4NY0A

Crystal structure of ferm domain of human focal adhesion kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
ERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGLRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title FAK dimerization controls its kinase-dependent functions at focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ny0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ny0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ny0A01
3U30A 4IC7B 3N30A 2UZSA 1Z87A 4KDIC 3NHEB 3AU5A 4FLHA 1EAZA 1UD7A 2ROZB 3PVLA 3AI5A 2GBKA 3VVWB 1IPGA 1X1MA 5HE0A 4GIVA 3ZNGC 4BBKA 1P9DU 1V49A 2EKEC 2NPTA 4J6IA 2MFQA 3AULA 1V5TA 2KD0A 2RGFA 3QA8A 2ELAA 2IYDB 3DVNV 4F7HA 2IO1B 1RFAA 4MH0E 2B3AA 4NAWB 3ZNHB 2L1CA 4GN1A 2VKIA 3LJ3A 1R4MI 2BCJA 3RCPA 5D2MB 2K2JA 1C1YB 3A4RA 4AJYB 1WGUA 3GZNI 2D9VA 2KMCA 4EKUA 3PREA 3UF8A 4JIOU 2PPHA 1WH3A 4M0WB 3DBHI 4FJZA 4II3B 4KDLB 2L3ZA 2WDTB 5JH5C 4HK2A 3PZDA 1WGRA 2NS5A 4G3XB 3QC8B 2KZRA 5GMVA 1V86A 1V9JA 1WGDA 3APDA 3EFUA 5DPWA 2Q13A 2Z0OA 3FSSA 5KQ4A 2KFKA 1I7AA 4MY6A 1J0WA 2HTHA 4NQKE 3TCAA 2FCQA 5KQ1A 4MSMB 4W9LA 1EVHA 3DXCA 1LFDA 2MDXA 2UWQA 1NBFC 3EC8A 4WAAA 4WJ7A 4EFOA 1ZC3B 3GYPA 4LDTB 3DCGA 2FJLA 2W2XC 3HM6X 2RQ1A 1ZC4B 2LOXA 2WH5A 3RD2A 2JZZA 2MKRA 1GC7A 4NSWA 1WMHB 5HKHA 3WIMA 5C23A 1UEFA 2X18A 1WXMA 4HHVA 1K5GB 3A9JB 4WVFB 4IM3A 5EFXA 5E6NA 4KIKA 1WVHA 2YRYA 2PJHA 2YVCA 2C9WB 1VCBA 1V6EA 2MCNB 1N3HA 2L0FA 5KHOA 4WJQA 1WXVA 2LOZA 1MK9B 4MJSA 4A6FB 1K8RB 4CHKA 1WI0A 3H1UA 1W1GA 2LVPA 2CR5A 1WZ0A 2JP2A 5D3VA 2KC1A 5KHQA 1WGQA 1IRSA 1WI1A 1WJMA 3JSVB 3R3MA 4B9KA 4A20A 2N23A 2D4QA 2KUPA 3PG7A 1WR6E 2C7MB 4W9DA 2GS0A 1V5PA 2CHZA 2D2QA 3C0RB 2HJ8A 2OOBB 2JY6A 4MK0A 5CHWA 1DYNA 4NJ7A 1YIWA 2K8BA 4E74A 2PEAA 3QWZB 2JXXA 2IY1B 2CODA 1QQGA 1WJUA 3NS8A 2C5LC 1RRBA 5AZFA 3ZVVA 1V88A 2WX1A 4MDKE 5C1ZA 5J3YA 3FP5A 3TO1A 2MLBA 3Q3FA 1KI1B 2M14A 4DDGD 1ZM0A 2KANA 4KZ0A 4MELA 3P7ZA 4BBNC 2BWES 3GOEA 2H7EA 4MGIE 1RAXA 3NOBA 3W1SC 3ZNZB 4MEMA 2MA9B 4BBNF 4GMVA 2L05A 3VHTC 2ASQA 2MSED 3UGBB 2J7QB 3H6NA 1G6JA 2N1VA 2P0FA 2RNRB 3CIKA 1WX9A 2DHIA 1WJ4A 3DVGY 1I2HA 1YD8U 4HPMB 2Y7BA 2D9XA 1M7EA 1TTNA 1DBHA 4F1SA 2LWPA 2DX1A 3IHPC 4CYEA 1ZSQA 1I35A 1TGZB 3APFA 3PS6A 3AU4A 2CB8A 3SHQA 3L54A 4WJNA 2ADZA 5JHGA 1OMWA 3A1QB 2RVBB 4X57B 3VUYA 3ZDTA 4E3CA 3M62B 3WYFB 4PNKA 2BKRB 3A33B 4DDID 4MGZE 2JZ3B 2LKOA 3IVFA 4AWJA 4IWOA 3HW2B 1NTVA 2DZJA 3APCA 3LDZE 1P98A 4F8CB 2JT4B 3ALBA 1GC6A 1XR0B 3KH0A 4BVUC 3T8MA 3DOWA 2UVMA 4WWOA 1XD3B 3V6CB 1TBEA 2KDBA 2LULA 2LGYA 2ZJDA 1Z5SB 2MX2A 2NBVB 1ZGUB 4GDKA 2R0DA 2K8HA 3L13A 5C79A 1X11A 2LZ6A 1V81A 3PSEB 2DZMA 3DVNU 2L76A 2MRPA 3KYDD 3R66C 4ZYNA 4HCPB 3X23A 3ZTDA 5KCVA 4WWPA 4G50A 3ZRCA 3TFMA 4GSWA 2LXAA 3NZUA 2K00A 3QCAA 4LCDE 2WWZA 4DX90 2IY0B 2KTRB 3U7DA 1H8CA 2ZVNA 4WSFA 4B6HA 1UELA 4EOYA 1ACAA 3ODXA 1OTRB 4WWNA 1WGYA 2CQUA 3X0WA 2DYQA 4IFSA 3OJ3A 3F0WA 3TMPB 1Q0WB 2ZNVB 4RM9A 2CRFA 1M94A 1PFJA 3QBVB 2GBMA 3KRWA 2DZIA 4URKA 3HQCA 3D32A 4NAWA 4DHJB 4K17A 2IYBA 2DHJA 2D11A 2MP2B 2J0JA 1NTYA 4XX5A 2EC1A 1UPQA 2KLCA 2Y8FA 1W1DA 3KUDB 2GCLA 4P7IA 2D9YA 2K6QA 1KZGA 4AJWA 2KN5A 5HE2A 1FAOA 1UBQA 2OJRA 4M8MA 2YSZA 3V62A 4CO7A 4IWQA 2LYDA 4GB9A 3PTFC 1LW3A 3S2AA 1NDDA 4MT7A 4PYUA 3TW1A 3PV1A 2FIFA 4KSKC 5CX3A 1GJZA 2LJ5A 1WG7A 4RM8A 3CMMB 3JYUA 3DXDA 3SU8X 4DK5A 2G4SA 4MGYE 2DYMA 1FHWA 1WFYA 1NU2A 4ZRKA 1DDVA 4W9CA 1EF5A 3FLVA 3PPAA 1WM3A 1WY8A 1BTNA 2L2IA 1HB8A 5D6JB 2RR9A 3FEHA 2KQ7A 4AUQC 4FADA 1WRDB 3EECA 1UNQA 2M0XA 3H9DA 3DBSA 3PRZA 1MG8A 4A6HA 1V2YA 4HCNB 1HB6A 3PHWB 5DHFB 5E6OA 4TV3A 2MWNB 1WF9A 1L7YA 4H8SA 4WJPA 1OY2A 3QJZA 1E5WA 1U5DA 2KOXA 5C5BB 3L0WB 3UIPB 2FNJB 1WMHA 4PS8A 4YL8A 3VUXA 4II2B 2COCA 2XBBC 1V5UA 3V61A 3L10B 1W1HA 1CMXB 5DPTA 1V89A 3A9JA 3ENEA 3MTNB 1P3QU 5J3QA 2WYQA 3H7SA 2DKQA 2DX5B 3VTUA 3ZLZA 3GYOA 2DYBA 1WM2A 4W9IA 4PYZA 1IP9A 4A6FA 2KDIA 3NSUA 3RULA 3PGEA 3PP2A 1ZVRA 4YONA 1SE9A 4W9HA 4ANWA 1U27A 2NBWB 3JSVA 2LG1A 2PE6B 1KZ7A 1S3SG 1S1QB 2G4DB 4HJKA 3G9WA 3V6EB 1X05A 2LI5A 4NQLB 3HM3A 3RT3B 2I1JA 4PS3A 3UQAA 4LJOB 5JHHA 4TYZA 3VTVA 1BT0A 2IO0B 2LGXA 2GCJA 2JVCA 4F7GA 2KJHB 3N32A 5LXHA 1TZ1A 2KXJA 5HE1A 2N7DA 4HDQA 2W2WA 3IFWB 3L08A 4HPLB 1AWEA 3W1YA 3L17A 2IBIB 3A8QA 1UH6A 2RSGA 1GUAB 3WANA 2R2QA 4Y94A 2MQJA 2DA0A 2V4LA 5GOWB 3VFKA 2MBBB 5D94A 4A6KA 5JZEB 1MKEA 4HB0B 3A4SC 2BPSA 2RPQA 1JRUA 5DPSA 3PHXB 2H7DA 2L0TA 3M3JA 3ML8A 4KSLC 4HWIB 2Z0EB 2CHXA 3VIAA 5DHAB 2V76A 2C7HA 5CLQB 4GMXB 2LD9A 2AL6A 5DH9B 2ZPNA 2RD0A 4GZUA 3D8DA 3QAQA 1BWNA 2JRHA 3PVUA 1KLVA 3ZKJC 2FCSA 2KC2A 4ANUA 2DYNA 2DAJA 1P5TA 3ZVRA 2I5FA 3T9LA 2KGXB 1Y5OA 4LDTD 3RZWC 4CHMA 2CHWA 2BYVE 4HAVB 4FA6A 3RYTA 1Z2MA 5CHFA 2G45B 4WQOB 4KHOA 4GPTB 4DXAB 2NBUA 1J0GA 1M7RA 1LQBA 1RLFA 3QX1A 1H4RA 1E8XA 3A1QA 1IYFA 2YLMA 3QIJA 3H7PB 1P3RA 2IFSA 3WALA 3TL5A 1V61A 2N4FA 3CSTA 2R09A 3PSCA 3BJIA 3HK0A 4I6PA 4GU2A 3RUIB 3VH3B 2KDFB 4N9F4 1SHCA 2KK8A 3PVWA 2K1FA 2DENB 1AQCA 2N1WA 4EZJA 1B55A 1XODA 3ML9A 1NTIA 2BWFA 4AOFA 1WX8A 3A9KB 2LVOA 2KCJA 5TR5A 3ECIA 2GBNA 3ODOA 1KM7A 2NMBA 2O6VB 2L8JA 5JP4A 2KMAA 3TJPA 1YJ1A 3EPYA 2KDEB 1WXSA 1ISNA 3PRMB 2K25A 3BY4B 1GG3A 1FGYA 4K81A 2OTXA 4MGKE 2FDQA 2DHKA 1LXDA 1X1GA 1DDWA 3UIOB 2ZZPB 3KUZA 1J19A 3B0AA 3U8ZA 2VRRB 2KWCA 5CHVC 2YS5A 3ML4A 2JF5A 3SV1A 3D8EA 3TBLD 3OJ4B 1WIAA 4PS7A 2QHOA 3DDCB 1XD4A 5FI1A 2KVRA 2KTRA 1FHOA 1UBIA 3ULCA 1E7VA 4D0NB 3PLVA 3RZFA 1GNUA 1FOEA 2M38A 2Z0DB 4W9FA 4BKGA 5LONB 4A3PA 4AP4C 2KWVB 2L00B 2D3GA 2D9WA 4K2PA 4KAXB 3MJWA 3VUWA 3ONSA 1PQSA 3AJ4A 4GDLB 2ROVA 1YQBA 2I5CA 2KKCA 4HAWB 1VD2A 1FB8A 3KUCB 2P0HA 2FAZA 2DZKA 2ZEQA 1K5DB 2IO2B 3ZDMC 2W2XD 4NJ6A 2FJ9A 2ZCBA 2COFA 2YT0A 3T06A 2DN6A 1ZW7A 1U4AA 3SUZA 4E71A 4M8NA 3UINB 2GBJA 1UPRA 2MP2A 3HIZA 3B08A 5IAAC 1EGXA 1DROA 2LGDA 3IG3A 4EMOA 4C0AA 1XX0A 3VH4B 4HAYB 1XT9B 2DHZA 3QARA 4HAUB 3V60A 3M63B 3LJUX 2COAA 1XQQA 1UGMA 2J0MA 2WX0A 5LXIB 2MWSB 3Q3JA 4K2OA 1Q1OA 5J2RA 2W9NA 2RGNB 1Q67A 4EUTA 2EJ8A 2LBBA 4IOYX 2GMIC 4DHZB 4DX8A 2IO3B 4W9JA 5L83A 3VTWA 1V5MA 4MSQB 4OVVA 1OQNA 2YS3A 2YS1A 1KJTA 4HLEA 2NR2A 3OANA 2XK5B 2N7EA 2GBRA 2UZRA 1E7UA 3QHTA 1A5RA 5DCNA 5BO4B 3NZSA 2L7RA 2P0DA 4FULA 4DWFA 2D07B 1E8YA 3KVFB 4DHZE 1UNRA 3PRPB 4DBGA 4KHBB 1BAKA 2KTFA 4XWXA 3QWMA 1WE6A 3CXBB 1MIZB 4TKNA 1Y19B 1FHXA 2C60A 2QKLA 3DQVA 4HXDA 2D10A 2I1KA 2M1MA 4HB3B 3VAWA 5C5BA 2MBQA 4FHKA 4HATB 4K7WA 2FIDA 4EZLA 2KQSA 2A5UA 4XC2A 4ASWC 2GJYA 3PEGA 4B6WA 4HB2B 3MHSD 1E90A 1J8CA 4IAPA 2N9PC 1E8ZA 4FBJB 3V5WA 2BGFA 3OAWA 2M8SA 2DX5A 3A8PA 2J59M 5AZGA 3L16A 2CY4A 3CF6E 3OLMD 3D8FA 2XQNM 2A4ZA 2ZPYA 2GOWA 2CY5A 5AZHA 2CS4A 1PLSA 4I6LB 5G55A 4F7ZA 3DVGX 5LLIA 4JGHB 2VSZA 1BTKA 3ZNID 1DDMA 5LOPB 4W9EA 4K1RB 2AWTA 5L81A 3HHMA 4A5KA 4HVBA 1FGZA 1AARA 2DTCA 2NPTB 2MBEA 3N3KB 5C16A 2ABDA 4I6NB 1WGGA 4KZCA 2REXA 5J3TA 2EMSA 2C7NB 2FCNA 1XKEA 4EJNA 2LXCA 5E6PA 4ZRJA 2K39A 1F9JA 4DHJD 4ICVA 3AXCA 3SYXA 2CU1A 4DBBA 5D3XA 2HRJA 3ZTCA 2D9ZA 3B1LX 3O96A 1EO6A 1P0RA 1XCGA 1WYWB 5C6RA 2G3QB 4L6EA 1E8WA 4F7UP 1P6SA 2UYZB 1PMSA 3DBRI 2JRIB 5D3YA 4HDOA 2R2OA 1QZEA 2CAYA 2K2UA 2LRWA 2EMTA 3ULBA 4GGQA 1SIFA 5J17A 4FN2A 2XEWA 2KFKB 4FJVB 1U2BA 2HTHB 1WR1A 5IA7A 4LJPB 3WAPA 3SNHA 3KRXA 1P1AA 1EUVB 4XZ4A 2DFKA 2YT1A 1ST7A 2G35A 1QC6A 2Y5BB 1ZKHA 1EF1A 3M95A 3SO6A 3DXEA 1MK7B 3ZO5B 2KO3A 2FUHB 4Z2MB 1Q5WB 3A98B 3BINA 2QKMA 4KHAA 3O65B 3H7PA 2BF8B 3WA0A 1HE8A 3DPDA 1NI2A 2ZCCA 4G0NB 1X1FA 4KIKB 4IUMB 2MBHA 1UZXB 2KX3A 2LUEA 5DIFB 4ICUA 2N9XA 4BKSA 1C3TA 1OGWA 4FJYA 5CTRC 4IM0A 3VQIA 3R7RA 1MAIA 4MJSB 5D7GA 4W9KA 5CLLB 4GXBA 2Z0PA 1MPHA 4ZDVA 4ANXA 3UQBA 1I42A 2AL3A 3A9KA 2DKPA 1TJ6A 4HAXB 2O6VA 4TQ1A 2ZVOA 3QK0A 3PT2B 4HAZB 2COPA 3TIXA 4IW0A 1D3ZA 2LRUA 1L2NA 3WAOA 4RMAA 2Z0QA 1UNPA 2K8CA 4BFRA 2N9EB 1SGHA 2JUOA 2KFJA 1U5FA 4OVUA 3CSFA 3JW0X 3NY5A 1R4NI 1WX7A 4ZRIA 2NVUI 3QQ8B 3K9PB 3SDLC 3DBLI 3ZUNA 1X86A 2ZNVC 2KJ6A 4EEWA 4IM2A 2PE9A 2KWUB 4CHJA 2DLWA 2VRWB 2KHWB 2IZVB 1FXTB 5AEKB 2M17A 4B95A 4W9GA 2O2VA 4G11A 1WZ3A 4GDLA 2RUKB 4EZKA 2MBOA 4IG7B 2V1YA 2KX0A 1OEYA 2BKFA 2OQBA 5HE3A 3UZTA 3KY9A 1YX6B 1RJ2A 5JLJB 4NPNA 5L95C 2JWZA 2J0KA 3VOQA 3MPXA 3W1SA 1OEYJ 5G2NA 2CKHB 2KNBA 2RSUA 1V80A 3MDBC 4Z2NA 1TXDA 2LVQA 1MIXA 4BOZB 4IWPA 3F5RA 3ZW3A 5DPRA 2BYFA 5D27A 2V3SA 2PZ1A 2AEHA 1WJNA 1HBKA 2RLOA 1U29A 4NNJB 1LB1A 3ODWA 2O2VB 4K7UA 5EDSA 1NVLA 3PLUA 1U5GA 4KVGB 1WGHA 4FHJA 4BKTA 3KW5B 2FCMA 3KYCD 1YX5B 3I3TB 2XK5A 2NCNA 2HE7A 2YF0A 4BOSC 2MW5A 3P2BA 5FR6A 1RRPB 1V5OA 5JHBA 4A3OA 5J18A 2JPHA 2K6DB 3K9OB 2N0YA 5DI9B 3M1IB 1Y8RC 3P6AA 4BKSD 4PQ0A 1OQYA 3R7QA 2LASA 3VXWA 2AYOB 2Z59B 5D3WA 2Y8GA 3ZRFA 3ZIMA 3KSYA 3N7CA 3EHVA 4JL9A 4JLCA 2E2XA 2NZ8B 4ANVA 1H10A 4HB4B 4WJOA 2O6VD 3IBEA 5JHAA 5IJMA 4NY0A 3TVVA 2HD5B 4GDKB 2BYEA 1WE7A 4MM3A 1U5EA 1KOTA 3JVZX 3FM8C 2ELBA 4GOCA 4K7SA 5FI0A 2DYOA 4TQ0A 3RCZA 2M4NA 1WJ6A 1T0YA 3WAMA 1TQZA 2DAFA 1LM8B 1WXAA 2P8VA 4JQWC 4TUUA 1WJ1A 3SD5A 4KV2A 2KLGA 2KJRA 3VDZA 3KZ1A
chains in the Genus database with same CATH superfamily
3U30A 4IC7B 3N30A 1PYWD 3P4PB 2UZSA 4OZBA 3BIID 3ZJTA 1Z87A 3Q2AC 4DIXA 4KDIC 3NHEB 3AU5A 4L1BA 3WCQA 4FLHA 1EAZA 1UD7A 2ROZB 2LGSA 3PVLA 3AI5A 2GBKA 1GAQB 5BYSA 4ZRPA 3VVWB 2INNE 4ILGB 1IPGA 1OFFA 1X1MA 5HE0A 1QKZA 1FIQA 1JWMD 4GIVA 1L4ZB 3ZNGC 4BBKA 4RGOS 3GE8C 2MHJA 1P9DU 2V3PA 3AM9A 1V49A 2EKEC 2NPTA 2TSSA 4J6IA 2MFQA 3AULA 3GE3C 3Q8EA 1V5TA 2KD0A 2RGFA 3QA8A 4M00A 2ELAA 1DIKA 2IYDB 3DVNV 4F7HA 2IO1B 4FXCA 2QJLA 1D4BA 2ZW1A 3NWDA 5MPOA 2Q5WD 1RFAA 4MH0E 2B3AA 3P4QB 4WQMA 4NAWB 3ZNHB 2L1CA 1SB3C 3MJ5A 4GN1A 2VKIA 3BYTB 3LJ3A 1R4MI 1JALA 4WWMA 2BCJA 3Q8BA 3RCPA 5M4YB 5D2MB 2K2JA 1C1YB 3A4RA 1YOVB 4AJYB 3SEBA 3AEGB 4S17A 1WGUA 3GZNI 3N1YC 1TKYA 2D9VA 2KMCA 3Q8FA 4EKUA 1XCQL 2LFIA 3OWEB 4NJCA 5HFYA 3PREA 3UF8A 4JIOU 2PPHA 1WH3A 4M0WB 3DBHI 4FJZA 5EE1A 2RDBC 3RMKC 4II3B 4KDLB 2OJWA 2L3ZA 4AS1A 2WDTB 2PKOA 5JH5C 4C7ZA 4HK2A 2IJ0A 3PZDA 1SEBD 1WGRA 2K3UA 2NS5A 4G3XB 3QC8B 2KZRA 4K3CA 5GMVA 1V86A 1V9JA 1WGDA 5JXVA 3APDA 3EFUA 1F77A 4IKGA 1MFWA 5DPWA 2Q13A 3PZ7A 2Z0OA 3FSSA 5KQ4A 3NRZA 2DWQA 1J7CA 2KFKA 1I7AA 4MY6A 3DWMA 2B76B 2QSDA 1J0WA 2HTHA 4NQKE 4D6WA 1ESFA 3MC0B 3TCAA 2FCQA 3AE1B 5KQ1A 4MSMB 4W9LA 1EVHA 4D2KA 3DXCA 3BVMA 1LFDA 2MDXA 3TSSA 4R3DA 2UWQA 1NBFC 3EC8A 3ZXVA 4WAAA 3VR9B 4WJ7A 3W5UB 1ZXIA 1GOZA 4EFOA 1ZC3B 3GYPA 2WXQA 3DCGA 4LDTB 2FJLA 2W2XC 1L4DB 1NI3A 3HM6X 1AW7A 2Y3AA 2RQ1A 2CJNA 1ZC4B 1K53A 2M56B 2NTTA 2K9XA 3DHHC 1V97A 2LOXA 1YN4A 2WH5A 3RD2A 2JZZA 3W5VB 1MJDA 2XN9C 2MKRA 1GC7A 4NSWA 3KLSX 1JWUD 1WMHB 5HKHA 3WIMA 2PVOD 2MJ3A 5C23A 1FRRA 2BB6A 1UEFA 3TUOA 2X18A 3MFGA 1ROEA 1WXMA 4HHVA 1K5GB 3A9JB 4WVFB 4IM3A 5EFXA 5E6NA 4KIKA 1WVHA 1K52A 2YRYA 2PJHA 2RPVA 2Y5CA 1CQVA 1P7EA 4BZAA 2YVCA 2C9WB 4LLGM 5TSSA 1Y56A 1VCBA 1V6EA 2J42A 2MCNB 1N3HA 2L0FA 5KHOA 4WJQA 1WXVA 2LOZA 2INCC 3SBGA 1MK9B 3NWFA 4MJSA 4A6FB 1K8RB 1KLUD 2RDGA 4CHKA 1WI0A 2JU6X 3H1UA 4GLSC 1W1GA 1QOFA 2LVPA 2CR5A 4OW0A 1WZ0A 2JP2A 1TS2A 5D3VA 2KC1A 5KHQA 1WGQA 1FPYA 1IRSA 1WI1A 1WJMA 3JSVB 3R3MA 4B9KA 4A20A 2N23A 2V3NA 4YT0B 2D4QA 2KUPA 3PG7A 1FEHA 1WR6E 2C7MB 4W9DA 2V4IB 4XE0A 2GS0A 2L1AA 3FAHA 1V5PA 3BYYB 2CHZA 2D2QA 3C0RB 2INDC 2JYEA 2HJ8A 2OOBB 1ZP0B 4DXGA 3AEFB 2JY6A 4ZOHC 4MK0A 5CHWA 1B9RA 1DYNA 4NJ7A 1YIWA 2K8BA 2D3BA 4E74A 2PEAA 3QWZB 5IRSA 2JXXA 2IY1B 4XDCA 2CODA 1QQGA 1WJUA 3NS8A 2C5LC 1RRBA 5AZFA 3ZVVA 2VZKD 1V88A 4ACFA 2WX1A 4MDKE 5C1ZA 4PT5A 5J3YA 3FP5A 3TO1A 2MLBA 4IDIA 3Q3FA 3ENBA 1QOBA 2PMVA 1KI1B 2M14A 4DDGD 1ZM0A 2KANA 4KZ0A 4MELA 3P7ZA 1XLPA 2BBCA 4BBNC 4HKZE 2BWES 3GOEA 2H7EA 4MGIE 1RAXA 3IAM1 1SBBB 1NYRA 3NOBA 3NUHB 3EGRA 3W1SC 3ZNZB 4MEMA 2KUQA 3AV8A 4JWSC 2MA9B 4BBNF 4RH6A 1K50A 4GMVA 2L05A 3VHTC 2Z4DA 2ASQA 2MSED 4NAMA 2MH7A 3UGBB 1F2RI 4LNNA 3FILB 2J7QB 3H6NA 1G6JA 2N1VA 2P0FA 2LMCA 2RNRB 3CIKA 2MEKA 1WX9A 2DHIA 1WJ4A 3DVGY 1I2HA 4XWWA 2WS3B 1YD8U 4HPMB 2Y7BA 2YT2A 1R7SA 2D9XA 1M7EA 2G9HD 1WGKA 1TTNA 2K22A 1TZOA 1DBHA 4F1SA 1VJKA 4LK0M 4L1RA 2LWPA 2KT7A 3OG5A 5HG2A 2DX1A 1QT9A 2WDQB 3IHPC 3RNGC 4CYEA 1ZSQA 3V3XA 1I35A 1TGZB 3APFA 3PS6A 4XGAB 3AU4A 2WXIA 2CB8A 3SHQA 3L54A 4WJNA 3RN9C 2ADZA 5JHGA 2H89B 1OMWA 2BB5A 4KGSA 3A1QB 2RVBB 2WNMA 4X57B 4A90A 3VUYA 3ZDTA 4E3CA 3M62B 4KGRA 5JVLA 3WYFB 4PNKA 1ET9A 2XNAC 1FCLA 1IBXA 5IOIA 2BKRB 3A33B 3I63C 4MGZE 4DDID 4Q2JA 2JZ3B 2LKOA 4OZAA 3IVFA 4QJ4B 4RF1A 4AWJA 4IWOA 1FNWA 3HW2B 1NTVA 2DZJA 1V1PB 3APCA 3A58A 4A6QA 3LDZE 3AMZA 1MPEA 1P98A 2Z59A 2Z8LA 4F8CB 2JT4B 3ALBA 1GC6A 1XR0B 3KH0A 4C4VA 4BVUC 3T8MA 3DOWA 2UVMA 4WWOA 1XD3B 3NW8A 3NS1A 3V6CB 1TBEA 4JWUC 1A70A 2LULA 2KDBA 2LGYA 2ZJDA 1Z5SB 4WURA 3ZJVA 4CQNA 2MX2A 2IGHA 1N62A 1YJJA 1SIJA 2NBVB 2X0SA 1ZGUB 4GDKA 2R0DA 2K8HA 2Y5PA 3L13A 4OHJA 5C79A 1X11A 2LZ6A 1V81A 2WU2B 3PSEB 1IBXB 2VH1A 2DZMA 3DVNU 1KFYB 2L76A 2MRPA 3KYDD 3R66C 4ZYNA 4HCPB 3X23A 3ZTDA 5KCVA 4WWPA 2J52A 1IGCA 2WXMA 4G50A 2BS4B 1I7HA 3ZRCA 5HI1A 3TFMA 4GSWA 2LXAA 3NZUA 2K00A 1D6EC 3QCAA 4LCDE 2WWZA 3NVVA 4DX90 1K51A 2IY0B 2KTRB 4L23A 3U7DA 2W55A 4KGTA 4M01A 1H8CA 5T8IA 2ZVNA 4WSFA 4B6HA 2WXKA 4JPSA 1UELA 4EOYA 1ACAA 3ODXA 1PUTA 4P16A 1V8CA 2W82A 1OTRB 4WWNA 1WGYA 2CQUA 3X0WA 3NVZA 2DYQA 4IFSA 3OJ3A 1RYJA 3F0WA 1XLOA 3W2DA 3TMPB 1JWBD 1XEEA 1Q0WB 2ZNVB 2Z14A 4QAYA 2GRIA 1TIFA 4RM9A 2CRFA 3NWAA 1M94A 1PFJA 3QBVB 2GBMA 3KRWA 2DZIA 4URKA 1PGAA 3HQCA 3D32A 4NAWA 3RNAC 4DHJB 4ARCA 2QILA 4K17A 4C56C 2WQYB 2IYBA 2DHJA 4RGTA 2D11A 3MC9A 1FM0D 4C7YA 3PO0A 2MP2B 3MC8A 2J0JA 1NTYA 1I4QA 4XX5A 2EC1A 1UPQA 1C76A 2Y8FA 1W1DA 2KLCA 3KUDB 2GCLA 3TEZA 1HZ5A 4P7IA 2D9YA 2K6QA 1OQRA 1KZGA 4AJWA 2KN5A 3AEAB 1HEZE 3E9PA 3HSAA 3HUIA 5HE2A 4M0WA 1FAOA 3BVGA 1DOYA 1UBQA 2OJRA 5BMIA 4M8MA 3B2GA 4JKEA 2YSZA 3V62A 4CO7A 4IWQA 2LYDA 4GB9A 3PTFC 1LW3A 3S2AA 1NDDA 4MT7A 4PYUA 1IUEA 3W9CB 3TW1A 3PV1A 2FIFA 3SFDB 4KSKC 5CX3A 1GJZA 2LJ5A 1WG7A 4RM8A 4EE2A 2JZPA 3CMMB 3JYUA 3DXDA 2HDEA 3SU8X 4DK5A 3LXFA 2G4SA 1FD6A 2X8XX 4MGYE 2DYMA 1FHWA 3ABVB 1WFYA 1NU2A 4OZCA 3BK2A 4ZRKA 1DDVA 4W9CA 1EF5A 3FLVA 3PPAA 1WM3A 1WY8A 1BTNA 2L2IA 1HB8A 5D6JB 2RR9A 3FEHA 2VH2A 3I9V1 2KQ7A 5H8YE 4AUQC 1YJIA 1L0XB 4FADA 1WRDB 3EECA 4DXFA 1UNQA 2M0XA 1YN5A 3H9DA 3DBSA 3Q14C 3PRZA 3RI7C 1MG8A 4A6HA 2WXOA 1YNTE 1V2YA 2INPE 1HB6A 2FBWB 3AE7B 4HCNB 3PHWB 1QF6A 5DHFB 2GI9A 5E6OA 1GPXA 4TV3A 4H2AA 1T0QC 1JW9D 2N7JA 3T3OA 2MWNB 1WF9A 1L7YA 4H8SA 4WJPA 1OY2A 3QJZA 1E5WA 1U5DA 2K49A 2KOXA 3Q8CA 5C5BB 2YEPB 4RNAA 3L0WB 3UIPB 2FNJB 1WMHA 4PS8A 4YL8A 2DNFA 2IDYA 3VUXA 4II2B 2COCA 1VBHA 3Q3MC 2XBBC 2LHEA 1V5UA 3Q8AA 3V61A 3L10B 4M02A 2LGIA 1W1HA 3U2SC 1CMXB 4ARIA 5DPTA 1V89A 2WXJA 3A9JA 3ENEA 1J7BA 3N1ZC 3MTNB 1P3QU 5J3QA 2WYQA 3H7SA 4YTPB 3OHMB 2DKQA 2DX5B 1FXIA 3VTUA 3ZLZA 3GYOA 2WXPA 2DYBA 4OVZA 3AE4B 3DWGC 1FCCC 1WM2A 3SBTA 4W9IA 4PYZA 1ZUD2 4US9A 1IP9A 2KIGA 4A6FA 1GB4A 5FK9C 3AE6B 2KDIA 1T0RC 2N9KA 3NSUA 3RULA 3PGEA 4OSNA 1KRHA 4P6VF 3PP2A 3R8BA 4OT1A 1ZVRA 4YONA 3DHGC 3EUB2 1SE9A 4W9HA 3NG0A 4ANWA 1VBGA 1U27A 3B9JA 2NBWB 3IAS1 3JSVA 2J53A 2LG1A 2PE6B 2QDFA 1KZ7A 1S3SG 1S1QB 4HROA 2G4DB 3O13A 4HJKA 3G9WA 3KQ4A 3V6EB 2R2YA 1X05A 2LI5A 4NQLB 3HM3A 3RT3B 2I1JA 1C78A 4PS3A 1KBLA 3UQAA 4LJOB 5JHHA 4TYZA 2E6XA 3VTVA 4ILJA 1BT0A 1P7FA 5LNK1 2IO0B 2KMMA 2LGXA 4JK7A 2GCJA 2JVCA 4F7GA 1DYQA 2KJHB 4JKAA 4TSSA 3N32A 5LXHA 2QC8A 1N5XA 1TZ1A 4JKBA 2KXJA 2DBYA 3ZQ4A 5HE1A 1ZOYB 2N7DA 4HDQA 2LHDA 2W2WA 1PDXA 3IFWB 1D5XC 3L08A 4HPLB 1MHXA 1AWEA 1QILA 1TKGA 3W1YA 3L17A 1ZE3D 3E9SA 2IBIB 3A8QA 5AUIA 1UH6A 4WAFA 2RSGA 1GUAB 3WANA 2R2QA 4Y94A 2MQJA 1BXTA 2DA0A 4QJ5B 3N20C 1JWAD 2V4LA 5FKAC 1RFKA 5GOWB 2D3CA 3VFKA 4YXDB 1FFVA 2MBBB 1KC7A 1ZDXA 5D94A 4A6KA 1N5WA 2WP9B 5JZEB 1XLQA 2WGSA 1MKEA 4RGNA 4HB0B 3A4SC 2BPSA 4JKDA 3U7ZA 2RPQA 1JRUA 1L0VB 1ACCA 4B0MA 5DPSA 3PHXB 2H7DA 2L0TA 3M3JA 3ML8A 2UU7A 1I4PA 4KSLC 4HWIB 4S0RA 2Z0EB 3VR8B 3FILA 2CHXA 3VIAA 3NZ3A 5DHAB 2WXHA 2V76A 1I4HA 3E56A 2C7HA 5CLQB 4GMXB 2LD9A 2AL6A 4ZHPA 5DH9B 4KKJA 2ZPNA 1KF6B 4ZYSA 4MH8A 2V0GA 1NYQA 2RD0A 4GZUA 5D3DA 3D8DA 3E9OA 3EA6A 3QAQA 1BWNA 2JRHA 3PVUA 2QIEB 1WXQA 3AEEB 1NEKB 1KLVA 3ZKJC 1HTQA 2FCSA 1MI1A 4ILHA 2KC2A 4ANUA 2DYNA 4JKHA 2DAJA 1P5TA 3ZVRA 2EKIA 2I5FA 3T9LA 2KGXB 2KN4A 1Y5OA 4LDTD 4IOIE 3DHIC 3RZWC 4CHMA 1JROA 1N6ZA 4HAVB 1STEA 2BYVE 2CHWA 2JX5A 4FA6A 4RGMA 3RYTA 4P1BC 1VDVA 1Z2MA 5CHFA 2G45B 1BUIC 4WQOB 3RNFC 4KHOA 1CK1A 3ETRA 4JKGA 4GPTB 4DXAB 1SE4A 3PZ8A 1VZ7A 1BMLC 2NBUA 1J0GA 1M7RA 1LQBA 1RLFA 1SE3A 3QX1A 1H4RA 1E8XA 3A1QA 5I4DA 1IYFA 1TS3A 2YLMA 3QIJA 3H7PB 1P3RA 2IFSA 3WALA 3TL5A 1V61A 4XYCA 2N4FA 3CSTA 2R09A 2FJUB 3PSCA 3BJIA 3HK0A 5BMHA 4I6PA 4GU2A 3VRAB 3RUIB 2W54A 1V1PA 1CZPA 3VH3B 2KDFB 1ZPSA 4N9F4 1SHCA 2KK8A 3PVWA 1E6EB 2K1FA 2DENB 1AQCA 2N1WA 3P4RB 3U52E 4EZJA 1B55A 2WXNA 2CJOA 1UGJA 4YSZB 1XODA 1DOXA 3ML9A 1NTIA 2BWFA 3N9YC 1FO4A 4AOFA 1WX8A 3A9KB 2LVOA 2X38A 2KCJA 2PW9A 3U12A 3ECIA 5TR5A 4JKGB 4JKFA 3ODOA 1SJHD 3FVCA 1TY2A 2AQ1B 2GBNA 3AE2B 1KM7A 2N0SB 2NMBA 2I2YA 1QQRA 2O6VB 2L8JA 5JP4A 2KMAA 3TJPA 1YJ1A 3EPYA 2KDEB 1WXSA 1ISNA 4HJGE 3P4SB 3T3NA 3PRMB 2NBVA 1N60A 2K25A 3BY4B 1YQ4B 1GG3A 1FGYA 1FXAA 4K81A 2OTXA 2RMMA 2BQQA 4HEA1 3ZGZA 4JX1C 4MGKE 2GUMA 4US8A 2FDQA 2DHKA 1LXDA 3NVYA 1X1GA 4A55A 1DDWA 4QXAB 3UIOB 1RWSA 2NTSA 2ZZPB 3KUZA 1J19A 1EM7A 3B0AA 3U8ZA 2VRRB 2KWCA 1MG4A 5CHVC 2YS5A 4K3BA 3ML4A 2KWDA 2GB1A 2JF5A 3SV1A 3Q3OC 5FR3A 4QJ3B 3D8EA 3TBLD 3OJ4B 2PIAA 1WIAA 4PS7A 2QHOA 3DDCB 1XD4A 5FI1A 1WSPA 4ZHOA 2KVRA 2KTRA 1FHOA 4A9AA 1UBIA 3ULCA 1E7VA 4D0NB 3PLVA 3RZFA 1YMHE 3SFEB 1VLBA 1GNUA 1FOEA 2M38A 2Z0DB 1ENFA 2M0AA 2KIEA 4W9FA 4BKGA 1JDEA 5LONB 2BS3B 4A3PA 1PGBA 2V9HA 1F52A 4AP4C 2KWVB 4C00A 1V1OA 2L00B 2D3GA 2D9WA 4K2PA 4KAXB 3MJWA 3VUWA 3ONSA 1PQSA 3AJ4A 4HSIA 4GDLB 2LEKA 3ZJUA 2ROVA 1YQBA 2I5CA 2KKCA 4HAWB 1VD2A 2KAJA 1FB8A 3KUCB 1C4CA 2P0HA 1UUPA 2FAZA 2DZKA 2ZEQA 1K5DB 2IO2B 4WH4A 2BTEA 3ZDMC 2W2XD 4XDDA 2WXLA 2LJIA 1F2RC 4NJ6A 2FJ9A 2ZCBA 2COFA 2YT0A 3T06A 2DN6A 1ZW7A 1U4AA 1TYGB 3SUZA 4E71A 2IGDA 4M8NA 3UINB 2GBJA 3RNCC 1UPRA 2MP2A 3HIZA 1L6UA 2WDVB 3B08A 2KACA 5IAAC 1N63A 1QOAA 1EGXA 1XCTL 1DROA 1E9MA 2LGDA 3IG3A 4EMOA 4C0AA 2DLBA 1XX0A 3VH4B 4HAYB 1XT9B 2DHZA 3QARA 4HAUB 2ON8A 3V60A 3DBRB 3M63B 3LJUX 2COAA 1XQQA 3P42A 1UGMA 2J0MA 2WX0A 5BYQA 4KHBA 1ZXHA 5LXIB 2JWUA 2MWSB 3Q3JA 2K8EA 1AYFA 4K2OA 1LGRA 2R61A 1Q1OA 1WYGA 5J2RA 2W9NA 2RGNB 1YN3A 4HPPA 1Q67A 1MVKA 4EUTA 2EJ8A 2LBBA 4IOYX 2GMIC 1C9FA 4DHZB 4A8XC 4DX8A 2ZKMX 2IO3B 3AE3B 4W9JA 3BVZA 5L83A 3VTWA 1V5MA 4MSQB 1JCKB 4C80A 3R2TA 3E9LA 4OVVA 1OQNA 5H92C 5I2SA 1EU4A 1JWSD 2YS3A 3FKYA 2YS1A 1KJTA 1C4PA 4HLEA 2NR2A 3OANA 2XK5B 2N7EA 2GBRA 2UZRA 1E7UA 2JYTA 4GNKB 3QHTA 1A5RA 5DCNA 3GB1A 2D3AA 1SJED 5BO4B 1C79A 1MI0A 3AEDB 5IP4D 1QLBB 3NZSA 2L7RA 2P0DA 4FULA 4HRSA 2J4XA 4LNKA 4DWFA 3AEBB 2D07B 1E8YA 3KVFB 4DHZE 1UNRA 3PRPB 4DBGA 4KHBB 1BAKA 2KTFA 3Q3NC 4XWXA 1LO5D 3QWMA 1WE6A 3C19A 3CXBB 1MIZB 4TKNA 1Y19B 1FHXA 2C60A 2QKLA 1HA5A 3DQVA 1TS5A 4HXDA 4TMAB 4P1CC 2D10A 2I1KA 2M1MA 4HB3B 1KTKA 3VAWA 5C5BA 2MBQA 2L32A 4FHKA 4HATB 4K7WA 2FIDA 3IT6B 4EZLA 1HQRD 2N9LA 1Q10A 1FFUA 2KQSA 2A5UA 3AB5A 4XC2A 1IGDA 3Q69A 3I57A 4ASWC 2GJYA 4MM3B 1AN8A 3PEGA 4B6WA 4HB2B 2WU5B 3MHSD 1E90A 1J8CA 4IAPA 2N9PC 1E8ZA 4FBJB 3V5WA 2BGFA 3OAWA 2M8SA 2DX5A 3A8PA 2BYTA 2J59M 1D5MC 5AZGA 3L16A 2ONQA 2CY4A 3CF6E 5EE0A 2JXTA 1CJEA 1FNUA 3OLMD 3D8FA 1NVID 2XQNM 2A4ZA 2BVCA 2ZPYA 2GOWA 2OHFA 2CY5A 5AZHA 3SR6A 2I38A 3TEYA 2CS4A 5D3IB 1PLSA 3HVDA 4I6LB 5G55A 4F7ZA 3DVGX 3R2IA 3B2FA 5LLIA 1XF5L 2W3RA 4JGHB 2VSZA 2AQ2B 1BTKA 4MACA 5BYRA 1GB1A 3ZNID 4REZA 1DDMA 5LOPB 4W9EA 4K1RB 2AWTA 5L81A 3HHMA 1N61A 4A5KA 4HVBA 2RRFA 1FGZA 1AARA 2DTCA 1XO3A 2NPTB 2MBEA 4B0EA 1R4NB 3N3KB 5EE9A 4GOUA 5C16A 2ABDA 5G5GA 4I6NB 1WGGA 4KZCA 2REXA 5J3TA 2KYWA 2RDHA 3DBLB 3J9CA 2D5GA 2EMSA 3ZYYX 2C7NB 2FCNA 1KH0A 1XKEA 2HJ1A 1D5ZC 4EJNA 1PGXA 2LXCA 4ZRJA 5E6PA 2K39A 1F9JA 2VZKB 4DHJD 4ICVA 2SAKA 4UDUC 1JRPA 3AXCA 2QEJC 3SYXA 4ZRQA 1E7PB 3URYA 2CU1A 1JQ4A 4DBBA 5D3XA 2HRJA 3HRDD 2WXGA 3ZTCA 2D9ZA 1UWMA 3B1LX 3O96A 1EO6A 2EELA 1P0RA 1XCGA 1J7AA 2IGGA 1ET6A 3AH7A 2L52A 1C4AA 1E0ZA 1WWTA 2R82A 1WYWB 2K0PA 5C6RA 4LTUA 2WXRA 3IXSA 2Z13A 2G3QB 4L6EA 3KWLA 1E8WA 4F7UP 1P6SA 2UYZB 1PMSA 3DBRI 3RNEC 3B77A 2JRIB 1HZ6A 5D3YA 4HDOA 2R2OA 1QZEA 2CAYA 2K2UA 4PK1A 2LRWA 2QMTA 4JK9A 2EMTA 3ULBA 3GP7A 4GGQA 1SIFA 5J17A 4FN2A 2XEWA 2JQRB 1TY0A 2KFKB 4FJVB 1U2BA 2HTHB 1WR1A 5IA7A 4LJPB 3WAPA 3SNHA 3KRXA 1P1AA 2QCZA 1DGJA 1EUVB 3Q6BA 3E66A 3IT4B 5C2TB 4XZ4A 4YSYB 2DFKA 2YT1A 1ST7A 3GS2A 3NVWA 4YWGG 1T3QA 2G35A 4JKCA 1E10A 1QC6A 5C3JB 2Y5BB 1ZKHA 5GXGB 1EF1A 3L4PA 3M95A 5HHDG 3SO6A 3LYYA 3DXEA 1MK7B 5LG4B 3ZO5B 4CSQA 5E6JA 4RF0A 3RFZB 2KO3A 2WHIA 2FUHB 4Z2MB 4RFBA 1Q5WB 3A98B 1SSNA 3CWIA 3BINA 2QKMA 4KHAA 3O65B 3H7PA 2BF8B 3WA0A 1HE8A 1RM6C 3DPDA 1OQQA 1NI2A 1I4GA 2ZCCA 4G0NB 1X1FA 4KIKB 4IUMB 1FNVA 2MBHA 1UZXB 2KX3A 2LUEA 5DIFB 4ICUA 2N9XA 5EE3A 4BKSA 1C3TA 1OGWA 2DIKA 5BMGA 4FJYA 5CTRC 2KVZA 4O1NA 1I4RA 3ZXRA 4IM0A 3VQIA 3R7RA 1L6VA 1MAIA 1VZ6A 4MJSB 5D7GA 4W9KA 1HTOA 5CLLB 4GXBA 3HVZA 3TEWA 2Z0PA 1MPHA 4ZDVA 1SE2A 4ANXA 3UQBA 4YTNB 1I42A 2AL3A 2OEDA 2AQ3B 3A9KA 2DKPA 1TJ6A 4HAXB 2O6VA 4N58A 4TQ1A 3EFCA 1VR9A 2ZVOA 1T5XD 3QK0A 3RPFC 2FUG1 2K5PA 3PT2B 4HAZB 2WXFA 3MHZA 2COPA 3TIXA 3P63A 1F0ZA 1EU3A 4IW0A 1D3ZA 2LRUA 1L2NA 3WAOA 1SF0A 4RMAA 2ZW0A 2Z0QA 1UNPA 2K8CA 2JSVX 4BAXA 4BFRA 2N9EB 1SGHA 2JUOA 2KFJA 1U5FA 2ACZB 4OVUA 1AWDA 3I5JC 2H88B 3CSFA 3JW0X 4YTMB 3NY5A 1R4NI 1WX7A 4ZRIA 2NVUI 3QQ8B 3VRBB 3K9PB 3SDLC 3DBLI 3ZUNA 4LNFA 1X86A 2KQ4X 1NENB 2ZNVC 2PVGC 1F1HA 4MT5A 2KJ6A 3BK1A 4N6EB 4EEWA 2NMQA 4IM2A 2PE9A 2KWUB 4CHJA 3P1MA 3AE8B 4N59A 2DLWA 3U4EG 2VRWB 2KHWB 1EWYC 2BT6A 2IZVB 1XLNA 1FXTB 4J3OD 5AEKB 2KR0A 2M17A 3AN1A 4B95A 4W9GA 2O2VA 4G11A 1WZ3A 4GDLA 2AX5A 1L5PA 2RUKB 5IN7A 4EZKA 2MBOA 1DOIA 1SXTA 4IG7B 2V1YA 1EWCA 2KX0A 1OEYA 3BZDB 2LUMA 2W3SA 1XXGA 2KDMA 3CIRB 2BKFA 4ITKA 1KLGD 4DQOC 1R4MB 2OQBA 4HKQA 5HE3A 3UZTA 3KY9A 1YX6B 3C8YA 4YSXB 1RJ2A 5JLJB 5IKCM 2GLSA 3RNBC 4NPNA 5L95C 2JWZA 3GZNB 2J0KA 3VOQA 3MPXA 1VZ8A 3W1SA 1OEYJ 1HXYD 3LB8C 5G2NA 2CKHB 4JK8A 2ICIA 2KNBA 4KX6B 2PTLA 3DBHB 2RSUA 1V80A 3MDBC 4Z2NA 1TXDA 2LVQA 1MIXA 1QOGA 4BOZB 4IWPA 1MHHE 1VRAB 3F5RA 3ZW3A 5DPRA 1WRIA 2BYFA 1UWXA 5D27A 2CU3A 2V3SA 2PZ1A 1TJEA 1C77A 2AEHA 1WJNA 1HBKA 2RLOA 1U29A 1TKEA 1PFDA 1TT5B 3DCXA 1FRDA 3HIEA 4NNJB 1LB1A 3ODWA 2MJEA 2O2VB 2SEBD 4K7UA 3TEXA 5EDSA 2G1EA 1NVLA 3PLUA 4L2YA 1B1ZA 1U5GA 4LNIA 4WIPA 3V05A 4KVGB 1JMLA 3FC4A 3KWVA 1WGHA 4FHJA 4JE3B 4BKTA 3KW5B 2FCMA 2WLBA 2E3TA 3KYCD 1T0SC 1YX5B 1L0YB 1ZDVA 3I3TB 1UF0A 1YQ3B 2XK5A 3NJTA 2NCNA 2HE7A 2YF0A 4BOSC 2MW5A 3P2BA 5FR6A 4KKIA 1RRPB 1V5OA 5JHBA 4A3OA 1GGOA 5J18A 2FE8A 2JPHA 2K6DB 3K9OB 2N0YA 5DI9B 3M1IB 1UNSA 1Y8RC 3P6AA 4BKSD 4PQ0A 4NZLB 1OQYA 1I4XA 3H8HA 3BWUD 3R7QA 3AE9B 2LASA 3VXWA 2AYOB 5IO9A 2MJDA 2Z59B 5D3WA 3N1XC 3MP9A 2Y8GA 3ZRFA 2YEPF 3UI3A 3ZIMA 3KSYA 4LNOA 4C4VB 4USAA 2BW2A 5AUKA 3N7CA 2PLPA 1T77A 5I2MA 3EHVA 4JL9A 4JLCA 4AQ7A 2E2XA 2NZ8B 4ANVA 1H10A 4HB4B 4WJOA 2O6VD 2HTME 3IBEA 5JHAA 3AE5B 1M4VA 1TS4A 5IJMA 4NY0A 3TVVA 1FMAD 2HD5B 4GDKB 2BYEA 1WE7A 2IPKD 2WDRB 4MM3A 1U5EA 1KOTA 5G5HA 3JVZX 3FM8C 1ZYIA 2ELBA 4GOCA 4K7SA 1T6BX 5FI0A 2DYOA 4TQ0A 3RCZA 2M4NA 4XWTA 1WJ6A 1T0YA 3WAMA 1TQZA 2DAFA 1LM8B 1WXAA 2P8VA 2M19A 4RCOA 4JQWC 2L83A 4TUUA 1WJ1A 3SD5A 3AECB 4KV2A 2KLGA 2KJRA 2BS2B 3VDZA 3KZ1A
chains in the Genus database with same CATH topology
3U30A 4IC7B 3N30A 2UZSA 1Z87A 4KDIC 3NHEB 3AU5A 4FLHA 1EAZA 1UD7A 2ROZB 3PVLA 3AI5A 2GBKA 3VVWB 4ILGB 1IPGA 1X1MA 5HE0A 4GIVA 3ZNGC 4BBKA 1P9DU 1V49A 2EKEC 2NPTA 4J6IA 2MFQA 3AULA 1V5TA 2KD0A 2RGFA 3QA8A 2ELAA 1DIKA 2IYDB 3DVNV 4F7HA 2IO1B 1RFAA 4MH0E 2B3AA 4NAWB 3ZNHB 2L1CA 4GN1A 2VKIA 3LJ3A 1R4MI 2BCJA 3RCPA 5D2MB 2K2JA 1C1YB 3A4RA 4AJYB 1WGUA 3GZNI 2D9VA 2KMCA 4EKUA 3PREA 3UF8A 4JIOU 2PPHA 1WH3A 4M0WB 3DBHI 4FJZA 4II3B 4KDLB 2L3ZA 2WDTB 5JH5C 4HK2A 3PZDA 1WGRA 2NS5A 4G3XB 3QC8B 2KZRA 5GMVA 1V86A 1V9JA 1WGDA 3APDA 3EFUA 5DPWA 2Q13A 2Z0OA 3FSSA 5KQ4A 2KFKA 1I7AA 4MY6A 1J0WA 2HTHA 4NQKE 3TCAA 2FCQA 5KQ1A 4MSMB 4W9LA 1EVHA 3DXCA 1LFDA 2MDXA 2UWQA 1NBFC 3EC8A 4WAAA 4WJ7A 4EFOA 1ZC3B 3GYPA 4LDTB 3DCGA 2FJLA 2W2XC 3HM6X 2RQ1A 1ZC4B 2LOXA 2WH5A 3RD2A 2JZZA 2MKRA 1GC7A 4NSWA 1WMHB 5HKHA 3WIMA 5C23A 1UEFA 2X18A 1WXMA 4HHVA 1K5GB 3A9JB 4WVFB 4IM3A 5EFXA 5E6NA 4KIKA 1WVHA 2YRYA 2PJHA 2YVCA 2C9WB 1VCBA 1V6EA 2MCNB 1N3HA 2L0FA 5KHOA 4WJQA 1WXVA 2LOZA 3SBGA 1MK9B 4MJSA 4A6FB 1K8RB 4CHKA 1WI0A 3H1UA 1W1GA 2LVPA 2CR5A 1WZ0A 2JP2A 5D3VA 2KC1A 5KHQA 1WGQA 1IRSA 1WI1A 1WJMA 3JSVB 3R3MA 4B9KA 4A20A 2N23A 2D4QA 2KUPA 3PG7A 1WR6E 2C7MB 4W9DA 2GS0A 1V5PA 2CHZA 2D2QA 3C0RB 2HJ8A 2OOBB 2JY6A 4MK0A 5CHWA 1DYNA 4NJ7A 1YIWA 2K8BA 4E74A 2PEAA 3QWZB 2JXXA 2IY1B 2CODA 1QQGA 1WJUA 3NS8A 2C5LC 1RRBA 5AZFA 3ZVVA 1V88A 2WX1A 4MDKE 5C1ZA 5J3YA 3FP5A 3TO1A 2MLBA 3Q3FA 3ENBA 1KI1B 2M14A 4DDGD 1ZM0A 2KANA 4KZ0A 4MELA 3P7ZA 4BBNC 2BWES 3GOEA 2H7EA 4MGIE 1RAXA 3NOBA 3W1SC 3ZNZB 4MEMA 2MA9B 4BBNF 4GMVA 2L05A 3VHTC 2ASQA 2MSED 3UGBB 2J7QB 3H6NA 1G6JA 2N1VA 2P0FA 2RNRB 3CIKA 1WX9A 2DHIA 1WJ4A 3DVGY 1I2HA 1YD8U 4HPMB 2Y7BA 2D9XA 1M7EA 1TTNA 1DBHA 4F1SA 2LWPA 2DX1A 3IHPC 4CYEA 1ZSQA 1I35A 1TGZB 3APFA 3PS6A 3AU4A 2CB8A 3SHQA 3L54A 4WJNA 2ADZA 5JHGA 1OMWA 3A1QB 2RVBB 4X57B 3VUYA 3ZDTA 4E3CA 3M62B 5JVLA 3WYFB 4PNKA 2BKRB 3A33B 4DDID 4MGZE 2JZ3B 2LKOA 3IVFA 4AWJA 4IWOA 3HW2B 1NTVA 2DZJA 3APCA 3LDZE 1P98A 4F8CB 2JT4B 3ALBA 1GC6A 1XR0B 3KH0A 4BVUC 3T8MA 3DOWA 2UVMA 4WWOA 1XD3B 3V6CB 1TBEA 2KDBA 2LULA 2LGYA 2ZJDA 1Z5SB 2MX2A 2NBVB 2X0SA 1ZGUB 4GDKA 2R0DA 2K8HA 3L13A 5C79A 1X11A 2LZ6A 1V81A 3PSEB 2DZMA 3DVNU 2L76A 2MRPA 3KYDD 3R66C 4ZYNA 4HCPB 3X23A 3ZTDA 5KCVA 4WWPA 4G50A 3ZRCA 3TFMA 4GSWA 2LXAA 3NZUA 2K00A 3QCAA 4LCDE 2WWZA 4DX90 2IY0B 2KTRB 3U7DA 1H8CA 2ZVNA 4WSFA 4B6HA 1UELA 4EOYA 1ACAA 3ODXA 1OTRB 4WWNA 1WGYA 2CQUA 3X0WA 2DYQA 4IFSA 3OJ3A 3F0WA 3TMPB 1Q0WB 2ZNVB 4RM9A 2CRFA 1M94A 1PFJA 3QBVB 2GBMA 3KRWA 2DZIA 4URKA 3HQCA 3D32A 4NAWA 4DHJB 4K17A 2IYBA 2DHJA 2D11A 2MP2B 2J0JA 1NTYA 4XX5A 2EC1A 1UPQA 2KLCA 2Y8FA 1W1DA 3KUDB 2GCLA 4P7IA 2D9YA 2K6QA 1KZGA 4AJWA 2KN5A 3E9PA 5HE2A 1FAOA 1UBQA 2OJRA 4M8MA 4JKEA 2YSZA 3V62A 4CO7A 4IWQA 2LYDA 4GB9A 3PTFC 1LW3A 3S2AA 1NDDA 4MT7A 4PYUA 3TW1A 3PV1A 2FIFA 4KSKC 5CX3A 1GJZA 2LJ5A 1WG7A 4RM8A 3CMMB 3JYUA 3DXDA 3SU8X 4DK5A 2G4SA 4MGYE 2DYMA 1FHWA 1WFYA 1NU2A 4ZRKA 1DDVA 4W9CA 1EF5A 3FLVA 3PPAA 1WM3A 1WY8A 1BTNA 2L2IA 1HB8A 5D6JB 2RR9A 3FEHA 2KQ7A 4AUQC 4FADA 1WRDB 3EECA 1UNQA 2M0XA 3H9DA 3DBSA 3PRZA 1MG8A 4A6HA 1V2YA 4HCNB 1HB6A 3PHWB 5DHFB 5E6OA 4TV3A 2MWNB 1WF9A 1L7YA 4H8SA 4WJPA 1OY2A 3QJZA 1E5WA 1U5DA 2KOXA 5C5BB 3L0WB 3UIPB 2FNJB 1WMHA 4PS8A 4YL8A 3VUXA 4II2B 2COCA 1VBHA 2XBBC 1V5UA 3V61A 3L10B 1W1HA 1CMXB 5DPTA 1V89A 3A9JA 3ENEA 3MTNB 1P3QU 5J3QA 2WYQA 3H7SA 2DKQA 2DX5B 3VTUA 3ZLZA 3GYOA 2DYBA 1WM2A 3SBTA 4W9IA 4PYZA 1IP9A 4A6FA 2KDIA 3NSUA 3RULA 3PGEA 3PP2A 1ZVRA 4YONA 1SE9A 4W9HA 4ANWA 1VBGA 1U27A 2NBWB 3JSVA 2LG1A 2PE6B 1KZ7A 1S3SG 1S1QB 2G4DB 4HJKA 3G9WA 3V6EB 1X05A 2LI5A 4NQLB 3HM3A 3RT3B 2I1JA 4PS3A 1KBLA 3UQAA 4LJOB 5JHHA 4TYZA 3VTVA 4ILJA 1BT0A 2IO0B 2LGXA 4JK7A 2GCJA 2JVCA 4F7GA 2KJHB 4JKAA 3N32A 5LXHA 1TZ1A 4JKBA 2KXJA 5HE1A 2N7DA 4HDQA 2W2WA 3IFWB 3L08A 4HPLB 1AWEA 3W1YA 3L17A 2IBIB 3A8QA 1UH6A 2RSGA 1GUAB 3WANA 2R2QA 4Y94A 2MQJA 2DA0A 2V4LA 5GOWB 3VFKA 2MBBB 1KC7A 5D94A 4A6KA 5JZEB 1MKEA 4HB0B 3A4SC 2BPSA 4JKDA 2RPQA 1JRUA 5DPSA 3PHXB 2H7DA 2L0TA 3M3JA 3ML8A 4KSLC 4HWIB 2Z0EB 2CHXA 3VIAA 5DHAB 2V76A 2C7HA 5CLQB 4GMXB 2LD9A 2AL6A 5DH9B 2ZPNA 2RD0A 4GZUA 3D8DA 3E9OA 3QAQA 1BWNA 2JRHA 3PVUA 1KLVA 3ZKJC 2FCSA 4ILHA 2KC2A 4ANUA 2DYNA 4JKHA 2DAJA 1P5TA 3ZVRA 2I5FA 3T9LA 2KGXB 1Y5OA 4LDTD 3RZWC 4CHMA 2CHWA 2BYVE 4HAVB 4FA6A 3RYTA 1Z2MA 5CHFA 2G45B 4WQOB 4KHOA 4JKGA 4GPTB 4DXAB 2NBUA 1J0GA 1M7RA 1LQBA 1RLFA 3QX1A 1H4RA 1E8XA 3A1QA 1IYFA 2YLMA 3QIJA 3H7PB 1P3RA 2IFSA 3WALA 3TL5A 1V61A 2N4FA 3CSTA 2R09A 3PSCA 3BJIA 3HK0A 4I6PA 4GU2A 3RUIB 3VH3B 2KDFB 4N9F4 1SHCA 2KK8A 3PVWA 2K1FA 2DENB 1AQCA 2N1WA 4EZJA 1B55A 1XODA 3ML9A 1NTIA 2BWFA 4AOFA 1WX8A 3A9KB 2LVOA 2KCJA 5TR5A 3ECIA 4JKGB 4JKFA 3ODOA 2GBNA 1KM7A 2NMBA 2O6VB 2L8JA 5JP4A 2KMAA 3TJPA 1YJ1A 3EPYA 2KDEB 1WXSA 1ISNA 3PRMB 2K25A 3BY4B 1GG3A 1FGYA 4K81A 2OTXA 4MGKE 2FDQA 2DHKA 1LXDA 1X1GA 1DDWA 3UIOB 2ZZPB 3KUZA 1J19A 3B0AA 3U8ZA 2VRRB 2KWCA 5CHVC 2YS5A 3ML4A 2JF5A 3SV1A 3D8EA 3TBLD 3OJ4B 1WIAA 4PS7A 2QHOA 3DDCB 1XD4A 5FI1A 2KVRA 2KTRA 1FHOA 1UBIA 3ULCA 1E7VA 4D0NB 3PLVA 3RZFA 1GNUA 1FOEA 2M38A 2Z0DB 4W9FA 4BKGA 1JDEA 5LONB 4A3PA 4AP4C 2KWVB 2L00B 2D3GA 2D9WA 4K2PA 4KAXB 3MJWA 3VUWA 3ONSA 1PQSA 3AJ4A 4GDLB 2ROVA 1YQBA 2I5CA 2KKCA 4HAWB 1VD2A 1FB8A 3KUCB 2P0HA 2FAZA 2DZKA 2ZEQA 1K5DB 2IO2B 3ZDMC 2W2XD 4NJ6A 2FJ9A 2ZCBA 2COFA 2YT0A 3T06A 2DN6A 1ZW7A 1U4AA 3SUZA 4E71A 4M8NA 3UINB 2GBJA 1UPRA 2MP2A 3HIZA 3B08A 5IAAC 1EGXA 1DROA 2LGDA 3IG3A 4EMOA 4C0AA 1XX0A 3VH4B 4HAYB 1XT9B 2DHZA 3QARA 4HAUB 3V60A 3M63B 3LJUX 2COAA 1XQQA 1UGMA 2J0MA 2WX0A 5LXIB 2MWSB 3Q3JA 4K2OA 1Q1OA 5J2RA 2W9NA 2RGNB 1Q67A 4EUTA 2EJ8A 2LBBA 4IOYX 2GMIC 4DHZB 4DX8A 2IO3B 4W9JA 5L83A 3VTWA 1V5MA 4MSQB 3E9LA 4OVVA 1OQNA 2YS3A 2YS1A 1KJTA 4HLEA 2NR2A 3OANA 2XK5B 2N7EA 2GBRA 2UZRA 1E7UA 3QHTA 1A5RA 5DCNA 5BO4B 3NZSA 2L7RA 2P0DA 4FULA 4DWFA 2D07B 1E8YA 3KVFB 4DHZE 1UNRA 3PRPB 4DBGA 4KHBB 1BAKA 2KTFA 4XWXA 3QWMA 1WE6A 3CXBB 1MIZB 4TKNA 1Y19B 1FHXA 2C60A 2QKLA 3DQVA 4HXDA 2D10A 2I1KA 2M1MA 4HB3B 3VAWA 5C5BA 2MBQA 4FHKA 4HATB 4K7WA 2FIDA 4EZLA 2KQSA 2A5UA 4XC2A 4ASWC 2GJYA 3PEGA 4B6WA 4HB2B 3MHSD 1E90A 1J8CA 4IAPA 2N9PC 1E8ZA 4FBJB 3V5WA 2BGFA 3OAWA 2M8SA 2DX5A 3A8PA 2J59M 5AZGA 3L16A 2CY4A 3CF6E 3OLMD 3D8FA 2XQNM 2A4ZA 2ZPYA 2GOWA 2CY5A 5AZHA 2CS4A 1PLSA 4I6LB 5G55A 4F7ZA 3DVGX 5LLIA 4JGHB 2VSZA 1BTKA 3ZNID 1DDMA 5LOPB 4W9EA 4K1RB 2AWTA 5L81A 3HHMA 4A5KA 4HVBA 1FGZA 1AARA 2DTCA 2NPTB 2MBEA 3N3KB 5C16A 2ABDA 4I6NB 1WGGA 4KZCA 2REXA 5J3TA 2EMSA 2C7NB 2FCNA 1XKEA 4EJNA 2LXCA 5E6PA 4ZRJA 2K39A 1F9JA 4DHJD 4ICVA 3AXCA 3SYXA 2CU1A 4DBBA 5D3XA 2HRJA 3ZTCA 2D9ZA 3B1LX 3O96A 1EO6A 1P0RA 1XCGA 2R82A 1WYWB 5C6RA 2G3QB 4L6EA 1E8WA 4F7UP 1P6SA 2UYZB 1PMSA 3DBRI 2JRIB 5D3YA 4HDOA 2R2OA 1QZEA 2CAYA 2K2UA 2LRWA 4JK9A 2EMTA 3ULBA 4GGQA 1SIFA 5J17A 4FN2A 2XEWA 2KFKB 4FJVB 1U2BA 2HTHB 1WR1A 5IA7A 4LJPB 3WAPA 3SNHA 3KRXA 1P1AA 1EUVB 3E66A 4XZ4A 2DFKA 2YT1A 1ST7A 2G35A 4JKCA 1QC6A 2Y5BB 1ZKHA 1EF1A 3M95A 3SO6A 3DXEA 1MK7B 3ZO5B 2KO3A 2FUHB 4Z2MB 1Q5WB 3A98B 3BINA 2QKMA 4KHAA 3O65B 3H7PA 2BF8B 3WA0A 1HE8A 3DPDA 1NI2A 2ZCCA 4G0NB 1X1FA 4KIKB 4IUMB 2MBHA 1UZXB 2KX3A 2LUEA 5DIFB 4ICUA 2N9XA 4BKSA 1C3TA 1OGWA 2DIKA 4FJYA 5CTRC 4IM0A 3VQIA 3R7RA 1MAIA 4MJSB 5D7GA 4W9KA 5CLLB 4GXBA 2Z0PA 1MPHA 4ZDVA 4ANXA 3UQBA 1I42A 2AL3A 3A9KA 2DKPA 1TJ6A 4HAXB 2O6VA 4TQ1A 2ZVOA 3QK0A 3PT2B 4HAZB 2COPA 3TIXA 4IW0A 1D3ZA 2LRUA 1L2NA 3WAOA 4RMAA 2Z0QA 1UNPA 2K8CA 4BFRA 2N9EB 1SGHA 2JUOA 2KFJA 1U5FA 4OVUA 3CSFA 3JW0X 3NY5A 1R4NI 1WX7A 4ZRIA 2NVUI 3QQ8B 3K9PB 3SDLC 3DBLI 3ZUNA 1X86A 2ZNVC 2KJ6A 4EEWA 4IM2A 2PE9A 2KWUB 4CHJA 2DLWA 2VRWB 2KHWB 2IZVB 1FXTB 5AEKB 2M17A 4B95A 4W9GA 2O2VA 4G11A 1WZ3A 4GDLA 2RUKB 4EZKA 2MBOA 4IG7B 2V1YA 2KX0A 1OEYA 2BKFA 2OQBA 5HE3A 3UZTA 3KY9A 1YX6B 1RJ2A 5JLJB 4NPNA 5L95C 2JWZA 2J0KA 3VOQA 3MPXA 3W1SA 1OEYJ 5G2NA 2CKHB 4JK8A 2KNBA 2RSUA 1V80A 3MDBC 4Z2NA 1TXDA 2LVQA 1MIXA 4BOZB 4IWPA 3F5RA 3ZW3A 5DPRA 2BYFA 5D27A 2V3SA 2PZ1A 2AEHA 1WJNA 1HBKA 2RLOA 1U29A 4NNJB 1LB1A 3ODWA 2O2VB 4K7UA 5EDSA 1NVLA 3PLUA 1U5GA 4KVGB 1WGHA 4FHJA 4BKTA 3KW5B 2FCMA 3KYCD 1YX5B 3I3TB 2XK5A 2NCNA 2HE7A 2YF0A 4BOSC 3P2BA 2MW5A 5FR6A 1RRPB 1V5OA 5JHBA 4A3OA 1GGOA 5J18A 2JPHA 2K6DB 3K9OB 2N0YA 5DI9B 3M1IB 1Y8RC 3P6AA 4BKSD 4PQ0A 1OQYA 3R7QA 2LASA 3VXWA 2AYOB 2Z59B 5D3WA 2Y8GA 3ZRFA 3ZIMA 3KSYA 3N7CA 3EHVA 4JL9A 4JLCA 2E2XA 2NZ8B 4ANVA 1H10A 4HB4B 4WJOA 2O6VD 3IBEA 5JHAA 5IJMA 4NY0A 3TVVA 2HD5B 4GDKB 2BYEA 1WE7A 4MM3A 1U5EA 1KOTA 3JVZX 3FM8C 2ELBA 4GOCA 4K7SA 5FI0A 2DYOA 4TQ0A 3RCZA 2M4NA 1WJ6A 1T0YA 3WAMA 1TQZA 2DAFA 1LM8B 1WXAA 2P8VA 4JQWC 4TUUA 1WJ1A 3SD5A 4KV2A 2KLGA 2KJRA 3VDZA 3KZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U30 A;  4IC7 B;  3N30 A;  2UZS A;  1Z87 A;  4KDI C;  3NHE B;  3AU5 A;  4FLH A;  1EAZ A;  1UD7 A;  2ROZ B;  3PVL A;  3AI5 A;  2GBK A;  3VVW B;  1IPG A;  1X1M A;  5HE0 A;  4GIV A;  3ZNG C;  4BBK A;  1P9D U;  1V49 A;  2EKE C;  2NPT A;  4J6I A;  2MFQ A;  3AUL A;  1V5T A;  2KD0 A;  2RGF A;  3QA8 A;  2ELA A;  2IYD B;  3DVN V;  4F7H A;  2IO1 B;  1RFA A;  4MH0 E;  2B3A A;  4NAW B;  3ZNH B;  2L1C A;  4GN1 A;  2VKI A;  3LJ3 A;  1R4M I;  2BCJ A;  3RCP A;  5D2M B;  2K2J A;  1C1Y B;  3A4R A;  4AJY B;  1WGU A;  3GZN I;  2D9V A;  2KMC A;  4EKU A;  3PRE A;  3UF8 A;  4JIO U;  2PPH A;  1WH3 A;  4M0W B;  3DBH I;  4FJZ A;  4II3 B;  4KDL B;  2L3Z A;  2WDT B;  5JH5 C;  4HK2 A;  3PZD A;  1WGR A;  2NS5 A;  4G3X B;  3QC8 B;  2KZR A;  5GMV A;  1V86 A;  1V9J A;  1WGD A;  3APD A;  3EFU A;  5DPW A;  2Q13 A;  2Z0O A;  3FSS A;  5KQ4 A;  2KFK A;  1I7A A;  4MY6 A;  1J0W A;  2HTH A;  4NQK E;  3TCA A;  2FCQ A;  5KQ1 A;  4MSM B;  4W9L A;  1EVH A;  3DXC A;  1LFD A;  2MDX A;  2UWQ A;  1NBF C;  3EC8 A;  4WAA A;  4WJ7 A;  4EFO A;  1ZC3 B;  3GYP A;  4LDT B;  3DCG A;  2FJL A;  2W2X C;  3HM6 X;  2RQ1 A;  1ZC4 B;  2LOX A;  2WH5 A;  3RD2 A;  2JZZ A;  2MKR A;  1GC7 A;  4NSW A;  1WMH B;  5HKH A;  3WIM A;  5C23 A;  1UEF A;  2X18 A;  1WXM A;  4HHV A;  1K5G B;  3A9J B;  4WVF B;  4IM3 A;  5EFX A;  5E6N A;  4KIK A;  1WVH A;  2YRY A;  2PJH A;  2YVC A;  2C9W B;  1VCB A;  1V6E A;  2MCN B;  1N3H A;  2L0F A;  5KHO A;  4WJQ A;  1WXV A;  2LOZ A;  1MK9 B;  4MJS A;  4A6F B;  1K8R B;  4CHK A;  1WI0 A;  3H1U A;  1W1G A;  2LVP A;  2CR5 A;  1WZ0 A;  2JP2 A;  5D3V A;  2KC1 A;  5KHQ A;  1WGQ A;  1IRS A;  1WI1 A;  1WJM A;  3JSV B;  3R3M A;  4B9K A;  4A20 A;  2N23 A;  2D4Q A;  2KUP A;  3PG7 A;  1WR6 E;  2C7M B;  4W9D A;  2GS0 A;  1V5P A;  2CHZ A;  2D2Q A;  3C0R B;  2HJ8 A;  2OOB B;  2JY6 A;  4MK0 A;  5CHW A;  1DYN A;  4NJ7 A;  1YIW A;  2K8B A;  4E74 A;  2PEA A;  3QWZ B;  2JXX A;  2IY1 B;  2COD A;  1QQG A;  1WJU A;  3NS8 A;  2C5L C;  1RRB A;  5AZF A;  3ZVV A;  1V88 A;  2WX1 A;  4MDK E;  5C1Z A;  5J3Y A;  3FP5 A;  3TO1 A;  2MLB A;  3Q3F A;  1KI1 B;  2M14 A;  4DDG D;  1ZM0 A;  2KAN A;  4KZ0 A;  4MEL A;  3P7Z A;  4BBN C;  2BWE S;  3GOE A;  2H7E A;  4MGI E;  1RAX A;  3NOB A;  3W1S C;  3ZNZ B;  4MEM A;  2MA9 B;  4BBN F;  4GMV A;  2L05 A;  3VHT C;  2ASQ A;  2MSE D;  3UGB B;  2J7Q B;  3H6N A;  1G6J A;  2N1V A;  2P0F A;  2RNR B;  3CIK A;  1WX9 A;  2DHI A;  1WJ4 A;  3DVG Y;  1I2H A;  1YD8 U;  4HPM B;  2Y7B A;  2D9X A;  1M7E A;  1TTN A;  1DBH A;  4F1S A;  2LWP A;  2DX1 A;  3IHP C;  4CYE A;  1ZSQ A;  1I35 A;  1TGZ B;  3APF A;  3PS6 A;  3AU4 A;  2CB8 A;  3SHQ A;  3L54 A;  4WJN A;  2ADZ A;  5JHG A;  1OMW A;  3A1Q B;  2RVB B;  4X57 B;  3VUY A;  3ZDT A;  4E3C A;  3M62 B;  3WYF B;  4PNK A;  2BKR B;  3A33 B;  4DDI D;  4MGZ E;  2JZ3 B;  2LKO A;  3IVF A;  4AWJ A;  4IWO A;  3HW2 B;  1NTV A;  2DZJ A;  3APC A;  3LDZ E;  1P98 A;  4F8C B;  2JT4 B;  3ALB A;  1GC6 A;  1XR0 B;  3KH0 A;  4BVU C;  3T8M A;  3DOW A;  2UVM A;  4WWO A;  1XD3 B;  3V6C B;  1TBE A;  2KDB A;  2LUL A;  2LGY A;  2ZJD A;  1Z5S B;  2MX2 A;  2NBV B;  1ZGU B;  4GDK A;  2R0D A;  2K8H A;  3L13 A;  5C79 A;  1X11 A;  2LZ6 A;  1V81 A;  3PSE B;  2DZM A;  3DVN U;  2L76 A;  2MRP A;  3KYD D;  3R66 C;  4ZYN A;  4HCP B;  3X23 A;  3ZTD A;  5KCV A;  4WWP A;  4G50 A;  3ZRC A;  3TFM A;  4GSW A;  2LXA A;  3NZU A;  2K00 A;  3QCA A;  4LCD E;  2WWZ A;  4DX9 0;  2IY0 B;  2KTR B;  3U7D A;  1H8C A;  2ZVN A;  4WSF A;  4B6H A;  1UEL A;  4EOY A;  1ACA A;  3ODX A;  1OTR B;  4WWN A;  1WGY A;  2CQU A;  3X0W A;  2DYQ A;  4IFS A;  3OJ3 A;  3F0W A;  3TMP B;  1Q0W B;  2ZNV B;  4RM9 A;  2CRF A;  1M94 A;  1PFJ A;  3QBV B;  2GBM A;  3KRW A;  2DZI A;  4URK A;  3HQC A;  3D32 A;  4NAW A;  4DHJ B;  4K17 A;  2IYB A;  2DHJ A;  2D11 A;  2MP2 B;  2J0J A;  1NTY A;  4XX5 A;  2EC1 A;  1UPQ A;  2KLC A;  2Y8F A;  1W1D A;  3KUD B;  2GCL A;  4P7I A;  2D9Y A;  2K6Q A;  1KZG A;  4AJW A;  2KN5 A;  5HE2 A;  1FAO A;  1UBQ A;  2OJR A;  4M8M A;  2YSZ A;  3V62 A;  4CO7 A;  4IWQ A;  2LYD A;  4GB9 A;  3PTF C;  1LW3 A;  3S2A A;  1NDD A;  4MT7 A;  4PYU A;  3TW1 A;  3PV1 A;  2FIF A;  4KSK C;  5CX3 A;  1GJZ A;  2LJ5 A;  1WG7 A;  4RM8 A;  3CMM B;  3JYU A;  3DXD A;  3SU8 X;  4DK5 A;  2G4S A;  4MGY E;  2DYM A;  1FHW A;  1WFY A;  1NU2 A;  4ZRK A;  1DDV A;  4W9C A;  1EF5 A;  3FLV A;  3PPA A;  1WM3 A;  1WY8 A;  1BTN A;  2L2I A;  1HB8 A;  5D6J B;  2RR9 A;  3FEH A;  2KQ7 A;  4AUQ C;  4FAD A;  1WRD B;  3EEC A;  1UNQ A;  2M0X A;  3H9D A;  3DBS A;  3PRZ A;  1MG8 A;  4A6H A;  1V2Y A;  4HCN B;  1HB6 A;  3PHW B;  5DHF B;  5E6O A;  4TV3 A;  2MWN B;  1WF9 A;  1L7Y A;  4H8S A;  4WJP A;  1OY2 A;  3QJZ A;  1E5W A;  1U5D A;  2KOX A;  5C5B B;  3L0W B;  3UIP B;  2FNJ B;  1WMH A;  4PS8 A;  4YL8 A;  3VUX A;  4II2 B;  2COC A;  2XBB C;  1V5U A;  3V61 A;  3L10 B;  1W1H A;  1CMX B;  5DPT A;  1V89 A;  3A9J A;  3ENE A;  3MTN B;  1P3Q U;  5J3Q A;  2WYQ A;  3H7S A;  2DKQ A;  2DX5 B;  3VTU A;  3ZLZ A;  3GYO A;  2DYB A;  1WM2 A;  4W9I A;  4PYZ A;  1IP9 A;  4A6F A;  2KDI A;  3NSU A;  3RUL A;  3PGE A;  3PP2 A;  1ZVR A;  4YON A;  1SE9 A;  4W9H A;  4ANW A;  1U27 A;  2NBW B;  3JSV A;  2LG1 A;  2PE6 B;  1KZ7 A;  1S3S G;  1S1Q B;  2G4D B;  4HJK A;  3G9W A;  3V6E B;  1X05 A;  2LI5 A;  4NQL B;  3HM3 A;  3RT3 B;  2I1J A;  4PS3 A;  3UQA A;  4LJO B;  5JHH A;  4TYZ A;  3VTV A;  1BT0 A;  2IO0 B;  2LGX A;  2GCJ A;  2JVC A;  4F7G A;  2KJH B;  3N32 A;  5LXH A;  1TZ1 A;  2KXJ A;  5HE1 A;  2N7D A;  4HDQ A;  2W2W A;  3IFW B;  3L08 A;  4HPL B;  1AWE A;  3W1Y A;  3L17 A;  2IBI B;  3A8Q A;  1UH6 A;  2RSG A;  1GUA B;  3WAN A;  2R2Q A;  4Y94 A;  2MQJ A;  2DA0 A;  2V4L A;  5GOW B;  3VFK A;  2MBB B;  5D94 A;  4A6K A;  5JZE B;  1MKE A;  4HB0 B;  3A4S C;  2BPS A;  2RPQ A;  1JRU A;  5DPS A;  3PHX B;  2H7D A;  2L0T A;  3M3J A;  3ML8 A;  4KSL C;  4HWI B;  2Z0E B;  2CHX A;  3VIA A;  5DHA B;  2V76 A;  2C7H A;  5CLQ B;  4GMX B;  2LD9 A;  2AL6 A;  5DH9 B;  2ZPN A;  2RD0 A;  4GZU A;  3D8D A;  3QAQ A;  1BWN A;  2JRH A;  3PVU A;  1KLV A;  3ZKJ C;  2FCS A;  2KC2 A;  4ANU A;  2DYN A;  2DAJ A;  1P5T A;  3ZVR A;  2I5F A;  3T9L A;  2KGX B;  1Y5O A;  4LDT D;  3RZW C;  4CHM A;  2CHW A;  2BYV E;  4HAV B;  4FA6 A;  3RYT A;  1Z2M A;  5CHF A;  2G45 B;  4WQO B;  4KHO A;  4GPT B;  4DXA B;  2NBU A;  1J0G A;  1M7R A;  1LQB A;  1RLF A;  3QX1 A;  1H4R A;  1E8X A;  3A1Q A;  1IYF A;  2YLM A;  3QIJ A;  3H7P B;  1P3R A;  2IFS A;  3WAL A;  3TL5 A;  1V61 A;  2N4F A;  3CST A;  2R09 A;  3PSC A;  3BJI A;  3HK0 A;  4I6P A;  4GU2 A;  3RUI B;  3VH3 B;  2KDF B;  4N9F 4;  1SHC A;  2KK8 A;  3PVW A;  2K1F A;  2DEN B;  1AQC A;  2N1W A;  4EZJ A;  1B55 A;  1XOD A;  3ML9 A;  1NTI A;  2BWF A;  4AOF A;  1WX8 A;  3A9K B;  2LVO A;  2KCJ A;  5TR5 A;  3ECI A;  2GBN A;  3ODO A;  1KM7 A;  2NMB A;  2O6V B;  2L8J A;  5JP4 A;  2KMA A;  3TJP A;  1YJ1 A;  3EPY A;  2KDE B;  1WXS A;  1ISN A;  3PRM B;  2K25 A;  3BY4 B;  1GG3 A;  1FGY A;  4K81 A;  2OTX A;  4MGK E;  2FDQ A;  2DHK A;  1LXD A;  1X1G A;  1DDW A;  3UIO B;  2ZZP B;  3KUZ A;  1J19 A;  3B0A A;  3U8Z A;  2VRR B;  2KWC A;  5CHV C;  2YS5 A;  3ML4 A;  2JF5 A;  3SV1 A;  3D8E A;  3TBL D;  3OJ4 B;  1WIA A;  4PS7 A;  2QHO A;  3DDC B;  1XD4 A;  5FI1 A;  2KVR A;  2KTR A;  1FHO A;  1UBI A;  3ULC A;  1E7V A;  4D0N B;  3PLV A;  3RZF A;  1GNU A;  1FOE A;  2M38 A;  2Z0D B;  4W9F A;  4BKG A;  5LON B;  4A3P A;  4AP4 C;  2KWV B;  2L00 B;  2D3G A;  2D9W A;  4K2P A;  4KAX B;  3MJW A;  3VUW A;  3ONS A;  1PQS A;  3AJ4 A;  4GDL B;  2ROV A;  1YQB A;  2I5C A;  2KKC A;  4HAW B;  1VD2 A;  1FB8 A;  3KUC B;  2P0H A;  2FAZ A;  2DZK A;  2ZEQ A;  1K5D B;  2IO2 B;  3ZDM C;  2W2X D;  4NJ6 A;  2FJ9 A;  2ZCB A;  2COF A;  2YT0 A;  3T06 A;  2DN6 A;  1ZW7 A;  1U4A A;  3SUZ A;  4E71 A;  4M8N A;  3UIN B;  2GBJ A;  1UPR A;  2MP2 A;  3HIZ A;  3B08 A;  5IAA C;  1EGX A;  1DRO A;  2LGD A;  3IG3 A;  4EMO A;  4C0A A;  1XX0 A;  3VH4 B;  4HAY B;  1XT9 B;  2DHZ A;  3QAR A;  4HAU B;  3V60 A;  3M63 B;  3LJU X;  2COA A;  1XQQ A;  1UGM A;  2J0M A;  2WX0 A;  5LXI B;  2MWS B;  3Q3J A;  4K2O A;  1Q1O A;  5J2R A;  2W9N A;  2RGN B;  1Q67 A;  4EUT A;  2EJ8 A;  2LBB A;  4IOY X;  2GMI C;  4DHZ B;  4DX8 A;  2IO3 B;  4W9J A;  5L83 A;  3VTW A;  1V5M A;  4MSQ B;  4OVV A;  1OQN A;  2YS3 A;  2YS1 A;  1KJT A;  4HLE A;  2NR2 A;  3OAN A;  2XK5 B;  2N7E A;  2GBR A;  2UZR A;  1E7U A;  3QHT A;  1A5R A;  5DCN A;  5BO4 B;  3NZS A;  2L7R A;  2P0D A;  4FUL A;  4DWF A;  2D07 B;  1E8Y A;  3KVF B;  4DHZ E;  1UNR A;  3PRP B;  4DBG A;  4KHB B;  1BAK A;  2KTF A;  4XWX A;  3QWM A;  1WE6 A;  3CXB B;  1MIZ B;  4TKN A;  1Y19 B;  1FHX A;  2C60 A;  2QKL A;  3DQV A;  4HXD A;  2D10 A;  2I1K A;  2M1M A;  4HB3 B;  3VAW A;  5C5B A;  2MBQ A;  4FHK A;  4HAT B;  4K7W A;  2FID A;  4EZL A;  2KQS A;  2A5U A;  4XC2 A;  4ASW C;  2GJY A;  3PEG A;  4B6W A;  4HB2 B;  3MHS D;  1E90 A;  1J8C A;  4IAP A;  2N9P C;  1E8Z A;  4FBJ B;  3V5W A;  2BGF A;  3OAW A;  2M8S A;  2DX5 A;  3A8P A;  2J59 M;  5AZG A;  3L16 A;  2CY4 A;  3CF6 E;  3OLM D;  3D8F A;  2XQN M;  2A4Z A;  2ZPY A;  2GOW A;  2CY5 A;  5AZH A;  2CS4 A;  1PLS A;  4I6L B;  5G55 A;  4F7Z A;  3DVG X;  5LLI A;  4JGH B;  2VSZ A;  1BTK A;  3ZNI D;  1DDM A;  5LOP B;  4W9E A;  4K1R B;  2AWT A;  5L81 A;  3HHM A;  4A5K A;  4HVB A;  1FGZ A;  1AAR A;  2DTC A;  2NPT B;  2MBE A;  3N3K B;  5C16 A;  2ABD A;  4I6N B;  1WGG A;  4KZC A;  2REX A;  5J3T A;  2EMS A;  2C7N B;  2FCN A;  1XKE A;  4EJN A;  2LXC A;  5E6P A;  4ZRJ A;  2K39 A;  1F9J A;  4DHJ D;  4ICV A;  3AXC A;  3SYX A;  2CU1 A;  4DBB A;  5D3X A;  2HRJ A;  3ZTC A;  2D9Z A;  3B1L X;  3O96 A;  1EO6 A;  1P0R A;  1XCG A;  1WYW B;  5C6R A;  2G3Q B;  4L6E A;  1E8W A;  4F7U P;  1P6S A;  2UYZ B;  1PMS A;  3DBR I;  2JRI B;  5D3Y A;  4HDO A;  2R2O A;  1QZE A;  2CAY A;  2K2U A;  2LRW A;  2EMT A;  3ULB A;  4GGQ A;  1SIF A;  5J17 A;  4FN2 A;  2XEW A;  2KFK B;  4FJV B;  1U2B A;  2HTH B;  1WR1 A;  5IA7 A;  4LJP B;  3WAP A;  3SNH A;  3KRX A;  1P1A A;  1EUV B;  4XZ4 A;  2DFK A;  2YT1 A;  1ST7 A;  2G35 A;  1QC6 A;  2Y5B B;  1ZKH A;  1EF1 A;  3M95 A;  3SO6 A;  3DXE A;  1MK7 B;  3ZO5 B;  2KO3 A;  2FUH B;  4Z2M B;  1Q5W B;  3A98 B;  3BIN A;  2QKM A;  4KHA A;  3O65 B;  3H7P A;  2BF8 B;  3WA0 A;  1HE8 A;  3DPD A;  1NI2 A;  2ZCC A;  4G0N B;  1X1F A;  4KIK B;  4IUM B;  2MBH A;  1UZX B;  2KX3 A;  2LUE A;  5DIF B;  4ICU A;  2N9X A;  4BKS A;  1C3T A;  1OGW A;  4FJY A;  5CTR C;  4IM0 A;  3VQI A;  3R7R A;  1MAI A;  4MJS B;  5D7G A;  4W9K A;  5CLL B;  4GXB A;  2Z0P A;  1MPH A;  4ZDV A;  4ANX A;  3UQB A;  1I42 A;  2AL3 A;  3A9K A;  2DKP A;  1TJ6 A;  4HAX B;  2O6V A;  4TQ1 A;  2ZVO A;  3QK0 A;  3PT2 B;  4HAZ B;  2COP A;  3TIX A;  4IW0 A;  1D3Z A;  2LRU A;  1L2N A;  3WAO A;  4RMA A;  2Z0Q A;  1UNP A;  2K8C A;  4BFR A;  2N9E B;  1SGH A;  2JUO A;  2KFJ A;  1U5F A;  4OVU A;  3CSF A;  3JW0 X;  3NY5 A;  1R4N I;  1WX7 A;  4ZRI A;  2NVU I;  3QQ8 B;  3K9P B;  3SDL C;  3DBL I;  3ZUN A;  1X86 A;  2ZNV C;  2KJ6 A;  4EEW A;  4IM2 A;  2PE9 A;  2KWU B;  4CHJ A;  2DLW A;  2VRW B;  2KHW B;  2IZV B;  1FXT B;  5AEK B;  2M17 A;  4B95 A;  4W9G A;  2O2V A;  4G11 A;  1WZ3 A;  4GDL A;  2RUK B;  4EZK A;  2MBO A;  4IG7 B;  2V1Y A;  2KX0 A;  1OEY A;  2BKF A;  2OQB A;  5HE3 A;  3UZT A;  3KY9 A;  1YX6 B;  1RJ2 A;  5JLJ B;  4NPN A;  5L95 C;  2JWZ A;  2J0K A;  3VOQ A;  3MPX A;  3W1S A;  1OEY J;  5G2N A;  2CKH B;  2KNB A;  2RSU A;  1V80 A;  3MDB C;  4Z2N A;  1TXD A;  2LVQ A;  1MIX A;  4BOZ B;  4IWP A;  3F5R A;  3ZW3 A;  5DPR A;  2BYF A;  5D27 A;  2V3S A;  2PZ1 A;  2AEH A;  1WJN A;  1HBK A;  2RLO A;  1U29 A;  4NNJ B;  1LB1 A;  3ODW A;  2O2V B;  4K7U A;  5EDS A;  1NVL A;  3PLU A;  1U5G A;  4KVG B;  1WGH A;  4FHJ A;  4BKT A;  3KW5 B;  2FCM A;  3KYC D;  1YX5 B;  3I3T B;  2XK5 A;  2NCN A;  2HE7 A;  2YF0 A;  4BOS C;  2MW5 A;  3P2B A;  5FR6 A;  1RRP B;  1V5O A;  5JHB A;  4A3O A;  5J18 A;  2JPH A;  2K6D B;  3K9O B;  2N0Y A;  5DI9 B;  3M1I B;  1Y8R C;  3P6A A;  4BKS D;  4PQ0 A;  1OQY A;  3R7Q A;  2LAS A;  3VXW A;  2AYO B;  2Z59 B;  5D3W A;  2Y8G A;  3ZRF A;  3ZIM A;  3KSY A;  3N7C A;  3EHV A;  4JL9 A;  4JLC A;  2E2X A;  2NZ8 B;  4ANV A;  1H10 A;  4HB4 B;  4WJO A;  2O6V D;  3IBE A;  5JHA A;  5IJM A;  4NY0 A;  3TVV A;  2HD5 B;  4GDK B;  2BYE A;  1WE7 A;  4MM3 A;  1U5E A;  1KOT A;  3JVZ X;  3FM8 C;  2ELB A;  4GOC A;  4K7S A;  5FI0 A;  2DYO A;  4TQ0 A;  3RCZ A;  2M4N A;  1WJ6 A;  1T0Y A;  3WAM A;  1TQZ A;  2DAF A;  1LM8 B;  1WXA A;  2P8V A;  4JQW C;  4TUU A;  1WJ1 A;  3SD5 A;  4KV2 A;  2KLG A;  2KJR A;  3VDZ A;  3KZ1 A; 
#chains in the Genus database with same CATH topology
 3U30 A;  4IC7 B;  3N30 A;  1PYW D;  3P4P B;  2UZS A;  4OZB A;  3BII D;  3ZJT A;  1Z87 A;  3Q2A C;  4DIX A;  4KDI C;  3NHE B;  3AU5 A;  4L1B A;  3WCQ A;  4FLH A;  1EAZ A;  1UD7 A;  2ROZ B;  2LGS A;  3PVL A;  3AI5 A;  2GBK A;  1GAQ B;  5BYS A;  4ZRP A;  3VVW B;  2INN E;  4ILG B;  1IPG A;  1OFF A;  1X1M A;  5HE0 A;  1QKZ A;  1FIQ A;  1JWM D;  4GIV A;  1L4Z B;  3ZNG C;  4BBK A;  4RGO S;  3GE8 C;  2MHJ A;  1P9D U;  2V3P A;  3AM9 A;  1V49 A;  2EKE C;  2NPT A;  2TSS A;  4J6I A;  2MFQ A;  3AUL A;  3GE3 C;  3Q8E A;  1V5T A;  2KD0 A;  2RGF A;  3QA8 A;  4M00 A;  2ELA A;  1DIK A;  2IYD B;  3DVN V;  4F7H A;  2IO1 B;  4FXC A;  2QJL A;  1D4B A;  2ZW1 A;  3NWD A;  5MPO A;  2Q5W D;  1RFA A;  4MH0 E;  2B3A A;  3P4Q B;  4WQM A;  4NAW B;  3ZNH B;  2L1C A;  1SB3 C;  3MJ5 A;  4GN1 A;  2VKI A;  3BYT B;  3LJ3 A;  1R4M I;  1JAL A;  4WWM A;  2BCJ A;  3Q8B A;  3RCP A;  5M4Y B;  5D2M B;  2K2J A;  1C1Y B;  3A4R A;  1YOV B;  4AJY B;  3SEB A;  3AEG B;  4S17 A;  1WGU A;  3GZN I;  3N1Y C;  1TKY A;  2D9V A;  2KMC A;  3Q8F A;  4EKU A;  1XCQ L;  2LFI A;  3OWE B;  4NJC A;  5HFY A;  3PRE A;  3UF8 A;  4JIO U;  2PPH A;  1WH3 A;  4M0W B;  3DBH I;  4FJZ A;  5EE1 A;  2RDB C;  3RMK C;  4II3 B;  4KDL B;  2OJW A;  2L3Z A;  4AS1 A;  2WDT B;  2PKO A;  5JH5 C;  4C7Z A;  4HK2 A;  2IJ0 A;  3PZD A;  1SEB D;  1WGR A;  2K3U A;  2NS5 A;  4G3X B;  3QC8 B;  2KZR A;  4K3C A;  5GMV A;  1V86 A;  1V9J A;  1WGD A;  5JXV A;  3APD A;  3EFU A;  1F77 A;  4IKG A;  1MFW A;  5DPW A;  2Q13 A;  3PZ7 A;  2Z0O A;  3FSS A;  5KQ4 A;  3NRZ A;  2DWQ A;  1J7C A;  2KFK A;  1I7A A;  4MY6 A;  3DWM A;  2B76 B;  2QSD A;  1J0W A;  2HTH A;  4NQK E;  4D6W A;  1ESF A;  3MC0 B;  3TCA A;  2FCQ A;  3AE1 B;  5KQ1 A;  4MSM B;  4W9L A;  1EVH A;  4D2K A;  3DXC A;  3BVM A;  1LFD A;  2MDX A;  3TSS A;  4R3D A;  2UWQ A;  1NBF C;  3EC8 A;  3ZXV A;  4WAA A;  3VR9 B;  4WJ7 A;  3W5U B;  1ZXI A;  1GOZ A;  4EFO A;  1ZC3 B;  3GYP A;  2WXQ A;  3DCG A;  4LDT B;  2FJL A;  2W2X C;  1L4D B;  1NI3 A;  3HM6 X;  1AW7 A;  2Y3A A;  2RQ1 A;  2CJN A;  1ZC4 B;  1K53 A;  2M56 B;  2NTT A;  2K9X A;  3DHH C;  1V97 A;  2LOX A;  1YN4 A;  2WH5 A;  3RD2 A;  2JZZ A;  3W5V B;  1MJD A;  2XN9 C;  2MKR A;  1GC7 A;  4NSW A;  3KLS X;  1JWU D;  1WMH B;  5HKH A;  3WIM A;  2PVO D;  2MJ3 A;  5C23 A;  1FRR A;  2BB6 A;  1UEF A;  3TUO A;  2X18 A;  3MFG A;  1ROE A;  1WXM A;  4HHV A;  1K5G B;  3A9J B;  4WVF B;  4IM3 A;  5EFX A;  5E6N A;  4KIK A;  1WVH A;  1K52 A;  2YRY A;  2PJH A;  2RPV A;  2Y5C A;  1CQV A;  1P7E A;  4BZA A;  2YVC A;  2C9W B;  4LLG M;  5TSS A;  1Y56 A;  1VCB A;  1V6E A;  2J42 A;  2MCN B;  1N3H A;  2L0F A;  5KHO A;  4WJQ A;  1WXV A;  2LOZ A;  2INC C;  3SBG A;  1MK9 B;  3NWF A;  4MJS A;  4A6F B;  1K8R B;  1KLU D;  2RDG A;  4CHK A;  1WI0 A;  2JU6 X;  3H1U A;  4GLS C;  1W1G A;  1QOF A;  2LVP A;  2CR5 A;  4OW0 A;  1WZ0 A;  2JP2 A;  1TS2 A;  5D3V A;  2KC1 A;  5KHQ A;  1WGQ A;  1FPY A;  1IRS A;  1WI1 A;  1WJM A;  3JSV B;  3R3M A;  4B9K A;  4A20 A;  2N23 A;  2V3N A;  4YT0 B;  2D4Q A;  2KUP A;  3PG7 A;  1FEH A;  1WR6 E;  2C7M B;  4W9D A;  2V4I B;  4XE0 A;  2GS0 A;  2L1A A;  3FAH A;  1V5P A;  3BYY B;  2CHZ A;  2D2Q A;  3C0R B;  2IND C;  2JYE A;  2HJ8 A;  2OOB B;  1ZP0 B;  4DXG A;  3AEF B;  2JY6 A;  4ZOH C;  4MK0 A;  5CHW A;  1B9R A;  1DYN A;  4NJ7 A;  1YIW A;  2K8B A;  2D3B A;  4E74 A;  2PEA A;  3QWZ B;  5IRS A;  2JXX A;  2IY1 B;  4XDC A;  2COD A;  1QQG A;  1WJU A;  3NS8 A;  2C5L C;  1RRB A;  5AZF A;  3ZVV A;  2VZK D;  1V88 A;  4ACF A;  2WX1 A;  4MDK E;  5C1Z A;  4PT5 A;  5J3Y A;  3FP5 A;  3TO1 A;  2MLB A;  4IDI A;  3Q3F A;  3ENB A;  1QOB A;  2PMV A;  1KI1 B;  2M14 A;  4DDG D;  1ZM0 A;  2KAN A;  4KZ0 A;  4MEL A;  3P7Z A;  1XLP A;  2BBC A;  4BBN C;  4HKZ E;  2BWE S;  3GOE A;  2H7E A;  4MGI E;  1RAX A;  3IAM 1;  1SBB B;  1NYR A;  3NOB A;  3NUH B;  3EGR A;  3W1S C;  3ZNZ B;  4MEM A;  2KUQ A;  3AV8 A;  4JWS C;  2MA9 B;  4BBN F;  4RH6 A;  1K50 A;  4GMV A;  2L05 A;  3VHT C;  2Z4D A;  2ASQ A;  2MSE D;  4NAM A;  2MH7 A;  3UGB B;  1F2R I;  4LNN A;  3FIL B;  2J7Q B;  3H6N A;  1G6J A;  2N1V A;  2P0F A;  2LMC A;  2RNR B;  3CIK A;  2MEK A;  1WX9 A;  2DHI A;  1WJ4 A;  3DVG Y;  1I2H A;  4XWW A;  2WS3 B;  1YD8 U;  4HPM B;  2Y7B A;  2YT2 A;  1R7S A;  2D9X A;  1M7E A;  2G9H D;  1WGK A;  1TTN A;  2K22 A;  1TZO A;  1DBH A;  4F1S A;  1VJK A;  4LK0 M;  4L1R A;  2LWP A;  2KT7 A;  3OG5 A;  5HG2 A;  2DX1 A;  1QT9 A;  2WDQ B;  3IHP C;  3RNG C;  4CYE A;  1ZSQ A;  3V3X A;  1I35 A;  1TGZ B;  3APF A;  3PS6 A;  4XGA B;  3AU4 A;  2WXI A;  2CB8 A;  3SHQ A;  3L54 A;  4WJN A;  3RN9 C;  2ADZ A;  5JHG A;  2H89 B;  1OMW A;  2BB5 A;  4KGS A;  3A1Q B;  2RVB B;  2WNM A;  4X57 B;  4A90 A;  3VUY A;  3ZDT A;  4E3C A;  3M62 B;  4KGR A;  5JVL A;  3WYF B;  4PNK A;  1ET9 A;  2XNA C;  1FCL A;  1IBX A;  5IOI A;  2BKR B;  3A33 B;  3I63 C;  4MGZ E;  4DDI D;  4Q2J A;  2JZ3 B;  2LKO A;  4OZA A;  3IVF A;  4QJ4 B;  4RF1 A;  4AWJ A;  4IWO A;  1FNW A;  3HW2 B;  1NTV A;  2DZJ A;  1V1P B;  3APC A;  3A58 A;  4A6Q A;  3LDZ E;  3AMZ A;  1MPE A;  1P98 A;  2Z59 A;  2Z8L A;  4F8C B;  2JT4 B;  3ALB A;  1GC6 A;  1XR0 B;  3KH0 A;  4C4V A;  4BVU C;  3T8M A;  3DOW A;  2UVM A;  4WWO A;  1XD3 B;  3NW8 A;  3NS1 A;  3V6C B;  1TBE A;  4JWU C;  1A70 A;  2LUL A;  2KDB A;  2LGY A;  2ZJD A;  1Z5S B;  4WUR A;  3ZJV A;  4CQN A;  2MX2 A;  2IGH A;  1N62 A;  1YJJ A;  1SIJ A;  2NBV B;  2X0S A;  1ZGU B;  4GDK A;  2R0D A;  2K8H A;  2Y5P A;  3L13 A;  4OHJ A;  5C79 A;  1X11 A;  2LZ6 A;  1V81 A;  2WU2 B;  3PSE B;  1IBX B;  2VH1 A;  2DZM A;  3DVN U;  1KFY B;  2L76 A;  2MRP A;  3KYD D;  3R66 C;  4ZYN A;  4HCP B;  3X23 A;  3ZTD A;  5KCV A;  4WWP A;  2J52 A;  1IGC A;  2WXM A;  4G50 A;  2BS4 B;  1I7H A;  3ZRC A;  5HI1 A;  3TFM A;  4GSW A;  2LXA A;  3NZU A;  2K00 A;  1D6E C;  3QCA A;  4LCD E;  2WWZ A;  3NVV A;  4DX9 0;  1K51 A;  2IY0 B;  2KTR B;  4L23 A;  3U7D A;  2W55 A;  4KGT A;  4M01 A;  1H8C A;  5T8I A;  2ZVN A;  4WSF A;  4B6H A;  2WXK A;  4JPS A;  1UEL A;  4EOY A;  1ACA A;  3ODX A;  1PUT A;  4P16 A;  1V8C A;  2W82 A;  1OTR B;  4WWN A;  1WGY A;  2CQU A;  3X0W A;  3NVZ A;  2DYQ A;  4IFS A;  3OJ3 A;  1RYJ A;  3F0W A;  1XLO A;  3W2D A;  3TMP B;  1JWB D;  1XEE A;  1Q0W B;  2ZNV B;  2Z14 A;  4QAY A;  2GRI A;  1TIF A;  4RM9 A;  2CRF A;  3NWA A;  1M94 A;  1PFJ A;  3QBV B;  2GBM A;  3KRW A;  2DZI A;  4URK A;  1PGA A;  3HQC A;  3D32 A;  4NAW A;  3RNA C;  4DHJ B;  4ARC A;  2QIL A;  4K17 A;  4C56 C;  2WQY B;  2IYB A;  2DHJ A;  4RGT A;  2D11 A;  3MC9 A;  1FM0 D;  4C7Y A;  3PO0 A;  2MP2 B;  3MC8 A;  2J0J A;  1NTY A;  1I4Q A;  4XX5 A;  2EC1 A;  1UPQ A;  1C76 A;  2Y8F A;  1W1D A;  2KLC A;  3KUD B;  2GCL A;  3TEZ A;  1HZ5 A;  4P7I A;  2D9Y A;  2K6Q A;  1OQR A;  1KZG A;  4AJW A;  2KN5 A;  3AEA B;  1HEZ E;  3E9P A;  3HSA A;  3HUI A;  5HE2 A;  4M0W A;  1FAO A;  3BVG A;  1DOY A;  1UBQ A;  2OJR A;  5BMI A;  4M8M A;  3B2G A;  4JKE A;  2YSZ A;  3V62 A;  4CO7 A;  4IWQ A;  2LYD A;  4GB9 A;  3PTF C;  1LW3 A;  3S2A A;  1NDD A;  4MT7 A;  4PYU A;  1IUE A;  3W9C B;  3TW1 A;  3PV1 A;  2FIF A;  3SFD B;  4KSK C;  5CX3 A;  1GJZ A;  2LJ5 A;  1WG7 A;  4RM8 A;  4EE2 A;  2JZP A;  3CMM B;  3JYU A;  3DXD A;  2HDE A;  3SU8 X;  4DK5 A;  3LXF A;  2G4S A;  1FD6 A;  2X8X X;  4MGY E;  2DYM A;  1FHW A;  3ABV B;  1WFY A;  1NU2 A;  4OZC A;  3BK2 A;  4ZRK A;  1DDV A;  4W9C A;  1EF5 A;  3FLV A;  3PPA A;  1WM3 A;  1WY8 A;  1BTN A;  2L2I A;  1HB8 A;  5D6J B;  2RR9 A;  3FEH A;  2VH2 A;  3I9V 1;  2KQ7 A;  5H8Y E;  4AUQ C;  1YJI A;  1L0X B;  4FAD A;  1WRD B;  3EEC A;  4DXF A;  1UNQ A;  2M0X A;  1YN5 A;  3H9D A;  3DBS A;  3Q14 C;  3PRZ A;  3RI7 C;  1MG8 A;  4A6H A;  2WXO A;  1YNT E;  1V2Y A;  2INP E;  1HB6 A;  2FBW B;  3AE7 B;  4HCN B;  3PHW B;  1QF6 A;  5DHF B;  2GI9 A;  5E6O A;  1GPX A;  4TV3 A;  4H2A A;  1T0Q C;  1JW9 D;  2N7J A;  3T3O A;  2MWN B;  1WF9 A;  1L7Y A;  4H8S A;  4WJP A;  1OY2 A;  3QJZ A;  1E5W A;  1U5D A;  2K49 A;  2KOX A;  3Q8C A;  5C5B B;  2YEP B;  4RNA A;  3L0W B;  3UIP B;  2FNJ B;  1WMH A;  4PS8 A;  4YL8 A;  2DNF A;  2IDY A;  3VUX A;  4II2 B;  2COC A;  1VBH A;  3Q3M C;  2XBB C;  2LHE A;  1V5U A;  3Q8A A;  3V61 A;  3L10 B;  4M02 A;  2LGI A;  1W1H A;  3U2S C;  1CMX B;  4ARI A;  5DPT A;  1V89 A;  2WXJ A;  3A9J A;  3ENE A;  1J7B A;  3N1Z C;  3MTN B;  1P3Q U;  5J3Q A;  2WYQ A;  3H7S A;  4YTP B;  3OHM B;  2DKQ A;  2DX5 B;  1FXI A;  3VTU A;  3ZLZ A;  3GYO A;  2WXP A;  2DYB A;  4OVZ A;  3AE4 B;  3DWG C;  1FCC C;  1WM2 A;  3SBT A;  4W9I A;  4PYZ A;  1ZUD 2;  4US9 A;  1IP9 A;  2KIG A;  4A6F A;  1GB4 A;  5FK9 C;  3AE6 B;  2KDI A;  1T0R C;  2N9K A;  3NSU A;  3RUL A;  3PGE A;  4OSN A;  1KRH A;  4P6V F;  3PP2 A;  3R8B A;  4OT1 A;  1ZVR A;  4YON A;  3DHG C;  3EUB 2;  1SE9 A;  4W9H A;  3NG0 A;  4ANW A;  1VBG A;  1U27 A;  3B9J A;  2NBW B;  3IAS 1;  3JSV A;  2J53 A;  2LG1 A;  2PE6 B;  2QDF A;  1KZ7 A;  1S3S G;  1S1Q B;  4HRO A;  2G4D B;  3O13 A;  4HJK A;  3G9W A;  3KQ4 A;  3V6E B;  2R2Y A;  1X05 A;  2LI5 A;  4NQL B;  3HM3 A;  3RT3 B;  2I1J A;  1C78 A;  4PS3 A;  1KBL A;  3UQA A;  4LJO B;  5JHH A;  4TYZ A;  2E6X A;  3VTV A;  4ILJ A;  1BT0 A;  1P7F A;  5LNK 1;  2IO0 B;  2KMM A;  2LGX A;  4JK7 A;  2GCJ A;  2JVC A;  4F7G A;  1DYQ A;  2KJH B;  4JKA A;  4TSS A;  3N32 A;  5LXH A;  2QC8 A;  1N5X A;  1TZ1 A;  4JKB A;  2KXJ A;  2DBY A;  3ZQ4 A;  5HE1 A;  1ZOY B;  2N7D A;  4HDQ A;  2LHD A;  2W2W A;  1PDX A;  3IFW B;  1D5X C;  3L08 A;  4HPL B;  1MHX A;  1AWE A;  1QIL A;  1TKG A;  3W1Y A;  3L17 A;  1ZE3 D;  3E9S A;  2IBI B;  3A8Q A;  5AUI A;  1UH6 A;  4WAF A;  2RSG A;  1GUA B;  3WAN A;  2R2Q A;  4Y94 A;  2MQJ A;  1BXT A;  2DA0 A;  4QJ5 B;  3N20 C;  1JWA D;  2V4L A;  5FKA C;  1RFK A;  5GOW B;  2D3C A;  3VFK A;  4YXD B;  1FFV A;  2MBB B;  1KC7 A;  1ZDX A;  5D94 A;  4A6K A;  1N5W A;  2WP9 B;  5JZE B;  1XLQ A;  2WGS A;  1MKE A;  4RGN A;  4HB0 B;  3A4S C;  2BPS A;  4JKD A;  3U7Z A;  2RPQ A;  1JRU A;  1L0V B;  1ACC A;  4B0M A;  5DPS A;  3PHX B;  2H7D A;  2L0T A;  3M3J A;  3ML8 A;  2UU7 A;  1I4P A;  4KSL C;  4HWI B;  4S0R A;  2Z0E B;  3VR8 B;  3FIL A;  2CHX A;  3VIA A;  3NZ3 A;  5DHA B;  2WXH A;  2V76 A;  1I4H A;  3E56 A;  2C7H A;  5CLQ B;  4GMX B;  2LD9 A;  2AL6 A;  4ZHP A;  5DH9 B;  4KKJ A;  2ZPN A;  1KF6 B;  4ZYS A;  4MH8 A;  2V0G A;  1NYQ A;  2RD0 A;  4GZU A;  5D3D A;  3D8D A;  3E9O A;  3EA6 A;  3QAQ A;  1BWN A;  2JRH A;  3PVU A;  2QIE B;  1WXQ A;  3AEE B;  1NEK B;  1KLV A;  3ZKJ C;  1HTQ A;  2FCS A;  1MI1 A;  4ILH A;  2KC2 A;  4ANU A;  2DYN A;  4JKH A;  2DAJ A;  1P5T A;  3ZVR A;  2EKI A;  2I5F A;  3T9L A;  2KGX B;  2KN4 A;  1Y5O A;  4LDT D;  4IOI E;  3DHI C;  3RZW C;  4CHM A;  1JRO A;  1N6Z A;  4HAV B;  1STE A;  2BYV E;  2CHW A;  2JX5 A;  4FA6 A;  4RGM A;  3RYT A;  4P1B C;  1VDV A;  1Z2M A;  5CHF A;  2G45 B;  1BUI C;  4WQO B;  3RNF C;  4KHO A;  1CK1 A;  3ETR A;  4JKG A;  4GPT B;  4DXA B;  1SE4 A;  3PZ8 A;  1VZ7 A;  1BML C;  2NBU A;  1J0G A;  1M7R A;  1LQB A;  1RLF A;  1SE3 A;  3QX1 A;  1H4R A;  1E8X A;  3A1Q A;  5I4D A;  1IYF A;  1TS3 A;  2YLM A;  3QIJ A;  3H7P B;  1P3R A;  2IFS A;  3WAL A;  3TL5 A;  1V61 A;  4XYC A;  2N4F A;  3CST A;  2R09 A;  2FJU B;  3PSC A;  3BJI A;  3HK0 A;  5BMH A;  4I6P A;  4GU2 A;  3VRA B;  3RUI B;  2W54 A;  1V1P A;  1CZP A;  3VH3 B;  2KDF B;  1ZPS A;  4N9F 4;  1SHC A;  2KK8 A;  3PVW A;  1E6E B;  2K1F A;  2DEN B;  1AQC A;  2N1W A;  3P4R B;  3U52 E;  4EZJ A;  1B55 A;  2WXN A;  2CJO A;  1UGJ A;  4YSZ B;  1XOD A;  1DOX A;  3ML9 A;  1NTI A;  2BWF A;  3N9Y C;  1FO4 A;  4AOF A;  1WX8 A;  3A9K B;  2LVO A;  2X38 A;  2KCJ A;  2PW9 A;  3U12 A;  3ECI A;  5TR5 A;  4JKG B;  4JKF A;  3ODO A;  1SJH D;  3FVC A;  1TY2 A;  2AQ1 B;  2GBN A;  3AE2 B;  1KM7 A;  2N0S B;  2NMB A;  2I2Y A;  1QQR A;  2O6V B;  2L8J A;  5JP4 A;  2KMA A;  3TJP A;  1YJ1 A;  3EPY A;  2KDE B;  1WXS A;  1ISN A;  4HJG E;  3P4S B;  3T3N A;  3PRM B;  2NBV A;  1N60 A;  2K25 A;  3BY4 B;  1YQ4 B;  1GG3 A;  1FGY A;  1FXA A;  4K81 A;  2OTX A;  2RMM A;  2BQQ A;  4HEA 1;  3ZGZ A;  4JX1 C;  4MGK E;  2GUM A;  4US8 A;  2FDQ A;  2DHK A;  1LXD A;  3NVY A;  1X1G A;  4A55 A;  1DDW A;  4QXA B;  3UIO B;  1RWS A;  2NTS A;  2ZZP B;  3KUZ A;  1J19 A;  1EM7 A;  3B0A A;  3U8Z A;  2VRR B;  2KWC A;  1MG4 A;  5CHV C;  2YS5 A;  4K3B A;  3ML4 A;  2KWD A;  2GB1 A;  2JF5 A;  3SV1 A;  3Q3O C;  5FR3 A;  4QJ3 B;  3D8E A;  3TBL D;  3OJ4 B;  2PIA A;  1WIA A;  4PS7 A;  2QHO A;  3DDC B;  1XD4 A;  5FI1 A;  1WSP A;  4ZHO A;  2KVR A;  2KTR A;  1FHO A;  4A9A A;  1UBI A;  3ULC A;  1E7V A;  4D0N B;  3PLV A;  3RZF A;  1YMH E;  3SFE B;  1VLB A;  1GNU A;  1FOE A;  2M38 A;  2Z0D B;  1ENF A;  2M0A A;  2KIE A;  4W9F A;  4BKG A;  1JDE A;  5LON B;  2BS3 B;  4A3P A;  1PGB A;  2V9H A;  1F52 A;  4AP4 C;  2KWV B;  4C00 A;  1V1O A;  2L00 B;  2D3G A;  2D9W A;  4K2P A;  4KAX B;  3MJW A;  3VUW A;  3ONS A;  1PQS A;  3AJ4 A;  4HSI A;  4GDL B;  2LEK A;  3ZJU A;  2ROV A;  1YQB A;  2I5C A;  2KKC A;  4HAW B;  1VD2 A;  2KAJ A;  1FB8 A;  3KUC B;  1C4C A;  2P0H A;  1UUP A;  2FAZ A;  2DZK A;  2ZEQ A;  1K5D B;  2IO2 B;  4WH4 A;  2BTE A;  3ZDM C;  2W2X D;  4XDD A;  2WXL A;  2LJI A;  1F2R C;  4NJ6 A;  2FJ9 A;  2ZCB A;  2COF A;  2YT0 A;  3T06 A;  2DN6 A;  1ZW7 A;  1U4A A;  1TYG B;  3SUZ A;  4E71 A;  2IGD A;  4M8N A;  3UIN B;  2GBJ A;  3RNC C;  1UPR A;  2MP2 A;  3HIZ A;  1L6U A;  2WDV B;  3B08 A;  2KAC A;  5IAA C;  1N63 A;  1QOA A;  1EGX A;  1XCT L;  1DRO A;  1E9M A;  2LGD A;  3IG3 A;  4EMO A;  4C0A A;  2DLB A;  1XX0 A;  3VH4 B;  4HAY B;  1XT9 B;  2DHZ A;  3QAR A;  4HAU B;  2ON8 A;  3V60 A;  3DBR B;  3M63 B;  3LJU X;  2COA A;  1XQQ A;  3P42 A;  1UGM A;  2J0M A;  2WX0 A;  5BYQ A;  4KHB A;  1ZXH A;  5LXI B;  2JWU A;  2MWS B;  3Q3J A;  2K8E A;  1AYF A;  4K2O A;  1LGR A;  2R61 A;  1Q1O A;  1WYG A;  5J2R A;  2W9N A;  2RGN B;  1YN3 A;  4HPP A;  1Q67 A;  1MVK A;  4EUT A;  2EJ8 A;  2LBB A;  4IOY X;  2GMI C;  1C9F A;  4DHZ B;  4A8X C;  4DX8 A;  2ZKM X;  2IO3 B;  3AE3 B;  4W9J A;  3BVZ A;  5L83 A;  3VTW A;  1V5M A;  4MSQ B;  1JCK B;  4C80 A;  3R2T A;  3E9L A;  4OVV A;  1OQN A;  5H92 C;  5I2S A;  1EU4 A;  1JWS D;  2YS3 A;  3FKY A;  2YS1 A;  1KJT A;  1C4P A;  4HLE A;  2NR2 A;  3OAN A;  2XK5 B;  2N7E A;  2GBR A;  2UZR A;  1E7U A;  2JYT A;  4GNK B;  3QHT A;  1A5R A;  5DCN A;  3GB1 A;  2D3A A;  1SJE D;  5BO4 B;  1C79 A;  1MI0 A;  3AED B;  5IP4 D;  1QLB B;  3NZS A;  2L7R A;  2P0D A;  4FUL A;  4HRS A;  2J4X A;  4LNK A;  4DWF A;  3AEB B;  2D07 B;  1E8Y A;  3KVF B;  4DHZ E;  1UNR A;  3PRP B;  4DBG A;  4KHB B;  1BAK A;  2KTF A;  3Q3N C;  4XWX A;  1LO5 D;  3QWM A;  1WE6 A;  3C19 A;  3CXB B;  1MIZ B;  4TKN A;  1Y19 B;  1FHX A;  2C60 A;  2QKL A;  1HA5 A;  3DQV A;  1TS5 A;  4HXD A;  4TMA B;  4P1C C;  2D10 A;  2I1K A;  2M1M A;  4HB3 B;  1KTK A;  3VAW A;  5C5B A;  2MBQ A;  2L32 A;  4FHK A;  4HAT B;  4K7W A;  2FID A;  3IT6 B;  4EZL A;  1HQR D;  2N9L A;  1Q10 A;  1FFU A;  2KQS A;  2A5U A;  3AB5 A;  4XC2 A;  1IGD A;  3Q69 A;  3I57 A;  4ASW C;  2GJY A;  4MM3 B;  1AN8 A;  3PEG A;  4B6W A;  4HB2 B;  2WU5 B;  3MHS D;  1E90 A;  1J8C A;  4IAP A;  2N9P C;  1E8Z A;  4FBJ B;  3V5W A;  2BGF A;  3OAW A;  2M8S A;  2DX5 A;  3A8P A;  2BYT A;  2J59 M;  1D5M C;  5AZG A;  3L16 A;  2ONQ A;  2CY4 A;  3CF6 E;  5EE0 A;  2JXT A;  1CJE A;  1FNU A;  3OLM D;  3D8F A;  1NVI D;  2XQN M;  2A4Z A;  2BVC A;  2ZPY A;  2GOW A;  2OHF A;  2CY5 A;  5AZH A;  3SR6 A;  2I38 A;  3TEY A;  2CS4 A;  5D3I B;  1PLS A;  3HVD A;  4I6L B;  5G55 A;  4F7Z A;  3DVG X;  3R2I A;  3B2F A;  5LLI A;  1XF5 L;  2W3R A;  4JGH B;  2VSZ A;  2AQ2 B;  1BTK A;  4MAC A;  5BYR A;  1GB1 A;  3ZNI D;  4REZ A;  1DDM A;  5LOP B;  4W9E A;  4K1R B;  2AWT A;  5L81 A;  3HHM A;  1N61 A;  4A5K A;  4HVB A;  2RRF A;  1FGZ A;  1AAR A;  2DTC A;  1XO3 A;  2NPT B;  2MBE A;  4B0E A;  1R4N B;  3N3K B;  5EE9 A;  4GOU A;  5C16 A;  2ABD A;  5G5G A;  4I6N B;  1WGG A;  4KZC A;  2REX A;  5J3T A;  2KYW A;  2RDH A;  3DBL B;  3J9C A;  2D5G A;  2EMS A;  3ZYY X;  2C7N B;  2FCN A;  1KH0 A;  1XKE A;  2HJ1 A;  1D5Z C;  4EJN A;  1PGX A;  2LXC A;  4ZRJ A;  5E6P A;  2K39 A;  1F9J A;  2VZK B;  4DHJ D;  4ICV A;  2SAK A;  4UDU C;  1JRP A;  3AXC A;  2QEJ C;  3SYX A;  4ZRQ A;  1E7P B;  3URY A;  2CU1 A;  1JQ4 A;  4DBB A;  5D3X A;  2HRJ A;  3HRD D;  2WXG A;  3ZTC A;  2D9Z A;  1UWM A;  3B1L X;  3O96 A;  1EO6 A;  2EEL A;  1P0R A;  1XCG A;  1J7A A;  2IGG A;  1ET6 A;  3AH7 A;  2L52 A;  1C4A A;  1E0Z A;  1WWT A;  2R82 A;  1WYW B;  2K0P A;  5C6R A;  4LTU A;  2WXR A;  3IXS A;  2Z13 A;  2G3Q B;  4L6E A;  3KWL A;  1E8W A;  4F7U P;  1P6S A;  2UYZ B;  1PMS A;  3DBR I;  3RNE C;  3B77 A;  2JRI B;  1HZ6 A;  5D3Y A;  4HDO A;  2R2O A;  1QZE A;  2CAY A;  2K2U A;  4PK1 A;  2LRW A;  2QMT A;  4JK9 A;  2EMT A;  3ULB A;  3GP7 A;  4GGQ A;  1SIF A;  5J17 A;  4FN2 A;  2XEW A;  2JQR B;  1TY0 A;  2KFK B;  4FJV B;  1U2B A;  2HTH B;  1WR1 A;  5IA7 A;  4LJP B;  3WAP A;  3SNH A;  3KRX A;  1P1A A;  2QCZ A;  1DGJ A;  1EUV B;  3Q6B A;  3E66 A;  3IT4 B;  5C2T B;  4XZ4 A;  4YSY B;  2DFK A;  2YT1 A;  1ST7 A;  3GS2 A;  3NVW A;  4YWG G;  1T3Q A;  2G35 A;  4JKC A;  1E10 A;  1QC6 A;  5C3J B;  2Y5B B;  1ZKH A;  5GXG B;  1EF1 A;  3L4P A;  3M95 A;  5HHD G;  3SO6 A;  3LYY A;  3DXE A;  1MK7 B;  5LG4 B;  3ZO5 B;  4CSQ A;  5E6J A;  4RF0 A;  3RFZ B;  2KO3 A;  2WHI A;  2FUH B;  4Z2M B;  4RFB A;  1Q5W B;  3A98 B;  1SSN A;  3CWI A;  3BIN A;  2QKM A;  4KHA A;  3O65 B;  3H7P A;  2BF8 B;  3WA0 A;  1HE8 A;  1RM6 C;  3DPD A;  1OQQ A;  1NI2 A;  1I4G A;  2ZCC A;  4G0N B;  1X1F A;  4KIK B;  4IUM B;  1FNV A;  2MBH A;  1UZX B;  2KX3 A;  2LUE A;  5DIF B;  4ICU A;  2N9X A;  5EE3 A;  4BKS A;  1C3T A;  1OGW A;  2DIK A;  5BMG A;  4FJY A;  5CTR C;  2KVZ A;  4O1N A;  1I4R A;  3ZXR A;  4IM0 A;  3VQI A;  3R7R A;  1L6V A;  1MAI A;  1VZ6 A;  4MJS B;  5D7G A;  4W9K A;  1HTO A;  5CLL B;  4GXB A;  3HVZ A;  3TEW A;  2Z0P A;  1MPH A;  4ZDV A;  1SE2 A;  4ANX A;  3UQB A;  4YTN B;  1I42 A;  2AL3 A;  2OED A;  2AQ3 B;  3A9K A;  2DKP A;  1TJ6 A;  4HAX B;  2O6V A;  4N58 A;  4TQ1 A;  3EFC A;  1VR9 A;  2ZVO A;  1T5X D;  3QK0 A;  3RPF C;  2FUG 1;  2K5P A;  3PT2 B;  4HAZ B;  2WXF A;  3MHZ A;  2COP A;  3TIX A;  3P63 A;  1F0Z A;  1EU3 A;  4IW0 A;  1D3Z A;  2LRU A;  1L2N A;  3WAO A;  1SF0 A;  4RMA A;  2ZW0 A;  2Z0Q A;  1UNP A;  2K8C A;  2JSV X;  4BAX A;  4BFR A;  2N9E B;  1SGH A;  2JUO A;  2KFJ A;  1U5F A;  2ACZ B;  4OVU A;  1AWD A;  3I5J C;  2H88 B;  3CSF A;  3JW0 X;  4YTM B;  3NY5 A;  1R4N I;  1WX7 A;  4ZRI A;  2NVU I;  3QQ8 B;  3VRB B;  3K9P B;  3SDL C;  3DBL I;  3ZUN A;  4LNF A;  1X86 A;  2KQ4 X;  1NEN B;  2ZNV C;  2PVG C;  1F1H A;  4MT5 A;  2KJ6 A;  3BK1 A;  4N6E B;  4EEW A;  2NMQ A;  4IM2 A;  2PE9 A;  2KWU B;  4CHJ A;  3P1M A;  3AE8 B;  4N59 A;  2DLW A;  3U4E G;  2VRW B;  2KHW B;  1EWY C;  2BT6 A;  2IZV B;  1XLN A;  1FXT B;  4J3O D;  5AEK B;  2KR0 A;  2M17 A;  3AN1 A;  4B95 A;  4W9G A;  2O2V A;  4G11 A;  1WZ3 A;  4GDL A;  2AX5 A;  1L5P A;  2RUK B;  5IN7 A;  4EZK A;  2MBO A;  1DOI A;  1SXT A;  4IG7 B;  2V1Y A;  1EWC A;  2KX0 A;  1OEY A;  3BZD B;  2LUM A;  2W3S A;  1XXG A;  2KDM A;  3CIR B;  2BKF A;  4ITK A;  1KLG D;  4DQO C;  1R4M B;  2OQB A;  4HKQ A;  5HE3 A;  3UZT A;  3KY9 A;  1YX6 B;  3C8Y A;  4YSX B;  1RJ2 A;  5JLJ B;  5IKC M;  2GLS A;  3RNB C;  4NPN A;  5L95 C;  2JWZ A;  3GZN B;  2J0K A;  3VOQ A;  3MPX A;  1VZ8 A;  3W1S A;  1OEY J;  1HXY D;  3LB8 C;  5G2N A;  2CKH B;  4JK8 A;  2ICI A;  2KNB A;  4KX6 B;  2PTL A;  3DBH B;  2RSU A;  1V80 A;  3MDB C;  4Z2N A;  1TXD A;  2LVQ A;  1MIX A;  1QOG A;  4BOZ B;  4IWP A;  1MHH E;  1VRA B;  3F5R A;  3ZW3 A;  5DPR A;  1WRI A;  2BYF A;  1UWX A;  5D27 A;  2CU3 A;  2V3S A;  2PZ1 A;  1TJE A;  1C77 A;  2AEH A;  1WJN A;  1HBK A;  2RLO A;  1U29 A;  1TKE A;  1PFD A;  1TT5 B;  3DCX A;  1FRD A;  3HIE A;  4NNJ B;  1LB1 A;  3ODW A;  2MJE A;  2O2V B;  2SEB D;  4K7U A;  3TEX A;  5EDS A;  2G1E A;  1NVL A;  3PLU A;  4L2Y A;  1B1Z A;  1U5G A;  4LNI A;  4WIP A;  3V05 A;  4KVG B;  1JML A;  3FC4 A;  3KWV A;  1WGH A;  4FHJ A;  4JE3 B;  4BKT A;  3KW5 B;  2FCM A;  2WLB A;  2E3T A;  3KYC D;  1T0S C;  1YX5 B;  1L0Y B;  1ZDV A;  3I3T B;  1UF0 A;  1YQ3 B;  2XK5 A;  3NJT A;  2NCN A;  2HE7 A;  2YF0 A;  4BOS C;  2MW5 A;  3P2B A;  5FR6 A;  4KKI A;  1RRP B;  1V5O A;  5JHB A;  4A3O A;  1GGO A;  5J18 A;  2FE8 A;  2JPH A;  2K6D B;  3K9O B;  2N0Y A;  5DI9 B;  3M1I B;  1UNS A;  1Y8R C;  3P6A A;  4BKS D;  4PQ0 A;  4NZL B;  1OQY A;  1I4X A;  3H8H A;  3BWU D;  3R7Q A;  3AE9 B;  2LAS A;  3VXW A;  2AYO B;  5IO9 A;  2MJD A;  2Z59 B;  5D3W A;  3N1X C;  3MP9 A;  2Y8G A;  3ZRF A;  2YEP F;  3UI3 A;  3ZIM A;  3KSY A;  4LNO A;  4C4V B;  4USA A;  2BW2 A;  5AUK A;  3N7C A;  2PLP A;  1T77 A;  5I2M A;  3EHV A;  4JL9 A;  4JLC A;  4AQ7 A;  2E2X A;  2NZ8 B;  4ANV A;  1H10 A;  4HB4 B;  4WJO A;  2O6V D;  2HTM E;  3IBE A;  5JHA A;  3AE5 B;  1M4V A;  1TS4 A;  5IJM A;  4NY0 A;  3TVV A;  1FMA D;  2HD5 B;  4GDK B;  2BYE A;  1WE7 A;  2IPK D;  2WDR B;  4MM3 A;  1U5E A;  1KOT A;  5G5H A;  3JVZ X;  3FM8 C;  1ZYI A;  2ELB A;  4GOC A;  4K7S A;  1T6B X;  5FI0 A;  2DYO A;  4TQ0 A;  3RCZ A;  2M4N A;  4XWT A;  1WJ6 A;  1T0Y A;  3WAM A;  1TQZ A;  2DAF A;  1LM8 B;  1WXA A;  2P8V A;  2M19 A;  4RCO A;  4JQW C;  2L83 A;  4TUU A;  1WJ1 A;  3SD5 A;  3AEC B;  4KV2 A;  2KLG A;  2KJR A;  2BS2 B;  3VDZ A;  3KZ1 A; 
#chains in the Genus database with same CATH homology
 3U30 A;  4IC7 B;  3N30 A;  2UZS A;  1Z87 A;  4KDI C;  3NHE B;  3AU5 A;  4FLH A;  1EAZ A;  1UD7 A;  2ROZ B;  3PVL A;  3AI5 A;  2GBK A;  3VVW B;  4ILG B;  1IPG A;  1X1M A;  5HE0 A;  4GIV A;  3ZNG C;  4BBK A;  1P9D U;  1V49 A;  2EKE C;  2NPT A;  4J6I A;  2MFQ A;  3AUL A;  1V5T A;  2KD0 A;  2RGF A;  3QA8 A;  2ELA A;  1DIK A;  2IYD B;  3DVN V;  4F7H A;  2IO1 B;  1RFA A;  4MH0 E;  2B3A A;  4NAW B;  3ZNH B;  2L1C A;  4GN1 A;  2VKI A;  3LJ3 A;  1R4M I;  2BCJ A;  3RCP A;  5D2M B;  2K2J A;  1C1Y B;  3A4R A;  4AJY B;  1WGU A;  3GZN I;  2D9V A;  2KMC A;  4EKU A;  3PRE A;  3UF8 A;  4JIO U;  2PPH A;  1WH3 A;  4M0W B;  3DBH I;  4FJZ A;  4II3 B;  4KDL B;  2L3Z A;  2WDT B;  5JH5 C;  4HK2 A;  3PZD A;  1WGR A;  2NS5 A;  4G3X B;  3QC8 B;  2KZR A;  5GMV A;  1V86 A;  1V9J A;  1WGD A;  3APD A;  3EFU A;  5DPW A;  2Q13 A;  2Z0O A;  3FSS A;  5KQ4 A;  2KFK A;  1I7A A;  4MY6 A;  1J0W A;  2HTH A;  4NQK E;  3TCA A;  2FCQ A;  5KQ1 A;  4MSM B;  4W9L A;  1EVH A;  3DXC A;  1LFD A;  2MDX A;  2UWQ A;  1NBF C;  3EC8 A;  4WAA A;  4WJ7 A;  4EFO A;  1ZC3 B;  3GYP A;  4LDT B;  3DCG A;  2FJL A;  2W2X C;  3HM6 X;  2RQ1 A;  1ZC4 B;  2LOX A;  2WH5 A;  3RD2 A;  2JZZ A;  2MKR A;  1GC7 A;  4NSW A;  1WMH B;  5HKH A;  3WIM A;  5C23 A;  1UEF A;  2X18 A;  1WXM A;  4HHV A;  1K5G B;  3A9J B;  4WVF B;  4IM3 A;  5EFX A;  5E6N A;  4KIK A;  1WVH A;  2YRY A;  2PJH A;  2YVC A;  2C9W B;  1VCB A;  1V6E A;  2MCN B;  1N3H A;  2L0F A;  5KHO A;  4WJQ A;  1WXV A;  2LOZ A;  3SBG A;  1MK9 B;  4MJS A;  4A6F B;  1K8R B;  4CHK A;  1WI0 A;  3H1U A;  1W1G A;  2LVP A;  2CR5 A;  1WZ0 A;  2JP2 A;  5D3V A;  2KC1 A;  5KHQ A;  1WGQ A;  1IRS A;  1WI1 A;  1WJM A;  3JSV B;  3R3M A;  4B9K A;  4A20 A;  2N23 A;  2D4Q A;  2KUP A;  3PG7 A;  1WR6 E;  2C7M B;  4W9D A;  2GS0 A;  1V5P A;  2CHZ A;  2D2Q A;  3C0R B;  2HJ8 A;  2OOB B;  2JY6 A;  4MK0 A;  5CHW A;  1DYN A;  4NJ7 A;  1YIW A;  2K8B A;  4E74 A;  2PEA A;  3QWZ B;  2JXX A;  2IY1 B;  2COD A;  1QQG A;  1WJU A;  3NS8 A;  2C5L C;  1RRB A;  5AZF A;  3ZVV A;  1V88 A;  2WX1 A;  4MDK E;  5C1Z A;  5J3Y A;  3FP5 A;  3TO1 A;  2MLB A;  3Q3F A;  3ENB A;  1KI1 B;  2M14 A;  4DDG D;  1ZM0 A;  2KAN A;  4KZ0 A;  4MEL A;  3P7Z A;  4BBN C;  2BWE S;  3GOE A;  2H7E A;  4MGI E;  1RAX A;  3NOB A;  3W1S C;  3ZNZ B;  4MEM A;  2MA9 B;  4BBN F;  4GMV A;  2L05 A;  3VHT C;  2ASQ A;  2MSE D;  3UGB B;  2J7Q B;  3H6N A;  1G6J A;  2N1V A;  2P0F A;  2RNR B;  3CIK A;  1WX9 A;  2DHI A;  1WJ4 A;  3DVG Y;  1I2H A;  1YD8 U;  4HPM B;  2Y7B A;  2D9X A;  1M7E A;  1TTN A;  1DBH A;  4F1S A;  2LWP A;  2DX1 A;  3IHP C;  4CYE A;  1ZSQ A;  1I35 A;  1TGZ B;  3APF A;  3PS6 A;  3AU4 A;  2CB8 A;  3SHQ A;  3L54 A;  4WJN A;  2ADZ A;  5JHG A;  1OMW A;  3A1Q B;  2RVB B;  4X57 B;  3VUY A;  3ZDT A;  4E3C A;  3M62 B;  5JVL A;  3WYF B;  4PNK A;  2BKR B;  3A33 B;  4DDI D;  4MGZ E;  2JZ3 B;  2LKO A;  3IVF A;  4AWJ A;  4IWO A;  3HW2 B;  1NTV A;  2DZJ A;  3APC A;  3LDZ E;  1P98 A;  4F8C B;  2JT4 B;  3ALB A;  1GC6 A;  1XR0 B;  3KH0 A;  4BVU C;  3T8M A;  3DOW A;  2UVM A;  4WWO A;  1XD3 B;  3V6C B;  1TBE A;  2KDB A;  2LUL A;  2LGY A;  2ZJD A;  1Z5S B;  2MX2 A;  2NBV B;  2X0S A;  1ZGU B;  4GDK A;  2R0D A;  2K8H A;  3L13 A;  5C79 A;  1X11 A;  2LZ6 A;  1V81 A;  3PSE B;  2DZM A;  3DVN U;  2L76 A;  2MRP A;  3KYD D;  3R66 C;  4ZYN A;  4HCP B;  3X23 A;  3ZTD A;  5KCV A;  4WWP A;  4G50 A;  3ZRC A;  3TFM A;  4GSW A;  2LXA A;  3NZU A;  2K00 A;  3QCA A;  4LCD E;  2WWZ A;  4DX9 0;  2IY0 B;  2KTR B;  3U7D A;  1H8C A;  2ZVN A;  4WSF A;  4B6H A;  1UEL A;  4EOY A;  1ACA A;  3ODX A;  1OTR B;  4WWN A;  1WGY A;  2CQU A;  3X0W A;  2DYQ A;  4IFS A;  3OJ3 A;  3F0W A;  3TMP B;  1Q0W B;  2ZNV B;  4RM9 A;  2CRF A;  1M94 A;  1PFJ A;  3QBV B;  2GBM A;  3KRW A;  2DZI A;  4URK A;  3HQC A;  3D32 A;  4NAW A;  4DHJ B;  4K17 A;  2IYB A;  2DHJ A;  2D11 A;  2MP2 B;  2J0J A;  1NTY A;  4XX5 A;  2EC1 A;  1UPQ A;  2KLC A;  2Y8F A;  1W1D A;  3KUD B;  2GCL A;  4P7I A;  2D9Y A;  2K6Q A;  1KZG A;  4AJW A;  2KN5 A;  3E9P A;  5HE2 A;  1FAO A;  1UBQ A;  2OJR A;  4M8M A;  4JKE A;  2YSZ A;  3V62 A;  4CO7 A;  4IWQ A;  2LYD A;  4GB9 A;  3PTF C;  1LW3 A;  3S2A A;  1NDD A;  4MT7 A;  4PYU A;  3TW1 A;  3PV1 A;  2FIF A;  4KSK C;  5CX3 A;  1GJZ A;  2LJ5 A;  1WG7 A;  4RM8 A;  3CMM B;  3JYU A;  3DXD A;  3SU8 X;  4DK5 A;  2G4S A;  4MGY E;  2DYM A;  1FHW A;  1WFY A;  1NU2 A;  4ZRK A;  1DDV A;  4W9C A;  1EF5 A;  3FLV A;  3PPA A;  1WM3 A;  1WY8 A;  1BTN A;  2L2I A;  1HB8 A;  5D6J B;  2RR9 A;  3FEH A;  2KQ7 A;  4AUQ C;  4FAD A;  1WRD B;  3EEC A;  1UNQ A;  2M0X A;  3H9D A;  3DBS A;  3PRZ A;  1MG8 A;  4A6H A;  1V2Y A;  4HCN B;  1HB6 A;  3PHW B;  5DHF B;  5E6O A;  4TV3 A;  2MWN B;  1WF9 A;  1L7Y A;  4H8S A;  4WJP A;  1OY2 A;  3QJZ A;  1E5W A;  1U5D A;  2KOX A;  5C5B B;  3L0W B;  3UIP B;  2FNJ B;  1WMH A;  4PS8 A;  4YL8 A;  3VUX A;  4II2 B;  2COC A;  1VBH A;  2XBB C;  1V5U A;  3V61 A;  3L10 B;  1W1H A;  1CMX B;  5DPT A;  1V89 A;  3A9J A;  3ENE A;  3MTN B;  1P3Q U;  5J3Q A;  2WYQ A;  3H7S A;  2DKQ A;  2DX5 B;  3VTU A;  3ZLZ A;  3GYO A;  2DYB A;  1WM2 A;  3SBT A;  4W9I A;  4PYZ A;  1IP9 A;  4A6F A;  2KDI A;  3NSU A;  3RUL A;  3PGE A;  3PP2 A;  1ZVR A;  4YON A;  1SE9 A;  4W9H A;  4ANW A;  1VBG A;  1U27 A;  2NBW B;  3JSV A;  2LG1 A;  2PE6 B;  1KZ7 A;  1S3S G;  1S1Q B;  2G4D B;  4HJK A;  3G9W A;  3V6E B;  1X05 A;  2LI5 A;  4NQL B;  3HM3 A;  3RT3 B;  2I1J A;  4PS3 A;  1KBL A;  3UQA A;  4LJO B;  5JHH A;  4TYZ A;  3VTV A;  4ILJ A;  1BT0 A;  2IO0 B;  2LGX A;  4JK7 A;  2GCJ A;  2JVC A;  4F7G A;  2KJH B;  4JKA A;  3N32 A;  5LXH A;  1TZ1 A;  4JKB A;  2KXJ A;  5HE1 A;  2N7D A;  4HDQ A;  2W2W A;  3IFW B;  3L08 A;  4HPL B;  1AWE A;  3W1Y A;  3L17 A;  2IBI B;  3A8Q A;  1UH6 A;  2RSG A;  1GUA B;  3WAN A;  2R2Q A;  4Y94 A;  2MQJ A;  2DA0 A;  2V4L A;  5GOW B;  3VFK A;  2MBB B;  1KC7 A;  5D94 A;  4A6K A;  5JZE B;  1MKE A;  4HB0 B;  3A4S C;  2BPS A;  4JKD A;  2RPQ A;  1JRU A;  5DPS A;  3PHX B;  2H7D A;  2L0T A;  3M3J A;  3ML8 A;  4KSL C;  4HWI B;  2Z0E B;  2CHX A;  3VIA A;  5DHA B;  2V76 A;  2C7H A;  5CLQ B;  4GMX B;  2LD9 A;  2AL6 A;  5DH9 B;  2ZPN A;  2RD0 A;  4GZU A;  3D8D A;  3E9O A;  3QAQ A;  1BWN A;  2JRH A;  3PVU A;  1KLV A;  3ZKJ C;  2FCS A;  4ILH A;  2KC2 A;  4ANU A;  2DYN A;  4JKH A;  2DAJ A;  1P5T A;  3ZVR A;  2I5F A;  3T9L A;  2KGX B;  1Y5O A;  4LDT D;  3RZW C;  4CHM A;  2CHW A;  2BYV E;  4HAV B;  4FA6 A;  3RYT A;  1Z2M A;  5CHF A;  2G45 B;  4WQO B;  4KHO A;  4JKG A;  4GPT B;  4DXA B;  2NBU A;  1J0G A;  1M7R A;  1LQB A;  1RLF A;  3QX1 A;  1H4R A;  1E8X A;  3A1Q A;  1IYF A;  2YLM A;  3QIJ A;  3H7P B;  1P3R A;  2IFS A;  3WAL A;  3TL5 A;  1V61 A;  2N4F A;  3CST A;  2R09 A;  3PSC A;  3BJI A;  3HK0 A;  4I6P A;  4GU2 A;  3RUI B;  3VH3 B;  2KDF B;  4N9F 4;  1SHC A;  2KK8 A;  3PVW A;  2K1F A;  2DEN B;  1AQC A;  2N1W A;  4EZJ A;  1B55 A;  1XOD A;  3ML9 A;  1NTI A;  2BWF A;  4AOF A;  1WX8 A;  3A9K B;  2LVO A;  2KCJ A;  5TR5 A;  3ECI A;  4JKG B;  4JKF A;  3ODO A;  2GBN A;  1KM7 A;  2NMB A;  2O6V B;  2L8J A;  5JP4 A;  2KMA A;  3TJP A;  1YJ1 A;  3EPY A;  2KDE B;  1WXS A;  1ISN A;  3PRM B;  2K25 A;  3BY4 B;  1GG3 A;  1FGY A;  4K81 A;  2OTX A;  4MGK E;  2FDQ A;  2DHK A;  1LXD A;  1X1G A;  1DDW A;  3UIO B;  2ZZP B;  3KUZ A;  1J19 A;  3B0A A;  3U8Z A;  2VRR B;  2KWC A;  5CHV C;  2YS5 A;  3ML4 A;  2JF5 A;  3SV1 A;  3D8E A;  3TBL D;  3OJ4 B;  1WIA A;  4PS7 A;  2QHO A;  3DDC B;  1XD4 A;  5FI1 A;  2KVR A;  2KTR A;  1FHO A;  1UBI A;  3ULC A;  1E7V A;  4D0N B;  3PLV A;  3RZF A;  1GNU A;  1FOE A;  2M38 A;  2Z0D B;  4W9F A;  4BKG A;  1JDE A;  5LON B;  4A3P A;  4AP4 C;  2KWV B;  2L00 B;  2D3G A;  2D9W A;  4K2P A;  4KAX B;  3MJW A;  3VUW A;  3ONS A;  1PQS A;  3AJ4 A;  4GDL B;  2ROV A;  1YQB A;  2I5C A;  2KKC A;  4HAW B;  1VD2 A;  1FB8 A;  3KUC B;  2P0H A;  2FAZ A;  2DZK A;  2ZEQ A;  1K5D B;  2IO2 B;  3ZDM C;  2W2X D;  4NJ6 A;  2FJ9 A;  2ZCB A;  2COF A;  2YT0 A;  3T06 A;  2DN6 A;  1ZW7 A;  1U4A A;  3SUZ A;  4E71 A;  4M8N A;  3UIN B;  2GBJ A;  1UPR A;  2MP2 A;  3HIZ A;  3B08 A;  5IAA C;  1EGX A;  1DRO A;  2LGD A;  3IG3 A;  4EMO A;  4C0A A;  1XX0 A;  3VH4 B;  4HAY B;  1XT9 B;  2DHZ A;  3QAR A;  4HAU B;  3V60 A;  3M63 B;  3LJU X;  2COA A;  1XQQ A;  1UGM A;  2J0M A;  2WX0 A;  5LXI B;  2MWS B;  3Q3J A;  4K2O A;  1Q1O A;  5J2R A;  2W9N A;  2RGN B;  1Q67 A;  4EUT A;  2EJ8 A;  2LBB A;  4IOY X;  2GMI C;  4DHZ B;  4DX8 A;  2IO3 B;  4W9J A;  5L83 A;  3VTW A;  1V5M A;  4MSQ B;  3E9L A;  4OVV A;  1OQN A;  2YS3 A;  2YS1 A;  1KJT A;  4HLE A;  2NR2 A;  3OAN A;  2XK5 B;  2N7E A;  2GBR A;  2UZR A;  1E7U A;  3QHT A;  1A5R A;  5DCN A;  5BO4 B;  3NZS A;  2L7R A;  2P0D A;  4FUL A;  4DWF A;  2D07 B;  1E8Y A;  3KVF B;  4DHZ E;  1UNR A;  3PRP B;  4DBG A;  4KHB B;  1BAK A;  2KTF A;  4XWX A;  3QWM A;  1WE6 A;  3CXB B;  1MIZ B;  4TKN A;  1Y19 B;  1FHX A;  2C60 A;  2QKL A;  3DQV A;  4HXD A;  2D10 A;  2I1K A;  2M1M A;  4HB3 B;  3VAW A;  5C5B A;  2MBQ A;  4FHK A;  4HAT B;  4K7W A;  2FID A;  4EZL A;  2KQS A;  2A5U A;  4XC2 A;  4ASW C;  2GJY A;  3PEG A;  4B6W A;  4HB2 B;  3MHS D;  1E90 A;  1J8C A;  4IAP A;  2N9P C;  1E8Z A;  4FBJ B;  3V5W A;  2BGF A;  3OAW A;  2M8S A;  2DX5 A;  3A8P A;  2J59 M;  5AZG A;  3L16 A;  2CY4 A;  3CF6 E;  3OLM D;  3D8F A;  2XQN M;  2A4Z A;  2ZPY A;  2GOW A;  2CY5 A;  5AZH A;  2CS4 A;  1PLS A;  4I6L B;  5G55 A;  4F7Z A;  3DVG X;  5LLI A;  4JGH B;  2VSZ A;  1BTK A;  3ZNI D;  1DDM A;  5LOP B;  4W9E A;  4K1R B;  2AWT A;  5L81 A;  3HHM A;  4A5K A;  4HVB A;  1FGZ A;  1AAR A;  2DTC A;  2NPT B;  2MBE A;  3N3K B;  5C16 A;  2ABD A;  4I6N B;  1WGG A;  4KZC A;  2REX A;  5J3T A;  2EMS A;  2C7N B;  2FCN A;  1XKE A;  4EJN A;  2LXC A;  5E6P A;  4ZRJ A;  2K39 A;  1F9J A;  4DHJ D;  4ICV A;  3AXC A;  3SYX A;  2CU1 A;  4DBB A;  5D3X A;  2HRJ A;  3ZTC A;  2D9Z A;  3B1L X;  3O96 A;  1EO6 A;  1P0R A;  1XCG A;  2R82 A;  1WYW B;  5C6R A;  2G3Q B;  4L6E A;  1E8W A;  4F7U P;  1P6S A;  2UYZ B;  1PMS A;  3DBR I;  2JRI B;  5D3Y A;  4HDO A;  2R2O A;  1QZE A;  2CAY A;  2K2U A;  2LRW A;  4JK9 A;  2EMT A;  3ULB A;  4GGQ A;  1SIF A;  5J17 A;  4FN2 A;  2XEW A;  2KFK B;  4FJV B;  1U2B A;  2HTH B;  1WR1 A;  5IA7 A;  4LJP B;  3WAP A;  3SNH A;  3KRX A;  1P1A A;  1EUV B;  3E66 A;  4XZ4 A;  2DFK A;  2YT1 A;  1ST7 A;  2G35 A;  4JKC A;  1QC6 A;  2Y5B B;  1ZKH A;  1EF1 A;  3M95 A;  3SO6 A;  3DXE A;  1MK7 B;  3ZO5 B;  2KO3 A;  2FUH B;  4Z2M B;  1Q5W B;  3A98 B;  3BIN A;  2QKM A;  4KHA A;  3O65 B;  3H7P A;  2BF8 B;  3WA0 A;  1HE8 A;  3DPD A;  1NI2 A;  2ZCC A;  4G0N B;  1X1F A;  4KIK B;  4IUM B;  2MBH A;  1UZX B;  2KX3 A;  2LUE A;  5DIF B;  4ICU A;  2N9X A;  4BKS A;  1C3T A;  1OGW A;  2DIK A;  4FJY A;  5CTR C;  4IM0 A;  3VQI A;  3R7R A;  1MAI A;  4MJS B;  5D7G A;  4W9K A;  5CLL B;  4GXB A;  2Z0P A;  1MPH A;  4ZDV A;  4ANX A;  3UQB A;  1I42 A;  2AL3 A;  3A9K A;  2DKP A;  1TJ6 A;  4HAX B;  2O6V A;  4TQ1 A;  2ZVO A;  3QK0 A;  3PT2 B;  4HAZ B;  2COP A;  3TIX A;  4IW0 A;  1D3Z A;  2LRU A;  1L2N A;  3WAO A;  4RMA A;  2Z0Q A;  1UNP A;  2K8C A;  4BFR A;  2N9E B;  1SGH A;  2JUO A;  2KFJ A;  1U5F A;  4OVU A;  3CSF A;  3JW0 X;  3NY5 A;  1R4N I;  1WX7 A;  4ZRI A;  2NVU I;  3QQ8 B;  3K9P B;  3SDL C;  3DBL I;  3ZUN A;  1X86 A;  2ZNV C;  2KJ6 A;  4EEW A;  4IM2 A;  2PE9 A;  2KWU B;  4CHJ A;  2DLW A;  2VRW B;  2KHW B;  2IZV B;  1FXT B;  5AEK B;  2M17 A;  4B95 A;  4W9G A;  2O2V A;  4G11 A;  1WZ3 A;  4GDL A;  2RUK B;  4EZK A;  2MBO A;  4IG7 B;  2V1Y A;  2KX0 A;  1OEY A;  2BKF A;  2OQB A;  5HE3 A;  3UZT A;  3KY9 A;  1YX6 B;  1RJ2 A;  5JLJ B;  4NPN A;  5L95 C;  2JWZ A;  2J0K A;  3VOQ A;  3MPX A;  3W1S A;  1OEY J;  5G2N A;  2CKH B;  4JK8 A;  2KNB A;  2RSU A;  1V80 A;  3MDB C;  4Z2N A;  1TXD A;  2LVQ A;  1MIX A;  4BOZ B;  4IWP A;  3F5R A;  3ZW3 A;  5DPR A;  2BYF A;  5D27 A;  2V3S A;  2PZ1 A;  2AEH A;  1WJN A;  1HBK A;  2RLO A;  1U29 A;  4NNJ B;  1LB1 A;  3ODW A;  2O2V B;  4K7U A;  5EDS A;  1NVL A;  3PLU A;  1U5G A;  4KVG B;  1WGH A;  4FHJ A;  4BKT A;  3KW5 B;  2FCM A;  3KYC D;  1YX5 B;  3I3T B;  2XK5 A;  2NCN A;  2HE7 A;  2YF0 A;  4BOS C;  3P2B A;  2MW5 A;  5FR6 A;  1RRP B;  1V5O A;  5JHB A;  4A3O A;  1GGO A;  5J18 A;  2JPH A;  2K6D B;  3K9O B;  2N0Y A;  5DI9 B;  3M1I B;  1Y8R C;  3P6A A;  4BKS D;  4PQ0 A;  1OQY A;  3R7Q A;  2LAS A;  3VXW A;  2AYO B;  2Z59 B;  5D3W A;  2Y8G A;  3ZRF A;  3ZIM A;  3KSY A;  3N7C A;  3EHV A;  4JL9 A;  4JLC A;  2E2X A;  2NZ8 B;  4ANV A;  1H10 A;  4HB4 B;  4WJO A;  2O6V D;  3IBE A;  5JHA A;  5IJM A;  4NY0 A;  3TVV A;  2HD5 B;  4GDK B;  2BYE A;  1WE7 A;  4MM3 A;  1U5E A;  1KOT A;  3JVZ X;  3FM8 C;  2ELB A;  4GOC A;  4K7S A;  5FI0 A;  2DYO A;  4TQ0 A;  3RCZ A;  2M4N A;  1WJ6 A;  1T0Y A;  3WAM A;  1TQZ A;  2DAF A;  1LM8 B;  1WXA A;  2P8V A;  4JQW C;  4TUU A;  1WJ1 A;  3SD5 A;  4KV2 A;  2KLG A;  2KJR A;  3VDZ A;  3KZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...