2CB8A

High resolution crystal structure of liganded human l-acbp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Unliganded and Liganded Human Liver Acbp Reveal a New Mode of Binding for the Acyl-Coa Ligand.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport
molecule keywords ACYL-COA-BINDING PROTEIN
total genus 35
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2cb8A00
3FLVA 1Y19B 3PZDA 1MIZB 5IJMA 2D11A 2J0JA 1HB6A 2AEHA 2EMSA 2FDQA 2RQ1A 2YVCA 3AU5A 4ZRIA 3IVFA 3WA0A 3PVLA 1GG3A 1MK7B 2I1KA 4YL8A 1GC6A 1GC7A 1E5WA 2EMTA 2HE7A 1ST7A 2J0MA 2ABDA 2D10A 2WH5A 3AU4A 3G9WA 3U7DA 1NI2A 3EPYA 4HDQA 4ZRJA 3X23A 4EKUA 4HDOA 1HBKA 2J0KA 1MK9B 2AL6A 3BINA 2CQUA 4CYEA 2CB8A 1ISNA 3ZDTA 4F7GA 1NTIA 1H4RA 2LBBA 1J19A 3FP5A 2COPA 2HRJA 3QIJA 2D2QA 4P7IA 2ZPYA 1MIXA 4NY0A 4DXAB 1SGHA 2I1JA 4ZRKA 3U8ZA 1EF1A 2FJ9A 1NVLA 1ACAA 1HB8A
chains in the Genus database with same CATH superfamily
3FLVA 1Y19B 2DIKA 1MIZB 4JKBA 4JKEA 3E9OA 1E5WA 2HE7A 2D10A 4EKUA 1MK9B 4JK7A 1ISNA 3ZDTA 3FP5A 2COPA 2HRJA 4ILJA 3SBTA 4ZRKA 4JKAA 2ZPYA 4JKCA 1DIKA 5IJMA 1VBHA 1HB6A 2AEHA 2RQ1A 1JDEA 3WA0A 4JKFA 1MK7B 1GC6A 3E66A 2J0MA 3G9WA 4ZRJA 3AU4A 2ABDA 1KBLA 3EPYA 4HDQA 4HDOA 3BINA 2X0SA 4JKHA 1J19A 4JKDA 3QIJA 2D2QA 2I1JA 2FJ9A 4JKGB 1KC7A 3PZDA 4ILHA 4JK9A 4ZRIA 2FDQA 1VBGA 3PVLA 1GG3A 2I1KA 4YL8A 1GC7A 2EMTA 1ST7A 3U7DA 2WH5A 1NI2A 1HBKA 2J0KA 4CYEA 4F7GA 1MIXA 4DXAB 1SGHA 3U8ZA 1EF1A 2CB8A 3ENBA 4JK8A 2D11A 2J0JA 3AU5A 3E9PA 2EMSA 2YVCA 3IVFA 4ILGB 2R82A 4JKGA 4TKNA 3X23A 1GGOA 2AL6A 2CQUA 3E9LA 1NTIA 1H4RA 2LBBA 3SBGA 4GXBA 4P7IA 5JVLA 4NY0A 1NVLA 1ACAA 1HB8A
chains in the Genus database with same CATH topology
3FLVA 1Y19B 2DIKA 1MIZB 4JKBA 4JKEA 3E9OA 1E5WA 2HE7A 2D10A 4EKUA 1MK9B 4JK7A 1ISNA 3ZDTA 3FP5A 2COPA 2HRJA 4ILJA 3SBTA 4ZRKA 4JKAA 2ZPYA 4JKCA 1DIKA 5IJMA 1VBHA 1HB6A 2AEHA 2RQ1A 1JDEA 3WA0A 4JKFA 1MK7B 1GC6A 3E66A 2J0MA 3G9WA 4ZRJA 3AU4A 2ABDA 1KBLA 3EPYA 4HDQA 4HDOA 3BINA 2X0SA 4JKHA 1J19A 4JKDA 3QIJA 2D2QA 2I1JA 2FJ9A 4JKGB 1KC7A 3PZDA 4ILHA 4JK9A 4ZRIA 2FDQA 1VBGA 3PVLA 1GG3A 2I1KA 4YL8A 1GC7A 2EMTA 1ST7A 3U7DA 2WH5A 1NI2A 1HBKA 2J0KA 4CYEA 4F7GA 1MIXA 4DXAB 1SGHA 3U8ZA 1EF1A 2CB8A 3ENBA 4JK8A 2D11A 2J0JA 3AU5A 3E9PA 2EMSA 2YVCA 3IVFA 4ILGB 2R82A 4JKGA 4TKNA 3X23A 1GGOA 2AL6A 2CQUA 3E9LA 1NTIA 1H4RA 2LBBA 3SBGA 4GXBA 4P7IA 5JVLA 4NY0A 1NVLA 1ACAA 1HB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLV A;  1Y19 B;  3PZD A;  1MIZ B;  5IJM A;  2D11 A;  2J0J A;  1HB6 A;  2AEH A;  2EMS A;  2FDQ A;  2RQ1 A;  2YVC A;  3AU5 A;  4ZRI A;  3IVF A;  3WA0 A;  3PVL A;  1GG3 A;  1MK7 B;  2I1K A;  4YL8 A;  1GC6 A;  1GC7 A;  1E5W A;  2EMT A;  2HE7 A;  1ST7 A;  2J0M A;  2ABD A;  2D10 A;  2WH5 A;  3AU4 A;  3G9W A;  3U7D A;  1NI2 A;  3EPY A;  4HDQ A;  4ZRJ A;  3X23 A;  4EKU A;  4HDO A;  1HBK A;  2J0K A;  1MK9 B;  2AL6 A;  3BIN A;  2CQU A;  4CYE A;  2CB8 A;  1ISN A;  3ZDT A;  4F7G A;  1NTI A;  1H4R A;  2LBB A;  1J19 A;  3FP5 A;  2COP A;  2HRJ A;  3QIJ A;  2D2Q A;  4P7I A;  2ZPY A;  1MIX A;  4NY0 A;  4DXA B;  1SGH A;  2I1J A;  4ZRK A;  3U8Z A;  1EF1 A;  2FJ9 A;  1NVL A;  1ACA A;  1HB8 A; 
#chains in the Genus database with same CATH topology
 3FLV A;  1Y19 B;  2DIK A;  1MIZ B;  4JKB A;  4JKE A;  3E9O A;  1E5W A;  2HE7 A;  2D10 A;  4EKU A;  1MK9 B;  4JK7 A;  1ISN A;  3ZDT A;  3FP5 A;  2COP A;  2HRJ A;  4ILJ A;  3SBT A;  4ZRK A;  4JKA A;  2ZPY A;  4JKC A;  1DIK A;  5IJM A;  1VBH A;  1HB6 A;  2AEH A;  2RQ1 A;  1JDE A;  3WA0 A;  4JKF A;  1MK7 B;  1GC6 A;  3E66 A;  2J0M A;  3G9W A;  4ZRJ A;  3AU4 A;  2ABD A;  1KBL A;  3EPY A;  4HDQ A;  4HDO A;  3BIN A;  2X0S A;  4JKH A;  1J19 A;  4JKD A;  3QIJ A;  2D2Q A;  2I1J A;  2FJ9 A;  4JKG B;  1KC7 A;  3PZD A;  4ILH A;  4JK9 A;  4ZRI A;  2FDQ A;  1VBG A;  3PVL A;  1GG3 A;  2I1K A;  4YL8 A;  1GC7 A;  2EMT A;  1ST7 A;  3U7D A;  2WH5 A;  1NI2 A;  1HBK A;  2J0K A;  4CYE A;  4F7G A;  1MIX A;  4DXA B;  1SGH A;  3U8Z A;  1EF1 A;  2CB8 A;  3ENB A;  4JK8 A;  2D11 A;  2J0J A;  3AU5 A;  3E9P A;  2EMS A;  2YVC A;  3IVF A;  4ILG B;  2R82 A;  4JKG A;  4TKN A;  3X23 A;  1GGO A;  2AL6 A;  2CQU A;  3E9L A;  1NTI A;  1H4R A;  2LBB A;  3SBG A;  4GXB A;  4P7I A;  5JVL A;  4NY0 A;  1NVL A;  1ACA A;  1HB8 A; 
#chains in the Genus database with same CATH homology
 3FLV A;  1Y19 B;  2DIK A;  1MIZ B;  4JKB A;  4JKE A;  3E9O A;  1E5W A;  2HE7 A;  2D10 A;  4EKU A;  1MK9 B;  4JK7 A;  1ISN A;  3ZDT A;  3FP5 A;  2COP A;  2HRJ A;  4ILJ A;  3SBT A;  4ZRK A;  4JKA A;  2ZPY A;  4JKC A;  1DIK A;  5IJM A;  1VBH A;  1HB6 A;  2AEH A;  2RQ1 A;  1JDE A;  3WA0 A;  4JKF A;  1MK7 B;  1GC6 A;  3E66 A;  2J0M A;  3G9W A;  4ZRJ A;  3AU4 A;  2ABD A;  1KBL A;  3EPY A;  4HDQ A;  4HDO A;  3BIN A;  2X0S A;  4JKH A;  1J19 A;  4JKD A;  3QIJ A;  2D2Q A;  2I1J A;  2FJ9 A;  4JKG B;  1KC7 A;  3PZD A;  4ILH A;  4JK9 A;  4ZRI A;  2FDQ A;  1VBG A;  3PVL A;  1GG3 A;  2I1K A;  4YL8 A;  1GC7 A;  2EMT A;  1ST7 A;  3U7D A;  2WH5 A;  1NI2 A;  1HBK A;  2J0K A;  4CYE A;  4F7G A;  1MIX A;  4DXA B;  1SGH A;  3U8Z A;  1EF1 A;  2CB8 A;  3ENB A;  4JK8 A;  2D11 A;  2J0J A;  3AU5 A;  3E9P A;  2EMS A;  2YVC A;  3IVF A;  4ILG B;  2R82 A;  4JKG A;  4TKN A;  3X23 A;  1GGO A;  2AL6 A;  2CQU A;  3E9L A;  1NTI A;  1H4R A;  2LBB A;  3SBG A;  4GXB A;  4P7I A;  5JVL A;  4NY0 A;  1NVL A;  1ACA A;  1HB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...