQ7 A;  2Z13 A;  3RNE C;  3B77 A;  4IM3 A;  4HKZ E;  4C4V A;  3HQC A;  2EMS A;  3TW1 A;  2KDM A;  2PVO D;  1HEZ E;  3CMM B;  3ENE A;  1WZ0 A;  3QK0 A;  4RH6 A;  1L7Y A;  2LHE A;  2Y5B B;  2WXK A;  3D32 A;  3WA0 A;  3RYT A;  2RLO A;  4KDL B;  4P1B C;  1WMH B;  2D3B A;  5JLJ B;  2YS3 A;  1FEH A;  1MI1 A;  3W1Y A;  1AWD A;  3DBH B;  1N61 A;  1ZUD 2;  1UEF A;  2G4S A;  4B95 A;  1L4D B;  5BMG A;  1U5E A;  4HB2 B;  1JAL A;  2INP E;  3KWV A;  5E6J A;  3QX1 A;  1RAX A;  3PP2 A;  4ZDV A;  2V3S A;  1F0Z A;  2CJO A;  4GGQ A;  3VRB B;  1DBH A;  5GXG B;  1Z87 A;  3ULB A;  4YL8 A;  2E3T A;  1RLF A;  5L83 A;  2ZPY A;  4E71 A;  4OVV A;  4Y94 A;  1I4R A;  2GB1 A;  2UZR A;  2MA9 B;  4GDL B;  4ZHP A;  3FLV A;  4AS1 A;  1SE2 A;  4KSK C;  2J53 A;  3TJP A;  4A9A A;  2I5F A;  3S2A A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  2LYD A;  4NSW A;  1UNR A;  2IYB A;  3MDB C;  4HAY B;  3HM3 A;  2Y8G A;  3CXB B;  1XD4 A;  3EEC A;  3F5R A;  2MP2 B;  1V86 A;  2I1J A;  3H7P A;  2K39 A;  3PSE B;  2XK5 A;  2VRR B;  4FJZ A;  1W1D A;  1X05 A;  4K7U A;  4G50 A;  3QWZ B;  5LXI B;  4IAP A;  1E8W A;  4D0N B;  2KDB A;  2L2I A;  4JIO U;  4MEL A;  1HE8 A;  3KW5 B;  4P7I A;  3SNH A;  2LRU A;  2FUH B;  2BKF A;  2DFK A;  2MBQ A;  5KQ4 A;  3KUD B;  3DBS A;  3QIJ A;  4JKC A;  2C7H A;  2CAY A;  2L1C A;  1UNP A;  2D9Y A;  3NS8 A;  5HE0 A;  2X18 A;  1SE9 A;  3SU8 X;  2Z0Q A;  1LB1 A;  2BPS A;  3PHX B;  1XCG A;  2IO1 B;  4B6H A;  4BKS D;  2V76 A;  4ANW A;  2LBB A;  2WWZ A;  4GDK A;  3RUL A;  2IYD B;  1SGH A;  4W9D A;  3L10 B;  4F7U P;  1TXD A;  2PZ1 A;  3LJU X;  4ASW C;  1NVL A;  2L00 B;  3E9L A;  1U4A A;  2HJ8 A;  1JDE A;  2CY4 A;  1E8X A;  3A4R A;  3PEG A;  4HJK A;  2C60 A;  3RUI B;  3T8M A;  3A8Q A;  3H1U A;  3TVV A;  2K8C A;  1YX5 B;  2MFQ A;  3D8F A;  4H8S A;  4A3O A;  2N7D A;  2RNR B;  5GOW B;  4WSF A;  3UGB B;  4PYU A;  1TQZ A;  4DBB A;  3PT2 B;  1XR0 B;  3M3J A;  2DHI A;  5KHO A;  4W9F A;  2KGX B;  1NU2 A;  1E7U A;  1X1M A;  3ENB A;  1EGX A;  2J59 M;  1UBI A;  2JRI B;  4NPN A;  2LKO A;  1FOE A;  2LG1 A;  1XQQ A;  2P8V A;  5C6R A;  2D11 A;  1V89 A;  3N7C A;  4CYE A;  2QKL A;  1OEY A;  4GOC A;  3D8E A;  3SUZ A;  5GMV A;  3QJZ A;  1R4N I;  3KVF B;  3A9K A;  1E7V A;  2GBK A;  4F1S A;  1V5M A;  2KD0 A;  3WAN A;  2LUE A;  4JKG A;  5C5B B;  3NZS A;  2NBW B;  4W9J A;  1W1H A;  1OEY J;  5FI0 A;  1V5U A;  4WWN A;  1KOT A;  1IP9 A;  2LXA A;  2G3Q B;  2J7Q B;  1IPG A;  2DZI A;  2K6Q A;  3QQ8 B;  4KDI C;  4FA6 A;  1WXS A;  5JHA A;  1XD3 B;  5C23 A;  2LOX A;  4AP4 C;  2KLC A;  4WQO B;  3V62 A;  1EF1 A;  1V88 A;  2CS4 A;  3AUL A;  3V6E B;  3SV1 A;  4GMX B;  4PYZ A;  2GS0 A;  1WJU A;  4JK8 A;  4B9K A;  3MTN B;  3ONS A;  4B6W A;  4I6P A;  3V5W A;  3WAO A;  2E2X A;  2ROZ B;  4KAX B;  3B1L X;  4HPM B;  1WJ4 A;  4WJN A;  3QAQ A;  2N9X A;  2LOZ A;  1ZW7 A;  2R0D A;  3UF8 A;  1DYN A;  1KI1 B;  4F8C B;  1GC7 A;  3WYF B;  4FAD A;  4WWP A;  2D9Z A;  1NI2 A;  2P0F A;  2ZZP B;  4X57 B;  3EPY A;  2ELB A;  1C3T A;  1P9D U;  1Z2M A;  4K2P A;  2R2O A;  1NBF C;  2HTH A;  2ZVO A;  2G45 B;  2DHZ A;  2KO3 A;  3H7S A;  4HDQ A;  3VH3 B;  3U30 A;  2K2J A;  5HKH A;  1OY2 A;  1QZE A;  2D9W A;  1WGY A;  3F0W A;  1V5T A;  3IHP C;  2FCN A;  1P3R A;  3NHE B;  2MWS B;  1IYF A;  5CLL B;  3PRP B;  1WF9 A;  1EAZ A;  3UIN B;  2MCN B;  3BY4 B;  4BKG A;  4N9F 4;  5AZG A;  2MLB A;  5JHB A;  3E66 A;  4KHB B;  2FCQ A;  2UZS A;  4HCP B;  1FXT B;  3EC8 A;  5EDS A;  1WY8 A;  4HVB A;  2ZCC A;  2DYM A;  1UEL A;  1M94 A;  1E90 A;  2KTR A;  5IJM A;  5DHF B;  3UIP B;  2EKE C;  2GCL A;  3PTF C;  4PS7 A;  3SHQ A;  3KYD D;  2D9V A;  4MDK E;  2W2X C;  3QBV B;  1J0W A;  3IVF A;  2PPH A;  3KSY A;  1LW3 A;  4JGH B;  4JK9 A;  2R09 A;  1U29 A;  2DLW A;  1MIX A;  2VRW B;  3IG3 A;  2MBB B;  2I1K A;  3ZO5 B;  4KHO A;  3MHS D;  5D27 A;  2FCM A;  3X0W A;  2KJ6 A;  3OJ4 B;  2OTX A;  2DYN A;  2COF A;  3M62 B;  4I6L B;  4MY6 A;  4II2 B;  3ZW3 A;  4EUT A;  4W9L A;  1CMX B;  1I42 A;  2RGF A;  2CB8 A;  1P6S A;  2R2Q A;  3DPD A;  3VOQ A;  2KOX A;  4A6K A;  2V1Y A;  4II3 B;  3R66 C;  2J0J A;  4LDT D;  5CHF A;  1I35 A;  2CY5 A;  4HPL B;  2PJH A;  4RM8 A;  1WGH A;  1WX9 A;  5D94 A;  4TV3 A;  4EMO A;  4HDO A;  2LD9 A;  2JP2 A;  4K1R B;  2M1M A;  4AJY B;  1GNU A;  4PS3 A;  3A1Q B;  4FJV B;  2YF0 A;  1GUA B;  4EZJ A;  4GMV A;  1KJT A;  4BBN F;  4HB0 B;  2BYE A;  3IBE A;  4GIV A;  1ZSQ A;  2G35 A;  4DX9 0;  3Q3J A;  4AUQ C;  2KLG A;  4CHM A;  4ILG B;  4KIK B;  2DEN B;  4NJ7 A;  2CR5 A;  3NSU A;  5J17 A;  3MJW A;  1WZ3 A;  2Z0P A;  5L95 C;  2EMT A;  2KQ7 A;  3L54 A;  1EUV B;  3JSV A;  1RJ2 A;  2PE9 A;  4GU2 A;  1ZKH A;  1WRD B;  2A5U A;  4MGK E;  1M7E A;  3DCG A;  1Z5S B;  2FDQ A;  2ADZ A;  2NZ8 B;  4DHZ E;  2C7N B;  3H7P B;  2C7M B;  3TCA A;  2RUK B;  2YS5 A;  3PV1 A;  5DI9 B;  2DX5 A;  2BWE S;  2EC1 A;  1UZX B;  1V6E A;  2Z59 B;  2JPH A;  2JXX A;  3TFM A;  1XOD A;  1MPH A;  2O6V A;  5DIF B;  2LI5 A;  3DOW A;  4GSW A;  3HK0 A;  5DHA B;  2DKP A;  2WX1 A;  2VKI A;  1P0R A;  2K6D B;  4WJO A;  4LJO B;  3CST A;  3AI5 A;  4G3X B;  1V9J A;  2M0X A;  3KRW A;  2GBR A;  2EJ8 A;  5BO4 B;  2KXJ A;  3HM6 X;  3WAM A;  1ZC3 B;  1WMH A;  2RGN B;  4XC2 A;  3A9J A;  2MW5 A;  5AZF A;  4EZK A;  1P98 A;  3Q3F A;  3VFK A;  2D10 A;  2KJH B;  4ZRJ A;  2J0M A;  4GDK B;  2GBJ A;  1P5T A;  3ZVV A;  2N9E B;  2UYZ B;  2XQN M;  1VD2 A;  4HWI B;  1W1G A;  2RSU A;  5J18 A;  4GDL A;  2KWU B;  3PSC A;  4W9G A;  2HD5 B;  2V4L A;  1NTI A;  3ULC A;  1X86 A;  5D3W A;  4IWO A;  1EF5 A;  1IRS A;  2AYO B;  4MGZ E;  3U7D A;  4DDG D;  3DXC A;  4JKH A;  3NY5 A;  5J3Q A;  3T06 A;  3OJ3 A;  4DDI D;  2W9N A;  3ZNG C;  4LCD E;  3UIO B;  3P7Z A;  2JRH A;  1LQB A;  2O6V D;  2KJR A;  2C5L C;  3VTV A;  2BYF A;  1X1F A;  2N4F A;  3B0A A;  1V5P A;  1UH6 A;  2HE7 A;  2ELA A;  1R4M I;  1ZC4 B;  3VQI A;  3N32 A;  2IO3 B;  2N1W A;  2FAZ A;  2DAF A;  1WX8 A;  2M4N A;  2KZR A;  3E9O A;  4HXD A;  2KDF B;  1XT9 B;  3U8Z A;  3ML9 A;  1T0Y A;  2ZVN A;  3PHW B;  1SHC A;  1KZ7 A;  2J0K A;  3K9O B;  4EJN A;  2P0D A;  1TGZ B;  2KQS A;  4G0N B;  4J6I A;  2LVO A;  4WJ7 A;  1WGD A;  3DQV A;  1QQG A;  2GJY A;  1AWE A;  1MAI A;  5D3Y A;  4M8N A;  3FP5 A;  4HAW B;  4MGY E;  3G9W A;  3SBG A;  2Z0D B;  4NQK E;  1Y19 B;  4IOY X;  2AL3 A;  1PMS A;  3PZD A;  1RRP B;  2OJR A;  4XWX A;  4MSM B;  4CHJ A;  3PG7 A;  1Y5O A;  1TJ6 A;  2X0S A;  1KLV A;  1H10 A;  4RMA A;  1I7A A;  3CSF A;  2CHX A;  3KUZ A;  1WGU A;  3HW2 B;  4BOZ B;  1DDW A;  3VUW A;  2DHK A;  1V80 A;  1OQN A;  1KC7 A;  3JW0 X;  1XKE A;  3MPX A;  4MJS B;  4IM0 A;  2COP A;  2WH5 A;  2DYQ A;  4K81 A;  2WDT B;  4EFO A;  4BVU C;  5HE3 A;  3KUC B;  4HLE A;  2K2U A;  3SO6 A;  1MKE A;  2IY0 B;  1K5G B;  5CHW A;  3DDC B;  3DVN U;  1C1Y B;  4HB3 B;  4IC7 B;  1LXD A;  1YX6 B;  3VIA A;  5DPT A;  2KK8 A;  4ZRI A;  4EZL A;  4GZU A;  4JKB A;  1U5D A;  2KCJ A;  1M7R A;  1HB6 A;  5AEK B;  3P6A A;  2FIF A;  4JLC A;  5D3V A;  3EFU A;  1GJZ A;  2FJ9 A;  2DIK A;  1OTR B;  3PVL A;  5JP4 A;  1N3H A;  4WVF B;  4RM9 A;  3HIZ A;  4WJP A;  1Q0W B;  3LDZ E;  2JT4 B;  1U27 A;  2MX2 A;  3K9P B;  2ZJD A;  2YT0 A;  4DBG A;  4KZC A;  3RCZ A;  4M8M A;  2JF5 A;  1FHX A;  2DN6 A;  4IFS A;  2W2W A;  4M0W B;  5D7G A;  5IAA C;  3VH4 B;  2KAN A;  2KVR A;  1V61 A;  3PLU A;  3TMP B;  3DBL I;  4ANX A;  3VTW A;  1ZGU B;  4K7W A;  5C5B A;  4A6F A;  3DVG Y;  1P3Q U;  2KWV B;  2P0H A;  3ZLZ A;  4CO7 A;  3UQA A;  4Z2N A;  2GMI C;  5DPS A;  3BJI A;  1BTK A;  3A4S C;  3R7Q A;  1X1G A;  1X11 A;  4AOF A;  2K25 A;  3PRE A;  2RD0 A;  1BAK A;  2ZNV B;  3OAN A;  1AAR A;  5DPR A;  2CKH B;  2N1V A;  4GPT B;  2IFS A;  4A6H A;  1Y8R C;  1OQY A;  1TBE A;  3ML4 A;  2A4Z A;  2KC2 A;  3V6C B;  1XX0 A;  4DX8 A;  1WJ1 A;  3ZNI D;  1L2N A;  3GOE A;  3GYP A;  4K17 A;  4URK A;  4HAV B;  5LOP B;  2NPT B;  3OLM D;  3VXW A;  2G4D B;  1V49 A;  2CRF A;  2FCS A;  3A33 B;  3PVW A;  1UBQ A;  3W1S C;  5KHQ A;  3N30 A;  2L0F A;  3ZRF A;  2COA A;  1RFA A;  2RPQ A;  4XX5 A;  4IG7 B;  4PQ0 A;  1EO6 A;  3ZTC A;  3KYC D;  2KX3 A;  4PNK A;  5LON B;  4BBN C;  3TIX A;  5CLQ B;  3QCA A;  2XEW A;  3H9D A;  2KFK B;  2QHO A;  3P2B A;  2LVP A;  3RT3 B;  2DKQ A;  3GZN I;  1VBH A;  2KMA A;  4NY0 A;  2IY1 B;  3WAP A;  2YVC A;  3GYO A;  1TZ1 A;  4DHZ B;  1DDM A;  2O2V B;  4EEW A;  2NVU I;  4WJQ A;  3ODO A;  4LJP B;  5FR6 A;  2GOW A;  2KDI A;  2UVM A;  2COC A;  4G11 A;  5E6P A;  3ZNZ B;  2BKR B;  4TYZ A;  2DAJ A;  4DHJ D;  3RZF A;  3DXE A;  3L17 A;  3ECI A;  3ZDM C;  2N0Y A;  4Z2M B;  1NTY A;  2N7E A;  1DRO A;  3QA8 A;  4FBJ B;  2YS1 A;  4HHV A;  1BT0 A;  2DZJ A;  4GN1 A;  4YON A;  1E5W A;  3JSV B;  2MRP A;  4ILH A;  2K8B A;  2BWF A;  3VUY A;  1G6J A;  3CIK A;  3KZ1 A;  3DVN V;  2NMB A;  4IM2 A;  4NAW A;  2ASQ A;  2R82 A;  3TBL D;  1A5R A;  1MG8 A;  2FJL A;  3W1S A;  4E3C A;  2AEH A;  2KUP A;  1FHW A;  4ZYN A;  4A5K A;  1Q5W B;  1OGW A;  2LWP A;  4AJW A;  3QC8 B;  2N23 A;  2GBM A;  4FHJ A;  3PS6 A;  1V81 A;  2CHZ A;  4DK5 A;  1KBL A;  2YT1 A;  1MK7 B;  1J0G A;  5J3Y A;  1WR1 A;  3RD2 A;  3ZDT A;  4A3P A;  4TKN A;  2GBN A;  3NZU A;  4MSQ B;  1FB8 A;  2DZM A;  2HRJ A;  4KSL C;  2FNJ B;  1WXM A;  3LJ3 A;  4FLH A;  1B55 A;  1K8R B;  3A9J B;  2XK5 B;  3A8P A;  4CHK A;  2Z0E B;  1WXV A;  1VCB A;  4NJ6 A;  1GGO A;  2DYO A;  1OMW A;  1AQC A;  4KV2 A;  3A1Q A;  3DVG X;  4W9E A;  4MGI E;  2KC1 A;  3O65 B;  4F7H A;  3L08 A;  1S3S G;  3VVW B;  1U5G A;  1KZG A;  1Q1O A;  1FHO A;  4KVG B;  2JZ3 B;  1WIA A;  4KIK A;  2M17 A;  2PEA A;  4BKS A;  3SDL C;  5KQ1 A;  4JQW C;  2LZ6 A;  3WIM A;  2RVB B;  1S1Q B;  3KRX A;  2JUO A;  2H7E A;  3QAR A;  2LGY A;  3ALB A;  4K2O A;  3VDZ A;  2KHW B;  2DA0 A;  3EHV A;  2DX1 A;  3I3T B;  4MT7 A;  1WM3 A;  2REX A;  3APC A;  3D8D A;  2D2Q A;  4KZ0 A;  2D3G A;  2W2X D;  2MSE D;  3PRZ A;  1LM8 B;  3V60 A;  3M95 A;  2IO2 B;  3DBH I;  2MDX A;  4JL9 A;  1J19 A;  3L0W B;  4TQ0 A;  3HHM A;  3A98 B;  4HCN B;  2ZCB A;  1GC6 A;  1I2H A;  4FN2 A;  5CX3 A;  3VTU A;  3NOB A;  5JVL A;  1WJN A;  2RSG A;  2KTF A;  2D07 B;  2NBV B;  2LRW A;  4HB4 B;  3QHT A;  2KFJ A;  4JK7 A;  3OAW A;  3ZVR A;  2MP2 A;  4A20 A;  1WH3 A;  5C1Z A;  2NS5 A;  4ICU A;  2CQU A;  3ZIM A;  3R7R A;  4PS8 A;  3AU5 A;  2KX0 A;  1FGY A;  1WM2 A;  2L76 A;  2LXC A;  4ANV A;  5JHH A;  3R3M A;  4ILJ A;  1P1A A;  2B3A A;  5D2M B;  4GXB A;  1WE6 A;  4BKT A;  2K00 A;  4MK0 A;  2L7R A;  1WFY A;  1SIF A;  1GG3 A;  4MM3 A;  4OVU A;  1PFJ A;  2LAS A;  3L16 A;  5LXH A;  3A9K B;  3ODW A;  3IFW B;  4BOS C;  4JKG B;  3FEH A;  3X23 A;  2Z0O A;  2LVQ A;  2H7D A;  5JH5 C;  3ZRC A;  3FM8 C;  2IZV B;  2L0T A;  3ZTD A;  3VUX A;  1UGM A;  5DCN A;  3ZUN A;  1Q67 A;  1WYW B;  4ANU A;  1EVH A;  1YD8 U;  3UZT A;  2XBB C;  3DBR I;  3B08 A;  4ZRK A;  2GCJ A;  2UWQ A;  2K1F A;  1WJM A;  1K5D B;  2NR2 A;  2Y8F A;  5JZE B;  2D4Q A;  4JKA A;  1WI1 A;  1KM7 A;  3QWM A;  1E8Z A;  2BYV E;  1F9J A;  3ZNH B;  1HBK A;  1WGG A;  5DH9 B;  1V5O A;  2IBI B;  2YRY A;  2C9W B;  4I6N B;  4C0A A;  1WGQ A;  4IW0 A;  5HE2 A;  1ZVR A;  4EKU A;  2MWN B;  2MBE A;  1WJ6 A;  1YJ1 A;  4A6F B;  1H4R A;  2DHJ A;  3TO1 A;  4IWP A;  4FUL A;  4EOY A;  4AWJ A;  1UNQ A;  2M8S A;  1PQS A;  4HAZ B;  3V61 A;  4JKD A;  4NQL B;  4MJS A;  1UPR A;  2ZNV C;  2MKR A;  2HTH B;  1ST7 A;  4IUM B;  2BCJ A;  5E6N A;  4MH0 E;  2LGX A;  4DWF A;  3O96 A;  5G55 A;  2LJ5 A;  5DPW A;  1YQB A;  1DIK A;  2YSZ A;  2AL6 A;  2JWZ A;  1UPQ A;  4E74 A;  2CU1 A;  2KWC A;  5KCV A;  2K8H A;  1MIZ B;  5IA7 A;  5CHV C;  4DHJ B;  2KNB A;  2WX0 A;  4W9K A;  2FID A;  4W9C A;  4HAU B;  2MQJ A;  1WGR A;  5D6J B;  2KMC A;  1DDV A;  1WR6 E;  4HK2 A;  4LDT B;  3KH0 A;  1WX7 A;  4BBK A;  3PGE A;  3RZW C;  2Q13 A;  2L8J A;  1WE7 A;  5LLI A;  3TL5 A;  4IWQ A;  1LFD A;  1WXA A;  3AJ4 A;  5HE1 A;  2KTR B;  2BGF A;  2IO0 B;  3UQB A;  4K7S A;  1QC6 A;  1BWN A;  4ICV A;  2D9X A;  3ZKJ C;  3M63 B;  4JKF A;  4NNJ B;  4FJY A;  1ISN A;  2MBH A;  3RCP A;  1NDD A;  2COD A;  1NTV A;  1WVH A;  2M14 A;  3M1I B;  5J3T A;  2WYQ A;  2KDE B;  1BTN A;  5FI1 A;  4WAA A;  4GB9 A;  4HAT B;  4W9I A;  3N3K B;  2JVC A;  5AZH A;  3PRM B;  2CHW A;  2KN5 A;  3WAL A;  2OOB B;  2YLM A;  1RRB A;  5D3X A;  3C0R B;  2DYB A;  4WWO A;  4BFR A;  3L13 A;  3KY9 A;  2ABD A;  3AXC A;  1TTN A;  2DZK A;  3SYX A;  5G2N A;  2AWT A;  3CF6 E;  2LUL A;  1FAO A;  2Y7B A;  4F7G A;  2RQ1 A;  2RR9 A;  3PLV A;  3T9L A;  3DXD A;  3JYU A;  3SD5 A;  1MK9 B;  2NBU A;  4MEM A;  2NPT A;  3BIN A;  3ML8 A;  1PLS A;  3AU4 A;  1JRU A;  4HAX B;  1ZM0 A;  2VSZ A;  1E8Y A;  2MBO A;  3VHT C;  4NAW B;  4TQ1 A;  2JZZ A;  2BF8 B;  2QKM A;  2OQB A;  1HB8 A;  2ZEQ A;  3H6N A;  2M38 A;  2PE6 B;  5C16 A;  5CTR C;  3FSS A;  1J8C A;  3APD A;  1D3Z A;  3JVZ X;  5L81 A;  1U2B A;  3VAW A;  2KFK A;  1V2Y A;  4XZ4 A;  2N9P C;  3PPA A;  2I5C A;  5JHG A;  5J2R A;  5E6O A;  2ZPN A;  5EFX A;  4L6E A;  2O2V A;  1UD7 A;  4W9H A;  1ACA A;  2L05 A;  3PVU A;  4KHA A;  3ODX A;  5C79 A;  2DX5 B;  4TUU A;  2DTC A;  1H8C A;  2NCN A;  3SBT A;  2LGD A;  4JKE A;  2O6V B;  1YIW A;  1WG7 A;  2ROV A;  1FGZ A;  4FHK A;  1VBG A;  5TR5 A;  2KKC A;  1WI0 A;  1U5F A;  3APF A;  4DXA B;  2JY6 A;  3E9P A;  2L3Z A;  4IM3 A;  3HQC A;  2EMS A;  3TW1 A;  3CMM B;  3ENE A;  1WZ0 A;  3QK0 A;  1L7Y A;  2Y5B B;  3D32 A;  3WA0 A;  3RYT A;  2RLO A;  4KDL B;  1WMH B;  5JLJ B;  2YS3 A;  3W1Y A;  1UEF A;  2G4S A;  4B95 A;  1U5E A;  4HB2 B;  3QX1 A;  1RAX A;  3PP2 A;  4ZDV A;  2V3S A;  4GGQ A;  1DBH A;  1Z87 A;  3ULB A;  4YL8 A;  1RLF A;  5L83 A;  2ZPY A;  4E71 A;  4OVV A;  4Y94 A;  4GDL B;  2UZR A;  2MA9 B;  3FLV A;  4KSK C;  3TJP A;  2I5F A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...