2CB8A

High resolution crystal structure of liganded human l-acbp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
b'SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA-BINDING PROTEIN
publication title High Resolution Crystal Structures of Unliganded and Liganded Human Liver Acbp Reveal a New Mode of Binding for the Acyl-Coa Ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport
total genus 35
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2cb8A00
2D10A 3FLVA 2YVCA 1SGHA 3U7DA 3WA0A 3IVFA 2WH5A 2RQ1A 2FDQA 1ISNA 1ST7A 3X23A 2AL6A 2J0JA 4CYEA 2HRJA 2J0MA 2ABDA 2I1KA 3EPYA 2ZPYA 2CB8A 2I1JA 4ZRJA 1J19A 1ACAA 1MK9B 1EF1A 1GC7A 1NTIA 2EMSA 1MIZB 1MK7B 1Y19B 3PZDA 2HE7A 2J0KA 3PVLA 4P7IA 3BINA 1GC6A 1NVLA 4HDQA 2EMTA 2CQUA 3AU4A 2D11A 2LBBA 1HB6A 2D2QA 1GG3A 4YL8A 3AU5A 4ZRIA 3ZDTA 4EKUA 1H4RA 4F7GA 3QIJA 1HBKA 3FP5A 4DXAB 1MIXA 4HDOA 2FJ9A 5IJMA 2COPA 1HB8A 3G9WA 1NI2A 2AEHA 1E5WA 4NY0A 3U8ZA 4ZRKA
chains in the Genus database with same CATH superfamily
2YVCA 3IVFA 3X23A 2AL6A 2J0MA 2ABDA 3EPYA 1DIKA 3ENBA 2R82A 4ILJA 2EMSA 1MK7B 4JKHA 1NVLA 2EMTA 1KC7A 1HB6A 4YL8A 1GG3A 4ZRIA 3ZDTA 4F7GA 1HBKA 3SBTA 3G9WA 1NI2A 1E5WA 2D10A 3WA0A 2WH5A 2RQ1A 2FDQA 4JK7A 1JDEA 2I1KA 2ZPYA 2I1JA 1MK9B 3E66A 4JKGB 1Y19B 5JVLA 1VBGA 3E9PA 2HE7A 3BINA 4HDQA 4EKUA 3AU5A 1H4RA 4DXAB 5IJMA 1HB8A 4NY0A 3U8ZA 4ZRKA 3FLVA 3U7DA 1SGHA 4JKGA 1ISNA 3E9LA 2HRJA 4ZRJA 1ACAA 1J19A 4GXBA 1NTIA 4JKEA 3PZDA 3PVLA 4JKAA 4P7IA 2CQUA 4JKBA 3FP5A 1MIXA 4HDOA 2FJ9A 2COPA 4JKFA 1GGOA 1ST7A 2J0JA 4CYEA 4JKDA 4ILHA 3E9OA 2CB8A 1VBHA 4JK8A 1EF1A 1GC7A 2DIKA 4TKNA 1MIZB 4JK9A 2J0KA 2X0SA 1GC6A 1KBLA 4ILGB 3AU4A 2D11A 2LBBA 2D2QA 3SBGA 4JKCA 3QIJA 2AEHA
chains in the Genus database with same CATH topology
2YVCA 3IVFA 3X23A 2AL6A 2J0MA 2ABDA 3EPYA 1DIKA 3ENBA 2R82A 4ILJA 2EMSA 1MK7B 4JKHA 1NVLA 2EMTA 1KC7A 1HB6A 4YL8A 1GG3A 4ZRIA 3ZDTA 4F7GA 1HBKA 3SBTA 3G9WA 1NI2A 1E5WA 2D10A 3WA0A 2WH5A 2RQ1A 2FDQA 4JK7A 1JDEA 2I1KA 2ZPYA 2I1JA 1MK9B 3E66A 4JKGB 1Y19B 5JVLA 1VBGA 3E9PA 2HE7A 3BINA 4HDQA 4EKUA 3AU5A 1H4RA 4DXAB 5IJMA 1HB8A 4NY0A 3U8ZA 4ZRKA 3FLVA 3U7DA 1SGHA 4JKGA 1ISNA 3E9LA 2HRJA 4ZRJA 1ACAA 1J19A 4GXBA 1NTIA 4JKEA 3PZDA 3PVLA 4JKAA 4P7IA 2CQUA 4JKBA 3FP5A 1MIXA 4HDOA 2FJ9A 2COPA 4JKFA 1GGOA 1ST7A 2J0JA 4CYEA 4JKDA 4ILHA 3E9OA 2CB8A 1VBHA 4JK8A 1EF1A 1GC7A 2DIKA 4TKNA 1MIZB 4JK9A 2J0KA 2X0SA 1GC6A 1KBLA 4ILGB 3AU4A 2D11A 2LBBA 2D2QA 3SBGA 4JKCA 3QIJA 2AEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D10 A;  3FLV A;  2YVC A;  1SGH A;  3U7D A;  3WA0 A;  3IVF A;  2WH5 A;  2RQ1 A;  2FDQ A;  1ISN A;  1ST7 A;  3X23 A;  2AL6 A;  2J0J A;  4CYE A;  2HRJ A;  2J0M A;  2ABD A;  2I1K A;  3EPY A;  2ZPY A;  2CB8 A;  2I1J A;  4ZRJ A;  1J19 A;  1ACA A;  1MK9 B;  1EF1 A;  1GC7 A;  1NTI A;  2EMS A;  1MIZ B;  1MK7 B;  1Y19 B;  3PZD A;  2HE7 A;  2J0K A;  3PVL A;  4P7I A;  3BIN A;  1GC6 A;  1NVL A;  4HDQ A;  2EMT A;  2CQU A;  3AU4 A;  2D11 A;  2LBB A;  1HB6 A;  2D2Q A;  1GG3 A;  4YL8 A;  3AU5 A;  4ZRI A;  3ZDT A;  4EKU A;  1H4R A;  4F7G A;  3QIJ A;  1HBK A;  3FP5 A;  4DXA B;  1MIX A;  4HDO A;  2FJ9 A;  5IJM A;  2COP A;  1HB8 A;  3G9W A;  1NI2 A;  2AEH A;  1E5W A;  4NY0 A;  3U8Z A;  4ZRK A; 
#chains in the Genus database with same CATH topology
 2YVC A;  3IVF A;  3X23 A;  2AL6 A;  2J0M A;  2ABD A;  3EPY A;  1DIK A;  3ENB A;  2R82 A;  4ILJ A;  2EMS A;  1MK7 B;  4JKH A;  1NVL A;  2EMT A;  1KC7 A;  1HB6 A;  4YL8 A;  1GG3 A;  4ZRI A;  3ZDT A;  4F7G A;  1HBK A;  3SBT A;  3G9W A;  1NI2 A;  1E5W A;  2D10 A;  3WA0 A;  2WH5 A;  2RQ1 A;  2FDQ A;  4JK7 A;  1JDE A;  2I1K A;  2ZPY A;  2I1J A;  1MK9 B;  3E66 A;  4JKG B;  1Y19 B;  5JVL A;  1VBG A;  3E9P A;  2HE7 A;  3BIN A;  4HDQ A;  4EKU A;  3AU5 A;  1H4R A;  4DXA B;  5IJM A;  1HB8 A;  4NY0 A;  3U8Z A;  4ZRK A;  3FLV A;  3U7D A;  1SGH A;  4JKG A;  1ISN A;  3E9L A;  2HRJ A;  4ZRJ A;  1ACA A;  1J19 A;  4GXB A;  1NTI A;  4JKE A;  3PZD A;  3PVL A;  4JKA A;  4P7I A;  2CQU A;  4JKB A;  3FP5 A;  1MIX A;  4HDO A;  2FJ9 A;  2COP A;  4JKF A;  1GGO A;  1ST7 A;  2J0J A;  4CYE A;  4JKD A;  4ILH A;  3E9O A;  2CB8 A;  1VBH A;  4JK8 A;  1EF1 A;  1GC7 A;  2DIK A;  4TKN A;  1MIZ B;  4JK9 A;  2J0K A;  2X0S A;  1GC6 A;  1KBL A;  4ILG B;  3AU4 A;  2D11 A;  2LBB A;  2D2Q A;  3SBG A;  4JKC A;  3QIJ A;  2AEH A; 
#chains in the Genus database with same CATH homology
 2YVC A;  3IVF A;  3X23 A;  2AL6 A;  2J0M A;  2ABD A;  3EPY A;  1DIK A;  3ENB A;  2R82 A;  4ILJ A;  2EMS A;  1MK7 B;  4JKH A;  1NVL A;  2EMT A;  1KC7 A;  1HB6 A;  4YL8 A;  1GG3 A;  4ZRI A;  3ZDT A;  4F7G A;  1HBK A;  3SBT A;  3G9W A;  1NI2 A;  1E5W A;  2D10 A;  3WA0 A;  2WH5 A;  2RQ1 A;  2FDQ A;  4JK7 A;  1JDE A;  2I1K A;  2ZPY A;  2I1J A;  1MK9 B;  3E66 A;  4JKG B;  1Y19 B;  5JVL A;  1VBG A;  3E9P A;  2HE7 A;  3BIN A;  4HDQ A;  4EKU A;  3AU5 A;  1H4R A;  4DXA B;  5IJM A;  1HB8 A;  4NY0 A;  3U8Z A;  4ZRK A;  3FLV A;  3U7D A;  1SGH A;  4JKG A;  1ISN A;  3E9L A;  2HRJ A;  4ZRJ A;  1ACA A;  1J19 A;  4GXB A;  1NTI A;  4JKE A;  3PZD A;  3PVL A;  4JKA A;  4P7I A;  2CQU A;  4JKB A;  3FP5 A;  1MIX A;  4HDO A;  2FJ9 A;  2COP A;  4JKF A;  1GGO A;  1ST7 A;  2J0J A;  4CYE A;  4JKD A;  4ILH A;  3E9O A;  2CB8 A;  1VBH A;  4JK8 A;  1EF1 A;  1GC7 A;  2DIK A;  4TKN A;  1MIZ B;  4JK9 A;  2J0K A;  2X0S A;  1GC6 A;  1KBL A;  4ILG B;  3AU4 A;  2D11 A;  2LBB A;  2D2Q A;  3SBG A;  4JKC A;  3QIJ A;  2AEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...