1SGHA

Moesin ferm domain bound to ebp50 c-terminal peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
294
structure length
294
Chain Sequence
TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Moesin
publication title The EBP50-moesin interaction involves a binding site regulated by direct masking on the FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 71
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2004-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1sghA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1sghA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1sghA01
3O96A 2MRPA 2YLMA 1RFAA 2L76A 3PP2A 3L17A 2QHOA 4G0NB 4HB2B 3GYPA 2W2WA 3VTUA 4FJVB 2EC1A 4ICUA 1M7EA 4A6KA 5EFXA 2HTHA 4HAYB 3ZVVA 1V88A 2RGNB 1WX8A 1KLVA 5DPSA 3KUZA 2N7EA 5IA7A 2AL6A 1WF9A 4HCNB 2G4DB 4DXAB 4TQ1A 3DXDA 4MJSB 4W9GA 2BKFA 2ZPNA 2BF8B 2G3QB 4J6IA 2BGFA 3FP5A 1LW3A 1WXAA 4NJ7A 2MBHA 2BYVE 2DKQA 2KLCA 1X05A 1E8XA 3BY4B 2N1VA 4ANVA 2K6QA 4II2B 1Q0WB 1LFDA 1MK9B 1NU2A 1NI2A 2LG1A 3R66C 4FBJB 2JVCA 3H7PB 1UH6A 2NS5A 5C79A 5TR5A 2R2QA 4D0NB 4HAUB 3WA0A 1EGXA 1FB8A 4GDLB 2OTXA 2H7EA 1EO6A 2DFKA 2LULA 2WDTB 4ANWA 2IY1B 2Z0PA 2RSGA 2KCJA 3UZTA 4DBBA 3ML4A 4KHBB 1BT0A 2OOBB 3VTVA 4WSFA 1ZW7A 4GSWA 3PVWA 1GC6A 2REXA 1RAXA 3A33B 4GIVA 3A1QB 2WX1A 3B1LX 3QA8A 3OJ4B 5IJMA 3H9DA 4PS8A 1V2YA 3WIMA 4DHJB 2I1KA 3VFKA 1EVHA 1WGQA 2IO1B 2DN6A 1XT9B 1DDMA 2D2QA 4EKUA 2K8CA 3QWMA 4K1RB 3A8QA 1WJNA 3JSVB 2KNBA 1WMHB 4XWXA 5HE2A 4E74A 2I5FA 1J8CA 3VQIA 1ZKHA 2ZEQA 3VHTC 2CY4A 3RCZA 3N3KB 5G55A 4DDID 1Y5OA 4B9KA 2COCA 1UPRA 3G9WA 4HXDA 2C7HA 3VH3B 2YRYA 3APCA 5D3WA 3EC8A 2R2OA 4DX90 1EAZA 2J0KA 3KYDD 5L95C 4W9EA 3SDLC 2D07B 2JXXA 4YONA 4MY6A 4KZ0A 4MELA 3PRMB 2M0XA 2WX0A 3DVNV 3QX1A 1GC7A 4WWOA 2V3SA 1L2NA 4MJSA 2IO3B 4KSKC 1WRDB 3WAMA 3VUYA 1KOTA 3I3TB 2KWVB 2ROZB 2KDIA 5L81A 2MKRA 2NMBA 3TL5A 2LGXA 3ODXA 1BTNA 1WJMA 2MA9B 2KMAA 1WJUA 1W1GA 4WWPA 4Z2NA 1HBKA 3ZVRA 4B6WA 1NDDA 2CAYA 1K5GB 3H7PA 1C3TA 1OGWA 4BOSC 3CXBB 2PJHA 3CSFA 2DAFA 2PE6B 1VD2A 2FJ9A 5D3VA 4GDLA 2K25A 4P7IA 3APDA 1TZ1A 2PEAA 2KQSA 3RD2A 2LKOA 2FCSA 5D7GA 2YS5A 2DENB 2YSZA 1PQSA 1SIFA 3MPXA 2DHZA 3OAWA 3U7DA 4BVUC 2Y5BB 3P6AA 3OJ3A 5LXIB 1UZXB 1J19A 3DXCA 2DZKA 3T06A 4W9KA 4PS3A 3D8FA 4IWQA 2KFJA 3JVZX 3W1SA 1X1GA 2JRHA 1IPGA 3A1QA 1D3ZA 3HQCA 2GBMA 3SYXA 1MIZB 1S1QB 4HB3B 3K9OB 2Q13A 3C0RB 4AJYB 1U27A 1C1YB 4BKTA 4HB0B 2D9YA 1U5GA 3ZLZA 5LXHA 5EDSA 1Z5SB 4K2OA 2K8BA 3A98B 2MBQA 1PLSA 1L7YA 1GG3A 1GNUA 2PE9A 3JSVA 2W2XD 2ROVA 1WMHA 1M94A 2VRWB 4HWIB 1UELA 1A5RA 2DX1A 1G6JA 1R4MI 3DQVA 2A4ZA 5AZFA 4OVUA 1FXTB 4FA6A 1EF5A 2EMTA 2MFQA 2LXAA 2KJRA 2YS3A 5D27A 2DYNA 3M95A 3PS6A 3AU5A 3AXCA 3N7CA 3TCAA 3KUCB 2RPQA 4HAVB 3RYTA 4C0AA 2R09A 4NAWB 1V5MA 2Y8GA 2NPTB 2KDBA 5DPTA 2NBWB 4G11A 4WAAA 1WVHA 2NZ8B 4HAXB 3DXEA 4II3B 1WI0A 2MWSB 2ZZPB 1WIAA 1P0RA 2RNRB 3DVGX 1I35A 4K2PA 1V5PA 3RT3B 1AWEA 2LRUA 2C60A 4A6FB 3M62B 1V89A 1W1HA 3L54A 4IM2A 2XBBC 2R0DA 3LDZE 1YD8U 2VRRB 2ZPYA 3TFMA 4E71A 2D9VA 1OMWA 1I2HA 3V60A 4TQ0A 4BOZB 2KHWB 1UPQA 1U29A 2GMIC 2HRJA 4H8SA 1IRSA 2KTRB 5IAAC 2KGXB 1V5TA 1WJ6A 1WGUA 3ONSA 1U5FA 4XC2A 1V6EA 2BYFA 3FM8C 4KZCA 2KO3A 2LI5A 4GMVA 3EECA 4MSMB 1P9DU 1TGZB 2DX5B 2LBBA 1J0WA 5JHGA 2JWZA 2PPHA 4AOFA 5J3TA 3IG3A 3PSCA 4F7UP 3JYUA 4FJYA 3PHWB 2YVCA 2LRWA 1FGZA 4A20A 5C23A 3VXWA 2RLOA 2ZJDA 3P7ZA 2D9XA 4FADA 3GYOA 2V1YA 3HHMA 2J0JA 1DBHA 3MDBC 4EFOA 1ZGUB 3D8EA 2I5CA 4ZYNA 4EUTA 3IHPC 1Q5WB 3PTFC 1K8RB 2KLGA 3DVGY 3ZNZB 2L1CA 1V86A 2KMCA 2LUEA 3Q3FA 1RLFA 1WGHA 2DYOA 1X1MA 2DYMA 4RM8A 2L00B 3ODOA 2L2IA 2KC2A 2JRIB 1UEFA 4PQ0A 3N32A 1AQCA 3L16A 4NAWA 2NPTA 2GOWA 1Y8RC 4MEMA 2MWNB 4X57B 2NBVB 3ZKJC 3ZIMA 4IWPA 2N9XA 1RJ2A 4RMAA 5LLIA 2LOXA 2ABDA 4XZ4A 4A6FA 4EEWA 3DBHI 1WY8A 4GOCA 2CRFA 3KH0A 1DDVA 2J7QB 3QWZB 3VUWA 4ZRIA 4BKSA 2C9WB 2IZVB 2FUHB 2ZNVB 5FI1A 3Q3JA 3V62A 4HDQA 2KTFA 3NOBA 2N23A 4DHZE 2L0FA 1P3QU 2FIDA 3TMPB 2M17A 2KWUB 1QZEA 5C6RA 1P1AA 2D9WA 3IFWB 2NBUA 2COFA 2L7RA 2I1JA 5FR6A 2LVPA 3CF6E 2KTRA 3W1SC 3DCGA 3KSYA 3PLVA 2K8HA 4W9DA 2K00A 2WYQA 4FLHA 3H7SA 4KSLC 1WXVA 2DX5A 4PYUA 3ML9A 2LJ5A 3ZNHB 1WXMA 2KKCA 2D10A 2C7MB 5JZEB 2VSZA 2M4NA 2CKHB 2JZZA 3EPYA 2B3AA 1UBIA 3PRZA 4ANUA 4MGKE 3LJUX 4TUUA 3PLUA 1I7AA 2J59M 2MQJA 2Z0QA 2ZCCA 3R7RA 2D3GA 2Z59B 4IOYX 3A8PA 1XD3B 5J3YA 3PZDA 2WWZA 1ISNA 4EZKA 3RZFA 1GJZA 4IUMB 2KX0A 3GZNI 4DHJD 4IW0A 4PYZA 4MK0A 3AULA 4OVVA 2HJ8A 2Z0DB 1KZ7A 3DBRI 2LZ6A 1WYWB 1YX6B 2MW5A 4LCDE 4ZRJA 5DHAB 2GBKA 4W9LA 3FSSA 4HAWB 2IO0B 2DYQA 1Z2MA 4EJNA 4KDLB 4PS7A 4GXBA 4WVFB 2BKRB 2IYBA 4A6HA 4IG7B 3QK0A 3PREA 1U5EA 2G45B 2G4SA 1V5UA 2N0YA 1NTIA 2NVUI 3PGEA 4MGZE 2O6VD 4GMXB 3VIAA 3UQAA 4EZLA 3UF8A 1UD7A 4IAPA 2V4LA 2HE7A 2DA0A 1VCBA 1OQNA 2LD9A 4HHVA 2KFKB 1UGMA 2UYZB 3T8MA 5LONB 1P5TA 2P0HA 3QJZA 5GOWB 3TVVA 1WXSA 1P98A 4NQKE 3ZNID 5CHWA 2DHKA 1WG7A 4CHJA 3UQBA 3M1IB 1LXDA 2FAZA 3F0WA 4AJWA 2CB8A 4HB4B 4RM9A 2O2VB 3AI5A 1BAKA 1OY2A 1X86A 1SHCA 2N1WA 4MM3A 4Y94A 2YT0A 2KN5A 3SNHA 1WE7A 2L05A 2GS0A 3HK0A 2RQ1A 5HKHA 3H1UA 5DIFB 4EZJA 2Z0EB 4AUQC 3F5RA 1WJ1A 1KI1B 1V49A 1E90A 4IWOA 3QAQA 1QC6A 3DVNU 1P3RA 4KAXB 1V5OA 2ZVOA 3SD5A 2V76A 5KQ4A 3W1YA 3R7QA 1T0YA 3CIKA 2XK5B 4K7UA 4FULA 1E7UA 3S2AA 3ZUNA 1Y19B 4N9F4 2DZJA 2OQBA 2GBNA 3ODWA 2Y8FA 5C5BB 5E6NA 4A5KA 1MPHA 1TTNA 1IYFA 3QCAA 2CODA 2D4QA 2ADZA 1TQZA 5AEKB 2M1MA 1WGDA 2RVBB 2LGYA 5KHOA 3SHQA 1N3HA 3BJIA 4G3XB 3MHSD 4KVGB 2L3ZA 4M0WB 2FNJB 4KIKB 3TO1A 4WJOA 2LVQA 2GCLA 2EMSA 4B95A 2KDEB 1DYNA 5JH5C 2UZRA 4YL8A 2YF0A 2K2UA 3DPDA 4TV3A 1UNPA 3QC8B 5BO4B 1FHXA 2KFKA 5AZGA 4HATB 2OJRA 3IBEA 1P6SA 3PPAA 1MAIA 3V5WA 1H10A 1UNQA 2JZ3B 2D11A 2JF5A 2CR5A 2LVOA 3PVLA 3HM3A 4MGYE 4BKGA 5KCVA 5D6JB 3DOWA 3TBLD 3AU4A 3V6CB 2KQ7A 1E5WA 1H4RA 4G50A 2MP2B 2O2VA 2CU1A 4CO7A 2Y7BA 3L0WB 2AWTA 3H6NA 3D8DA 4GU2A 3D32A 5CHVC 1WZ3A 3KRWA 1GUAB 3TJPA 2ELAA 2FCNA 1UNRA 4LDTD 2CHZA 3U30A 4DHZB 5KQ1A 4TKNA 4WJ7A 3QBVB 1TJ6A 1SE9A 4W9HA 2XK5A 2MDXA 3VAWA 4WJPA 4GDKB 2CY5A 1EF1A 2DTCA 4IM0A 2QKLA 3QIJA 3UGBB 5C5BA 2RUKB 2LGDA 1WM2A 4B6HA 4NY0A 1E8WA 1MK7B 3A4SC 2GBRA 2KJHB 1V81A 3PRPB 2EKEC 4HJKA 3M63B 1H8CA 1TXDA 4F8CB 1ZVRA 2JUOA 4WJNA 3DDCB 4MDKE 3EFUA 3PHXB 1B55A 4ZRKA 1WFYA 4HCPB 2P0FA 3O65B 1M7RA 3ULCA 2M14A 4KIKA 5D2MB 3UIOB 1TBEA 2JY6A 1IP9A 4AWJA 2KWCA 4I6PA 4HVBA 3KUDB 3MTNB 3SO6A 3NZUA 3WANA 1YIWA 3RULA 3VH4B 5E6PA 5J2RA 2KJ6A 1KM7A 1BWNA 4BBNC 5GMVA 3ULBA 2FDQA 2GJYA 4TYZA 2ZNVC 4ASWC 5CLLB 4JQWC 1R4NI 2FCQA 4HDOA 4F7HA 2DZMA 3U8ZA 2BWES 1K5DB 1PFJA 4ANXA 3NSUA 2MBEA 1KJTA 2P0DA 4EMOA 4I6NB 2KC1A 1X1FA 1X11A 3RUIB 5HE0A 4I6LB 4IC7B 5JP4A 3RZWC 1QQGA 1WM3A 1I42A 3VTWA 3FLVA 1Q67A 2MP2A 2J0MA 4KDIC 2UZSA 3FEHA 3X0WA 2N9EB 3NHEB 2C7NB 4XX5A 3KY9A 4K17A 2MCNB 3HM6X 2KOXA 4M8MA 4IFSA 4PNKA 3ZW3A 4LJPB 1V9JA 1ZC3B 1E7VA 4MT7A 1EUVB 3LJ3A 4F1SA 2N4FA 3CSTA 4A3OA 5CX3A 1WR1A 4MSQB 4ICVA 1AARA 2K2JA 1KZGA 2RGFA 3SU8X 4W9CA 3A9JB 2MLBA 3QARA 4NSWA 3UIPB 4HLEA 5JHHA 3ENEA 3KW5B 5L83A 1CMXB 2RSUA 3APFA 1RRPB 4GDKA 4K7WA 5JHBA 2K39A 1WZ0A 2CQUA 3PEGA 2BYEA 3ZTCA 1RRBA 5JLJB 3L13A 5DCNA 2N7DA 3VUXA 1ZC4B 3ZRFA 1HB6A 5C1ZA 1XCGA 2RD0A 2X18A 4GPTB 3WAOA 3B0AA 1DROA 3SV1A 2DHIA 4KHAA 3EHVA 4WJQA 5D3YA 3B08A 4URKA 4M8NA 3CMMB 5HE3A 3JW0X 3KVFB 1XR0B 1BTKA 4WWNA 5J18A 3VDZA 3DBLI 2COAA 3GOEA 3ZRCA 3WALA 3ZNGC 1F9JA 2KVRA 5J17A 1XODA 4FHKA 1WH3A 3A9KB 4DDGD 2FIFA 5AZHA 3NS8A 2COPA 2ZVNA 1NTVA 2UVMA 2XQNM 1ZM0A 2H7DA 2E2XA 2O6VB 4K81A 2K1FA 5DI9B 1S3SG 4DK5A 3ALBA 4JL9A 2WH5A 3ZTDA 2KD0A 1NBFC 2AEHA 2L0TA 4K7SA 3UINB 2RR9A 1E8YA 2LWPA 1V80A 3P2BA 1V61A 1XKEA 2LXCA 2M38A 1YJ1A 1E8ZA 1FHWA 2IBIB 1SGHA 4EOYA 4NNJB 4NJ6A 4ZDVA 4IM3A 4CHMA 4JIOU 5CLQB 2CHWA 2IO2B 3DBSA 2KX3A 1W1DA 1MG8A 2MSED 3K9PB 2KDFB 1NVLA 2YT1A 2HD5B 2DKPA 1UBQA 1OEYA 1ST7A 4GB9A 3NZSA 2C5LC 2JP2A 2K6DB 3A9JA 2FJLA 1WI1A 3IVFA 2QKMA 3RCPA 2W2XC 2L8JA 1Q1OA 2NR2A 3MJWA 2IFSA 1WJ4A 3NY5A 1WGYA 3R3MA 1FAOA 2N9PC 1FHOA 2Z0OA 1U2BA 4DWFA 1WX7A 3M3JA 4WQOB 5CTRC 3VOQA 3QHTA 1YQBA 2BPSA 3AJ4A 2YS1A 2CHXA 2DZIA 1XX0A 3ZDTA 5DH9B 3PT2B 4GZUA 1WR6E 3ZO5B 2CS4A 3ECIA 1OTRB 1MKEA 3TW1A 3ZDMC 3A9KA 1Z87A 3PG7A 5G2NA 3PV1A 2D9ZA 4FJZA 4NPNA 4F7GA 1OQYA 2LOZA 3A4RA 4W9JA 3L08A 2G35A 2MBBB 4HK2A 2UWQA 1HE8A 2ELBA 1ACAA 2O6VA 2JPHA 1LM8B 3OLMD 3HW2B 2HTHB 2AL3A 4MH0E 3OANA 3N30A 5FI0A 1MIXA 2AYOB 2M8SA 4JGHB 2DAJA 3VVWB 2GBJA 2BWFA 4NQLB 2DYBA 4HPMB 3V61A 5J3QA 3PVUA 2MBOA 4CHKA 1U5DA 2MX2A 3PSEB 2VKIA 4Z2MB 1XQQA 4W9FA 1YX5B 5KHQA 4GGQA 3V6EB 4KV2A 2KUPA 4L6EA 4HAZB 3WAPA 4LJOB 1PMSA 1J0GA 3QQ8B 4GN1A 4F7ZA 5D3XA 4BBKA 5DPRA 1DDWA 2KANA 4HPLB 3BINA 2KZRA 4BKSD 3SUZA 2DHJA 4DX8A 1LQBA 3HIZA 1NTYA 1XD4A 3KYCD 3KRXA 1HB8A 2JT4B 5C16A 2KK8A 2BCJA 2XEWA 1U4AA 2FCMA 3T9LA 1WGGA 5E6OA 5D94A 2LYDA 2NCNA 2W9NA 4KHOA 4E3CA 2LASA 3TIXA 4FHJA 4LDTB 2EJ8A 1JRUA 4CYEA 2A5UA 5JHAA 1ZSQA 5LOPB 1WX9A 5DPWA 4FN2A 1OEYJ 5DHFB 2IYDB 2DLWA 4AP4C 2ASQA 4MGIE 3WYFB 4DBGA 2KXJA 4A3PA 5CHFA 2IY0B 4JLCA 4BFRA 3X23A 3L10B 5HE1A 1LB1A 2PZ1A 1WGRA 2P8VA 4W9IA 2GCJA 3ML8A 1WE6A 3KZ1A 4BBNF 1FGYA 2ZCBA 1FOEA
chains in the Genus database with same CATH superfamily
3O96A 2LJIA 2WGSA 2MRPA 2YLMA 1KTKA 1RFAA 2L76A 4H2AA 1YNTE 1FNUA 3OWEB 2K3UA 3U4EG 2WXLA 3PP2A 4DQOC 3L17A 3W5VB 2QHOA 1AN8A 4G0NB 4HB2B 3GYPA 2WXIA 5I2MA 1VJKA 2W2WA 1FNVA 3VTUA 4FJVB 4RH6A 1K53A 2EC1A 4ICUA 3ZXVA 4HPPA 1M7EA 1GPXA 4A6KA 5EFXA 2E3TA 2HTHA 4HAYB 3ZVVA 3ZXRA 1V88A 2RGNB 1L6UA 1WX8A 1KLVA 2YEPF 2W55A 5DPSA 3KUZA 1L0XB 4LNNA 2BVCA 1JRPA 2N7EA 5IA7A 1SSNA 2V3NA 2AL6A 1I4HA 5FK9C 1WF9A 3AM9A 4HCNB 2G4DB 4DXAB 4TQ1A 3DXDA 4MJSB 4W9GA 2BKFA 2ZPNA 2BF8B 2G3QB 4J6IA 2BGFA 3FP5A 1LW3A 1R4MB 1WXAA 1ZP0B 3FILB 4NJ7A 2CU3A 2MBHA 1K52A 2BYVE 2CJNA 2DKQA 2KLCA 1X05A 1E8XA 3BY4B 2N1VA 4ANVA 2K6QA 3GS2A 4II2B 1Q0WB 3P4PB 1LFDA 1MK9B 1NU2A 1NI2A 2LG1A 3R66C 4FBJB 2JX5A 4MH8A 2JVCA 3H7PB 1UH6A 3AE3B 2NS5A 3AMZA 4YTNB 5C79A 4N58A 5TR5A 2R2QA 4D0NB 1E6EB 3LB8C 3R2TA 4HAUB 1ZDVA 3WA0A 1EGXA 1FB8A 4GDLB 1ET9A 2OTXA 4QJ4B 2H7EA 1EO6A 2ZW0A 2DFKA 2LULA 2WDTB 3N9YC 3R8BA 3DHIC 1TS5A 1KLGD 4ANWA 2ONQA 2IY1B 1CZPA 4CSQA 2Z0PA 2RSGA 1F77A 2KCJA 1QKZA 3UZTA 4DBBA 2Q5WD 3ML4A 4KHBB 1BT0A 3E66A 2OOBB 3VTVA 4PK1A 4WSFA 1ZW7A 2KDMA 4GSWA 1R7SA 3PVWA 2QILA 1GC6A 2REXA 1RAXA 3A33B 4GIVA 3A1QB 5C2TB 2WX1A 2KMMA 3B1LX 3QA8A 3OJ4B 5IJMA 3H9DA 3VR9B 4PS8A 1V2YA 1TIFA 4WH4A 3WIMA 2FBWB 3RMKC 2INNE 4DHJB 2I1KA 3VFKA 1NVID 4L23A 1EVHA 1XLOA 1WGQA 5EE1A 3Q8FA 1E10A 2IO1B 4A55A 3BVMA 4P1BC 2V9HA 4HKZE 2DN6A 1XT9B 2G1EA 1DDMA 1RM6C 2I38A 2W3RA 1D5MC 2D2QA 4EKUA 2K8CA 3QWMA 2PMVA 4K1RB 4NJCA 3A8QA 1YJIA 2PW9A 5AUKA 1WJNA 3JSVB 2KNBA 1WMHB 5EE9A 4XWXA 5HE2A 4E74A 2I5FA 1J8CA 1BUIC 3VQIA 1ZKHA 2ZEQA 2Y5PA 3VHTC 2CY4A 3RCZA 3N3KB 3WCQA 3AE1B 5G55A 3BVGA 4DDID 1Y5OA 1YJJA 4B9KA 3HVZA 1DOIA 4YSYB 2COCA 1UPRA 3G9WA 5HG2A 4HXDA 2C7HA 1XXGA 3VH3B 2YRYA 3APCA 5D3WA 3EC8A 2WP9B 2R2OA 1FXIA 2AQ1B 1YOVB 4DX90 1EAZA 4KGTA 2J0KA 3KYDD 1MI1A 2KIGA 5L95C 4W9EA 3SDLC 1QF6A 2D07B 2JXXA 4YONA 2BB6A 4MY6A 3T3OA 4KZ0A 1C76A 1UF0A 2Z13A 1NYRA 4MELA 3PRMB 2M0XA 2WX0A 3DVNV 3QX1A 3B2GA 1GC7A 4WWOA 2WQYB 2V3SA 1L2NA 4MJSA 5M4YB 2IO3B 4KSKC 1WRDB 3WAMA 3VUYA 1KOTA 3P4SB 3I3TB 2J52A 2KWVB 2ROZB 2KDIA 3FILA 5L81A 2MKRA 2NMBA 1XEEA 4YTPB 2LGXA 1I4PA 3ODXA 1BTNA 1HQRD 1WJMA 3TL5A 2MA9B 4LNIA 3AEAB 2KMAA 1J7AA 3BWUD 1WJUA 1QT9A 1W1GA 4ZHOA 4WWPA 3BK2A 3I57A 4Z2NA 3B2FA 1HBKA 3ZVRA 4B6WA 2WLBA 3VRAB 1NDDA 2CAYA 2WHIA 1K5GB 3H7PA 2WU5B 1C3TA 1SBBB 3TEZA 1IBXB 1OGWA 4YSZB 4BOSC 3CXBB 2PJHA 1IGCA 2DAFA 3CSFA 2PE6B 2X38A 3MJ5A 2BTEA 4ILGB 1VD2A 2FJ9A 5D3VA 4GDLA 2K25A 4P7IA 1KRHA 1TZ1A 2PEAA 2KQSA 3APDA 3RD2A 2LKOA 1QLBB 2FCSA 5D7GA 2OEDA 2YS5A 2DENB 2YSZA 1PFDA 2DHZA 3MPXA 1PQSA 1SIFA 3OAWA 3U7DA 4BVUC 2Y5BB 3BK1A 2KAJA 3P6AA 1MFWA 2WXOA 3Q3NC 2FJUB 3OJ3A 5LXIB 2PLPA 1UZXB 1J19A 4KHBA 3DXCA 2DZKA 3T06A 4W9KA 3TEXA 5JXVA 1EU3A 4PS3A 1FFUA 3DBHB 3D8FA 4IWQA 1JWSD 2KFJA 3JVZX 1ENFA 3W1SA 1X1GA 2JRHA 4BAXA 1IPGA 3KWVA 3EUB2 4LNFA 3A1QA 2WDVB 1D3ZA 2WXQA 3HQCA 2GBMA 3RFZB 1I7HA 3SYXA 1MIZB 2DNFA 1IGDA 4HB3B 1S1QB 1XF5L 5EE3A 3K9OB 2Q13A 3C0RB 3NRZA 4AJYB 1U27A 1C1YB 4BKTA 4HB0B 2I2YA 2D9YA 1U5GA 1TKGA 3ZLZA 5LXHA 5EDSA 2GI9A 1Z5SB 4K2OA 1YN5A 2K8BA 3A98B 2FUG1 4QJ3B 2MBQA 1PLSA 1L7YA 4D2KA 1GG3A 2WXJA 1GNUA 1B9RA 2PE9A 3JSVA 2W2XD 2ROVA 1WMHA 4EE2A 1M94A 2LGSA 2VRWB 3ENBA 4HWIB 5GXGB 5G5GA 1UELA 4JKDA 1E0ZA 1A5RA 2DX1A 1G6JA 1R4MI 4IOIE 3DQVA 3RPFC 2A4ZA 5AZFA 2JU6X 4C4VB 3SEBA 4OVUA 3MFGA 1FXTB 4FA6A 1EF5A 2EMTA 2MFQA 2V4IB 2LXAA 2KJRA 2KUQA 2YS3A 1QOGA 3GE8C 5D27A 2DYNA 3M95A 3PS6A 3AU5A 2D3CA 3AXCA 4OSNA 2AX5A 1ZUD2 1SE4A 3N7CA 2VZKD 3TCAA 3KUCB 1F2RI 2RPQA 4HAVB 1TT5B 3ABVB 4TMAB 3RYTA 4C0AA 2R09A 4NAWB 2Y8GA 1V5MA 1KBLA 2NPTB 2WXGA 1JROA 2KDBA 5DPTA 2R82A 2NBWB 3AEBB 4G11A 5D3DA 3ZJVA 4WAAA 1WVHA 3TEWA 1C79A 2BS2B 2NZ8B 4HAXB 1ZOYB 3DXEA 1AYFA 3NW8A 3GZNB 4II3B 1WI0A 2MWSB 2ZZPB 1WIAA 1P0RA 2RNRB 1FCLA 3DVGX 3MHZA 1I35A 4K2PA 2ACZB 1V5PA 3RT3B 1AWEA 2QEJC 2LRUA 2C60A 4A6FB 3Q3MC 3M62B 1HXYD 3CIRB 1V89A 1W1HA 2BW2A 3L54A 4IM2A 2XBBC 3PZ7A 2R0DA 3R2IA 5MPOA 3LDZE 3B9JA 1YD8U 2WXMA 1MVKA 2VRRB 2ZPYA 3TFMA 4E71A 1IBXA 1VRAB 2X0SA 1J7CA 2N0SB 4S17A 2D9VA 1OMWA 1WGKA 1I2HA 3V60A 3EGRA 4TQ0A 1PUTA 4BOZB 2KHWB 2RDHA 1UPQA 4RGOS 2EKIA 1U29A 2GMIC 2WXRA 2HRJA 2NTSA 4H8SA 1TZOA 2J4XA 1IRSA 2KTRB 1QOAA 2KGXB 5IAAC 1WRIA 4XDDA 1V5TA 1WJ6A 1WGUA 3ONSA 1U5FA 4YSXB 2KWDA 1MHHE 1RFKA 4XC2A 1V6EA 2BYFA 3FM8C 2MEKA 4M02A 2LI5A 2KO3A 2WNMA 4KZCA 4GMVA 1SF0A 3EECA 1JCKB 4MSMB 4KGSA 1P9DU 1TGZB 2DX5B 1T0QC 2LBBA 1J0WA 1I4XA 1FRRA 5JHGA 2JWZA 4A6QA 2PPHA 4AOFA 3E56A 5J3TA 3IG3A 4XE0A 3PSCA 3AE7B 4F7UP 1WYGA 3JYUA 4XYCA 4FJYA 1QILA 3PHWB 2YVCA 2LRWA 1FGZA 1XLNA 4A20A 1JALA 5C23A 5TSSA 3VXWA 2RLOA 5LNK1 1GOZA 5HFYA 3Q8EA 4USAA 2ZJDA 1VZ6A 2DLBA 3P7ZA 2D9XA 4FADA 3GYOA 1N60A 2V1YA 3HHMA 2J0JA 1DBHA 3MDBC 2LMCA 4EFOA 1ZGUB 3D8EA 2I5CA 4ZYNA 4EUTA 3IHPC 1Q5WB 1STEA 3PTFC 1K8RB 2KLGA 4C4VA 3DVGY 3ZNZB 2L1CA 1V86A 2KMCA 2N9KA 2LUEA 3Q3FA 1RLFA 1WGHA 2DYOA 1X1MA 2DYMA 4RM8A 1YQ3B 2L00B 3NWAA 3ODOA 3VR8B 2L2IA 1FCCC 2KC2A 2JRIB 1UEFA 4PQ0A 3N32A 4ILHA 2LHDA 1AQCA 2HJ1A 3L16A 4JKGB 2KVZA 4NAWA 4ZOHC 2NPTA 2GOWA 4RF1A 1P7EA 2GLSA 5D3IB 3MC9A 4DIXA 3RN9C 1Y8RC 3FKYA 4MEMA 3Q2AC 2MWNB 3KQ4A 3P1MA 5C3JB 3PO0A 4X57B 4GOUA 1F0ZA 2NBVB 3ZKJC 3ZIMA 4IWPA 2N9XA 1RJ2A 4RMAA 5LLIA 2LOXA 2ABDA 4XZ4A 5BYSA 4A6FA 4J3OD 4EEWA 3AEDB 3DBHI 1WY8A 4GOCA 2CRFA 2KIEA 3KH0A 3P4QB 1DIKA 3NZ3A 1KF6B 3Q6BA 1DDVA 2J7QB 1F2RC 3QWZB 3W2DA 4YT0B 1K50A 3VUWA 3URYA 3BIID 5IO9A 4ZRIA 4BKSA 2C9WB 2IZVB 3TUOA 2GB1A 4YWGG 2FUHB 4KX6B 2ZNVB 5FI1A 3Q3JA 2H89B 3V62A 4HDQA 2KTFA 3NOBA 2N23A 4DHZE 2L0FA 1P3QU 2FIDA 4ILJA 3TMPB 2J42A 2M17A 2KWUB 1QZEA 1ET6A 5C6RA 1L0VB 1P1AA 2LHEA 2D9WA 3IFWB 2NBUA 2COFA 1UNSA 2L7RA 2I1JA 5FR6A 2LVPA 3CF6E 2KTRA 3U52E 3W1SC 3DCGA 4C7ZA 3KSYA 3PLVA 2K8HA 2K00A 2WYQA 4W9DA 4A8XC 4FLHA 1FIQA 4MM3B 3H7SA 4KSLC 1WXVA 2DX5A 4PYUA 4MACA 3ML9A 2LJ5A 2YEPB 4RGNA 3ZNHB 1WXMA 2KKCA 2D10A 2C7MB 5JZEB 2VSZA 2M4NA 2CKHB 1QQRA 5IOIA 4HROA 2JZZA 3EPYA 2B3AA 1UBIA 2IPKD 3PRZA 4ANUA 4MGKE 3LJUX 1KFYB 1QOBA 3NUHB 4TUUA 3RNGC 1FFVA 1J7BA 2D3BA 3NG0A 3PLUA 1I7AA 2QDFA 2J59M 2MQJA 4C7YA 1FM0D 5AUIA 1I4GA 2Z0QA 3HSAA 1I4QA 4JKBA 2ZCCA 3R7RA 3W9CB 1XCQL 2BT6A 2D3GA 3FVCA 2Z59B 2ZKMX 4IOYX 3A8PA 1XD3B 1MPEA 5J3YA 3AECB 3PZDA 1C4AA 2WWZA 1ISNA 4EZKA 3RZFA 1GJZA 4IUMB 2KX0A 3GZNI 5FKAC 3BZDB 2HTME 1VDVA 4DHJD 3RNCC 2QJLA 4IW0A 3OHMB 4PYZA 4MK0A 3AULA 4OZBA 4OVVA 2HJ8A 2AQ2B 2WU2B 1V97A 2Z0DB 1VLBA 1KZ7A 3DBRI 3Q69A 2LZ6A 1WYWB 3VRBB 1YX6B 2OHFA 2MW5A 3E9PA 4LCDE 4ZRJA 3AE4B 1F52A 2AQ3B 4JK7A 5DHAB 2GBKA 4W9LA 4WIPA 2LEKA 3FSSA 4HAWB 4LTUA 2KT7A 2IO0B 2IGGA 2DYQA 1Z2MA 1YMHE 4JKGA 4EJNA 4KDLB 4PS7A 4GXBA 4WVFB 2PTLA 2BKRB 4JKHA 2IYBA 4A6HA 4YTMB 4IG7B 1CK1A 2GUMA 3NVYA 3QK0A 3PREA 1U5EA 2RPVA 2G45B 4QXAB 2G4SA 1V5UA 2N0YA 1NTIA 3EFCA 2NVUI 3PGEA 4MGZE 2O6VD 4GMXB 3VIAA 3ETRA 3UQAA 3GE3C 4EZLA 2NBVA 3UF8A 1UD7A 1OFFA 4OZAA 4WAFA 4IAPA 2V4LA 4A90A 2JYEA 2HE7A 2DA0A 1VCBA 1OQNA 2LD9A 4HHVA 3N20C 4JK9A 2KFKB 1UGMA 2UYZB 3T8MA 4AS1A 5LONB 1P5TA 2P0HA 3QJZA 5GOWB 3TVVA 2PIAA 1WXSA 1P98A 4NQKE 2E6XA 1EU4A 3ZNID 5CHWA 2DHKA 2GRIA 1WG7A 3N1ZC 4CHJA 3UQBA 3M1IB 2WXPA 4NZLB 2KACA 1LXDA 1D4BA 2FAZA 1DGJA 1GB1A 3F0WA 4AJWA 2QMTA 1HZ5A 2M0AA 2CB8A 4HB4B 1K51A 4M01A 4RM9A 1TJEA 2O2VB 3AI5A 3ZGZA 1BAKA 1JDEA 1HEZE 1OY2A 1X86A 1L5PA 3C19A 4C56C 1SHCA 2BS4B 2N1WA 4MM3A 4HEA1 4Y94A 3AE2B 2YT0A 2KN5A 3SNHA 5G5HA 4IDIA 2TSSA 1WE7A 2L05A 4HJGE 2GS0A 3HK0A 2RQ1A 1R4NB 5BYRA 5HKHA 2WDRB 1ZE3D 4LK0M 3H1UA 2LUMA 2VH2A 5DIFB 3NS1A 4EZJA 2Z0EB 4AUQC 3F5RA 1WJ1A 1KI1B 1V49A 4S0RA 2K49A 3GP7A 1E90A 4IWOA 3QAQA 1QC6A 3DVNU 1P3RA 4KAXB 1V5OA 2ZVOA 4JPSA 2Z59A 3SD5A 2V76A 5KQ4A 3NVZA 3W1YA 3AEFB 3R7QA 4R3DA 1T3QA 2BB5A 3V05A 1T0YA 3CIKA 4L1RA 2XK5B 2VH1A 4K7UA 4FULA 1MG4A 2M56B 1E7UA 3S2AA 3ZUNA 1Y19B 4N9F4 2DZJA 2OQBA 2GBNA 3ODWA 2Y8FA 4ZHPA 1JMLA 5C5BB 5E6NA 1EM7A 2RMMA 5IRSA 4A5KA 1XCTL 1MPHA 1RWSA 1V8CA 1TTNA 1VR9A 5IP4D 1PGXA 1IYFA 3QCAA 2CODA 3TEYA 2D4QA 2ADZA 1JWBD 1NENB 5JVLA 1TQZA 4P1CC 5AEKB 5T8IA 2M1MA 1DOYA 2BQQA 1WGDA 2RVBB 2LGYA 5KHOA 3SHQA 1N3HA 3BJIA 4G3XB 4ZRPA 3MHSD 1MHXA 4US8A 4KVGB 2NTTA 2L3ZA 4M0WB 2FNJB 4RNAA 1ZDXA 1BMLC 4KIKB 3TO1A 4WJOA 2LVQA 2GCLA 2V0GA 2EMSA 4B95A 2KDEB 4C00A 1DYNA 5JH5C 2NMQA 2UZRA 1UUPA 4YL8A 4JX1C 2YF0A 1VZ7A 5BMHA 5HI1A 2K2UA 4JK8A 1QOFA 3DPDA 1TS2A 1PGAA 3SFDB 4TV3A 1UNPA 3QC8B 5BO4B 5H8YE 1FHXA 2KFKA 2ZW1A 1C4CA 2KN4A 2W54A 5AZGA 4HATB 2OJRA 3BVZA 3IBEA 1FXAA 3DBRB 3BYYB 2WS3B 1P6SA 3PPAA 1MAIA 3V5WA 1H10A 3ZYYX 3SR6A 4OW0A 1ZXIA 3DBLB 4B0EA 4L1BA 1UNQA 2JZ3B 2D11A 1YN3A 2JF5A 1TS4A 4M00A 3E9SA 3RNEC 2CR5A 2R61A 2LVOA 3PVLA 1UWMA 3HM3A 2K22A 1FPYA 4MGYE 4BKGA 5KCVA 2QC8A 5D6JB 3DOWA 1Q10A 2BYTA 3TBLD 2D5GA 3AU4A 3V6CB 2KQ7A 1E5WA 1H4RA 4G50A 2MP2B 2O2VA 1ZYIA 2CU1A 4CO7A 2Y7BA 2BS3B 3L0WB 2AWTA 4GLSC 3H6NA 4MT5A 1JW9D 3D8DA 1LO5D 2JZPA 4GU2A 2L1AA 3D32A 2FE8A 5CHVC 4B0MA 1WZ3A 4P16A 4P6VF 3P4RB 4L2YA 3KRWA 1GUAB 3KLSX 3NVVA 3TJPA 3Q14C 2ELAA 3EA6A 3NWDA 2DBYA 2FCNA 3AE6B 2Y5CA 1UNRA 4LDTD 5BYQA 1D5ZC 2CHZA 4ACFA 1L6VA 3L4PA 2EELA 3T3NA 3U30A 4DHZB 4TSSA 1JWAD 5KQ1A 2QSDA 4TKNA 4WJ7A 3QBVB 1TJ6A 4JWUC 4WQMA 1SE9A 4W9HA 2XK5A 2MDXA 3VAWA 3FAHA 4WJPA 4GDKB 2CY5A 2Z8LA 1EF1A 2DTCA 4IM0A 2QKLA 3QIJA 1WXQA 3OG5A 3UGBB 3C8YA 5C5BA 2LGDA 2RUKB 1SEBD 1TYGB 1WM2A 4B6HA 4NY0A 1F1HA 1E8WA 1MK7B 2L83A 2QIEB 2GBRA 3A4SC 3TSSA 1WSPA 2KJHB 1V81A 3PRPB 2EKEC 3AH7A 5BMGA 4HJKA 2RDBC 3M63B 4XWWA 1H8CA 1FRDA 1TXDA 4F8CB 1ZVRA 5I2SA 1EWYC 2SEBD 2JUOA 1JQ4A 4WJNA 3DDCB 4MDKE 3EFUA 3PHXB 1B55A 3U7ZA 4ZRKA 2IGHA 2LFIA 1N5WA 1ACCA 2BBCA 4RFBA 5BMIA 1WFYA 4HCPB 2P0FA 3O65B 4N6EB 1M7RA 3ULCA 1T77A 2M14A 4M0WA 4KIKA 3NVWA 5D2MB 2RRFA 3UIOB 3E9LA 1TBEA 2JY6A 1IP9A 1L4ZB 4AWJA 2KWCA 4I6PA 4HVBA 3KUDB 3MTNB 4DXFA 3SO6A 3NZUA 3WANA 1AWDA 1OQRA 1YIWA 3RULA 3VH4B 5E6PA 5J2RA 2KJ6A 1KM7A 2D3AA 1BWNA 1JWMD 4BBNC 3SBGA 5GMVA 3ULBA 2MJ3A 2FDQA 2GJYA 4TYZA 2ZNVC 3Q8BA 4ASWC 1VBHA 1D6EC 5CLLB 4NAMA 4JQWC 1R4NI 1HTQA 2FCQA 3HRDD 4KKJA 4HDOA 4F7HA 2DZMA 1C78A 3U8ZA 2BWES 1K5DB 1PFJA 3A58A 4ANXA 3NSUA 2MBEA 1KJTA 2P0DA 4KGRA 1JWUD 4EMOA 4I6NB 2KC1A 1X1FA 4HSIA 1X11A 5FR3A 3RUIB 5HE0A 4I6LB 4IC7B 2CJOA 5JP4A 3KWLA 3RZWC 1QQGA 1WM3A 1I42A 3AN1A 3LXFA 3VTWA 3FLVA 1Q67A 3DWMA 2MP2A 2J0MA 1SE2A 4KDIC 2UZSA 3FEHA 2INPE 4JWSC 2DWQA 1AW7A 3X0WA 1E9MA 2LGIA 2N9EB 3NHEB 2C7NB 4XX5A 1HTOA 3KY9A 4K17A 2MCNB 3HM6X 2KOXA 1CQVA 1CJEA 1GAQB 4M8MA 4IFSA 4PNKA 3ZW3A 4LJPB 1V9JA 1ZC3B 1E7VA 4MT7A 1EUVB 3LJ3A 4F1SA 2N4FA 3CSTA 4A3OA 5LG4B 5CX3A 1WR1A 3PZ8A 4MSQB 4RGTA 4ICVA 1AARA 2WXFA 2L52A 2K2JA 1KZGA 4D6WA 2QCZA 2RGFA 3SU8X 4W9CA 3HIEA 3A9JB 2MLBA 1DOXA 4NSWA 3QARA 3UIPB 4HLEA 3P42A 3DHGC 1YN4A 5JHHA 2K8EA 3DHHC 1SJHD 3ENEA 4Q2JA 2JQRB 3KW5B 5L83A 4XGAB 1CMXB 3Q3OC 2RSUA 1EWCA 3APFA 1RRPB 1T0SC 1TKEA 4GDKA 3BYTB 4K7WA 5JHBA 1P7FA 2K39A 1WZ0A 2CQUA 3PEGA 2BYEA 3ZTCA 3NWFA 1RRBA 5JLJB 3L13A 5DCNA 2N7DA 1ZPSA 3VUXA 1V1PB 1ZC4B 1C4PA 3ZRFA 4YXDB 1HB6A 1RYJA 5C1ZA 1XCGA 1HA5A 2RD0A 3IXSA 2PVGC 2W3SA 4OT1A 1V1OA 2X18A 2MJEA 3HVDA 4GPTB 3WAOA 3I63C 3B0AA 1DROA 3SV1A 4ZRQA 2DHIA 3NJTA 4KHAA 1TKYA 3EHVA 4WJQA 5D3YA 1FO4A 3B08A 4LNKA 4URKA 4M8NA 3MC8A 3CMMB 5HE3A 3JW0X 4PT5A 3KVFB 1XR0B 1BTKA 4WWNA 5J18A 3VDZA 3DBLI 2COAA 3GOEA 3ZRCA 3WALA 3ZNGC 1F9JA 2KVRA 3J9CA 5J17A 1XODA 4CQNA 4FHKA 4N59A 1WH3A 3A9KB 2K9XA 4LLGM 4DDGD 2INDC 2L32A 1SIJA 1I4RA 2FIFA 5AZHA 2N7JA 3NS8A 4JE3B 2COPA 3AE9B 2ZVNA 1NTVA 1FNWA 4K3BA 2UVMA 2XQNM 1ZM0A 2H7DA 2E2XA 3W5UB 3RNAC 2SAKA 3IT4B 1BXTA 1N63A 2O6VB 4ITKA 4K81A 1L0YB 2K1FA 1IUEA 5DI9B 2K0PA 1D5XC 1S3SG 4A9AA 4DK5A 3ALBA 4JL9A 2WH5A 1E7PB 3AEEB 3ZTDA 2KD0A 4JKFA 1Y56A 1NBFC 1SB3C 4JKAA 2AEHA 2HDEA 2L0TA 4K7SA 1N62A 1VBGA 5IN7A 4JKCA 1C9FA 1N6ZA 3UINB 4HKQA 2RR9A 1E8YA 4XDCA 2LWPA 1V80A 3P2BA 1WWTA 2MHJA 1SXTA 1N5XA 4UDUC 1V61A 1XKEA 2LXCA 2M38A 4RF0A 5HHDG 1YJ1A 1E8ZA 1FHWA 2IBIB 1SGHA 2XN9C 4GNKB 4EOYA 4NNJB 4NJ6A 3SFEB 4ZDVA 1KC7A 4WWMA 2PVOD 3E9OA 1UWXA 4IM3A 4CHMA 2WDQB 4JIOU 5CLQB 2CHWA 2PKOA 2IO2B 1L4DB 3DBSA 2KX3A 3RI7C 1W1DA 1MG8A 2MSED 1B1ZA 3K9PB 4QAYA 3P63A 2KDFB 1NVLA 4HRSA 3O13A 2YT1A 2HD5B 2DKPA 1UBQA 1SE3A 3UI3A 1OEYA 1ST7A 3I5JC 4XWTA 4GB9A 5H92C 2IDYA 3NZSA 2C5LC 2JP2A 2K6DB 3A9JA 2FJLA 4ZYSA 4ARCA 1T5XD 1WI1A 3MC0B 1KLUD 3IVFA 2QKMA 3RCPA 3AE8B 3V3XA 2W2XC 2L8JA 1TY2A 5IKCM 3CWIA 4O1NA 1XO3A 1Q1OA 3SBTA 1GGOA 1HZ6A 2NR2A 3MJWA 2IFSA 1WJ4A 1V1PA 3NY5A 1MI0A 1WGYA 3R3MA 1FAOA 1FMAD 2N9PC 1FHOA 4LNOA 2Z0OA 1U2BA 4DWFA 1WX7A 2DIKA 3ZJTA 1KH0A 1XLQA 3M3JA 4RGMA 4WURA 4WQOB 5CTRC 5I4DA 3VOQA 3LYYA 5EE0A 3QHTA 1YQBA 2BPSA 3AJ4A 2JXTA 2YS1A 2H88B 2CHXA 2DZIA 3B77A 1XX0A 1A70A 1M4VA 1FD6A 3ZDTA 5DH9B 3PT2B 4GZUA 1WR6E 3ZO5B 2CS4A 3ECIA 4OHJA 2WXKA 1OTRB 3AB5A 1GB4A 1MKEA 3TW1A 3ZDMC 3A9KA 2YT2A 1Z87A 3PG7A 5G2NA 2XNAC 3Q8AA 3PV1A 1NYQA 4OZCA 4RCOA 2D9ZA 2UU7A 4FJZA 4NPNA 4F7GA 3H8HA 1OQYA 2LOZA 2J53A 2VZKB 3IAM1 4US9A 2INCC 2Y3AA 3A4RA 4W9JA 3L08A 4BZAA 2G35A 1PYWD 2MBBB 2ICIA 3HUIA 4HK2A 2UWQA 2WXHA 4QJ5B 1HE8A 2ELBA 1PGBA 1ACAA 2O6VA 2JPHA 1VZ8A 3IT6B 1LM8B 3OLMD 3HW2B 3GB1A 2HTHB 4DXGA 2AL3A 4MH0E 3ZQ4A 3OANA 3N30A 5FI0A 1MIXA 2AYOB 2M8SA 4JGHB 2DAJA 3VVWB 1ESFA 1YQ4B 2GBJA 2W82A 2JYTA 2BWFA 4NQLB 2B76B 2DYBA 4HPMB 3V61A 2IJ0A 1C77A 5J3QA 3PVUA 2MBOA 4IKGA 1U5DA 4CHKA 2MX2A 3PSEB 2VKIA 4Z2MB 1XQQA 3MP9A 4W9FA 1YX5B 2K5PA 5KHQA 4GGQA 2WXNA 3V6EB 3RNBC 4KV2A 2KUPA 4L6EA 4HAZB 3WAPA 4LJOB 1PMSA 4ARIA 1J0GA 3QQ8B 4JKEA 4GN1A 1XLPA 5D3XA 3U2SC 4F7ZA 4BBKA 2G9HD 5E6JA 2IGDA 5DPRA 1DDWA 2KANA 4HPLB 3BINA 2KZRA 4BKSD 3U12A 2JWUA 3SUZA 2RDGA 3I9V1 2DHJA 1OQQA 2KYWA 4DX8A 1LQBA 1ZXHA 3HIZA 1NTYA 3AV8A 1XD4A 3KYCD 4KKIA 3RNFC 3ZJUA 1FEHA 3KRXA 2KR0A 1HB8A 2JT4B 3IAS1 5C16A 4OVZA 2KK8A 2OJWA 3AEGB 2BCJA 2XEWA 1U4AA 1T0RC 2M19A 2FCMA 2KQ4X 3T9LA 3DWGC 3Q8CA 2MH7A 1WGGA 5E6OA 1LGRA 5D94A 3AE5B 1MJDA 1TS3A 2LYDA 2NCNA 2Z14A 2W9NA 4KHOA 4E3CA 2LASA 3TIXA 4FHJA 4LDTB 2EJ8A 1JRUA 1N61A 4CYEA 4FXCA 3N1YC 2A5UA 5JHAA 2N9LA 1ZSQA 5LOPB 2X8XX 1UGJA 1WX9A 5DPWA 4FN2A 1ROEA 1OEYJ 5DHFB 1NI3A 2MJDA 3DCXA 2IYDB 2DLWA 2R2YA 4AP4C 1SJED 4K3CA 2JSVX 2ASQA 1DYQA 3WYFB 4MGIE 4DBGA 2KXJA 4A3PA 1TY0A 5CHFA 2Z4DA 2IY0B 4JLCA 4BFRA 2V3PA 1T6BX 3X23A 3L10B 5HE1A 3FC4A 2ON8A 1LB1A 1NEKB 2PZ1A 1WGRA 2P8VA 4W9IA 2GCJA 3ML8A 4REZA 1PDXA 4AQ7A 1WE6A 3KZ1A 4BBNF 4C80A 1FGYA 2ZCBA 3N1XC 1FOEA
chains in the Genus database with same CATH topology
3O96A 2MRPA 2YLMA 1RFAA 2L76A 3PP2A 3L17A 2QHOA 4G0NB 4HB2B 3GYPA 2W2WA 3VTUA 4FJVB 2EC1A 4ICUA 1M7EA 4A6KA 5EFXA 2HTHA 4HAYB 3ZVVA 1V88A 2RGNB 1WX8A 1KLVA 5DPSA 3KUZA 2N7EA 5IA7A 2AL6A 1WF9A 4HCNB 2G4DB 4DXAB 4TQ1A 3DXDA 4MJSB 4W9GA 2BKFA 2ZPNA 2BF8B 2G3QB 4J6IA 2BGFA 3FP5A 1LW3A 1WXAA 4NJ7A 2MBHA 2BYVE 2DKQA 2KLCA 1X05A 1E8XA 3BY4B 2N1VA 4ANVA 2K6QA 4II2B 1Q0WB 1LFDA 1MK9B 1NU2A 1NI2A 2LG1A 3R66C 4FBJB 2JVCA 3H7PB 1UH6A 2NS5A 5C79A 5TR5A 2R2QA 4D0NB 4HAUB 3WA0A 1EGXA 1FB8A 4GDLB 2OTXA 2H7EA 1EO6A 2DFKA 2LULA 2WDTB 4ANWA 2IY1B 2Z0PA 2RSGA 2KCJA 3UZTA 4DBBA 3ML4A 4KHBB 1BT0A 3E66A 2OOBB 3VTVA 4WSFA 1ZW7A 4GSWA 3PVWA 1GC6A 2REXA 1RAXA 3A33B 4GIVA 3A1QB 2WX1A 3B1LX 3QA8A 3OJ4B 5IJMA 3H9DA 4PS8A 1V2YA 3WIMA 4DHJB 2I1KA 3VFKA 1EVHA 1WGQA 2IO1B 2DN6A 1XT9B 1DDMA 2D2QA 4EKUA 2K8CA 3QWMA 4K1RB 3A8QA 1WJNA 3JSVB 2KNBA 1WMHB 4XWXA 5HE2A 4E74A 2I5FA 1J8CA 3VQIA 1ZKHA 2ZEQA 3VHTC 2CY4A 3RCZA 3N3KB 5G55A 4DDID 1Y5OA 4B9KA 2COCA 1UPRA 3G9WA 4HXDA 2C7HA 3VH3B 2YRYA 3APCA 5D3WA 3EC8A 2R2OA 4DX90 1EAZA 2J0KA 3KYDD 5L95C 4W9EA 3SDLC 2D07B 2JXXA 4YONA 4MY6A 4KZ0A 4MELA 3PRMB 2M0XA 2WX0A 3DVNV 3QX1A 1GC7A 4WWOA 2V3SA 1L2NA 4MJSA 2IO3B 4KSKC 1WRDB 3WAMA 3VUYA 1KOTA 3I3TB 2KWVB 2ROZB 2KDIA 5L81A 2MKRA 2NMBA 3TL5A 2LGXA 3ODXA 1BTNA 1WJMA 2MA9B 2KMAA 1WJUA 1W1GA 4WWPA 4Z2NA 1HBKA 3ZVRA 4B6WA 1NDDA 2CAYA 1K5GB 3H7PA 1C3TA 1OGWA 4BOSC 3CXBB 2PJHA 3CSFA 2DAFA 2PE6B 4ILGB 1VD2A 2FJ9A 5D3VA 4GDLA 2K25A 4P7IA 3APDA 1TZ1A 2PEAA 2KQSA 3RD2A 2LKOA 2FCSA 5D7GA 2YS5A 2DENB 2YSZA 1PQSA 1SIFA 3MPXA 2DHZA 3OAWA 3U7DA 4BVUC 2Y5BB 3P6AA 3OJ3A 5LXIB 1UZXB 1J19A 3DXCA 2DZKA 3T06A 4W9KA 4PS3A 3D8FA 4IWQA 2KFJA 3JVZX 3W1SA 1X1GA 2JRHA 1IPGA 3A1QA 1D3ZA 3HQCA 2GBMA 3SYXA 1MIZB 1S1QB 4HB3B 3K9OB 2Q13A 3C0RB 4AJYB 1U27A 1C1YB 4BKTA 4HB0B 2D9YA 1U5GA 3ZLZA 5LXHA 5EDSA 1Z5SB 4K2OA 2K8BA 3A98B 2MBQA 1PLSA 1L7YA 1GG3A 1GNUA 2PE9A 3JSVA 2W2XD 2ROVA 1WMHA 1M94A 2VRWB 3ENBA 4HWIB 1UELA 4JKDA 1A5RA 2DX1A 1G6JA 1R4MI 3DQVA 2A4ZA 5AZFA 4OVUA 1FXTB 4FA6A 1EF5A 2EMTA 2MFQA 2LXAA 2KJRA 2YS3A 5D27A 2DYNA 3M95A 3PS6A 3AU5A 3AXCA 3N7CA 3TCAA 3KUCB 2RPQA 4HAVB 3RYTA 4C0AA 2R09A 4NAWB 2Y8GA 1V5MA 2NPTB 1KBLA 2KDBA 5DPTA 2R82A 2NBWB 4G11A 4WAAA 1WVHA 2NZ8B 4HAXB 3DXEA 4II3B 1WI0A 2MWSB 2ZZPB 1WIAA 1P0RA 2RNRB 3DVGX 1I35A 4K2PA 1V5PA 3RT3B 1AWEA 2LRUA 2C60A 4A6FB 3M62B 1V89A 1W1HA 3L54A 4IM2A 2XBBC 2R0DA 3LDZE 1YD8U 2VRRB 2ZPYA 3TFMA 4E71A 2X0SA 2D9VA 1OMWA 1I2HA 3V60A 4TQ0A 4BOZB 2KHWB 1UPQA 1U29A 2GMIC 2HRJA 4H8SA 1IRSA 2KTRB 5IAAC 2KGXB 1V5TA 1WJ6A 1WGUA 3ONSA 1U5FA 4XC2A 1V6EA 2BYFA 3FM8C 4KZCA 2KO3A 2LI5A 4GMVA 3EECA 4MSMB 1P9DU 1TGZB 2DX5B 2LBBA 1J0WA 5JHGA 2JWZA 2PPHA 4AOFA 5J3TA 3IG3A 3PSCA 4F7UP 3JYUA 4FJYA 3PHWB 2YVCA 2LRWA 1FGZA 4A20A 5C23A 3VXWA 2RLOA 2ZJDA 3P7ZA 2D9XA 4FADA 3GYOA 2V1YA 3HHMA 2J0JA 1DBHA 3MDBC 4EFOA 1ZGUB 3D8EA 2I5CA 4ZYNA 4EUTA 3IHPC 1Q5WB 3PTFC 1K8RB 2KLGA 3DVGY 3ZNZB 2L1CA 1V86A 2KMCA 2LUEA 3Q3FA 1RLFA 1WGHA 2DYOA 1X1MA 2DYMA 4RM8A 2L00B 3ODOA 2L2IA 2KC2A 2JRIB 1UEFA 4PQ0A 3N32A 4ILHA 1AQCA 3L16A 4JKGB 4NAWA 2NPTA 2GOWA 1Y8RC 4MEMA 2MWNB 4X57B 2NBVB 3ZKJC 3ZIMA 4IWPA 2N9XA 1RJ2A 4RMAA 5LLIA 2LOXA 2ABDA 4XZ4A 4A6FA 4EEWA 3DBHI 1WY8A 4GOCA 2CRFA 3KH0A 1DIKA 1DDVA 2J7QB 3QWZB 3VUWA 4ZRIA 4BKSA 2C9WB 2IZVB 2FUHB 2ZNVB 5FI1A 3Q3JA 3V62A 4HDQA 2KTFA 3NOBA 2N23A 4DHZE 2L0FA 1P3QU 2FIDA 4ILJA 3TMPB 2M17A 2KWUB 1QZEA 5C6RA 1P1AA 2D9WA 3IFWB 2NBUA 2COFA 2L7RA 2I1JA 5FR6A 2LVPA 3CF6E 2KTRA 3W1SC 3DCGA 3KSYA 3PLVA 2K8HA 4W9DA 2K00A 2WYQA 4FLHA 3H7SA 4KSLC 1WXVA 2DX5A 4PYUA 3ML9A 2LJ5A 3ZNHB 1WXMA 2KKCA 2D10A 2C7MB 5JZEB 2VSZA 2M4NA 2CKHB 2JZZA 3EPYA 2B3AA 1UBIA 3PRZA 4ANUA 4MGKE 3LJUX 4TUUA 3PLUA 1I7AA 2J59M 2MQJA 2Z0QA 2ZCCA 4JKBA 3R7RA 2D3GA 2Z59B 4IOYX 3A8PA 1XD3B 5J3YA 3PZDA 2WWZA 1ISNA 4EZKA 3RZFA 1GJZA 4IUMB 2KX0A 3GZNI 4DHJD 4IW0A 4PYZA 4MK0A 3AULA 4OVVA 2HJ8A 2Z0DB 1KZ7A 3DBRI 2LZ6A 1WYWB 1YX6B 2MW5A 3E9PA 4LCDE 4ZRJA 4JK7A 5DHAB 2GBKA 4W9LA 3FSSA 4HAWB 2IO0B 2DYQA 1Z2MA 4JKGA 4EJNA 4KDLB 4PS7A 4GXBA 4WVFB 2BKRB 4JKHA 2IYBA 4A6HA 4IG7B 3QK0A 3PREA 1U5EA 2G45B 2G4SA 1V5UA 2N0YA 1NTIA 2NVUI 3PGEA 4MGZE 2O6VD 4GMXB 3VIAA 3UQAA 4EZLA 3UF8A 1UD7A 4IAPA 2V4LA 2HE7A 2DA0A 1VCBA 1OQNA 2LD9A 4HHVA 4JK9A 2KFKB 1UGMA 2UYZB 3T8MA 5LONB 1P5TA 2P0HA 3QJZA 5GOWB 3TVVA 1WXSA 1P98A 4NQKE 3ZNID 5CHWA 2DHKA 1WG7A 4CHJA 3UQBA 3M1IB 1LXDA 2FAZA 3F0WA 4AJWA 2CB8A 4HB4B 4RM9A 2O2VB 3AI5A 1BAKA 1JDEA 1OY2A 1X86A 1SHCA 2N1WA 4MM3A 4Y94A 2YT0A 2KN5A 3SNHA 1WE7A 2L05A 2GS0A 3HK0A 2RQ1A 5HKHA 3H1UA 5DIFB 4EZJA 2Z0EB 4AUQC 3F5RA 1WJ1A 1KI1B 1V49A 1E90A 4IWOA 3QAQA 1QC6A 3DVNU 1P3RA 4KAXB 1V5OA 2ZVOA 3SD5A 2V76A 5KQ4A 3W1YA 3R7QA 1T0YA 3CIKA 2XK5B 4K7UA 4FULA 1E7UA 3S2AA 3ZUNA 1Y19B 4N9F4 2DZJA 2OQBA 2GBNA 3ODWA 2Y8FA 5C5BB 5E6NA 4A5KA 1MPHA 1TTNA 1IYFA 3QCAA 2CODA 2D4QA 2ADZA 5JVLA 1TQZA 5AEKB 2M1MA 1WGDA 2RVBB 2LGYA 5KHOA 3SHQA 1N3HA 3BJIA 4G3XB 3MHSD 4KVGB 2L3ZA 4M0WB 2FNJB 4KIKB 3TO1A 4WJOA 2LVQA 2GCLA 2EMSA 4B95A 2KDEB 1DYNA 5JH5C 2UZRA 4YL8A 2YF0A 2K2UA 4JK8A 3DPDA 4TV3A 1UNPA 3QC8B 5BO4B 1FHXA 2KFKA 5AZGA 4HATB 2OJRA 3IBEA 1P6SA 3PPAA 1MAIA 3V5WA 1H10A 1UNQA 2JZ3B 2D11A 2JF5A 2CR5A 2LVOA 3PVLA 3HM3A 4MGYE 4BKGA 5KCVA 5D6JB 3DOWA 3TBLD 3AU4A 3V6CB 2KQ7A 1E5WA 1H4RA 4G50A 2MP2B 2O2VA 2CU1A 4CO7A 2Y7BA 3L0WB 2AWTA 3H6NA 3D8DA 4GU2A 3D32A 5CHVC 1WZ3A 3KRWA 1GUAB 3TJPA 2ELAA 2FCNA 1UNRA 4LDTD 2CHZA 3U30A 4DHZB 5KQ1A 4TKNA 4WJ7A 3QBVB 1TJ6A 1SE9A 4W9HA 2XK5A 2MDXA 3VAWA 4WJPA 4GDKB 2CY5A 1EF1A 2DTCA 4IM0A 2QKLA 3QIJA 3UGBB 5C5BA 2RUKB 2LGDA 1WM2A 4B6HA 4NY0A 1E8WA 1MK7B 3A4SC 2GBRA 2KJHB 1V81A 3PRPB 2EKEC 4HJKA 3M63B 1H8CA 1TXDA 4F8CB 1ZVRA 2JUOA 4WJNA 3DDCB 4MDKE 3EFUA 3PHXB 1B55A 4ZRKA 1WFYA 4HCPB 2P0FA 3O65B 1M7RA 3ULCA 2M14A 4KIKA 5D2MB 3UIOB 3E9LA 1TBEA 2JY6A 1IP9A 4AWJA 2KWCA 4I6PA 4HVBA 3KUDB 3MTNB 3SO6A 3NZUA 3WANA 1YIWA 3RULA 3VH4B 5E6PA 5J2RA 2KJ6A 1KM7A 1BWNA 4BBNC 3SBGA 5GMVA 3ULBA 2FDQA 2GJYA 4TYZA 2ZNVC 4ASWC 1VBHA 5CLLB 4JQWC 1R4NI 2FCQA 4HDOA 4F7HA 2DZMA 3U8ZA 2BWES 1K5DB 1PFJA 4ANXA 3NSUA 2MBEA 1KJTA 2P0DA 4EMOA 4I6NB 2KC1A 1X1FA 1X11A 3RUIB 5HE0A 4I6LB 4IC7B 5JP4A 3RZWC 1QQGA 1WM3A 1I42A 3VTWA 3FLVA 1Q67A 2MP2A 2J0MA 4KDIC 2UZSA 3FEHA 3X0WA 2N9EB 3NHEB 2C7NB 4XX5A 3KY9A 4K17A 2MCNB 3HM6X 2KOXA 4M8MA 4IFSA 4PNKA 3ZW3A 4LJPB 1V9JA 1ZC3B 1E7VA 4MT7A 1EUVB 3LJ3A 4F1SA 2N4FA 3CSTA 4A3OA 5CX3A 1WR1A 4MSQB 4ICVA 1AARA 2K2JA 1KZGA 2RGFA 3SU8X 4W9CA 3A9JB 2MLBA 3QARA 4NSWA 3UIPB 4HLEA 5JHHA 3ENEA 3KW5B 5L83A 1CMXB 2RSUA 3APFA 1RRPB 4GDKA 4K7WA 5JHBA 2K39A 1WZ0A 2CQUA 3PEGA 2BYEA 3ZTCA 1RRBA 5JLJB 3L13A 5DCNA 2N7DA 3VUXA 1ZC4B 3ZRFA 1HB6A 5C1ZA 1XCGA 2RD0A 2X18A 4GPTB 3WAOA 3B0AA 1DROA 3SV1A 2DHIA 4KHAA 3EHVA 4WJQA 5D3YA 3B08A 4URKA 4M8NA 3CMMB 5HE3A 3JW0X 3KVFB 1XR0B 1BTKA 4WWNA 5J18A 3VDZA 3DBLI 2COAA 3GOEA 3ZRCA 3WALA 3ZNGC 1F9JA 2KVRA 5J17A 1XODA 4FHKA 1WH3A 3A9KB 4DDGD 2FIFA 5AZHA 3NS8A 2COPA 2ZVNA 1NTVA 2UVMA 2XQNM 1ZM0A 2H7DA 2E2XA 2O6VB 4K81A 2K1FA 5DI9B 1S3SG 4DK5A 3ALBA 4JL9A 2WH5A 3ZTDA 2KD0A 4JKFA 1NBFC 4JKAA 2AEHA 2L0TA 4K7SA 1VBGA 4JKCA 3UINB 2RR9A 1E8YA 2LWPA 1V80A 3P2BA 1V61A 1XKEA 2LXCA 2M38A 1YJ1A 1E8ZA 1FHWA 2IBIB 1SGHA 4EOYA 4NNJB 4NJ6A 4ZDVA 1KC7A 3E9OA 4IM3A 4CHMA 4JIOU 5CLQB 2CHWA 2IO2B 3DBSA 2KX3A 1W1DA 1MG8A 2MSED 3K9PB 2KDFB 1NVLA 2YT1A 2HD5B 2DKPA 1UBQA 1OEYA 1ST7A 4GB9A 3NZSA 2C5LC 2JP2A 2K6DB 3A9JA 2FJLA 1WI1A 3IVFA 2QKMA 3RCPA 2W2XC 2L8JA 1Q1OA 3SBTA 1GGOA 2NR2A 3MJWA 2IFSA 1WJ4A 3NY5A 1WGYA 3R3MA 1FAOA 2N9PC 1FHOA 2Z0OA 1U2BA 4DWFA 1WX7A 2DIKA 3M3JA 4WQOB 5CTRC 3VOQA 3QHTA 1YQBA 2BPSA 3AJ4A 2YS1A 2CHXA 2DZIA 1XX0A 3ZDTA 5DH9B 3PT2B 4GZUA 1WR6E 3ZO5B 2CS4A 3ECIA 1OTRB 1MKEA 3TW1A 3ZDMC 3A9KA 1Z87A 3PG7A 5G2NA 3PV1A 2D9ZA 4FJZA 4NPNA 4F7GA 1OQYA 2LOZA 3A4RA 4W9JA 3L08A 2G35A 2MBBB 4HK2A 2UWQA 1HE8A 2ELBA 1ACAA 2O6VA 2JPHA 1LM8B 3OLMD 3HW2B 2HTHB 2AL3A 4MH0E 3OANA 3N30A 5FI0A 1MIXA 2AYOB 2M8SA 4JGHB 2DAJA 3VVWB 2GBJA 2BWFA 4NQLB 2DYBA 4HPMB 3V61A 5J3QA 3PVUA 2MBOA 4CHKA 1U5DA 2MX2A 3PSEB 2VKIA 4Z2MB 1XQQA 4W9FA 1YX5B 5KHQA 4GGQA 3V6EB 4KV2A 2KUPA 4L6EA 4HAZB 3WAPA 4LJOB 1PMSA 1J0GA 3QQ8B 4JKEA 4GN1A 4F7ZA 5D3XA 4BBKA 5DPRA 1DDWA 2KANA 4HPLB 3BINA 2KZRA 4BKSD 3SUZA 2DHJA 4DX8A 1LQBA 3HIZA 1NTYA 1XD4A 3KYCD 3KRXA 1HB8A 2JT4B 5C16A 2KK8A 2BCJA 2XEWA 1U4AA 2FCMA 3T9LA 1WGGA 5E6OA 5D94A 2LYDA 2NCNA 2W9NA 4KHOA 4E3CA 2LASA 3TIXA 4FHJA 4LDTB 2EJ8A 1JRUA 4CYEA 2A5UA 5JHAA 1ZSQA 5LOPB 1WX9A 5DPWA 4FN2A 1OEYJ 5DHFB 2IYDB 2DLWA 4AP4C 2ASQA 4MGIE 3WYFB 4DBGA 2KXJA 4A3PA 5CHFA 2IY0B 4JLCA 4BFRA 3X23A 3L10B 5HE1A 1LB1A 2PZ1A 1WGRA 2P8VA 4W9IA 2GCJA 3ML8A 1WE6A 3KZ1A 4BBNF 1FGYA 2ZCBA 1FOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O96 A;  2MRP A;  2YLM A;  1RFA A;  2L76 A;  3PP2 A;  3L17 A;  2QHO A;  4G0N B;  4HB2 B;  3GYP A;  2W2W A;  3VTU A;  4FJV B;  2EC1 A;  4ICU A;  1M7E A;  4A6K A;  5EFX A;  2HTH A;  4HAY B;  3ZVV A;  1V88 A;  2RGN B;  1WX8 A;  1KLV A;  5DPS A;  3KUZ A;  2N7E A;  5IA7 A;  2AL6 A;  1WF9 A;  4HCN B;  2G4D B;  4DXA B;  4TQ1 A;  3DXD A;  4MJS B;  4W9G A;  2BKF A;  2ZPN A;  2BF8 B;  2G3Q B;  4J6I A;  2BGF A;  3FP5 A;  1LW3 A;  1WXA A;  4NJ7 A;  2MBH A;  2BYV E;  2DKQ A;  2KLC A;  1X05 A;  1E8X A;  3BY4 B;  2N1V A;  4ANV A;  2K6Q A;  4II2 B;  1Q0W B;  1LFD A;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  3R66 C;  4FBJ B;  2JVC A;  3H7P B;  1UH6 A;  2NS5 A;  5C79 A;  5TR5 A;  2R2Q A;  4D0N B;  4HAU B;  3WA0 A;  1EGX A;  1FB8 A;  4GDL B;  2OTX A;  2H7E A;  1EO6 A;  2DFK A;  2LUL A;  2WDT B;  4ANW A;  2IY1 B;  2Z0P A;  2RSG A;  2KCJ A;  3UZT A;  4DBB A;  3ML4 A;  4KHB B;  1BT0 A;  2OOB B;  3VTV A;  4WSF A;  1ZW7 A;  4GSW A;  3PVW A;  1GC6 A;  2REX A;  1RAX A;  3A33 B;  4GIV A;  3A1Q B;  2WX1 A;  3B1L X;  3QA8 A;  3OJ4 B;  5IJM A;  3H9D A;  4PS8 A;  1V2Y A;  3WIM A;  4DHJ B;  2I1K A;  3VFK A;  1EVH A;  1WGQ A;  2IO1 B;  2DN6 A;  1XT9 B;  1DDM A;  2D2Q A;  4EKU A;  2K8C A;  3QWM A;  4K1R B;  3A8Q A;  1WJN A;  3JSV B;  2KNB A;  1WMH B;  4XWX A;  5HE2 A;  4E74 A;  2I5F A;  1J8C A;  3VQI A;  1ZKH A;  2ZEQ A;  3VHT C;  2CY4 A;  3RCZ A;  3N3K B;  5G55 A;  4DDI D;  1Y5O A;  4B9K A;  2COC A;  1UPR A;  3G9W A;  4HXD A;  2C7H A;  3VH3 B;  2YRY A;  3APC A;  5D3W A;  3EC8 A;  2R2O A;  4DX9 0;  1EAZ A;  2J0K A;  3KYD D;  5L95 C;  4W9E A;  3SDL C;  2D07 B;  2JXX A;  4YON A;  4MY6 A;  4KZ0 A;  4MEL A;  3PRM B;  2M0X A;  2WX0 A;  3DVN V;  3QX1 A;  1GC7 A;  4WWO A;  2V3S A;  1L2N A;  4MJS A;  2IO3 B;  4KSK C;  1WRD B;  3WAM A;  3VUY A;  1KOT A;  3I3T B;  2KWV B;  2ROZ B;  2KDI A;  5L81 A;  2MKR A;  2NMB A;  3TL5 A;  2LGX A;  3ODX A;  1BTN A;  1WJM A;  2MA9 B;  2KMA A;  1WJU A;  1W1G A;  4WWP A;  4Z2N A;  1HBK A;  3ZVR A;  4B6W A;  1NDD A;  2CAY A;  1K5G B;  3H7P A;  1C3T A;  1OGW A;  4BOS C;  3CXB B;  2PJH A;  3CSF A;  2DAF A;  2PE6 B;  1VD2 A;  2FJ9 A;  5D3V A;  4GDL A;  2K25 A;  4P7I A;  3APD A;  1TZ1 A;  2PEA A;  2KQS A;  3RD2 A;  2LKO A;  2FCS A;  5D7G A;  2YS5 A;  2DEN B;  2YSZ A;  1PQS A;  1SIF A;  3MPX A;  2DHZ A;  3OAW A;  3U7D A;  4BVU C;  2Y5B B;  3P6A A;  3OJ3 A;  5LXI B;  1UZX B;  1J19 A;  3DXC A;  2DZK A;  3T06 A;  4W9K A;  4PS3 A;  3D8F A;  4IWQ A;  2KFJ A;  3JVZ X;  3W1S A;  1X1G A;  2JRH A;  1IPG A;  3A1Q A;  1D3Z A;  3HQC A;  2GBM A;  3SYX A;  1MIZ B;  1S1Q B;  4HB3 B;  3K9O B;  2Q13 A;  3C0R B;  4AJY B;  1U27 A;  1C1Y B;  4BKT A;  4HB0 B;  2D9Y A;  1U5G A;  3ZLZ A;  5LXH A;  5EDS A;  1Z5S B;  4K2O A;  2K8B A;  3A98 B;  2MBQ A;  1PLS A;  1L7Y A;  1GG3 A;  1GNU A;  2PE9 A;  3JSV A;  2W2X D;  2ROV A;  1WMH A;  1M94 A;  2VRW B;  4HWI B;  1UEL A;  1A5R A;  2DX1 A;  1G6J A;  1R4M I;  3DQV A;  2A4Z A;  5AZF A;  4OVU A;  1FXT B;  4FA6 A;  1EF5 A;  2EMT A;  2MFQ A;  2LXA A;  2KJR A;  2YS3 A;  5D27 A;  2DYN A;  3M95 A;  3PS6 A;  3AU5 A;  3AXC A;  3N7C A;  3TCA A;  3KUC B;  2RPQ A;  4HAV B;  3RYT A;  4C0A A;  2R09 A;  4NAW B;  1V5M A;  2Y8G A;  2NPT B;  2KDB A;  5DPT A;  2NBW B;  4G11 A;  4WAA A;  1WVH A;  2NZ8 B;  4HAX B;  3DXE A;  4II3 B;  1WI0 A;  2MWS B;  2ZZP B;  1WIA A;  1P0R A;  2RNR B;  3DVG X;  1I35 A;  4K2P A;  1V5P A;  3RT3 B;  1AWE A;  2LRU A;  2C60 A;  4A6F B;  3M62 B;  1V89 A;  1W1H A;  3L54 A;  4IM2 A;  2XBB C;  2R0D A;  3LDZ E;  1YD8 U;  2VRR B;  2ZPY A;  3TFM A;  4E71 A;  2D9V A;  1OMW A;  1I2H A;  3V60 A;  4TQ0 A;  4BOZ B;  2KHW B;  1UPQ A;  1U29 A;  2GMI C;  2HRJ A;  4H8S A;  1IRS A;  2KTR B;  5IAA C;  2KGX B;  1V5T A;  1WJ6 A;  1WGU A;  3ONS A;  1U5F A;  4XC2 A;  1V6E A;  2BYF A;  3FM8 C;  4KZC A;  2KO3 A;  2LI5 A;  4GMV A;  3EEC A;  4MSM B;  1P9D U;  1TGZ B;  2DX5 B;  2LBB A;  1J0W A;  5JHG A;  2JWZ A;  2PPH A;  4AOF A;  5J3T A;  3IG3 A;  3PSC A;  4F7U P;  3JYU A;  4FJY A;  3PHW B;  2YVC A;  2LRW A;  1FGZ A;  4A20 A;  5C23 A;  3VXW A;  2RLO A;  2ZJD A;  3P7Z A;  2D9X A;  4FAD A;  3GYO A;  2V1Y A;  3HHM A;  2J0J A;  1DBH A;  3MDB C;  4EFO A;  1ZGU B;  3D8E A;  2I5C A;  4ZYN A;  4EUT A;  3IHP C;  1Q5W B;  3PTF C;  1K8R B;  2KLG A;  3DVG Y;  3ZNZ B;  2L1C A;  1V86 A;  2KMC A;  2LUE A;  3Q3F A;  1RLF A;  1WGH A;  2DYO A;  1X1M A;  2DYM A;  4RM8 A;  2L00 B;  3ODO A;  2L2I A;  2KC2 A;  2JRI B;  1UEF A;  4PQ0 A;  3N32 A;  1AQC A;  3L16 A;  4NAW A;  2NPT A;  2GOW A;  1Y8R C;  4MEM A;  2MWN B;  4X57 B;  2NBV B;  3ZKJ C;  3ZIM A;  4IWP A;  2N9X A;  1RJ2 A;  4RMA A;  5LLI A;  2LOX A;  2ABD A;  4XZ4 A;  4A6F A;  4EEW A;  3DBH I;  1WY8 A;  4GOC A;  2CRF A;  3KH0 A;  1DDV A;  2J7Q B;  3QWZ B;  3VUW A;  4ZRI A;  4BKS A;  2C9W B;  2IZV B;  2FUH B;  2ZNV B;  5FI1 A;  3Q3J A;  3V62 A;  4HDQ A;  2KTF A;  3NOB A;  2N23 A;  4DHZ E;  2L0F A;  1P3Q U;  2FID A;  3TMP B;  2M17 A;  2KWU B;  1QZE A;  5C6R A;  1P1A A;  2D9W A;  3IFW B;  2NBU A;  2COF A;  2L7R A;  2I1J A;  5FR6 A;  2LVP A;  3CF6 E;  2KTR A;  3W1S C;  3DCG A;  3KSY A;  3PLV A;  2K8H A;  4W9D A;  2K00 A;  2WYQ A;  4FLH A;  3H7S A;  4KSL C;  1WXV A;  2DX5 A;  4PYU A;  3ML9 A;  2LJ5 A;  3ZNH B;  1WXM A;  2KKC A;  2D10 A;  2C7M B;  5JZE B;  2VSZ A;  2M4N A;  2CKH B;  2JZZ A;  3EPY A;  2B3A A;  1UBI A;  3PRZ A;  4ANU A;  4MGK E;  3LJU X;  4TUU A;  3PLU A;  1I7A A;  2J59 M;  2MQJ A;  2Z0Q A;  2ZCC A;  3R7R A;  2D3G A;  2Z59 B;  4IOY X;  3A8P A;  1XD3 B;  5J3Y A;  3PZD A;  2WWZ A;  1ISN A;  4EZK A;  3RZF A;  1GJZ A;  4IUM B;  2KX0 A;  3GZN I;  4DHJ D;  4IW0 A;  4PYZ A;  4MK0 A;  3AUL A;  4OVV A;  2HJ8 A;  2Z0D B;  1KZ7 A;  3DBR I;  2LZ6 A;  1WYW B;  1YX6 B;  2MW5 A;  4LCD E;  4ZRJ A;  5DHA B;  2GBK A;  4W9L A;  3FSS A;  4HAW B;  2IO0 B;  2DYQ A;  1Z2M A;  4EJN A;  4KDL B;  4PS7 A;  4GXB A;  4WVF B;  2BKR B;  2IYB A;  4A6H A;  4IG7 B;  3QK0 A;  3PRE A;  1U5E A;  2G45 B;  2G4S A;  1V5U A;  2N0Y A;  1NTI A;  2NVU I;  3PGE A;  4MGZ E;  2O6V D;  4GMX B;  3VIA A;  3UQA A;  4EZL A;  3UF8 A;  1UD7 A;  4IAP A;  2V4L A;  2HE7 A;  2DA0 A;  1VCB A;  1OQN A;  2LD9 A;  4HHV A;  2KFK B;  1UGM A;  2UYZ B;  3T8M A;  5LON B;  1P5T A;  2P0H A;  3QJZ A;  5GOW B;  3TVV A;  1WXS A;  1P98 A;  4NQK E;  3ZNI D;  5CHW A;  2DHK A;  1WG7 A;  4CHJ A;  3UQB A;  3M1I B;  1LXD A;  2FAZ A;  3F0W A;  4AJW A;  2CB8 A;  4HB4 B;  4RM9 A;  2O2V B;  3AI5 A;  1BAK A;  1OY2 A;  1X86 A;  1SHC A;  2N1W A;  4MM3 A;  4Y94 A;  2YT0 A;  2KN5 A;  3SNH A;  1WE7 A;  2L05 A;  2GS0 A;  3HK0 A;  2RQ1 A;  5HKH A;  3H1U A;  5DIF B;  4EZJ A;  2Z0E B;  4AUQ C;  3F5R A;  1WJ1 A;  1KI1 B;  1V49 A;  1E90 A;  4IWO A;  3QAQ A;  1QC6 A;  3DVN U;  1P3R A;  4KAX B;  1V5O A;  2ZVO A;  3SD5 A;  2V76 A;  5KQ4 A;  3W1Y A;  3R7Q A;  1T0Y A;  3CIK A;  2XK5 B;  4K7U A;  4FUL A;  1E7U A;  3S2A A;  3ZUN A;  1Y19 B;  4N9F 4;  2DZJ A;  2OQB A;  2GBN A;  3ODW A;  2Y8F A;  5C5B B;  5E6N A;  4A5K A;  1MPH A;  1TTN A;  1IYF A;  3QCA A;  2COD A;  2D4Q A;  2ADZ A;  1TQZ A;  5AEK B;  2M1M A;  1WGD A;  2RVB B;  2LGY A;  5KHO A;  3SHQ A;  1N3H A;  3BJI A;  4G3X B;  3MHS D;  4KVG B;  2L3Z A;  4M0W B;  2FNJ B;  4KIK B;  3TO1 A;  4WJO A;  2LVQ A;  2GCL A;  2EMS A;  4B95 A;  2KDE B;  1DYN A;  5JH5 C;  2UZR A;  4YL8 A;  2YF0 A;  2K2U A;  3DPD A;  4TV3 A;  1UNP A;  3QC8 B;  5BO4 B;  1FHX A;  2KFK A;  5AZG A;  4HAT B;  2OJR A;  3IBE A;  1P6S A;  3PPA A;  1MAI A;  3V5W A;  1H10 A;  1UNQ A;  2JZ3 B;  2D11 A;  2JF5 A;  2CR5 A;  2LVO A;  3PVL A;  3HM3 A;  4MGY E;  4BKG A;  5KCV A;  5D6J B;  3DOW A;  3TBL D;  3AU4 A;  3V6C B;  2KQ7 A;  1E5W A;  1H4R A;  4G50 A;  2MP2 B;  2O2V A;  2CU1 A;  4CO7 A;  2Y7B A;  3L0W B;  2AWT A;  3H6N A;  3D8D A;  4GU2 A;  3D32 A;  5CHV C;  1WZ3 A;  3KRW A;  1GUA B;  3TJP A;  2ELA A;  2FCN A;  1UNR A;  4LDT D;  2CHZ A;  3U30 A;  4DHZ B;  5KQ1 A;  4TKN A;  4WJ7 A;  3QBV B;  1TJ6 A;  1SE9 A;  4W9H A;  2XK5 A;  2MDX A;  3VAW A;  4WJP A;  4GDK B;  2CY5 A;  1EF1 A;  2DTC A;  4IM0 A;  2QKL A;  3QIJ A;  3UGB B;  5C5B A;  2RUK B;  2LGD A;  1WM2 A;  4B6H A;  4NY0 A;  1E8W A;  1MK7 B;  3A4S C;  2GBR A;  2KJH B;  1V81 A;  3PRP B;  2EKE C;  4HJK A;  3M63 B;  1H8C A;  1TXD A;  4F8C B;  1ZVR A;  2JUO A;  4WJN A;  3DDC B;  4MDK E;  3EFU A;  3PHX B;  1B55 A;  4ZRK A;  1WFY A;  4HCP B;  2P0F A;  3O65 B;  1M7R A;  3ULC A;  2M14 A;  4KIK A;  5D2M B;  3UIO B;  1TBE A;  2JY6 A;  1IP9 A;  4AWJ A;  2KWC A;  4I6P A;  4HVB A;  3KUD B;  3MTN B;  3SO6 A;  3NZU A;  3WAN A;  1YIW A;  3RUL A;  3VH4 B;  5E6P A;  5J2R A;  2KJ6 A;  1KM7 A;  1BWN A;  4BBN C;  5GMV A;  3ULB A;  2FDQ A;  2GJY A;  4TYZ A;  2ZNV C;  4ASW C;  5CLL B;  4JQW C;  1R4N I;  2FCQ A;  4HDO A;  4F7H A;  2DZM A;  3U8Z A;  2BWE S;  1K5D B;  1PFJ A;  4ANX A;  3NSU A;  2MBE A;  1KJT A;  2P0D A;  4EMO A;  4I6N B;  2KC1 A;  1X1F A;  1X11 A;  3RUI B;  5HE0 A;  4I6L B;  4IC7 B;  5JP4 A;  3RZW C;  1QQG A;  1WM3 A;  1I42 A;  3VTW A;  3FLV A;  1Q67 A;  2MP2 A;  2J0M A;  4KDI C;  2UZS A;  3FEH A;  3X0W A;  2N9E B;  3NHE B;  2C7N B;  4XX5 A;  3KY9 A;  4K17 A;  2MCN B;  3HM6 X;  2KOX A;  4M8M A;  4IFS A;  4PNK A;  3ZW3 A;  4LJP B;  1V9J A;  1ZC3 B;  1E7V A;  4MT7 A;  1EUV B;  3LJ3 A;  4F1S A;  2N4F A;  3CST A;  4A3O A;  5CX3 A;  1WR1 A;  4MSQ B;  4ICV A;  1AAR A;  2K2J A;  1KZG A;  2RGF A;  3SU8 X;  4W9C A;  3A9J B;  2MLB A;  3QAR A;  4NSW A;  3UIP B;  4HLE A;  5JHH A;  3ENE A;  3KW5 B;  5L83 A;  1CMX B;  2RSU A;  3APF A;  1RRP B;  4GDK A;  4K7W A;  5JHB A;  2K39 A;  1WZ0 A;  2CQU A;  3PEG A;  2BYE A;  3ZTC A;  1RRB A;  5JLJ B;  3L13 A;  5DCN A;  2N7D A;  3VUX A;  1ZC4 B;  3ZRF A;  1HB6 A;  5C1Z A;  1XCG A;  2RD0 A;  2X18 A;  4GPT B;  3WAO A;  3B0A A;  1DRO A;  3SV1 A;  2DHI A;  4KHA A;  3EHV A;  4WJQ A;  5D3Y A;  3B08 A;  4URK A;  4M8N A;  3CMM B;  5HE3 A;  3JW0 X;  3KVF B;  1XR0 B;  1BTK A;  4WWN A;  5J18 A;  3VDZ A;  3DBL I;  2COA A;  3GOE A;  3ZRC A;  3WAL A;  3ZNG C;  1F9J A;  2KVR A;  5J17 A;  1XOD A;  4FHK A;  1WH3 A;  3A9K B;  4DDG D;  2FIF A;  5AZH A;  3NS8 A;  2COP A;  2ZVN A;  1NTV A;  2UVM A;  2XQN M;  1ZM0 A;  2H7D A;  2E2X A;  2O6V B;  4K81 A;  2K1F A;  5DI9 B;  1S3S G;  4DK5 A;  3ALB A;  4JL9 A;  2WH5 A;  3ZTD A;  2KD0 A;  1NBF C;  2AEH A;  2L0T A;  4K7S A;  3UIN B;  2RR9 A;  1E8Y A;  2LWP A;  1V80 A;  3P2B A;  1V61 A;  1XKE A;  2LXC A;  2M38 A;  1YJ1 A;  1E8Z A;  1FHW A;  2IBI B;  1SGH A;  4EOY A;  4NNJ B;  4NJ6 A;  4ZDV A;  4IM3 A;  4CHM A;  4JIO U;  5CLQ B;  2CHW A;  2IO2 B;  3DBS A;  2KX3 A;  1W1D A;  1MG8 A;  2MSE D;  3K9P B;  2KDF B;  1NVL A;  2YT1 A;  2HD5 B;  2DKP A;  1UBQ A;  1OEY A;  1ST7 A;  4GB9 A;  3NZS A;  2C5L C;  2JP2 A;  2K6D B;  3A9J A;  2FJL A;  1WI1 A;  3IVF A;  2QKM A;  3RCP A;  2W2X C;  2L8J A;  1Q1O A;  2NR2 A;  3MJW A;  2IFS A;  1WJ4 A;  3NY5 A;  1WGY A;  3R3M A;  1FAO A;  2N9P C;  1FHO A;  2Z0O A;  1U2B A;  4DWF A;  1WX7 A;  3M3J A;  4WQO B;  5CTR C;  3VOQ A;  3QHT A;  1YQB A;  2BPS A;  3AJ4 A;  2YS1 A;  2CHX A;  2DZI A;  1XX0 A;  3ZDT A;  5DH9 B;  3PT2 B;  4GZU A;  1WR6 E;  3ZO5 B;  2CS4 A;  3ECI A;  1OTR B;  1MKE A;  3TW1 A;  3ZDM C;  3A9K A;  1Z87 A;  3PG7 A;  5G2N A;  3PV1 A;  2D9Z A;  4FJZ A;  4NPN A;  4F7G A;  1OQY A;  2LOZ A;  3A4R A;  4W9J A;  3L08 A;  2G35 A;  2MBB B;  4HK2 A;  2UWQ A;  1HE8 A;  2ELB A;  1ACA A;  2O6V A;  2JPH A;  1LM8 B;  3OLM D;  3HW2 B;  2HTH B;  2AL3 A;  4MH0 E;  3OAN A;  3N30 A;  5FI0 A;  1MIX A;  2AYO B;  2M8S A;  4JGH B;  2DAJ A;  3VVW B;  2GBJ A;  2BWF A;  4NQL B;  2DYB A;  4HPM B;  3V61 A;  5J3Q A;  3PVU A;  2MBO A;  4CHK A;  1U5D A;  2MX2 A;  3PSE B;  2VKI A;  4Z2M B;  1XQQ A;  4W9F A;  1YX5 B;  5KHQ A;  4GGQ A;  3V6E B;  4KV2 A;  2KUP A;  4L6E A;  4HAZ B;  3WAP A;  4LJO B;  1PMS A;  1J0G A;  3QQ8 B;  4GN1 A;  4F7Z A;  5D3X A;  4BBK A;  5DPR A;  1DDW A;  2KAN A;  4HPL B;  3BIN A;  2KZR A;  4BKS D;  3SUZ A;  2DHJ A;  4DX8 A;  1LQB A;  3HIZ A;  1NTY A;  1XD4 A;  3KYC D;  3KRX A;  1HB8 A;  2JT4 B;  5C16 A;  2KK8 A;  2BCJ A;  2XEW A;  1U4A A;  2FCM A;  3T9L A;  1WGG A;  5E6O A;  5D94 A;  2LYD A;  2NCN A;  2W9N A;  4KHO A;  4E3C A;  2LAS A;  3TIX A;  4FHJ A;  4LDT B;  2EJ8 A;  1JRU A;  4CYE A;  2A5U A;  5JHA A;  1ZSQ A;  5LOP B;  1WX9 A;  5DPW A;  4FN2 A;  1OEY J;  5DHF B;  2IYD B;  2DLW A;  4AP4 C;  2ASQ A;  4MGI E;  3WYF B;  4DBG A;  2KXJ A;  4A3P A;  5CHF A;  2IY0 B;  4JLC A;  4BFR A;  3X23 A;  3L10 B;  5HE1 A;  1LB1 A;  2PZ1 A;  1WGR A;  2P8V A;  4W9I A;  2GCJ A;  3ML8 A;  1WE6 A;  3KZ1 A;  4BBN F;  1FGY A;  2ZCB A;  1FOE A; 
#chains in the Genus database with same CATH topology
 3O96 A;  2LJI A;  2WGS A;  2MRP A;  2YLM A;  1KTK A;  1RFA A;  2L76 A;  4H2A A;  1YNT E;  1FNU A;  3OWE B;  2K3U A;  3U4E G;  2WXL A;  3PP2 A;  4DQO C;  3L17 A;  3W5V B;  2QHO A;  1AN8 A;  4G0N B;  4HB2 B;  3GYP A;  2WXI A;  5I2M A;  1VJK A;  2W2W A;  1FNV A;  3VTU A;  4FJV B;  4RH6 A;  1K53 A;  2EC1 A;  4ICU A;  3ZXV A;  4HPP A;  1M7E A;  1GPX A;  4A6K A;  5EFX A;  2E3T A;  2HTH A;  4HAY B;  3ZVV A;  3ZXR A;  1V88 A;  2RGN B;  1L6U A;  1WX8 A;  1KLV A;  2YEP F;  2W55 A;  5DPS A;  3KUZ A;  1L0X B;  4LNN A;  2BVC A;  1JRP A;  2N7E A;  5IA7 A;  1SSN A;  2V3N A;  2AL6 A;  1I4H A;  5FK9 C;  1WF9 A;  3AM9 A;  4HCN B;  2G4D B;  4DXA B;  4TQ1 A;  3DXD A;  4MJS B;  4W9G A;  2BKF A;  2ZPN A;  2BF8 B;  2G3Q B;  4J6I A;  2BGF A;  3FP5 A;  1LW3 A;  1R4M B;  1WXA A;  1ZP0 B;  3FIL B;  4NJ7 A;  2CU3 A;  2MBH A;  1K52 A;  2BYV E;  2CJN A;  2DKQ A;  2KLC A;  1X05 A;  1E8X A;  3BY4 B;  2N1V A;  4ANV A;  2K6Q A;  3GS2 A;  4II2 B;  1Q0W B;  3P4P B;  1LFD A;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  3R66 C;  4FBJ B;  2JX5 A;  4MH8 A;  2JVC A;  3H7P B;  1UH6 A;  3AE3 B;  2NS5 A;  3AMZ A;  4YTN B;  5C79 A;  4N58 A;  5TR5 A;  2R2Q A;  4D0N B;  1E6E B;  3LB8 C;  3R2T A;  4HAU B;  1ZDV A;  3WA0 A;  1EGX A;  1FB8 A;  4GDL B;  1ET9 A;  2OTX A;  4QJ4 B;  2H7E A;  1EO6 A;  2ZW0 A;  2DFK A;  2LUL A;  2WDT B;  3N9Y C;  3R8B A;  3DHI C;  1TS5 A;  1KLG D;  4ANW A;  2ONQ A;  2IY1 B;  1CZP A;  4CSQ A;  2Z0P A;  2RSG A;  1F77 A;  2KCJ A;  1QKZ A;  3UZT A;  4DBB A;  2Q5W D;  3ML4 A;  4KHB B;  1BT0 A;  3E66 A;  2OOB B;  3VTV A;  4PK1 A;  4WSF A;  1ZW7 A;  2KDM A;  4GSW A;  1R7S A;  3PVW A;  2QIL A;  1GC6 A;  2REX A;  1RAX A;  3A33 B;  4GIV A;  3A1Q B;  5C2T B;  2WX1 A;  2KMM A;  3B1L X;  3QA8 A;  3OJ4 B;  5IJM A;  3H9D A;  3VR9 B;  4PS8 A;  1V2Y A;  1TIF A;  4WH4 A;  3WIM A;  2FBW B;  3RMK C;  2INN E;  4DHJ B;  2I1K A;  3VFK A;  1NVI D;  4L23 A;  1EVH A;  1XLO A;  1WGQ A;  5EE1 A;  3Q8F A;  1E10 A;  2IO1 B;  4A55 A;  3BVM A;  4P1B C;  2V9H A;  4HKZ E;  2DN6 A;  1XT9 B;  2G1E A;  1DDM A;  1RM6 C;  2I38 A;  2W3R A;  1D5M C;  2D2Q A;  4EKU A;  2K8C A;  3QWM A;  2PMV A;  4K1R B;  4NJC A;  3A8Q A;  1YJI A;  2PW9 A;  5AUK A;  1WJN A;  3JSV B;  2KNB A;  1WMH B;  5EE9 A;  4XWX A;  5HE2 A;  4E74 A;  2I5F A;  1J8C A;  1BUI C;  3VQI A;  1ZKH A;  2ZEQ A;  2Y5P A;  3VHT C;  2CY4 A;  3RCZ A;  3N3K B;  3WCQ A;  3AE1 B;  5G55 A;  3BVG A;  4DDI D;  1Y5O A;  1YJJ A;  4B9K A;  3HVZ A;  1DOI A;  4YSY B;  2COC A;  1UPR A;  3G9W A;  5HG2 A;  4HXD A;  2C7H A;  1XXG A;  3VH3 B;  2YRY A;  3APC A;  5D3W A;  3EC8 A;  2WP9 B;  2R2O A;  1FXI A;  2AQ1 B;  1YOV B;  4DX9 0;  1EAZ A;  4KGT A;  2J0K A;  3KYD D;  1MI1 A;  2KIG A;  5L95 C;  4W9E A;  3SDL C;  1QF6 A;  2D07 B;  2JXX A;  4YON A;  2BB6 A;  4MY6 A;  3T3O A;  4KZ0 A;  1C76 A;  1UF0 A;  2Z13 A;  1NYR A;  4MEL A;  3PRM B;  2M0X A;  2WX0 A;  3DVN V;  3QX1 A;  3B2G A;  1GC7 A;  4WWO A;  2WQY B;  2V3S A;  1L2N A;  4MJS A;  5M4Y B;  2IO3 B;  4KSK C;  1WRD B;  3WAM A;  3VUY A;  1KOT A;  3P4S B;  3I3T B;  2J52 A;  2KWV B;  2ROZ B;  2KDI A;  3FIL A;  5L81 A;  2MKR A;  2NMB A;  1XEE A;  4YTP B;  2LGX A;  1I4P A;  3ODX A;  1BTN A;  1HQR D;  1WJM A;  3TL5 A;  2MA9 B;  4LNI A;  3AEA B;  2KMA A;  1J7A A;  3BWU D;  1WJU A;  1QT9 A;  1W1G A;  4ZHO A;  4WWP A;  3BK2 A;  3I57 A;  4Z2N A;  3B2F A;  1HBK A;  3ZVR A;  4B6W A;  2WLB A;  3VRA B;  1NDD A;  2CAY A;  2WHI A;  1K5G B;  3H7P A;  2WU5 B;  1C3T A;  1SBB B;  3TEZ A;  1IBX B;  1OGW A;  4YSZ B;  4BOS C;  3CXB B;  2PJH A;  1IGC A;  2DAF A;  3CSF A;  2PE6 B;  2X38 A;  3MJ5 A;  2BTE A;  4ILG B;  1VD2 A;  2FJ9 A;  5D3V A;  4GDL A;  2K25 A;  4P7I A;  1KRH A;  1TZ1 A;  2PEA A;  2KQS A;  3APD A;  3RD2 A;  2LKO A;  1QLB B;  2FCS A;  5D7G A;  2OED A;  2YS5 A;  2DEN B;  2YSZ A;  1PFD A;  2DHZ A;  3MPX A;  1PQS A;  1SIF A;  3OAW A;  3U7D A;  4BVU C;  2Y5B B;  3BK1 A;  2KAJ A;  3P6A A;  1MFW A;  2WXO A;  3Q3N C;  2FJU B;  3OJ3 A;  5LXI B;  2PLP A;  1UZX B;  1J19 A;  4KHB A;  3DXC A;  2DZK A;  3T06 A;  4W9K A;  3TEX A;  5JXV A;  1EU3 A;  4PS3 A;  1FFU A;  3DBH B;  3D8F A;  4IWQ A;  1JWS D;  2KFJ A;  3JVZ X;  1ENF A;  3W1S A;  1X1G A;  2JRH A;  4BAX A;  1IPG A;  3KWV A;  3EUB 2;  4LNF A;  3A1Q A;  2WDV B;  1D3Z A;  2WXQ A;  3HQC A;  2GBM A;  3RFZ B;  1I7H A;  3SYX A;  1MIZ B;  2DNF A;  1IGD A;  4HB3 B;  1S1Q B;  1XF5 L;  5EE3 A;  3K9O B;  2Q13 A;  3C0R B;  3NRZ A;  4AJY B;  1U27 A;  1C1Y B;  4BKT A;  4HB0 B;  2I2Y A;  2D9Y A;  1U5G A;  1TKG A;  3ZLZ A;  5LXH A;  5EDS A;  2GI9 A;  1Z5S B;  4K2O A;  1YN5 A;  2K8B A;  3A98 B;  2FUG 1;  4QJ3 B;  2MBQ A;  1PLS A;  1L7Y A;  4D2K A;  1GG3 A;  2WXJ A;  1GNU A;  1B9R A;  2PE9 A;  3JSV A;  2W2X D;  2ROV A;  1WMH A;  4EE2 A;  1M94 A;  2LGS A;  2VRW B;  3ENB A;  4HWI B;  5GXG B;  5G5G A;  1UEL A;  4JKD A;  1E0Z A;  1A5R A;  2DX1 A;  1G6J A;  1R4M I;  4IOI E;  3DQV A;  3RPF C;  2A4Z A;  5AZF A;  2JU6 X;  4C4V B;  3SEB A;  4OVU A;  3MFG A;  1FXT B;  4FA6 A;  1EF5 A;  2EMT A;  2MFQ A;  2V4I B;  2LXA A;  2KJR A;  2KUQ A;  2YS3 A;  1QOG A;  3GE8 C;  5D27 A;  2DYN A;  3M95 A;  3PS6 A;  3AU5 A;  2D3C A;  3AXC A;  4OSN A;  2AX5 A;  1ZUD 2;  1SE4 A;  3N7C A;  2VZK D;  3TCA A;  3KUC B;  1F2R I;  2RPQ A;  4HAV B;  1TT5 B;  3ABV B;  4TMA B;  3RYT A;  4C0A A;  2R09 A;  4NAW B;  2Y8G A;  1V5M A;  1KBL A;  2NPT B;  2WXG A;  1JRO A;  2KDB A;  5DPT A;  2R82 A;  2NBW B;  3AEB B;  4G11 A;  5D3D A;  3ZJV A;  4WAA A;  1WVH A;  3TEW A;  1C79 A;  2BS2 B;  2NZ8 B;  4HAX B;  1ZOY B;  3DXE A;  1AYF A;  3NW8 A;  3GZN B;  4II3 B;  1WI0 A;  2MWS B;  2ZZP B;  1WIA A;  1P0R A;  2RNR B;  1FCL A;  3DVG X;  3MHZ A;  1I35 A;  4K2P A;  2ACZ B;  1V5P A;  3RT3 B;  1AWE A;  2QEJ C;  2LRU A;  2C60 A;  4A6F B;  3Q3M C;  3M62 B;  1HXY D;  3CIR B;  1V89 A;  1W1H A;  2BW2 A;  3L54 A;  4IM2 A;  2XBB C;  3PZ7 A;  2R0D A;  3R2I A;  5MPO A;  3LDZ E;  3B9J A;  1YD8 U;  2WXM A;  1MVK A;  2VRR B;  2ZPY A;  3TFM A;  4E71 A;  1IBX A;  1VRA B;  2X0S A;  1J7C A;  2N0S B;  4S17 A;  2D9V A;  1OMW A;  1WGK A;  1I2H A;  3V60 A;  3EGR A;  4TQ0 A;  1PUT A;  4BOZ B;  2KHW B;  2RDH A;  1UPQ A;  4RGO S;  2EKI A;  1U29 A;  2GMI C;  2WXR A;  2HRJ A;  2NTS A;  4H8S A;  1TZO A;  2J4X A;  1IRS A;  2KTR B;  1QOA A;  2KGX B;  5IAA C;  1WRI A;  4XDD A;  1V5T A;  1WJ6 A;  1WGU A;  3ONS A;  1U5F A;  4YSX B;  2KWD A;  1MHH E;  1RFK A;  4XC2 A;  1V6E A;  2BYF A;  3FM8 C;  2MEK A;  4M02 A;  2LI5 A;  2KO3 A;  2WNM A;  4KZC A;  4GMV A;  1SF0 A;  3EEC A;  1JCK B;  4MSM B;  4KGS A;  1P9D U;  1TGZ B;  2DX5 B;  1T0Q C;  2LBB A;  1J0W A;  1I4X A;  1FRR A;  5JHG A;  2JWZ A;  4A6Q A;  2PPH A;  4AOF A;  3E56 A;  5J3T A;  3IG3 A;  4XE0 A;  3PSC A;  3AE7 B;  4F7U P;  1WYG A;  3JYU A;  4XYC A;  4FJY A;  1QIL A;  3PHW B;  2YVC A;  2LRW A;  1FGZ A;  1XLN A;  4A20 A;  1JAL A;  5C23 A;  5TSS A;  3VXW A;  2RLO A;  5LNK 1;  1GOZ A;  5HFY A;  3Q8E A;  4USA A;  2ZJD A;  1VZ6 A;  2DLB A;  3P7Z A;  2D9X A;  4FAD A;  3GYO A;  1N60 A;  2V1Y A;  3HHM A;  2J0J A;  1DBH A;  3MDB C;  2LMC A;  4EFO A;  1ZGU B;  3D8E A;  2I5C A;  4ZYN A;  4EUT A;  3IHP C;  1Q5W B;  1STE A;  3PTF C;  1K8R B;  2KLG A;  4C4V A;  3DVG Y;  3ZNZ B;  2L1C A;  1V86 A;  2KMC A;  2N9K A;  2LUE A;  3Q3F A;  1RLF A;  1WGH A;  2DYO A;  1X1M A;  2DYM A;  4RM8 A;  1YQ3 B;  2L00 B;  3NWA A;  3ODO A;  3VR8 B;  2L2I A;  1FCC C;  2KC2 A;  2JRI B;  1UEF A;  4PQ0 A;  3N32 A;  4ILH A;  2LHD A;  1AQC A;  2HJ1 A;  3L16 A;  4JKG B;  2KVZ A;  4NAW A;  4ZOH C;  2NPT A;  2GOW A;  4RF1 A;  1P7E A;  2GLS A;  5D3I B;  3MC9 A;  4DIX A;  3RN9 C;  1Y8R C;  3FKY A;  4MEM A;  3Q2A C;  2MWN B;  3KQ4 A;  3P1M A;  5C3J B;  3PO0 A;  4X57 B;  4GOU A;  1F0Z A;  2NBV B;  3ZKJ C;  3ZIM A;  4IWP A;  2N9X A;  1RJ2 A;  4RMA A;  5LLI A;  2LOX A;  2ABD A;  4XZ4 A;  5BYS A;  4A6F A;  4J3O D;  4EEW A;  3AED B;  3DBH I;  1WY8 A;  4GOC A;  2CRF A;  2KIE A;  3KH0 A;  3P4Q B;  1DIK A;  3NZ3 A;  1KF6 B;  3Q6B A;  1DDV A;  2J7Q B;  1F2R C;  3QWZ B;  3W2D A;  4YT0 B;  1K50 A;  3VUW A;  3URY A;  3BII D;  5IO9 A;  4ZRI A;  4BKS A;  2C9W B;  2IZV B;  3TUO A;  2GB1 A;  4YWG G;  2FUH B;  4KX6 B;  2ZNV B;  5FI1 A;  3Q3J A;  2H89 B;  3V62 A;  4HDQ A;  2KTF A;  3NOB A;  2N23 A;  4DHZ E;  2L0F A;  1P3Q U;  2FID A;  4ILJ A;  3TMP B;  2J42 A;  2M17 A;  2KWU B;  1QZE A;  1ET6 A;  5C6R A;  1L0V B;  1P1A A;  2LHE A;  2D9W A;  3IFW B;  2NBU A;  2COF A;  1UNS A;  2L7R A;  2I1J A;  5FR6 A;  2LVP A;  3CF6 E;  2KTR A;  3U52 E;  3W1S C;  3DCG A;  4C7Z A;  3KSY A;  3PLV A;  2K8H A;  2K00 A;  2WYQ A;  4W9D A;  4A8X C;  4FLH A;  1FIQ A;  4MM3 B;  3H7S A;  4KSL C;  1WXV A;  2DX5 A;  4PYU A;  4MAC A;  3ML9 A;  2LJ5 A;  2YEP B;  4RGN A;  3ZNH B;  1WXM A;  2KKC A;  2D10 A;  2C7M B;  5JZE B;  2VSZ A;  2M4N A;  2CKH B;  1QQR A;  5IOI A;  4HRO A;  2JZZ A;  3EPY A;  2B3A A;  1UBI A;  2IPK D;  3PRZ A;  4ANU A;  4MGK E;  3LJU X;  1KFY B;  1QOB A;  3NUH B;  4TUU A;  3RNG C;  1FFV A;  1J7B A;  2D3B A;  3NG0 A;  3PLU A;  1I7A A;  2QDF A;  2J59 M;  2MQJ A;  4C7Y A;  1FM0 D;  5AUI A;  1I4G A;  2Z0Q A;  3HSA A;  1I4Q A;  4JKB A;  2ZCC A;  3R7R A;  3W9C B;  1XCQ L;  2BT6 A;  2D3G A;  3FVC A;  2Z59 B;  2ZKM X;  4IOY X;  3A8P A;  1XD3 B;  1MPE A;  5J3Y A;  3AEC B;  3PZD A;  1C4A A;  2WWZ A;  1ISN A;  4EZK A;  3RZF A;  1GJZ A;  4IUM B;  2KX0 A;  3GZN I;  5FKA C;  3BZD B;  2HTM E;  1VDV A;  4DHJ D;  3RNC C;  2QJL A;  4IW0 A;  3OHM B;  4PYZ A;  4MK0 A;  3AUL A;  4OZB A;  4OVV A;  2HJ8 A;  2AQ2 B;  2WU2 B;  1V97 A;  2Z0D B;  1VLB A;  1KZ7 A;  3DBR I;  3Q69 A;  2LZ6 A;  1WYW B;  3VRB B;  1YX6 B;  2OHF A;  2MW5 A;  3E9P A;  4LCD E;  4ZRJ A;  3AE4 B;  1F52 A;  2AQ3 B;  4JK7 A;  5DHA B;  2GBK A;  4W9L A;  4WIP A;  2LEK A;  3FSS A;  4HAW B;  4LTU A;  2KT7 A;  2IO0 B;  2IGG A;  2DYQ A;  1Z2M A;  1YMH E;  4JKG A;  4EJN A;  4KDL B;  4PS7 A;  4GXB A;  4WVF B;  2PTL A;  2BKR B;  4JKH A;  2IYB A;  4A6H A;  4YTM B;  4IG7 B;  1CK1 A;  2GUM A;  3NVY A;  3QK0 A;  3PRE A;  1U5E A;  2RPV A;  2G45 B;  4QXA B;  2G4S A;  1V5U A;  2N0Y A;  1NTI A;  3EFC A;  2NVU I;  3PGE A;  4MGZ E;  2O6V D;  4GMX B;  3VIA A;  3ETR A;  3UQA A;  3GE3 C;  4EZL A;  2NBV A;  3UF8 A;  1UD7 A;  1OFF A;  4OZA A;  4WAF A;  4IAP A;  2V4L A;  4A90 A;  2JYE A;  2HE7 A;  2DA0 A;  1VCB A;  1OQN A;  2LD9 A;  4HHV A;  3N20 C;  4JK9 A;  2KFK B;  1UGM A;  2UYZ B;  3T8M A;  4AS1 A;  5LON B;  1P5T A;  2P0H A;  3QJZ A;  5GOW B;  3TVV A;  2PIA A;  1WXS A;  1P98 A;  4NQK E;  2E6X A;  1EU4 A;  3ZNI D;  5CHW A;  2DHK A;  2GRI A;  1WG7 A;  3N1Z C;  4CHJ A;  3UQB A;  3M1I B;  2WXP A;  4NZL B;  2KAC A;  1LXD A;  1D4B A;  2FAZ A;  1DGJ A;  1GB1 A;  3F0W A;  4AJW A;  2QMT A;  1HZ5 A;  2M0A A;  2CB8 A;  4HB4 B;  1K51 A;  4M01 A;  4RM9 A;  1TJE A;  2O2V B;  3AI5 A;  3ZGZ A;  1BAK A;  1JDE A;  1HEZ E;  1OY2 A;  1X86 A;  1L5P A;  3C19 A;  4C56 C;  1SHC A;  2BS4 B;  2N1W A;  4MM3 A;  4HEA 1;  4Y94 A;  3AE2 B;  2YT0 A;  2KN5 A;  3SNH A;  5G5H A;  4IDI A;  2TSS A;  1WE7 A;  2L05 A;  4HJG E;  2GS0 A;  3HK0 A;  2RQ1 A;  1R4N B;  5BYR A;  5HKH A;  2WDR B;  1ZE3 D;  4LK0 M;  3H1U A;  2LUM A;  2VH2 A;  5DIF B;  3NS1 A;  4EZJ A;  2Z0E B;  4AUQ C;  3F5R A;  1WJ1 A;  1KI1 B;  1V49 A;  4S0R A;  2K49 A;  3GP7 A;  1E90 A;  4IWO A;  3QAQ A;  1QC6 A;  3DVN U;  1P3R A;  4KAX B;  1V5O A;  2ZVO A;  4JPS A;  2Z59 A;  3SD5 A;  2V76 A;  5KQ4 A;  3NVZ A;  3W1Y A;  3AEF B;  3R7Q A;  4R3D A;  1T3Q A;  2BB5 A;  3V05 A;  1T0Y A;  3CIK A;  4L1R A;  2XK5 B;  2VH1 A;  4K7U A;  4FUL A;  1MG4 A;  2M56 B;  1E7U A;  3S2A A;  3ZUN A;  1Y19 B;  4N9F 4;  2DZJ A;  2OQB A;  2GBN A;  3ODW A;  2Y8F A;  4ZHP A;  1JML A;  5C5B B;  5E6N A;  1EM7 A;  2RMM A;  5IRS A;  4A5K A;  1XCT L;  1MPH A;  1RWS A;  1V8C A;  1TTN A;  1VR9 A;  5IP4 D;  1PGX A;  1IYF A;  3QCA A;  2COD A;  3TEY A;  2D4Q A;  2ADZ A;  1JWB D;  1NEN B;  5JVL A;  1TQZ A;  4P1C C;  5AEK B;  5T8I A;  2M1M A;  1DOY A;  2BQQ A;  1WGD A;  2RVB B;  2LGY A;  5KHO A;  3SHQ A;  1N3H A;  3BJI A;  4G3X B;  4ZRP A;  3MHS D;  1MHX A;  4US8 A;  4KVG B;  2NTT A;  2L3Z A;  4M0W B;  2FNJ B;  4RNA A;  1ZDX A;  1BML C;  4KIK B;  3TO1 A;  4WJO A;  2LVQ A;  2GCL A;  2V0G A;  2EMS A;  4B95 A;  2KDE B;  4C00 A;  1DYN A;  5JH5 C;  2NMQ A;  2UZR A;  1UUP A;  4YL8 A;  4JX1 C;  2YF0 A;  1VZ7 A;  5BMH A;  5HI1 A;  2K2U A;  4JK8 A;  1QOF A;  3DPD A;  1TS2 A;  1PGA A;  3SFD B;  4TV3 A;  1UNP A;  3QC8 B;  5BO4 B;  5H8Y E;  1FHX A;  2KFK A;  2ZW1 A;  1C4C A;  2KN4 A;  2W54 A;  5AZG A;  4HAT B;  2OJR A;  3BVZ A;  3IBE A;  1FXA A;  3DBR B;  3BYY B;  2WS3 B;  1P6S A;  3PPA A;  1MAI A;  3V5W A;  1H10 A;  3ZYY X;  3SR6 A;  4OW0 A;  1ZXI A;  3DBL B;  4B0E A;  4L1B A;  1UNQ A;  2JZ3 B;  2D11 A;  1YN3 A;  2JF5 A;  1TS4 A;  4M00 A;  3E9S A;  3RNE C;  2CR5 A;  2R61 A;  2LVO A;  3PVL A;  1UWM A;  3HM3 A;  2K22 A;  1FPY A;  4MGY E;  4BKG A;  5KCV A;  2QC8 A;  5D6J B;  3DOW A;  1Q10 A;  2BYT A;  3TBL D;  2D5G A;  3AU4 A;  3V6C B;  2KQ7 A;  1E5W A;  1H4R A;  4G50 A;  2MP2 B;  2O2V A;  1ZYI A;  2CU1 A;  4CO7 A;  2Y7B A;  2BS3 B;  3L0W B;  2AWT A;  4GLS C;  3H6N A;  4MT5 A;  1JW9 D;  3D8D A;  1LO5 D;  2JZP A;  4GU2 A;  2L1A A;  3D32 A;  2FE8 A;  5CHV C;  4B0M A;  1WZ3 A;  4P16 A;  4P6V F;  3P4R B;  4L2Y A;  3KRW A;  1GUA B;  3KLS X;  3NVV A;  3TJP A;  3Q14 C;  2ELA A;  3EA6 A;  3NWD A;  2DBY A;  2FCN A;  3AE6 B;  2Y5C A;  1UNR A;  4LDT D;  5BYQ A;  1D5Z C;  2CHZ A;  4ACF A;  1L6V A;  3L4P A;  2EEL A;  3T3N A;  3U30 A;  4DHZ B;  4TSS A;  1JWA D;  5KQ1 A;  2QSD A;  4TKN A;  4WJ7 A;  3QBV B;  1TJ6 A;  4JWU C;  4WQM A;  1SE9 A;  4W9H A;  2XK5 A;  2MDX A;  3VAW A;  3FAH A;  4WJP A;  4GDK B;  2CY5 A;  2Z8L A;  1EF1 A;  2DTC A;  4IM0 A;  2QKL A;  3QIJ A;  1WXQ A;  3OG5 A;  3UGB B;  3C8Y A;  5C5B A;  2LGD A;  2RUK B;  1SEB D;  1TYG B;  1WM2 A;  4B6H A;  4NY0 A;  1F1H A;  1E8W A;  1MK7 B;  2L83 A;  2QIE B;  2GBR A;  3A4S C;  3TSS A;  1WSP A;  2KJH B;  1V81 A;  3PRP B;  2EKE C;  3AH7 A;  5BMG A;  4HJK A;  2RDB C;  3M63 B;  4XWW A;  1H8C A;  1FRD A;  1TXD A;  4F8C B;  1ZVR A;  5I2S A;  1EWY C;  2SEB D;  2JUO A;  1JQ4 A;  4WJN A;  3DDC B;  4MDK E;  3EFU A;  3PHX B;  1B55 A;  3U7Z A;  4ZRK A;  2IGH A;  2LFI A;  1N5W A;  1ACC A;  2BBC A;  4RFB A;  5BMI A;  1WFY A;  4HCP B;  2P0F A;  3O65 B;  4N6E B;  1M7R A;  3ULC A;  1T77 A;  2M14 A;  4M0W A;  4KIK A;  3NVW A;  5D2M B;  2RRF A;  3UIO B;  3E9L A;  1TBE A;  2JY6 A;  1IP9 A;  1L4Z B;  4AWJ A;  2KWC A;  4I6P A;  4HVB A;  3KUD B;  3MTN B;  4DXF A;  3SO6 A;  3NZU A;  3WAN A;  1AWD A;  1OQR A;  1YIW A;  3RUL A;  3VH4 B;  5E6P A;  5J2R A;  2KJ6 A;  1KM7 A;  2D3A A;  1BWN A;  1JWM D;  4BBN C;  3SBG A;  5GMV A;  3ULB A;  2MJ3 A;  2FDQ A;  2GJY A;  4TYZ A;  2ZNV C;  3Q8B A;  4ASW C;  1VBH A;  1D6E C;  5CLL B;  4NAM A;  4JQW C;  1R4N I;  1HTQ A;  2FCQ A;  3HRD D;  4KKJ A;  4HDO A;  4F7H A;  2DZM A;  1C78 A;  3U8Z A;  2BWE S;  1K5D B;  1PFJ A;  3A58 A;  4ANX A;  3NSU A;  2MBE A;  1KJT A;  2P0D A;  4KGR A;  1JWU D;  4EMO A;  4I6N B;  2KC1 A;  1X1F A;  4HSI A;  1X11 A;  5FR3 A;  3RUI B;  5HE0 A;  4I6L B;  4IC7 B;  2CJO A;  5JP4 A;  3KWL A;  3RZW C;  1QQG A;  1WM3 A;  1I42 A;  3AN1 A;  3LXF A;  3VTW A;  3FLV A;  1Q67 A;  3DWM A;  2MP2 A;  2J0M A;  1SE2 A;  4KDI C;  2UZS A;  3FEH A;  2INP E;  4JWS C;  2DWQ A;  1AW7 A;  3X0W A;  1E9M A;  2LGI A;  2N9E B;  3NHE B;  2C7N B;  4XX5 A;  1HTO A;  3KY9 A;  4K17 A;  2MCN B;  3HM6 X;  2KOX A;  1CQV A;  1CJE A;  1GAQ B;  4M8M A;  4IFS A;  4PNK A;  3ZW3 A;  4LJP B;  1V9J A;  1ZC3 B;  1E7V A;  4MT7 A;  1EUV B;  3LJ3 A;  4F1S A;  2N4F A;  3CST A;  4A3O A;  5LG4 B;  5CX3 A;  1WR1 A;  3PZ8 A;  4MSQ B;  4RGT A;  4ICV A;  1AAR A;  2WXF A;  2L52 A;  2K2J A;  1KZG A;  4D6W A;  2QCZ A;  2RGF A;  3SU8 X;  4W9C A;  3HIE A;  3A9J B;  2MLB A;  1DOX A;  4NSW A;  3QAR A;  3UIP B;  4HLE A;  3P42 A;  3DHG C;  1YN4 A;  5JHH A;  2K8E A;  3DHH C;  1SJH D;  3ENE A;  4Q2J A;  2JQR B;  3KW5 B;  5L83 A;  4XGA B;  1CMX B;  3Q3O C;  2RSU A;  1EWC A;  3APF A;  1RRP B;  1T0S C;  1TKE A;  4GDK A;  3BYT B;  4K7W A;  5JHB A;  1P7F A;  2K39 A;  1WZ0 A;  2CQU A;  3PEG A;  2BYE A;  3ZTC A;  3NWF A;  1RRB A;  5JLJ B;  3L13 A;  5DCN A;  2N7D A;  1ZPS A;  3VUX A;  1V1P B;  1ZC4 B;  1C4P A;  3ZRF A;  4YXD B;  1HB6 A;  1RYJ A;  5C1Z A;  1XCG A;  1HA5 A;  2RD0 A;  3IXS A;  2PVG C;  2W3S A;  4OT1 A;  1V1O A;  2X18 A;  2MJE A;  3HVD A;  4GPT B;  3WAO A;  3I63 C;  3B0A A;  1DRO A;  3SV1 A;  4ZRQ A;  2DHI A;  3NJT A;  4KHA A;  1TKY A;  3EHV A;  4WJQ A;  5D3Y A;  1FO4 A;  3B08 A;  4LNK A;  4URK A;  4M8N A;  3MC8 A;  3CMM B;  5HE3 A;  3JW0 X;  4PT5 A;  3KVF B;  1XR0 B;  1BTK A;  4WWN A;  5J18 A;  3VDZ A;  3DBL I;  2COA A;  3GOE A;  3ZRC A;  3WAL A;  3ZNG C;  1F9J A;  2KVR A;  3J9C A;  5J17 A;  1XOD A;  4CQN A;  4FHK A;  4N59 A;  1WH3 A;  3A9K B;  2K9X A;  4LLG M;  4DDG D;  2IND C;  2L32 A;  1SIJ A;  1I4R A;  2FIF A;  5AZH A;  2N7J A;  3NS8 A;  4JE3 B;  2COP A;  3AE9 B;  2ZVN A;  1NTV A;  1FNW A;  4K3B A;  2UVM A;  2XQN M;  1ZM0 A;  2H7D A;  2E2X A;  3W5U B;  3RNA C;  2SAK A;  3IT4 B;  1BXT A;  1N63 A;  2O6V B;  4ITK A;  4K81 A;  1L0Y B;  2K1F A;  1IUE A;  5DI9 B;  2K0P A;  1D5X C;  1S3S G;  4A9A A;  4DK5 A;  3ALB A;  4JL9 A;  2WH5 A;  1E7P B;  3AEE B;  3ZTD A;  2KD0 A;  4JKF A;  1Y56 A;  1NBF C;  1SB3 C;  4JKA A;  2AEH A;  2HDE A;  2L0T A;  4K7S A;  1N62 A;  1VBG A;  5IN7 A;  4JKC A;  1C9F A;  1N6Z A;  3UIN B;  4HKQ A;  2RR9 A;  1E8Y A;  4XDC A;  2LWP A;  1V80 A;  3P2B A;  1WWT A;  2MHJ A;  1SXT A;  1N5X A;  4UDU C;  1V61 A;  1XKE A;  2LXC A;  2M38 A;  4RF0 A;  5HHD G;  1YJ1 A;  1E8Z A;  1FHW A;  2IBI B;  1SGH A;  2XN9 C;  4GNK B;  4EOY A;  4NNJ B;  4NJ6 A;  3SFE B;  4ZDV A;  1KC7 A;  4WWM A;  2PVO D;  3E9O A;  1UWX A;  4IM3 A;  4CHM A;  2WDQ B;  4JIO U;  5CLQ B;  2CHW A;  2PKO A;  2IO2 B;  1L4D B;  3DBS A;  2KX3 A;  3RI7 C;  1W1D A;  1MG8 A;  2MSE D;  1B1Z A;  3K9P B;  4QAY A;  3P63 A;  2KDF B;  1NVL A;  4HRS A;  3O13 A;  2YT1 A;  2HD5 B;  2DKP A;  1UBQ A;  1SE3 A;  3UI3 A;  1OEY A;  1ST7 A;  3I5J C;  4XWT A;  4GB9 A;  5H92 C;  2IDY A;  3NZS A;  2C5L C;  2JP2 A;  2K6D B;  3A9J A;  2FJL A;  4ZYS A;  4ARC A;  1T5X D;  1WI1 A;  3MC0 B;  1KLU D;  3IVF A;  2QKM A;  3RCP A;  3AE8 B;  3V3X A;  2W2X C;  2L8J A;  1TY2 A;  5IKC M;  3CWI A;  4O1N A;  1XO3 A;  1Q1O A;  3SBT A;  1GGO A;  1HZ6 A;  2NR2 A;  3MJW A;  2IFS A;  1WJ4 A;  1V1P A;  3NY5 A;  1MI0 A;  1WGY A;  3R3M A;  1FAO A;  1FMA D;  2N9P C;  1FHO A;  4LNO A;  2Z0O A;  1U2B A;  4DWF A;  1WX7 A;  2DIK A;  3ZJT A;  1KH0 A;  1XLQ A;  3M3J A;  4RGM A;  4WUR A;  4WQO B;  5CTR C;  5I4D A;  3VOQ A;  3LYY A;  5EE0 A;  3QHT A;  1YQB A;  2BPS A;  3AJ4 A;  2JXT A;  2YS1 A;  2H88 B;  2CHX A;  2DZI A;  3B77 A;  1XX0 A;  1A70 A;  1M4V A;  1FD6 A;  3ZDT A;  5DH9 B;  3PT2 B;  4GZU A;  1WR6 E;  3ZO5 B;  2CS4 A;  3ECI A;  4OHJ A;  2WXK A;  1OTR B;  3AB5 A;  1GB4 A;  1MKE A;  3TW1 A;  3ZDM C;  3A9K A;  2YT2 A;  1Z87 A;  3PG7 A;  5G2N A;  2XNA C;  3Q8A A;  3PV1 A;  1NYQ A;  4OZC A;  4RCO A;  2D9Z A;  2UU7 A;  4FJZ A;  4NPN A;  4F7G A;  3H8H A;  1OQY A;  2LOZ A;  2J53 A;  2VZK B;  3IAM 1;  4US9 A;  2INC C;  2Y3A A;  3A4R A;  4W9J A;  3L08 A;  4BZA A;  2G35 A;  1PYW D;  2MBB B;  2ICI A;  3HUI A;  4HK2 A;  2UWQ A;  2WXH A;  4QJ5 B;  1HE8 A;  2ELB A;  1PGB A;  1ACA A;  2O6V A;  2JPH A;  1VZ8 A;  3IT6 B;  1LM8 B;  3OLM D;  3HW2 B;  3GB1 A;  2HTH B;  4DXG A;  2AL3 A;  4MH0 E;  3ZQ4 A;  3OAN A;  3N30 A;  5FI0 A;  1MIX A;  2AYO B;  2M8S A;  4JGH B;  2DAJ A;  3VVW B;  1ESF A;  1YQ4 B;  2GBJ A;  2W82 A;  2JYT A;  2BWF A;  4NQL B;  2B76 B;  2DYB A;  4HPM B;  3V61 A;  2IJ0 A;  1C77 A;  5J3Q A;  3PVU A;  2MBO A;  4IKG A;  1U5D A;  4CHK A;  2MX2 A;  3PSE B;  2VKI A;  4Z2M B;  1XQQ A;  3MP9 A;  4W9F A;  1YX5 B;  2K5P A;  5KHQ A;  4GGQ A;  2WXN A;  3V6E B;  3RNB C;  4KV2 A;  2KUP A;  4L6E A;  4HAZ B;  3WAP A;  4LJO B;  1PMS A;  4ARI A;  1J0G A;  3QQ8 B;  4JKE A;  4GN1 A;  1XLP A;  5D3X A;  3U2S C;  4F7Z A;  4BBK A;  2G9H D;  5E6J A;  2IGD A;  5DPR A;  1DDW A;  2KAN A;  4HPL B;  3BIN A;  2KZR A;  4BKS D;  3U12 A;  2JWU A;  3SUZ A;  2RDG A;  3I9V 1;  2DHJ A;  1OQQ A;  2KYW A;  4DX8 A;  1LQB A;  1ZXH A;  3HIZ A;  1NTY A;  3AV8 A;  1XD4 A;  3KYC D;  4KKI A;  3RNF C;  3ZJU A;  1FEH A;  3KRX A;  2KR0 A;  1HB8 A;  2JT4 B;  3IAS 1;  5C16 A;  4OVZ A;  2KK8 A;  2OJW A;  3AEG B;  2BCJ A;  2XEW A;  1U4A A;  1T0R C;  2M19 A;  2FCM A;  2KQ4 X;  3T9L A;  3DWG C;  3Q8C A;  2MH7 A;  1WGG A;  5E6O A;  1LGR A;  5D94 A;  3AE5 B;  1MJD A;  1TS3 A;  2LYD A;  2NCN A;  2Z14 A;  2W9N A;  4KHO A;  4E3C A;  2LAS A;  3TIX A;  4FHJ A;  4LDT B;  2EJ8 A;  1JRU A;  1N61 A;  4CYE A;  4FXC A;  3N1Y C;  2A5U A;  5JHA A;  2N9L A;  1ZSQ A;  5LOP B;  2X8X X;  1UGJ A;  1WX9 A;  5DPW A;  4FN2 A;  1ROE A;  1OEY J;  5DHF B;  1NI3 A;  2MJD A;  3DCX A;  2IYD B;  2DLW A;  2R2Y A;  4AP4 C;  1SJE D;  4K3C A;  2JSV X;  2ASQ A;  1DYQ A;  3WYF B;  4MGI E;  4DBG A;  2KXJ A;  4A3P A;  1TY0 A;  5CHF A;  2Z4D A;  2IY0 B;  4JLC A;  4BFR A;  2V3P A;  1T6B X;  3X23 A;  3L10 B;  5HE1 A;  3FC4 A;  2ON8 A;  1LB1 A;  1NEK B;  2PZ1 A;  1WGR A;  2P8V A;  4W9I A;  2GCJ A;  3ML8 A;  4REZ A;  1PDX A;  4AQ7 A;  1WE6 A;  3KZ1 A;  4BBN F;  4C80 A;  1FGY A;  2ZCB A;  3N1X C;  1FOE A; 
#chains in the Genus database with same CATH homology
 3O96 A;  2MRP A;  2YLM A;  1RFA A;  2L76 A;  3PP2 A;  3L17 A;  2QHO A;  4G0N B;  4HB2 B;  3GYP A;  2W2W A;  3VTU A;  4FJV B;  2EC1 A;  4ICU A;  1M7E A;  4A6K A;  5EFX A;  2HTH A;  4HAY B;  3ZVV A;  1V88 A;  2RGN B;  1WX8 A;  1KLV A;  5DPS A;  3KUZ A;  2N7E A;  5IA7 A;  2AL6 A;  1WF9 A;  4HCN B;  2G4D B;  4DXA B;  4TQ1 A;  3DXD A;  4MJS B;  4W9G A;  2BKF A;  2ZPN A;  2BF8 B;  2G3Q B;  4J6I A;  2BGF A;  3FP5 A;  1LW3 A;  1WXA A;  4NJ7 A;  2MBH A;  2BYV E;  2DKQ A;  2KLC A;  1X05 A;  1E8X A;  3BY4 B;  2N1V A;  4ANV A;  2K6Q A;  4II2 B;  1Q0W B;  1LFD A;  1MK9 B;  1NU2 A;  1NI2 A;  2LG1 A;  3R66 C;  4FBJ B;  2JVC A;  3H7P B;  1UH6 A;  2NS5 A;  5C79 A;  5TR5 A;  2R2Q A;  4D0N B;  4HAU B;  3WA0 A;  1EGX A;  1FB8 A;  4GDL B;  2OTX A;  2H7E A;  1EO6 A;  2DFK A;  2LUL A;  2WDT B;  4ANW A;  2IY1 B;  2Z0P A;  2RSG A;  2KCJ A;  3UZT A;  4DBB A;  3ML4 A;  4KHB B;  1BT0 A;  3E66 A;  2OOB B;  3VTV A;  4WSF A;  1ZW7 A;  4GSW A;  3PVW A;  1GC6 A;  2REX A;  1RAX A;  3A33 B;  4GIV A;  3A1Q B;  2WX1 A;  3B1L X;  3QA8 A;  3OJ4 B;  5IJM A;  3H9D A;  4PS8 A;  1V2Y A;  3WIM A;  4DHJ B;  2I1K A;  3VFK A;  1EVH A;  1WGQ A;  2IO1 B;  2DN6 A;  1XT9 B;  1DDM A;  2D2Q A;  4EKU A;  2K8C A;  3QWM A;  4K1R B;  3A8Q A;  1WJN A;  3JSV B;  2KNB A;  1WMH B;  4XWX A;  5HE2 A;  4E74 A;  2I5F A;  1J8C A;  3VQI A;  1ZKH A;  2ZEQ A;  3VHT C;  2CY4 A;  3RCZ A;  3N3K B;  5G55 A;  4DDI D;  1Y5O A;  4B9K A;  2COC A;  1UPR A;  3G9W A;  4HXD A;  2C7H A;  3VH3 B;  2YRY A;  3APC A;  5D3W A;  3EC8 A;  2R2O A;  4DX9 0;  1EAZ A;  2J0K A;  3KYD D;  5L95 C;  4W9E A;  3SDL C;  2D07 B;  2JXX A;  4YON A;  4MY6 A;  4KZ0 A;  4MEL A;  3PRM B;  2M0X A;  2WX0 A;  3DVN V;  3QX1 A;  1GC7 A;  4WWO A;  2V3S A;  1L2N A;  4MJS A;  2IO3 B;  4KSK C;  1WRD B;  3WAM A;  3VUY A;  1KOT A;  3I3T B;  2KWV B;  2ROZ B;  2KDI A;  5L81 A;  2MKR A;  2NMB A;  3TL5 A;  2LGX A;  3ODX A;  1BTN A;  1WJM A;  2MA9 B;  2KMA A;  1WJU A;  1W1G A;  4WWP A;  4Z2N A;  1HBK A;  3ZVR A;  4B6W A;  1NDD A;  2CAY A;  1K5G B;  3H7P A;  1C3T A;  1OGW A;  4BOS C;  3CXB B;  2PJH A;  3CSF A;  2DAF A;  2PE6 B;  4ILG B;  1VD2 A;  2FJ9 A;  5D3V A;  4GDL A;  2K25 A;  4P7I A;  3APD A;  1TZ1 A;  2PEA A;  2KQS A;  3RD2 A;  2LKO A;  2FCS A;  5D7G A;  2YS5 A;  2DEN B;  2YSZ A;  1PQS A;  1SIF A;  3MPX A;  2DHZ A;  3OAW A;  3U7D A;  4BVU C;  2Y5B B;  3P6A A;  3OJ3 A;  5LXI B;  1UZX B;  1J19 A;  3DXC A;  2DZK A;  3T06 A;  4W9K A;  4PS3 A;  3D8F A;  4IWQ A;  2KFJ A;  3JVZ X;  3W1S A;  1X1G A;  2JRH A;  1IPG A;  3A1Q A;  1D3Z A;  3HQC A;  2GBM A;  3SYX A;  1MIZ B;  1S1Q B;  4HB3 B;  3K9O B;  2Q13 A;  3C0R B;  4AJY B;  1U27 A;  1C1Y B;  4BKT A;  4HB0 B;  2D9Y A;  1U5G A;  3ZLZ A;  5LXH A;  5EDS A;  1Z5S B;  4K2O A;  2K8B A;  3A98 B;  2MBQ A;  1PLS A;  1L7Y A;  1GG3 A;  1GNU A;  2PE9 A;  3JSV A;  2W2X D;  2ROV A;  1WMH A;  1M94 A;  2VRW B;  3ENB A;  4HWI B;  1UEL A;  4JKD A;  1A5R A;  2DX1 A;  1G6J A;  1R4M I;  3DQV A;  2A4Z A;  5AZF A;  4OVU A;  1FXT B;  4FA6 A;  1EF5 A;  2EMT A;  2MFQ A;  2LXA A;  2KJR A;  2YS3 A;  5D27 A;  2DYN A;  3M95 A;  3PS6 A;  3AU5 A;  3AXC A;  3N7C A;  3TCA A;  3KUC B;  2RPQ A;  4HAV B;  3RYT A;  4C0A A;  2R09 A;  4NAW B;  2Y8G A;  1V5M A;  2NPT B;  1KBL A;  2KDB A;  5DPT A;  2R82 A;  2NBW B;  4G11 A;  4WAA A;  1WVH A;  2NZ8 B;  4HAX B;  3DXE A;  4II3 B;  1WI0 A;  2MWS B;  2ZZP B;  1WIA A;  1P0R A;  2RNR B;  3DVG X;  1I35 A;  4K2P A;  1V5P A;  3RT3 B;  1AWE A;  2LRU A;  2C60 A;  4A6F B;  3M62 B;  1V89 A;  1W1H A;  3L54 A;  4IM2 A;  2XBB C;  2R0D A;  3LDZ E;  1YD8 U;  2VRR B;  2ZPY A;  3TFM A;  4E71 A;  2X0S A;  2D9V A;  1OMW A;  1I2H A;  3V60 A;  4TQ0 A;  4BOZ B;  2KHW B;  1UPQ A;  1U29 A;  2GMI C;  2HRJ A;  4H8S A;  1IRS A;  2KTR B;  5IAA C;  2KGX B;  1V5T A;  1WJ6 A;  1WGU A;  3ONS A;  1U5F A;  4XC2 A;  1V6E A;  2BYF A;  3FM8 C;  4KZC A;  2KO3 A;  2LI5 A;  4GMV A;  3EEC A;  4MSM B;  1P9D U;  1TGZ B;  2DX5 B;  2LBB A;  1J0W A;  5JHG A;  2JWZ A;  2PPH A;  4AOF A;  5J3T A;  3IG3 A;  3PSC A;  4F7U P;  3JYU A;  4FJY A;  3PHW B;  2YVC A;  2LRW A;  1FGZ A;  4A20 A;  5C23 A;  3VXW A;  2RLO A;  2ZJD A;  3P7Z A;  2D9X A;  4FAD A;  3GYO A;  2V1Y A;  3HHM A;  2J0J A;  1DBH A;  3MDB C;  4EFO A;  1ZGU B;  3D8E A;  2I5C A;  4ZYN A;  4EUT A;  3IHP C;  1Q5W B;  3PTF C;  1K8R B;  2KLG A;  3DVG Y;  3ZNZ B;  2L1C A;  1V86 A;  2KMC A;  2LUE A;  3Q3F A;  1RLF A;  1WGH A;  2DYO A;  1X1M A;  2DYM A;  4RM8 A;  2L00 B;  3ODO A;  2L2I A;  2KC2 A;  2JRI B;  1UEF A;  4PQ0 A;  3N32 A;  4ILH A;  1AQC A;  3L16 A;  4JKG B;  4NAW A;  2NPT A;  2GOW A;  1Y8R C;  4MEM A;  2MWN B;  4X57 B;  2NBV B;  3ZKJ C;  3ZIM A;  4IWP A;  2N9X A;  1RJ2 A;  4RMA A;  5LLI A;  2LOX A;  2ABD A;  4XZ4 A;  4A6F A;  4EEW A;  3DBH I;  1WY8 A;  4GOC A;  2CRF A;  3KH0 A;  1DIK A;  1DDV A;  2J7Q B;  3QWZ B;  3VUW A;  4ZRI A;  4BKS A;  2C9W B;  2IZV B;  2FUH B;  2ZNV B;  5FI1 A;  3Q3J A;  3V62 A;  4HDQ A;  2KTF A;  3NOB A;  2N23 A;  4DHZ E;  2L0F A;  1P3Q U;  2FID A;  4ILJ A;  3TMP B;  2M17 A;  2KWU B;  1QZE A;  5C6R A;  1P1A A;  2D9W A;  3IFW B;  2NBU A;  2COF A;  2L7R A;  2I1J A;  5FR6 A;  2LVP A;  3CF6 E;  2KTR A;  3W1S C;  3DCG A;  3KSY A;  3PLV A;  2K8H A;  4W9D A;  2K00 A;  2WYQ A;  4FLH A;  3H7S A;  4KSL C;  1WXV A;  2DX5 A;  4PYU A;  3ML9 A;  2LJ5 A;  3ZNH B;  1WXM A;  2KKC A;  2D10 A;  2C7M B;  5JZE B;  2VSZ A;  2M4N A;  2CKH B;  2JZZ A;  3EPY A;  2B3A A;  1UBI A;  3PRZ A;  4ANU A;  4MGK E;  3LJU X;  4TUU A;  3PLU A;  1I7A A;  2J59 M;  2MQJ A;  2Z0Q A;  2ZCC A;  4JKB A;  3R7R A;  2D3G A;  2Z59 B;  4IOY X;  3A8P A;  1XD3 B;  5J3Y A;  3PZD A;  2WWZ A;  1ISN A;  4EZK A;  3RZF A;  1GJZ A;  4IUM B;  2KX0 A;  3GZN I;  4DHJ D;  4IW0 A;  4PYZ A;  4MK0 A;  3AUL A;  4OVV A;  2HJ8 A;  2Z0D B;  1KZ7 A;  3DBR I;  2LZ6 A;  1WYW B;  1YX6 B;  2MW5 A;  3E9P A;  4LCD E;  4ZRJ A;  4JK7 A;  5DHA B;  2GBK A;  4W9L A;  3FSS A;  4HAW B;  2IO0 B;  2DYQ A;  1Z2M A;  4JKG A;  4EJN A;  4KDL B;  4PS7 A;  4GXB A;  4WVF B;  2BKR B;  4JKH A;  2IYB A;  4A6H A;  4IG7 B;  3QK0 A;  3PRE A;  1U5E A;  2G45 B;  2G4S A;  1V5U A;  2N0Y A;  1NTI A;  2NVU I;  3PGE A;  4MGZ E;  2O6V D;  4GMX B;  3VIA A;  3UQA A;  4EZL A;  3UF8 A;  1UD7 A;  4IAP A;  2V4L A;  2HE7 A;  2DA0 A;  1VCB A;  1OQN A;  2LD9 A;  4HHV A;  4JK9 A;  2KFK B;  1UGM A;  2UYZ B;  3T8M A;  5LON B;  1P5T A;  2P0H A;  3QJZ A;  5GOW B;  3TVV A;  1WXS A;  1P98 A;  4NQK E;  3ZNI D;  5CHW A;  2DHK A;  1WG7 A;  4CHJ A;  3UQB A;  3M1I B;  1LXD A;  2FAZ A;  3F0W A;  4AJW A;  2CB8 A;  4HB4 B;  4RM9 A;  2O2V B;  3AI5 A;  1BAK A;  1JDE A;  1OY2 A;  1X86 A;  1SHC A;  2N1W A;  4MM3 A;  4Y94 A;  2YT0 A;  2KN5 A;  3SNH A;  1WE7 A;  2L05 A;  2GS0 A;  3HK0 A;  2RQ1 A;  5HKH A;  3H1U A;  5DIF B;  4EZJ A;  2Z0E B;  4AUQ C;  3F5R A;  1WJ1 A;  1KI1 B;  1V49 A;  1E90 A;  4IWO A;  3QAQ A;  1QC6 A;  3DVN U;  1P3R A;  4KAX B;  1V5O A;  2ZVO A;  3SD5 A;  2V76 A;  5KQ4 A;  3W1Y A;  3R7Q A;  1T0Y A;  3CIK A;  2XK5 B;  4K7U A;  4FUL A;  1E7U A;  3S2A A;  3ZUN A;  1Y19 B;  4N9F 4;  2DZJ A;  2OQB A;  2GBN A;  3ODW A;  2Y8F A;  5C5B B;  5E6N A;  4A5K A;  1MPH A;  1TTN A;  1IYF A;  3QCA A;  2COD A;  2D4Q A;  2ADZ A;  5JVL A;  1TQZ A;  5AEK B;  2M1M A;  1WGD A;  2RVB B;  2LGY A;  5KHO A;  3SHQ A;  1N3H A;  3BJI A;  4G3X B;  3MHS D;  4KVG B;  2L3Z A;  4M0W B;  2FNJ B;  4KIK B;  3TO1 A;  4WJO A;  2LVQ A;  2GCL A;  2EMS A;  4B95 A;  2KDE B;  1DYN A;  5JH5 C;  2UZR A;  4YL8 A;  2YF0 A;  2K2U A;  4JK8 A;  3DPD A;  4TV3 A;  1UNP A;  3QC8 B;  5BO4 B;  1FHX A;  2KFK A;  5AZG A;  4HAT B;  2OJR A;  3IBE A;  1P6S A;  3PPA A;  1MAI A;  3V5W A;  1H10 A;  1UNQ A;  2JZ3 B;  2D11 A;  2JF5 A;  2CR5 A;  2LVO A;  3PVL A;  3HM3 A;  4MGY E;  4BKG A;  5KCV A;  5D6J B;  3DOW A;  3TBL D;  3AU4 A;  3V6C B;  2KQ7 A;  1E5W A;  1H4R A;  4G50 A;  2MP2 B;  2O2V A;  2CU1 A;  4CO7 A;  2Y7B A;  3L0W B;  2AWT A;  3H6N A;  3D8D A;  4GU2 A;  3D32 A;  5CHV C;  1WZ3 A;  3KRW A;  1GUA B;  3TJP A;  2ELA A;  2FCN A;  1UNR A;  4LDT D;  2CHZ A;  3U30 A;  4DHZ B;  5KQ1 A;  4TKN A;  4WJ7 A;  3QBV B;  1TJ6 A;  1SE9 A;  4W9H A;  2XK5 A;  2MDX A;  3VAW A;  4WJP A;  4GDK B;  2CY5 A;  1EF1 A;  2DTC A;  4IM0 A;  2QKL A;  3QIJ A;  3UGB B;  5C5B A;  2RUK B;  2LGD A;  1WM2 A;  4B6H A;  4NY0 A;  1E8W A;  1MK7 B;  3A4S C;  2GBR A;  2KJH B;  1V81 A;  3PRP B;  2EKE C;  4HJK A;  3M63 B;  1H8C A;  1TXD A;  4F8C B;  1ZVR A;  2JUO A;  4WJN A;  3DDC B;  4MDK E;  3EFU A;  3PHX B;  1B55 A;  4ZRK A;  1WFY A;  4HCP B;  2P0F A;  3O65 B;  1M7R A;  3ULC A;  2M14 A;  4KIK A;  5D2M B;  3UIO B;  3E9L A;  1TBE A;  2JY6 A;  1IP9 A;  4AWJ A;  2KWC A;  4I6P A;  4HVB A;  3KUD B;  3MTN B;  3SO6 A;  3NZU A;  3WAN A;  1YIW A;  3RUL A;  3VH4 B;  5E6P A;  5J2R A;  2KJ6 A;  1KM7 A;  1BWN A;  4BBN C;  3SBG A;  5GMV A;  3ULB A;  2FDQ A;  2GJY A;  4TYZ A;  2ZNV C;  4ASW C;  1VBH A;  5CLL B;  4JQW C;  1R4N I;  2FCQ A;  4HDO A;  4F7H A;  2DZM A;  3U8Z A;  2BWE S;  1K5D B;  1PFJ A;  4ANX A;  3NSU A;  2MBE A;  1KJT A;  2P0D A;  4EMO A;  4I6N B;  2KC1 A;  1X1F A;  1X11 A;  3RUI B;  5HE0 A;  4I6L B;  4IC7 B;  5JP4 A;  3RZW C;  1QQG A;  1WM3 A;  1I42 A;  3VTW A;  3FLV A;  1Q67 A;  2MP2 A;  2J0M A;  4KDI C;  2UZS A;  3FEH A;  3X0W A;  2N9E B;  3NHE B;  2C7N B;  4XX5 A;  3KY9 A;  4K17 A;  2MCN B;  3HM6 X;  2KOX A;  4M8M A;  4IFS A;  4PNK A;  3ZW3 A;  4LJP B;  1V9J A;  1ZC3 B;  1E7V A;  4MT7 A;  1EUV B;  3LJ3 A;  4F1S A;  2N4F A;  3CST A;  4A3O A;  5CX3 A;  1WR1 A;  4MSQ B;  4ICV A;  1AAR A;  2K2J A;  1KZG A;  2RGF A;  3SU8 X;  4W9C A;  3A9J B;  2MLB A;  3QAR A;  4NSW A;  3UIP B;  4HLE A;  5JHH A;  3ENE A;  3KW5 B;  5L83 A;  1CMX B;  2RSU A;  3APF A;  1RRP B;  4GDK A;  4K7W A;  5JHB A;  2K39 A;  1WZ0 A;  2CQU A;  3PEG A;  2BYE A;  3ZTC A;  1RRB A;  5JLJ B;  3L13 A;  5DCN A;  2N7D A;  3VUX A;  1ZC4 B;  3ZRF A;  1HB6 A;  5C1Z A;  1XCG A;  2RD0 A;  2X18 A;  4GPT B;  3WAO A;  3B0A A;  1DRO A;  3SV1 A;  2DHI A;  4KHA A;  3EHV A;  4WJQ A;  5D3Y A;  3B08 A;  4URK A;  4M8N A;  3CMM B;  5HE3 A;  3JW0 X;  3KVF B;  1XR0 B;  1BTK A;  4WWN A;  5J18 A;  3VDZ A;  3DBL I;  2COA A;  3GOE A;  3ZRC A;  3WAL A;  3ZNG C;  1F9J A;  2KVR A;  5J17 A;  1XOD A;  4FHK A;  1WH3 A;  3A9K B;  4DDG D;  2FIF A;  5AZH A;  3NS8 A;  2COP A;  2ZVN A;  1NTV A;  2UVM A;  2XQN M;  1ZM0 A;  2H7D A;  2E2X A;  2O6V B;  4K81 A;  2K1F A;  5DI9 B;  1S3S G;  4DK5 A;  3ALB A;  4JL9 A;  2WH5 A;  3ZTD A;  2KD0 A;  4JKF A;  1NBF C;  4JKA A;  2AEH A;  2L0T A;  4K7S A;  1VBG A;  4JKC A;  3UIN B;  2RR9 A;  1E8Y A;  2LWP A;  1V80 A;  3P2B A;  1V61 A;  1XKE A;  2LXC A;  2M38 A;  1YJ1 A;  1E8Z A;  1FHW A;  2IBI B;  1SGH A;  4EOY A;  4NNJ B;  4NJ6 A;  4ZDV A;  1KC7 A;  3E9O A;  4IM3 A;  4CHM A;  4JIO U;  5CLQ B;  2CHW A;  2IO2 B;  3DBS A;  2KX3 A;  1W1D A;  1MG8 A;  2MSE D;  3K9P B;  2KDF B;  1NVL A;  2YT1 A;  2HD5 B;  2DKP A;  1UBQ A;  1OEY A;  1ST7 A;  4GB9 A;  3NZS A;  2C5L C;  2JP2 A;  2K6D B;  3A9J A;  2FJL A;  1WI1 A;  3IVF A;  2QKM A;  3RCP A;  2W2X C;  2L8J A;  1Q1O A;  3SBT A;  1GGO A;  2NR2 A;  3MJW A;  2IFS A;  1WJ4 A;  3NY5 A;  1WGY A;  3R3M A;  1FAO A;  2N9P C;  1FHO A;  2Z0O A;  1U2B A;  4DWF A;  1WX7 A;  2DIK A;  3M3J A;  4WQO B;  5CTR C;  3VOQ A;  3QHT A;  1YQB A;  2BPS A;  3AJ4 A;  2YS1 A;  2CHX A;  2DZI A;  1XX0 A;  3ZDT A;  5DH9 B;  3PT2 B;  4GZU A;  1WR6 E;  3ZO5 B;  2CS4 A;  3ECI A;  1OTR B;  1MKE A;  3TW1 A;  3ZDM C;  3A9K A;  1Z87 A;  3PG7 A;  5G2N A;  3PV1 A;  2D9Z A;  4FJZ A;  4NPN A;  4F7G A;  1OQY A;  2LOZ A;  3A4R A;  4W9J A;  3L08 A;  2G35 A;  2MBB B;  4HK2 A;  2UWQ A;  1HE8 A;  2ELB A;  1ACA A;  2O6V A;  2JPH A;  1LM8 B;  3OLM D;  3HW2 B;  2HTH B;  2AL3 A;  4MH0 E;  3OAN A;  3N30 A;  5FI0 A;  1MIX A;  2AYO B;  2M8S A;  4JGH B;  2DAJ A;  3VVW B;  2GBJ A;  2BWF A;  4NQL B;  2DYB A;  4HPM B;  3V61 A;  5J3Q A;  3PVU A;  2MBO A;  4CHK A;  1U5D A;  2MX2 A;  3PSE B;  2VKI A;  4Z2M B;  1XQQ A;  4W9F A;  1YX5 B;  5KHQ A;  4GGQ A;  3V6E B;  4KV2 A;  2KUP A;  4L6E A;  4HAZ B;  3WAP A;  4LJO B;  1PMS A;  1J0G A;  3QQ8 B;  4JKE A;  4GN1 A;  4F7Z A;  5D3X A;  4BBK A;  5DPR A;  1DDW A;  2KAN A;  4HPL B;  3BIN A;  2KZR A;  4BKS D;  3SUZ A;  2DHJ A;  4DX8 A;  1LQB A;  3HIZ A;  1NTY A;  1XD4 A;  3KYC D;  3KRX A;  1HB8 A;  2JT4 B;  5C16 A;  2KK8 A;  2BCJ A;  2XEW A;  1U4A A;  2FCM A;  3T9L A;  1WGG A;  5E6O A;  5D94 A;  2LYD A;  2NCN A;  2W9N A;  4KHO A;  4E3C A;  2LAS A;  3TIX A;  4FHJ A;  4LDT B;  2EJ8 A;  1JRU A;  4CYE A;  2A5U A;  5JHA A;  1ZSQ A;  5LOP B;  1WX9 A;  5DPW A;  4FN2 A;  1OEY J;  5DHF B;  2IYD B;  2DLW A;  4AP4 C;  2ASQ A;  4MGI E;  3WYF B;  4DBG A;  2KXJ A;  4A3P A;  5CHF A;  2IY0 B;  4JLC A;  4BFR A;  3X23 A;  3L10 B;  5HE1 A;  1LB1 A;  2PZ1 A;  1WGR A;  2P8V A;  4W9I A;  2GCJ A;  3ML8 A;  1WE6 A;  3KZ1 A;  4BBN F;  1FGY A;  2ZCB A;  1FOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...