1SGHA

Moesin ferm domain bound to ebp50 c-terminal peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Moesin
total genus 71
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1sghA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1sghA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1sghA01
1AARA 1KJTA 1EUVB 2FCSA 2BYVE 2KANA 4FJZA 4MSQB 4OVUA 4GSWA 2PEAA 3SU8X 1WGRA 4XZ4A 3KZ1A 3TBLD 3DVNU 4BFRA 1E8ZA 2KDIA 4GU2A 3IFWB 2C7HA 1KZGA 2O2VB 3QWMA 2GCJA 2BGFA 3ML4A 4K2OA 3APDA 3KW5B 5DPSA 2MCNB 3RUIB 3ZNZB 4TQ0A 1UNQA 2D9YA 2JZZA 2NBVB 4M8MA 2MWNB 3TIXA 3OANA 3H6NA 2AEHA 3VVWB 2M38A 3IG3A 4LDTD 3ZNID 1G6JA 4M0WB 3LDZE 4GGQA 4W9FA 3V6CB 3OJ4B 4BBNC 1BTNA 4GDLA 3X0WA 3KYCD 4KIKA 1W1GA 4BKGA 2VRRB 3ZW3A 4NNJB 3G9WA 1M94A 1ZVRA 4JQWC 5DHAB 2KQ7A 4MJSB 3QARA 4ICVA 1NU2A 1XCGA 2AYOB 2NBUA 4WAAA 3V61A 5J17A 4FLHA 1AWEA 3FP5A 2K1FA 2MW5A 2GBJA 2UYZB 1J0GA 4HDOA 2KVRA 4PQ0A 1KI1B 4GDKA 4MSMB 3DXCA 2V1YA 1FHOA 5JH5C 2COPA 3PS6A 2JVCA 1TXDA 1OQYA 1WR6E 3KH0A 1ISNA 3VIAA 5C6RA 1WMHA 3CF6E 4FN2A 4WWNA 1R4MI 2FDQA 2YSZA 1WJ1A 3F0WA 2HTHB 2Z0DB 3N30A 2UVMA 3JVZX 4NAWA 4CHKA 1UPQA 5DPTA 4GMXB 1XQQA 2ZPNA 4W9LA 3BY4B 5J2RA 1UEFA 2K2UA 4W9HA 1E7VA 5LONB 1X86A 2KZRA 1S3SG 5HE3A 3PG7A 3LJ3A 2AWTA 3SO6A 4IUMB 4A6HA 4G50A 2DAFA 3T8MA 4HXDA 2ZCCA 1WGHA 2D9ZA 2ROZB 2KD0A 4HK2A 1U29A 2HD5B 5JHGA 1WE6A 4MM3A 2M17A 3D8FA 4C0AA 2MSED 2N1VA 2DN6A 4J6IA 2COCA 1WXMA 4FULA 1WGDA 3ODOA 2XK5B 2O6VB 3WA0A 3A9KB 3DBSA 4HCPB 4IM0A 4LJPB 3H7SA 3QC8B 3PRZA 4IWPA 2Z0QA 2DTCA 1EGXA 2CQUA 2RLOA 4KHOA 4IOYX 1WG7A 2KDEB 2BCJA 2DX1A 3T06A 3RCPA 1K8RB 2C60A 2IO2B 4OVVA 1LQBA 1OTRB 2B3AA 5E6PA 3RCZA 5JHHA 3IHPC 3VDZA 2KCJA 1MAIA 2W2XC 1L7YA 3ZNHB 1P3QU 1WH3A 1EF5A 1WF9A 3VXWA 3QWZB 2YF0A 1LW3A 3M95A 3C0RB 5DPRA 2N7DA 4EZJA 2K8CA 4IWOA 2ZJDA 3ZKJC 1RRBA 4AJWA 2L8JA 2QHOA 2LJ5A 1E90A 2JF5A 5LOPB 2G45B 3NZSA 4EKUA 4BKSA 1ZW7A 4HAUB 2LGDA 3UIPB 1AQCA 3AJ4A 4GN1A 1NBFC 1W1HA 3HM3A 3QCAA 3TMPB 2GJYA 2LVQA 1P3RA 3A8PA 2MKRA 2YS3A 2K8BA 1WXSA 1H10A 4EEWA 3GYOA 5EDSA 1X11A 4IFSA 1ZSQA 3PPAA 2D07B 2ZCBA 2LASA 4ICUA 3D8EA 4PS8A 2HE7A 3L08A 5DPWA 1QC6A 3PGEA 2M1MA 4NY0A 4FHJA 4HCNB 2N1WA 4KHAA 2C9WB 4KDLB 3EHVA 3QA8A 3X23A 3M63B 3DDCB 4KVGB 4TQ1A 5D3XA 4DHJB 1K5GB 3FLVA 2D9WA 1UBQA 2DAJA 4N9F4 3VAWA 1IRSA 4IM3A 1DROA 3DQVA 4XC2A 2KKCA 3PV1A 3DVGY 3T9LA 1WR1A 5AZFA 4W9CA 2JRIB 1DDVA 4MDKE 1Q1OA 4DBGA 3A1QB 4ZYNA 1LB1A 4H8SA 1P6SA 1E8XA 4W9JA 1U27A 2NCNA 2ZZPB 3WAPA 1WGUA 2GCLA 2COFA 2I5FA 2KTRA 2YLMA 1V5PA 4F7GA 2ABDA 1XD4A 2D4QA 3DPDA 1WZ0A 1RAXA 2WYQA 4DK5A 1DDWA 4F7ZA 2FCQA 3MJWA 2BF8B 1OGWA 1WJ4A 2RVBB 3PTFC 4B6WA 2ZVNA 5AZGA 2RSUA 3ODXA 1Q67A 1WXAA 1YIWA 1WVHA 3IVFA 3A8QA 5HE2A 1V5TA 1EVHA 2ASQA 4HPLB 3SDLC 4EOYA 1FHXA 4MK0A 2CY5A 1NTVA 4KHBB 3JW0X 2YVCA 2Y8GA 3EPYA 1BAKA 1P9DU 3W1SC 4EJNA 2OQBA 5L83A 1X1FA 2LYDA 1OY2A 2ELBA 1J19A 1V2YA 1UBIA 2J0MA 4ANWA 4E74A 2FCMA 3R3MA 1J8CA 4HAZB 3AU5A 2FIFA 5KQ1A 2MQJA 4F1SA 4MGYE 3NOBA 4PYUA 2MFQA 4IWQA 3H9DA 2ELAA 2YT1A 4HAVB 4WJ7A 4HLEA 4JIOU 3L17A 2WH5A 4MELA 1Q0WB 3WAMA 3M62B 2N9EB 3VTWA 4E3CA 5JHAA 2XBBC 1FAOA 5FI0A 1P98A 4YONA 1SE9A 4RM8A 3K9PB 2I5CA 4GDLB 1TTNA 4K7UA 2YS5A 2P0FA 4HHVA 1FXTB 5KHOA 2DX5B 4WVFB 2GBMA 3P6AA 2Z0OA 3HK0A 2O2VA 2IYBA 2JT4B 1WZ3A 4GMVA 2KMAA 2W9NA 1GG3A 1YD8U 2CKHB 4WJNA 2G4DB 5DCNA 3WANA 2KFKB 2ZVOA 3L54A 1WJUA 5HKHA 2E2XA 2IO0B 2L3ZA 4DHZB 4DXAB 1NTIA 2Y8FA 2BKFA 4NJ7A 1YJ1A 3EC8A 1GJZA 1E5WA 2UWQA 1GC6A 3HW2B 4MH0E 1FB8A 3TVVA 2ZNVC 4LJOB 1HB8A 2JZ3B 3S2AA 2PE6B 3UQBA 2LI5A 5D6JB 2HTHA 4II3B 2KX0A 2R2OA 1GUAB 3GYPA 4Z2NA 1XR0B 2KFJA 3QJZA 4LDTB 4WJPA 1PFJA 1I42A 2CHWA 4XWXA 3L0WB 4BOZB 1TGZB 1WFYA 4RMAA 2KDFB 3KUDB 3PZDA 3UQAA 1A5RA 2R0DA 3EFUA 1ST7A 3UF8A 2CR5A 4M8NA 3VUYA 3PP2A 1WM2A 1TJ6A 2EMSA 4A20A 4DX90 4K2PA 2JUOA 2MLBA 2P0HA 2L76A 5KHQA 4TYZA 1UH6A 2XK5A 1WGYA 2O6VA 3ZRCA 2J59M 4HAWB 3QQ8B 3WIMA 4Z2MB 4CHMA 4FHKA 2LD9A 1X1GA 1WX9A 2K39A 4KSKC 4MGZE 1V5MA 2K2JA 2DHKA 4TV3A 5GOWB 2IO3B 4KV2A 3ZO5B 3MPXA 1XD3B 2C5LC 2CU1A 5AZHA 5JHBA 4DDGD 3DBRI 1K5DB 3NSUA 4EUTA 3ZDTA 2BKRB 4EZKA 3B0AA 5FI1A 1WM3A 3APCA 4AWJA 2GBNA 4HVBA 2IFSA 2QKLA 2AL3A 1C1YB 1ZC4B 2W2XD 2CAYA 3N32A 3CIKA 5IJMA 4K81A 3ML8A 5LLIA 2N4FA 4FJVB 4B9KA 5CLQB 4DDID 3VH4B 3ZUNA 3ULCA 5DH9B 3FM8C 1WI1A 1V6EA 3GOEA 2DHJA 2LOXA 3KUCB 3W1YA 3HIZA 2L0FA 1E8YA 1P5TA 2DZKA 4HB4B 3A4RA 2ZEQA 1QZEA 2NPTB 2LG1A 3R7RA 4L6EA 2LXAA 4A6KA 3IBEA 2MBBB 1LM8B 1DYNA 3SV1A 2IZVB 3DOWA 3PHWB 1WGGA 1NTYA 2LXCA 3VFKA 3DXDA 5D94A 3MHSD 5BO4B 2C7NB 3QX1A 4JGHB 1JRUA 4AJYB 4DWFA 4PS7A 1TZ1A 3ONSA 3RD2A 4D0NB 1T0YA 3UIOB 1R4NI 1OEYJ 1VD2A 3EECA 4ASWC 3OJ3A 5D2MB 3L16A 4W9DA 2YRYA 2I1KA 1OEYA 2DA0A 1P0RA 2OOBB 4MY6A 3CSTA 3JSVB 3QK0A 3SD5A 3PHXB 1SHCA 2FUHB 4K7SA 1W1DA 1WE7A 1WJMA 4GPTB 2V3SA 3V6EB 1M7EA 1M7RA 3ZRFA 2Y7BA 1UGMA 2KJ6A 4K7WA 2CB8A 1V88A 2MDXA 2D11A 1MG8A 2M14A 4BVUC 2O6VD 4G3XB 3CXBB 3DVGX 1V86A 3ZVVA 1FHWA 2Z0PA 3F5RA 4FA6A 3V62A 5C1ZA 3P2BA 4K1RB 1U5EA 3U7DA 2I1JA 5D3WA 3V5WA 3M3JA 4NPNA 5G2NA 4HPMB 2RNRB 2H7DA 1PMSA 1DDMA 4W9EA 5FR6A 2NZ8B 2DYBA 3JYUA 1ZGUB 1HBKA 1V61A 5KQ4A 3A33B 1U5GA 3N3KB 2LULA 3VOQA 3TO1A 2UZRA 4A6FA 4DBBA 1Z5SB 2MX2A 5CX3A 4HWIB 3PLUA 1V5OA 1KLVA 4W9IA 3SNHA 3FEHA 1WYWB 1Y8RC 2M8SA 3ZTCA 5CHFA 2N9PC 2MBHA 2L1CA 2NPTA 1KOTA 2MP2B 4NQLB 4ZDVA 1MK7B 2RQ1A 1QQGA 4BBKA 2KC1A 2KNBA 1NVLA 2N7EA 3NZUA 2JY6A 4YL8A 2D3GA 4IM2A 2MA9B 3QAQA 3TJPA 3BJIA 4AP4C 4W9GA 2CY4A 3TW1A 1WGQA 3PRMB 2COAA 1WX7A 2KO3A 3NHEB 2CODA 3H1UA 4WJQA 2Z59B 2KOXA 2R09A 2ROVA 4E71A 4BBNF 3H7PB 4ZRIA 2PPHA 3JSVA 4HB0B 2H7EA 2DX5A 2KJHB 4A5KA 1IYFA 2D9VA 1UNPA 3PVUA 2DHZA 4CO7A 2KHWB 4PS3A 3VQIA 5AEKB 3U8ZA 1ZKHA 2LWPA 1IPGA 2L2IA 2EMTA 2KX3A 3AXCA 2CHXA 1MIZB 2KFKA 5C5BA 4KDIC 1CMXB 2J7QB 2JXXA 5CLLB 3I3TB 4B95A 4DX8A 2DKPA 1YQBA 1LFDA 2KQSA 1XX0A 4BOSC 2GMIC 5DIFB 2D9XA 2KN5A 4KAXB 3R66C 2DZMA 2EJ8A 4NJ6A 4EZLA 1U2BA 3A9JB 3BINA 2ZNVB 4F7HA 3DVNV 3OLMD 2N9XA 3O65B 1V80A 2BYFA 5C23A 4A6FB 1WY8A 3TCAA 4A3PA 1BTKA 4TUUA 3D8DA 5JLJB 1YX5B 2D10A 1UZXB 3DCGA 1I7AA 1GNUA 1H8CA 4JLCA 2ZPYA 1MKEA 5IA7A 2NBWB 3RZFA 1WIAA 2LRUA 2EC1A 4IW0A 2KGXB 2KK8A 4BKSD 3A98B 3MTNB 2N0YA 4HJKA 4MGIE 4HAXB 4FJYA 2DZIA 4DHJD 5C79A 3AI5A 2W2WA 4HDQA 1WXVA 2JWZA 1Y19B 4NQKE 2IYDB 3VTUA 2DFKA 2FNJB 3B1LX 1V49A 3ODWA 3K9OB 4PYZA 3RT3B 2LKOA 4KZ0A 5J3YA 3WAOA 2KLCA 3RYTA 1MK9B 1RFAA 2LBBA 1S1QB 3HHMA 2K8HA 2KWCA 3KSYA 2RSGA 4EMOA 1FGYA 2L7RA 2NVUI 2PJHA 2XQNM 3RZWC 4WQOB 3U30A 2DYNA 2JRHA 3QIJA 5L81A 2IY0B 2MBEA 2YT0A 4P7IA 2VKIA 1XT9B 2LGXA 3FSSA 2NMBA 2NS5A 1ZC3B 4HB3B 2LUEA 3KUZA 2Q13A 4GB9A 2KXJA 3VH3B 3ML9A 2KMCA 3MDBC 1B55A 1VCBA 2WX0A 3UINB 5E6NA 2BWFA 4B6HA 3APFA 1ACAA 3HM6X 4MEMA 2WX1A 4RM9A 2LVPA 2LRWA 5CHWA 5J18A 3AU4A 2WDTB 3SHQA 3VUWA 3PLVA 3Q3JA 3ENEA 2RPQA 4HATB 4HAYB 4MJSA 4ANUA 2VRWB 3SUZA 3TFMA 1E7UA 2OJRA 2IY1B 3ALBA 3ZIMA 4URKA 4JL9A 5D3YA 2KC2A 5HE0A 2FJ9A 2HJ8A 2FCNA 2XEWA 4WJOA 1MPHA 5IAAC 1YX6B 4A3OA 2NR2A 2A5UA 1UPRA 2FAZA 1V5UA 5J3QA 4G0NB 1C3TA 4ZRKA 1HE8A 2BPSA 2KTFA 3L10B 3UGBB 1D3ZA 1I35A 5GMVA 2YS1A 2REXA 2G3QB 1U5DA 1WX8A 3KY9A 1RLFA 1Z87A 2EKEC 2DHIA 3A4SC 3M1IB 3CMMB 4FADA 4I6LB 2G35A 2P0DA 2KDBA 2V76A 2Z0EB 3PRPB 4NAWB 4F7UP 2N23A 5EFXA 4W9KA 4WWOA 1X05A 3RULA 2IO1B 4NSWA 2DYQA 2MBQA 3P7ZA 2K25A 4Y94A 1EO6A 2RGNB 1OMWA 1XODA 4FBJB 2LZ6A 3V60A 2CS4A 3CSFA 3ZLZA 4LCDE 2FJLA 3ULBA 2WWZA 1E8WA 3D32A 2L0TA 3L13A 3PSEB 2GBRA 5CTRC 3ZTDA 1OQNA 4HB2B 1X1MA 4GIVA 4AUQC 4ANVA 4DHZE 2LOZA 3A9KA 3VHTC 3W1SA 4K17A 2D2QA 1BT0A 2LGYA 1FOEA 2ADZA 5D27A 1WRDB 2KWUB 2PE9A 2JP2A 2RGFA 3NY5A 2V4LA 1WJNA 2L05A 2DLWA 5G55A 1PQSA 4X57B 1KZ7A 1SGHA 2LVOA 1GC7A 4GOCA 1N3HA 3QHTA 1U5FA 1LXDA 4IC7B 2UZSA 2A4ZA 2BYEA 2KWVB 1EAZA 4ANXA 5L95C 2MP2A 1P1AA 3HQCA 4F8CB 5KCVA 2X18A 1KM7A 2CRFA 5HE1A 4KSLC 2G4SA 2K00A 3PVLA 3KRXA 3TL5A 1U4AA 4IAPA 2IBIB 3WALA 4GZUA 1EF1A 3GZNI 1HB6A 2DYMA 4I6NB 3NS8A 5DHFB 2OTXA 3PREA 3H7PA 1FGZA 2BWES 3SYXA 2KJRA 3QBVB 4TKNA 1RRPB 2J0KA 2GS0A 1DBHA 2PZ1A 2DYOA 1RJ2A 3DBLI 1NDDA 2M4NA 2DKQA 5JZEB 2RR9A 2AL6A 3O96A 4MT7A 4ZRJA 2DZJA 2MWSB 3ZVRA 5TR5A 3ZDMC 1WI0A 2HRJA 1BWNA 5C5BB 2K6DB 3WYFB 4II2B 1Z2MA 4PNKA 1H4RA 1V81A 5J3TA 3LJUX 1UD7A 2JPHA 2GBKA 1TQZA 2VSZA 2RUKB 5JP4A 3KYDD 4MGKE 1I2HA 1IP9A 5CHVC 5D3VA 2KUPA 4CYEA 1Q5WB 2K6QA 2L00B 1V89A 1Y5OA 1WJ6A 3PT2B 4KIKB 5D7GA 3A9JA 3A1QA 3AULA 3OAWA 2Y5BB 3VUXA 1J0WA 3PEGA 3DBHI 2P8VA 3KVFB 4BKTA 5LXHA 4WSFA 1UELA 3PVWA 5E6OA 1V9JA 2GOWA 2KLGA 4G11A 3UZTA 3VTVA 4WWPA 1PLSA 3ECIA 4AOFA 2KTRB 1L2NA 2M0XA 5C16A 2FIDA 4GDKB 4I6PA 1XKEA 2RD0A 3N7CA 3PSCA 1F9JA 5LXIB 4GXBA 1SIFA 2R2QA 3B08A 3R7QA 2QKMA 1NI2A 1ZM0A 2C7MB 4KZCA 4IG7B 3ZNGC 3Q3FA 1WMHB 2MRPA 4CHJA 5DI9B 1TBEA 2MBOA 4EFOA 2CHZA 2J0JA 3KRWA 1MIXA 4XX5A 3DXEA 1UNRA 2DENB
chains in the Genus database with same CATH superfamily
2KANA 4FJZA 4MSQB 2BYVE 3TBLD 1MJDA 3DVNU 1KLGD 2C7HA 2O2VB 3ZNZB 1J7BA 3ML4A 4TQ0A 1UNQA 2JZZA 2NBVB 3H6NA 1XLOA 4LDTD 3IG3A 4GGQA 3OJ4B 1BTNA 4KIKA 2WHIA 2B76B 3EGRA 5DHAB 1YN3A 4OVZA 3SBGA 1NU2A 1XCGA 1J0GA 2MW5A 4YTPB 4HDOA 1QOGA 3AE7B 4MSMB 2E3TA 3BWUD 2COPA 5BYRA 2JVCA 1OQYA 4FN2A 3VIAA 3AH7A 2JSVX 2YSZA 2WNMA 2KVZA 1QT9A 4CHKA 2ZPNA 3AEDB 4W9HA 1SXTA 5LONB 1S3SG 5HE3A 3PG7A 3AE6B 3LJ3A 4IUMB 4WWMA 4ARCA 1C77A 4HXDA 2HD5B 1J7AA 3D8FA 2MSED 2N1VA 4J6IA 1WXMA 3SHQA 4HCPB 3A9KB 1EGXA 2RLOA 2WXQA 3T06A 2R82A 5JHHA 3IHPC 4JKHA 1EF5A 1JROA 2DLBA 5DPRA 1BUIC 1FXIA 2N7DA 4IWOA 1RRBA 4AJWA 2HDEA 2QHOA 4BKSA 3NZSA 1XEEA 1AQCA 3AJ4A 1NBFC 3HM3A 2QSDA 2LVQA 5HHDG 3KLSX 1WXSA 5EDSA 3NS1A 1ZSQA 4XGAB 3EA6A 4PS8A 3PGEA 2M1MA 4KHAA 4KDLB 1B9RA 3I63C 2BW2A 3DDCB 4JK7A 4DHJB 1K5GB 3FLVA 4N9F4 1IRSA 3DQVA 1ENFA 4W9CA 4MDKE 1Q1OA 4WQMA 4H8SA 1P6SA 1U27A 2PIAA 1YMHE 1WGUA 2KTRA 1V5PA 2ABDA 2JYEA 5G5GA 1RAXA 2WYQA 1DDWA 4F7ZA 5AZGA 3ODXA 3W5VB 1YIWA 2Z4DA 1WVHA 3IVFA 3A8QA 3SDLC 4EOYA 3FC4A 3EPYA 1BAKA 1ZXHA 4JWUC 2LYDA 2PVGC 2FCMA 4YTNB 3NOBA 5M4YB 1UNSA 4JX1C 4KGTA 3H9DA 2ELAA 4HAVB 4HLEA 4JIOU 4MELA 2D3CA 4YONA 2I5CA 2Y3AA 2V0GA 1L0YB 1SBBB 3SFDB 2KWDA 1WZ3A 2W9NA 3E9SA 4WJNA 1T0QC 4IOIE 1QOAA 1GC6A 3HW2B 4JPSA 3TVVA 3AEEB 2JZ3B 3UQBA 3QJZA 5I2MA 4XWXA 3AMZA 4RGOS 2R0DA 3VUYA 1WM2A 2MLBA 1SB3C 2L76A 4ZYSA 3QQ8B 3RNEC 4CHMA 4FHKA 2M19A 1WX9A 1V5MA 2DHKA 4M00A 2IO3B 3GS2A 5AUKA 3DBRI 1D5ZC 3APCA 1C4PA 2IFSA 1C1YB 1ZC4B 2VZKD 4B9KA 5LLIA 4FJVB 3AE1B 3ZUNA 5DH9B 2LOXA 1LGRA 4HB4B 4L6EA 2MBBB 1WGGA 1NTYA 1ZUD2 4JGHB 1JRUA 4PS7A 4D0NB 1T0YA 1OEYJ 3EECA 1TS2A 4ASWC 4W9DA 2YRYA 2INNE 2OOBB 3QK0A 2KT7A 4R3DA 4P1BC 1WE7A 1WJMA 3BK2A 5FK9C 1UGMA 2KJ6A 2DNFA 3IT4B 3W2DA 2MDXA 1NYQA 2M14A 2O6VD 4ILGB 3CXBB 1I4GA 5D3WA 3V5WA 1QILA 3FKYA 4NPNA 1D5XC 4HPMB 1SJHD 1HBKA 2YT2A 1U5GA 4DBBA 3C8YA 3NVZA 1FCLA 1XLPA 1KOTA 1LO5D 3Q3NC 2MP2B 2RQ1A 1NVLA 3TW1A 1WGQA 3V3XA 3DWMA 3AEGB 2KOXA 5JVLA 4ZRIA 5BYSA 4HB0B 4NAMA 2D9VA 1UNPA 2D3AA 3TSSA 5TSSA 3VQIA 3HUIA 2K9XA 1MVKA 1IPGA 2KX3A 5IP4D 5C5BA 1YN4A 5CLLB 1YQBA 4A90A 2GMIC 5DIFB 2TSSA 1ROEA 2WXRA 2NMQA 4NJ6A 3BINA 4F7HA 3O65B 1V80A 2BYFA 4TUUA 3D8DA 1YX5B 1GNUA 2PLPA 1H8CA 2ZPYA 2NBWB 4BKSD 2KGXB 3A98B 3MTNB 4ARIA 3AI5A 3VTUA 1Y19B 4N59A 2EKIA 3B1LX 2LKOA 4KZ0A 2LMCA 4EMOA 1FGYA 2NVUI 1JWMD 1XT9B 2LGXA 3FSSA 2NS5A 1D4BA 1SIJA 3KUZA 2KMCA 1N61A 4MEMA 1ACAA 5CHWA 4KKIA 3VUWA 3Q3JA 3ENEA 4HEA1 4MJSA 4ANUA 1IGDA 5HE0A 2FCNA 1MPHA 4LNIA 1BXTA 4G0NB 1C3TA 2KTFA 3L10B 1I35A 1HQRD 2REXA 2JZPA 3KY9A 3CMMB 3M1IB 4P16A 1X05A 2IO1B 2QIEB 2MBQA 3Q14C 2K25A 3URYA 1UWXA 1XODA 2BS4B 1L0VB 4FBJB 3Q8BA 3NRZA 3N1YC 2GRIA 1TIFA 3BYTB 3AE8B 1E0ZA 1X1MA 1R4NB 3NWAA 3BVGA 2LGYA 1SSNA 1FOEA 1WRDB 5D27A 3DCXA 1KZ7A 1FNUA 1K51A 1K53A 1GC7A 2KWVB 4ANXA 2DBYA 1DOYA 3U12A 3Q8CA 2G9HD 3PVLA 4O1NA 2ZKMX 1U4AA 2RMMA 2ICIA 2WDVB 2WXOA 3H7PA 3QBVB 4C7ZA 2J0KA 3AV8A 2WXFA 4GOUA 5JZEB 2RR9A 2AL6A 2M0AA 2WXHA 3VRAB 4ILJA 1BWNA 5C5BB 2IGDA 1UD7A 5CHVC 5D3VA 2WXJA 1V89A 1Y5OA 1CJEA 5D7GA 5BMIA 3A1QA 3NVWA 4J3OD 4BKTA 3DBHI 2P8VA 1UELA 3VTVA 3PVWA 3DWGC 1PLSA 3ECIA 4HSIA 1MG4A 2FIDA 3EFCA 4I6PA 1F9JA 1SE2A 4GXBA 5EE1A 3E66A 4IG7B 3ZNGC 3Q3FA 1WMHB 5I2SA 1TBEA 2MBOA 1JDEA 1DYQA 4XX5A 1UNRA 2FCSA 1N5XA 2PEAA 3SU8X 3SR6A 1I4PA 1EWCA 1E8ZA 4LK0M 4OHJA 3N1ZC 3QWMA 2MCNB 2BQQA 3APDA 1ET6A 2AEHA 3ZNID 4W9FA 4BBNC 3B2FA 3KYCD 1W1GA 4BKGA 2VRRB 3ZW3A 4NNJB 5I4DA 1ZVRA 4MJSB 2ON8A 1KFYB 2AYOB 1AWEA 3FP5A 2G1EA 2QILA 2GBJA 2UYZB 1WXQA 4ITKA 4PQ0A 1KI1B 1C79A 1FHOA 5JH5C 3PS6A 3SEBA 3ZQ4A 3CF6E 4XDCA 4WIPA 4NAWA 2KDMA 3BY4B 1UEFA 3B77A 2KZRA 3E9OA 4G50A 5EE0A 1DGJA 3RPFC 1WGHA 2ROZB 2KD0A 4HK2A 1U29A 5JHGA 4MM3A 4QAYA 2WXMA 1WGDA 3ODOA 2XK5B 3DBSA 3I57A 3QC8B 4IWPA 2Z0QA 2DTCA 4RH6A 2KDEB 2J42A 4IOYX 3RCPA 2DX1A 1FPYA 3AM9A 1K8RB 2IO2B 1LQBA 1KBLA 4MACA 2N7JA 2B3AA 5E6PA 3VDZA 1HTQA 3I9V1 3QWZB 4EZJA 4YXDB 2L8JA 1E90A 2JF5A 5LOPB 2PVOD 4EKUA 1ZW7A 4HAUB 4GN1A 3PO0A 1W1HA 4YWGG 4KHBA 2YS3A 3GYOA 4IFSA 2ZCBA 2LASA 3D8EA 1UF0A 3U52E 4D2KA 4HCNB 5D3DA 3M63B 4LNFA 1UBQA 1Y56A 1DROA 3BVMA 4XC2A 4AS1A 3DVGY 5LG4B 3T9LA 2JRIB 1DDVA 3RNGC 4ZYNA 4W9JA 2JWUA 2NCNA 4OZCA 1MPEA 2COFA 1QOFA 4JKGA 1XD4A 2BF8B 1AYFA 3RNAC 2RVBB 1T6BX 1MI0A 2RSUA 1N5WA 4HPLB 4HKQA 1FHXA 1HXYD 2CY5A 3JW0X 4KHBB 3K9PB 2YVCA 3W1SC 1L4ZB 1VLBA 1X1FA 2ELBA 1J19A 1UBIA 1V1PA 2J0MA 3U2SC 4ANWA 4E74A 3MC8A 4HAZB 3AU5A 1I4QA 4PYUA 1DOIA 2FJUB 4WJ7A 2QJLA 1HZ6A 3L17A 2WH5A 3WAMA 3M62B 4E3CA 2XBBC 1TY0A 1P98A 1TTNA 2YS5A 2WDRB 4HHVA 4OZBA 1FXTB 3GZNB 2IYBA 3ZRFA 4GMVA 5DCNA 2CKHB 3WANA 2KFKB 2ZVOA 3BK1A 1ZDVA 4DXAB 2BKFA 1GJZA 3ETRA 1SJED 1FB8A 5AUIA 2ZNVC 3ENBA 2RDBC 1HB8A 3TEXA 1NEKB 2PE6B 4XYCA 3GYPA 4Z2NA 1ZP0B 2KFJA 1PFJA 4C56C 2QCZA 3L0WB 4HKZE 1TGZB 4RMAA 3PZDA 3UQAA 1L6VA 4HRSA 2CR5A 4YSZB 2EMSA 4DX90 2JUOA 2P0HA 2XK5A 1WGYA 4PT5A 1L6UA 2J59M 4YSXB 1C9FA 2D5GA 1X1GA 4KX6B 2K2JA 2Z13A 4TV3A 5FKAC 2C5LC 2K5PA 4P1CC 5JHBA 4LLGM 4DDGD 3NSUA 2BKRB 3B0AA 5FI1A 1WM3A 5T8IA 4AWJA 4HVBA 2QKLA 5IJMA 3GOEA 3KUCB 4RGMA 1T5XD 1E8YA 1P5TA 2DZKA 1N6ZA 4RGNA 1IBXA 2NPTB 2LG1A 1N60A 3LXFA 4A6KA 2Y5CA 3VFKA 3DXDA 2KN4A 1PGXA 3QX1A 3RD2A 1TKGA 3ONSA 1VD2A 3VR8B 3L16A 4RM9A 5FR3A 3SD5A 3JSVB 3PHXB 1OFFA 1M7EA 1M7RA 3BVZA 4K7WA 1V88A 1KTKA 1MG8A 1C4AA 3DVGX 5C1ZA 4K1RB 2XNAC 1U5EA 2GUMA 1CQVA 2RNRB 4A9AA 1PMSA 2NZ8B 2ZW1A 1ZGUB 1GAQB 5KQ4A 2IGGA 3N3KB 3VOQA 5CX3A 2UZRA 1KLVA 4HWIB 4QJ5B 5CHFA 1WRIA 4NQLB 3P63A 1QQGA 2KC1A 2MH7A 2N7EA 3NZUA 4YL8A 4IM2A 3TJPA 3BJIA 1YJIA 4AP4C 2CJOA 2KO3A 1WX7A 2LGIA 2CODA 4WJQA 4B0EA 2ROVA 3H7PB 4YSYB 2LUMA 1P7EA 4PS3A 3U8ZA 1XCQL 4JK8A 2CHXA 3BIID 4L1BA 2J7QB 4B95A 4BOSC 1LFDA 2KQSA 4KAXB 5BYQA 2EJ8A 3P42A 2PW9A 2ZNVB 3DVNV 3OLMD 3TCAA 1BTKA 2LGSA 5JLJB 4HPPA 4ZOHC 2YEPB 1MKEA 3RZFA 1WIAA 2LRUA 2N0YA 1RM6C 1KRHA 2W2WA 1VZ6A 3Q8AA 1FNWA 3LYYA 3FILB 1B1ZA 3K9OB 1JMLA 2Z59A 2BVCA 1S1QB 3HHMA 3IT6B 3E56A 3KSYA 4WAFA 2L7RA 3MC0B 3RZWC 3P4RB 4NJCA 5EE9A 2O2VA 4P7IA 2VKIA 1PUTA 4HB3B 4TSSA 2FBWB 3I5JC 2Q13A 4GB9A 3MDBC 3U4EG 1VCBA 2WX0A 2WXIA 3UINB 5E6NA 3HM6X 2WX1A 5J18A 2LVPA 2X0SA 1F1HA 3TFMA 1E7UA 2OJRA 2Z8LA 1FMAD 5D3YA 3T3NA 2FJ9A 4YTMB 5IAAC 1D6EC 1I4HA 4A3OA 2FAZA 1N63A 2JU6X 1XO3A 1HE8A 4LNOA 1E6EB 2JX5A 2QMTA 2G3QB 3DBRB 2SAKA 1TZOA 4P6VF 2V76A 1HTOA 4WWOA 3W9CB 4LNNA 4Y94A 2LZ6A 2CS4A 3ZLZA 4LCDE 2FJLA 3RFZB 1E8WA 3L13A 2L0TA 5CTRC 1I4XA 2WS3B 3W1SA 1FRRA 1BT0A 2PE9A 2JP2A 1TJEA 2V3NA 3ABVB 5G55A 4QJ3B 1N3HA 4IC7B 1LXDA 1R4MB 2RRFA 2A4ZA 2BYEA 1P1AA 4HROA 2CJNA 2X18A 2CRFA 3NJTA 1TY2A 4IAPA 4ZHOA 2IBIB 3WALA 1EF1A 1HB6A 2KMMA 3NWFA 2OTXA 3PREA 3SYXA 1RRPB 2PZ1A 1RJ2A 5EE3A 2FUG1 2DKQA 1DOXA 3O96A 1XLNA 4ZHPA 2INPE 5TR5A 3C19A 1FNVA 2K6DB 1Z2MA 4PNKA 3TEZA 1V81A 3B2GA 3LJUX 2JPHA 4NZLB 1TQZA 1IP9A 2RUKB 1I2HA 4CYEA 2L00B 4KIKB 3VUXA 3KVFB 1ACCA 3AEAB 3H8HA 3AE5B 4AOFA 2L52A 1F77A 2RD0A 3PSCA 2V3PA 1SIFA 3B08A 1ZDXA 3R7QA 4ZRQA 3AEFB 2NTTA 4A8XC 3DHHC 3KRWA 4C00A 1L5PA 4GSWA 2KIGA 1WGRA 4XZ4A 3KZ1A 2KDIA 2BTEA 2WXLA 1UWMA 2GCJA 3KW5B 3RUIB 1FXAA 4K3CA 2D9YA 4M8MA 3TIXA 3P4PB 2K8EA 5G5HA 4DQOC 3LDZE 3V6CB 4GDLA 1E7PB 3NVYA 3X0WA 3G9WA 3QARA 1VBHA 1SE3A 5J17A 4WAAA 4FLHA 2K1FA 3AE4B 2KVRA 3TEYA 3DXCA 2V1YA 1F2RI 1GGOA 1PGAA 1TXDA 2LFIA 4REZA 1ISNA 1WMHA 5D3IB 3Q3MC 1R7SA 2Z0DB 2HTHB 3N30A 5KHQA 2UVMA 3JVZX 1UPQA 5DPTA 4GMXB 3KWLA 5J2RA 2K2UA 1E7VA 2PKOA 1X86A 2AWTA 4A6HA 4MT5A 2ZCCA 2D9ZA 2BB5A 1WE6A 1XCTL 1VR9A 1I7HA 4C0AA 2Z14A 2DN6A 2COCA 1ZPSA 2O6VB 4IM0A 3GP7A 3H7SA 2WLBA 4M0WA 1WG7A 2BCJA 2C60A 3HVDA 1OTRB 4S17A 2KCJA 1WH3A 4KGRA 1WF9A 3M95A 1LW3A 3C0RB 2IDYA 2ZJDA 3ZKJC 2RDGA 2LJ5A 2KYWA 2LGDA 1AWDA 2UU7A 1P3RA 5IKCM 4RF1A 3A8PA 4EEWA 2K8BA 4RNAA 3MC9A 1X11A 3PPAA 4ICUA 1QC6A 4H2AA 3AEBB 4FHJA 2N1WA 4L23A 3QA8A 3X23A 4KVGB 2DAJA 1MFWA 3A58A 2LHEA 3PV1A 1A70A 2XN9C 4US9A 2L83A 1NENB 2HJ1A 5AZFA 3RNCC 3HVZA 2R2YA 3A1QB 1NYRA 2W3RA 1E8XA 2K0PA 2I5FA 1TYGB 3AE2B 1L0XB 4DK5A 4RGTA 2FCQA 1AN8A 1WJ4A 3PTFC 1WXAA 2ASQA 5HE2A 1F52A 2JQRB 1P9DU 1VJKA 4EJNA 2OQBA 5L83A 1V2YA 3R8BA 3R3MA 1J8CA 2FIFA 4F1SA 4MGYE 1NVID 2WP9B 2MFQA 2WXKA 2YT1A 2AQ1B 1FCCC 1UGJA 3VTWA 1V8CA 5JHAA 2R61A 1FAOA 5FI0A 1SE9A 2QDFA 4GDLB 2WXNA 2P0FA 5KHOA 1T0RC 3P6AA 3HK0A 2KMAA 2JT4B 3P4QB 3U7ZA 1GG3A 1YD8U 3SBTA 5HKHA 1WJUA 4A55A 2E2XA 2IO0B 4DHZB 3NUHB 4NJ7A 3NW8A 1YJ1A 2V9HA 1TT5B 4RF0A 1E5WA 2UWQA 2INCC 2K3UA 4LJOB 2LI5A 5D6JB 2HTHA 4II3B 2KX0A 4IKGA 1XR0B 2VH2A 4LDTB 3NG0A 4WJPA 2CHWA 1WFYA 3TEWA 2KDFB 1GB1A 1A5RA 3EFUA 4GLSC 2BYTA 2BBCA 2H89B 1TJ6A 4K2PA 1FFUA 4BZAA 3WIMA 5JXVA 2BB6A 4KSKC 2K39A 3E9LA 4S0RA 2MJDA 3HRDD 3P4SB 3V05A 3ZO5B 2CU1A 1FD6A 1KLUD 1K5DB 4EUTA 3ZDTA 2RPVA 4EZKA 2GBNA 1I4RA 2W2XD 2CAYA 1K50A 3N32A 3CIKA 3ML8A 4DDID 2N4FA 5H92C 3W1YA 1WI1A 2DHJA 3HIZA 2INDC 1ZYIA 4JKBA 1QZEA 2LXAA 2KIEA 4JKCA 3SV1A 1ET9A 3DOWA 3FVCA 5D94A 2BS2B 2MEKA 3RMKC 4DWFA 2PMVA 3UIOB 4OSNA 3OJ3A 5D2MB 3VXWA 2DA0A 1P0RA 1SHCA 2FUHB 4K7SA 3V6EB 1WYGA 1JWAD 3IXSA 4BVUC 4G3XB 1GOZA 1V86A 2J53A 3V62A 3HSAA 1JALA 2I1JA 2H7DA 5FR6A 4W9EA 3AN1A 3JYUA 2LULA 3TO1A 4A6FA 2Y5PA 2IGHA 1V5OA 3PLUA 2OHFA 4W9IA 1WYWB 1XXGA 2N9PC 2L1CA 2NPTA 1OQQA 4L2YA 4ZDVA 1MK7B 4XWWA 2JY6A 2D3GA 2MA9B 2E6XA 4W9GA 1N62A 2COAA 3NHEB 3H1UA 2Z59B 4OW0A 3LB8C 2H7EA 3BZDB 3WCQA 2DX5A 1D5MC 4A5KA 1HA5A 3AECB 5LXIB 2DHZA 3Q6BA 2LWPA 5IOIA 2L2IA 1MIZB 1K52A 1CMXB 3I3TB 4JK9A 4DX8A 2ONQA 1MI1A 3R66C 2BT6A 1U2BA 3A9JB 5C23A 3N1XC 1KF6B 3R2TA 4A6FB 1J7CA 3DBHB 5IN7A 2D10A 1UZXB 3DCGA 1I7AA 1JWBD 1WSPA 4IW0A 4HJKA 4MGIE 4HAXB 4DHJD 2WDQB 1MHHE 4HDQA 1WXVA 2JWZA 2IYDB 2L1AA 4MH8A 2DFKA 2FNJB 3RT3B 3WAOA 3RYTA 2D3BA 1IGCA 1RFAA 2N9LA 2K8HA 3IAM1 2KWCA 2XQNM 4WQOB 3U30A 2IY0B 2MBEA 2NMBA 1SE4A 2LUEA 3VH3B 2KXJA 2KQ4X 2VH1A 2LJIA 3APFA 1NI3A 3FAHA 3AU4A 2WDTB 3GE3C 4HATB 4URKA 3ALBA 4WJOA 1YX6B 4JKDA 3VR9B 2KR0A 5BMHA 3MJ5A 1UPRA 4ZRKA 2BPSA 3UGBB 5GMVA 4N58A 1WX8A 1Z87A 3A4SC 2K22A 2G35A 2KDBA 2Z0EB 4W9KA 2OEDA 1YNTE 2X38A 1OMWA 3CSFA 1VZ8A 2WWZA 2GBRA 4DHZE 4K17A 4BAXA 2ADZA 2KWUB 1YOVB 1VDVA 1T3QA 3RNBC 4X57B 1SGHA 4GOCA 3QHTA 3VRBB 5L95C 1JQ4A 1F2RC 1EAZA 2MHJA 3DHGC 4F8CB 3GB1A 4KSLC 4ACFA 2H88B 4JE3B 3TL5A 2OJWA 3GZNI 4I6NB 1ESFA 3NS8A 1XF5L 1FGZA 2BWES 2GS0A 3DBLI 1NDDA 4MT7A 2DZJA 4ZRJA 3ZVRA 3ZDMC 1WI0A 2HRJA 1H4RA 1TKYA 1E10A 5J3TA 4MGKE 2VSZA 5JP4A 2K6QA 2W54A 3PT2B 2X8XX 4A6QA 2Y5BB 3PEGA 4XE0A 4K3BA 1V9JA 4G11A 3UZTA 4LNKA 1L2NA 2KTRB 4CQNA 1FFVA 1XKEA 3N7CA 3ZJVA 2C7MB 4WH4A 4AQ7A 1QLBB 2MRPA 5DI9B 4EFOA 3Q8FA 2J0JA 5IO9A 1AARA 1KJTA 1EUVB 4OVUA 3MP9A 4BFRA 4GU2A 3IFWB 2DWQA 1KZGA 3Q2AC 2BGFA 5DPSA 4K2OA 3RN9C 2MWNB 1PFDA 5HFYA 2KUQA 3OANA 1F0ZA 3VVWB 2M38A 3NZ3A 1G6JA 4M0WB 2Q5WD 1M94A 4JQWC 1JRPA 2KQ7A 2L32A 4ICVA 5HG2A 2NBUA 3V61A 2IPKD 1UUPA 1RYJA 4JKAA 4GDKA 1V1OA 2N9KA 1C4CA 3CWIA 1WR6E 3KH0A 5C6RA 4WWNA 1M4VA 2WU2B 1R4MI 3BYYB 2FDQA 1WJ1A 3F0WA 1XQQA 4W9LA 2WXGA 3T8MA 2K49A 3SO6A 4ZRPA 2DAFA 2MJ3A 3KWVA 2M17A 4ILHA 2AQ2B 4FULA 3VAWA 3WA0A 1EM7A 2JYTA 4LJPB 2GI9A 3PRZA 4IDIA 2CQUA 4KHOA 4OVVA 4DIXA 1QKZA 3RCZA 1HEZE 1QOBA 2W2XC 1MAIA 1L7YA 3ZNHB 1P3QU 4DXFA 2YF0A 4JKEA 2K8CA 3KQ4A 2G45B 3UIPB 5C3JB 3QCAA 1BMLC 3TMPB 2GJYA 2MKRA 1H10A 2EELA 4XDDA 2JXTA 2D07B 3IAS1 1C78A 4YT0B 2HE7A 3L08A 3TUOA 4EE2A 3OG5A 5DPWA 4USAA 4NY0A 2C9WB 4KKJA 3EHVA 1FEHA 4TQ1A 5D3XA 4KGSA 2D9WA 3L4PA 3HIEA 4IM3A 2KKCA 1WR1A 2LEKA 4DBGA 2QEJC 1FIQA 1LB1A 2W3SA 1VRAB 2ZZPB 3WAPA 2IJ0A 2GCLA 2YLMA 4F7GA 4OZAA 2D4QA 3DPDA 1WZ0A 3MJWA 1OGWA 4D6WA 4XWTA 4B6WA 2ZVNA 1Q67A 1V5TA 2W82A 1V97A 1EVHA 4RCOA 4MK0A 1NTVA 2Y8GA 2WXPA 1OY2A 1TS3A 2KACA 2MQJA 1TKEA 5KQ1A 2J52A 3ZXVA 4IWQA 3DHIC 3RNFC 2ACZB 2NBVA 4C7YA 1CK1A 1P7FA 1Q0WB 4US8A 2N9EB 3PZ7A 4RM8A 1EWYC 1VBGA 2KAJA 3EUB2 2WU5B 1HZ5A 4K7UA 2DX5B 4WVFB 2GBMA 2Z0OA 3ZXRA 2G4DB 2ZW0A 3L54A 2BS3B 2L3ZA 2Y8FA 1NTIA 2DIKA 3EC8A 3N20C 4MH0E 2PTLA 4N6EB 3S2AA 5HI1A 1EU4A 2R2OA 1GUAB 2N0SB 1I42A 4BOZB 1ZOYB 5IRSA 3KUDB 1V1PB 1YN5A 1ST7A 3UF8A 3OHMB 4M8NA 3PP2A 4MM3B 4B0MA 4A20A 1CZPA 4TYZA 1UH6A 2O6VA 3ZRCA 4HAWB 4Z2MB 2LD9A 4MGZE 4JKFA 3Q3OC 5GOWB 4KV2A 3MPXA 1XD3B 5AZHA 1YQ3B 2I38A 1RFKA 1T77A 1IUEA 2AL3A 2VZKB 4WURA 1TS4A 3DBLB 4K81A 5CLQB 1GPXA 3VH4B 1OQRA 3N9YC 3ULCA 1V6EA 3FM8C 2L0FA 4C4VB 3A4RA 2ZEQA 3R7RA 3IBEA 1LM8B 1DYNA 2IZVB 3PHWB 2LXCA 1JWSD 3MHSD 1SEBD 2C7NB 5BO4B 4AJYB 1STEA 1TZ1A 1R4NI 5C2TB 4CSQA 2I1KA 1OEYA 1GB4A 3CSTA 4MY6A 1W1DA 2HTME 4GPTB 2V3SA 2Y7BA 2CB8A 2D11A 4JKGB 2CU3A 1FHWA 2Z0PA 3F5RA 1AW7A 3ZVVA 4FA6A 1Q10A 3P2BA 3U7DA 5GXGB 3M3JA 5G2NA 1FM0D 1DDMA 3MFGA 3NVVA 2DYBA 1V61A 3A33B 3NWDA 2MX2A 3AE3B 1Z5SB 2J4XA 4HJGE 1SF0A 3SNHA 3FEHA 1Y8RC 2M8SA 1DIKA 3ZTCA 1JW9D 2MBHA 1IBXB 3O13A 2KNBA 4BBKA 4M01A 3QAQA 2FE8A 2CY4A 3PRMB 3FILA 4DXGA 2R09A 4E71A 4BBNF 1YQ4B 2V4IB 2PPHA 3B9JA 3JSVA 3RI7C 1PGBA 1WWTA 2KJHB 1IYFA 3PVUA 5AEKB 4CO7A 2KHWB 1KC7A 1ZKHA 2EMTA 1JCKB 3AXCA 2KFKA 2AQ3B 4KDIC 2JXXA 1JWUD 4QJ4B 2DKPA 4OT1A 1XX0A 1KH0A 3Q8EA 2D9XA 2KN5A 1QF6A 2DZMA 5E6JA 4EZLA 4UDUC 4M02A 2N9XA 3Q69A 1WY8A 4A3PA 3W5UB 4JLCA 5IA7A 4RFBA 1L4DB 2EC1A 4GNKB 2KK8A 2NTSA 4FJYA 2DZIA 5C79A 2RDHA 4NQKE 2YEPF 2LHDA 3AE9B 4PYZA 1V49A 3ODWA 5J3YA 2KLCA 1MK9B 2LBBA 2RSGA 2PJHA 2DYNA 4QXAB 2JRHA 3QIJA 5L81A 1EU3A 2WQYB 2YT0A 1T0SC 1ZC3B 5LNK1 1C76A 3ML9A 5H8YE 1B55A 3P1MA 2BWFA 4B6HA 2LRWA 3PLVA 2RPQA 4HAYB 1QQRA 2VRWB 3SUZA 4C4VA 2IY1B 3ZIMA 4JL9A 2GB1A 2KC2A 2HJ8A 2XEWA 4L1RA 3SFEB 2NR2A 2A5UA 1V5UA 5J3QA 1TS5A 1D3ZA 2YS1A 1U5DA 1RLFA 4FADA 2EKEC 2DHIA 4C80A 4I6LB 2P0DA 3PRPB 4NAWB 4F7UP 3ZJTA 2N23A 5EFXA 2MJEA 3RULA 4NSWA 2DYQA 4PK1A 3ZJUA 3P7ZA 2W55A 1EO6A 3ZYYX 2RGNB 3AB5A 5BMGA 3V60A 3ULBA 3ZTDA 3D32A 3PSEB 1OQNA 4HB2B 4GIVA 4AUQC 4ANVA 3E9PA 1ZXIA 2LOZA 3ZGZA 3A9KA 3UI3A 3VHTC 2D2QA 4TMAB 2RGFA 1ZE3D 3NY5A 2V4LA 1PYWD 1WJNA 2L05A 2DLWA 1E9MA 1PQSA 1MHXA 2SEBD 2LVOA 3PZ8A 1U5FA 1VZ7A 2UZSA 2MP2A 3HQCA 5KCVA 1KM7A 1RWSA 5HE1A 2G4SA 2K00A 3KRXA 4GZUA 2DYMA 1XLQA 2WGSA 5DHFB 3GE8C 2KJRA 2M56B 4TKNA 4FXCA 1DBHA 2DYOA 4Q2JA 2M4NA 2GLSA 3J9CA 1YJJA 2MWSB 3WYFB 4II2B 3R2IA 1PDXA 1FRDA 2GBKA 3KYDD 1Q5WB 2KUPA 1WJ6A 5MPOA 3A9JA 3AULA 3OWEB 3OAWA 1J0WA 1FO4A 4LTUA 4WSFA 5LXHA 5E6OA 2GOWA 2KLGA 2QC8A 4WWPA 3T3OA 2I2YA 2M0XA 5C16A 1WGKA 4GDKB 2R2QA 2QKMA 1NI2A 1ZM0A 4KZCA 4CHJA 2AX5A 4JWSC 3MHZA 3CIRB 2CHZA 1MIXA 3DXEA 2DENB
chains in the Genus database with same CATH topology
2KANA 4FJZA 4MSQB 2BYVE 3TBLD 3DVNU 2C7HA 2O2VB 3ZNZB 3ML4A 4TQ0A 1UNQA 2JZZA 2NBVB 3H6NA 4LDTD 3IG3A 4GGQA 3OJ4B 1BTNA 4KIKA 5DHAB 3SBGA 1NU2A 1XCGA 1J0GA 2MW5A 4HDOA 4MSMB 2COPA 2JVCA 1OQYA 4FN2A 3VIAA 2YSZA 4CHKA 2ZPNA 4W9HA 5LONB 1S3SG 5HE3A 3PG7A 3LJ3A 4IUMB 4HXDA 2HD5B 3D8FA 2MSED 2N1VA 4J6IA 1WXMA 3SHQA 4HCPB 3A9KB 1EGXA 2RLOA 3T06A 2R82A 5JHHA 3IHPC 4JKHA 1EF5A 5DPRA 2N7DA 4IWOA 1RRBA 4AJWA 2QHOA 4BKSA 3NZSA 1AQCA 3AJ4A 1NBFC 3HM3A 2LVQA 1WXSA 5EDSA 1ZSQA 4PS8A 3PGEA 2M1MA 4KHAA 4KDLB 3DDCB 4JK7A 4DHJB 1K5GB 3FLVA 4N9F4 1IRSA 3DQVA 4W9CA 4MDKE 1Q1OA 4H8SA 1P6SA 1U27A 1WGUA 2KTRA 1V5PA 2ABDA 1RAXA 2WYQA 1DDWA 4F7ZA 5AZGA 3ODXA 1YIWA 1WVHA 3IVFA 3A8QA 3SDLC 4EOYA 3EPYA 1BAKA 2LYDA 2FCMA 3NOBA 3H9DA 2ELAA 4HAVB 4HLEA 4JIOU 4MELA 4YONA 2I5CA 1WZ3A 2W9NA 4WJNA 1GC6A 3HW2B 3TVVA 2JZ3B 3UQBA 3QJZA 4XWXA 2R0DA 3VUYA 1WM2A 2MLBA 2L76A 3QQ8B 4CHMA 4FHKA 1WX9A 1V5MA 2DHKA 2IO3B 3DBRI 3APCA 2IFSA 1C1YB 1ZC4B 4B9KA 5LLIA 4FJVB 3ZUNA 5DH9B 2LOXA 4HB4B 4L6EA 2MBBB 1WGGA 1NTYA 4JGHB 1JRUA 4PS7A 4D0NB 1T0YA 1OEYJ 3EECA 4ASWC 4W9DA 2YRYA 2OOBB 3QK0A 1WE7A 1WJMA 1UGMA 2KJ6A 2MDXA 2M14A 2O6VD 4ILGB 3CXBB 5D3WA 3V5WA 4NPNA 4HPMB 1HBKA 1U5GA 4DBBA 1KOTA 2MP2B 2RQ1A 1NVLA 3TW1A 1WGQA 2KOXA 5JVLA 4ZRIA 4HB0B 2D9VA 1UNPA 3VQIA 1IPGA 2KX3A 5C5BA 5CLLB 1YQBA 2GMIC 5DIFB 4NJ6A 3BINA 4F7HA 3O65B 1V80A 2BYFA 4TUUA 3D8DA 1YX5B 1GNUA 1H8CA 2ZPYA 2NBWB 4BKSD 2KGXB 3A98B 3MTNB 3AI5A 3VTUA 1Y19B 3B1LX 2LKOA 4KZ0A 4EMOA 1FGYA 2NVUI 1XT9B 2LGXA 3FSSA 2NS5A 3KUZA 2KMCA 4MEMA 1ACAA 5CHWA 3VUWA 3Q3JA 3ENEA 4MJSA 4ANUA 5HE0A 2FCNA 1MPHA 4G0NB 1C3TA 2KTFA 3L10B 1I35A 2REXA 3KY9A 3CMMB 3M1IB 1X05A 2IO1B 2MBQA 2K25A 1XODA 4FBJB 1X1MA 2LGYA 1FOEA 1WRDB 5D27A 1KZ7A 1GC7A 2KWVB 4ANXA 3PVLA 1U4AA 3H7PA 3QBVB 2J0KA 5JZEB 2RR9A 2AL6A 4ILJA 1BWNA 5C5BB 1UD7A 5CHVC 5D3VA 1V89A 1Y5OA 5D7GA 3A1QA 4BKTA 3DBHI 2P8VA 1UELA 3VTVA 3PVWA 1PLSA 3ECIA 2FIDA 4I6PA 1F9JA 4GXBA 3E66A 4IG7B 3ZNGC 3Q3FA 1WMHB 1TBEA 2MBOA 1JDEA 4XX5A 1UNRA 2FCSA 2PEAA 3SU8X 1E8ZA 3QWMA 2MCNB 3APDA 2AEHA 3ZNID 4W9FA 4BBNC 3KYCD 1W1GA 4BKGA 2VRRB 3ZW3A 4NNJB 1ZVRA 4MJSB 2AYOB 1AWEA 3FP5A 2UYZB 2GBJA 4PQ0A 1KI1B 1FHOA 5JH5C 3PS6A 3CF6E 4NAWA 3BY4B 1UEFA 2KZRA 3E9OA 4G50A 1WGHA 2ROZB 2KD0A 4HK2A 1U29A 5JHGA 4MM3A 1WGDA 3ODOA 2XK5B 3DBSA 3QC8B 4IWPA 2Z0QA 2DTCA 2KDEB 4IOYX 3RCPA 2DX1A 1K8RB 2IO2B 1LQBA 1KBLA 2B3AA 5E6PA 3VDZA 3QWZB 4EZJA 2L8JA 1E90A 2JF5A 5LOPB 4EKUA 1ZW7A 4HAUB 4GN1A 1W1HA 2YS3A 3GYOA 4IFSA 2ZCBA 2LASA 3D8EA 4HCNB 3M63B 1UBQA 1DROA 4XC2A 3DVGY 3T9LA 2JRIB 1DDVA 4ZYNA 4W9JA 2NCNA 2COFA 4JKGA 1XD4A 2BF8B 2RVBB 2RSUA 4HPLB 1FHXA 3JW0X 2CY5A 3K9PB 4KHBB 3W1SC 2YVCA 1X1FA 2ELBA 1J19A 1UBIA 2J0MA 4ANWA 4E74A 4HAZB 3AU5A 4PYUA 4WJ7A 3L17A 2WH5A 3WAMA 3M62B 4E3CA 2XBBC 1P98A 1TTNA 2YS5A 4HHVA 1FXTB 2IYBA 3ZRFA 4GMVA 5DCNA 2CKHB 3WANA 2KFKB 2ZVOA 4DXAB 2BKFA 1GJZA 1FB8A 2ZNVC 3ENBA 1HB8A 2PE6B 3GYPA 4Z2NA 2KFJA 1PFJA 3L0WB 1TGZB 4RMAA 3PZDA 3UQAA 2CR5A 2EMSA 4DX90 2JUOA 2P0HA 2XK5A 1WGYA 2J59M 1X1GA 2K2JA 4TV3A 2C5LC 5JHBA 4DDGD 3NSUA 2BKRB 3B0AA 5FI1A 1WM3A 4AWJA 4HVBA 2QKLA 5IJMA 3GOEA 3KUCB 1E8YA 1P5TA 2DZKA 2NPTB 2LG1A 4A6KA 3VFKA 3DXDA 3QX1A 3RD2A 3ONSA 1VD2A 3L16A 4RM9A 3SD5A 3JSVB 3PHXB 1M7EA 1M7RA 4K7WA 1V88A 1MG8A 3DVGX 5C1ZA 4K1RB 1U5EA 2RNRB 1PMSA 2NZ8B 1ZGUB 5KQ4A 3N3KB 3VOQA 5CX3A 2UZRA 1KLVA 4HWIB 5CHFA 4NQLB 1QQGA 2KC1A 2N7EA 3NZUA 4YL8A 4IM2A 3TJPA 3BJIA 4AP4C 2KO3A 1WX7A 2CODA 4WJQA 2ROVA 3H7PB 4PS3A 3U8ZA 4JK8A 2CHXA 2J7QB 4B95A 4BOSC 1LFDA 2KQSA 4KAXB 2EJ8A 2ZNVB 3DVNV 3OLMD 3TCAA 1BTKA 5JLJB 1MKEA 3RZFA 1WIAA 2LRUA 2N0YA 2W2WA 3K9OB 1S1QB 3HHMA 3KSYA 3RZWC 2L7RA 2O2VA 4P7IA 2VKIA 4HB3B 2Q13A 4GB9A 3MDBC 1VCBA 2WX0A 3UINB 5E6NA 3HM6X 2WX1A 5J18A 2LVPA 2X0SA 3TFMA 1E7UA 2OJRA 5D3YA 2FJ9A 5IAAC 4A3OA 2FAZA 1HE8A 2G3QB 2V76A 4WWOA 4Y94A 2LZ6A 2CS4A 3ZLZA 4LCDE 2FJLA 1E8WA 3L13A 2L0TA 5CTRC 3W1SA 1BT0A 2PE9A 2JP2A 5G55A 1N3HA 4IC7B 1LXDA 2A4ZA 2BYEA 1P1AA 2X18A 2CRFA 4IAPA 2IBIB 3WALA 1EF1A 1HB6A 2OTXA 3PREA 3SYXA 1RRPB 2PZ1A 1RJ2A 2DKQA 3O96A 5TR5A 2K6DB 1Z2MA 4PNKA 1V81A 3LJUX 2JPHA 1IP9A 1TQZA 2RUKB 1I2HA 4CYEA 2L00B 4KIKB 3VUXA 3KVFB 4AOFA 2RD0A 3PSCA 1SIFA 3B08A 3R7QA 3KRWA 4GSWA 1WGRA 4XZ4A 3KZ1A 2KDIA 2GCJA 3KW5B 3RUIB 2D9YA 4M8MA 3TIXA 3LDZE 3V6CB 4GDLA 3X0WA 3G9WA 3QARA 1VBHA 5J17A 4WAAA 4FLHA 2K1FA 2KVRA 3DXCA 2V1YA 1GGOA 1TXDA 1ISNA 1WMHA 2Z0DB 2HTHB 3N30A 5KHQA 2UVMA 3JVZX 1UPQA 5DPTA 4GMXB 5J2RA 2K2UA 1E7VA 1X86A 2AWTA 4A6HA 2ZCCA 2D9ZA 1WE6A 4C0AA 2DN6A 2COCA 2O6VB 4IM0A 3H7SA 1WG7A 2BCJA 2C60A 1OTRB 2KCJA 1WH3A 1WF9A 3M95A 1LW3A 3C0RB 2ZJDA 3ZKJC 2LJ5A 2LGDA 1P3RA 3A8PA 4EEWA 2K8BA 1X11A 3PPAA 4ICUA 1QC6A 4FHJA 2N1WA 3QA8A 3X23A 4KVGB 2DAJA 3PV1A 5AZFA 3A1QB 1E8XA 2I5FA 4DK5A 2FCQA 1WJ4A 3PTFC 1WXAA 2ASQA 5HE2A 1P9DU 4EJNA 2OQBA 5L83A 1V2YA 3R3MA 1J8CA 2FIFA 4F1SA 4MGYE 2MFQA 2YT1A 3VTWA 5JHAA 1FAOA 5FI0A 1SE9A 4GDLB 2P0FA 5KHOA 3P6AA 3HK0A 2KMAA 2JT4B 1GG3A 1YD8U 3SBTA 5HKHA 1WJUA 2E2XA 2IO0B 4DHZB 4NJ7A 1YJ1A 1E5WA 2UWQA 4LJOB 2LI5A 5D6JB 2HTHA 4II3B 2KX0A 1XR0B 4LDTB 4WJPA 2CHWA 1WFYA 2KDFB 1A5RA 3EFUA 1TJ6A 4K2PA 3WIMA 4KSKC 2K39A 3E9LA 3ZO5B 2CU1A 1K5DB 4EUTA 3ZDTA 4EZKA 2GBNA 2W2XD 2CAYA 3N32A 3CIKA 3ML8A 4DDID 2N4FA 3W1YA 1WI1A 2DHJA 3HIZA 4JKBA 1QZEA 2LXAA 4JKCA 3SV1A 3DOWA 5D94A 4DWFA 3UIOB 3OJ3A 5D2MB 3VXWA 2DA0A 1P0RA 1SHCA 2FUHB 4K7SA 3V6EB 4BVUC 4G3XB 1V86A 3V62A 2I1JA 2H7DA 5FR6A 4W9EA 3JYUA 2LULA 3TO1A 4A6FA 3PLUA 1V5OA 4W9IA 1WYWB 2N9PC 2L1CA 2NPTA 4ZDVA 1MK7B 2JY6A 2D3GA 2MA9B 4W9GA 2COAA 3NHEB 3H1UA 2Z59B 2H7EA 2DX5A 4A5KA 5LXIB 2DHZA 2LWPA 2L2IA 1MIZB 1CMXB 3I3TB 4JK9A 4DX8A 3R66C 1U2BA 3A9JB 5C23A 4A6FB 2D10A 1UZXB 3DCGA 1I7AA 4IW0A 4HJKA 4MGIE 4HAXB 4DHJD 1WXVA 4HDQA 2JWZA 2IYDB 2DFKA 2FNJB 3RT3B 3WAOA 3RYTA 1RFAA 2K8HA 2KWCA 2XQNM 4WQOB 3U30A 2IY0B 2MBEA 2NMBA 2LUEA 3VH3B 2KXJA 3APFA 3AU4A 2WDTB 4HATB 4URKA 3ALBA 4WJOA 1YX6B 4JKDA 1UPRA 4ZRKA 2BPSA 3UGBB 5GMVA 1WX8A 1Z87A 3A4SC 2G35A 2KDBA 2Z0EB 4W9KA 1OMWA 3CSFA 2WWZA 2GBRA 4DHZE 4K17A 2ADZA 2KWUB 4X57B 1SGHA 4GOCA 3QHTA 5L95C 1EAZA 4F8CB 4KSLC 3TL5A 3GZNI 4I6NB 3NS8A 1FGZA 2BWES 2GS0A 3DBLI 1NDDA 4MT7A 2DZJA 4ZRJA 3ZVRA 3ZDMC 1WI0A 2HRJA 1H4RA 5J3TA 4MGKE 2VSZA 5JP4A 2K6QA 3PT2B 2Y5BB 3PEGA 1V9JA 4G11A 3UZTA 1L2NA 2KTRB 1XKEA 3N7CA 2C7MB 2MRPA 5DI9B 4EFOA 2J0JA 1AARA 1KJTA 1EUVB 4OVUA 4BFRA 4GU2A 3IFWB 1KZGA 2BGFA 5DPSA 4K2OA 2MWNB 3OANA 3VVWB 2M38A 1G6JA 4M0WB 1M94A 4JQWC 2KQ7A 4ICVA 2NBUA 3V61A 4JKAA 4GDKA 1WR6E 3KH0A 5C6RA 4WWNA 1R4MI 2FDQA 1WJ1A 3F0WA 1XQQA 4W9LA 3T8MA 3SO6A 2DAFA 2M17A 4ILHA 4FULA 3VAWA 3WA0A 4LJPB 3PRZA 2CQUA 4KHOA 4OVVA 3RCZA 2W2XC 1MAIA 1L7YA 3ZNHB 1P3QU 2YF0A 4JKEA 2K8CA 2G45B 3UIPB 3QCAA 3TMPB 2GJYA 2MKRA 1H10A 2D07B 2HE7A 3L08A 5DPWA 4NY0A 2C9WB 3EHVA 4TQ1A 5D3XA 2D9WA 4IM3A 2KKCA 1WR1A 4DBGA 1LB1A 2ZZPB 3WAPA 2GCLA 2YLMA 4F7GA 2D4QA 3DPDA 1WZ0A 3MJWA 1OGWA 4B6WA 2ZVNA 1Q67A 1V5TA 1EVHA 4MK0A 1NTVA 2Y8GA 1OY2A 2MQJA 5KQ1A 4IWQA 1Q0WB 2N9EB 4RM8A 1VBGA 4K7UA 2DX5B 4WVFB 2GBMA 2Z0OA 2G4DB 3L54A 2L3ZA 2Y8FA 1NTIA 2DIKA 4MH0E 3S2AA 2R2OA 1GUAB 1I42A 4BOZB 3KUDB 1ST7A 3UF8A 4M8NA 3PP2A 4A20A 4TYZA 1UH6A 2O6VA 3ZRCA 4HAWB 4Z2MB 2LD9A 4MGZE 4JKFA 5GOWB 4KV2A 3MPXA 1XD3B 5AZHA 2AL3A 4K81A 5CLQB 3VH4B 3ULCA 1V6EA 3FM8C 2L0FA 3A4RA 2ZEQA 3R7RA 3IBEA 1LM8B 1DYNA 2IZVB 3PHWB 2LXCA 3MHSD 5BO4B 2C7NB 4AJYB 1TZ1A 1R4NI 2I1KA 1OEYA 3CSTA 4MY6A 1W1DA 4GPTB 2V3SA 2Y7BA 2CB8A 2D11A 4JKGB 3ZVVA 1FHWA 2Z0PA 3F5RA 4FA6A 3P2BA 3U7DA 3M3JA 5G2NA 1DDMA 2DYBA 1V61A 3A33B 2MX2A 1Z5SB 3SNHA 3FEHA 1Y8RC 2M8SA 1DIKA 3ZTCA 2MBHA 2KNBA 4BBKA 3QAQA 2CY4A 3PRMB 2R09A 4E71A 4BBNF 2PPHA 3JSVA 2KJHB 1IYFA 3PVUA 5AEKB 4CO7A 2KHWB 1KC7A 1ZKHA 2EMTA 3AXCA 2KFKA 4KDIC 2JXXA 2DKPA 1XX0A 2D9XA 2KN5A 2DZMA 4EZLA 2N9XA 1WY8A 4A3PA 4JLCA 5IA7A 2EC1A 2KK8A 4FJYA 2DZIA 5C79A 4NQKE 4PYZA 1V49A 3ODWA 5J3YA 2KLCA 1MK9B 2LBBA 2RSGA 2PJHA 2DYNA 2JRHA 3QIJA 5L81A 2YT0A 1ZC3B 3DXEA 3ML9A 1B55A 2BWFA 4B6HA 2LRWA 3PLVA 2RPQA 4HAYB 2VRWB 3SUZA 2IY1B 3ZIMA 4JL9A 2KC2A 2HJ8A 2XEWA 2NR2A 2A5UA 1V5UA 5J3QA 1D3ZA 2YS1A 1U5DA 1RLFA 4FADA 2EKEC 2DHIA 4I6LB 2P0DA 3PRPB 4NAWB 4F7UP 2N23A 5EFXA 3RULA 4NSWA 2DYQA 3P7ZA 1EO6A 2RGNB 3V60A 3ULBA 3ZTDA 3D32A 3PSEB 1OQNA 4HB2B 4GIVA 4AUQC 4ANVA 3E9PA 2LOZA 3A9KA 3VHTC 2D2QA 2RGFA 3NY5A 2V4LA 1WJNA 2L05A 2DLWA 1PQSA 2LVOA 1U5FA 2UZSA 2MP2A 3HQCA 5KCVA 1KM7A 5HE1A 2G4SA 2K00A 3KRXA 4GZUA 2DYMA 5DHFB 2KJRA 4TKNA 1DBHA 2DYOA 2M4NA 2MWSB 3WYFB 4II2B 2GBKA 3KYDD 1Q5WB 2KUPA 1WJ6A 3A9JA 3AULA 3OAWA 1J0WA 5LXHA 4WSFA 5E6OA 2GOWA 2KLGA 4WWPA 2M0XA 5C16A 4GDKB 2R2QA 2QKMA 1NI2A 1ZM0A 4KZCA 4CHJA 2CHZA 1MIXA 3EC8A 2DENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAR A;  1KJT A;  1EUV B;  2FCS A;  2BYV E;  2KAN A;  4FJZ A;  4MSQ B;  4OVU A;  4GSW A;  2PEA A;  3SU8 X;  1WGR A;  4XZ4 A;  3KZ1 A;  3TBL D;  3DVN U;  4BFR A;  1E8Z A;  2KDI A;  4GU2 A;  3IFW B;  2C7H A;  1KZG A;  2O2V B;  3QWM A;  2GCJ A;  2BGF A;  3ML4 A;  4K2O A;  3APD A;  3KW5 B;  5DPS A;  2MCN B;  3RUI B;  3ZNZ B;  4TQ0 A;  1UNQ A;  2D9Y A;  2JZZ A;  2NBV B;  4M8M A;  2MWN B;  3TIX A;  3OAN A;  3H6N A;  2AEH A;  3VVW B;  2M38 A;  3IG3 A;  4LDT D;  3ZNI D;  1G6J A;  4M0W B;  3LDZ E;  4GGQ A;  4W9F A;  3V6C B;  3OJ4 B;  4BBN C;  1BTN A;  4GDL A;  3X0W A;  3KYC D;  4KIK A;  1W1G A;  4BKG A;  2VRR B;  3ZW3 A;  4NNJ B;  3G9W A;  1M94 A;  1ZVR A;  4JQW C;  5DHA B;  2KQ7 A;  4MJS B;  3QAR A;  4ICV A;  1NU2 A;  1XCG A;  2AYO B;  2NBU A;  4WAA A;  3V61 A;  5J17 A;  4FLH A;  1AWE A;  3FP5 A;  2K1F A;  2MW5 A;  2GBJ A;  2UYZ B;  1J0G A;  4HDO A;  2KVR A;  4PQ0 A;  1KI1 B;  4GDK A;  4MSM B;  3DXC A;  2V1Y A;  1FHO A;  5JH5 C;  2COP A;  3PS6 A;  2JVC A;  1TXD A;  1OQY A;  1WR6 E;  3KH0 A;  1ISN A;  3VIA A;  5C6R A;  1WMH A;  3CF6 E;  4FN2 A;  4WWN A;  1R4M I;  2FDQ A;  2YSZ A;  1WJ1 A;  3F0W A;  2HTH B;  2Z0D B;  3N30 A;  2UVM A;  3JVZ X;  4NAW A;  4CHK A;  1UPQ A;  5DPT A;  4GMX B;  1XQQ A;  2ZPN A;  4W9L A;  3BY4 B;  5J2R A;  1UEF A;  2K2U A;  4W9H A;  1E7V A;  5LON B;  1X86 A;  2KZR A;  1S3S G;  5HE3 A;  3PG7 A;  3LJ3 A;  2AWT A;  3SO6 A;  4IUM B;  4A6H A;  4G50 A;  2DAF A;  3T8M A;  4HXD A;  2ZCC A;  1WGH A;  2D9Z A;  2ROZ B;  2KD0 A;  4HK2 A;  1U29 A;  2HD5 B;  5JHG A;  1WE6 A;  4MM3 A;  2M17 A;  3D8F A;  4C0A A;  2MSE D;  2N1V A;  2DN6 A;  4J6I A;  2COC A;  1WXM A;  4FUL A;  1WGD A;  3ODO A;  2XK5 B;  2O6V B;  3WA0 A;  3A9K B;  3DBS A;  4HCP B;  4IM0 A;  4LJP B;  3H7S A;  3QC8 B;  3PRZ A;  4IWP A;  2Z0Q A;  2DTC A;  1EGX A;  2CQU A;  2RLO A;  4KHO A;  4IOY X;  1WG7 A;  2KDE B;  2BCJ A;  2DX1 A;  3T06 A;  3RCP A;  1K8R B;  2C60 A;  2IO2 B;  4OVV A;  1LQB A;  1OTR B;  2B3A A;  5E6P A;  3RCZ A;  5JHH A;  3IHP C;  3VDZ A;  2KCJ A;  1MAI A;  2W2X C;  1L7Y A;  3ZNH B;  1P3Q U;  1WH3 A;  1EF5 A;  1WF9 A;  3VXW A;  3QWZ B;  2YF0 A;  1LW3 A;  3M95 A;  3C0R B;  5DPR A;  2N7D A;  4EZJ A;  2K8C A;  4IWO A;  2ZJD A;  3ZKJ C;  1RRB A;  4AJW A;  2L8J A;  2QHO A;  2LJ5 A;  1E90 A;  2JF5 A;  5LOP B;  2G45 B;  3NZS A;  4EKU A;  4BKS A;  1ZW7 A;  4HAU B;  2LGD A;  3UIP B;  1AQC A;  3AJ4 A;  4GN1 A;  1NBF C;  1W1H A;  3HM3 A;  3QCA A;  3TMP B;  2GJY A;  2LVQ A;  1P3R A;  3A8P A;  2MKR A;  2YS3 A;  2K8B A;  1WXS A;  1H10 A;  4EEW A;  3GYO A;  5EDS A;  1X11 A;  4IFS A;  1ZSQ A;  3PPA A;  2D07 B;  2ZCB A;  2LAS A;  4ICU A;  3D8E A;  4PS8 A;  2HE7 A;  3L08 A;  5DPW A;  1QC6 A;  3PGE A;  2M1M A;  4NY0 A;  4FHJ A;  4HCN B;  2N1W A;  4KHA A;  2C9W B;  4KDL B;  3EHV A;  3QA8 A;  3X23 A;  3M63 B;  3DDC B;  4KVG B;  4TQ1 A;  5D3X A;  4DHJ B;  1K5G B;  3FLV A;  2D9W A;  1UBQ A;  2DAJ A;  4N9F 4;  3VAW A;  1IRS A;  4IM3 A;  1DRO A;  3DQV A;  4XC2 A;  2KKC A;  3PV1 A;  3DVG Y;  3T9L A;  1WR1 A;  5AZF A;  4W9C A;  2JRI B;  1DDV A;  4MDK E;  1Q1O A;  4DBG A;  3A1Q B;  4ZYN A;  1LB1 A;  4H8S A;  1P6S A;  1E8X A;  4W9J A;  1U27 A;  2NCN A;  2ZZP B;  3WAP A;  1WGU A;  2GCL A;  2COF A;  2I5F A;  2KTR A;  2YLM A;  1V5P A;  4F7G A;  2ABD A;  1XD4 A;  2D4Q A;  3DPD A;  1WZ0 A;  1RAX A;  2WYQ A;  4DK5 A;  1DDW A;  4F7Z A;  2FCQ A;  3MJW A;  2BF8 B;  1OGW A;  1WJ4 A;  2RVB B;  3PTF C;  4B6W A;  2ZVN A;  5AZG A;  2RSU A;  3ODX A;  1Q67 A;  1WXA A;  1YIW A;  1WVH A;  3IVF A;  3A8Q A;  5HE2 A;  1V5T A;  1EVH A;  2ASQ A;  4HPL B;  3SDL C;  4EOY A;  1FHX A;  4MK0 A;  2CY5 A;  1NTV A;  4KHB B;  3JW0 X;  2YVC A;  2Y8G A;  3EPY A;  1BAK A;  1P9D U;  3W1S C;  4EJN A;  2OQB A;  5L83 A;  1X1F A;  2LYD A;  1OY2 A;  2ELB A;  1J19 A;  1V2Y A;  1UBI A;  2J0M A;  4ANW A;  4E74 A;  2FCM A;  3R3M A;  1J8C A;  4HAZ B;  3AU5 A;  2FIF A;  5KQ1 A;  2MQJ A;  4F1S A;  4MGY E;  3NOB A;  4PYU A;  2MFQ A;  4IWQ A;  3H9D A;  2ELA A;  2YT1 A;  4HAV B;  4WJ7 A;  4HLE A;  4JIO U;  3L17 A;  2WH5 A;  4MEL A;  1Q0W B;  3WAM A;  3M62 B;  2N9E B;  3VTW A;  4E3C A;  5JHA A;  2XBB C;  1FAO A;  5FI0 A;  1P98 A;  4YON A;  1SE9 A;  4RM8 A;  3K9P B;  2I5C A;  4GDL B;  1TTN A;  4K7U A;  2YS5 A;  2P0F A;  4HHV A;  1FXT B;  5KHO A;  2DX5 B;  4WVF B;  2GBM A;  3P6A A;  2Z0O A;  3HK0 A;  2O2V A;  2IYB A;  2JT4 B;  1WZ3 A;  4GMV A;  2KMA A;  2W9N A;  1GG3 A;  1YD8 U;  2CKH B;  4WJN A;  2G4D B;  5DCN A;  3WAN A;  2KFK B;  2ZVO A;  3L54 A;  1WJU A;  5HKH A;  2E2X A;  2IO0 B;  2L3Z A;  4DHZ B;  4DXA B;  1NTI A;  2Y8F A;  2BKF A;  4NJ7 A;  1YJ1 A;  3EC8 A;  1GJZ A;  1E5W A;  2UWQ A;  1GC6 A;  3HW2 B;  4MH0 E;  1FB8 A;  3TVV A;  2ZNV C;  4LJO B;  1HB8 A;  2JZ3 B;  3S2A A;  2PE6 B;  3UQB A;  2LI5 A;  5D6J B;  2HTH A;  4II3 B;  2KX0 A;  2R2O A;  1GUA B;  3GYP A;  4Z2N A;  1XR0 B;  2KFJ A;  3QJZ A;  4LDT B;  4WJP A;  1PFJ A;  1I42 A;  2CHW A;  4XWX A;  3L0W B;  4BOZ B;  1TGZ B;  1WFY A;  4RMA A;  2KDF B;  3KUD B;  3PZD A;  3UQA A;  1A5R A;  2R0D A;  3EFU A;  1ST7 A;  3UF8 A;  2CR5 A;  4M8N A;  3VUY A;  3PP2 A;  1WM2 A;  1TJ6 A;  2EMS A;  4A20 A;  4DX9 0;  4K2P A;  2JUO A;  2MLB A;  2P0H A;  2L76 A;  5KHQ A;  4TYZ A;  1UH6 A;  2XK5 A;  1WGY A;  2O6V A;  3ZRC A;  2J59 M;  4HAW B;  3QQ8 B;  3WIM A;  4Z2M B;  4CHM A;  4FHK A;  2LD9 A;  1X1G A;  1WX9 A;  2K39 A;  4KSK C;  4MGZ E;  1V5M A;  2K2J A;  2DHK A;  4TV3 A;  5GOW B;  2IO3 B;  4KV2 A;  3ZO5 B;  3MPX A;  1XD3 B;  2C5L C;  2CU1 A;  5AZH A;  5JHB A;  4DDG D;  3DBR I;  1K5D B;  3NSU A;  4EUT A;  3ZDT A;  2BKR B;  4EZK A;  3B0A A;  5FI1 A;  1WM3 A;  3APC A;  4AWJ A;  2GBN A;  4HVB A;  2IFS A;  2QKL A;  2AL3 A;  1C1Y B;  1ZC4 B;  2W2X D;  2CAY A;  3N32 A;  3CIK A;  5IJM A;  4K81 A;  3ML8 A;  5LLI A;  2N4F A;  4FJV B;  4B9K A;  5CLQ B;  4DDI D;  3VH4 B;  3ZUN A;  3ULC A;  5DH9 B;  3FM8 C;  1WI1 A;  1V6E A;  3GOE A;  2DHJ A;  2LOX A;  3KUC B;  3W1Y A;  3HIZ A;  2L0F A;  1E8Y A;  1P5T A;  2DZK A;  4HB4 B;  3A4R A;  2ZEQ A;  1QZE A;  2NPT B;  2LG1 A;  3R7R A;  4L6E A;  2LXA A;  4A6K A;  3IBE A;  2MBB B;  1LM8 B;  1DYN A;  3SV1 A;  2IZV B;  3DOW A;  3PHW B;  1WGG A;  1NTY A;  2LXC A;  3VFK A;  3DXD A;  5D94 A;  3MHS D;  5BO4 B;  2C7N B;  3QX1 A;  4JGH B;  1JRU A;  4AJY B;  4DWF A;  4PS7 A;  1TZ1 A;  3ONS A;  3RD2 A;  4D0N B;  1T0Y A;  3UIO B;  1R4N I;  1OEY J;  1VD2 A;  3EEC A;  4ASW C;  3OJ3 A;  5D2M B;  3L16 A;  4W9D A;  2YRY A;  2I1K A;  1OEY A;  2DA0 A;  1P0R A;  2OOB B;  4MY6 A;  3CST A;  3JSV B;  3QK0 A;  3SD5 A;  3PHX B;  1SHC A;  2FUH B;  4K7S A;  1W1D A;  1WE7 A;  1WJM A;  4GPT B;  2V3S A;  3V6E B;  1M7E A;  1M7R A;  3ZRF A;  2Y7B A;  1UGM A;  2KJ6 A;  4K7W A;  2CB8 A;  1V88 A;  2MDX A;  2D11 A;  1MG8 A;  2M14 A;  4BVU C;  2O6V D;  4G3X B;  3CXB B;  3DVG X;  1V86 A;  3ZVV A;  1FHW A;  2Z0P A;  3F5R A;  4FA6 A;  3V62 A;  5C1Z A;  3P2B A;  4K1R B;  1U5E A;  3U7D A;  2I1J A;  5D3W A;  3V5W A;  3M3J A;  4NPN A;  5G2N A;  4HPM B;  2RNR B;  2H7D A;  1PMS A;  1DDM A;  4W9E A;  5FR6 A;  2NZ8 B;  2DYB A;  3JYU A;  1ZGU B;  1HBK A;  1V61 A;  5KQ4 A;  3A33 B;  1U5G A;  3N3K B;  2LUL A;  3VOQ A;  3TO1 A;  2UZR A;  4A6F A;  4DBB A;  1Z5S B;  2MX2 A;  5CX3 A;  4HWI B;  3PLU A;  1V5O A;  1KLV A;  4W9I A;  3SNH A;  3FEH A;  1WYW B;  1Y8R C;  2M8S A;  3ZTC A;  5CHF A;  2N9P C;  2MBH A;  2L1C A;  2NPT A;  1KOT A;  2MP2 B;  4NQL B;  4ZDV A;  1MK7 B;  2RQ1 A;  1QQG A;  4BBK A;  2KC1 A;  2KNB A;  1NVL A;  2N7E A;  3NZU A;  2JY6 A;  4YL8 A;  2D3G A;  4IM2 A;  2MA9 B;  3QAQ A;  3TJP A;  3BJI A;  4AP4 C;  4W9G A;  2CY4 A;  3TW1 A;  1WGQ A;  3PRM B;  2COA A;  1WX7 A;  2KO3 A;  3NHE B;  2COD A;  3H1U A;  4WJQ A;  2Z59 B;  2KOX A;  2R09 A;  2ROV A;  4E71 A;  4BBN F;  3H7P B;  4ZRI A;  2PPH A;  3JSV A;  4HB0 B;  2H7E A;  2DX5 A;  2KJH B;  4A5K A;  1IYF A;  2D9V A;  1UNP A;  3PVU A;  2DHZ A;  4CO7 A;  2KHW B;  4PS3 A;  3VQI A;  5AEK B;  3U8Z A;  1ZKH A;  2LWP A;  1IPG A;  2L2I A;  2EMT A;  2KX3 A;  3AXC A;  2CHX A;  1MIZ B;  2KFK A;  5C5B A;  4KDI C;  1CMX B;  2J7Q B;  2JXX A;  5CLL B;  3I3T B;  4B95 A;  4DX8 A;  2DKP A;  1YQB A;  1LFD A;  2KQS A;  1XX0 A;  4BOS C;  2GMI C;  5DIF B;  2D9X A;  2KN5 A;  4KAX B;  3R66 C;  2DZM A;  2EJ8 A;  4NJ6 A;  4EZL A;  1U2B A;  3A9J B;  3BIN A;  2ZNV B;  4F7H A;  3DVN V;  3OLM D;  2N9X A;  3O65 B;  1V80 A;  2BYF A;  5C23 A;  4A6F B;  1WY8 A;  3TCA A;  4A3P A;  1BTK A;  4TUU A;  3D8D A;  5JLJ B;  1YX5 B;  2D10 A;  1UZX B;  3DCG A;  1I7A A;  1GNU A;  1H8C A;  4JLC A;  2ZPY A;  1MKE A;  5IA7 A;  2NBW B;  3RZF A;  1WIA A;  2LRU A;  2EC1 A;  4IW0 A;  2KGX B;  2KK8 A;  4BKS D;  3A98 B;  3MTN B;  2N0Y A;  4HJK A;  4MGI E;  4HAX B;  4FJY A;  2DZI A;  4DHJ D;  5C79 A;  3AI5 A;  2W2W A;  4HDQ A;  1WXV A;  2JWZ A;  1Y19 B;  4NQK E;  2IYD B;  3VTU A;  2DFK A;  2FNJ B;  3B1L X;  1V49 A;  3ODW A;  3K9O B;  4PYZ A;  3RT3 B;  2LKO A;  4KZ0 A;  5J3Y A;  3WAO A;  2KLC A;  3RYT A;  1MK9 B;  1RFA A;  2LBB A;  1S1Q B;  3HHM A;  2K8H A;  2KWC A;  3KSY A;  2RSG A;  4EMO A;  1FGY A;  2L7R A;  2NVU I;  2PJH A;  2XQN M;  3RZW C;  4WQO B;  3U30 A;  2DYN A;  2JRH A;  3QIJ A;  5L81 A;  2IY0 B;  2MBE A;  2YT0 A;  4P7I A;  2VKI A;  1XT9 B;  2LGX A;  3FSS A;  2NMB A;  2NS5 A;  1ZC3 B;  4HB3 B;  2LUE A;  3KUZ A;  2Q13 A;  4GB9 A;  2KXJ A;  3VH3 B;  3ML9 A;  2KMC A;  3MDB C;  1B55 A;  1VCB A;  2WX0 A;  3UIN B;  5E6N A;  2BWF A;  4B6H A;  3APF A;  1ACA A;  3HM6 X;  4MEM A;  2WX1 A;  4RM9 A;  2LVP A;  2LRW A;  5CHW A;  5J18 A;  3AU4 A;  2WDT B;  3SHQ A;  3VUW A;  3PLV A;  3Q3J A;  3ENE A;  2RPQ A;  4HAT B;  4HAY B;  4MJS A;  4ANU A;  2VRW B;  3SUZ A;  3TFM A;  1E7U A;  2OJR A;  2IY1 B;  3ALB A;  3ZIM A;  4URK A;  4JL9 A;  5D3Y A;  2KC2 A;  5HE0 A;  2FJ9 A;  2HJ8 A;  2FCN A;  2XEW A;  4WJO A;  1MPH A;  5IAA C;  1YX6 B;  4A3O A;  2NR2 A;  2A5U A;  1UPR A;  2FAZ A;  1V5U A;  5J3Q A;  4G0N B;  1C3T A;  4ZRK A;  1HE8 A;  2BPS A;  2KTF A;  3L10 B;  3UGB B;  1D3Z A;  1I35 A;  5GMV A;  2YS1 A;  2REX A;  2G3Q B;  1U5D A;  1WX8 A;  3KY9 A;  1RLF A;  1Z87 A;  2EKE C;  2DHI A;  3A4S C;  3M1I B;  3CMM B;  4FAD A;  4I6L B;  2G35 A;  2P0D A;  2KDB A;  2V76 A;  2Z0E B;  3PRP B;  4NAW B;  4F7U P;  2N23 A;  5EFX A;  4W9K A;  4WWO A;  1X05 A;  3RUL A;  2IO1 B;  4NSW A;  2DYQ A;  2MBQ A;  3P7Z A;  2K25 A;  4Y94 A;  1EO6 A;  2RGN B;  1OMW A;  1XOD A;  4FBJ B;  2LZ6 A;  3V60 A;  2CS4 A;  3CSF A;  3ZLZ A;  4LCD E;  2FJL A;  3ULB A;  2WWZ A;  1E8W A;  3D32 A;  2L0T A;  3L13 A;  3PSE B;  2GBR A;  5CTR C;  3ZTD A;  1OQN A;  4HB2 B;  1X1M A;  4GIV A;  4AUQ C;  4ANV A;  4DHZ E;  2LOZ A;  3A9K A;  3VHT C;  3W1S A;  4K17 A;  2D2Q A;  1BT0 A;  2LGY A;  1FOE A;  2ADZ A;  5D27 A;  1WRD B;  2KWU B;  2PE9 A;  2JP2 A;  2RGF A;  3NY5 A;  2V4L A;  1WJN A;  2L05 A;  2DLW A;  5G55 A;  1PQS A;  4X57 B;  1KZ7 A;  1SGH A;  2LVO A;  1GC7 A;  4GOC A;  1N3H A;  3QHT A;  1U5F A;  1LXD A;  4IC7 B;  2UZS A;  2A4Z A;  2BYE A;  2KWV B;  1EAZ A;  4ANX A;  5L95 C;  2MP2 A;  1P1A A;  3HQC A;  4F8C B;  5KCV A;  2X18 A;  1KM7 A;  2CRF A;  5HE1 A;  4KSL C;  2G4S A;  2K00 A;  3PVL A;  3KRX A;  3TL5 A;  1U4A A;  4IAP A;  2IBI B;  3WAL A;  4GZU A;  1EF1 A;  3GZN I;  1HB6 A;  2DYM A;  4I6N B;  3NS8 A;  5DHF B;  2OTX A;  3PRE A;  3H7P A;  1FGZ A;  2BWE S;  3SYX A;  2KJR A;  3QBV B;  4TKN A;  1RRP B;  2J0K A;  2GS0 A;  1DBH A;  2PZ1 A;  2DYO A;  1RJ2 A;  3DBL I;  1NDD A;  2M4N A;  2DKQ A;  5JZE B;  2RR9 A;  2AL6 A;  3O96 A;  4MT7 A;  4ZRJ A;  2DZJ A;  2MWS B;  3ZVR A;  5TR5 A;  3ZDM C;  1WI0 A;  2HRJ A;  1BWN A;  5C5B B;  2K6D B;  3WYF B;  4II2 B;  1Z2M A;  4PNK A;  1H4R A;  1V81 A;  5J3T A;  3LJU X;  1UD7 A;  2JPH A;  2GBK A;  1TQZ A;  2VSZ A;  2RUK B;  5JP4 A;  3KYD D;  4MGK E;  1I2H A;  1IP9 A;  5CHV C;  5D3V A;  2KUP A;  4CYE A;  1Q5W B;  2K6Q A;  2L00 B;  1V89 A;  1Y5O A;  1WJ6 A;  3PT2 B;  4KIK B;  5D7G A;  3A9J A;  3A1Q A;  3AUL A;  3OAW A;  2Y5B B;  3VUX A;  1J0W A;  3PEG A;  3DBH I;  2P8V A;  3KVF B;  4BKT A;  5LXH A;  4WSF A;  1UEL A;  3PVW A;  5E6O A;  1V9J A;  2GOW A;  2KLG A;  4G11 A;  3UZT A;  3VTV A;  4WWP A;  1PLS A;  3ECI A;  4AOF A;  2KTR B;  1L2N A;  2M0X A;  5C16 A;  2FID A;  4GDK B;  4I6P A;  1XKE A;  2RD0 A;  3N7C A;  3PSC A;  1F9J A;  5LXI B;  4GXB A;  1SIF A;  2R2Q A;  3B08 A;  3R7Q A;  2QKM A;  1NI2 A;  1ZM0 A;  2C7M B;  4KZC A;  4IG7 B;  3ZNG C;  3Q3F A;  1WMH B;  2MRP A;  4CHJ A;  5DI9 B;  1TBE A;  2MBO A;  4EFO A;  2CHZ A;  2J0J A;  3KRW A;  1MIX A;  4XX5 A;  3DXE A;  1UNR A;  2DEN B; 
#chains in the Genus database with same CATH topology
 2KAN A;  4FJZ A;  4MSQ B;  2BYV E;  3TBL D;  1MJD A;  3DVN U;  1KLG D;  2C7H A;  2O2V B;  3ZNZ B;  1J7B A;  3ML4 A;  4TQ0 A;  1UNQ A;  2JZZ A;  2NBV B;  3H6N A;  1XLO A;  4LDT D;  3IG3 A;  4GGQ A;  3OJ4 B;  1BTN A;  4KIK A;  2WHI A;  2B76 B;  3EGR A;  5DHA B;  1YN3 A;  4OVZ A;  3SBG A;  1NU2 A;  1XCG A;  1J0G A;  2MW5 A;  4YTP B;  4HDO A;  1QOG A;  3AE7 B;  4MSM B;  2E3T A;  3BWU D;  2COP A;  5BYR A;  2JVC A;  1OQY A;  4FN2 A;  3VIA A;  3AH7 A;  2JSV X;  2YSZ A;  2WNM A;  2KVZ A;  1QT9 A;  4CHK A;  2ZPN A;  3AED B;  4W9H A;  1SXT A;  5LON B;  1S3S G;  5HE3 A;  3PG7 A;  3AE6 B;  3LJ3 A;  4IUM B;  4WWM A;  4ARC A;  1C77 A;  4HXD A;  2HD5 B;  1J7A A;  3D8F A;  2MSE D;  2N1V A;  4J6I A;  1WXM A;  3SHQ A;  4HCP B;  3A9K B;  1EGX A;  2RLO A;  2WXQ A;  3T06 A;  2R82 A;  5JHH A;  3IHP C;  4JKH A;  1EF5 A;  1JRO A;  2DLB A;  5DPR A;  1BUI C;  1FXI A;  2N7D A;  4IWO A;  1RRB A;  4AJW A;  2HDE A;  2QHO A;  4BKS A;  3NZS A;  1XEE A;  1AQC A;  3AJ4 A;  1NBF C;  3HM3 A;  2QSD A;  2LVQ A;  5HHD G;  3KLS X;  1WXS A;  5EDS A;  3NS1 A;  1ZSQ A;  4XGA B;  3EA6 A;  4PS8 A;  3PGE A;  2M1M A;  4KHA A;  4KDL B;  1B9R A;  3I63 C;  2BW2 A;  3DDC B;  4JK7 A;  4DHJ B;  1K5G B;  3FLV A;  4N9F 4;  1IRS A;  3DQV A;  1ENF A;  4W9C A;  4MDK E;  1Q1O A;  4WQM A;  4H8S A;  1P6S A;  1U27 A;  2PIA A;  1YMH E;  1WGU A;  2KTR A;  1V5P A;  2ABD A;  2JYE A;  5G5G A;  1RAX A;  2WYQ A;  1DDW A;  4F7Z A;  5AZG A;  3ODX A;  3W5V B;  1YIW A;  2Z4D A;  1WVH A;  3IVF A;  3A8Q A;  3SDL C;  4EOY A;  3FC4 A;  3EPY A;  1BAK A;  1ZXH A;  4JWU C;  2LYD A;  2PVG C;  2FCM A;  4YTN B;  3NOB A;  5M4Y B;  1UNS A;  4JX1 C;  4KGT A;  3H9D A;  2ELA A;  4HAV B;  4HLE A;  4JIO U;  4MEL A;  2D3C A;  4YON A;  2I5C A;  2Y3A A;  2V0G A;  1L0Y B;  1SBB B;  3SFD B;  2KWD A;  1WZ3 A;  2W9N A;  3E9S A;  4WJN A;  1T0Q C;  4IOI E;  1QOA A;  1GC6 A;  3HW2 B;  4JPS A;  3TVV A;  3AEE B;  2JZ3 B;  3UQB A;  3QJZ A;  5I2M A;  4XWX A;  3AMZ A;  4RGO S;  2R0D A;  3VUY A;  1WM2 A;  2MLB A;  1SB3 C;  2L76 A;  4ZYS A;  3QQ8 B;  3RNE C;  4CHM A;  4FHK A;  2M19 A;  1WX9 A;  1V5M A;  2DHK A;  4M00 A;  2IO3 B;  3GS2 A;  5AUK A;  3DBR I;  1D5Z C;  3APC A;  1C4P A;  2IFS A;  1C1Y B;  1ZC4 B;  2VZK D;  4B9K A;  5LLI A;  4FJV B;  3AE1 B;  3ZUN A;  5DH9 B;  2LOX A;  1LGR A;  4HB4 B;  4L6E A;  2MBB B;  1WGG A;  1NTY A;  1ZUD 2;  4JGH B;  1JRU A;  4PS7 A;  4D0N B;  1T0Y A;  1OEY J;  3EEC A;  1TS2 A;  4ASW C;  4W9D A;  2YRY A;  2INN E;  2OOB B;  3QK0 A;  2KT7 A;  4R3D A;  4P1B C;  1WE7 A;  1WJM A;  3BK2 A;  5FK9 C;  1UGM A;  2KJ6 A;  2DNF A;  3IT4 B;  3W2D A;  2MDX A;  1NYQ A;  2M14 A;  2O6V D;  4ILG B;  3CXB B;  1I4G A;  5D3W A;  3V5W A;  1QIL A;  3FKY A;  4NPN A;  1D5X C;  4HPM B;  1SJH D;  1HBK A;  2YT2 A;  1U5G A;  4DBB A;  3C8Y A;  3NVZ A;  1FCL A;  1XLP A;  1KOT A;  1LO5 D;  3Q3N C;  2MP2 B;  2RQ1 A;  1NVL A;  3TW1 A;  1WGQ A;  3V3X A;  3DWM A;  3AEG B;  2KOX A;  5JVL A;  4ZRI A;  5BYS A;  4HB0 B;  4NAM A;  2D9V A;  1UNP A;  2D3A A;  3TSS A;  5TSS A;  3VQI A;  3HUI A;  2K9X A;  1MVK A;  1IPG A;  2KX3 A;  5IP4 D;  5C5B A;  1YN4 A;  5CLL B;  1YQB A;  4A90 A;  2GMI C;  5DIF B;  2TSS A;  1ROE A;  2WXR A;  2NMQ A;  4NJ6 A;  3BIN A;  4F7H A;  3O65 B;  1V80 A;  2BYF A;  4TUU A;  3D8D A;  1YX5 B;  1GNU A;  2PLP A;  1H8C A;  2ZPY A;  2NBW B;  4BKS D;  2KGX B;  3A98 B;  3MTN B;  4ARI A;  3AI5 A;  3VTU A;  1Y19 B;  4N59 A;  2EKI A;  3B1L X;  2LKO A;  4KZ0 A;  2LMC A;  4EMO A;  1FGY A;  2NVU I;  1JWM D;  1XT9 B;  2LGX A;  3FSS A;  2NS5 A;  1D4B A;  1SIJ A;  3KUZ A;  2KMC A;  1N61 A;  4MEM A;  1ACA A;  5CHW A;  4KKI A;  3VUW A;  3Q3J A;  3ENE A;  4HEA 1;  4MJS A;  4ANU A;  1IGD A;  5HE0 A;  2FCN A;  1MPH A;  4LNI A;  1BXT A;  4G0N B;  1C3T A;  2KTF A;  3L10 B;  1I35 A;  1HQR D;  2REX A;  2JZP A;  3KY9 A;  3CMM B;  3M1I B;  4P16 A;  1X05 A;  2IO1 B;  2QIE B;  2MBQ A;  3Q14 C;  2K25 A;  3URY A;  1UWX A;  1XOD A;  2BS4 B;  1L0V B;  4FBJ B;  3Q8B A;  3NRZ A;  3N1Y C;  2GRI A;  1TIF A;  3BYT B;  3AE8 B;  1E0Z A;  1X1M A;  1R4N B;  3NWA A;  3BVG A;  2LGY A;  1SSN A;  1FOE A;  1WRD B;  5D27 A;  3DCX A;  1KZ7 A;  1FNU A;  1K51 A;  1K53 A;  1GC7 A;  2KWV B;  4ANX A;  2DBY A;  1DOY A;  3U12 A;  3Q8C A;  2G9H D;  3PVL A;  4O1N A;  2ZKM X;  1U4A A;  2RMM A;  2ICI A;  2WDV B;  2WXO A;  3H7P A;  3QBV B;  4C7Z A;  2J0K A;  3AV8 A;  2WXF A;  4GOU A;  5JZE B;  2RR9 A;  2AL6 A;  2M0A A;  2WXH A;  3VRA B;  4ILJ A;  1BWN A;  5C5B B;  2IGD A;  1UD7 A;  5CHV C;  5D3V A;  2WXJ A;  1V89 A;  1Y5O A;  1CJE A;  5D7G A;  5BMI A;  3A1Q A;  3NVW A;  4J3O D;  4BKT A;  3DBH I;  2P8V A;  1UEL A;  3VTV A;  3PVW A;  3DWG C;  1PLS A;  3ECI A;  4HSI A;  1MG4 A;  2FID A;  3EFC A;  4I6P A;  1F9J A;  1SE2 A;  4GXB A;  5EE1 A;  3E66 A;  4IG7 B;  3ZNG C;  3Q3F A;  1WMH B;  5I2S A;  1TBE A;  2MBO A;  1JDE A;  1DYQ A;  4XX5 A;  1UNR A;  2FCS A;  1N5X A;  2PEA A;  3SU8 X;  3SR6 A;  1I4P A;  1EWC A;  1E8Z A;  4LK0 M;  4OHJ A;  3N1Z C;  3QWM A;  2MCN B;  2BQQ A;  3APD A;  1ET6 A;  2AEH A;  3ZNI D;  4W9F A;  4BBN C;  3B2F A;  3KYC D;  1W1G A;  4BKG A;  2VRR B;  3ZW3 A;  4NNJ B;  5I4D A;  1ZVR A;  4MJS B;  2ON8 A;  1KFY B;  2AYO B;  1AWE A;  3FP5 A;  2G1E A;  2QIL A;  2GBJ A;  2UYZ B;  1WXQ A;  4ITK A;  4PQ0 A;  1KI1 B;  1C79 A;  1FHO A;  5JH5 C;  3PS6 A;  3SEB A;  3ZQ4 A;  3CF6 E;  4XDC A;  4WIP A;  4NAW A;  2KDM A;  3BY4 B;  1UEF A;  3B77 A;  2KZR A;  3E9O A;  4G50 A;  5EE0 A;  1DGJ A;  3RPF C;  1WGH A;  2ROZ B;  2KD0 A;  4HK2 A;  1U29 A;  5JHG A;  4MM3 A;  4QAY A;  2WXM A;  1WGD A;  3ODO A;  2XK5 B;  3DBS A;  3I57 A;  3QC8 B;  4IWP A;  2Z0Q A;  2DTC A;  4RH6 A;  2KDE B;  2J42 A;  4IOY X;  3RCP A;  2DX1 A;  1FPY A;  3AM9 A;  1K8R B;  2IO2 B;  1LQB A;  1KBL A;  4MAC A;  2N7J A;  2B3A A;  5E6P A;  3VDZ A;  1HTQ A;  3I9V 1;  3QWZ B;  4EZJ A;  4YXD B;  2L8J A;  1E90 A;  2JF5 A;  5LOP B;  2PVO D;  4EKU A;  1ZW7 A;  4HAU B;  4GN1 A;  3PO0 A;  1W1H A;  4YWG G;  4KHB A;  2YS3 A;  3GYO A;  4IFS A;  2ZCB A;  2LAS A;  3D8E A;  1UF0 A;  3U52 E;  4D2K A;  4HCN B;  5D3D A;  3M63 B;  4LNF A;  1UBQ A;  1Y56 A;  1DRO A;  3BVM A;  4XC2 A;  4AS1 A;  3DVG Y;  5LG4 B;  3T9L A;  2JRI B;  1DDV A;  3RNG C;  4ZYN A;  4W9J A;  2JWU A;  2NCN A;  4OZC A;  1MPE A;  2COF A;  1QOF A;  4JKG A;  1XD4 A;  2BF8 B;  1AYF A;  3RNA C;  2RVB B;  1T6B X;  1MI0 A;  2RSU A;  1N5W A;  4HPL B;  4HKQ A;  1FHX A;  1HXY D;  2CY5 A;  3JW0 X;  4KHB B;  3K9P B;  2YVC A;  3W1S C;  1L4Z B;  1VLB A;  1X1F A;  2ELB A;  1J19 A;  1UBI A;  1V1P A;  2J0M A;  3U2S C;  4ANW A;  4E74 A;  3MC8 A;  4HAZ B;  3AU5 A;  1I4Q A;  4PYU A;  1DOI A;  2FJU B;  4WJ7 A;  2QJL A;  1HZ6 A;  3L17 A;  2WH5 A;  3WAM A;  3M62 B;  4E3C A;  2XBB C;  1TY0 A;  1P98 A;  1TTN A;  2YS5 A;  2WDR B;  4HHV A;  4OZB A;  1FXT B;  3GZN B;  2IYB A;  3ZRF A;  4GMV A;  5DCN A;  2CKH B;  3WAN A;  2KFK B;  2ZVO A;  3BK1 A;  1ZDV A;  4DXA B;  2BKF A;  1GJZ A;  3ETR A;  1SJE D;  1FB8 A;  5AUI A;  2ZNV C;  3ENB A;  2RDB C;  1HB8 A;  3TEX A;  1NEK B;  2PE6 B;  4XYC A;  3GYP A;  4Z2N A;  1ZP0 B;  2KFJ A;  1PFJ A;  4C56 C;  2QCZ A;  3L0W B;  4HKZ E;  1TGZ B;  4RMA A;  3PZD A;  3UQA A;  1L6V A;  4HRS A;  2CR5 A;  4YSZ B;  2EMS A;  4DX9 0;  2JUO A;  2P0H A;  2XK5 A;  1WGY A;  4PT5 A;  1L6U A;  2J59 M;  4YSX B;  1C9F A;  2D5G A;  1X1G A;  4KX6 B;  2K2J A;  2Z13 A;  4TV3 A;  5FKA C;  2C5L C;  2K5P A;  4P1C C;  5JHB A;  4LLG M;  4DDG D;  3NSU A;  2BKR B;  3B0A A;  5FI1 A;  1WM3 A;  5T8I A;  4AWJ A;  4HVB A;  2QKL A;  5IJM A;  3GOE A;  3KUC B;  4RGM A;  1T5X D;  1E8Y A;  1P5T A;  2DZK A;  1N6Z A;  4RGN A;  1IBX A;  2NPT B;  2LG1 A;  1N60 A;  3LXF A;  4A6K A;  2Y5C A;  3VFK A;  3DXD A;  2KN4 A;  1PGX A;  3QX1 A;  3RD2 A;  1TKG A;  3ONS A;  1VD2 A;  3VR8 B;  3L16 A;  4RM9 A;  5FR3 A;  3SD5 A;  3JSV B;  3PHX B;  1OFF A;  1M7E A;  1M7R A;  3BVZ A;  4K7W A;  1V88 A;  1KTK A;  1MG8 A;  1C4A A;  3DVG X;  5C1Z A;  4K1R B;  2XNA C;  1U5E A;  2GUM A;  1CQV A;  2RNR B;  4A9A A;  1PMS A;  2NZ8 B;  2ZW1 A;  1ZGU B;  1GAQ B;  5KQ4 A;  2IGG A;  3N3K B;  3VOQ A;  5CX3 A;  2UZR A;  1KLV A;  4HWI B;  4QJ5 B;  5CHF A;  1WRI A;  4NQL B;  3P63 A;  1QQG A;  2KC1 A;  2MH7 A;  2N7E A;  3NZU A;  4YL8 A;  4IM2 A;  3TJP A;  3BJI A;  1YJI A;  4AP4 C;  2CJO A;  2KO3 A;  1WX7 A;  2LGI A;  2COD A;  4WJQ A;  4B0E A;  2ROV A;  3H7P B;  4YSY B;  2LUM A;  1P7E A;  4PS3 A;  3U8Z A;  1XCQ L;  4JK8 A;  2CHX A;  3BII D;  4L1B A;  2J7Q B;  4B95 A;  4BOS C;  1LFD A;  2KQS A;  4KAX B;  5BYQ A;  2EJ8 A;  3P42 A;  2PW9 A;  2ZNV B;  3DVN V;  3OLM D;  3TCA A;  1BTK A;  2LGS A;  5JLJ B;  4HPP A;  4ZOH C;  2YEP B;  1MKE A;  3RZF A;  1WIA A;  2LRU A;  2N0Y A;  1RM6 C;  1KRH A;  2W2W A;  1VZ6 A;  3Q8A A;  1FNW A;  3LYY A;  3FIL B;  1B1Z A;  3K9O B;  1JML A;  2Z59 A;  2BVC A;  1S1Q B;  3HHM A;  3IT6 B;  3E56 A;  3KSY A;  4WAF A;  2L7R A;  3MC0 B;  3RZW C;  3P4R B;  4NJC A;  5EE9 A;  2O2V A;  4P7I A;  2VKI A;  1PUT A;  4HB3 B;  4TSS A;  2FBW B;  3I5J C;  2Q13 A;  4GB9 A;  3MDB C;  3U4E G;  1VCB A;  2WX0 A;  2WXI A;  3UIN B;  5E6N A;  3HM6 X;  2WX1 A;  5J18 A;  2LVP A;  2X0S A;  1F1H A;  3TFM A;  1E7U A;  2OJR A;  2Z8L A;  1FMA D;  5D3Y A;  3T3N A;  2FJ9 A;  4YTM B;  5IAA C;  1D6E C;  1I4H A;  4A3O A;  2FAZ A;  1N63 A;  2JU6 X;  1XO3 A;  1HE8 A;  4LNO A;  1E6E B;  2JX5 A;  2QMT A;  2G3Q B;  3DBR B;  2SAK A;  1TZO A;  4P6V F;  2V76 A;  1HTO A;  4WWO A;  3W9C B;  4LNN A;  4Y94 A;  2LZ6 A;  2CS4 A;  3ZLZ A;  4LCD E;  2FJL A;  3RFZ B;  1E8W A;  3L13 A;  2L0T A;  5CTR C;  1I4X A;  2WS3 B;  3W1S A;  1FRR A;  1BT0 A;  2PE9 A;  2JP2 A;  1TJE A;  2V3N A;  3ABV B;  5G55 A;  4QJ3 B;  1N3H A;  4IC7 B;  1LXD A;  1R4M B;  2RRF A;  2A4Z A;  2BYE A;  1P1A A;  4HRO A;  2CJN A;  2X18 A;  2CRF A;  3NJT A;  1TY2 A;  4IAP A;  4ZHO A;  2IBI B;  3WAL A;  1EF1 A;  1HB6 A;  2KMM A;  3NWF A;  2OTX A;  3PRE A;  3SYX A;  1RRP B;  2PZ1 A;  1RJ2 A;  5EE3 A;  2FUG 1;  2DKQ A;  1DOX A;  3O96 A;  1XLN A;  4ZHP A;  2INP E;  5TR5 A;  3C19 A;  1FNV A;  2K6D B;  1Z2M A;  4PNK A;  3TEZ A;  1V81 A;  3B2G A;  3LJU X;  2JPH A;  4NZL B;  1TQZ A;  1IP9 A;  2RUK B;  1I2H A;  4CYE A;  2L00 B;  4KIK B;  3VUX A;  3KVF B;  1ACC A;  3AEA B;  3H8H A;  3AE5 B;  4AOF A;  2L52 A;  1F77 A;  2RD0 A;  3PSC A;  2V3P A;  1SIF A;  3B08 A;  1ZDX A;  3R7Q A;  4ZRQ A;  3AEF B;  2NTT A;  4A8X C;  3DHH C;  3KRW A;  4C00 A;  1L5P A;  4GSW A;  2KIG A;  1WGR A;  4XZ4 A;  3KZ1 A;  2KDI A;  2BTE A;  2WXL A;  1UWM A;  2GCJ A;  3KW5 B;  3RUI B;  1FXA A;  4K3C A;  2D9Y A;  4M8M A;  3TIX A;  3P4P B;  2K8E A;  5G5H A;  4DQO C;  3LDZ E;  3V6C B;  4GDL A;  1E7P B;  3NVY A;  3X0W A;  3G9W A;  3QAR A;  1VBH A;  1SE3 A;  5J17 A;  4WAA A;  4FLH A;  2K1F A;  3AE4 B;  2KVR A;  3TEY A;  3DXC A;  2V1Y A;  1F2R I;  1GGO A;  1PGA A;  1TXD A;  2LFI A;  4REZ A;  1ISN A;  1WMH A;  5D3I B;  3Q3M C;  1R7S A;  2Z0D B;  2HTH B;  3N30 A;  5KHQ A;  2UVM A;  3JVZ X;  1UPQ A;  5DPT A;  4GMX B;  3KWL A;  5J2R A;  2K2U A;  1E7V A;  2PKO A;  1X86 A;  2AWT A;  4A6H A;  4MT5 A;  2ZCC A;  2D9Z A;  2BB5 A;  1WE6 A;  1XCT L;  1VR9 A;  1I7H A;  4C0A A;  2Z14 A;  2DN6 A;  2COC A;  1ZPS A;  2O6V B;  4IM0 A;  3GP7 A;  3H7S A;  2WLB A;  4M0W A;  1WG7 A;  2BCJ A;  2C60 A;  3HVD A;  1OTR B;  4S17 A;  2KCJ A;  1WH3 A;  4KGR A;  1WF9 A;  3M95 A;  1LW3 A;  3C0R B;  2IDY A;  2ZJD A;  3ZKJ C;  2RDG A;  2LJ5 A;  2KYW A;  2LGD A;  1AWD A;  2UU7 A;  1P3R A;  5IKC M;  4RF1 A;  3A8P A;  4EEW A;  2K8B A;  4RNA A;  3MC9 A;  1X11 A;  3PPA A;  4ICU A;  1QC6 A;  4H2A A;  3AEB B;  4FHJ A;  2N1W A;  4L23 A;  3QA8 A;  3X23 A;  4KVG B;  2DAJ A;  1MFW A;  3A58 A;  2LHE A;  3PV1 A;  1A70 A;  2XN9 C;  4US9 A;  2L83 A;  1NEN B;  2HJ1 A;  5AZF A;  3RNC C;  3HVZ A;  2R2Y A;  3A1Q B;  1NYR A;  2W3R A;  1E8X A;  2K0P A;  2I5F A;  1TYG B;  3AE2 B;  1L0X B;  4DK5 A;  4RGT A;  2FCQ A;  1AN8 A;  1WJ4 A;  3PTF C;  1WXA A;  2ASQ A;  5HE2 A;  1F52 A;  2JQR B;  1P9D U;  1VJK A;  4EJN A;  2OQB A;  5L83 A;  1V2Y A;  3R8B A;  3R3M A;  1J8C A;  2FIF A;  4F1S A;  4MGY E;  1NVI D;  2WP9 B;  2MFQ A;  2WXK A;  2YT1 A;  2AQ1 B;  1FCC C;  1UGJ A;  3VTW A;  1V8C A;  5JHA A;  2R61 A;  1FAO A;  5FI0 A;  1SE9 A;  2QDF A;  4GDL B;  2WXN A;  2P0F A;  5KHO A;  1T0R C;  3P6A A;  3HK0 A;  2KMA A;  2JT4 B;  3P4Q B;  3U7Z A;  1GG3 A;  1YD8 U;  3SBT A;  5HKH A;  1WJU A;  4A55 A;  2E2X A;  2IO0 B;  4DHZ B;  3NUH B;  4NJ7 A;  3NW8 A;  1YJ1 A;  2V9H A;  1TT5 B;  4RF0 A;  1E5W A;  2UWQ A;  2INC C;  2K3U A;  4LJO B;  2LI5 A;  5D6J B;  2HTH A;  4II3 B;  2KX0 A;  4IKG A;  1XR0 B;  2VH2 A;  4LDT B;  3NG0 A;  4WJP A;  2CHW A;  1WFY A;  3TEW A;  2KDF B;  1GB1 A;  1A5R A;  3EFU A;  4GLS C;  2BYT A;  2BBC A;  2H89 B;  1TJ6 A;  4K2P A;  1FFU A;  4BZA A;  3WIM A;  5JXV A;  2BB6 A;  4KSK C;  2K39 A;  3E9L A;  4S0R A;  2MJD A;  3HRD D;  3P4S B;  3V05 A;  3ZO5 B;  2CU1 A;  1FD6 A;  1KLU D;  1K5D B;  4EUT A;  3ZDT A;  2RPV A;  4EZK A;  2GBN A;  1I4R A;  2W2X D;  2CAY A;  1K50 A;  3N32 A;  3CIK A;  3ML8 A;  4DDI D;  2N4F A;  5H92 C;  3W1Y A;  1WI1 A;  2DHJ A;  3HIZ A;  2IND C;  1ZYI A;  4JKB A;  1QZE A;  2LXA A;  2KIE A;  4JKC A;  3SV1 A;  1ET9 A;  3DOW A;  3FVC A;  5D94 A;  2BS2 B;  2MEK A;  3RMK C;  4DWF A;  2PMV A;  3UIO B;  4OSN A;  3OJ3 A;  5D2M B;  3VXW A;  2DA0 A;  1P0R A;  1SHC A;  2FUH B;  4K7S A;  3V6E B;  1WYG A;  1JWA D;  3IXS A;  4BVU C;  4G3X B;  1GOZ A;  1V86 A;  2J53 A;  3V62 A;  3HSA A;  1JAL A;  2I1J A;  2H7D A;  5FR6 A;  4W9E A;  3AN1 A;  3JYU A;  2LUL A;  3TO1 A;  4A6F A;  2Y5P A;  2IGH A;  1V5O A;  3PLU A;  2OHF A;  4W9I A;  1WYW B;  1XXG A;  2N9P C;  2L1C A;  2NPT A;  1OQQ A;  4L2Y A;  4ZDV A;  1MK7 B;  4XWW A;  2JY6 A;  2D3G A;  2MA9 B;  2E6X A;  4W9G A;  1N62 A;  2COA A;  3NHE B;  3H1U A;  2Z59 B;  4OW0 A;  3LB8 C;  2H7E A;  3BZD B;  3WCQ A;  2DX5 A;  1D5M C;  4A5K A;  1HA5 A;  3AEC B;  5LXI B;  2DHZ A;  3Q6B A;  2LWP A;  5IOI A;  2L2I A;  1MIZ B;  1K52 A;  1CMX B;  3I3T B;  4JK9 A;  4DX8 A;  2ONQ A;  1MI1 A;  3R66 C;  2BT6 A;  1U2B A;  3A9J B;  5C23 A;  3N1X C;  1KF6 B;  3R2T A;  4A6F B;  1J7C A;  3DBH B;  5IN7 A;  2D10 A;  1UZX B;  3DCG A;  1I7A A;  1JWB D;  1WSP A;  4IW0 A;  4HJK A;  4MGI E;  4HAX B;  4DHJ D;  2WDQ B;  1MHH E;  4HDQ A;  1WXV A;  2JWZ A;  2IYD B;  2L1A A;  4MH8 A;  2DFK A;  2FNJ B;  3RT3 B;  3WAO A;  3RYT A;  2D3B A;  1IGC A;  1RFA A;  2N9L A;  2K8H A;  3IAM 1;  2KWC A;  2XQN M;  4WQO B;  3U30 A;  2IY0 B;  2MBE A;  2NMB A;  1SE4 A;  2LUE A;  3VH3 B;  2KXJ A;  2KQ4 X;  2VH1 A;  2LJI A;  3APF A;  1NI3 A;  3FAH A;  3AU4 A;  2WDT B;  3GE3 C;  4HAT B;  4URK A;  3ALB A;  4WJO A;  1YX6 B;  4JKD A;  3VR9 B;  2KR0 A;  5BMH A;  3MJ5 A;  1UPR A;  4ZRK A;  2BPS A;  3UGB B;  5GMV A;  4N58 A;  1WX8 A;  1Z87 A;  3A4S C;  2K22 A;  2G35 A;  2KDB A;  2Z0E B;  4W9K A;  2OED A;  1YNT E;  2X38 A;  1OMW A;  3CSF A;  1VZ8 A;  2WWZ A;  2GBR A;  4DHZ E;  4K17 A;  4BAX A;  2ADZ A;  2KWU B;  1YOV B;  1VDV A;  1T3Q A;  3RNB C;  4X57 B;  1SGH A;  4GOC A;  3QHT A;  3VRB B;  5L95 C;  1JQ4 A;  1F2R C;  1EAZ A;  2MHJ A;  3DHG C;  4F8C B;  3GB1 A;  4KSL C;  4ACF A;  2H88 B;  4JE3 B;  3TL5 A;  2OJW A;  3GZN I;  4I6N B;  1ESF A;  3NS8 A;  1XF5 L;  1FGZ A;  2BWE S;  2GS0 A;  3DBL I;  1NDD A;  4MT7 A;  2DZJ A;  4ZRJ A;  3ZVR A;  3ZDM C;  1WI0 A;  2HRJ A;  1H4R A;  1TKY A;  1E10 A;  5J3T A;  4MGK E;  2VSZ A;  5JP4 A;  2K6Q A;  2W54 A;  3PT2 B;  2X8X X;  4A6Q A;  2Y5B B;  3PEG A;  4XE0 A;  4K3B A;  1V9J A;  4G11 A;  3UZT A;  4LNK A;  1L2N A;  2KTR B;  4CQN A;  1FFV A;  1XKE A;  3N7C A;  3ZJV A;  2C7M B;  4WH4 A;  4AQ7 A;  1QLB B;  2MRP A;  5DI9 B;  4EFO A;  3Q8F A;  2J0J A;  5IO9 A;  1AAR A;  1KJT A;  1EUV B;  4OVU A;  3MP9 A;  4BFR A;  4GU2 A;  3IFW B;  2DWQ A;  1KZG A;  3Q2A C;  2BGF A;  5DPS A;  4K2O A;  3RN9 C;  2MWN B;  1PFD A;  5HFY A;  2KUQ A;  3OAN A;  1F0Z A;  3VVW B;  2M38 A;  3NZ3 A;  1G6J A;  4M0W B;  2Q5W D;  1M94 A;  4JQW C;  1JRP A;  2KQ7 A;  2L32 A;  4ICV A;  5HG2 A;  2NBU A;  3V61 A;  2IPK D;  1UUP A;  1RYJ A;  4JKA A;  4GDK A;  1V1O A;  2N9K A;  1C4C A;  3CWI A;  1WR6 E;  3KH0 A;  5C6R A;  4WWN A;  1M4V A;  2WU2 B;  1R4M I;  3BYY B;  2FDQ A;  1WJ1 A;  3F0W A;  1XQQ A;  4W9L A;  2WXG A;  3T8M A;  2K49 A;  3SO6 A;  4ZRP A;  2DAF A;  2MJ3 A;  3KWV A;  2M17 A;  4ILH A;  2AQ2 B;  4FUL A;  3VAW A;  3WA0 A;  1EM7 A;  2JYT A;  4LJP B;  2GI9 A;  3PRZ A;  4IDI A;  2CQU A;  4KHO A;  4OVV A;  4DIX A;  1QKZ A;  3RCZ A;  1HEZ E;  1QOB A;  2W2X C;  1MAI A;  1L7Y A;  3ZNH B;  1P3Q U;  4DXF A;  2YF0 A;  4JKE A;  2K8C A;  3KQ4 A;  2G45 B;  3UIP B;  5C3J B;  3QCA A;  1BML C;  3TMP B;  2GJY A;  2MKR A;  1H10 A;  2EEL A;  4XDD A;  2JXT A;  2D07 B;  3IAS 1;  1C78 A;  4YT0 B;  2HE7 A;  3L08 A;  3TUO A;  4EE2 A;  3OG5 A;  5DPW A;  4USA A;  4NY0 A;  2C9W B;  4KKJ A;  3EHV A;  1FEH A;  4TQ1 A;  5D3X A;  4KGS A;  2D9W A;  3L4P A;  3HIE A;  4IM3 A;  2KKC A;  1WR1 A;  2LEK A;  4DBG A;  2QEJ C;  1FIQ A;  1LB1 A;  2W3S A;  1VRA B;  2ZZP B;  3WAP A;  2IJ0 A;  2GCL A;  2YLM A;  4F7G A;  4OZA A;  2D4Q A;  3DPD A;  1WZ0 A;  3MJW A;  1OGW A;  4D6W A;  4XWT A;  4B6W A;  2ZVN A;  1Q67 A;  1V5T A;  2W82 A;  1V97 A;  1EVH A;  4RCO A;  4MK0 A;  1NTV A;  2Y8G A;  2WXP A;  1OY2 A;  1TS3 A;  2KAC A;  2MQJ A;  1TKE A;  5KQ1 A;  2J52 A;  3ZXV A;  4IWQ A;  3DHI C;  3RNF C;  2ACZ B;  2NBV A;  4C7Y A;  1CK1 A;  1P7F A;  1Q0W B;  4US8 A;  2N9E B;  3PZ7 A;  4RM8 A;  1EWY C;  1VBG A;  2KAJ A;  3EUB 2;  2WU5 B;  1HZ5 A;  4K7U A;  2DX5 B;  4WVF B;  2GBM A;  2Z0O A;  3ZXR A;  2G4D B;  2ZW0 A;  3L54 A;  2BS3 B;  2L3Z A;  2Y8F A;  1NTI A;  2DIK A;  3EC8 A;  3N20 C;  4MH0 E;  2PTL A;  4N6E B;  3S2A A;  5HI1 A;  1EU4 A;  2R2O A;  1GUA B;  2N0S B;  1I42 A;  4BOZ B;  1ZOY B;  5IRS A;  3KUD B;  1V1P B;  1YN5 A;  1ST7 A;  3UF8 A;  3OHM B;  4M8N A;  3PP2 A;  4MM3 B;  4B0M A;  4A20 A;  1CZP A;  4TYZ A;  1UH6 A;  2O6V A;  3ZRC A;  4HAW B;  4Z2M B;  2LD9 A;  4MGZ E;  4JKF A;  3Q3O C;  5GOW B;  4KV2 A;  3MPX A;  1XD3 B;  5AZH A;  1YQ3 B;  2I38 A;  1RFK A;  1T77 A;  1IUE A;  2AL3 A;  2VZK B;  4WUR A;  1TS4 A;  3DBL B;  4K81 A;  5CLQ B;  1GPX A;  3VH4 B;  1OQR A;  3N9Y C;  3ULC A;  1V6E A;  3FM8 C;  2L0F A;  4C4V B;  3A4R A;  2ZEQ A;  3R7R A;  3IBE A;  1LM8 B;  1DYN A;  2IZV B;  3PHW B;  2LXC A;  1JWS D;  3MHS D;  1SEB D;  2C7N B;  5BO4 B;  4AJY B;  1STE A;  1TZ1 A;  1R4N I;  5C2T B;  4CSQ A;  2I1K A;  1OEY A;  1GB4 A;  3CST A;  4MY6 A;  1W1D A;  2HTM E;  4GPT B;  2V3S A;  2Y7B A;  2CB8 A;  2D11 A;  4JKG B;  2CU3 A;  1FHW A;  2Z0P A;  3F5R A;  1AW7 A;  3ZVV A;  4FA6 A;  1Q10 A;  3P2B A;  3U7D A;  5GXG B;  3M3J A;  5G2N A;  1FM0 D;  1DDM A;  3MFG A;  3NVV A;  2DYB A;  1V61 A;  3A33 B;  3NWD A;  2MX2 A;  3AE3 B;  1Z5S B;  2J4X A;  4HJG E;  1SF0 A;  3SNH A;  3FEH A;  1Y8R C;  2M8S A;  1DIK A;  3ZTC A;  1JW9 D;  2MBH A;  1IBX B;  3O13 A;  2KNB A;  4BBK A;  4M01 A;  3QAQ A;  2FE8 A;  2CY4 A;  3PRM B;  3FIL A;  4DXG A;  2R09 A;  4E71 A;  4BBN F;  1YQ4 B;  2V4I B;  2PPH A;  3B9J A;  3JSV A;  3RI7 C;  1PGB A;  1WWT A;  2KJH B;  1IYF A;  3PVU A;  5AEK B;  4CO7 A;  2KHW B;  1KC7 A;  1ZKH A;  2EMT A;  1JCK B;  3AXC A;  2KFK A;  2AQ3 B;  4KDI C;  2JXX A;  1JWU D;  4QJ4 B;  2DKP A;  4OT1 A;  1XX0 A;  1KH0 A;  3Q8E A;  2D9X A;  2KN5 A;  1QF6 A;  2DZM A;  5E6J A;  4EZL A;  4UDU C;  4M02 A;  2N9X A;  3Q69 A;  1WY8 A;  4A3P A;  3W5U B;  4JLC A;  5IA7 A;  4RFB A;  1L4D B;  2EC1 A;  4GNK B;  2KK8 A;  2NTS A;  4FJY A;  2DZI A;  5C79 A;  2RDH A;  4NQK E;  2YEP F;  2LHD A;  3AE9 B;  4PYZ A;  1V49 A;  3ODW A;  5J3Y A;  2KLC A;  1MK9 B;  2LBB A;  2RSG A;  2PJH A;  2DYN A;  4QXA B;  2JRH A;  3QIJ A;  5L81 A;  1EU3 A;  2WQY B;  2YT0 A;  1T0S C;  1ZC3 B;  5LNK 1;  1C76 A;  3ML9 A;  5H8Y E;  1B55 A;  3P1M A;  2BWF A;  4B6H A;  2LRW A;  3PLV A;  2RPQ A;  4HAY B;  1QQR A;  2VRW B;  3SUZ A;  4C4V A;  2IY1 B;  3ZIM A;  4JL9 A;  2GB1 A;  2KC2 A;  2HJ8 A;  2XEW A;  4L1R A;  3SFE B;  2NR2 A;  2A5U A;  1V5U A;  5J3Q A;  1TS5 A;  1D3Z A;  2YS1 A;  1U5D A;  1RLF A;  4FAD A;  2EKE C;  2DHI A;  4C80 A;  4I6L B;  2P0D A;  3PRP B;  4NAW B;  4F7U P;  3ZJT A;  2N23 A;  5EFX A;  2MJE A;  3RUL A;  4NSW A;  2DYQ A;  4PK1 A;  3ZJU A;  3P7Z A;  2W55 A;  1EO6 A;  3ZYY X;  2RGN B;  3AB5 A;  5BMG A;  3V60 A;  3ULB A;  3ZTD A;  3D32 A;  3PSE B;  1OQN A;  4HB2 B;  4GIV A;  4AUQ C;  4ANV A;  3E9P A;  1ZXI A;  2LOZ A;  3ZGZ A;  3A9K A;  3UI3 A;  3VHT C;  2D2Q A;  4TMA B;  2RGF A;  1ZE3 D;  3NY5 A;  2V4L A;  1PYW D;  1WJN A;  2L05 A;  2DLW A;  1E9M A;  1PQS A;  1MHX A;  2SEB D;  2LVO A;  3PZ8 A;  1U5F A;  1VZ7 A;  2UZS A;  2MP2 A;  3HQC A;  5KCV A;  1KM7 A;  1RWS A;  5HE1 A;  2G4S A;  2K00 A;  3KRX A;  4GZU A;  2DYM A;  1XLQ A;  2WGS A;  5DHF B;  3GE8 C;  2KJR A;  2M56 B;  4TKN A;  4FXC A;  1DBH A;  2DYO A;  4Q2J A;  2M4N A;  2GLS A;  3J9C A;  1YJJ A;  2MWS B;  3WYF B;  4II2 B;  3R2I A;  1PDX A;  1FRD A;  2GBK A;  3KYD D;  1Q5W B;  2KUP A;  1WJ6 A;  5MPO A;  3A9J A;  3AUL A;  3OWE B;  3OAW A;  1J0W A;  1FO4 A;  4LTU A;  4WSF A;  5LXH A;  5E6O A;  2GOW A;  2KLG A;  2QC8 A;  4WWP A;  3T3O A;  2I2Y A;  2M0X A;  5C16 A;  1WGK A;  4GDK B;  2R2Q A;  2QKM A;  1NI2 A;  1ZM0 A;  4KZC A;  4CHJ A;  2AX5 A;  4JWS C;  3MHZ A;  3CIR B;  2CHZ A;  1MIX A;  3DXE A;  2DEN B; 
#chains in the Genus database with same CATH homology
 2KAN A;  4FJZ A;  4MSQ B;  2BYV E;  3TBL D;  3DVN U;  2C7H A;  2O2V B;  3ZNZ B;  3ML4 A;  4TQ0 A;  1UNQ A;  2JZZ A;  2NBV B;  3H6N A;  4LDT D;  3IG3 A;  4GGQ A;  3OJ4 B;  1BTN A;  4KIK A;  5DHA B;  3SBG A;  1NU2 A;  1XCG A;  1J0G A;  2MW5 A;  4HDO A;  4MSM B;  2COP A;  2JVC A;  1OQY A;  4FN2 A;  3VIA A;  2YSZ A;  4CHK A;  2ZPN A;  4W9H A;  5LON B;  1S3S G;  5HE3 A;  3PG7 A;  3LJ3 A;  4IUM B;  4HXD A;  2HD5 B;  3D8F A;  2MSE D;  2N1V A;  4J6I A;  1WXM A;  3SHQ A;  4HCP B;  3A9K B;  1EGX A;  2RLO A;  3T06 A;  2R82 A;  5JHH A;  3IHP C;  4JKH A;  1EF5 A;  5DPR A;  2N7D A;  4IWO A;  1RRB A;  4AJW A;  2QHO A;  4BKS A;  3NZS A;  1AQC A;  3AJ4 A;  1NBF C;  3HM3 A;  2LVQ A;  1WXS A;  5EDS A;  1ZSQ A;  4PS8 A;  3PGE A;  2M1M A;  4KHA A;  4KDL B;  3DDC B;  4JK7 A;  4DHJ B;  1K5G B;  3FLV A;  4N9F 4;  1IRS A;  3DQV A;  4W9C A;  4MDK E;  1Q1O A;  4H8S A;  1P6S A;  1U27 A;  1WGU A;  2KTR A;  1V5P A;  2ABD A;  1RAX A;  2WYQ A;  1DDW A;  4F7Z A;  5AZG A;  3ODX A;  1YIW A;  1WVH A;  3IVF A;  3A8Q A;  3SDL C;  4EOY A;  3EPY A;  1BAK A;  2LYD A;  2FCM A;  3NOB A;  3H9D A;  2ELA A;  4HAV B;  4HLE A;  4JIO U;  4MEL A;  4YON A;  2I5C A;  1WZ3 A;  2W9N A;  4WJN A;  1GC6 A;  3HW2 B;  3TVV A;  2JZ3 B;  3UQB A;  3QJZ A;  4XWX A;  2R0D A;  3VUY A;  1WM2 A;  2MLB A;  2L76 A;  3QQ8 B;  4CHM A;  4FHK A;  1WX9 A;  1V5M A;  2DHK A;  2IO3 B;  3DBR I;  3APC A;  2IFS A;  1C1Y B;  1ZC4 B;  4B9K A;  5LLI A;  4FJV B;  3ZUN A;  5DH9 B;  2LOX A;  4HB4 B;  4L6E A;  2MBB B;  1WGG A;  1NTY A;  4JGH B;  1JRU A;  4PS7 A;  4D0N B;  1T0Y A;  1OEY J;  3EEC A;  4ASW C;  4W9D A;  2YRY A;  2OOB B;  3QK0 A;  1WE7 A;  1WJM A;  1UGM A;  2KJ6 A;  2MDX A;  2M14 A;  2O6V D;  4ILG B;  3CXB B;  5D3W A;  3V5W A;  4NPN A;  4HPM B;  1HBK A;  1U5G A;  4DBB A;  1KOT A;  2MP2 B;  2RQ1 A;  1NVL A;  3TW1 A;  1WGQ A;  2KOX A;  5JVL A;  4ZRI A;  4HB0 B;  2D9V A;  1UNP A;  3VQI A;  1IPG A;  2KX3 A;  5C5B A;  5CLL B;  1YQB A;  2GMI C;  5DIF B;  4NJ6 A;  3BIN A;  4F7H A;  3O65 B;  1V80 A;  2BYF A;  4TUU A;  3D8D A;  1YX5 B;  1GNU A;  1H8C A;  2ZPY A;  2NBW B;  4BKS D;  2KGX B;  3A98 B;  3MTN B;  3AI5 A;  3VTU A;  1Y19 B;  3B1L X;  2LKO A;  4KZ0 A;  4EMO A;  1FGY A;  2NVU I;  1XT9 B;  2LGX A;  3FSS A;  2NS5 A;  3KUZ A;  2KMC A;  4MEM A;  1ACA A;  5CHW A;  3VUW A;  3Q3J A;  3ENE A;  4MJS A;  4ANU A;  5HE0 A;  2FCN A;  1MPH A;  4G0N B;  1C3T A;  2KTF A;  3L10 B;  1I35 A;  2REX A;  3KY9 A;  3CMM B;  3M1I B;  1X05 A;  2IO1 B;  2MBQ A;  2K25 A;  1XOD A;  4FBJ B;  1X1M A;  2LGY A;  1FOE A;  1WRD B;  5D27 A;  1KZ7 A;  1GC7 A;  2KWV B;  4ANX A;  3PVL A;  1U4A A;  3H7P A;  3QBV B;  2J0K A;  5JZE B;  2RR9 A;  2AL6 A;  4ILJ A;  1BWN A;  5C5B B;  1UD7 A;  5CHV C;  5D3V A;  1V89 A;  1Y5O A;  5D7G A;  3A1Q A;  4BKT A;  3DBH I;  2P8V A;  1UEL A;  3VTV A;  3PVW A;  1PLS A;  3ECI A;  2FID A;  4I6P A;  1F9J A;  4GXB A;  3E66 A;  4IG7 B;  3ZNG C;  3Q3F A;  1WMH B;  1TBE A;  2MBO A;  1JDE A;  4XX5 A;  1UNR A;  2FCS A;  2PEA A;  3SU8 X;  1E8Z A;  3QWM A;  2MCN B;  3APD A;  2AEH A;  3ZNI D;  4W9F A;  4BBN C;  3KYC D;  1W1G A;  4BKG A;  2VRR B;  3ZW3 A;  4NNJ B;  1ZVR A;  4MJS B;  2AYO B;  1AWE A;  3FP5 A;  2UYZ B;  2GBJ A;  4PQ0 A;  1KI1 B;  1FHO A;  5JH5 C;  3PS6 A;  3CF6 E;  4NAW A;  3BY4 B;  1UEF A;  2KZR A;  3E9O A;  4G50 A;  1WGH A;  2ROZ B;  2KD0 A;  4HK2 A;  1U29 A;  5JHG A;  4MM3 A;  1WGD A;  3ODO A;  2XK5 B;  3DBS A;  3QC8 B;  4IWP A;  2Z0Q A;  2DTC A;  2KDE B;  4IOY X;  3RCP A;  2DX1 A;  1K8R B;  2IO2 B;  1LQB A;  1KBL A;  2B3A A;  5E6P A;  3VDZ A;  3QWZ B;  4EZJ A;  2L8J A;  1E90 A;  2JF5 A;  5LOP B;  4EKU A;  1ZW7 A;  4HAU B;  4GN1 A;  1W1H A;  2YS3 A;  3GYO A;  4IFS A;  2ZCB A;  2LAS A;  3D8E A;  4HCN B;  3M63 B;  1UBQ A;  1DRO A;  4XC2 A;  3DVG Y;  3T9L A;  2JRI B;  1DDV A;  4ZYN A;  4W9J A;  2NCN A;  2COF A;  4JKG A;  1XD4 A;  2BF8 B;  2RVB B;  2RSU A;  4HPL B;  1FHX A;  3JW0 X;  2CY5 A;  3K9P B;  4KHB B;  3W1S C;  2YVC A;  1X1F A;  2ELB A;  1J19 A;  1UBI A;  2J0M A;  4ANW A;  4E74 A;  4HAZ B;  3AU5 A;  4PYU A;  4WJ7 A;  3L17 A;  2WH5 A;  3WAM A;  3M62 B;  4E3C A;  2XBB C;  1P98 A;  1TTN A;  2YS5 A;  4HHV A;  1FXT B;  2IYB A;  3ZRF A;  4GMV A;  5DCN A;  2CKH B;  3WAN A;  2KFK B;  2ZVO A;  4DXA B;  2BKF A;  1GJZ A;  1FB8 A;  2ZNV C;  3ENB A;  1HB8 A;  2PE6 B;  3GYP A;  4Z2N A;  2KFJ A;  1PFJ A;  3L0W B;  1TGZ B;  4RMA A;  3PZD A;  3UQA A;  2CR5 A;  2EMS A;  4DX9 0;  2JUO A;  2P0H A;  2XK5 A;  1WGY A;  2J59 M;  1X1G A;  2K2J A;  4TV3 A;  2C5L C;  5JHB A;  4DDG D;  3NSU A;  2BKR B;  3B0A A;  5FI1 A;  1WM3 A;  4AWJ A;  4HVB A;  2QKL A;  5IJM A;  3GOE A;  3KUC B;  1E8Y A;  1P5T A;  2DZK A;  2NPT B;  2LG1 A;  4A6K A;  3VFK A;  3DXD A;  3QX1 A;  3RD2 A;  3ONS A;  1VD2 A;  3L16 A;  4RM9 A;  3SD5 A;  3JSV B;  3PHX B;  1M7E A;  1M7R A;  4K7W A;  1V88 A;  1MG8 A;  3DVG X;  5C1Z A;  4K1R B;  1U5E A;  2RNR B;  1PMS A;  2NZ8 B;  1ZGU B;  5KQ4 A;  3N3K B;  3VOQ A;  5CX3 A;  2UZR A;  1KLV A;  4HWI B;  5CHF A;  4NQL B;  1QQG A;  2KC1 A;  2N7E A;  3NZU A;  4YL8 A;  4IM2 A;  3TJP A;  3BJI A;  4AP4 C;  2KO3 A;  1WX7 A;  2COD A;  4WJQ A;  2ROV A;  3H7P B;  4PS3 A;  3U8Z A;  4JK8 A;  2CHX A;  2J7Q B;  4B95 A;  4BOS C;  1LFD A;  2KQS A;  4KAX B;  2EJ8 A;  2ZNV B;  3DVN V;  3OLM D;  3TCA A;  1BTK A;  5JLJ B;  1MKE A;  3RZF A;  1WIA A;  2LRU A;  2N0Y A;  2W2W A;  3K9O B;  1S1Q B;  3HHM A;  3KSY A;  3RZW C;  2L7R A;  2O2V A;  4P7I A;  2VKI A;  4HB3 B;  2Q13 A;  4GB9 A;  3MDB C;  1VCB A;  2WX0 A;  3UIN B;  5E6N A;  3HM6 X;  2WX1 A;  5J18 A;  2LVP A;  2X0S A;  3TFM A;  1E7U A;  2OJR A;  5D3Y A;  2FJ9 A;  5IAA C;  4A3O A;  2FAZ A;  1HE8 A;  2G3Q B;  2V76 A;  4WWO A;  4Y94 A;  2LZ6 A;  2CS4 A;  3ZLZ A;  4LCD E;  2FJL A;  1E8W A;  3L13 A;  2L0T A;  5CTR C;  3W1S A;  1BT0 A;  2PE9 A;  2JP2 A;  5G55 A;  1N3H A;  4IC7 B;  1LXD A;  2A4Z A;  2BYE A;  1P1A A;  2X18 A;  2CRF A;  4IAP A;  2IBI B;  3WAL A;  1EF1 A;  1HB6 A;  2OTX A;  3PRE A;  3SYX A;  1RRP B;  2PZ1 A;  1RJ2 A;  2DKQ A;  3O96 A;  5TR5 A;  2K6D B;  1Z2M A;  4PNK A;  1V81 A;  3LJU X;  2JPH A;  1IP9 A;  1TQZ A;  2RUK B;  1I2H A;  4CYE A;  2L00 B;  4KIK B;  3VUX A;  3KVF B;  4AOF A;  2RD0 A;  3PSC A;  1SIF A;  3B08 A;  3R7Q A;  3KRW A;  4GSW A;  1WGR A;  4XZ4 A;  3KZ1 A;  2KDI A;  2GCJ A;  3KW5 B;  3RUI B;  2D9Y A;  4M8M A;  3TIX A;  3LDZ E;  3V6C B;  4GDL A;  3X0W A;  3G9W A;  3QAR A;  1VBH A;  5J17 A;  4WAA A;  4FLH A;  2K1F A;  2KVR A;  3DXC A;  2V1Y A;  1GGO A;  1TXD A;  1ISN A;  1WMH A;  2Z0D B;  2HTH B;  3N30 A;  5KHQ A;  2UVM A;  3JVZ X;  1UPQ A;  5DPT A;  4GMX B;  5J2R A;  2K2U A;  1E7V A;  1X86 A;  2AWT A;  4A6H A;  2ZCC A;  2D9Z A;  1WE6 A;  4C0A A;  2DN6 A;  2COC A;  2O6V B;  4IM0 A;  3H7S A;  1WG7 A;  2BCJ A;  2C60 A;  1OTR B;  2KCJ A;  1WH3 A;  1WF9 A;  3M95 A;  1LW3 A;  3C0R B;  2ZJD A;  3ZKJ C;  2LJ5 A;  2LGD A;  1P3R A;  3A8P A;  4EEW A;  2K8B A;  1X11 A;  3PPA A;  4ICU A;  1QC6 A;  4FHJ A;  2N1W A;  3QA8 A;  3X23 A;  4KVG B;  2DAJ A;  3PV1 A;  5AZF A;  3A1Q B;  1E8X A;  2I5F A;  4DK5 A;  2FCQ A;  1WJ4 A;  3PTF C;  1WXA A;  2ASQ A;  5HE2 A;  1P9D U;  4EJN A;  2OQB A;  5L83 A;  1V2Y A;  3R3M A;  1J8C A;  2FIF A;  4F1S A;  4MGY E;  2MFQ A;  2YT1 A;  3VTW A;  5JHA A;  1FAO A;  5FI0 A;  1SE9 A;  4GDL B;  2P0F A;  5KHO A;  3P6A A;  3HK0 A;  2KMA A;  2JT4 B;  1GG3 A;  1YD8 U;  3SBT A;  5HKH A;  1WJU A;  2E2X A;  2IO0 B;  4DHZ B;  4NJ7 A;  1YJ1 A;  1E5W A;  2UWQ A;  4LJO B;  2LI5 A;  5D6J B;  2HTH A;  4II3 B;  2KX0 A;  1XR0 B;  4LDT B;  4WJP A;  2CHW A;  1WFY A;  2KDF B;  1A5R A;  3EFU A;  1TJ6 A;  4K2P A;  3WIM A;  4KSK C;  2K39 A;  3E9L A;  3ZO5 B;  2CU1 A;  1K5D B;  4EUT A;  3ZDT A;  4EZK A;  2GBN A;  2W2X D;  2CAY A;  3N32 A;  3CIK A;  3ML8 A;  4DDI D;  2N4F A;  3W1Y A;  1WI1 A;  2DHJ A;  3HIZ A;  4JKB A;  1QZE A;  2LXA A;  4JKC A;  3SV1 A;  3DOW A;  5D94 A;  4DWF A;  3UIO B;  3OJ3 A;  5D2M B;  3VXW A;  2DA0 A;  1P0R A;  1SHC A;  2FUH B;  4K7S A;  3V6E B;  4BVU C;  4G3X B;  1V86 A;  3V62 A;  2I1J A;  2H7D A;  5FR6 A;  4W9E A;  3JYU A;  2LUL A;  3TO1 A;  4A6F A;  3PLU A;  1V5O A;  4W9I A;  1WYW B;  2N9P C;  2L1C A;  2NPT A;  4ZDV A;  1MK7 B;  2JY6 A;  2D3G A;  2MA9 B;  4W9G A;  2COA A;  3NHE B;  3H1U A;  2Z59 B;  2H7E A;  2DX5 A;  4A5K A;  5LXI B;  2DHZ A;  2LWP A;  2L2I A;  1MIZ B;  1CMX B;  3I3T B;  4JK9 A;  4DX8 A;  3R66 C;  1U2B A;  3A9J B;  5C23 A;  4A6F B;  2D10 A;  1UZX B;  3DCG A;  1I7A A;  4IW0 A;  4HJK A;  4MGI E;  4HAX B;  4DHJ D;  1WXV A;  4HDQ A;  2JWZ A;  2IYD B;  2DFK A;  2FNJ B;  3RT3 B;  3WAO A;  3RYT A;  1RFA A;  2K8H A;  2KWC A;  2XQN M;  4WQO B;  3U30 A;  2IY0 B;  2MBE A;  2NMB A;  2LUE A;  3VH3 B;  2KXJ A;  3APF A;  3AU4 A;  2WDT B;  4HAT B;  4URK A;  3ALB A;  4WJO A;  1YX6 B;  4JKD A;  1UPR A;  4ZRK A;  2BPS A;  3UGB B;  5GMV A;  1WX8 A;  1Z87 A;  3A4S C;  2G35 A;  2KDB A;  2Z0E B;  4W9K A;  1OMW A;  3CSF A;  2WWZ A;  2GBR A;  4DHZ E;  4K17 A;  2ADZ A;  2KWU B;  4X57 B;  1SGH A;  4GOC A;  3QHT A;  5L95 C;  1EAZ A;  4F8C B;  4KSL C;  3TL5 A;  3GZN I;  4I6N B;  3NS8 A;  1FGZ A;  2BWE S;  2GS0 A;  3DBL I;  1NDD A;  4MT7 A;  2DZJ A;  4ZRJ A;  3ZVR A;  3ZDM C;  1WI0 A;  2HRJ A;  1H4R A;  5J3T A;  4MGK E;  2VSZ A;  5JP4 A;  2K6Q A;  3PT2 B;  2Y5B B;  3PEG A;  1V9J A;  4G11 A;  3UZT A;  1L2N A;  2KTR B;  1XKE A;  3N7C A;  2C7M B;  2MRP A;  5DI9 B;  4EFO A;  2J0J A;  1AAR A;  1KJT A;  1EUV B;  4OVU A;  4BFR A;  4GU2 A;  3IFW B;  1KZG A;  2BGF A;  5DPS A;  4K2O A;  2MWN B;  3OAN A;  3VVW B;  2M38 A;  1G6J A;  4M0W B;  1M94 A;  4JQW C;  2KQ7 A;  4ICV A;  2NBU A;  3V61 A;  4JKA A;  4GDK A;  1WR6 E;  3KH0 A;  5C6R A;  4WWN A;  1R4M I;  2FDQ A;  1WJ1 A;  3F0W A;  1XQQ A;  4W9L A;  3T8M A;  3SO6 A;  2DAF A;  2M17 A;  4ILH A;  4FUL A;  3VAW A;  3WA0 A;  4LJP B;  3PRZ A;  2CQU A;  4KHO A;  4OVV A;  3RCZ A;  2W2X C;  1MAI A;  1L7Y A;  3ZNH B;  1P3Q U;  2YF0 A;  4JKE A;  2K8C A;  2G45 B;  3UIP B;  3QCA A;  3TMP B;  2GJY A;  2MKR A;  1H10 A;  2D07 B;  2HE7 A;  3L08 A;  5DPW A;  4NY0 A;  2C9W B;  3EHV A;  4TQ1 A;  5D3X A;  2D9W A;  4IM3 A;  2KKC A;  1WR1 A;  4DBG A;  1LB1 A;  2ZZP B;  3WAP A;  2GCL A;  2YLM A;  4F7G A;  2D4Q A;  3DPD A;  1WZ0 A;  3MJW A;  1OGW A;  4B6W A;  2ZVN A;  1Q67 A;  1V5T A;  1EVH A;  4MK0 A;  1NTV A;  2Y8G A;  1OY2 A;  2MQJ A;  5KQ1 A;  4IWQ A;  1Q0W B;  2N9E B;  4RM8 A;  1VBG A;  4K7U A;  2DX5 B;  4WVF B;  2GBM A;  2Z0O A;  2G4D B;  3L54 A;  2L3Z A;  2Y8F A;  1NTI A;  2DIK A;  4MH0 E;  3S2A A;  2R2O A;  1GUA B;  1I42 A;  4BOZ B;  3KUD B;  1ST7 A;  3UF8 A;  4M8N A;  3PP2 A;  4A20 A;  4TYZ A;  1UH6 A;  2O6V A;  3ZRC A;  4HAW B;  4Z2M B;  2LD9 A;  4MGZ E;  4JKF A;  5GOW B;  4KV2 A;  3MPX A;  1XD3 B;  5AZH A;  2AL3 A;  4K81 A;  5CLQ B;  3VH4 B;  3ULC A;  1V6E A;  3FM8 C;  2L0F A;  3A4R A;  2ZEQ A;  3R7R A;  3IBE A;  1LM8 B;  1DYN A;  2IZV B;  3PHW B;  2LXC A;  3MHS D;  5BO4 B;  2C7N B;  4AJY B;  1TZ1 A;  1R4N I;  2I1K A;  1OEY A;  3CST A;  4MY6 A;  1W1D A;  4GPT B;  2V3S A;  2Y7B A;  2CB8 A;  2D11 A;  4JKG B;  3ZVV A;  1FHW A;  2Z0P A;  3F5R A;  4FA6 A;  3P2B A;  3U7D A;  3M3J A;  5G2N A;  1DDM A;  2DYB A;  1V61 A;  3A33 B;  2MX2 A;  1Z5S B;  3SNH A;  3FEH A;  1Y8R C;  2M8S A;  1DIK A;  3ZTC A;  2MBH A;  2KNB A;  4BBK A;  3QAQ A;  2CY4 A;  3PRM B;  2R09 A;  4E71 A;  4BBN F;  2PPH A;  3JSV A;  2KJH B;  1IYF A;  3PVU A;  5AEK B;  4CO7 A;  2KHW B;  1KC7 A;  1ZKH A;  2EMT A;  3AXC A;  2KFK A;  4KDI C;  2JXX A;  2DKP A;  1XX0 A;  2D9X A;  2KN5 A;  2DZM A;  4EZL A;  2N9X A;  1WY8 A;  4A3P A;  4JLC A;  5IA7 A;  2EC1 A;  2KK8 A;  4FJY A;  2DZI A;  5C79 A;  4NQK E;  4PYZ A;  1V49 A;  3ODW A;  5J3Y A;  2KLC A;  1MK9 B;  2LBB A;  2RSG A;  2PJH A;  2DYN A;  2JRH A;  3QIJ A;  5L81 A;  2YT0 A;  1ZC3 B;  3DXE A;  3ML9 A;  1B55 A;  2BWF A;  4B6H A;  2LRW A;  3PLV A;  2RPQ A;  4HAY B;  2VRW B;  3SUZ A;  2IY1 B;  3ZIM A;  4JL9 A;  2KC2 A;  2HJ8 A;  2XEW A;  2NR2 A;  2A5U A;  1V5U A;  5J3Q A;  1D3Z A;  2YS1 A;  1U5D A;  1RLF A;  4FAD A;  2EKE C;  2DHI A;  4I6L B;  2P0D A;  3PRP B;  4NAW B;  4F7U P;  2N23 A;  5EFX A;  3RUL A;  4NSW A;  2DYQ A;  3P7Z A;  1EO6 A;  2RGN B;  3V60 A;  3ULB A;  3ZTD A;  3D32 A;  3PSE B;  1OQN A;  4HB2 B;  4GIV A;  4AUQ C;  4ANV A;  3E9P A;  2LOZ A;  3A9K A;  3VHT C;  2D2Q A;  2RGF A;  3NY5 A;  2V4L A;  1WJN A;  2L05 A;  2DLW A;  1PQS A;  2LVO A;  1U5F A;  2UZS A;  2MP2 A;  3HQC A;  5KCV A;  1KM7 A;  5HE1 A;  2G4S A;  2K00 A;  3KRX A;  4GZU A;  2DYM A;  5DHF B;  2KJR A;  4TKN A;  1DBH A;  2DYO A;  2M4N A;  2MWS B;  3WYF B;  4II2 B;  2GBK A;  3KYD D;  1Q5W B;  2KUP A;  1WJ6 A;  3A9J A;  3AUL A;  3OAW A;  1J0W A;  5LXH A;  4WSF A;  5E6O A;  2GOW A;  2KLG A;  4WWP A;  2M0X A;  5C16 A;  4GDK B;  2R2Q A;  2QKM A;  1NI2 A;  1ZM0 A;  4KZC A;  4CHJ A;  2CHZ A;  1MIX A;  3EC8 A;  2DEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...