2CB8A

High resolution crystal structure of liganded human l-acbp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords ACYL-COA-BINDING PROTEIN
publication title High Resolution Crystal Structures of Unliganded and Liganded Human Liver Acbp Reveal a New Mode of Binding for the Acyl-Coa Ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2cb8A00
2D10A 3AU5A 2AEHA 1Y19B 5IJMA 2I1JA 4DXAB 1NI2A 2YVCA 4ZRIA 3U7DA 3U8ZA 3ZDTA 4F7GA 2D11A 4HDQA 1NVLA 2I1KA 1HB8A 3FLVA 1GC6A 3FP5A 1NTIA 1ISNA 2FJ9A 1SGHA 2ABDA 4P7IA 1EF1A 1MIXA 2RQ1A 1ACAA 2LBBA 2ZPYA 4NY0A 1J19A 1HB6A 3QIJA 2J0KA 2J0JA 3X23A 2HE7A 2EMTA 2AL6A 3IVFA 2WH5A 2D2QA 4EKUA 2CB8A 3EPYA 4ZRKA 1GG3A 2FDQA 3PVLA 1MK9B 2COPA 3PZDA 4CYEA 1MIZB 1MK7B 4ZRJA 2CQUA 1E5WA 3G9WA 4HDOA 1H4RA 1HBKA 2EMSA 2J0MA 1GC7A 2HRJA 3WA0A 3AU4A 4YL8A 1ST7A 3BINA
chains in the Genus database with same CATH superfamily
5IJMA 2I1JA 3U7DA 1JDEA 4JKDA 4GXBA 3FP5A 2ABDA 1EF1A 4JKAA 1KBLA 1ACAA 2LBBA 2J0KA 2J0JA 1KC7A 4JKGA 2X0SA 1VBGA 1GG3A 3E9OA 4JK8A 1MK7B 4HDOA 1HBKA 1VBHA 4YL8A 4ILHA 3BINA 3ZDTA 2D11A 1NVLA 1GGOA 3FLVA 1GC6A 4JKFA 4ILJA 4P7IA 5JVLA 1J19A 2CB8A 4ZRKA 3E66A 4CYEA 2COPA 3G9WA 1H4RA 2EMSA 2J0MA 2HRJA 2D10A 3AU5A 2AEHA 1Y19B 4DXAB 2YVCA 4ZRIA 4F7GA 3U8ZA 3SBTA 2I1KA 1HB8A 4JKBA 4JKEA 2FJ9A 1SGHA 1MIXA 2ZPYA 3QIJA 3SBGA 3X23A 2EMTA 2AL6A 3IVFA 2WH5A 4JKHA 2D2QA 4EKUA 3EPYA 1MIZB 4ILGB 1E5WA 4JK9A 3WA0A 3AU4A 4NY0A 1NI2A 4HDQA 3ENBA 1NTIA 1ISNA 2RQ1A 1DIKA 1HB6A 2DIKA 4TKNA 2HE7A 3E9PA 2FDQA 3PVLA 1MK9B 3PZDA 4ZRJA 2CQUA 4JK7A 4JKCA 2R82A 4JKGB 1GC7A 1ST7A 3E9LA
chains in the Genus database with same CATH topology
5IJMA 2I1JA 3U7DA 1JDEA 4JKDA 4GXBA 3FP5A 2ABDA 1EF1A 4JKAA 1KBLA 1ACAA 2LBBA 2J0KA 2J0JA 1KC7A 4JKGA 2X0SA 1VBGA 1GG3A 3E9OA 4JK8A 1MK7B 4HDOA 1HBKA 1VBHA 4YL8A 4ILHA 3BINA 3ZDTA 2D11A 1NVLA 1GGOA 3FLVA 1GC6A 4JKFA 4ILJA 4P7IA 5JVLA 1J19A 2CB8A 4ZRKA 3E66A 4CYEA 2COPA 3G9WA 1H4RA 2EMSA 2J0MA 2HRJA 2D10A 3AU5A 2AEHA 1Y19B 4DXAB 2YVCA 4ZRIA 4F7GA 3U8ZA 3SBTA 2I1KA 1HB8A 4JKBA 4JKEA 2FJ9A 1SGHA 1MIXA 2ZPYA 3QIJA 3SBGA 3X23A 2EMTA 2AL6A 3IVFA 2WH5A 4JKHA 2D2QA 4EKUA 3EPYA 1MIZB 4ILGB 1E5WA 4JK9A 3WA0A 3AU4A 4NY0A 1NI2A 4HDQA 3ENBA 1NTIA 1ISNA 2RQ1A 1DIKA 1HB6A 2DIKA 4TKNA 2HE7A 3E9PA 2FDQA 3PVLA 1MK9B 3PZDA 4ZRJA 2CQUA 4JK7A 4JKCA 2R82A 4JKGB 1GC7A 1ST7A 3E9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  3AU5 A;  2AEH A;  1Y19 B;  5IJM A;  2I1J A;  4DXA B;  1NI2 A;  2YVC A;  4ZRI A;  3U7D A;  3U8Z A;  3ZDT A;  4F7G A;  2D11 A;  4HDQ A;  1NVL A;  2I1K A;  1HB8 A;  3FLV A;  1GC6 A;  3FP5 A;  1NTI A;  1ISN A;  2FJ9 A;  1SGH A;  2ABD A;  4P7I A;  1EF1 A;  1MIX A;  2RQ1 A;  1ACA A;  2LBB A;  2ZPY A;  4NY0 A;  1J19 A;  1HB6 A;  3QIJ A;  2J0K A;  2J0J A;  3X23 A;  2HE7 A;  2EMT A;  2AL6 A;  3IVF A;  2WH5 A;  2D2Q A;  4EKU A;  2CB8 A;  3EPY A;  4ZRK A;  1GG3 A;  2FDQ A;  3PVL A;  1MK9 B;  2COP A;  3PZD A;  4CYE A;  1MIZ B;  1MK7 B;  4ZRJ A;  2CQU A;  1E5W A;  3G9W A;  4HDO A;  1H4R A;  1HBK A;  2EMS A;  2J0M A;  1GC7 A;  2HRJ A;  3WA0 A;  3AU4 A;  4YL8 A;  1ST7 A;  3BIN A; 
#chains in the Genus database with same CATH topology
 5IJM A;  2I1J A;  3U7D A;  1JDE A;  4JKD A;  4GXB A;  3FP5 A;  2ABD A;  1EF1 A;  4JKA A;  1KBL A;  1ACA A;  2LBB A;  2J0K A;  2J0J A;  1KC7 A;  4JKG A;  2X0S A;  1VBG A;  1GG3 A;  3E9O A;  4JK8 A;  1MK7 B;  4HDO A;  1HBK A;  1VBH A;  4YL8 A;  4ILH A;  3BIN A;  3ZDT A;  2D11 A;  1NVL A;  1GGO A;  3FLV A;  1GC6 A;  4JKF A;  4ILJ A;  4P7I A;  5JVL A;  1J19 A;  2CB8 A;  4ZRK A;  3E66 A;  4CYE A;  2COP A;  3G9W A;  1H4R A;  2EMS A;  2J0M A;  2HRJ A;  2D10 A;  3AU5 A;  2AEH A;  1Y19 B;  4DXA B;  2YVC A;  4ZRI A;  4F7G A;  3U8Z A;  3SBT A;  2I1K A;  1HB8 A;  4JKB A;  4JKE A;  2FJ9 A;  1SGH A;  1MIX A;  2ZPY A;  3QIJ A;  3SBG A;  3X23 A;  2EMT A;  2AL6 A;  3IVF A;  2WH5 A;  4JKH A;  2D2Q A;  4EKU A;  3EPY A;  1MIZ B;  4ILG B;  1E5W A;  4JK9 A;  3WA0 A;  3AU4 A;  4NY0 A;  1NI2 A;  4HDQ A;  3ENB A;  1NTI A;  1ISN A;  2RQ1 A;  1DIK A;  1HB6 A;  2DIK A;  4TKN A;  2HE7 A;  3E9P A;  2FDQ A;  3PVL A;  1MK9 B;  3PZD A;  4ZRJ A;  2CQU A;  4JK7 A;  4JKC A;  2R82 A;  4JKG B;  1GC7 A;  1ST7 A;  3E9L A; 
#chains in the Genus database with same CATH homology
 5IJM A;  2I1J A;  3U7D A;  1JDE A;  4JKD A;  4GXB A;  3FP5 A;  2ABD A;  1EF1 A;  4JKA A;  1KBL A;  1ACA A;  2LBB A;  2J0K A;  2J0J A;  1KC7 A;  4JKG A;  2X0S A;  1VBG A;  1GG3 A;  3E9O A;  4JK8 A;  1MK7 B;  4HDO A;  1HBK A;  1VBH A;  4YL8 A;  4ILH A;  3BIN A;  3ZDT A;  2D11 A;  1NVL A;  1GGO A;  3FLV A;  1GC6 A;  4JKF A;  4ILJ A;  4P7I A;  5JVL A;  1J19 A;  2CB8 A;  4ZRK A;  3E66 A;  4CYE A;  2COP A;  3G9W A;  1H4R A;  2EMS A;  2J0M A;  2HRJ A;  2D10 A;  3AU5 A;  2AEH A;  1Y19 B;  4DXA B;  2YVC A;  4ZRI A;  4F7G A;  3U8Z A;  3SBT A;  2I1K A;  1HB8 A;  4JKB A;  4JKE A;  2FJ9 A;  1SGH A;  1MIX A;  2ZPY A;  3QIJ A;  3SBG A;  3X23 A;  2EMT A;  2AL6 A;  3IVF A;  2WH5 A;  4JKH A;  2D2Q A;  4EKU A;  3EPY A;  1MIZ B;  4ILG B;  1E5W A;  4JK9 A;  3WA0 A;  3AU4 A;  4NY0 A;  1NI2 A;  4HDQ A;  3ENB A;  1NTI A;  1ISN A;  2RQ1 A;  1DIK A;  1HB6 A;  2DIK A;  4TKN A;  2HE7 A;  3E9P A;  2FDQ A;  3PVL A;  1MK9 B;  3PZD A;  4ZRJ A;  2CQU A;  4JK7 A;  4JKC A;  2R82 A;  4JKG B;  1GC7 A;  1ST7 A;  3E9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...