4NY0A

Crystal structure of ferm domain of human focal adhesion kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
ERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGLRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
publication title FAK dimerization controls its kinase-dependent functions at focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ny0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ny0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ny0A01
2YT0A 2H7DA 2RNRB 2R2OA 3DVNU 1ZW7A 2FCSA 1VCBA 4A6KA 1OTRB 1J19A 3T9LA 3V62A 3L13A 1TXDA 2X18A 2DKPA 2L0TA 3P2BA 1KZ7A 5D27A 1LB1A 2KNBA 4NQLB 2WX0A 4W9CA 1SE9A 2HRJA 3QX1A 2PJHA 3RYTA 3ZW3A 2MBEA 4W9EA 2ZVNA 3VUXA 4K7SA 1RFAA 4URKA 2XEWA 4KV2A 4NNJB 2W2XD 1MK7B 4AJYB 4OVUA 2EC1A 3RZFA 3HK0A 3AULA 3VTUA 1RRPB 3KW5B 1Z5SB 2JXXA 4XC2A 3NZSA 5J3YA 1V5TA 2C5LC 2IO2B 4HAWB 3W1YA 2RGFA 4IW0A 3DPDA 3APCA 3KUCB 4H8SA 3DVNV 3AU5A 1GJZA 4MEMA 5HE3A 3SYXA 2L0FA 5KHOA 1WE7A 1KM7A 5C16A 1A5RA 2O6VB 2WDTB 3UF8A 1E8YA 3CXBB 2M4NA 2KWCA 2P8VA 3WANA 3A9JB 4EZJA 1XQQA 2DTCA 2KMCA 4EKUA 2LOXA 1GG3A 4K7UA 2BGFA 5J3QA 2KLGA 2Z0OA 2Q13A 2KJRA 1WGQA 2LGDA 3PPAA 1AWEA 3BJIA 1IYFA 3L16A 1K5DB 3SV1A 3F0WA 2KMAA 5E6NA 1J0GA 3ODWA 1V80A 1QZEA 2R09A 4GN1A 2N1WA 2C9WB 3CF6E 2BYVE 2LXCA 1Y19B 5CHWA 4HB0B 4WWOA 2CQUA 2N7EA 3DQVA 4LJPB 4KDIC 4BKSD 3LDZE 3PRMB 5C1ZA 3SUZA 2RGNB 1MIZB 2M14A 4HB3B 1WXVA 1E7VA 2Y8GA 5JZEB 4GMVA 2MRPA 3LJUX 1RAXA 1Z87A 3ZNID 3X23A 5EDSA 2AEHA 2YSZA 2LD9A 1U2BA 3AJ4A 1ZC4B 3B08A 5CTRC 5EFXA 4D0NB 1WY8A 2BF8B 2BPSA 2RSGA 3APFA 5AZFA 4ZYNA 4FN2A 3DBLI 2DHKA 2AWTA 3IHPC 3KUZA 1KI1B 2LGYA 5JP4A 5C5BA 2KCJA 2KC2A 2DYQA 2DX5B 4I6PA 4DHJB 4DWFA 2DKQA 2GJYA 4FBJB 1BAKA 4K81A 4A3OA 3APDA 1V61A 1U5DA 1ISNA 2BWES 5HKHA 1ACAA 4KIKA 2M38A 1ST7A 1OEYJ 2GBNA 3JW0X 3DBHI 2PPHA 2D07B 2MP2B 4A3PA 2ELAA 1U5GA 4HB2B 1WX7A 3PS6A 4EUTA 2ZNVB 3PGEA 2XBBC 2LVQA 2IYBA 2JRHA 4WAAA 3FM8C 3L0WB 3H7PB 1NU2A 3EECA 2IY1B 1FHOA 1XCGA 2MBQA 1LQBA 2IO0B 4PQ0A 3AXCA 1U4AA 2IZVB 2Z0QA 3IVFA 3UIPB 1C1YB 2NCNA 1WXSA 5FR6A 3A33B 1KLVA 1DROA 1YX5B 4MK0A 3ONSA 1J0WA 5L95C 2LRUA 2FCNA 3A9KB 4HPMB 2XK5A 2O6VD 3C0RB 1PFJA 5IA7A 3CSTA 4GZUA 2C7NB 3ULCA 1WXAA 2VKIA 3R7QA 2MDXA 4EZKA 3FP5A 2KQ7A 2RR9A 1V88A 3DOWA 2K8CA 3A98B 3VH3B 1KZGA 3QBVB 5DCNA 2HTHA 3G9WA 1HE8A 3U7DA 2R0DA 1WZ0A 3DBSA 1X05A 2N9PC 4IM2A 2ZNVC 3A4SC 1DYNA 3M1IB 4GDLB 2ZPYA 1WYWB 4EJNA 3K9PB 4BKSA 1WM2A 1UNQA 2PEAA 4TQ0A 4WJOA 4I6NB 1WFYA 4W9FA 3VIAA 3PEGA 1WGHA 3IFWB 4AUQC 2L7RA 1NDDA 5HE0A 4NJ7A 4EMOA 2Z59B 4LJOB 3TJPA 2ASQA 1WGYA 2JF5A 2Z0DB 1SIFA 3VQIA 3WAOA 5D7GA 3D8DA 2KD0A 4NQKE 1XD3B 5LXHA 3VVWB 2CHWA 4IUMB 4JL9A 2OOBB 1I7AA 2ZVOA 3ODOA 3ZUNA 2KC1A 2I5CA 2P0FA 1WE6A 3UINB 2P0HA 1U27A 2GMIC 1GNUA 2G4DB 3ML4A 2C7MB 3PT2B 4KDLB 3N32A 1G6JA 1L2NA 2I1JA 1F9JA 2DENB 4IFSA 1C3TA 2KO3A 2FIFA 2CHZA 2JZZA 4TQ1A 1NTVA 4HCPB 4E74A 2DA0A 2K1FA 2V76A 4GPTB 1WX9A 3P6AA 3N30A 3OAWA 1V6EA 5C6RA 4W9HA 4ZDVA 2M8SA 3JVZX 3UIOB 4GMXB 4HB4B 4F7GA 3DXDA 3QCAA 2D9ZA 1BTNA 2O6VA 2LI5A 2CB8A 3PTFC 3RCPA 3A9JA 3M3JA 2LRWA 2FCQA 4ICVA 1V2YA 2V3SA 3KUDB 2UZRA 5J3TA 4LCDE 2WH5A 1XR0B 3KYCD 2EMTA 2AL6A 1V5PA 3ZIMA 2D2QA 4K17A 3HIZA 2L1CA 1V86A 3RULA 4DBGA 3KY9A 3PVUA 4LDTB 2Z0EB 1PMSA 2GBKA 2GBRA 3SHQA 3QWMA 2JRIB 3H6NA 1OGWA 1JRUA 5IAAC 2IO1B 5LLIA 4AJWA 2LG1A 4K1RB 5TR5A 4K2PA 3HHMA 4W9KA 3VXWA 4KHOA 3ZO5B 1Q1OA 2G4SA 2CRFA 3L08A 2KWUB 4DXAB 4AP4C 1V5MA 2VSZA 3V5WA 4A20A 1FGYA 1U5EA 2N1VA 4BKTA 2CAYA 2FUHB 2ROZB 4Z2MB 2LULA 1XT9B 5CX3A 4FULA 2M1MA 2R2QA 4A6FB 3DXEA 4DDGD 4W9JA 3K9OB 3GYOA 1XD4A 2YS5A 3BINA 2RVBB 2DX5A 2ZPNA 3QHTA 3D8EA 1V89A 2ADZA 4ANUA 3MHSD 2CKHB 4M8NA 2HD5B 2D9YA 3RUIB 1SHCA 2MP2A 3PREA 4FA6A 2L2IA 2CY5A 4HWIB 1TZ1A 4JQWC 2J7QB 4HXDA 2G35A 4EOYA 2Y7BA 3H7PA 2BKFA 1WM3A 1GUAB 4WQOB 2K2JA 2KVRA 2D10A 2MWSB 1QC6A 3N3KB 3TMPB 2CY4A 3H1UA 4F8CB 2BYEA 1WMHB 1XODA 4A6HA 3CSFA 3PVWA 2ROVA 2ABDA 1PQSA 2LBBA 3A9KA 2K6DB 2ZCBA 3ZDMC 3CIKA 2J0MA 3B0AA 3D8FA 2HJ8A 3R3MA 2HE7A 2M17A 3V6EB 1FAOA 3H7SA 4HCNB 2CODA 1GC6A 4P7IA 1MPHA 2COCA 2GCJA 5CHVC 3WAPA 3PP2A 4HLEA 3UQBA 2D9WA 2BYFA 1Y5OA 1PLSA 1OQNA 5C79A 2L8JA 2N9XA 4GDLA 4XZ4A 4LDTD 2K2UA 3WALA 2RPQA 2P0DA 3AI5A 1WVHA 3SDLC 4IWOA 1CMXB 4AOFA 4W9DA 2K8HA 2FJLA 2DYNA 1S1QB 2DZMA 3DXCA 4HAYB 5JHAA 4HAVB 4J6IA 2N23A 2L00B 3JSVA 2DLWA 4MGZE 4HJKA 2LYDA 5G55A 1IP9A 2JUOA 3FLVA 1WIAA 1M94A 2DYMA 4B95A 2WX1A 3TW1A 2KXJA 5LXIB 4ZRIA 2KJ6A 2DAFA 4DHZE 1N3HA 1Y8RC 4MGYE 2LGXA 1DBHA 2FDQA 2ZZPB 2JP2A 1TQZA 1ZKHA 3TCAA 3WYFB 3I3TB 4BBNF 2K00A 1NBFC 2NBVB 3KYDD 4II2B 5DPRA 3NZUA 3GYPA 4PYZA 2MBHA 2KTRA 4WWNA 1X1FA 1UH6A 3S2AA 2MSED 1L7YA 1LM8B 2PE9A 5J17A 1WG7A 1H8CA 1XX0A 2IO3B 1RLFA 3UGBB 4MT7A 5GMVA 2ZCCA 4YL8A 5LONB 2RUKB 2COPA 3ML9A 4KHBB 3HQCA 2KJHB 3OJ3A 3HW2B 3T8MA 1DDMA 2QKLA 2UZSA 2KUPA 1W1GA 4MGIE 1K5GB 4IAPA 4PYUA 3WA0A 4WSFA 4W9IA 4KZCA 1EF5A 2MA9B 1TBEA 2JY6A 2ELBA 1WJMA 4M8MA 4WJNA 3VTWA 4N9F4 3PLUA 3W1SC 3T06A 3PRZA 4M0WB 1FGZA 4ZRKA 3A1QB 3EC8A 1DDWA 1HB6A 2C60A 2DN6A 2KTFA 3U8ZA 4W9LA 3ZLZA 1EUVB 3GOEA 3P7ZA 3VDZA 3L54A 3ZVRA 2KDBA 2NS5A 3JSVB 4ASWC 4DDID 4F7HA 3HM3A 4RM9A 4IWPA 1WGUA 2OJRA 3JYUA 2YF0A 4B6HA 1OEYA 2XQNM 3HM6X 4PNKA 2JVCA 2RLOA 3QIJA 3ZDTA 1MG8A 4WJQA 4G0NB 4BOZB 4A6FA 2JPHA 1VD2A 1WJ4A 2KHWB 4DHJD 2D9XA 1R4NI 2YRYA 1NTIA 3TIXA 4GDKB 2BCJA 3TBLD 3ZTDA 2YS3A 4WWPA 1UD7A 2IYDB 1FXTB 1W1HA 1E8XA 3SO6A 1P9DU 1X1MA 5DIFB 2KZRA 1SGHA 2K39A 4DX8A 5HE2A 3ZNGC 5FI0A 3EHVA 2KTRB 2KX0A 2KQSA 1S3SG 3VFKA 2FNJB 4AWJA 4F7ZA 3NOBA 3ZVVA 4YONA 3PRPB 4IWQA 2MWNB 2JT4B 2H7EA 3WAMA 4MELA 2K8BA 2W2WA 3MDBC 3VUYA 4HAXB 4MM3A 1P0RA 3O65B 4WVFB 2LASA 1V5OA 4JLCA 3M63B 1XKEA 1IPGA 2QHOA 1Q0WB 4FHJA 1WXMA 1OQYA 4FADA 1WGDA 1WMHA 2W9NA 3DBRI 1OY2A 2C7HA 4KVGB 3SD5A 4GOCA 3PG7A 2FCMA 4HPLB 5G2NA 2REXA 3BY4B 4TKNA 2JWZA 1TJ6A 3PV1A 2DFKA 5L83A 4KSKC 2IY0B 3VTVA 2NR2A 1BT0A 2ZEQA 3NHEB 1R4MI 1W1DA 2MBBB 4PS7A 2A5UA 3DDCB 1LFDA 4K7WA 4NAWB 2RD0A 3MTNB 3A8QA 2GCLA 1Q5WB 1EVHA 2D3GA 3SNHA 3ENEA 2KGXB 5JHHA 4PS8A 1HBKA 4BKGA 1MKEA 1YQBA 1HB8A 2NMBA 2NZ8B 5KHQA 3KRXA 4CO7A 1NVLA 4RM8A 3GZNI 5DPSA 1P3RA 4MY6A 4GB9A 1ZSQA 5AEKB 2LJ5A 5JHGA 4OVVA 5LOPB 1BWNA 4DK5A 2DZIA 3PVLA 1E8ZA 2D9VA 4ANXA 3R66C 4BVUC 5IJMA 2NBWB 5KCVA 1WJ6A 3RZWC 3VHTC 1U29A 3PHWB 4C0AA 1WX8A 1K8RB 2DZJA 3PLVA 4HATB 2RSUA 4IM0A 2EMSA 3Q3FA 2YVCA 4Z2NA 4BBKA 5DHFB 4I6LB 2GBJA 1WGGA 3V6CB 2E2XA 3OLMD 4EFOA 1B55A 1D3ZA 4MJSB 3LJ3A 3PSEB 4IC7B 4Y94A 4WJ7A 2KX3A 3W1SA 2V4LA 2N0YA 2G45B 5JLJB 4GSWA 4KSLC 2ZJDA 2J59M 1P98A 1AARA 3MJWA 2O2VB 2FAZA 1V49A 5C23A 1UBQA 4BOSC 3KRWA 5D6JB 2V1YA 4FJVB 3CMMB 1UGMA 5DH9B 2MQJA 3V61A 1FHWA 4JGHB 3QA8A 1P5TA 1X11A 2K25A 2DHZA 3B1LX 2KFKB 2DYOA 3OJ4B 3ZTCA 2DHIA 4ANVA 2NPTB 1EO6A 1TTNA 4NY0A 1I2HA 3L10B 5DPWA 4GGQA 5CHFA 1WZ3A 2Y5BB 2L76A 1V9JA 4CHMA 1WRDB 2IFSA 4CHKA 3ODXA 3UZTA 2VRWB 4MDKE 3EFUA 3SU8X 1Z2MA 1NTYA 4II3B 3QAQA 3DCGA 4DBBA 1WR6E 4CYEA 2FIDA 4E3CA 3A1QA 2NBUA 2WYQA 3X0WA 1WH3A 2N4FA 3WIMA 1YJ1A 2CR5A 3A4RA 4MSMB 2Z0PA 2UYZB 1KOTA 4L6EA 4NPNA 4G11A 3U30A 2AL3A 1V81A 1P3QU 2MLBA 1OMWA 2GS0A 2K6QA 3TFMA 5D3VA 5DI9B 2KFJA 1YIWA 1UELA 2DX1A 1ZM0A 2GBMA 2G3QB 4TYZA 4KAXB 2MW5A 3VH4B 5CLQB 4MH0E 4XWXA 2MX2A 1P1AA 4KZ0A 2MCNB 1H10A 3QC8B 5CLLB 3Q3JA 2PZ1A 1M7RA 1X1GA 2N7DA 1UBIA 4GDKA 4HK2A 3QK0A 1E8WA 3FEHA 4FJZA 3DVGY 2IBIB 1TGZB 2BKRB 2KDEB 2WWZA 3NSUA 2NVUI 1UPQA 2FJ9A 4MSQB 1V5UA 3NS8A 4IM3A 4HHVA 4TV3A 1KJTA 3L17A 1UPRA 1IRSA 3N7CA 1YD8U 4ANWA 2DHJA 2MKRA 2KANA 2CS4A 4BFRA 1ZVRA 2LXAA 3PZDA 3FSSA 4BBNC 2KWVB 5D3XA 2LVPA 1FB8A 3IBEA 1E7UA 2BWFA 5DPTA 5D94A 4DX90 2KLCA 1I35A 1WJUA 2UWQA 1WJNA 3TVVA 3ALBA 2M0XA 2J0KA 2OQBA 3QQ8B 4HVBA 1YX6B 4B6WA 2JZ3B 4X57B 3RT3B 1UEFA 5GOWB 1X86A 5BO4B 5D3WA 3ZRCA 1WI0A 2YLMA 4B9KA 1I42A 1Q67A 3KZ1A 1EGXA 2KKCA 4WJPA 4NAWA 2L3ZA 4NJ6A 3ZRFA 5J18A 2N9EB 4HDQA 3AU4A 4DHZB 3NY5A 4HAUB 4K2OA 4A5KA 3VOQA 1LXDA 1WR1A 5JH5C 4TUUA 4IOYX 5KQ4A 5D2MB 1LW3A 1WJ1A 4F1SA 4F7UP 3VUWA 4ICUA 4GU2A 2LWPA 3M95A 2LVOA 1J8CA 2Y8FA 1UNRA 2KDIA 3RD2A 4EEWA 2LZ6A 3V60A 3PHXB 1MAIA 4FLHA 2YS1A 3OANA 1MK9B 3UQAA 4G50A 2MBOA 3D32A 3M62B 1BTKA 3KVFB 1P6SA 3RCZA 4RMAA 2KOXA 1U5FA 2COAA 5C5BB 3QARA 1RJ2A 4IG7B 2VRRB 3A8PA 1ZC3B 2CU1A 3KSYA 4GIVA 4PS3A 4XX5A 5D3YA 5HE1A 1DDVA 1H4RA 2KDFB 4ZRJA 4KIKB 1T0YA 4HAZB 5FI1A 4HDOA 2YT1A 3IG3A 2RQ1A 2LOZA 1E90A 2D11A 4MJSA 5AZHA 2LUEA 4W9GA 3F5RA 3H9DA 1AQCA 2J0JA 3ULBA 3ZNZB 1M7EA 5E6OA 2COFA 2DZKA 1NI2A 1QQGA 5J2RA 3KH0A 3TO1A 3ZNHB 5L81A 1RRBA 2O2VA 3DVGX 5KQ1A 2EJ8A 1WGRA 5E6PA 2PE6B 3ZKJC 1ZGUB 2CHXA 2I1KA 2MFQA 4NSWA 3PSCA 2DAJA 3QWZB 2OTXA 4G3XB 5JHBA 3O96A 1UNPA 1EAZA 3QJZA 1GC7A 2D4QA 2XK5B 2A4ZA 2L05A 1WF9A 4CHJA 2KFKA 1E5WA 3TL5A 1WI1A 2UVMA 4E71A 4GXBA 2NPTA 4KHAA 2DYBA 2GOWA 1FHXA 4EZLA 3ECIA 3R7RA 2B3AA 1EF1A 3MPXA 2W2XC 4JIOU 4MGKE 2KK8A 5DHAB 4FHKA 2HTHB 3VAWA 3ML8A 3EPYA 5AZGA 4FJYA 2QKMA 1FOEA 2I5FA 2EKEC 2KN5A 2LKOA 1MIXA 2AYOB 1UZXB
chains in the Genus database with same CATH superfamily
2YT0A 2H7DA 2RNRB 2R2OA 1HTOA 2WNMA 5H92C 3DVNU 1ZW7A 1NYQA 1GPXA 2FCSA 2RDGA 1VCBA 1VR9A 4A6KA 1OTRB 5JVLA 4QJ3B 2QSDA 1D6EC 5D3IB 3N1ZC 1J19A 3Q8BA 3V3XA 3T9LA 3KQ4A 3V62A 3L13A 4WWMA 1P7FA 1TXDA 2X18A 2DKPA 4JKGA 1R7SA 1GB1A 1QF6A 2L0TA 3P2BA 1KZ7A 5D27A 1LB1A 1KRHA 2KNBA 1SE4A 4NQLB 1VZ6A 1IGCA 2WX0A 2X0SA 4W9CA 1SE9A 2HRJA 2EELA 1K53A 3QX1A 3RFZB 2PJHA 3RYTA 3ZW3A 2MBEA 3Q3MC 4W9EA 3RNEC 4A8XC 4EE2A 2K8EA 2ZVNA 4JWSC 1PYWD 2GB1A 3VUXA 4K7SA 3AEFB 2AQ2B 3RNGC 3E9LA 2WXMA 1RFAA 4URKA 2XEWA 4KV2A 4NNJB 1L0YB 1D4BA 2W2XD 1MK7B 1SEBD 4AJYB 4OVUA 2EC1A 1SF0A 2DIKA 3RZFA 3HK0A 3AULA 3VTUA 3AB5A 1RRPB 3KW5B 1Z5SB 1JWAD 2JXXA 4XC2A 3NZSA 5J3YA 1V5TA 1PUTA 2C5LC 2IO2B 2XN9C 2WDVB 4HAWB 3W1YA 4MH8A 2RGFA 4IW0A 3DPDA 3Q14C 3APCA 4ILGB 3IAS1 5IRSA 3KUCB 1I4GA 4H8SA 3DVNV 3AU5A 3LYYA 2M0AA 2BYTA 1GJZA 4MEMA 5HE3A 3IAM1 1VLBA 3SYXA 1MG4A 2L0FA 5KHOA 1UUPA 1WE7A 1KM7A 4P1CC 5C16A 1OQRA 1A5RA 2O6VB 2WDTB 1HXYD 1C4PA 3UF8A 2IJ0A 1E8YA 3CXBB 1L6VA 2JXTA 2M4NA 2KWCA 2INPE 2P8VA 1UGJA 3DBLB 3WANA 3A9JB 4EZJA 2INCC 3ZJTA 1XQQA 4L1BA 2DTCA 2KMCA 2BS4B 2PMVA 4EKUA 2LOXA 1GG3A 4K7UA 2BGFA 1QKZA 2J53A 5J3QA 2KLGA 3HSAA 2Z0OA 2Q13A 3TUOA 2KJRA 1MVKA 4C80A 2QC8A 1IUEA 1WGQA 2LGDA 3PPAA 1I4RA 1AWEA 3BJIA 1IYFA 1SJED 3L16A 1K5DB 3SV1A 3F0WA 2KMAA 3R8BA 5E6NA 2V3NA 3DBHB 2R82A 3E56A 1J0GA 3ODWA 1V80A 1QZEA 2R09A 4GN1A 4OT1A 1F1HA 1JRPA 3KWLA 5TSSA 2N1WA 1ZOYB 2KIGA 2L32A 1TYGB 1GAQB 2C9WB 3CF6E 4WAFA 4XWWA 1TS2A 1C9FA 5IKCM 2BYVE 2V9HA 2LXCA 1Y19B 5CHWA 4O1NA 4HB0B 3SEBA 4WWOA 2CQUA 2N7EA 2N7JA 3DQVA 4KDIC 4LJPB 4BKSD 1BXTA 3LDZE 3PRMB 5C1ZA 3SUZA 2RGNB 1MIZB 2M14A 4HB3B 1WXVA 1ZE3D 1E7VA 2R61A 2WLBA 2Y8GA 1FCLA 4YT0B 5JZEB 4GMVA 2MRPA 2BBCA 3LJUX 1RAXA 1Z87A 3ZNID 3X23A 4B0MA 4A6QA 5EDSA 1P7EA 2AEHA 1MI1A 2YSZA 2LD9A 1U2BA 3AJ4A 2K22A 3NVWA 5HHDG 1I7HA 1ZC4B 2LMCA 3B08A 5EFXA 4D0NB 5CTRC 1WY8A 2BF8B 2BPSA 2RSGA 2DBYA 3APFA 5AZFA 4ZYNA 2WXPA 4FN2A 1VJKA 3DBLI 2DHKA 2AWTA 3IHPC 3KUZA 1KI1B 2L1AA 2LGYA 2PVGC 2OJWA 5JP4A 5IP4D 5C5BA 2KCJA 1AYFA 2KC2A 2DYQA 2DX5B 4I6PA 4S0RA 4DHJB 1IGDA 3OG5A 4DWFA 2DKQA 2GJYA 2FJUB 4YTMB 4FBJB 1BAKA 2PIAA 4K81A 4A3OA 2K49A 3APDA 1N62A 1T0RC 1V61A 1U5DA 3BWUD 1ISNA 4C7ZA 2WXOA 4JKAA 2BWES 5HKHA 1ACAA 4KIKA 4L1RA 4M00A 2M38A 1ST7A 1OEYJ 4RGNA 3EFCA 2GBNA 3TEYA 2YEPB 3JW0X 3DBHI 2PPHA 1KH0A 2D07B 2MP2B 4A3PA 5H8YE 2ELAA 3ZGZA 1U5GA 4HB2B 1QOFA 1WX7A 3PS6A 1QT9A 4EUTA 1T5XD 2ZNVB 3PGEA 1BMLC 2LVQA 2XBBC 2KIEA 2IYBA 1ZPSA 2JRHA 4LNIA 4WAAA 3FM8C 3L0WB 3H7PB 1NU2A 3EECA 3T3OA 2IY1B 1FHOA 1XCGA 2MBQA 1LQBA 2IO0B 4PQ0A 3AXCA 1U4AA 2IZVB 3Q3NC 2Z0QA 1SE2A 3IVFA 3UIPB 4ZRQA 1C1YB 2NCNA 4IOIE 1WXSA 3ZYYX 2JYTA 5FR6A 5T8IA 3A33B 1KLVA 1DROA 1YX5B 4MK0A 1HZ5A 3ONSA 1J0WA 5L95C 4JKHA 1DOIA 2LRUA 2FCNA 3A9KB 4HPMB 2XK5A 2IDYA 2O6VD 4A90A 2Z14A 3C0RB 1PFJA 5IA7A 3CSTA 1TIFA 4GZUA 2C7NB 3ULCA 1WXAA 2VKIA 3R7QA 2MDXA 4EZKA 4JWUC 3FP5A 1VBHA 2KQ7A 1FNWA 3MHZA 3RNBC 2RR9A 1V88A 3DOWA 2I38A 2K8CA 3A98B 3VH3B 1KZGA 3QBVB 5DCNA 4M01A 2HTHA 2SEBD 3G9WA 1HE8A 3U7DA 2R0DA 1WZ0A 3DBSA 1X05A 2N9PC 2OEDA 4IM2A 1NEKB 2ZNVC 3A4SC 1DYNA 4JKCA 3M1IB 2M19A 4GDLB 2ZPYA 3SFEB 1WYWB 4EJNA 3K9PB 4DQOC 4NZLB 4B0EA 4BKSA 2QDFA 1WM2A 2JZPA 2Y5PA 1UNQA 2PEAA 4TQ0A 4JK8A 4WJOA 1BUIC 4I6NB 1XEEA 1WFYA 4W9FA 4N58A 3MC0B 3VIAA 1JWMD 3PEGA 4TMAB 1WGHA 3IFWB 4AUQC 1VDVA 2L7RA 2GUMA 1I4HA 1NDDA 4GNKB 3GS2A 5HE0A 3GE3C 4NJ7A 4EMOA 2K3UA 2Z59B 3PO0A 4LJOB 2JSVX 3TJPA 5I2MA 2ASQA 3A58A 1WGYA 2MHJA 2JF5A 1J7AA 2Z0DB 1SIFA 4RGTA 3VQIA 3WAOA 1JWUD 5D7GA 2QCZA 3D8DA 2KD0A 4NQKE 1STEA 2B76B 3AEBB 5BMIA 1XD3B 5LXHA 3VVWB 4HPPA 5E6JA 1KFYB 2CHWA 3O13A 2YT2A 2G9HD 4LK0M 4IUMB 4JL9A 2OOBB 1I7AA 2ZVOA 3BZDB 4ITKA 3ODOA 3ZUNA 2KC1A 4KKJA 2I5CA 2P0FA 3AEEB 3ETRA 1WE6A 1FO4A 3UINB 2P0HA 1U27A 2GMIC 1R4MB 1GNUA 2W55A 1L4DB 2G4DB 3ML4A 3BIID 5EE3A 2DNFA 4OZAA 2C7MB 4XDDA 3PT2B 4KDLB 3N32A 1G6JA 3N20C 3NWFA 1L2NA 2I1JA 1F9JA 1HZ6A 2DENB 4IFSA 1C3TA 2KO3A 1T0QC 2FIFA 1PGXA 2CHZA 2JZZA 4HRSA 4TQ1A 1NTVA 1LGRA 1WXQA 4HCPB 2TSSA 4E74A 1QILA 2DA0A 2K1FA 2PKOA 2V76A 2PLPA 4GPTB 1WX9A 3P6AA 1JROA 3N30A 3OAWA 1RWSA 5HG2A 1V6EA 4HSIA 5C6RA 4W9HA 2WXRA 4YTPB 4ZDVA 1C78A 2M8SA 3JVZX 1L6UA 3OWEB 3UIOB 4GMXB 4HB4B 2FE8A 4F7GA 3DXDA 1D5ZC 3QCAA 2D9ZA 1BTNA 2O6VA 2LI5A 3SR6A 2BS2B 2CB8A 3PTFC 3FKYA 3RCPA 4BZAA 3VRAB 3A9JA 3M3JA 2H88B 2LRWA 3E66A 2FCQA 4ICVA 1MHXA 1V2YA 4WQMA 2V3SA 3KUDB 2UZRA 3TSSA 4OSNA 3VR9B 5J3TA 4LNFA 4LCDE 3R2IA 1MPEA 2WH5A 1XR0B 3N1XC 3KYCD 3W5VB 2EMTA 5FK9C 3NWDA 4USAA 2ICIA 2AL6A 1V5PA 4K3BA 3ZIMA 4JKFA 2D2QA 2KACA 4K17A 3HIZA 3AE8B 2L1CA 1V86A 2RDBC 3BVGA 4US9A 3RULA 1I4XA 4DBGA 2UU7A 3KY9A 3PVUA 5AUKA 1YQ3B 2Z0EB 4LDTB 1PMSA 1TZOA 2GBKA 2GBRA 2WGSA 3SHQA 3QWMA 2JRIB 3H6NA 1OGWA 4MACA 1JRUA 4RGMA 5IAAC 1KLUD 2IO1B 2MJ3A 4OZBA 5LLIA 4AJWA 2SAKA 2LG1A 4K1RB 5TR5A 4K2PA 3HHMA 4W9KA 3VXWA 2M56B 3ZXRA 4KHOA 3ZO5B 1SB3C 1Q1OA 2G4SA 4KGSA 2CRFA 3L08A 2KWUB 4DXAB 1FFUA 1V5MA 4AP4C 2VSZA 3V5WA 4A20A 1FGYA 1U5EA 2N1VA 4BKTA 2WHIA 2CAYA 2FUHB 2ROZB 1FD6A 1DYQA 1UWMA 4Z2MB 1YQ4B 1QQRA 2LULA 1RYJA 1XT9B 5CX3A 4JK7A 3BYYB 4FULA 2M1MA 1SE3A 2R2QA 4A6FB 3B2GA 3DXEA 4XWTA 2QILA 4DDGD 1ROEA 1OQQA 4W9JA 3K9OB 3GYOA 1XD4A 2YS5A 1QOAA 3BINA 1ACCA 2RVBB 2DX5A 3Q69A 4C4VB 2ZPNA 3QHTA 2ON8A 3D8EA 1XO3A 1V89A 4KGRA 2ADZA 4LNOA 4ANUA 3MHSD 2CKHB 4N6EB 4M8NA 2HD5B 2D9YA 2KVZA 1GGOA 1SHCA 2PVOD 3RUIB 2MP2A 3PREA 2H89B 1F2RI 4FA6A 2L2IA 5FR3A 1CQVA 2CY5A 1JMLA 4HWIB 1TZ1A 4JQWC 2J7QB 4HXDA 2QIEB 2LGSA 2G35A 1IBXB 4EOYA 2Y7BA 4XDCA 3H7PA 4N59A 2BKFA 3PZ8A 3HRDD 2N9KA 1WM3A 3AE2B 1GUAB 5BYQA 1TT5B 2Z8LA 2K2JA 4WQOB 2KVRA 3V05A 2D10A 2MWSB 2XNAC 3BVZA 4MM3B 1QC6A 4RNAA 3DWMA 3N3KB 1AWDA 3TMPB 2CY4A 3NWAA 3HVZA 3H1UA 3P4SB 2ACZB 1E0ZA 1DIKA 4F8CB 2BYEA 1WMHB 1V97A 1XODA 4A6HA 3CSFA 3PVWA 2ROVA 2ABDA 2PW9A 1PQSA 2LBBA 3A9KA 3NRZA 1SSNA 2K6DB 1DGJA 3EA6A 2ZCBA 3ZDMC 1C79A 2JX5A 4ILJA 3CIKA 2J0MA 3B0AA 3NVVA 4ZHPA 4YSXB 3D8FA 2HJ8A 5G5GA 3URYA 3R3MA 3H8HA 2W3RA 2HE7A 2M17A 3MC9A 3V6EB 1FAOA 3U4EG 3H7SA 4HCNB 2CODA 1GC6A 3AEGB 4P7IA 3MC8A 1B9RA 1MPHA 2COCA 2GCJA 5CHVC 3WAPA 3PP2A 3W5UB 4HLEA 3UQBA 2D9WA 3P4PB 2BYFA 1N61A 1Y5OA 1PLSA 2V3PA 1OQNA 5C79A 2L8JA 2N9XA 4GDLA 4XZ4A 4LDTD 2I2YA 1DOXA 3AE1B 4M0WA 2K2UA 1WRIA 2WQYB 3WALA 2RPQA 2P0DA 3AI5A 1WVHA 3SDLC 4TSSA 4IWOA 1CMXB 4AOFA 1F0ZA 2EKIA 1WSPA 1YNTE 2VZKB 3NVYA 2KN4A 2KAJA 4W9DA 2K8HA 2VH1A 2FJLA 1ZXIA 1HQRD 2DYNA 1S1QB 2K9XA 2DZMA 3DXCA 2Z59A 4HAYB 5JHAA 4HAVB 4J6IA 2N23A 1T0SC 2L00B 4HKQA 3JSVA 2DLWA 2JQRB 4MGZE 3BYTB 4HJKA 2LYDA 5G55A 1IP9A 2QJLA 2JUOA 3FLVA 1WIAA 5IOIA 1M94A 2DYMA 4B95A 2WX1A 3P42A 3TW1A 2KXJA 3GP7A 5LXIB 4ZRIA 3ZJUA 1PFDA 1FRDA 1XXGA 2KJ6A 2DAFA 4DHZE 3LXFA 1DOYA 3E9SA 1N3HA 1Y8RC 3CWIA 4MGYE 2LGXA 1DBHA 2FDQA 2RDHA 2ZZPB 2JP2A 4KX6B 1QLBB 1FNVA 4LLGM 2BS3B 1TQZA 1B1ZA 1ZKHA 4NJCA 3TCAA 3WYFB 3I3TB 3Q8AA 2Y3AA 5IN7A 1E9MA 4BBNF 2K00A 1NBFC 4R3DA 1KBLA 2NBVB 3KYDD 4II2B 2RPVA 5DPRA 2KYWA 3P4QB 3NZUA 3Q8CA 3GYPA 2AQ1B 4PYZA 2MBHA 2KTRA 1ET9A 4WWNA 1X1FA 1UH6A 3S2AA 2MSED 1L7YA 2BT6A 1LM8B 1TKYA 3UI3A 4NAMA 2E3TA 2BW2A 3RNCC 2PE9A 5BYRA 5J17A 1WG7A 1H8CA 1XX0A 2IO3B 1YN5A 1RLFA 3UGBB 4MT7A 3AM9A 5GMVA 2ZCCA 4ARCA 1XLOA 4YL8A 5LONB 2RUKB 2COPA 3ML9A 4KHBB 3HQCA 1ZXHA 2KJHB 3OJ3A 3HW2B 1A70A 1TY0A 3T8MA 1DDMA 2QKLA 1EWCA 4XGAB 3Q3OC 2UZSA 3WCQA 2KUPA 1W1GA 1R4NB 4MGIE 1K5GB 4IAPA 4PYUA 3WA0A 1TKGA 4WSFA 4W9IA 2MEKA 4KZCA 1EF5A 2MA9B 1TBEA 2JY6A 2ELBA 1WJMA 4M8MA 4WJNA 3VTWA 3TEZA 2WXLA 1V1PB 1E10A 5GXGB 2FBWB 1QOBA 4N9F4 3AE3B 2BQQA 3PLUA 3W1SC 4QXAB 3T06A 3PRZA 4M0WB 1FGZA 3OHMB 4ZRKA 3A1QB 3EC8A 4ILHA 1DDWA 3SFDB 1HB6A 2ZKMX 2C60A 2DN6A 5BYSA 2KTFA 2INNE 3U8ZA 4W9LA 3ZLZA 4HROA 1EUVB 1JDEA 3GOEA 3P7ZA 3VDZA 1SJHD 3FILA 2HDEA 3Q6BA 2D3BA 3L54A 3ZVRA 4H2AA 2VZKD 2KDBA 2NS5A 3JSVB 4ASWC 5C3JB 3B2FA 4DDID 1GB4A 1MI0A 4F7HA 3HM3A 1JW9D 4RM9A 2GI9A 2OJRA 1WGUA 4IWPA 1VZ7A 3JYUA 2LGIA 2YF0A 4B6HA 1OEYA 3AN1A 2XQNM 3DBRB 3HM6X 3ZJVA 3N9YC 4PNKA 2JVCA 2V4IB 4WH4A 2RLOA 3QIJA 4ZYSA 4D2KA 3ZDTA 1MG8A 2WXIA 4WJQA 1YN3A 1J7CA 4G0NB 1HTQA 2CJOA 4BOZB 1FEHA 4A6FA 1D5XC 2JPHA 1VD2A 1WJ4A 2KHWB 4DHJD 2D9XA 1R4NI 2YRYA 1NTIA 1C77A 4C4VA 3TIXA 4GDKB 2BCJA 3TBLD 2W3SA 1C4AA 3W9CB 2MJDA 3HVDA 3ZTDA 2YS3A 4WWPA 4QJ4B 1UD7A 3NZ3A 2IYDB 1FXTB 1W1HA 1E8XA 2CJNA 3SO6A 3P1MA 1P9DU 2WDRB 1X1MA 5DIFB 1TKEA 2KZRA 1SGHA 2K39A 4DX8A 5HE2A 3ZNGC 2L83A 1T6BX 5FI0A 4RCOA 2KQ4X 1L4ZB 3EHVA 1WWTA 2KTRB 2KX0A 3N1YC 2KQSA 1S3SG 4BAXA 3VFKA 1IBXA 2FNJB 3Q2AC 4AWJA 4F7ZA 3NOBA 3ZXVA 3GZNB 3ZVVA 4YXDB 4YONA 3PRPB 4IWQA 2MWNB 2JT4B 3VRBB 2H7EA 3WAMA 4MELA 2K8BA 1E6EB 2W2WA 3MDBC 1YOVB 2W82A 3VUYA 4HAXB 4P1BC 4MM3A 1P0RA 3O65B 1FNUA 4WVFB 1XCQL 2LASA 1V5OA 3NG0A 4JLCA 3M63B 5EE1A 4WIPA 2LFIA 1XKEA 1UWXA 4L2YA 1IPGA 2QHOA 1Q0WB 4FHJA 1K51A 1WXMA 1OQYA 4FADA 1WGDA 1WMHA 1JQ4A 2W9NA 1F77A 3DBRI 3VR8B 1OY2A 4A9AA 1NI3A 2C7HA 4KVGB 5FKAC 3SD5A 4GOCA 3ABVB 3PG7A 4XYCA 2FCMA 1L0XB 2BTEA 4HPLB 5G2NA 2REXA 1SIJA 3BY4B 4TKNA 2JWZA 1TJ6A 3PV1A 2DFKA 5L83A 4KSKC 2IY0B 3VTVA 2NR2A 1BT0A 1YN4A 3GB1A 3HIEA 2ZEQA 3NHEB 1R4MI 2WDQB 1W1DA 2MBBB 2KUQA 4PS7A 1C76A 2A5UA 4C7YA 3DDCB 1LFDA 4K7WA 4NAWB 5BMHA 1OFFA 2RD0A 3MTNB 3A8QA 2GCLA 1Q5WB 1EVHA 2D3GA 3SNHA 3ENEA 2KGXB 4OHJA 2NTTA 4P16A 4HJGE 1GOZA 5JHHA 1TS3A 2ZW0A 4JKBA 4PS8A 1HBKA 1MJDA 1Y56A 4BKGA 1MKEA 1YQBA 1HB8A 2NMBA 4A55A 3AEAB 2NZ8B 2OHFA 1JALA 5KHQA 3KRXA 2L52A 2R2YA 4CO7A 1NVLA 4GLSC 4RFBA 3GZNI 4RM8A 5DPSA 1P3RA 3FILB 4MY6A 4DIXA 4GB9A 3MJ5A 1ZSQA 5AEKB 2LJ5A 1TJEA 5JHGA 4OVVA 5LOPB 1BWNA 4DK5A 2DZIA 3PVLA 1E8ZA 1MHHE 2D9VA 4ANXA 3R66C 4BVUC 5IJMA 2JYEA 2NBWB 3AE4B 5KCVA 1PDXA 1WJ6A 1JWBD 3RZWC 3DWGC 4ARIA 2WXHA 1NYRA 3VHTC 1U29A 3PHWB 4C0AA 4IDIA 1CK1A 1WX8A 1K8RB 2KR0A 2DZJA 3PLVA 4HATB 3TEWA 2RSUA 4IM0A 3BK2A 2EMSA 3AECB 4KKIA 4REZA 3Q3FA 3NS1A 4RGOS 2YVCA 3LB8C 4Z2NA 4BBKA 3ENBA 4KGTA 1ZYIA 5DHFB 2VH2A 2AQ3B 4I6LB 2GBJA 1WGGA 3V6CB 3I9V1 2E2XA 3OLMD 5AUIA 4EFOA 3MFGA 1B55A 2KMMA 5G5HA 4D6WA 3B9JA 1F2RC 1KLGD 3E9PA 1D3ZA 4MJSB 4US8A 3LJ3A 3PSEB 4IC7B 2RMMA 4K3CA 4Y94A 4WJ7A 3P4RB 2KX3A 4L23A 5HI1A 2V4LA 3W1SA 1FXIA 2N0YA 1FCCC 1UNSA 2G45B 5JLJB 2NBVA 4GSWA 2J4XA 4KSLC 2ZJDA 2J59M 3Q8FA 1P98A 1AARA 3MJWA 2O2VB 3NJTA 2FAZA 1V49A 5C23A 1UBQA 2JWUA 3Q8EA 3KRWA 4BOSC 4PK1A 1WYGA 4JX1C 5MPOA 2WXQA 1EU4A 5D6JB 2V1YA 1FXAA 4OW0A 4FJVB 3CMMB 1UGMA 4AS1A 1I4QA 4JE3B 3AH7A 2BVCA 5DH9B 2MQJA 1ESFA 5EE9A 3V61A 1FHWA 2DWQA 4JGHB 3QA8A 2GRIA 1P5TA 2WXGA 1X11A 2K25A 4KHBA 2DHZA 3B1LX 3B77A 2KWDA 2KFKB 4XE0A 2DYOA 3OJ4B 3ZTCA 2DHIA 4P6VF 4OZCA 4ANVA 2NPTB 1EO6A 1TTNA 3RMKC 4HEA1 4RH6A 1D5MC 2WU5B 4LNNA 1WGKA 4NY0A 1I2HA 1L0VB 3L10B 5DPWA 4GGQA 5CHFA 1WZ3A 3RI7C 2Y5BB 2Y5CA 1JWSD 1YJJA 2L76A 3I5JC 2N0SB 1V9JA 4CHMA 3FAHA 1WRDB 1V1PA 2IFSA 1YJIA 4DXGA 2V0GA 4CHKA 3ODXA 3UZTA 2VRWB 4MDKE 3EFUA 3SU8X 2J42A 3L4PA 1Z2MA 1NTYA 2Z4DA 4II3B 1T77A 3NVZA 3QAQA 4C00A 4C56C 3DCGA 1N5XA 4M02A 4DBBA 1WR6E 4CYEA 2FIDA 2MJEA 4E3CA 3FC4A 3AMZA 1AN8A 1LO5D 3A1QA 2NBUA 4ACFA 2WYQA 2QEJC 1FFVA 5M4YB 1RFKA 2INDC 3X0WA 1WH3A 2N4FA 3WIMA 1YJ1A 2CR5A 3A4RA 4MSMB 2Z0PA 2UYZB 2FUG1 3FVCA 4L6EA 2WXFA 1KOTA 4UDUC 2ZW1A 4NPNA 3AE7B 4G11A 3U30A 2AL3A 2Z13A 1P3QU 1V81A 3NW8A 1L5PA 3R2TA 2MLBA 4JKEA 2LHDA 5LG4B 1XCTL 1OMWA 2GS0A 2LJIA 2K6QA 3TFMA 4MT5A 1I4PA 5D3VA 5DI9B 2KFJA 1K52A 1JCKB 1YIWA 3EGRA 1UELA 2DX1A 1ZM0A 2WXKA 2IGGA 2GBMA 2X8XX 4JKGB 2G3QB 4TYZA 4KAXB 2MW5A 3VH4B 1C4CA 1TS4A 5CLQB 4MH0E 4XWXA 2LHEA 2MX2A 1P1AA 4KZ0A 3W2DA 1CJEA 2MCNB 2RRFA 1ZUD2 3DCXA 1H10A 3QC8B 5CLLB 1NVID 3Q3JA 3DHIC 1MFWA 2PZ1A 3MP9A 1M7RA 1ZDXA 1FRRA 1X1GA 2N7DA 1FMAD 1UBIA 4GDKA 1N6ZA 1T3QA 4HK2A 1PGBA 3QK0A 2LUMA 1E8WA 3RNFC 3FEHA 4FJZA 1EWYC 5D3DA 3DVGY 4RF0A 2IBIB 1TGZB 1RM6C 1V8CA 2BKRB 2KDEB 2WWZA 3NSUA 2GLSA 2NVUI 1UPQA 2FJ9A 4MSQB 1PGAA 5BMGA 1V5UA 3NS8A 3PZ7A 2PTLA 4IM3A 4IKGA 4HHVA 4TV3A 1KJTA 3L17A 4CQNA 3RNAC 1UPRA 1IRSA 5C2TB 1HA5A 3N7CA 4YWGG 3U2SC 4J3OD 1YD8U 2X38A 1UF0A 4ANWA 2DHJA 2MKRA 2KANA 2CS4A 1VZ8A 4BFRA 5HFYA 1ZVRA 2LXAA 3PZDA 3P63A 1QOGA 3BVMA 3FSSA 4BBNC 2E6XA 2KWVB 5D3XA 3SBGA 2LVPA 2YEPF 1FB8A 3IBEA 1XF5L 4YTNB 1E7UA 1K50A 2BWFA 1FIQA 5DPTA 1VBGA 5D94A 4DX90 2KLCA 3SBTA 1I35A 1WJUA 1N60A 2UWQA 3IT6B 1WJNA 3TVVA 3ALBA 3ZQ4A 2M0XA 2J0KA 2N9LA 4OVZA 2OQBA 3QQ8B 4HVBA 1YX6B 4B6WA 4QJ5B 1NENB 2JZ3B 4X57B 3U7ZA 3RT3B 1XLNA 3C19A 1UEFA 5GOWB 4WURA 1XLQA 1X86A 5BO4B 5D3WA 3ZRCA 1WI0A 2YLMA 3IT4B 4LTUA 4B9KA 1I42A 4QAYA 1ZDVA 4FXCA 1YMHE 5I2SA 1Q67A 3KZ1A 2CU3A 1EGXA 2KKCA 4WJPA 3AE9B 3DHHC 4NAWA 2L3ZA 1F52A 4NJ6A 3ZRFA 3TEXA 5EE0A 5J18A 2N9EB 4HDQA 3AU4A 4DHZB 1KF6B 3NY5A 4HAUB 4K2OA 3U52E 4ZRPA 4A5KA 3VOQA 1LXDA 2NTSA 2IGHA 1WR1A 5JH5C 2KDMA 3I63C 4IOYX 1TY2A 4TUUA 5KQ4A 5D2MB 4JKDA 1SXTA 1LW3A 1WJ1A 4F1SA 2D5GA 4F7UP 3VUWA 1Q10A 4ICUA 4GU2A 5JXVA 2Q5WD 2LWPA 3M95A 2LVOA 2MH7A 4JPSA 1J8CA 3C8YA 2Y8FA 4RF1A 3GE8C 1UNRA 2KDIA 3RD2A 4EEWA 2LZ6A 3V60A 1N63A 1KC7A 3PHXB 2D3CA 1MAIA 4FLHA 1CZPA 2YS1A 3OANA 2K5PA 2WP9B 1MK9B 1V1OA 3I57A 2MBOA 4G50A 3UQAA 3EUB2 3D32A 3DHGC 2IPKD 2K0PA 1BTKA 3M62B 3KVFB 3RPFC 1P6SA 1ENFA 4DXFA 3RCZA 4RMAA 4YSYB 2HJ1A 2KOXA 1U5FA 2COAA 5C5BB 3QARA 1TS5A 1RJ2A 4IG7B 1J7BA 2VRRB 1AW7A 1FPYA 3A8PA 1ZC3B 2CU1A 3NUHB 3KWVA 3KSYA 4GIVA 4PS3A 4XX5A 5D3YA 5HE1A 2DLBA 1DDVA 2WXJA 1H4RA 2KDFB 4ZRJA 4KIKB 1T0YA 1XLPA 4HAZB 5IO9A 5FI1A 1ET6A 2IGDA 4HDOA 2YT1A 3AE5B 3IG3A 3BK1A 2RQ1A 2LOZA 1E90A 2WS3B 1KTKA 1N5WA 2D11A 4MJSA 2JU6X 5AZHA 2LUEA 3AEDB 4W9GA 3F5RA 3H9DA 1AQCA 2J0JA 2WU2B 2QMTA 3ULBA 3ZNZB 1M7EA 5E6OA 2COFA 2DZKA 2WXNA 1NI2A 1QQGA 5J2RA 3KH0A 3TO1A 3ZNHB 5L81A 1RRBA 2O2VA 3DVGX 5KQ1A 2EJ8A 1WGRA 5E6PA 2BB5A 3IXSA 1M4VA 2PE6B 1ZGUB 3ZKJC 2CHXA 3E9OA 1SBBB 2I1KA 2MFQA 4NSWA 2KT7A 3PSCA 4S17A 2DAJA 4ZOHC 2LEKA 3QWZB 2OTXA 4G3XB 2HTME 5JHBA 3O96A 1UNPA 1EAZA 3QJZA 1GC7A 2G1EA 5I4DA 2D3AA 2D4QA 2XK5B 2A4ZA 4CSQA 2BB6A 3U12A 2L05A 1WF9A 4CHJA 2KFKA 1E5WA 3TL5A 1WI1A 2UVMA 4E71A 4GXBA 3KLSX 2NPTA 4KHAA 2DYBA 1EM7A 3T3NA 4Q2JA 2GOWA 1FHXA 4EZLA 4PT5A 4LNKA 3ECIA 3R7RA 4GOUA 2B3AA 2NMQA 1EF1A 3MPXA 2W2XC 4JIOU 1VRAB 4MGKE 4HKZE 1ZP0B 2ONQA 1E7PB 2KK8A 4JK9A 5DHAB 4ZHOA 3AV8A 4FHKA 2HTHB 3J9CA 1HEZE 2J52A 3VAWA 3AE6B 3ML8A 3EPYA 3CIRB 3HUIA 5AZGA 4YSZB 4FJYA 2QKMA 1FOEA 2I5FA 5LNK1 2W54A 2AX5A 4AQ7A 2EKEC 2KN5A 1FM0D 2LKOA 1MIXA 3RN9C 2AYOB 1UZXB 1EU3A
chains in the Genus database with same CATH topology
2YT0A 2H7DA 2RNRB 2R2OA 3DVNU 1ZW7A 2FCSA 1VCBA 4A6KA 1OTRB 5JVLA 1J19A 3T9LA 3V62A 3L13A 1TXDA 2X18A 2DKPA 4JKGA 2L0TA 3P2BA 1KZ7A 5D27A 1LB1A 2KNBA 4NQLB 2WX0A 2X0SA 4W9CA 1SE9A 2HRJA 3QX1A 2PJHA 3RYTA 3ZW3A 2MBEA 4W9EA 2ZVNA 3VUXA 4K7SA 3E9LA 1RFAA 4URKA 2XEWA 4KV2A 4NNJB 2W2XD 1MK7B 4AJYB 4OVUA 2EC1A 2DIKA 3RZFA 3HK0A 3AULA 3VTUA 1RRPB 3KW5B 1Z5SB 2JXXA 4XC2A 3NZSA 5J3YA 1V5TA 2C5LC 2IO2B 4HAWB 3W1YA 2RGFA 4IW0A 3DPDA 3APCA 4ILGB 3KUCB 4H8SA 3DVNV 3AU5A 1GJZA 4MEMA 5HE3A 3SYXA 2L0FA 5KHOA 1WE7A 1KM7A 5C16A 1A5RA 2O6VB 2WDTB 3UF8A 1E8YA 3CXBB 2M4NA 2KWCA 2P8VA 3WANA 3A9JB 4EZJA 1XQQA 2DTCA 2KMCA 4EKUA 2LOXA 1GG3A 4K7UA 2BGFA 5J3QA 2KLGA 2Z0OA 2Q13A 2KJRA 1WGQA 2LGDA 3PPAA 1AWEA 3BJIA 1IYFA 3L16A 1K5DB 3SV1A 3F0WA 2KMAA 5E6NA 2R82A 1J0GA 3ODWA 1V80A 1QZEA 2R09A 4GN1A 2N1WA 2C9WB 3CF6E 2BYVE 2LXCA 1Y19B 5CHWA 4HB0B 4WWOA 2CQUA 2N7EA 3DQVA 4LJPB 4KDIC 4BKSD 3LDZE 3PRMB 5C1ZA 3SUZA 2RGNB 1MIZB 2M14A 4HB3B 1WXVA 1E7VA 2Y8GA 5JZEB 4GMVA 2MRPA 3LJUX 1RAXA 1Z87A 3ZNID 3X23A 5EDSA 2AEHA 2YSZA 2LD9A 1U2BA 3AJ4A 1ZC4B 3B08A 5CTRC 5EFXA 4D0NB 1WY8A 2BF8B 2BPSA 2RSGA 3APFA 5AZFA 4ZYNA 4FN2A 3DBLI 2DHKA 2AWTA 3IHPC 3KUZA 1KI1B 2LGYA 5JP4A 5C5BA 2KCJA 2KC2A 2DYQA 2DX5B 4I6PA 4DHJB 4DWFA 2DKQA 2GJYA 4FBJB 1BAKA 4K81A 4A3OA 3APDA 1V61A 1U5DA 1ISNA 4JKAA 2BWES 5HKHA 1ACAA 4KIKA 2M38A 1ST7A 1OEYJ 2GBNA 3JW0X 3DBHI 2PPHA 2D07B 2MP2B 4A3PA 2ELAA 1U5GA 4HB2B 1WX7A 3PS6A 4EUTA 2ZNVB 3PGEA 2XBBC 2LVQA 2IYBA 2JRHA 4WAAA 3FM8C 3L0WB 3H7PB 1NU2A 3EECA 2IY1B 1FHOA 1XCGA 2MBQA 1LQBA 2IO0B 4PQ0A 3AXCA 1U4AA 2IZVB 2Z0QA 3IVFA 3UIPB 1C1YB 2NCNA 1WXSA 5FR6A 3A33B 1KLVA 1DROA 1YX5B 4MK0A 3ONSA 1J0WA 5L95C 4JKHA 2LRUA 2FCNA 3A9KB 4HPMB 2XK5A 2O6VD 3C0RB 1PFJA 5IA7A 3CSTA 4GZUA 2C7NB 3ULCA 1WXAA 2VKIA 3R7QA 2MDXA 4EZKA 3FP5A 1VBHA 2KQ7A 2RR9A 1V88A 3DOWA 2K8CA 3A98B 3VH3B 1KZGA 3QBVB 5DCNA 2HTHA 3G9WA 1HE8A 3U7DA 2R0DA 1WZ0A 3DBSA 1X05A 2N9PC 4IM2A 2ZNVC 3A4SC 1DYNA 4JKCA 3M1IB 4GDLB 2ZPYA 1WYWB 4EJNA 3K9PB 4BKSA 1WM2A 1UNQA 2PEAA 4TQ0A 4JK8A 4WJOA 4I6NB 1WFYA 4W9FA 3VIAA 3PEGA 1WGHA 3IFWB 4AUQC 2L7RA 1NDDA 5HE0A 4NJ7A 4EMOA 2Z59B 4LJOB 3TJPA 2ASQA 1WGYA 2JF5A 2Z0DB 1SIFA 3VQIA 3WAOA 5D7GA 3D8DA 2KD0A 4NQKE 1XD3B 5LXHA 3VVWB 2CHWA 4IUMB 4JL9A 2OOBB 1I7AA 2ZVOA 3ODOA 3ZUNA 2KC1A 2I5CA 2P0FA 1WE6A 3UINB 2P0HA 1U27A 2GMIC 1GNUA 2G4DB 3ML4A 2C7MB 3PT2B 4KDLB 3N32A 1G6JA 1L2NA 2I1JA 1F9JA 2DENB 4IFSA 1C3TA 2KO3A 2FIFA 2CHZA 2JZZA 4TQ1A 1NTVA 4HCPB 4E74A 2DA0A 2K1FA 2V76A 4GPTB 1WX9A 3P6AA 3N30A 3OAWA 1V6EA 5C6RA 4W9HA 4ZDVA 2M8SA 3JVZX 3UIOB 4GMXB 4HB4B 4F7GA 3DXDA 3QCAA 2D9ZA 1BTNA 2O6VA 2LI5A 2CB8A 3PTFC 3RCPA 3A9JA 3M3JA 2LRWA 3E66A 2FCQA 4ICVA 1V2YA 2V3SA 3KUDB 2UZRA 5J3TA 4LCDE 2WH5A 1XR0B 3KYCD 2EMTA 2AL6A 1V5PA 3ZIMA 4JKFA 2D2QA 4K17A 3HIZA 2L1CA 1V86A 3RULA 4DBGA 3KY9A 3PVUA 4LDTB 2Z0EB 1PMSA 2GBKA 2GBRA 3SHQA 3QWMA 2JRIB 3H6NA 1OGWA 1JRUA 5IAAC 2IO1B 5LLIA 4AJWA 2LG1A 4K1RB 5TR5A 4K2PA 3HHMA 4W9KA 3VXWA 4KHOA 3ZO5B 1Q1OA 2G4SA 2CRFA 3L08A 2KWUB 4DXAB 4AP4C 1V5MA 2VSZA 3V5WA 4A20A 1FGYA 1U5EA 2N1VA 4BKTA 2CAYA 2FUHB 2ROZB 4Z2MB 2LULA 1XT9B 5CX3A 4JK7A 4FULA 2M1MA 2R2QA 4A6FB 3DXEA 4DDGD 4W9JA 3K9OB 3GYOA 1XD4A 2YS5A 3BINA 2RVBB 2DX5A 2ZPNA 3QHTA 3D8EA 1V89A 2ADZA 4ANUA 3MHSD 2CKHB 4M8NA 2HD5B 2D9YA 1GGOA 3RUIB 1SHCA 2MP2A 3PREA 4FA6A 2L2IA 2CY5A 4HWIB 1TZ1A 4JQWC 2J7QB 4HXDA 2G35A 4EOYA 2Y7BA 3H7PA 2BKFA 1WM3A 1GUAB 4WQOB 2K2JA 2KVRA 2D10A 2MWSB 1QC6A 3N3KB 3TMPB 2CY4A 3H1UA 1DIKA 4F8CB 2BYEA 1WMHB 1XODA 4A6HA 3CSFA 3PVWA 2ROVA 2ABDA 1PQSA 2LBBA 3A9KA 2K6DB 2ZCBA 3ZDMC 4ILJA 3CIKA 2J0MA 3B0AA 3D8FA 2HJ8A 3R3MA 2HE7A 2M17A 3V6EB 1FAOA 3H7SA 4HCNB 2CODA 1GC6A 4P7IA 1MPHA 2COCA 2GCJA 5CHVC 3WAPA 3PP2A 4HLEA 3UQBA 2D9WA 2BYFA 1Y5OA 1PLSA 1OQNA 5C79A 2L8JA 2N9XA 4GDLA 4XZ4A 4LDTD 2K2UA 3WALA 2RPQA 2P0DA 3AI5A 1WVHA 3SDLC 4IWOA 1CMXB 4AOFA 4W9DA 2K8HA 2FJLA 2DYNA 1S1QB 2DZMA 3DXCA 4HAYB 5JHAA 4HAVB 4J6IA 2N23A 2L00B 3JSVA 2DLWA 4MGZE 4HJKA 2LYDA 5G55A 1IP9A 2JUOA 3FLVA 1WIAA 1M94A 2DYMA 4B95A 2WX1A 3TW1A 2KXJA 5LXIB 4ZRIA 2KJ6A 2DAFA 4DHZE 1N3HA 1Y8RC 4MGYE 2LGXA 1DBHA 2FDQA 2ZZPB 2JP2A 1TQZA 1ZKHA 3TCAA 3WYFB 3I3TB 4BBNF 2K00A 1NBFC 1KBLA 2NBVB 3KYDD 4II2B 5DPRA 3NZUA 3GYPA 4PYZA 2MBHA 2KTRA 4WWNA 1X1FA 1UH6A 3S2AA 2MSED 1L7YA 1LM8B 2PE9A 5J17A 1WG7A 1H8CA 1XX0A 2IO3B 1RLFA 3UGBB 4MT7A 5GMVA 2ZCCA 4YL8A 5LONB 2RUKB 2COPA 3ML9A 4KHBB 3HQCA 2KJHB 3OJ3A 3HW2B 3T8MA 1DDMA 2QKLA 2UZSA 2KUPA 1W1GA 4MGIE 1K5GB 4IAPA 4PYUA 3WA0A 4WSFA 4W9IA 4KZCA 1EF5A 2MA9B 1TBEA 2JY6A 2ELBA 1WJMA 4M8MA 4WJNA 3VTWA 4N9F4 3PLUA 3W1SC 3T06A 3PRZA 4M0WB 1FGZA 4ZRKA 3A1QB 3EC8A 4ILHA 1DDWA 1HB6A 2C60A 2DN6A 2KTFA 3U8ZA 4W9LA 3ZLZA 1EUVB 1JDEA 3GOEA 3P7ZA 3VDZA 3L54A 3ZVRA 2KDBA 2NS5A 3JSVB 4ASWC 4DDID 4F7HA 3HM3A 4RM9A 4IWPA 1WGUA 2OJRA 3JYUA 2YF0A 4B6HA 1OEYA 2XQNM 3HM6X 4PNKA 2JVCA 2RLOA 3QIJA 3ZDTA 1MG8A 4WJQA 4G0NB 4BOZB 4A6FA 2JPHA 1VD2A 1WJ4A 2KHWB 4DHJD 2D9XA 1R4NI 2YRYA 1NTIA 3TIXA 4GDKB 2BCJA 3TBLD 3ZTDA 2YS3A 4WWPA 1UD7A 2IYDB 1FXTB 1W1HA 1E8XA 3SO6A 1P9DU 1X1MA 5DIFB 2KZRA 1SGHA 2K39A 4DX8A 5HE2A 3ZNGC 5FI0A 3EHVA 2KTRB 2KX0A 2KQSA 1S3SG 3VFKA 2FNJB 4AWJA 4F7ZA 3NOBA 3ZVVA 4YONA 3PRPB 4IWQA 2MWNB 2JT4B 2H7EA 3WAMA 4MELA 2K8BA 2W2WA 3MDBC 3VUYA 4HAXB 4MM3A 1P0RA 3O65B 4WVFB 2LASA 1V5OA 4JLCA 3M63B 1XKEA 1IPGA 2QHOA 1Q0WB 4FHJA 1WXMA 1OQYA 4FADA 1WGDA 1WMHA 2W9NA 3DBRI 1OY2A 2C7HA 4KVGB 3SD5A 4GOCA 3PG7A 2FCMA 4HPLB 5G2NA 2REXA 3BY4B 4TKNA 2JWZA 1TJ6A 3PV1A 2DFKA 5L83A 4KSKC 2IY0B 3VTVA 2NR2A 1BT0A 2ZEQA 3NHEB 1R4MI 1W1DA 2MBBB 4PS7A 2A5UA 3DDCB 1LFDA 4K7WA 4NAWB 2RD0A 3MTNB 3A8QA 2GCLA 1Q5WB 1EVHA 2D3GA 3SNHA 3ENEA 2KGXB 5JHHA 4PS8A 4JKBA 1HBKA 4BKGA 1MKEA 1YQBA 1HB8A 2NMBA 2NZ8B 5KHQA 3KRXA 4CO7A 1NVLA 4RM8A 3GZNI 5DPSA 1P3RA 4MY6A 4GB9A 1ZSQA 5AEKB 2LJ5A 5JHGA 4OVVA 5LOPB 1BWNA 4DK5A 2DZIA 3PVLA 1E8ZA 2D9VA 4ANXA 3R66C 4BVUC 5IJMA 2NBWB 5KCVA 1WJ6A 3RZWC 3VHTC 1U29A 3PHWB 4C0AA 1WX8A 1K8RB 2DZJA 3PLVA 4HATB 2RSUA 4IM0A 2EMSA 3Q3FA 2YVCA 4Z2NA 4BBKA 3ENBA 5DHFB 4I6LB 2GBJA 1WGGA 3V6CB 2E2XA 3OLMD 4EFOA 1B55A 3E9PA 1D3ZA 4MJSB 3LJ3A 3PSEB 4IC7B 4Y94A 4WJ7A 2KX3A 2V4LA 3W1SA 2N0YA 2G45B 5JLJB 4GSWA 4KSLC 2ZJDA 2J59M 1P98A 1AARA 3MJWA 2O2VB 2FAZA 1V49A 5C23A 1UBQA 4BOSC 3KRWA 5D6JB 2V1YA 4FJVB 3CMMB 1UGMA 5DH9B 2MQJA 3V61A 1FHWA 4JGHB 3QA8A 1P5TA 1X11A 2K25A 2DHZA 3B1LX 2KFKB 2DYOA 3OJ4B 3ZTCA 2DHIA 4ANVA 2NPTB 1EO6A 1TTNA 4NY0A 1I2HA 3L10B 5DPWA 4GGQA 5CHFA 1WZ3A 2Y5BB 2L76A 1V9JA 4CHMA 1WRDB 2IFSA 4CHKA 3ODXA 3UZTA 2VRWB 4MDKE 3EFUA 3SU8X 1Z2MA 1NTYA 4II3B 3QAQA 3DCGA 4DBBA 1WR6E 4CYEA 2FIDA 4E3CA 3A1QA 2NBUA 2WYQA 3X0WA 1WH3A 2N4FA 3WIMA 1YJ1A 2CR5A 3A4RA 4MSMB 2Z0PA 2UYZB 1KOTA 4L6EA 4NPNA 4G11A 3U30A 2AL3A 1V81A 1P3QU 2MLBA 4JKEA 1OMWA 2GS0A 2K6QA 3TFMA 5D3VA 5DI9B 2KFJA 1YIWA 1UELA 2DX1A 1ZM0A 2GBMA 4JKGB 2G3QB 4TYZA 4KAXB 2MW5A 3VH4B 5CLQB 4MH0E 4XWXA 2MX2A 1P1AA 4KZ0A 2MCNB 1H10A 3QC8B 5CLLB 3Q3JA 2PZ1A 1M7RA 1X1GA 2N7DA 1UBIA 4GDKA 4HK2A 3QK0A 1E8WA 3FEHA 4FJZA 3DVGY 2IBIB 1TGZB 2BKRB 2KDEB 2WWZA 3NSUA 2NVUI 1UPQA 2FJ9A 4MSQB 1V5UA 3NS8A 4IM3A 4HHVA 4TV3A 1KJTA 3L17A 1UPRA 1IRSA 3N7CA 1YD8U 4ANWA 2DHJA 2MKRA 2KANA 2CS4A 4BFRA 1ZVRA 2LXAA 3PZDA 3FSSA 4BBNC 2KWVB 5D3XA 3SBGA 2LVPA 1FB8A 3IBEA 1E7UA 2BWFA 5DPTA 1VBGA 5D94A 4DX90 2KLCA 3SBTA 1I35A 1WJUA 2UWQA 1WJNA 3TVVA 3ALBA 2M0XA 2J0KA 2OQBA 3QQ8B 4HVBA 1YX6B 4B6WA 2JZ3B 4X57B 3RT3B 1UEFA 5GOWB 1X86A 5BO4B 5D3WA 3ZRCA 1WI0A 2YLMA 4B9KA 1I42A 1Q67A 3KZ1A 1EGXA 2KKCA 4WJPA 4NAWA 2L3ZA 4NJ6A 3ZRFA 5J18A 2N9EB 4HDQA 3AU4A 4DHZB 3NY5A 4HAUB 4K2OA 4A5KA 3VOQA 1LXDA 1WR1A 5JH5C 4TUUA 4IOYX 5KQ4A 5D2MB 4JKDA 1LW3A 1WJ1A 4F1SA 4F7UP 3VUWA 4ICUA 4GU2A 2LWPA 3M95A 2LVOA 1J8CA 2Y8FA 1UNRA 2KDIA 3RD2A 4EEWA 2LZ6A 3V60A 1KC7A 3PHXB 1MAIA 4FLHA 2YS1A 3OANA 1MK9B 3UQAA 4G50A 2MBOA 3D32A 3M62B 1BTKA 3KVFB 1P6SA 3RCZA 4RMAA 2KOXA 1U5FA 2COAA 5C5BB 3QARA 1RJ2A 4IG7B 2VRRB 3A8PA 1ZC3B 2CU1A 3KSYA 4GIVA 4PS3A 4XX5A 5D3YA 5HE1A 1DDVA 1H4RA 2KDFB 4ZRJA 4KIKB 1T0YA 4HAZB 5FI1A 4HDOA 2YT1A 3IG3A 2RQ1A 2LOZA 1E90A 2D11A 4MJSA 5AZHA 2LUEA 4W9GA 3F5RA 3H9DA 1AQCA 2J0JA 3ULBA 3ZNZB 1M7EA 5E6OA 2COFA 2DZKA 1NI2A 1QQGA 5J2RA 3KH0A 3TO1A 3ZNHB 5L81A 1RRBA 2O2VA 3DVGX 5KQ1A 2EJ8A 1WGRA 5E6PA 2PE6B 3ZKJC 1ZGUB 2CHXA 3E9OA 2I1KA 2MFQA 4NSWA 3PSCA 2DAJA 3QWZB 2OTXA 4G3XB 5JHBA 3O96A 1UNPA 1EAZA 3QJZA 1GC7A 2D4QA 2XK5B 2A4ZA 2L05A 1WF9A 4CHJA 2KFKA 1E5WA 3TL5A 1WI1A 2UVMA 4E71A 4GXBA 2NPTA 4KHAA 2DYBA 2GOWA 1FHXA 4EZLA 3ECIA 3R7RA 2B3AA 1EF1A 3MPXA 2W2XC 4JIOU 4MGKE 2KK8A 4JK9A 5DHAB 4FHKA 2HTHB 3VAWA 3ML8A 3EPYA 5AZGA 4FJYA 2QKMA 1FOEA 2I5FA 2EKEC 2KN5A 2LKOA 1MIXA 2AYOB 1UZXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT0 A;  2H7D A;  2RNR B;  2R2O A;  3DVN U;  1ZW7 A;  2FCS A;  1VCB A;  4A6K A;  1OTR B;  1J19 A;  3T9L A;  3V62 A;  3L13 A;  1TXD A;  2X18 A;  2DKP A;  2L0T A;  3P2B A;  1KZ7 A;  5D27 A;  1LB1 A;  2KNB A;  4NQL B;  2WX0 A;  4W9C A;  1SE9 A;  2HRJ A;  3QX1 A;  2PJH A;  3RYT A;  3ZW3 A;  2MBE A;  4W9E A;  2ZVN A;  3VUX A;  4K7S A;  1RFA A;  4URK A;  2XEW A;  4KV2 A;  4NNJ B;  2W2X D;  1MK7 B;  4AJY B;  4OVU A;  2EC1 A;  3RZF A;  3HK0 A;  3AUL A;  3VTU A;  1RRP B;  3KW5 B;  1Z5S B;  2JXX A;  4XC2 A;  3NZS A;  5J3Y A;  1V5T A;  2C5L C;  2IO2 B;  4HAW B;  3W1Y A;  2RGF A;  4IW0 A;  3DPD A;  3APC A;  3KUC B;  4H8S A;  3DVN V;  3AU5 A;  1GJZ A;  4MEM A;  5HE3 A;  3SYX A;  2L0F A;  5KHO A;  1WE7 A;  1KM7 A;  5C16 A;  1A5R A;  2O6V B;  2WDT B;  3UF8 A;  1E8Y A;  3CXB B;  2M4N A;  2KWC A;  2P8V A;  3WAN A;  3A9J B;  4EZJ A;  1XQQ A;  2DTC A;  2KMC A;  4EKU A;  2LOX A;  1GG3 A;  4K7U A;  2BGF A;  5J3Q A;  2KLG A;  2Z0O A;  2Q13 A;  2KJR A;  1WGQ A;  2LGD A;  3PPA A;  1AWE A;  3BJI A;  1IYF A;  3L16 A;  1K5D B;  3SV1 A;  3F0W A;  2KMA A;  5E6N A;  1J0G A;  3ODW A;  1V80 A;  1QZE A;  2R09 A;  4GN1 A;  2N1W A;  2C9W B;  3CF6 E;  2BYV E;  2LXC A;  1Y19 B;  5CHW A;  4HB0 B;  4WWO A;  2CQU A;  2N7E A;  3DQV A;  4LJP B;  4KDI C;  4BKS D;  3LDZ E;  3PRM B;  5C1Z A;  3SUZ A;  2RGN B;  1MIZ B;  2M14 A;  4HB3 B;  1WXV A;  1E7V A;  2Y8G A;  5JZE B;  4GMV A;  2MRP A;  3LJU X;  1RAX A;  1Z87 A;  3ZNI D;  3X23 A;  5EDS A;  2AEH A;  2YSZ A;  2LD9 A;  1U2B A;  3AJ4 A;  1ZC4 B;  3B08 A;  5CTR C;  5EFX A;  4D0N B;  1WY8 A;  2BF8 B;  2BPS A;  2RSG A;  3APF A;  5AZF A;  4ZYN A;  4FN2 A;  3DBL I;  2DHK A;  2AWT A;  3IHP C;  3KUZ A;  1KI1 B;  2LGY A;  5JP4 A;  5C5B A;  2KCJ A;  2KC2 A;  2DYQ A;  2DX5 B;  4I6P A;  4DHJ B;  4DWF A;  2DKQ A;  2GJY A;  4FBJ B;  1BAK A;  4K81 A;  4A3O A;  3APD A;  1V61 A;  1U5D A;  1ISN A;  2BWE S;  5HKH A;  1ACA A;  4KIK A;  2M38 A;  1ST7 A;  1OEY J;  2GBN A;  3JW0 X;  3DBH I;  2PPH A;  2D07 B;  2MP2 B;  4A3P A;  2ELA A;  1U5G A;  4HB2 B;  1WX7 A;  3PS6 A;  4EUT A;  2ZNV B;  3PGE A;  2XBB C;  2LVQ A;  2IYB A;  2JRH A;  4WAA A;  3FM8 C;  3L0W B;  3H7P B;  1NU2 A;  3EEC A;  2IY1 B;  1FHO A;  1XCG A;  2MBQ A;  1LQB A;  2IO0 B;  4PQ0 A;  3AXC A;  1U4A A;  2IZV B;  2Z0Q A;  3IVF A;  3UIP B;  1C1Y B;  2NCN A;  1WXS A;  5FR6 A;  3A33 B;  1KLV A;  1DRO A;  1YX5 B;  4MK0 A;  3ONS A;  1J0W A;  5L95 C;  2LRU A;  2FCN A;  3A9K B;  4HPM B;  2XK5 A;  2O6V D;  3C0R B;  1PFJ A;  5IA7 A;  3CST A;  4GZU A;  2C7N B;  3ULC A;  1WXA A;  2VKI A;  3R7Q A;  2MDX A;  4EZK A;  3FP5 A;  2KQ7 A;  2RR9 A;  1V88 A;  3DOW A;  2K8C A;  3A98 B;  3VH3 B;  1KZG A;  3QBV B;  5DCN A;  2HTH A;  3G9W A;  1HE8 A;  3U7D A;  2R0D A;  1WZ0 A;  3DBS A;  1X05 A;  2N9P C;  4IM2 A;  2ZNV C;  3A4S C;  1DYN A;  3M1I B;  4GDL B;  2ZPY A;  1WYW B;  4EJN A;  3K9P B;  4BKS A;  1WM2 A;  1UNQ A;  2PEA A;  4TQ0 A;  4WJO A;  4I6N B;  1WFY A;  4W9F A;  3VIA A;  3PEG A;  1WGH A;  3IFW B;  4AUQ C;  2L7R A;  1NDD A;  5HE0 A;  4NJ7 A;  4EMO A;  2Z59 B;  4LJO B;  3TJP A;  2ASQ A;  1WGY A;  2JF5 A;  2Z0D B;  1SIF A;  3VQI A;  3WAO A;  5D7G A;  3D8D A;  2KD0 A;  4NQK E;  1XD3 B;  5LXH A;  3VVW B;  2CHW A;  4IUM B;  4JL9 A;  2OOB B;  1I7A A;  2ZVO A;  3ODO A;  3ZUN A;  2KC1 A;  2I5C A;  2P0F A;  1WE6 A;  3UIN B;  2P0H A;  1U27 A;  2GMI C;  1GNU A;  2G4D B;  3ML4 A;  2C7M B;  3PT2 B;  4KDL B;  3N32 A;  1G6J A;  1L2N A;  2I1J A;  1F9J A;  2DEN B;  4IFS A;  1C3T A;  2KO3 A;  2FIF A;  2CHZ A;  2JZZ A;  4TQ1 A;  1NTV A;  4HCP B;  4E74 A;  2DA0 A;  2K1F A;  2V76 A;  4GPT B;  1WX9 A;  3P6A A;  3N30 A;  3OAW A;  1V6E A;  5C6R A;  4W9H A;  4ZDV A;  2M8S A;  3JVZ X;  3UIO B;  4GMX B;  4HB4 B;  4F7G A;  3DXD A;  3QCA A;  2D9Z A;  1BTN A;  2O6V A;  2LI5 A;  2CB8 A;  3PTF C;  3RCP A;  3A9J A;  3M3J A;  2LRW A;  2FCQ A;  4ICV A;  1V2Y A;  2V3S A;  3KUD B;  2UZR A;  5J3T A;  4LCD E;  2WH5 A;  1XR0 B;  3KYC D;  2EMT A;  2AL6 A;  1V5P A;  3ZIM A;  2D2Q A;  4K17 A;  3HIZ A;  2L1C A;  1V86 A;  3RUL A;  4DBG A;  3KY9 A;  3PVU A;  4LDT B;  2Z0E B;  1PMS A;  2GBK A;  2GBR A;  3SHQ A;  3QWM A;  2JRI B;  3H6N A;  1OGW A;  1JRU A;  5IAA C;  2IO1 B;  5LLI A;  4AJW A;  2LG1 A;  4K1R B;  5TR5 A;  4K2P A;  3HHM A;  4W9K A;  3VXW A;  4KHO A;  3ZO5 B;  1Q1O A;  2G4S A;  2CRF A;  3L08 A;  2KWU B;  4DXA B;  4AP4 C;  1V5M A;  2VSZ A;  3V5W A;  4A20 A;  1FGY A;  1U5E A;  2N1V A;  4BKT A;  2CAY A;  2FUH B;  2ROZ B;  4Z2M B;  2LUL A;  1XT9 B;  5CX3 A;  4FUL A;  2M1M A;  2R2Q A;  4A6F B;  3DXE A;  4DDG D;  4W9J A;  3K9O B;  3GYO A;  1XD4 A;  2YS5 A;  3BIN A;  2RVB B;  2DX5 A;  2ZPN A;  3QHT A;  3D8E A;  1V89 A;  2ADZ A;  4ANU A;  3MHS D;  2CKH B;  4M8N A;  2HD5 B;  2D9Y A;  3RUI B;  1SHC A;  2MP2 A;  3PRE A;  4FA6 A;  2L2I A;  2CY5 A;  4HWI B;  1TZ1 A;  4JQW C;  2J7Q B;  4HXD A;  2G35 A;  4EOY A;  2Y7B A;  3H7P A;  2BKF A;  1WM3 A;  1GUA B;  4WQO B;  2K2J A;  2KVR A;  2D10 A;  2MWS B;  1QC6 A;  3N3K B;  3TMP B;  2CY4 A;  3H1U A;  4F8C B;  2BYE A;  1WMH B;  1XOD A;  4A6H A;  3CSF A;  3PVW A;  2ROV A;  2ABD A;  1PQS A;  2LBB A;  3A9K A;  2K6D B;  2ZCB A;  3ZDM C;  3CIK A;  2J0M A;  3B0A A;  3D8F A;  2HJ8 A;  3R3M A;  2HE7 A;  2M17 A;  3V6E B;  1FAO A;  3H7S A;  4HCN B;  2COD A;  1GC6 A;  4P7I A;  1MPH A;  2COC A;  2GCJ A;  5CHV C;  3WAP A;  3PP2 A;  4HLE A;  3UQB A;  2D9W A;  2BYF A;  1Y5O A;  1PLS A;  1OQN A;  5C79 A;  2L8J A;  2N9X A;  4GDL A;  4XZ4 A;  4LDT D;  2K2U A;  3WAL A;  2RPQ A;  2P0D A;  3AI5 A;  1WVH A;  3SDL C;  4IWO A;  1CMX B;  4AOF A;  4W9D A;  2K8H A;  2FJL A;  2DYN A;  1S1Q B;  2DZM A;  3DXC A;  4HAY B;  5JHA A;  4HAV B;  4J6I A;  2N23 A;  2L00 B;  3JSV A;  2DLW A;  4MGZ E;  4HJK A;  2LYD A;  5G55 A;  1IP9 A;  2JUO A;  3FLV A;  1WIA A;  1M94 A;  2DYM A;  4B95 A;  2WX1 A;  3TW1 A;  2KXJ A;  5LXI B;  4ZRI A;  2KJ6 A;  2DAF A;  4DHZ E;  1N3H A;  1Y8R C;  4MGY E;  2LGX A;  1DBH A;  2FDQ A;  2ZZP B;  2JP2 A;  1TQZ A;  1ZKH A;  3TCA A;  3WYF B;  3I3T B;  4BBN F;  2K00 A;  1NBF C;  2NBV B;  3KYD D;  4II2 B;  5DPR A;  3NZU A;  3GYP A;  4PYZ A;  2MBH A;  2KTR A;  4WWN A;  1X1F A;  1UH6 A;  3S2A A;  2MSE D;  1L7Y A;  1LM8 B;  2PE9 A;  5J17 A;  1WG7 A;  1H8C A;  1XX0 A;  2IO3 B;  1RLF A;  3UGB B;  4MT7 A;  5GMV A;  2ZCC A;  4YL8 A;  5LON B;  2RUK B;  2COP A;  3ML9 A;  4KHB B;  3HQC A;  2KJH B;  3OJ3 A;  3HW2 B;  3T8M A;  1DDM A;  2QKL A;  2UZS A;  2KUP A;  1W1G A;  4MGI E;  1K5G B;  4IAP A;  4PYU A;  3WA0 A;  4WSF A;  4W9I A;  4KZC A;  1EF5 A;  2MA9 B;  1TBE A;  2JY6 A;  2ELB A;  1WJM A;  4M8M A;  4WJN A;  3VTW A;  4N9F 4;  3PLU A;  3W1S C;  3T06 A;  3PRZ A;  4M0W B;  1FGZ A;  4ZRK A;  3A1Q B;  3EC8 A;  1DDW A;  1HB6 A;  2C60 A;  2DN6 A;  2KTF A;  3U8Z A;  4W9L A;  3ZLZ A;  1EUV B;  3GOE A;  3P7Z A;  3VDZ A;  3L54 A;  3ZVR A;  2KDB A;  2NS5 A;  3JSV B;  4ASW C;  4DDI D;  4F7H A;  3HM3 A;  4RM9 A;  4IWP A;  1WGU A;  2OJR A;  3JYU A;  2YF0 A;  4B6H A;  1OEY A;  2XQN M;  3HM6 X;  4PNK A;  2JVC A;  2RLO A;  3QIJ A;  3ZDT A;  1MG8 A;  4WJQ A;  4G0N B;  4BOZ B;  4A6F A;  2JPH A;  1VD2 A;  1WJ4 A;  2KHW B;  4DHJ D;  2D9X A;  1R4N I;  2YRY A;  1NTI A;  3TIX A;  4GDK B;  2BCJ A;  3TBL D;  3ZTD A;  2YS3 A;  4WWP A;  1UD7 A;  2IYD B;  1FXT B;  1W1H A;  1E8X A;  3SO6 A;  1P9D U;  1X1M A;  5DIF B;  2KZR A;  1SGH A;  2K39 A;  4DX8 A;  5HE2 A;  3ZNG C;  5FI0 A;  3EHV A;  2KTR B;  2KX0 A;  2KQS A;  1S3S G;  3VFK A;  2FNJ B;  4AWJ A;  4F7Z A;  3NOB A;  3ZVV A;  4YON A;  3PRP B;  4IWQ A;  2MWN B;  2JT4 B;  2H7E A;  3WAM A;  4MEL A;  2K8B A;  2W2W A;  3MDB C;  3VUY A;  4HAX B;  4MM3 A;  1P0R A;  3O65 B;  4WVF B;  2LAS A;  1V5O A;  4JLC A;  3M63 B;  1XKE A;  1IPG A;  2QHO A;  1Q0W B;  4FHJ A;  1WXM A;  1OQY A;  4FAD A;  1WGD A;  1WMH A;  2W9N A;  3DBR I;  1OY2 A;  2C7H A;  4KVG B;  3SD5 A;  4GOC A;  3PG7 A;  2FCM A;  4HPL B;  5G2N A;  2REX A;  3BY4 B;  4TKN A;  2JWZ A;  1TJ6 A;  3PV1 A;  2DFK A;  5L83 A;  4KSK C;  2IY0 B;  3VTV A;  2NR2 A;  1BT0 A;  2ZEQ A;  3NHE B;  1R4M I;  1W1D A;  2MBB B;  4PS7 A;  2A5U A;  3DDC B;  1LFD A;  4K7W A;  4NAW B;  2RD0 A;  3MTN B;  3A8Q A;  2GCL A;  1Q5W B;  1EVH A;  2D3G A;  3SNH A;  3ENE A;  2KGX B;  5JHH A;  4PS8 A;  1HBK A;  4BKG A;  1MKE A;  1YQB A;  1HB8 A;  2NMB A;  2NZ8 B;  5KHQ A;  3KRX A;  4CO7 A;  1NVL A;  4RM8 A;  3GZN I;  5DPS A;  1P3R A;  4MY6 A;  4GB9 A;  1ZSQ A;  5AEK B;  2LJ5 A;  5JHG A;  4OVV A;  5LOP B;  1BWN A;  4DK5 A;  2DZI A;  3PVL A;  1E8Z A;  2D9V A;  4ANX A;  3R66 C;  4BVU C;  5IJM A;  2NBW B;  5KCV A;  1WJ6 A;  3RZW C;  3VHT C;  1U29 A;  3PHW B;  4C0A A;  1WX8 A;  1K8R B;  2DZJ A;  3PLV A;  4HAT B;  2RSU A;  4IM0 A;  2EMS A;  3Q3F A;  2YVC A;  4Z2N A;  4BBK A;  5DHF B;  4I6L B;  2GBJ A;  1WGG A;  3V6C B;  2E2X A;  3OLM D;  4EFO A;  1B55 A;  1D3Z A;  4MJS B;  3LJ3 A;  3PSE B;  4IC7 B;  4Y94 A;  4WJ7 A;  2KX3 A;  3W1S A;  2V4L A;  2N0Y A;  2G45 B;  5JLJ B;  4GSW A;  4KSL C;  2ZJD A;  2J59 M;  1P98 A;  1AAR A;  3MJW A;  2O2V B;  2FAZ A;  1V49 A;  5C23 A;  1UBQ A;  4BOS C;  3KRW A;  5D6J B;  2V1Y A;  4FJV B;  3CMM B;  1UGM A;  5DH9 B;  2MQJ A;  3V61 A;  1FHW A;  4JGH B;  3QA8 A;  1P5T A;  1X11 A;  2K25 A;  2DHZ A;  3B1L X;  2KFK B;  2DYO A;  3OJ4 B;  3ZTC A;  2DHI A;  4ANV A;  2NPT B;  1EO6 A;  1TTN A;  4NY0 A;  1I2H A;  3L10 B;  5DPW A;  4GGQ A;  5CHF A;  1WZ3 A;  2Y5B B;  2L76 A;  1V9J A;  4CHM A;  1WRD B;  2IFS A;  4CHK A;  3ODX A;  3UZT A;  2VRW B;  4MDK E;  3EFU A;  3SU8 X;  1Z2M A;  1NTY A;  4II3 B;  3QAQ A;  3DCG A;  4DBB A;  1WR6 E;  4CYE A;  2FID A;  4E3C A;  3A1Q A;  2NBU A;  2WYQ A;  3X0W A;  1WH3 A;  2N4F A;  3WIM A;  1YJ1 A;  2CR5 A;  3A4R A;  4MSM B;  2Z0P A;  2UYZ B;  1KOT A;  4L6E A;  4NPN A;  4G11 A;  3U30 A;  2AL3 A;  1V81 A;  1P3Q U;  2MLB A;  1OMW A;  2GS0 A;  2K6Q A;  3TFM A;  5D3V A;  5DI9 B;  2KFJ A;  1YIW A;  1UEL A;  2DX1 A;  1ZM0 A;  2GBM A;  2G3Q B;  4TYZ A;  4KAX B;  2MW5 A;  3VH4 B;  5CLQ B;  4MH0 E;  4XWX A;  2MX2 A;  1P1A A;  4KZ0 A;  2MCN B;  1H10 A;  3QC8 B;  5CLL B;  3Q3J A;  2PZ1 A;  1M7R A;  1X1G A;  2N7D A;  1UBI A;  4GDK A;  4HK2 A;  3QK0 A;  1E8W A;  3FEH A;  4FJZ A;  3DVG Y;  2IBI B;  1TGZ B;  2BKR B;  2KDE B;  2WWZ A;  3NSU A;  2NVU I;  1UPQ A;  2FJ9 A;  4MSQ B;  1V5U A;  3NS8 A;  4IM3 A;  4HHV A;  4TV3 A;  1KJT A;  3L17 A;  1UPR A;  1IRS A;  3N7C A;  1YD8 U;  4ANW A;  2DHJ A;  2MKR A;  2KAN A;  2CS4 A;  4BFR A;  1ZVR A;  2LXA A;  3PZD A;  3FSS A;  4BBN C;  2KWV B;  5D3X A;  2LVP A;  1FB8 A;  3IBE A;  1E7U A;  2BWF A;  5DPT A;  5D94 A;  4DX9 0;  2KLC A;  1I35 A;  1WJU A;  2UWQ A;  1WJN A;  3TVV A;  3ALB A;  2M0X A;  2J0K A;  2OQB A;  3QQ8 B;  4HVB A;  1YX6 B;  4B6W A;  2JZ3 B;  4X57 B;  3RT3 B;  1UEF A;  5GOW B;  1X86 A;  5BO4 B;  5D3W A;  3ZRC A;  1WI0 A;  2YLM A;  4B9K A;  1I42 A;  1Q67 A;  3KZ1 A;  1EGX A;  2KKC A;  4WJP A;  4NAW A;  2L3Z A;  4NJ6 A;  3ZRF A;  5J18 A;  2N9E B;  4HDQ A;  3AU4 A;  4DHZ B;  3NY5 A;  4HAU B;  4K2O A;  4A5K A;  3VOQ A;  1LXD A;  1WR1 A;  5JH5 C;  4TUU A;  4IOY X;  5KQ4 A;  5D2M B;  1LW3 A;  1WJ1 A;  4F1S A;  4F7U P;  3VUW A;  4ICU A;  4GU2 A;  2LWP A;  3M95 A;  2LVO A;  1J8C A;  2Y8F A;  1UNR A;  2KDI A;  3RD2 A;  4EEW A;  2LZ6 A;  3V60 A;  3PHX B;  1MAI A;  4FLH A;  2YS1 A;  3OAN A;  1MK9 B;  3UQA A;  4G50 A;  2MBO A;  3D32 A;  3M62 B;  1BTK A;  3KVF B;  1P6S A;  3RCZ A;  4RMA A;  2KOX A;  1U5F A;  2COA A;  5C5B B;  3QAR A;  1RJ2 A;  4IG7 B;  2VRR B;  3A8P A;  1ZC3 B;  2CU1 A;  3KSY A;  4GIV A;  4PS3 A;  4XX5 A;  5D3Y A;  5HE1 A;  1DDV A;  1H4R A;  2KDF B;  4ZRJ A;  4KIK B;  1T0Y A;  4HAZ B;  5FI1 A;  4HDO A;  2YT1 A;  3IG3 A;  2RQ1 A;  2LOZ A;  1E90 A;  2D11 A;  4MJS A;  5AZH A;  2LUE A;  4W9G A;  3F5R A;  3H9D A;  1AQC A;  2J0J A;  3ULB A;  3ZNZ B;  1M7E A;  5E6O A;  2COF A;  2DZK A;  1NI2 A;  1QQG A;  5J2R A;  3KH0 A;  3TO1 A;  3ZNH B;  5L81 A;  1RRB A;  2O2V A;  3DVG X;  5KQ1 A;  2EJ8 A;  1WGR A;  5E6P A;  2PE6 B;  3ZKJ C;  1ZGU B;  2CHX A;  2I1K A;  2MFQ A;  4NSW A;  3PSC A;  2DAJ A;  3QWZ B;  2OTX A;  4G3X B;  5JHB A;  3O96 A;  1UNP A;  1EAZ A;  3QJZ A;  1GC7 A;  2D4Q A;  2XK5 B;  2A4Z A;  2L05 A;  1WF9 A;  4CHJ A;  2KFK A;  1E5W A;  3TL5 A;  1WI1 A;  2UVM A;  4E71 A;  4GXB A;  2NPT A;  4KHA A;  2DYB A;  2GOW A;  1FHX A;  4EZL A;  3ECI A;  3R7R A;  2B3A A;  1EF1 A;  3MPX A;  2W2X C;  4JIO U;  4MGK E;  2KK8 A;  5DHA B;  4FHK A;  2HTH B;  3VAW A;  3ML8 A;  3EPY A;  5AZG A;  4FJY A;  2QKM A;  1FOE A;  2I5F A;  2EKE C;  2KN5 A;  2LKO A;  1MIX A;  2AYO B;  1UZX B; 
#chains in the Genus database with same CATH topology
 2YT0 A;  2H7D A;  2RNR B;  2R2O A;  1HTO A;  2WNM A;  5H92 C;  3DVN U;  1ZW7 A;  1NYQ A;  1GPX A;  2FCS A;  2RDG A;  1VCB A;  1VR9 A;  4A6K A;  1OTR B;  5JVL A;  4QJ3 B;  2QSD A;  1D6E C;  5D3I B;  3N1Z C;  1J19 A;  3Q8B A;  3V3X A;  3T9L A;  3KQ4 A;  3V62 A;  3L13 A;  4WWM A;  1P7F A;  1TXD A;  2X18 A;  2DKP A;  4JKG A;  1R7S A;  1GB1 A;  1QF6 A;  2L0T A;  3P2B A;  1KZ7 A;  5D27 A;  1LB1 A;  1KRH A;  2KNB A;  1SE4 A;  4NQL B;  1VZ6 A;  1IGC A;  2WX0 A;  2X0S A;  4W9C A;  1SE9 A;  2HRJ A;  2EEL A;  1K53 A;  3QX1 A;  3RFZ B;  2PJH A;  3RYT A;  3ZW3 A;  2MBE A;  3Q3M C;  4W9E A;  3RNE C;  4A8X C;  4EE2 A;  2K8E A;  2ZVN A;  4JWS C;  1PYW D;  2GB1 A;  3VUX A;  4K7S A;  3AEF B;  2AQ2 B;  3RNG C;  3E9L A;  2WXM A;  1RFA A;  4URK A;  2XEW A;  4KV2 A;  4NNJ B;  1L0Y B;  1D4B A;  2W2X D;  1MK7 B;  1SEB D;  4AJY B;  4OVU A;  2EC1 A;  1SF0 A;  2DIK A;  3RZF A;  3HK0 A;  3AUL A;  3VTU A;  3AB5 A;  1RRP B;  3KW5 B;  1Z5S B;  1JWA D;  2JXX A;  4XC2 A;  3NZS A;  5J3Y A;  1V5T A;  1PUT A;  2C5L C;  2IO2 B;  2XN9 C;  2WDV B;  4HAW B;  3W1Y A;  4MH8 A;  2RGF A;  4IW0 A;  3DPD A;  3Q14 C;  3APC A;  4ILG B;  3IAS 1;  5IRS A;  3KUC B;  1I4G A;  4H8S A;  3DVN V;  3AU5 A;  3LYY A;  2M0A A;  2BYT A;  1GJZ A;  4MEM A;  5HE3 A;  3IAM 1;  1VLB A;  3SYX A;  1MG4 A;  2L0F A;  5KHO A;  1UUP A;  1WE7 A;  1KM7 A;  4P1C C;  5C16 A;  1OQR A;  1A5R A;  2O6V B;  2WDT B;  1HXY D;  1C4P A;  3UF8 A;  2IJ0 A;  1E8Y A;  3CXB B;  1L6V A;  2JXT A;  2M4N A;  2KWC A;  2INP E;  2P8V A;  1UGJ A;  3DBL B;  3WAN A;  3A9J B;  4EZJ A;  2INC C;  3ZJT A;  1XQQ A;  4L1B A;  2DTC A;  2KMC A;  2BS4 B;  2PMV A;  4EKU A;  2LOX A;  1GG3 A;  4K7U A;  2BGF A;  1QKZ A;  2J53 A;  5J3Q A;  2KLG A;  3HSA A;  2Z0O A;  2Q13 A;  3TUO A;  2KJR A;  1MVK A;  4C80 A;  2QC8 A;  1IUE A;  1WGQ A;  2LGD A;  3PPA A;  1I4R A;  1AWE A;  3BJI A;  1IYF A;  1SJE D;  3L16 A;  1K5D B;  3SV1 A;  3F0W A;  2KMA A;  3R8B A;  5E6N A;  2V3N A;  3DBH B;  2R82 A;  3E56 A;  1J0G A;  3ODW A;  1V80 A;  1QZE A;  2R09 A;  4GN1 A;  4OT1 A;  1F1H A;  1JRP A;  3KWL A;  5TSS A;  2N1W A;  1ZOY B;  2KIG A;  2L32 A;  1TYG B;  1GAQ B;  2C9W B;  3CF6 E;  4WAF A;  4XWW A;  1TS2 A;  1C9F A;  5IKC M;  2BYV E;  2V9H A;  2LXC A;  1Y19 B;  5CHW A;  4O1N A;  4HB0 B;  3SEB A;  4WWO A;  2CQU A;  2N7E A;  2N7J A;  3DQV A;  4KDI C;  4LJP B;  4BKS D;  1BXT A;  3LDZ E;  3PRM B;  5C1Z A;  3SUZ A;  2RGN B;  1MIZ B;  2M14 A;  4HB3 B;  1WXV A;  1ZE3 D;  1E7V A;  2R61 A;  2WLB A;  2Y8G A;  1FCL A;  4YT0 B;  5JZE B;  4GMV A;  2MRP A;  2BBC A;  3LJU X;  1RAX A;  1Z87 A;  3ZNI D;  3X23 A;  4B0M A;  4A6Q A;  5EDS A;  1P7E A;  2AEH A;  1MI1 A;  2YSZ A;  2LD9 A;  1U2B A;  3AJ4 A;  2K22 A;  3NVW A;  5HHD G;  1I7H A;  1ZC4 B;  2LMC A;  3B08 A;  5EFX A;  4D0N B;  5CTR C;  1WY8 A;  2BF8 B;  2BPS A;  2RSG A;  2DBY A;  3APF A;  5AZF A;  4ZYN A;  2WXP A;  4FN2 A;  1VJK A;  3DBL I;  2DHK A;  2AWT A;  3IHP C;  3KUZ A;  1KI1 B;  2L1A A;  2LGY A;  2PVG C;  2OJW A;  5JP4 A;  5IP4 D;  5C5B A;  2KCJ A;  1AYF A;  2KC2 A;  2DYQ A;  2DX5 B;  4I6P A;  4S0R A;  4DHJ B;  1IGD A;  3OG5 A;  4DWF A;  2DKQ A;  2GJY A;  2FJU B;  4YTM B;  4FBJ B;  1BAK A;  2PIA A;  4K81 A;  4A3O A;  2K49 A;  3APD A;  1N62 A;  1T0R C;  1V61 A;  1U5D A;  3BWU D;  1ISN A;  4C7Z A;  2WXO A;  4JKA A;  2BWE S;  5HKH A;  1ACA A;  4KIK A;  4L1R A;  4M00 A;  2M38 A;  1ST7 A;  1OEY J;  4RGN A;  3EFC A;  2GBN A;  3TEY A;  2YEP B;  3JW0 X;  3DBH I;  2PPH A;  1KH0 A;  2D07 B;  2MP2 B;  4A3P A;  5H8Y E;  2ELA A;  3ZGZ A;  1U5G A;  4HB2 B;  1QOF A;  1WX7 A;  3PS6 A;  1QT9 A;  4EUT A;  1T5X D;  2ZNV B;  3PGE A;  1BML C;  2LVQ A;  2XBB C;  2KIE A;  2IYB A;  1ZPS A;  2JRH A;  4LNI A;  4WAA A;  3FM8 C;  3L0W B;  3H7P B;  1NU2 A;  3EEC A;  3T3O A;  2IY1 B;  1FHO A;  1XCG A;  2MBQ A;  1LQB A;  2IO0 B;  4PQ0 A;  3AXC A;  1U4A A;  2IZV B;  3Q3N C;  2Z0Q A;  1SE2 A;  3IVF A;  3UIP B;  4ZRQ A;  1C1Y B;  2NCN A;  4IOI E;  1WXS A;  3ZYY X;  2JYT A;  5FR6 A;  5T8I A;  3A33 B;  1KLV A;  1DRO A;  1YX5 B;  4MK0 A;  1HZ5 A;  3ONS A;  1J0W A;  5L95 C;  4JKH A;  1DOI A;  2LRU A;  2FCN A;  3A9K B;  4HPM B;  2XK5 A;  2IDY A;  2O6V D;  4A90 A;  2Z14 A;  3C0R B;  1PFJ A;  5IA7 A;  3CST A;  1TIF A;  4GZU A;  2C7N B;  3ULC A;  1WXA A;  2VKI A;  3R7Q A;  2MDX A;  4EZK A;  4JWU C;  3FP5 A;  1VBH A;  2KQ7 A;  1FNW A;  3MHZ A;  3RNB C;  2RR9 A;  1V88 A;  3DOW A;  2I38 A;  2K8C A;  3A98 B;  3VH3 B;  1KZG A;  3QBV B;  5DCN A;  4M01 A;  2HTH A;  2SEB D;  3G9W A;  1HE8 A;  3U7D A;  2R0D A;  1WZ0 A;  3DBS A;  1X05 A;  2N9P C;  2OED A;  4IM2 A;  1NEK B;  2ZNV C;  3A4S C;  1DYN A;  4JKC A;  3M1I B;  2M19 A;  4GDL B;  2ZPY A;  3SFE B;  1WYW B;  4EJN A;  3K9P B;  4DQO C;  4NZL B;  4B0E A;  4BKS A;  2QDF A;  1WM2 A;  2JZP A;  2Y5P A;  1UNQ A;  2PEA A;  4TQ0 A;  4JK8 A;  4WJO A;  1BUI C;  4I6N B;  1XEE A;  1WFY A;  4W9F A;  4N58 A;  3MC0 B;  3VIA A;  1JWM D;  3PEG A;  4TMA B;  1WGH A;  3IFW B;  4AUQ C;  1VDV A;  2L7R A;  2GUM A;  1I4H A;  1NDD A;  4GNK B;  3GS2 A;  5HE0 A;  3GE3 C;  4NJ7 A;  4EMO A;  2K3U A;  2Z59 B;  3PO0 A;  4LJO B;  2JSV X;  3TJP A;  5I2M A;  2ASQ A;  3A58 A;  1WGY A;  2MHJ A;  2JF5 A;  1J7A A;  2Z0D B;  1SIF A;  4RGT A;  3VQI A;  3WAO A;  1JWU D;  5D7G A;  2QCZ A;  3D8D A;  2KD0 A;  4NQK E;  1STE A;  2B76 B;  3AEB B;  5BMI A;  1XD3 B;  5LXH A;  3VVW B;  4HPP A;  5E6J A;  1KFY B;  2CHW A;  3O13 A;  2YT2 A;  2G9H D;  4LK0 M;  4IUM B;  4JL9 A;  2OOB B;  1I7A A;  2ZVO A;  3BZD B;  4ITK A;  3ODO A;  3ZUN A;  2KC1 A;  4KKJ A;  2I5C A;  2P0F A;  3AEE B;  3ETR A;  1WE6 A;  1FO4 A;  3UIN B;  2P0H A;  1U27 A;  2GMI C;  1R4M B;  1GNU A;  2W55 A;  1L4D B;  2G4D B;  3ML4 A;  3BII D;  5EE3 A;  2DNF A;  4OZA A;  2C7M B;  4XDD A;  3PT2 B;  4KDL B;  3N32 A;  1G6J A;  3N20 C;  3NWF A;  1L2N A;  2I1J A;  1F9J A;  1HZ6 A;  2DEN B;  4IFS A;  1C3T A;  2KO3 A;  1T0Q C;  2FIF A;  1PGX A;  2CHZ A;  2JZZ A;  4HRS A;  4TQ1 A;  1NTV A;  1LGR A;  1WXQ A;  4HCP B;  2TSS A;  4E74 A;  1QIL A;  2DA0 A;  2K1F A;  2PKO A;  2V76 A;  2PLP A;  4GPT B;  1WX9 A;  3P6A A;  1JRO A;  3N30 A;  3OAW A;  1RWS A;  5HG2 A;  1V6E A;  4HSI A;  5C6R A;  4W9H A;  2WXR A;  4YTP B;  4ZDV A;  1C78 A;  2M8S A;  3JVZ X;  1L6U A;  3OWE B;  3UIO B;  4GMX B;  4HB4 B;  2FE8 A;  4F7G A;  3DXD A;  1D5Z C;  3QCA A;  2D9Z A;  1BTN A;  2O6V A;  2LI5 A;  3SR6 A;  2BS2 B;  2CB8 A;  3PTF C;  3FKY A;  3RCP A;  4BZA A;  3VRA B;  3A9J A;  3M3J A;  2H88 B;  2LRW A;  3E66 A;  2FCQ A;  4ICV A;  1MHX A;  1V2Y A;  4WQM A;  2V3S A;  3KUD B;  2UZR A;  3TSS A;  4OSN A;  3VR9 B;  5J3T A;  4LNF A;  4LCD E;  3R2I A;  1MPE A;  2WH5 A;  1XR0 B;  3N1X C;  3KYC D;  3W5V B;  2EMT A;  5FK9 C;  3NWD A;  4USA A;  2ICI A;  2AL6 A;  1V5P A;  4K3B A;  3ZIM A;  4JKF A;  2D2Q A;  2KAC A;  4K17 A;  3HIZ A;  3AE8 B;  2L1C A;  1V86 A;  2RDB C;  3BVG A;  4US9 A;  3RUL A;  1I4X A;  4DBG A;  2UU7 A;  3KY9 A;  3PVU A;  5AUK A;  1YQ3 B;  2Z0E B;  4LDT B;  1PMS A;  1TZO A;  2GBK A;  2GBR A;  2WGS A;  3SHQ A;  3QWM A;  2JRI B;  3H6N A;  1OGW A;  4MAC A;  1JRU A;  4RGM A;  5IAA C;  1KLU D;  2IO1 B;  2MJ3 A;  4OZB A;  5LLI A;  4AJW A;  2SAK A;  2LG1 A;  4K1R B;  5TR5 A;  4K2P A;  3HHM A;  4W9K A;  3VXW A;  2M56 B;  3ZXR A;  4KHO A;  3ZO5 B;  1SB3 C;  1Q1O A;  2G4S A;  4KGS A;  2CRF A;  3L08 A;  2KWU B;  4DXA B;  1FFU A;  1V5M A;  4AP4 C;  2VSZ A;  3V5W A;  4A20 A;  1FGY A;  1U5E A;  2N1V A;  4BKT A;  2WHI A;  2CAY A;  2FUH B;  2ROZ B;  1FD6 A;  1DYQ A;  1UWM A;  4Z2M B;  1YQ4 B;  1QQR A;  2LUL A;  1RYJ A;  1XT9 B;  5CX3 A;  4JK7 A;  3BYY B;  4FUL A;  2M1M A;  1SE3 A;  2R2Q A;  4A6F B;  3B2G A;  3DXE A;  4XWT A;  2QIL A;  4DDG D;  1ROE A;  1OQQ A;  4W9J A;  3K9O B;  3GYO A;  1XD4 A;  2YS5 A;  1QOA A;  3BIN A;  1ACC A;  2RVB B;  2DX5 A;  3Q69 A;  4C4V B;  2ZPN A;  3QHT A;  2ON8 A;  3D8E A;  1XO3 A;  1V89 A;  4KGR A;  2ADZ A;  4LNO A;  4ANU A;  3MHS D;  2CKH B;  4N6E B;  4M8N A;  2HD5 B;  2D9Y A;  2KVZ A;  1GGO A;  1SHC A;  2PVO D;  3RUI B;  2MP2 A;  3PRE A;  2H89 B;  1F2R I;  4FA6 A;  2L2I A;  5FR3 A;  1CQV A;  2CY5 A;  1JML A;  4HWI B;  1TZ1 A;  4JQW C;  2J7Q B;  4HXD A;  2QIE B;  2LGS A;  2G35 A;  1IBX B;  4EOY A;  2Y7B A;  4XDC A;  3H7P A;  4N59 A;  2BKF A;  3PZ8 A;  3HRD D;  2N9K A;  1WM3 A;  3AE2 B;  1GUA B;  5BYQ A;  1TT5 B;  2Z8L A;  2K2J A;  4WQO B;  2KVR A;  3V05 A;  2D10 A;  2MWS B;  2XNA C;  3BVZ A;  4MM3 B;  1QC6 A;  4RNA A;  3DWM A;  3N3K B;  1AWD A;  3TMP B;  2CY4 A;  3NWA A;  3HVZ A;  3H1U A;  3P4S B;  2ACZ B;  1E0Z A;  1DIK A;  4F8C B;  2BYE A;  1WMH B;  1V97 A;  1XOD A;  4A6H A;  3CSF A;  3PVW A;  2ROV A;  2ABD A;  2PW9 A;  1PQS A;  2LBB A;  3A9K A;  3NRZ A;  1SSN A;  2K6D B;  1DGJ A;  3EA6 A;  2ZCB A;  3ZDM C;  1C79 A;  2JX5 A;  4ILJ A;  3CIK A;  2J0M A;  3B0A A;  3NVV A;  4ZHP A;  4YSX B;  3D8F A;  2HJ8 A;  5G5G A;  3URY A;  3R3M A;  3H8H A;  2W3R A;  2HE7 A;  2M17 A;  3MC9 A;  3V6E B;  1FAO A;  3U4E G;  3H7S A;  4HCN B;  2COD A;  1GC6 A;  3AEG B;  4P7I A;  3MC8 A;  1B9R A;  1MPH A;  2COC A;  2GCJ A;  5CHV C;  3WAP A;  3PP2 A;  3W5U B;  4HLE A;  3UQB A;  2D9W A;  3P4P B;  2BYF A;  1N61 A;  1Y5O A;  1PLS A;  2V3P A;  1OQN A;  5C79 A;  2L8J A;  2N9X A;  4GDL A;  4XZ4 A;  4LDT D;  2I2Y A;  1DOX A;  3AE1 B;  4M0W A;  2K2U A;  1WRI A;  2WQY B;  3WAL A;  2RPQ A;  2P0D A;  3AI5 A;  1WVH A;  3SDL C;  4TSS A;  4IWO A;  1CMX B;  4AOF A;  1F0Z A;  2EKI A;  1WSP A;  1YNT E;  2VZK B;  3NVY A;  2KN4 A;  2KAJ A;  4W9D A;  2K8H A;  2VH1 A;  2FJL A;  1ZXI A;  1HQR D;  2DYN A;  1S1Q B;  2K9X A;  2DZM A;  3DXC A;  2Z59 A;  4HAY B;  5JHA A;  4HAV B;  4J6I A;  2N23 A;  1T0S C;  2L00 B;  4HKQ A;  3JSV A;  2DLW A;  2JQR B;  4MGZ E;  3BYT B;  4HJK A;  2LYD A;  5G55 A;  1IP9 A;  2QJL A;  2JUO A;  3FLV A;  1WIA A;  5IOI A;  1M94 A;  2DYM A;  4B95 A;  2WX1 A;  3P42 A;  3TW1 A;  2KXJ A;  3GP7 A;  5LXI B;  4ZRI A;  3ZJU A;  1PFD A;  1FRD A;  1XXG A;  2KJ6 A;  2DAF A;  4DHZ E;  3LXF A;  1DOY A;  3E9S A;  1N3H A;  1Y8R C;  3CWI A;  4MGY E;  2LGX A;  1DBH A;  2FDQ A;  2RDH A;  2ZZP B;  2JP2 A;  4KX6 B;  1QLB B;  1FNV A;  4LLG M;  2BS3 B;  1TQZ A;  1B1Z A;  1ZKH A;  4NJC A;  3TCA A;  3WYF B;  3I3T B;  3Q8A A;  2Y3A A;  5IN7 A;  1E9M A;  4BBN F;  2K00 A;  1NBF C;  4R3D A;  1KBL A;  2NBV B;  3KYD D;  4II2 B;  2RPV A;  5DPR A;  2KYW A;  3P4Q B;  3NZU A;  3Q8C A;  3GYP A;  2AQ1 B;  4PYZ A;  2MBH A;  2KTR A;  1ET9 A;  4WWN A;  1X1F A;  1UH6 A;  3S2A A;  2MSE D;  1L7Y A;  2BT6 A;  1LM8 B;  1TKY A;  3UI3 A;  4NAM A;  2E3T A;  2BW2 A;  3RNC C;  2PE9 A;  5BYR A;  5J17 A;  1WG7 A;  1H8C A;  1XX0 A;  2IO3 B;  1YN5 A;  1RLF A;  3UGB B;  4MT7 A;  3AM9 A;  5GMV A;  2ZCC A;  4ARC A;  1XLO A;  4YL8 A;  5LON B;  2RUK B;  2COP A;  3ML9 A;  4KHB B;  3HQC A;  1ZXH A;  2KJH B;  3OJ3 A;  3HW2 B;  1A70 A;  1TY0 A;  3T8M A;  1DDM A;  2QKL A;  1EWC A;  4XGA B;  3Q3O C;  2UZS A;  3WCQ A;  2KUP A;  1W1G A;  1R4N B;  4MGI E;  1K5G B;  4IAP A;  4PYU A;  3WA0 A;  1TKG A;  4WSF A;  4W9I A;  2MEK A;  4KZC A;  1EF5 A;  2MA9 B;  1TBE A;  2JY6 A;  2ELB A;  1WJM A;  4M8M A;  4WJN A;  3VTW A;  3TEZ A;  2WXL A;  1V1P B;  1E10 A;  5GXG B;  2FBW B;  1QOB A;  4N9F 4;  3AE3 B;  2BQQ A;  3PLU A;  3W1S C;  4QXA B;  3T06 A;  3PRZ A;  4M0W B;  1FGZ A;  3OHM B;  4ZRK A;  3A1Q B;  3EC8 A;  4ILH A;  1DDW A;  3SFD B;  1HB6 A;  2ZKM X;  2C60 A;  2DN6 A;  5BYS A;  2KTF A;  2INN E;  3U8Z A;  4W9L A;  3ZLZ A;  4HRO A;  1EUV B;  1JDE A;  3GOE A;  3P7Z A;  3VDZ A;  1SJH D;  3FIL A;  2HDE A;  3Q6B A;  2D3B A;  3L54 A;  3ZVR A;  4H2A A;  2VZK D;  2KDB A;  2NS5 A;  3JSV B;  4ASW C;  5C3J B;  3B2F A;  4DDI D;  1GB4 A;  1MI0 A;  4F7H A;  3HM3 A;  1JW9 D;  4RM9 A;  2GI9 A;  2OJR A;  1WGU A;  4IWP A;  1VZ7 A;  3JYU A;  2LGI A;  2YF0 A;  4B6H A;  1OEY A;  3AN1 A;  2XQN M;  3DBR B;  3HM6 X;  3ZJV A;  3N9Y C;  4PNK A;  2JVC A;  2V4I B;  4WH4 A;  2RLO A;  3QIJ A;  4ZYS A;  4D2K A;  3ZDT A;  1MG8 A;  2WXI A;  4WJQ A;  1YN3 A;  1J7C A;  4G0N B;  1HTQ A;  2CJO A;  4BOZ B;  1FEH A;  4A6F A;  1D5X C;  2JPH A;  1VD2 A;  1WJ4 A;  2KHW B;  4DHJ D;  2D9X A;  1R4N I;  2YRY A;  1NTI A;  1C77 A;  4C4V A;  3TIX A;  4GDK B;  2BCJ A;  3TBL D;  2W3S A;  1C4A A;  3W9C B;  2MJD A;  3HVD A;  3ZTD A;  2YS3 A;  4WWP A;  4QJ4 B;  1UD7 A;  3NZ3 A;  2IYD B;  1FXT B;  1W1H A;  1E8X A;  2CJN A;  3SO6 A;  3P1M A;  1P9D U;  2WDR B;  1X1M A;  5DIF B;  1TKE A;  2KZR A;  1SGH A;  2K39 A;  4DX8 A;  5HE2 A;  3ZNG C;  2L83 A;  1T6B X;  5FI0 A;  4RCO A;  2KQ4 X;  1L4Z B;  3EHV A;  1WWT A;  2KTR B;  2KX0 A;  3N1Y C;  2KQS A;  1S3S G;  4BAX A;  3VFK A;  1IBX A;  2FNJ B;  3Q2A C;  4AWJ A;  4F7Z A;  3NOB A;  3ZXV A;  3GZN B;  3ZVV A;  4YXD B;  4YON A;  3PRP B;  4IWQ A;  2MWN B;  2JT4 B;  3VRB B;  2H7E A;  3WAM A;  4MEL A;  2K8B A;  1E6E B;  2W2W A;  3MDB C;  1YOV B;  2W82 A;  3VUY A;  4HAX B;  4P1B C;  4MM3 A;  1P0R A;  3O65 B;  1FNU A;  4WVF B;  1XCQ L;  2LAS A;  1V5O A;  3NG0 A;  4JLC A;  3M63 B;  5EE1 A;  4WIP A;  2LFI A;  1XKE A;  1UWX A;  4L2Y A;  1IPG A;  2QHO A;  1Q0W B;  4FHJ A;  1K51 A;  1WXM A;  1OQY A;  4FAD A;  1WGD A;  1WMH A;  1JQ4 A;  2W9N A;  1F77 A;  3DBR I;  3VR8 B;  1OY2 A;  4A9A A;  1NI3 A;  2C7H A;  4KVG B;  5FKA C;  3SD5 A;  4GOC A;  3ABV B;  3PG7 A;  4XYC A;  2FCM A;  1L0X B;  2BTE A;  4HPL B;  5G2N A;  2REX A;  1SIJ A;  3BY4 B;  4TKN A;  2JWZ A;  1TJ6 A;  3PV1 A;  2DFK A;  5L83 A;  4KSK C;  2IY0 B;  3VTV A;  2NR2 A;  1BT0 A;  1YN4 A;  3GB1 A;  3HIE A;  2ZEQ A;  3NHE B;  1R4M I;  2WDQ B;  1W1D A;  2MBB B;  2KUQ A;  4PS7 A;  1C76 A;  2A5U A;  4C7Y A;  3DDC B;  1LFD A;  4K7W A;  4NAW B;  5BMH A;  1OFF A;  2RD0 A;  3MTN B;  3A8Q A;  2GCL A;  1Q5W B;  1EVH A;  2D3G A;  3SNH A;  3ENE A;  2KGX B;  4OHJ A;  2NTT A;  4P16 A;  4HJG E;  1GOZ A;  5JHH A;  1TS3 A;  2ZW0 A;  4JKB A;  4PS8 A;  1HBK A;  1MJD A;  1Y56 A;  4BKG A;  1MKE A;  1YQB A;  1HB8 A;  2NMB A;  4A55 A;  3AEA B;  2NZ8 B;  2OHF A;  1JAL A;  5KHQ A;  3KRX A;  2L52 A;  2R2Y A;  4CO7 A;  1NVL A;  4GLS C;  4RFB A;  3GZN I;  4RM8 A;  5DPS A;  1P3R A;  3FIL B;  4MY6 A;  4DIX A;  4GB9 A;  3MJ5 A;  1ZSQ A;  5AEK B;  2LJ5 A;  1TJE A;  5JHG A;  4OVV A;  5LOP B;  1BWN A;  4DK5 A;  2DZI A;  3PVL A;  1E8Z A;  1MHH E;  2D9V A;  4ANX A;  3R66 C;  4BVU C;  5IJM A;  2JYE A;  2NBW B;  3AE4 B;  5KCV A;  1PDX A;  1WJ6 A;  1JWB D;  3RZW C;  3DWG C;  4ARI A;  2WXH A;  1NYR A;  3VHT C;  1U29 A;  3PHW B;  4C0A A;  4IDI A;  1CK1 A;  1WX8 A;  1K8R B;  2KR0 A;  2DZJ A;  3PLV A;  4HAT B;  3TEW A;  2RSU A;  4IM0 A;  3BK2 A;  2EMS A;  3AEC B;  4KKI A;  4REZ A;  3Q3F A;  3NS1 A;  4RGO S;  2YVC A;  3LB8 C;  4Z2N A;  4BBK A;  3ENB A;  4KGT A;  1ZYI A;  5DHF B;  2VH2 A;  2AQ3 B;  4I6L B;  2GBJ A;  1WGG A;  3V6C B;  3I9V 1;  2E2X A;  3OLM D;  5AUI A;  4EFO A;  3MFG A;  1B55 A;  2KMM A;  5G5H A;  4D6W A;  3B9J A;  1F2R C;  1KLG D;  3E9P A;  1D3Z A;  4MJS B;  4US8 A;  3LJ3 A;  3PSE B;  4IC7 B;  2RMM A;  4K3C A;  4Y94 A;  4WJ7 A;  3P4R B;  2KX3 A;  4L23 A;  5HI1 A;  2V4L A;  3W1S A;  1FXI A;  2N0Y A;  1FCC C;  1UNS A;  2G45 B;  5JLJ B;  2NBV A;  4GSW A;  2J4X A;  4KSL C;  2ZJD A;  2J59 M;  3Q8F A;  1P98 A;  1AAR A;  3MJW A;  2O2V B;  3NJT A;  2FAZ A;  1V49 A;  5C23 A;  1UBQ A;  2JWU A;  3Q8E A;  3KRW A;  4BOS C;  4PK1 A;  1WYG A;  4JX1 C;  5MPO A;  2WXQ A;  1EU4 A;  5D6J B;  2V1Y A;  1FXA A;  4OW0 A;  4FJV B;  3CMM B;  1UGM A;  4AS1 A;  1I4Q A;  4JE3 B;  3AH7 A;  2BVC A;  5DH9 B;  2MQJ A;  1ESF A;  5EE9 A;  3V61 A;  1FHW A;  2DWQ A;  4JGH B;  3QA8 A;  2GRI A;  1P5T A;  2WXG A;  1X11 A;  2K25 A;  4KHB A;  2DHZ A;  3B1L X;  3B77 A;  2KWD A;  2KFK B;  4XE0 A;  2DYO A;  3OJ4 B;  3ZTC A;  2DHI A;  4P6V F;  4OZC A;  4ANV A;  2NPT B;  1EO6 A;  1TTN A;  3RMK C;  4HEA 1;  4RH6 A;  1D5M C;  2WU5 B;  4LNN A;  1WGK A;  4NY0 A;  1I2H A;  1L0V B;  3L10 B;  5DPW A;  4GGQ A;  5CHF A;  1WZ3 A;  3RI7 C;  2Y5B B;  2Y5C A;  1JWS D;  1YJJ A;  2L76 A;  3I5J C;  2N0S B;  1V9J A;  4CHM A;  3FAH A;  1WRD B;  1V1P A;  2IFS A;  1YJI A;  4DXG A;  2V0G A;  4CHK A;  3ODX A;  3UZT A;  2VRW B;  4MDK E;  3EFU A;  3SU8 X;  2J42 A;  3L4P A;  1Z2M A;  1NTY A;  2Z4D A;  4II3 B;  1T77 A;  3NVZ A;  3QAQ A;  4C00 A;  4C56 C;  3DCG A;  1N5X A;  4M02 A;  4DBB A;  1WR6 E;  4CYE A;  2FID A;  2MJE A;  4E3C A;  3FC4 A;  3AMZ A;  1AN8 A;  1LO5 D;  3A1Q A;  2NBU A;  4ACF A;  2WYQ A;  2QEJ C;  1FFV A;  5M4Y B;  1RFK A;  2IND C;  3X0W A;  1WH3 A;  2N4F A;  3WIM A;  1YJ1 A;  2CR5 A;  3A4R A;  4MSM B;  2Z0P A;  2UYZ B;  2FUG 1;  3FVC A;  4L6E A;  2WXF A;  1KOT A;  4UDU C;  2ZW1 A;  4NPN A;  3AE7 B;  4G11 A;  3U30 A;  2AL3 A;  2Z13 A;  1P3Q U;  1V81 A;  3NW8 A;  1L5P A;  3R2T A;  2MLB A;  4JKE A;  2LHD A;  5LG4 B;  1XCT L;  1OMW A;  2GS0 A;  2LJI A;  2K6Q A;  3TFM A;  4MT5 A;  1I4P A;  5D3V A;  5DI9 B;  2KFJ A;  1K52 A;  1JCK B;  1YIW A;  3EGR A;  1UEL A;  2DX1 A;  1ZM0 A;  2WXK A;  2IGG A;  2GBM A;  2X8X X;  4JKG B;  2G3Q B;  4TYZ A;  4KAX B;  2MW5 A;  3VH4 B;  1C4C A;  1TS4 A;  5CLQ B;  4MH0 E;  4XWX A;  2LHE A;  2MX2 A;  1P1A A;  4KZ0 A;  3W2D A;  1CJE A;  2MCN B;  2RRF A;  1ZUD 2;  3DCX A;  1H10 A;  3QC8 B;  5CLL B;  1NVI D;  3Q3J A;  3DHI C;  1MFW A;  2PZ1 A;  3MP9 A;  1M7R A;  1ZDX A;  1FRR A;  1X1G A;  2N7D A;  1FMA D;  1UBI A;  4GDK A;  1N6Z A;  1T3Q A;  4HK2 A;  1PGB A;  3QK0 A;  2LUM A;  1E8W A;  3RNF C;  3FEH A;  4FJZ A;  1EWY C;  5D3D A;  3DVG Y;  4RF0 A;  2IBI B;  1TGZ B;  1RM6 C;  1V8C A;  2BKR B;  2KDE B;  2WWZ A;  3NSU A;  2GLS A;  2NVU I;  1UPQ A;  2FJ9 A;  4MSQ B;  1PGA A;  5BMG A;  1V5U A;  3NS8 A;  3PZ7 A;  2PTL A;  4IM3 A;  4IKG A;  4HHV A;  4TV3 A;  1KJT A;  3L17 A;  4CQN A;  3RNA C;  1UPR A;  1IRS A;  5C2T B;  1HA5 A;  3N7C A;  4YWG G;  3U2S C;  4J3O D;  1YD8 U;  2X38 A;  1UF0 A;  4ANW A;  2DHJ A;  2MKR A;  2KAN A;  2CS4 A;  1VZ8 A;  4BFR A;  5HFY A;  1ZVR A;  2LXA A;  3PZD A;  3P63 A;  1QOG A;  3BVM A;  3FSS A;  4BBN C;  2E6X A;  2KWV B;  5D3X A;  3SBG A;  2LVP A;  2YEP F;  1FB8 A;  3IBE A;  1XF5 L;  4YTN B;  1E7U A;  1K50 A;  2BWF A;  1FIQ A;  5DPT A;  1VBG A;  5D94 A;  4DX9 0;  2KLC A;  3SBT A;  1I35 A;  1WJU A;  1N60 A;  2UWQ A;  3IT6 B;  1WJN A;  3TVV A;  3ALB A;  3ZQ4 A;  2M0X A;  2J0K A;  2N9L A;  4OVZ A;  2OQB A;  3QQ8 B;  4HVB A;  1YX6 B;  4B6W A;  4QJ5 B;  1NEN B;  2JZ3 B;  4X57 B;  3U7Z A;  3RT3 B;  1XLN A;  3C19 A;  1UEF A;  5GOW B;  4WUR A;  1XLQ A;  1X86 A;  5BO4 B;  5D3W A;  3ZRC A;  1WI0 A;  2YLM A;  3IT4 B;  4LTU A;  4B9K A;  1I42 A;  4QAY A;  1ZDV A;  4FXC A;  1YMH E;  5I2S A;  1Q67 A;  3KZ1 A;  2CU3 A;  1EGX A;  2KKC A;  4WJP A;  3AE9 B;  3DHH C;  4NAW A;  2L3Z A;  1F52 A;  4NJ6 A;  3ZRF A;  3TEX A;  5EE0 A;  5J18 A;  2N9E B;  4HDQ A;  3AU4 A;  4DHZ B;  1KF6 B;  3NY5 A;  4HAU B;  4K2O A;  3U52 E;  4ZRP A;  4A5K A;  3VOQ A;  1LXD A;  2NTS A;  2IGH A;  1WR1 A;  5JH5 C;  2KDM A;  3I63 C;  4IOY X;  1TY2 A;  4TUU A;  5KQ4 A;  5D2M B;  4JKD A;  1SXT A;  1LW3 A;  1WJ1 A;  4F1S A;  2D5G A;  4F7U P;  3VUW A;  1Q10 A;  4ICU A;  4GU2 A;  5JXV A;  2Q5W D;  2LWP A;  3M95 A;  2LVO A;  2MH7 A;  4JPS A;  1J8C A;  3C8Y A;  2Y8F A;  4RF1 A;  3GE8 C;  1UNR A;  2KDI A;  3RD2 A;  4EEW A;  2LZ6 A;  3V60 A;  1N63 A;  1KC7 A;  3PHX B;  2D3C A;  1MAI A;  4FLH A;  1CZP A;  2YS1 A;  3OAN A;  2K5P A;  2WP9 B;  1MK9 B;  1V1O A;  3I57 A;  2MBO A;  4G50 A;  3UQA A;  3EUB 2;  3D32 A;  3DHG C;  2IPK D;  2K0P A;  1BTK A;  3M62 B;  3KVF B;  3RPF C;  1P6S A;  1ENF A;  4DXF A;  3RCZ A;  4RMA A;  4YSY B;  2HJ1 A;  2KOX A;  1U5F A;  2COA A;  5C5B B;  3QAR A;  1TS5 A;  1RJ2 A;  4IG7 B;  1J7B A;  2VRR B;  1AW7 A;  1FPY A;  3A8P A;  1ZC3 B;  2CU1 A;  3NUH B;  3KWV A;  3KSY A;  4GIV A;  4PS3 A;  4XX5 A;  5D3Y A;  5HE1 A;  2DLB A;  1DDV A;  2WXJ A;  1H4R A;  2KDF B;  4ZRJ A;  4KIK B;  1T0Y A;  1XLP A;  4HAZ B;  5IO9 A;  5FI1 A;  1ET6 A;  2IGD A;  4HDO A;  2YT1 A;  3AE5 B;  3IG3 A;  3BK1 A;  2RQ1 A;  2LOZ A;  1E90 A;  2WS3 B;  1KTK A;  1N5W A;  2D11 A;  4MJS A;  2JU6 X;  5AZH A;  2LUE A;  3AED B;  4W9G A;  3F5R A;  3H9D A;  1AQC A;  2J0J A;  2WU2 B;  2QMT A;  3ULB A;  3ZNZ B;  1M7E A;  5E6O A;  2COF A;  2DZK A;  2WXN A;  1NI2 A;  1QQG A;  5J2R A;  3KH0 A;  3TO1 A;  3ZNH B;  5L81 A;  1RRB A;  2O2V A;  3DVG X;  5KQ1 A;  2EJ8 A;  1WGR A;  5E6P A;  2BB5 A;  3IXS A;  1M4V A;  2PE6 B;  1ZGU B;  3ZKJ C;  2CHX A;  3E9O A;  1SBB B;  2I1K A;  2MFQ A;  4NSW A;  2KT7 A;  3PSC A;  4S17 A;  2DAJ A;  4ZOH C;  2LEK A;  3QWZ B;  2OTX A;  4G3X B;  2HTM E;  5JHB A;  3O96 A;  1UNP A;  1EAZ A;  3QJZ A;  1GC7 A;  2G1E A;  5I4D A;  2D3A A;  2D4Q A;  2XK5 B;  2A4Z A;  4CSQ A;  2BB6 A;  3U12 A;  2L05 A;  1WF9 A;  4CHJ A;  2KFK A;  1E5W A;  3TL5 A;  1WI1 A;  2UVM A;  4E71 A;  4GXB A;  3KLS X;  2NPT A;  4KHA A;  2DYB A;  1EM7 A;  3T3N A;  4Q2J A;  2GOW A;  1FHX A;  4EZL A;  4PT5 A;  4LNK A;  3ECI A;  3R7R A;  4GOU A;  2B3A A;  2NMQ A;  1EF1 A;  3MPX A;  2W2X C;  4JIO U;  1VRA B;  4MGK E;  4HKZ E;  1ZP0 B;  2ONQ A;  1E7P B;  2KK8 A;  4JK9 A;  5DHA B;  4ZHO A;  3AV8 A;  4FHK A;  2HTH B;  3J9C A;  1HEZ E;  2J52 A;  3VAW A;  3AE6 B;  3ML8 A;  3EPY A;  3CIR B;  3HUI A;  5AZG A;  4YSZ B;  4FJY A;  2QKM A;  1FOE A;  2I5F A;  5LNK 1;  2W54 A;  2AX5 A;  4AQ7 A;  2EKE C;  2KN5 A;  1FM0 D;  2LKO A;  1MIX A;  3RN9 C;  2AYO B;  1UZX B;  1EU3 A; 
#chains in the Genus database with same CATH homology
 2YT0 A;  2H7D A;  2RNR B;  2R2O A;  3DVN U;  1ZW7 A;  2FCS A;  1VCB A;  4A6K A;  1OTR B;  5JVL A;  1J19 A;  3T9L A;  3V62 A;  3L13 A;  1TXD A;  2X18 A;  2DKP A;  4JKG A;  2L0T A;  3P2B A;  1KZ7 A;  5D27 A;  1LB1 A;  2KNB A;  4NQL B;  2WX0 A;  2X0S A;  4W9C A;  1SE9 A;  2HRJ A;  3QX1 A;  2PJH A;  3RYT A;  3ZW3 A;  2MBE A;  4W9E A;  2ZVN A;  3VUX A;  4K7S A;  3E9L A;  1RFA A;  4URK A;  2XEW A;  4KV2 A;  4NNJ B;  2W2X D;  1MK7 B;  4AJY B;  4OVU A;  2EC1 A;  2DIK A;  3RZF A;  3HK0 A;  3AUL A;  3VTU A;  1RRP B;  3KW5 B;  1Z5S B;  2JXX A;  4XC2 A;  3NZS A;  5J3Y A;  1V5T A;  2C5L C;  2IO2 B;  4HAW B;  3W1Y A;  2RGF A;  4IW0 A;  3DPD A;  3APC A;  4ILG B;  3KUC B;  4H8S A;  3DVN V;  3AU5 A;  1GJZ A;  4MEM A;  5HE3 A;  3SYX A;  2L0F A;  5KHO A;  1WE7 A;  1KM7 A;  5C16 A;  1A5R A;  2O6V B;  2WDT B;  3UF8 A;  1E8Y A;  3CXB B;  2M4N A;  2KWC A;  2P8V A;  3WAN A;  3A9J B;  4EZJ A;  1XQQ A;  2DTC A;  2KMC A;  4EKU A;  2LOX A;  1GG3 A;  4K7U A;  2BGF A;  5J3Q A;  2KLG A;  2Z0O A;  2Q13 A;  2KJR A;  1WGQ A;  2LGD A;  3PPA A;  1AWE A;  3BJI A;  1IYF A;  3L16 A;  1K5D B;  3SV1 A;  3F0W A;  2KMA A;  5E6N A;  2R82 A;  1J0G A;  3ODW A;  1V80 A;  1QZE A;  2R09 A;  4GN1 A;  2N1W A;  2C9W B;  3CF6 E;  2BYV E;  2LXC A;  1Y19 B;  5CHW A;  4HB0 B;  4WWO A;  2CQU A;  2N7E A;  3DQV A;  4LJP B;  4KDI C;  4BKS D;  3LDZ E;  3PRM B;  5C1Z A;  3SUZ A;  2RGN B;  1MIZ B;  2M14 A;  4HB3 B;  1WXV A;  1E7V A;  2Y8G A;  5JZE B;  4GMV A;  2MRP A;  3LJU X;  1RAX A;  1Z87 A;  3ZNI D;  3X23 A;  5EDS A;  2AEH A;  2YSZ A;  2LD9 A;  1U2B A;  3AJ4 A;  1ZC4 B;  3B08 A;  5CTR C;  5EFX A;  4D0N B;  1WY8 A;  2BF8 B;  2BPS A;  2RSG A;  3APF A;  5AZF A;  4ZYN A;  4FN2 A;  3DBL I;  2DHK A;  2AWT A;  3IHP C;  3KUZ A;  1KI1 B;  2LGY A;  5JP4 A;  5C5B A;  2KCJ A;  2KC2 A;  2DYQ A;  2DX5 B;  4I6P A;  4DHJ B;  4DWF A;  2DKQ A;  2GJY A;  4FBJ B;  1BAK A;  4K81 A;  4A3O A;  3APD A;  1V61 A;  1U5D A;  1ISN A;  4JKA A;  2BWE S;  5HKH A;  1ACA A;  4KIK A;  2M38 A;  1ST7 A;  1OEY J;  2GBN A;  3JW0 X;  3DBH I;  2PPH A;  2D07 B;  2MP2 B;  4A3P A;  2ELA A;  1U5G A;  4HB2 B;  1WX7 A;  3PS6 A;  4EUT A;  2ZNV B;  3PGE A;  2XBB C;  2LVQ A;  2IYB A;  2JRH A;  4WAA A;  3FM8 C;  3L0W B;  3H7P B;  1NU2 A;  3EEC A;  2IY1 B;  1FHO A;  1XCG A;  2MBQ A;  1LQB A;  2IO0 B;  4PQ0 A;  3AXC A;  1U4A A;  2IZV B;  2Z0Q A;  3IVF A;  3UIP B;  1C1Y B;  2NCN A;  1WXS A;  5FR6 A;  3A33 B;  1KLV A;  1DRO A;  1YX5 B;  4MK0 A;  3ONS A;  1J0W A;  5L95 C;  4JKH A;  2LRU A;  2FCN A;  3A9K B;  4HPM B;  2XK5 A;  2O6V D;  3C0R B;  1PFJ A;  5IA7 A;  3CST A;  4GZU A;  2C7N B;  3ULC A;  1WXA A;  2VKI A;  3R7Q A;  2MDX A;  4EZK A;  3FP5 A;  1VBH A;  2KQ7 A;  2RR9 A;  1V88 A;  3DOW A;  2K8C A;  3A98 B;  3VH3 B;  1KZG A;  3QBV B;  5DCN A;  2HTH A;  3G9W A;  1HE8 A;  3U7D A;  2R0D A;  1WZ0 A;  3DBS A;  1X05 A;  2N9P C;  4IM2 A;  2ZNV C;  3A4S C;  1DYN A;  4JKC A;  3M1I B;  4GDL B;  2ZPY A;  1WYW B;  4EJN A;  3K9P B;  4BKS A;  1WM2 A;  1UNQ A;  2PEA A;  4TQ0 A;  4JK8 A;  4WJO A;  4I6N B;  1WFY A;  4W9F A;  3VIA A;  3PEG A;  1WGH A;  3IFW B;  4AUQ C;  2L7R A;  1NDD A;  5HE0 A;  4NJ7 A;  4EMO A;  2Z59 B;  4LJO B;  3TJP A;  2ASQ A;  1WGY A;  2JF5 A;  2Z0D B;  1SIF A;  3VQI A;  3WAO A;  5D7G A;  3D8D A;  2KD0 A;  4NQK E;  1XD3 B;  5LXH A;  3VVW B;  2CHW A;  4IUM B;  4JL9 A;  2OOB B;  1I7A A;  2ZVO A;  3ODO A;  3ZUN A;  2KC1 A;  2I5C A;  2P0F A;  1WE6 A;  3UIN B;  2P0H A;  1U27 A;  2GMI C;  1GNU A;  2G4D B;  3ML4 A;  2C7M B;  3PT2 B;  4KDL B;  3N32 A;  1G6J A;  1L2N A;  2I1J A;  1F9J A;  2DEN B;  4IFS A;  1C3T A;  2KO3 A;  2FIF A;  2CHZ A;  2JZZ A;  4TQ1 A;  1NTV A;  4HCP B;  4E74 A;  2DA0 A;  2K1F A;  2V76 A;  4GPT B;  1WX9 A;  3P6A A;  3N30 A;  3OAW A;  1V6E A;  5C6R A;  4W9H A;  4ZDV A;  2M8S A;  3JVZ X;  3UIO B;  4GMX B;  4HB4 B;  4F7G A;  3DXD A;  3QCA A;  2D9Z A;  1BTN A;  2O6V A;  2LI5 A;  2CB8 A;  3PTF C;  3RCP A;  3A9J A;  3M3J A;  2LRW A;  3E66 A;  2FCQ A;  4ICV A;  1V2Y A;  2V3S A;  3KUD B;  2UZR A;  5J3T A;  4LCD E;  2WH5 A;  1XR0 B;  3KYC D;  2EMT A;  2AL6 A;  1V5P A;  3ZIM A;  4JKF A;  2D2Q A;  4K17 A;  3HIZ A;  2L1C A;  1V86 A;  3RUL A;  4DBG A;  3KY9 A;  3PVU A;  4LDT B;  2Z0E B;  1PMS A;  2GBK A;  2GBR A;  3SHQ A;  3QWM A;  2JRI B;  3H6N A;  1OGW A;  1JRU A;  5IAA C;  2IO1 B;  5LLI A;  4AJW A;  2LG1 A;  4K1R B;  5TR5 A;  4K2P A;  3HHM A;  4W9K A;  3VXW A;  4KHO A;  3ZO5 B;  1Q1O A;  2G4S A;  2CRF A;  3L08 A;  2KWU B;  4DXA B;  4AP4 C;  1V5M A;  2VSZ A;  3V5W A;  4A20 A;  1FGY A;  1U5E A;  2N1V A;  4BKT A;  2CAY A;  2FUH B;  2ROZ B;  4Z2M B;  2LUL A;  1XT9 B;  5CX3 A;  4JK7 A;  4FUL A;  2M1M A;  2R2Q A;  4A6F B;  3DXE A;  4DDG D;  4W9J A;  3K9O B;  3GYO A;  1XD4 A;  2YS5 A;  3BIN A;  2RVB B;  2DX5 A;  2ZPN A;  3QHT A;  3D8E A;  1V89 A;  2ADZ A;  4ANU A;  3MHS D;  2CKH B;  4M8N A;  2HD5 B;  2D9Y A;  1GGO A;  3RUI B;  1SHC A;  2MP2 A;  3PRE A;  4FA6 A;  2L2I A;  2CY5 A;  4HWI B;  1TZ1 A;  4JQW C;  2J7Q B;  4HXD A;  2G35 A;  4EOY A;  2Y7B A;  3H7P A;  2BKF A;  1WM3 A;  1GUA B;  4WQO B;  2K2J A;  2KVR A;  2D10 A;  2MWS B;  1QC6 A;  3N3K B;  3TMP B;  2CY4 A;  3H1U A;  1DIK A;  4F8C B;  2BYE A;  1WMH B;  1XOD A;  4A6H A;  3CSF A;  3PVW A;  2ROV A;  2ABD A;  1PQS A;  2LBB A;  3A9K A;  2K6D B;  2ZCB A;  3ZDM C;  4ILJ A;  3CIK A;  2J0M A;  3B0A A;  3D8F A;  2HJ8 A;  3R3M A;  2HE7 A;  2M17 A;  3V6E B;  1FAO A;  3H7S A;  4HCN B;  2COD A;  1GC6 A;  4P7I A;  1MPH A;  2COC A;  2GCJ A;  5CHV C;  3WAP A;  3PP2 A;  4HLE A;  3UQB A;  2D9W A;  2BYF A;  1Y5O A;  1PLS A;  1OQN A;  5C79 A;  2L8J A;  2N9X A;  4GDL A;  4XZ4 A;  4LDT D;  2K2U A;  3WAL A;  2RPQ A;  2P0D A;  3AI5 A;  1WVH A;  3SDL C;  4IWO A;  1CMX B;  4AOF A;  4W9D A;  2K8H A;  2FJL A;  2DYN A;  1S1Q B;  2DZM A;  3DXC A;  4HAY B;  5JHA A;  4HAV B;  4J6I A;  2N23 A;  2L00 B;  3JSV A;  2DLW A;  4MGZ E;  4HJK A;  2LYD A;  5G55 A;  1IP9 A;  2JUO A;  3FLV A;  1WIA A;  1M94 A;  2DYM A;  4B95 A;  2WX1 A;  3TW1 A;  2KXJ A;  5LXI B;  4ZRI A;  2KJ6 A;  2DAF A;  4DHZ E;  1N3H A;  1Y8R C;  4MGY E;  2LGX A;  1DBH A;  2FDQ A;  2ZZP B;  2JP2 A;  1TQZ A;  1ZKH A;  3TCA A;  3WYF B;  3I3T B;  4BBN F;  2K00 A;  1NBF C;  1KBL A;  2NBV B;  3KYD D;  4II2 B;  5DPR A;  3NZU A;  3GYP A;  4PYZ A;  2MBH A;  2KTR A;  4WWN A;  1X1F A;  1UH6 A;  3S2A A;  2MSE D;  1L7Y A;  1LM8 B;  2PE9 A;  5J17 A;  1WG7 A;  1H8C A;  1XX0 A;  2IO3 B;  1RLF A;  3UGB B;  4MT7 A;  5GMV A;  2ZCC A;  4YL8 A;  5LON B;  2RUK B;  2COP A;  3ML9 A;  4KHB B;  3HQC A;  2KJH B;  3OJ3 A;  3HW2 B;  3T8M A;  1DDM A;  2QKL A;  2UZS A;  2KUP A;  1W1G A;  4MGI E;  1K5G B;  4IAP A;  4PYU A;  3WA0 A;  4WSF A;  4W9I A;  4KZC A;  1EF5 A;  2MA9 B;  1TBE A;  2JY6 A;  2ELB A;  1WJM A;  4M8M A;  4WJN A;  3VTW A;  4N9F 4;  3PLU A;  3W1S C;  3T06 A;  3PRZ A;  4M0W B;  1FGZ A;  4ZRK A;  3A1Q B;  3EC8 A;  4ILH A;  1DDW A;  1HB6 A;  2C60 A;  2DN6 A;  2KTF A;  3U8Z A;  4W9L A;  3ZLZ A;  1EUV B;  1JDE A;  3GOE A;  3P7Z A;  3VDZ A;  3L54 A;  3ZVR A;  2KDB A;  2NS5 A;  3JSV B;  4ASW C;  4DDI D;  4F7H A;  3HM3 A;  4RM9 A;  4IWP A;  1WGU A;  2OJR A;  3JYU A;  2YF0 A;  4B6H A;  1OEY A;  2XQN M;  3HM6 X;  4PNK A;  2JVC A;  2RLO A;  3QIJ A;  3ZDT A;  1MG8 A;  4WJQ A;  4G0N B;  4BOZ B;  4A6F A;  2JPH A;  1VD2 A;  1WJ4 A;  2KHW B;  4DHJ D;  2D9X A;  1R4N I;  2YRY A;  1NTI A;  3TIX A;  4GDK B;  2BCJ A;  3TBL D;  3ZTD A;  2YS3 A;  4WWP A;  1UD7 A;  2IYD B;  1FXT B;  1W1H A;  1E8X A;  3SO6 A;  1P9D U;  1X1M A;  5DIF B;  2KZR A;  1SGH A;  2K39 A;  4DX8 A;  5HE2 A;  3ZNG C;  5FI0 A;  3EHV A;  2KTR B;  2KX0 A;  2KQS A;  1S3S G;  3VFK A;  2FNJ B;  4AWJ A;  4F7Z A;  3NOB A;  3ZVV A;  4YON A;  3PRP B;  4IWQ A;  2MWN B;  2JT4 B;  2H7E A;  3WAM A;  4MEL A;  2K8B A;  2W2W A;  3MDB C;  3VUY A;  4HAX B;  4MM3 A;  1P0R A;  3O65 B;  4WVF B;  2LAS A;  1V5O A;  4JLC A;  3M63 B;  1XKE A;  1IPG A;  2QHO A;  1Q0W B;  4FHJ A;  1WXM A;  1OQY A;  4FAD A;  1WGD A;  1WMH A;  2W9N A;  3DBR I;  1OY2 A;  2C7H A;  4KVG B;  3SD5 A;  4GOC A;  3PG7 A;  2FCM A;  4HPL B;  5G2N A;  2REX A;  3BY4 B;  4TKN A;  2JWZ A;  1TJ6 A;  3PV1 A;  2DFK A;  5L83 A;  4KSK C;  2IY0 B;  3VTV A;  2NR2 A;  1BT0 A;  2ZEQ A;  3NHE B;  1R4M I;  1W1D A;  2MBB B;  4PS7 A;  2A5U A;  3DDC B;  1LFD A;  4K7W A;  4NAW B;  2RD0 A;  3MTN B;  3A8Q A;  2GCL A;  1Q5W B;  1EVH A;  2D3G A;  3SNH A;  3ENE A;  2KGX B;  5JHH A;  4PS8 A;  4JKB A;  1HBK A;  4BKG A;  1MKE A;  1YQB A;  1HB8 A;  2NMB A;  2NZ8 B;  5KHQ A;  3KRX A;  4CO7 A;  1NVL A;  4RM8 A;  3GZN I;  5DPS A;  1P3R A;  4MY6 A;  4GB9 A;  1ZSQ A;  5AEK B;  2LJ5 A;  5JHG A;  4OVV A;  5LOP B;  1BWN A;  4DK5 A;  2DZI A;  3PVL A;  1E8Z A;  2D9V A;  4ANX A;  3R66 C;  4BVU C;  5IJM A;  2NBW B;  5KCV A;  1WJ6 A;  3RZW C;  3VHT C;  1U29 A;  3PHW B;  4C0A A;  1WX8 A;  1K8R B;  2DZJ A;  3PLV A;  4HAT B;  2RSU A;  4IM0 A;  2EMS A;  3Q3F A;  2YVC A;  4Z2N A;  4BBK A;  3ENB A;  5DHF B;  4I6L B;  2GBJ A;  1WGG A;  3V6C B;  2E2X A;  3OLM D;  4EFO A;  1B55 A;  3E9P A;  1D3Z A;  4MJS B;  3LJ3 A;  3PSE B;  4IC7 B;  4Y94 A;  4WJ7 A;  2KX3 A;  2V4L A;  3W1S A;  2N0Y A;  2G45 B;  5JLJ B;  4GSW A;  4KSL C;  2ZJD A;  2J59 M;  1P98 A;  1AAR A;  3MJW A;  2O2V B;  2FAZ A;  1V49 A;  5C23 A;  1UBQ A;  4BOS C;  3KRW A;  5D6J B;  2V1Y A;  4FJV B;  3CMM B;  1UGM A;  5DH9 B;  2MQJ A;  3V61 A;  1FHW A;  4JGH B;  3QA8 A;  1P5T A;  1X11 A;  2K25 A;  2DHZ A;  3B1L X;  2KFK B;  2DYO A;  3OJ4 B;  3ZTC A;  2DHI A;  4ANV A;  2NPT B;  1EO6 A;  1TTN A;  4NY0 A;  1I2H A;  3L10 B;  5DPW A;  4GGQ A;  5CHF A;  1WZ3 A;  2Y5B B;  2L76 A;  1V9J A;  4CHM A;  1WRD B;  2IFS A;  4CHK A;  3ODX A;  3UZT A;  2VRW B;  4MDK E;  3EFU A;  3SU8 X;  1Z2M A;  1NTY A;  4II3 B;  3QAQ A;  3DCG A;  4DBB A;  1WR6 E;  4CYE A;  2FID A;  4E3C A;  3A1Q A;  2NBU A;  2WYQ A;  3X0W A;  1WH3 A;  2N4F A;  3WIM A;  1YJ1 A;  2CR5 A;  3A4R A;  4MSM B;  2Z0P A;  2UYZ B;  1KOT A;  4L6E A;  4NPN A;  4G11 A;  3U30 A;  2AL3 A;  1V81 A;  1P3Q U;  2MLB A;  4JKE A;  1OMW A;  2GS0 A;  2K6Q A;  3TFM A;  5D3V A;  5DI9 B;  2KFJ A;  1YIW A;  1UEL A;  2DX1 A;  1ZM0 A;  2GBM A;  4JKG B;  2G3Q B;  4TYZ A;  4KAX B;  2MW5 A;  3VH4 B;  5CLQ B;  4MH0 E;  4XWX A;  2MX2 A;  1P1A A;  4KZ0 A;  2MCN B;  1H10 A;  3QC8 B;  5CLL B;  3Q3J A;  2PZ1 A;  1M7R A;  1X1G A;  2N7D A;  1UBI A;  4GDK A;  4HK2 A;  3QK0 A;  1E8W A;  3FEH A;  4FJZ A;  3DVG Y;  2IBI B;  1TGZ B;  2BKR B;  2KDE B;  2WWZ A;  3NSU A;  2NVU I;  1UPQ A;  2FJ9 A;  4MSQ B;  1V5U A;  3NS8 A;  4IM3 A;  4HHV A;  4TV3 A;  1KJT A;  3L17 A;  1UPR A;  1IRS A;  3N7C A;  1YD8 U;  4ANW A;  2DHJ A;  2MKR A;  2KAN A;  2CS4 A;  4BFR A;  1ZVR A;  2LXA A;  3PZD A;  3FSS A;  4BBN C;  2KWV B;  5D3X A;  3SBG A;  2LVP A;  1FB8 A;  3IBE A;  1E7U A;  2BWF A;  5DPT A;  1VBG A;  5D94 A;  4DX9 0;  2KLC A;  3SBT A;  1I35 A;  1WJU A;  2UWQ A;  1WJN A;  3TVV A;  3ALB A;  2M0X A;  2J0K A;  2OQB A;  3QQ8 B;  4HVB A;  1YX6 B;  4B6W A;  2JZ3 B;  4X57 B;  3RT3 B;  1UEF A;  5GOW B;  1X86 A;  5BO4 B;  5D3W A;  3ZRC A;  1WI0 A;  2YLM A;  4B9K A;  1I42 A;  1Q67 A;  3KZ1 A;  1EGX A;  2KKC A;  4WJP A;  4NAW A;  2L3Z A;  4NJ6 A;  3ZRF A;  5J18 A;  2N9E B;  4HDQ A;  3AU4 A;  4DHZ B;  3NY5 A;  4HAU B;  4K2O A;  4A5K A;  3VOQ A;  1LXD A;  1WR1 A;  5JH5 C;  4TUU A;  4IOY X;  5KQ4 A;  5D2M B;  4JKD A;  1LW3 A;  1WJ1 A;  4F1S A;  4F7U P;  3VUW A;  4ICU A;  4GU2 A;  2LWP A;  3M95 A;  2LVO A;  1J8C A;  2Y8F A;  1UNR A;  2KDI A;  3RD2 A;  4EEW A;  2LZ6 A;  3V60 A;  1KC7 A;  3PHX B;  1MAI A;  4FLH A;  2YS1 A;  3OAN A;  1MK9 B;  3UQA A;  4G50 A;  2MBO A;  3D32 A;  3M62 B;  1BTK A;  3KVF B;  1P6S A;  3RCZ A;  4RMA A;  2KOX A;  1U5F A;  2COA A;  5C5B B;  3QAR A;  1RJ2 A;  4IG7 B;  2VRR B;  3A8P A;  1ZC3 B;  2CU1 A;  3KSY A;  4GIV A;  4PS3 A;  4XX5 A;  5D3Y A;  5HE1 A;  1DDV A;  1H4R A;  2KDF B;  4ZRJ A;  4KIK B;  1T0Y A;  4HAZ B;  5FI1 A;  4HDO A;  2YT1 A;  3IG3 A;  2RQ1 A;  2LOZ A;  1E90 A;  2D11 A;  4MJS A;  5AZH A;  2LUE A;  4W9G A;  3F5R A;  3H9D A;  1AQC A;  2J0J A;  3ULB A;  3ZNZ B;  1M7E A;  5E6O A;  2COF A;  2DZK A;  1NI2 A;  1QQG A;  5J2R A;  3KH0 A;  3TO1 A;  3ZNH B;  5L81 A;  1RRB A;  2O2V A;  3DVG X;  5KQ1 A;  2EJ8 A;  1WGR A;  5E6P A;  2PE6 B;  3ZKJ C;  1ZGU B;  2CHX A;  3E9O A;  2I1K A;  2MFQ A;  4NSW A;  3PSC A;  2DAJ A;  3QWZ B;  2OTX A;  4G3X B;  5JHB A;  3O96 A;  1UNP A;  1EAZ A;  3QJZ A;  1GC7 A;  2D4Q A;  2XK5 B;  2A4Z A;  2L05 A;  1WF9 A;  4CHJ A;  2KFK A;  1E5W A;  3TL5 A;  1WI1 A;  2UVM A;  4E71 A;  4GXB A;  2NPT A;  4KHA A;  2DYB A;  2GOW A;  1FHX A;  4EZL A;  3ECI A;  3R7R A;  2B3A A;  1EF1 A;  3MPX A;  2W2X C;  4JIO U;  4MGK E;  2KK8 A;  4JK9 A;  5DHA B;  4FHK A;  2HTH B;  3VAW A;  3ML8 A;  3EPY A;  5AZG A;  4FJY A;  2QKM A;  1FOE A;  2I5F A;  2EKE C;  2KN5 A;  2LKO A;  1MIX A;  2AYO B;  1UZX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...