4NY0A

Crystal structure of ferm domain of human focal adhesion kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
ERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGLRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title FAK dimerization controls its kinase-dependent functions at focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ny0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ny0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ny0A01
2NVUI 4AP4C 2DHZA 2MBBB 2C9WB 2V3SA 3ZNHB 2NR2A 2JVCA 3A4SC 5FI1A 1WJUA 3PEGA 2KXJA 2I5CA 1Z5SB 2D07B 2R2QA 2RGNB 4W9GA 3W1SC 2PE6B 3RT3B 5L95C 4IFSA 2K2UA 4KDLB 1V61A 1TBEA 2D3GA 4K7UA 4J6IA 3M1IB 1IYFA 1WI0A 3ZNZB 4JL9A 4CHKA 2KCJA 1LW3A 2YRYA 3ODWA 2YS3A 3M95A 2GBMA 4KHAA 3KRXA 3DXDA 3NHEB 1WE6A 1DROA 2KOXA 2H7DA 1ZC3B 3WALA 2M17A 3ML8A 2AYOB 2LVPA 4FN2A 3W1SA 2ZPYA 2J7QB 4G3XB 2G4SA 2RNRB 1XCGA 5CTRC 2P0FA 1PMSA 2HD5B 2O6VD 2KC1A 2FAZA 1WGUA 5FI0A 3WA0A 5KHQA 3A9JA 4HLEA 3KZ1A 3ULCA 4A20A 3VH4B 2V1YA 3IG3A 2EMSA 5J2RA 1EVHA 3T9LA 3D8DA 4ANXA 2LGYA 5L81A 2KVRA 2HJ8A 2ZJDA 2W2XC 1I7AA 2AEHA 1BAKA 2LVQA 4EKUA 1ZM0A 4EZKA 2XBBC 4G0NB 2Z0QA 3FP5A 4DHZB 4KIKB 1UNPA 3OANA 3A1QB 5J3TA 1OMWA 1X1FA 2EC1A 1E90A 5CHFA 4A5KA 4HXDA 2FCQA 5JHGA 3PLUA 3L0WB 3DOWA 2WX0A 2IYDB 2RLOA 2UZRA 4TQ0A 4IWOA 5AEKB 2QHOA 1E7UA 1VD2A 4G11A 1SIFA 3QJZA 3K9OB 4BOSC 1UEFA 4DX90 4MSQB 3PTFC 3NY5A 3NZUA 5TR5A 4MT7A 4GGQA 2P8VA 2CHWA 4W9KA 1PLSA 4W9EA 4WJ7A 3GZNI 2DYNA 2ELBA 2KLCA 5AZHA 3WIMA 2ZZPB 2UVMA 2N7DA 3KH0A 4B95A 1S1QB 5DCNA 3ZRFA 5HKHA 2Q13A 3IBEA 3SHQA 2O6VB 2R0DA 5DHFB 5DHAB 3UQAA 2PEAA 3VOQA 2KX3A 1WX7A 4NAWA 1WMHA 3JYUA 1QC6A 4EMOA 4E74A 3DVNV 1WGYA 2YLMA 2RSUA 2FUHB 2K1FA 4FJVB 5D3YA 5JZEB 2WWZA 1E5WA 3OJ4B 3H7PA 2CHZA 3ZNGC 1U2BA 2Z0EB 4MELA 4Z2MB 5KQ1A 4D0NB 2IFSA 3H6NA 1W1DA 2UYZB 5AZGA 2XQNM 4F7UP 4ZDVA 4HAXB 2L00B 1WGDA 1V49A 4EOYA 1UZXB 1PQSA 1WJNA 4BKSA 3VDZA 4GDLA 4W9HA 4NJ7A 4BKGA 3QC8B 1WXVA 3AJ4A 4HCPB 3UGBB 3VAWA 3WYFB 5C79A 2KX0A 1U4AA 1DDVA 2CB8A 3HM3A 3KY9A 1RLFA 3N32A 3PVUA 4HAYB 2NPTB 3AU5A 5D2MB 3PVLA 1UBIA 3PSCA 2DHKA 3PP2A 2DKQA 5DH9B 5L83A 5LLIA 2Y5BB 1YX6B 2L76A 3WAOA 4GMVA 3V61A 1X86A 4WJPA 4URKA 1W1GA 1WGRA 2K00A 2ABDA 3ZO5B 3IFWB 1H4RA 3HM6X 4MM3A 3RULA 5G2NA 3BJIA 1P3QU 3VXWA 5D27A 3SV1A 1K5GB 2A4ZA 2LZ6A 5LOPB 5CX3A 3JSVA 3FM8C 3ZIMA 1XODA 4GDKA 2BGFA 3EHVA 5CHWA 1P0RA 4B6HA 1WM3A 5BO4B 1LXDA 2J0MA 2ROZB 3R66C 1BTKA 4A6FA 3OJ3A 2FDQA 1WGGA 3DVNU 2MA9B 4ANVA 5EDSA 2N7EA 2M14A 1X1GA 4W9LA 2FCSA 1X11A 1V89A 2CRFA 2L0FA 4KDIC 4OVUA 1KOTA 1V5PA 3K9PB 2DZMA 2LASA 4GU2A 1EUVB 2COFA 4WWPA 4MGKE 4E71A 1WX9A 4HB2B 3DVGY 5DPTA 4XC2A 1LB1A 1Y5OA 4I6PA 3B08A 3OLMD 4GSWA 3ZDMC 2AL3A 2MBEA 2E2XA 4HDOA 2QKMA 1I2HA 3WAPA 1XR0B 4JQWC 5E6NA 2MBOA 3CSFA 1UPQA 1C1YB 3DVGX 1TQZA 4BBKA 2L0TA 3TMPB 3ULBA 1WXMA 2V76A 1WXAA 1VCBA 1IRSA 1IP9A 4NPNA 1AWEA 2K25A 1M7RA 2VKIA 3VUWA 2AWTA 1UNQA 3DBSA 3B0AA 2ZVOA 1ZKHA 1GUAB 3KUZA 2MP2B 1V80A 4A3PA 2COPA 3DQVA 1BT0A 4HHVA 2GMIC 1E8XA 3A9KB 1V86A 2V4LA 2M4NA 1DBHA 2X18A 4KAXB 2KNBA 1NDDA 1EF5A 3QBVB 4A6FB 1Q0WB 3UQBA 1KM7A 3JW0X 1A5RA 4I6NB 2FJLA 4MJSB 3DDCB 2N4FA 4FBJB 2C60A 3AI5A 5E6PA 2D9XA 2N9PC 2DKPA 2JZZA 2K6DB 1ZVRA 3KUDB 1NI2A 2DZKA 1GC6A 3PRMB 1V88A 2EJ8A 5LXHA 2N23A 2BYVE 2DAFA 5AZFA 4K17A 2LGXA 3VTUA 2FIDA 3MDBC 4HVBA 2LG1A 3HQCA 1XD3B 1WZ3A 2KWCA 2LOZA 2HRJA 2KTRB 4W9JA 2KDFB 2BYEA 4HPLB 1DDMA 3P7ZA 1FHOA 4HB4B 3V5WA 3FEHA 3EC8A 3NZSA 1BWNA 1WYWB 2MWSB 2IO0B 1K5DB 3RUIB 4F7GA 1D3ZA 2DX5B 1RFAA 3TO1A 2L05A 3KVFB 2KFJA 2CU1A 1OQYA 1V9JA 2O2VB 3TVVA 5D3WA 4WAAA 3PV1A 1QQGA 1XKEA 2KQSA 3PS6A 4WJOA 2Z0OA 3QA8A 4HAWB 1Y19B 1WJ1A 1WGQA 3VVWB 1CMXB 4LJOB 2CHXA 5DPSA 4BKTA 4II2B 2MBQA 5CHVC 1X05A 4ZYNA 5KCVA 1W1HA 4N9F4 3TJPA 1MAIA 3ML4A 4AJWA 4DK5A 2KHWB 3OAWA 1NTVA 1WXSA 1V5MA 3RZWC 2MCNB 1N3HA 3UIOB 1GJZA 3WAMA 2XK5A 3MTNB 2FCNA 1WF9A 2N0YA 2W2XD 2KC2A 4WWNA 4ICVA 4ICUA 2LRUA 3DCGA 3VTWA 2UZSA 1ST7A 1EAZA 3DXEA 1V5OA 3B1LX 5JP4A 2FNJB 3ZVRA 3SD5A 5HE1A 3DBLI 3PSEB 4W9DA 1XX0A 4PYZA 1MK7B 2KFKA 4TKNA 2DHIA 4RM9A 1E8WA 2I5FA 5JLJB 4F1SA 2N1WA 3NS8A 3P2BA 4MEMA 2NCNA 2BWFA 2D2QA 1NTYA 2G4DB 3G9WA 3D8FA 3UIPB 5DPRA 2Y7BA 2JRHA 4HWIB 3H7SA 2KQ7A 3SUZA 4KZ0A 2KLGA 1RRPB 2BPSA 2DFKA 1LFDA 2HTHA 3A9JB 1WM2A 5KQ4A 1GNUA 1WR6E 3T06A 4ZRJA 2ELAA 4LJPB 2JRIB 3GOEA 4M8NA 3RD2A 3VFKA 4FHJA 1WI1A 1MIXA 2IY1B 1J0WA 3PG7A 3ZW3A 2NBWB 4GMXB 4E3CA 1OY2A 2L8JA 4M0WB 2RSGA 1X1MA 2LVOA 1J8CA 4KHOA 2MW5A 5CLLB 3L13A 3L08A 4X57B 5KHOA 3CF6E 3SU8X 2LULA 2K39A 3P6AA 2DA0A 1IPGA 5D7GA 2GS0A 3VIAA 2LD9A 2JF5A 2KO3A 3V6CB 4WWOA 4BKSD 3I3TB 3ZLZA 2YS5A 3MJWA 1MIZB 3O96A 5JH5C 5CLQB 3GYPA 5D3XA 3PHWB 4DBBA 1KZ7A 4HJKA 4WSFA 5D94A 2RD0A 1WX8A 4KSLC 2D4QA 5JHHA 3QWMA 4BBNC 2BKRB 2Y8GA 3SO6A 2ADZA 5C5BA 4DDGD 2RQ1A 2GJYA 4BFRA 3R7QA 3VUYA 1BTNA 3VUXA 3NSUA 2GBKA 2DTCA 1E8ZA 1WJ4A 3JVZX 1WJMA 5HE2A 2IO3B 3R3MA 3PZDA 4GN1A 3CSTA 4DXAB 3F5RA 5DI9B 4NAWB 4A6KA 1WMHB 1V6EA 5IAAC 4MGYE 1T0YA 1I42A 3D8EA 4HCNB 4A3OA 3V6EB 4EZJA 2WH5A 3ODOA 2OTXA 1FOEA 3AXCA 3H7PB 3KSYA 2J0KA 2N9EB 2LKOA 1NU2A 4HB0B 2ASQA 1U5DA 1ZGUB 3ONSA 3IVFA 1ZSQA 3HHMA 5D6JB 1YQBA 2LXAA 3TW1A 2LOXA 1E8YA 1J19A 2KDBA 4FA6A 3X0WA 2IZVB 4Y94A 4DDID 3PRPB 3PGEA 1WY8A 3H9DA 4GDLB 2FJ9A 3ZRCA 3QCAA 4YONA 1PFJA 1G6JA 2K2JA 2OOBB 4GIVA 4CYEA 4CHMA 1MG8A 3EFUA 4XX5A 2LXCA 3VQIA 2KUPA 3ZDTA 4LCDE 2UWQA 2MQJA 1V81A 1QZEA 3EPYA 3V60A 3APDA 2L3ZA 2DZJA 4WJNA 2YT0A 1R4NI 1E7VA 1M94A 2LBBA 4PS7A 1AQCA 4TUUA 2WX1A 4K2PA 4TV3A 4MSMB 2RPQA 2JXXA 4DHJB 2PPHA 3W1YA 1MK9B 2FIFA 2ZPNA 1V2YA 3QIJA 3V62A 3QARA 2CKHB 1FGYA 1WFYA 4IOYX 3HIZA 3N7CA 1WRDB 3Q3FA 2LYDA 1YIWA 3QK0A 4FADA 4DBGA 3FLVA 2DAJA 4BVUC 2GOWA 3KUCB 4CHJA 1P3RA 2Z0PA 5C16A 1UNRA 1R4MI 3JSVB 4IC7B 4BOZB 2MSED 2LGDA 2KMCA 4HDQA 4GDKB 1P5TA 2G3QB 2LI5A 4WVFB 4FHKA 4IUMB 1MKEA 2RGFA 2M8SA 2JWZA 1GC7A 1Q5WB 1V5TA 4HAVB 2KGXB 2K6QA 4B6WA 4XZ4A 1UH6A 2PZ1A 4NSWA 1TXDA 5DIFB 2AL6A 4BBNF 2ZCBA 5DPWA 3L10B 1ACAA 5C6RA 2N9XA 4MGZE 2BCJA 4IM3A 2DYMA 2BF8B 3A98B 2ZNVB 2N1VA 2YF0A 4GB9A 2JT4B 1XD4A 2DYOA 4WQOB 1ZW7A 2GBNA 3ZNID 3QX1A 1F9JA 4MGIE 3KW5B 3A8QA 2LWPA 3M62B 3QQ8B 2CR5A 4K7WA 4W9CA 4GPTB 2JZ3B 4KIKA 3VHTC 4AJYB 1WJ6A 2XEWA 3A1QA 3N30A 4ASWC 4FJYA 1WR1A 3TBLD 5GOWB 1L7YA 2K8HA 5IJMA 1SGHA 4HB3B 2JP2A 2P0HA 3BY4B 1WE7A 2BKFA 4W9FA 2R2OA 4Z2NA 2QKLA 1YD8U 1ZC4B 5LONB 2JUOA 2RVBB 4HPMB 3RYTA 2NMBA 2M38A 4PS3A 3ZTDA 2YSZA 4C0AA 2IO2B 3SNHA 1WVHA 1EGXA 3UINB 3A33B 2ZEQA 4W9IA 2NBVB 3L54A 3ALBA 3WANA 4II3B 3ZTCA 3PRZA 3TIXA 3DPDA 2O6VA 1MPHA 1WG7A 4MH0E 2R09A 4IAPA 1Z2MA 3N3KB 4K7SA 2KK8A 3RCZA 4NQLB 4XWXA 4MDKE 3Q3JA 2J0JA 4AWJA 5J18A 1U5GA 2I1JA 1UGMA 1U27A 1FXTB 4KHBB 4P7IA 4NQKE 2DX1A 2KDEB 2NZ8B 4A6HA 3VTVA 1RRBA 3KYDD 1YX5B 4DHZE 3HW2B 1P9DU 2GCLA 2GBRA 1OTRB 4HK2A 2HE7A 3MPXA 1P6SA 2D9VA 2H7EA 2M0XA 2NS5A 3QWZB 2C7MB 4ANUA 1RAXA 2DYQA 1HBKA 2FCMA 2KJHB 1V5UA 3GYOA 2KWVB 3AULA 4IM0A 1TTNA 2ZCCA 2YT1A 4MK0A 1XT9B 4MY6A 4KVGB 3CMMB 4K81A 2KTFA 4I6LB 3C0RB 5J17A 3PLVA 3A4RA 4EUTA 4F8CB 2K8CA 1WH3A 3PHXB 3QAQA 1UBQA 3RCPA 2VRRB 5FR6A 2NPTA 2DENB 2YS1A 2RR9A 1P98A 2DYBA 3APFA 3APCA 1HE8A 2NBUA 4PQ0A 1SHCA 1KZGA 3F0WA 2W2WA 1P1AA 1I35A 2LRWA 3U30A 3ENEA 2G45B 3TFMA 1OQNA 3QHTA 1TGZB 2CS4A 2VRWB 1NTIA 2MX2A 4HAUB 2CAYA 2KANA 2BYFA 2KJ6A 3H1UA 1M7EA 3KYCD 4F7ZA 1DDWA 2D9ZA 3T8MA 1HB8A 2XK5B 2MFQA 3S2AA 2KD0A 1L2NA 1Z87A 4NNJB 1DYNA 2IO1B 3DBHI 5JHAA 4K2OA 5JHBA 2COCA 3AU4A 2MWNB 2GBJA 2D9WA 3ML9A 3R7RA 1KJTA 4GXBA 4AUQC 4RMAA 1S3SG 3U7DA 2J59M 2IY0B 4IW0A 1U29A 1OGWA 4K1RB 2KFKB 4G50A 2EKEC 4KZCA 3PT2B 3L17A 2D10A 4FJZA 4GOCA 3DXCA 3M63B 1FB8A 2Z0DB 4DHJD 1AARA 1LQBA 2DZIA 3LJUX 4LDTD 3M3JA 1OEYJ 1B55A 1KI1B 3BINA 2I1KA 1OEYA 4AOFA 1UD7A 2P0DA 5E6OA 2MKRA 2HTHB 2CY4A 3PPAA 4ANWA 2KMAA 4GZUA 4YL8A 2DHJA 2DN6A 1Y8RC 3DBRI 1H8CA 4F7HA 2ROVA 3RZFA 2CQUA 3U8ZA 1Q1OA 3LDZE 2KWUB 4B9KA 3IHPC 4FLHA 1WZ0A 1GG3A 3A8PA 4IWQA 2K8BA 4DX8A 1FHXA 4PS8A 2MDXA 2JPHA 3SDLC 1U5EA 3ZVVA 4RM8A 3PREA 2M1MA 2EMTA 4IM2A 2RUKB 5IA7A 4ZRIA 1C3TA 1H10A 2REXA 2MP2A 5HE3A 2KJRA 3ECIA 2LUEA 1K8RB 3ZKJC 2PJHA 2ZVNA 1JRUA 2ZNVC 3A9KA 4FULA 2MBHA 4HAZB 1UPRA 1XQQA 4TQ1A 2CODA 2VSZA 1WIAA 2MLBA 5LXIB 3KRWA 4KV2A 1EF1A 1LM8B 2MRPA 4EFOA 3O65B 5J3QA 5G55A 4KSKC 5GMVA 2OJRA 1EO6A 1WGHA 2Y8FA 2Z59B 3TL5A 2B3AA 1KLVA 2IBIB 1HB6A 4PNKA 4MJSA 1NVLA 4EJNA 1U5FA 2L2IA 2WYQA 4EEWA 3ZUNA 3UZTA 5C23A 3ODXA 5J3YA 5C5BB 2C7NB 2KDIA 1FHWA 4LDTB 2KZRA 4M8MA 1NBFC 2JY6A 3LJ3A 1ISNA 2COAA 4L6EA 1J0GA 2W9NA 2GCJA 4ZRKA 3PVWA 2CY5A 2OQBA 4H8SA 1YJ1A 3X23A 4EZLA 2BWES 2G35A 2L1CA 2KTRA 1TZ1A 3L16A 3SYXA 3CIKA 5EFXA 2KN5A 2A5UA 4WJQA 1Q67A 4IG7B 4DWFA 3HK0A 2D11A 3UF8A 4HATB 1SE9A 1UELA 2C5LC 2PE9A 4NJ6A 2DX5A 4JGHB 4JIOU 3VH3B 4TYZA 3CXBB 2IYBA 2YVCA 5D3VA 4CO7A 3MHSD 2O2VA 2D9YA 1RJ2A 3EECA 5C1ZA 4NY0A 3NOBA 3FSSA 1FAOA 2DLWA 1TJ6A 3D32A 5HE0A 4IWPA 2C7HA 4JLCA 3TCAA 2WDTB 4OVVA 2L7RA 1FGZA 2KKCA 2LJ5A 4PYUA
chains in the Genus database with same CATH superfamily
2NVUI 4AP4C 4ILHA 2DHZA 2MBBB 1RYJA 2C9WB 2V3SA 4R3DA 1N62A 1IGDA 3ZNHB 1HTOA 2NR2A 2JVCA 3A4SC 5FI1A 3ZJTA 1WJUA 1L4ZB 1VRAB 3PEGA 2KXJA 2QJLA 2I5CA 1Z5SB 4LNFA 5D3IB 2D07B 2R2QA 5IOIA 2RGNB 4W9GA 2PIAA 1SEBD 3W1SC 2PE6B 1DOYA 2KT7A 3RT3B 5L95C 1SBBB 4IFSA 2K2UA 4KDLB 1V61A 1TBEA 2D3GA 4K7UA 4J6IA 3M1IB 1E10A 1IYFA 1WI0A 1GB4A 3ZNZB 2NTTA 4JL9A 4CHKA 2KCJA 4ZRQA 1LW3A 2DBYA 2YRYA 5EE9A 3ODWA 2YS3A 3IAM1 1R4NB 3M95A 3BIID 2WU5B 2GBMA 2W82A 3TEYA 4KHAA 3KRXA 1TKEA 3DXDA 3NHEB 1WE6A 1JWSD 2ON8A 1DROA 2KOXA 1J7CA 2H7DA 1ZC3B 3WALA 2M17A 3ML8A 2AYOB 2LVPA 4FN2A 3EFCA 3W1SA 3E9OA 2ZPYA 2J7QB 3BZDB 3FC4A 1CQVA 4G3XB 2V3PA 5BMHA 2G4SA 2RNRB 3IAS1 2M56B 1XCGA 5CTRC 2P0FA 1PMSA 2HD5B 2O6VD 2KC1A 2FAZA 1WGUA 5FI0A 3WA0A 5KHQA 1D6EC 1GAQB 3A9JA 2MHJA 4HLEA 3KZ1A 3ULCA 3I63C 3AEGB 4A20A 2Z8LA 1YJJA 3VH4B 2V1YA 5HHDG 3IG3A 2EMSA 5J2RA 2E3TA 4RGTA 1EVHA 3T9LA 3D8DA 3NVZA 4PK1A 4ANXA 2LGYA 5L81A 2KVRA 4HJGE 2KQ4X 2GI9A 2HJ8A 1C79A 2ZJDA 2W2XC 1FXIA 1RFKA 1OQQA 1I7AA 2AEHA 4M0WA 5BYQA 3BYTB 1BAKA 4O1NA 2LVQA 4EKUA 1ZM0A 5LG4B 4EZKA 2XBBC 1HZ5A 4G0NB 3E9LA 2Z0QA 2WXGA 2Z13A 4A8XC 3FP5A 2JZPA 1VBHA 3ZXVA 4DHZB 4KIKB 1UNPA 2INCC 3OANA 3WCQA 3A1QB 5J3TA 1CJEA 1OMWA 2RPVA 3AM9A 1J7AA 1X1FA 2EC1A 1BXTA 1L0VB 1E90A 2QILA 3VR9B 5CHFA 3NVYA 4A5KA 4HXDA 2FCQA 4JKCA 5JHGA 3PLUA 3L0WB 1XLOA 3DOWA 2WX0A 5C2TB 2IYDB 2RLOA 2UZRA 4B0MA 1ZPSA 4WIPA 4TQ0A 4IWOA 5AEKB 2QHOA 1E7UA 1VD2A 4ZHOA 1JWUD 4G11A 4USAA 3A58A 4IKGA 3AE5B 1SIFA 3QJZA 3K9OB 2NMQA 4BOSC 1UEFA 4ACFA 4DX90 4MSQB 3PTFC 3NY5A 3NZUA 5TR5A 4YSXB 4MT7A 4GGQA 2P8VA 2CHWA 4W9KA 1PLSA 2Y3AA 4W9EA 4WJ7A 4A55A 3GZNI 3OHMB 1PDXA 4FXCA 2DYNA 2ELBA 2KLCA 5AZHA 3WIMA 3NW8A 2ZZPB 2UVMA 2N7DA 1D5ZC 2WXHA 2N0SB 3KH0A 3P4RB 4B95A 1S1QB 3TEXA 2N7JA 4AS1A 5DCNA 3ZRFA 5HKHA 1TY2A 2Q13A 3IBEA 3SHQA 1C77A 2O6VB 2R0DA 5DHFB 5DHAB 2WXQA 3UQAA 2PEAA 2INDC 3VOQA 2KX3A 4IOIE 3AE9B 1WX7A 1FPYA 4NAWA 1IGCA 1WMHA 3JYUA 1UUPA 2BBCA 5BYSA 1I4GA 1T0QC 1QC6A 4EMOA 4E74A 3DVNV 1C78A 1WGYA 2YLMA 2RSUA 2FUHB 2K1FA 4FJVB 5D3YA 5D3DA 5JZEB 1C9FA 3H8HA 2WWZA 4WAFA 2K8EA 1V1PA 1NYQA 1CZPA 1E5WA 3OJ4B 3H7PA 1ACCA 4C7YA 1UNSA 2CHZA 3ZNGC 1U2BA 2Z0EB 2ZW1A 4MELA 4Z2MB 1ET6A 5KQ1A 4D0NB 2IFSA 3H6NA 3R2TA 1TS5A 1W1DA 2UYZB 5AZGA 2XQNM 1MI1A 3AV8A 4F7UP 4ZDVA 4HAXB 2L00B 1WGDA 1XLQA 1V49A 4EOYA 3AMZA 1PGXA 4TMAB 1UZXB 2D3CA 1TKYA 2BB5A 1DOXA 1PQSA 1WJNA 4BKSA 2INNE 1T5XD 3VDZA 4GDLA 4W9HA 2WDQB 4HRSA 3Q69A 2MH7A 4NJ7A 4BKGA 3QC8B 4K3BA 3TEZA 1WXVA 3AJ4A 4HCPB 3UGBB 4LNKA 3VAWA 3WYFB 5JVLA 5C79A 3U52E 3KQ4A 2KX0A 1JMLA 1U4AA 3N20C 4OZCA 5G5GA 1DDVA 4RF1A 2CB8A 3HM3A 3KY9A 2AQ3B 1RLFA 3N32A 2Y5PA 1VLBA 5IN7A 2IGHA 3PVUA 4HAYB 2NPTB 3AU5A 5AUKA 5D2MB 1N60A 3PVLA 1C4AA 1UBIA 3PSCA 4JKFA 2DHKA 3PP2A 2DKQA 5DH9B 1BUIC 5L83A 5LLIA 2Y5BB 4LNIA 2KWDA 3NWAA 1YX6B 5FK9C 4NAMA 2L76A 3WAOA 2DWQA 1CK1A 3Q3OC 4GMVA 4GNKB 1RM6C 2WGSA 3V61A 1X86A 4OHJA 3EGRA 2LFIA 4WJPA 4URKA 1W1GA 1QT9A 2CU3A 1K53A 1WGRA 1V97A 2WXMA 2K00A 5EE0A 2ABDA 3ZO5B 3IFWB 1H4RA 1MJDA 3HM6X 2WXOA 4MM3A 3RULA 3GZNB 4XYCA 4LLGM 5G2NA 3BJIA 4HPPA 3HVDA 1P3QU 3VXWA 5D27A 3SV1A 1GGOA 1K5GB 2A4ZA 2LZ6A 5LOPB 5CX3A 4N58A 3JSVA 3FM8C 3ZIMA 2IPKD 4S17A 4YT0B 3NJTA 3CIRB 1XODA 2NTSA 4GDKA 2BGFA 2WXIA 3GE8C 3EHVA 5CHWA 1P0RA 2QDFA 1ZDXA 4B6HA 1WM3A 1P7EA 5BO4B 1LXDA 2J0MA 2ROZB 3R66C 2X0SA 1ENFA 2BVCA 1BTKA 4CSQA 2JQRB 4A6FA 3OJ3A 1QOBA 3RMKC 3GE3C 2FDQA 1XEEA 2PTLA 2DNFA 1WGGA 3DVNU 2MA9B 1V8CA 1ZDVA 4ANVA 3AEDB 1VBGA 5EDSA 2N7EA 2M14A 1X1GA 4W9LA 2FCSA 1X11A 1V89A 2CRFA 2L0FA 4KDIC 3Q8AA 4OVUA 5E6JA 1KOTA 4TSSA 1V5PA 3K9PB 2DZMA 2LASA 2IGGA 4GU2A 1EUVB 3AB5A 2COFA 4WWPA 4MGKE 4E71A 1WX9A 2JSVX 1SE4A 4HB2B 3DVGY 4OZBA 5DPTA 3DBHB 3NVVA 3BK1A 4XC2A 1QQRA 1LB1A 1Y5OA 4C7ZA 4XWWA 5G5HA 4I6PA 3B08A 3OLMD 4RCOA 4GSWA 3ZDMC 1WSPA 2AL3A 4YTPB 1N6ZA 3NWFA 2MBEA 4JK9A 5GXGB 2E2XA 4HDOA 2QKMA 1I2HA 2ICIA 1IUEA 1TZOA 3WAPA 1XR0B 4JQWC 5E6NA 2GUMA 2MBOA 3B2FA 3CSFA 1UPQA 1C1YB 1PGAA 3DVGX 1TQZA 4BBKA 2L0TA 3DCXA 3U4EG 3TMPB 3AE2B 5T8IA 2PVOD 3VR8B 3ULBA 3RNBC 3MJ5A 1WXMA 3E56A 2V76A 4NZLB 1WXAA 1VCBA 2LJIA 1IRSA 1SE2A 1IP9A 1ZYIA 3Q8EA 4NPNA 1AWEA 4JWUC 2K25A 1M7RA 1I7HA 2VKIA 3NUHB 3VUWA 2EKIA 2AWTA 1UNQA 3Q2AC 4HKQA 3DBSA 3B0AA 2ZVOA 1ZKHA 1GUAB 1YN3A 1TT5B 2MP2B 3KUZA 4XE0A 1B1ZA 1V80A 5BYRA 1QF6A 4N59A 2WXPA 4A3PA 2COPA 3DQVA 1BT0A 2KVZA 4RGMA 4HHVA 2GMIC 1E8XA 3A9KB 1V86A 3V3XA 1FMAD 2V4LA 2NBVA 1N5XA 2M4NA 5IRSA 1DBHA 2X18A 1PYWD 4KAXB 2KNBA 1NDDA 2W3SA 3MP9A 1EF5A 3QBVB 1TS4A 2CJNA 4OVZA 4A6FB 1NVID 1EU3A 3FKYA 1Q0WB 2TSSA 2RRFA 2D3BA 3UQBA 1KM7A 5BMGA 3JW0X 5HG2A 1A5RA 4I6NB 2FJLA 2BW2A 4MJSB 3DDCB 2IJ0A 2N4FA 4FBJB 2C60A 2D3AA 1C4PA 3AI5A 5E6PA 3P4QB 2D9XA 1YOVB 2N9PC 3AEAB 3AE1B 3DHHC 2DKPA 2LUMA 2DIKA 4KHBA 2JYTA 2JZZA 2K6DB 1ZVRA 3KUDB 1NI2A 2DZKA 3OWEB 1GC6A 3C19A 3PRMB 1T77A 1MPEA 2JWUA 1V88A 2EJ8A 5LXHA 2N23A 2BYVE 2MJEA 2GLSA 2DAFA 5AZFA 4K17A 3L4PA 2LGXA 3VTUA 4J3OD 2FIDA 3MDBC 4HVBA 3AE6B 2LG1A 3HQCA 1YQ3B 4LK0M 1XD3B 1FFVA 1WZ3A 4YXDB 2KWCA 1QOAA 4US9A 1K51A 1FFUA 4ZYSA 2LOZA 2HRJA 2KTRB 1JWAD 4W9JA 1L0YB 2KDFB 2BYEA 2RMMA 1B9RA 4HPLB 1DDMA 2FE8A 1PUTA 3P7ZA 1MVKA 3PZ7A 1FHOA 4HB4B 2QCZA 3V5WA 3FEHA 2M19A 3NS1A 1WWTA 3EC8A 3NZSA 3TEWA 1BWNA 1KC7A 1WYWB 2MWSB 2IGDA 1K5DB 2IO0B 3RUIB 4F7GA 1LGRA 1D3ZA 4JK7A 2DX5B 1RFAA 3TO1A 3I5JC 2L05A 1I4PA 3KVFB 2H88B 4KKJA 2BB6A 2KFJA 3FVCA 2CU1A 1OQYA 1V9JA 4YSYB 1JDEA 1GB1A 2O2VB 3TVVA 5D3WA 1TKGA 4WAAA 2Y5CA 3V05A 3PV1A 4ILGB 1QQGA 1XKEA 2KQSA 3PS6A 1R7SA 4WJOA 2Z0OA 3LB8C 1KLGD 2QIEB 1IBXA 4MT5A 2N9KA 3QA8A 4HAWB 1Y19B 1E0ZA 1WJ1A 1WGQA 3VVWB 1CMXB 4LJOB 4XDDA 2CHXA 5DPSA 4BKTA 4II2B 2MBQA 5CHVC 1X05A 4ZYNA 5KCVA 1W1HA 4N9F4 2I38A 2PLPA 3TJPA 1MAIA 3CWIA 3ML4A 4AJWA 3IXSA 1MHHE 4DK5A 2KHWB 3OAWA 3IT6B 2ACZB 1NTVA 1WXSA 1V5MA 4ARCA 3RZWC 2MCNB 2YT2A 1N3HA 3UIOB 1YNTE 2Z14A 1GJZA 3U12A 1ZXIA 2KIGA 3WAMA 2XK5A 1JRPA 3MTNB 1NEKB 2FCNA 2LHEA 1WF9A 2N0YA 5MPOA 2KN4A 2W2XD 2KC2A 4WWNA 4ICVA 2RDBC 1T0SC 1SJED 2XN9C 4P1BC 4ICUA 2LRUA 3DCGA 3VTWA 2UZSA 1ST7A 3MC8A 5JXVA 1EAZA 3DXEA 1V5OA 3B1LX 5JP4A 2FNJB 4DQOC 3ZVRA 2BT6A 3SD5A 5HE1A 3RFZB 3DBLI 3PSEB 4C56C 1SE3A 4W9DA 1XX0A 4PYZA 4AQ7A 1MK7B 1PGBA 2KFKA 1ZP0B 4TKNA 3BVGA 4JKHA 2DHIA 4RM9A 1E8WA 2I5FA 1T6BX 5JLJB 2L83A 4F1SA 2N1WA 3NS8A 2W3RA 1OQRA 3P2BA 4MEMA 2NCNA 2BWFA 2D2QA 1NTYA 2G4DB 4PT5A 1ZUD2 3G9WA 3D8FA 1VZ8A 3UIPB 5DPRA 4YTNB 2Y7BA 3LXFA 3MC0B 3P1MA 2JRHA 4HWIB 3H7SA 2KQ7A 3SUZA 3AECB 4KZ0A 2KLGA 1RRPB 2BPSA 2DFKA 1LFDA 2HTHA 3A9JB 3W5VB 1WM2A 4YTMB 5KQ4A 1D5MC 1GNUA 1WR6E 3ZQ4A 3T06A 4ZRJA 2ELAA 4LJPB 2JRIB 2JXTA 2BS2B 2WXLA 3GOEA 3FILA 4M8NA 1E7PB 3RD2A 1NI3A 3VFKA 2KYWA 4JX1C 2XNAC 3Q14C 4FHJA 1WI1A 1MIXA 2IY1B 1VJKA 1GOZA 1JW9D 1J0WA 3PG7A 3ZW3A 4D6WA 2Z4DA 5I2MA 2NBWB 4GMXB 3ZXRA 4E3CA 3J9CA 1OY2A 1FRDA 2L8JA 4M0WB 2RSGA 1X1MA 2LVOA 1AYFA 4JKGA 1E9MA 1ROEA 1J8CA 4KHOA 2MW5A 5CLLB 3L13A 3L08A 3Q3NC 4X57B 5KHOA 3CF6E 3SU8X 2LULA 2K39A 5IO9A 3P6AA 2DA0A 1IPGA 2GS0A 3VIAA 2LD9A 2JF5A 5D7GA 4C4VA 4JWSC 2KO3A 3AE7B 3V6CB 4WWOA 4BKSD 3I3TB 3ZLZA 2YS5A 1FIQA 4UDUC 3MJWA 3URYA 4Q2JA 4OT1A 1TJEA 1ESFA 4LNNA 4GOUA 1MIZB 3O96A 2YEPB 3AE8B 3NVWA 4XGAB 5JH5C 2K3UA 2KACA 3RNGC 5CLQB 3U7ZA 3GYPA 5D3XA 4P16A 3PHWB 4DBBA 3HRDD 1C4CA 1KZ7A 3VRAB 2Z59A 4HJKA 4QXAB 4WSFA 5D94A 2MJDA 5H92C 2RD0A 1ET9A 1WX8A 4KSLC 4RNAA 3VRBB 3ZJUA 1D4BA 3RNFC 2D4QA 1F2RC 5JHHA 3QWMA 1L6VA 1ZE3D 4REZA 4BBNC 2BKRB 2Y8GA 1F2RI 1HEZE 3RNAC 3SO6A 2ADZA 5C5BA 4WURA 1NYRA 1OFFA 4WH4A 1EM7A 2G9HD 4DDGD 2RQ1A 2GJYA 4BFRA 3R7QA 1UF0A 3VUYA 1BTNA 3VUXA 1N61A 3NSUA 2GBKA 2DTCA 1YN4A 1E8ZA 1WJ4A 3JVZX 3C8YA 4GLSC 1WJMA 5HE2A 1MFWA 2IO3B 3R3MA 3PZDA 4GN1A 4C00A 1BMLC 2K9XA 2OEDA 3CSTA 4DXAB 4OW0A 3F5RA 5DI9B 1QLBB 3T3OA 4NAWB 4A6KA 3SEBA 3U2SC 1WMHB 1V6EA 1TS2A 1JROA 2AQ2B 2M0AA 4KX6B 5IAAC 4MGYE 1FNVA 1T0YA 3D8EA 2W55A 2X8XX 1I42A 4HCNB 2WHIA 3B77A 4A3OA 1L5PA 3V6EB 4BAXA 1V1PB 4EZJA 2WH5A 3ODOA 2RDGA 2OTXA 1FOEA 4LNOA 2Q5WD 3AXCA 3H7PB 3KSYA 2J0KA 4S0RA 2N9EB 2LKOA 1NU2A 2LHDA 4HB0B 1FEHA 3FAHA 2ASQA 4H2AA 1XCQL 1U5DA 1ZGUB 3ONSA 3IVFA 1ZSQA 3HHMA 5D6JB 1YQBA 2KDMA 1F77A 2LXAA 3TW1A 3W9CB 2FBWB 2LOXA 1E8YA 1J19A 5AUIA 2KDBA 2WLBA 4FA6A 3X0WA 2IZVB 4Y94A 4DDID 3PRPB 3PGEA 3ZYYX 1WY8A 3H9DA 4GDLB 2FJ9A 1WYGA 3ZRCA 3QCAA 4YONA 1PFJA 1G6JA 2K2JA 2OOBB 4GIVA 1V1OA 5I2SA 4ZHPA 1KRHA 4CYEA 4CHMA 1MG8A 3EFUA 2MEKA 1L6UA 4XX5A 2LXCA 3VQIA 2V0GA 1QOFA 2KUPA 3ZDTA 2PVGC 4LCDE 2V9HA 3UI3A 2UWQA 3IT4B 2MQJA 1V81A 3NRZA 1QZEA 3EPYA 2K0PA 3APDA 2L3ZA 2DZJA 4JPSA 3V60A 4WJNA 2YT0A 1DGJA 2WDRB 1VDVA 3Q8FA 1R4NI 1E7VA 2I2YA 1M94A 2LBBA 4PS7A 1EWCA 1AQCA 4M01A 4L23A 4TUUA 2WX1A 4K2PA 4TV3A 2QMTA 4MSMB 2RPQA 3E66A 2JXXA 2WXKA 4DHJB 2PPHA 3W1YA 5LNK1 2QSDA 1MK9B 2FIFA 2ZPNA 1V2YA 4P1CC 3TSSA 3I9V1 3AEBB 2ZKMX 4HKZE 2PMVA 3QIJA 3V62A 2WXRA 2DLBA 3QARA 2CKHB 1FGYA 1JWBD 5M4YB 1WFYA 1FO4A 2B76B 4NJCA 4IOYX 3HIZA 3N7CA 1WRDB 3Q3FA 4RFBA 2KAJA 3MFGA 2LYDA 1YIWA 3QK0A 4LTUA 2L1AA 3HUIA 4DBGA 4FADA 4QJ4B 1FCLA 3FLVA 4MM3B 2DAJA 4BVUC 2GOWA 3KUCB 2JX5A 4CHJA 1P3RA 2Z0PA 5C16A 2BQQA 1YJIA 1UNRA 1R4MI 3Q6BA 1KH0A 3JSVB 4IC7B 1FNUA 4BOZB 2MSED 2LGDA 1SF0A 2KMCA 4HDQA 4GDKB 1P5TA 2G3QB 2LI5A 4WVFB 4FHKA 4IUMB 4P6VF 1MKEA 2KR0A 1XF5L 2RGFA 3GP7A 2M8SA 2JWZA 1Q10A 1GC7A 3R8BA 3MHZA 1Q5WB 1V5TA 4HAVB 2KGXB 2K6QA 4B6WA 3LYYA 2KIEA 4QJ5B 1YQ4B 4XZ4A 1UH6A 2PZ1A 3T3NA 3MC9A 4NSWA 2SAKA 1RWSA 2HJ1A 1TXDA 5DIFB 2AL6A 4JKAA 2J53A 2ZCBA 4BBNF 5DPWA 3DWMA 3L10B 1ACAA 5C6RA 1JALA 2E6XA 2N9XA 4MGZE 2BCJA 4MACA 4IM3A 2DYMA 4KGSA 2BF8B 3A98B 1T0RC 2ZNVB 2N1VA 2YF0A 4D2KA 4GB9A 1MG4A 2JT4B 1XD4A 2DYOA 4A6QA 4WQOB 1ZW7A 2GB1A 2GBNA 3ZNID 2PW9A 1F9JA 3QX1A 4MGIE 3KW5B 3NZ3A 3A8QA 2LWPA 3M62B 3QQ8B 2CR5A 1JQ4A 4K7WA 4W9CA 4GPTB 3O13A 2JZ3B 4KIKA 3VHTC 2JYEA 4AJYB 1MI0A 1WJ6A 2XEWA 3A1QA 1HTQA 3N30A 4RH6A 4ASWC 3EA6A 4FJYA 2LEKA 1WR1A 3TBLD 5GOWB 1L7YA 2K8HA 5IJMA 3BVMA 1SGHA 4HB3B 4ZOHC 2JP2A 2P0HA 1MHXA 4ITKA 3BY4B 3ZJVA 2AQ1B 1WE7A 2LGSA 2BKFA 4W9FA 2R2OA 4L2YA 4Z2NA 2QKLA 5I4DA 1YD8U 1ZC4B 3AEFB 5LONB 1TY0A 2JUOA 1KLUD 3KLSX 1WXQA 2RVBB 4HPMB 3P42A 3RYTA 3BK2A 3N9YC 3BVZA 2NMBA 3W5UB 3RPFC 2M38A 4PS3A 3ZTDA 3N1XC 2YSZA 1XLPA 3E9PA 2G1EA 4DXFA 3SBGA 1TYGB 2IDYA 2WXNA 4C0AA 5HFYA 1A70A 1DOIA 2IO2B 3SNHA 4B0EA 1WVHA 2AX5A 1EGXA 3UINB 3A33B 3RI7C 2ZEQA 4W9IA 1K50A 2NBVB 3L54A 3ALBA 1WGKA 3WANA 4II3B 3ZTCA 1SSNA 3PRZA 5FKAC 1DYQA 2LMCA 3TIXA 3DPDA 2O6VA 1MPHA 1WG7A 4IDIA 4MH0E 2QC8A 3RNCC 2R09A 4IAPA 1Z2MA 3N3KB 4OZAA 4K7SA 2KK8A 1XXGA 4US8A 2WNMA 1YN5A 3RCZA 1R4MB 4NQLB 4XWXA 4MDKE 4WWMA 3Q3JA 2H89B 2HDEA 2J0JA 4AWJA 4KKIA 3BYYB 5J18A 1U5GA 2I1JA 1UGMA 1HQRD 1QOGA 3B9JA 3NWDA 1U27A 1KF6B 1FXTB 4KHBB 4P7IA 1YMHE 4NQKE 2DX1A 4QAYA 5C3JB 1UWXA 1JWMD 2KDEB 1KBLA 2NZ8B 4DIXA 4A6HA 3VTVA 4HEA1 1RRBA 3KYDD 1YX5B 4DHZE 3HW2B 3I57A 1P9DU 2GCLA 2GBRA 1OTRB 4WQMA 4HK2A 2HE7A 3MPXA 1P6SA 2D9VA 2H7EA 2M0XA 2NS5A 3QWZB 2C7MB 4ANUA 1RAXA 1XCTL 3R2IA 2DYQA 1HBKA 2FCMA 2KJHB 1V5UA 3GYOA 1GPXA 2KWVB 3AULA 4IM0A 1TTNA 1F52A 2ZCCA 2YT1A 1P7FA 4MK0A 1FXAA 4RGOS 1XT9B 4MY6A 1I4RA 2BS4B 4KVGB 4YWGG 1L0XB 3CMMB 2OHFA 5BMIA 4K81A 2KTFA 4I6LB 3C0RB 4HROA 5J17A 3PLVA 3A4RA 3PO0A 4EUTA 4F8CB 1QILA 2K8CA 3ETRA 1WH3A 3PHXB 3QAQA 2W54A 1UBQA 3RCPA 2X38A 2VRRB 5FR6A 4KGTA 1FNWA 4KGRA 1Y56A 2NPTA 3SFEB 2BYTA 5TSSA 1ZXHA 2DENB 2YS1A 2RR9A 1P98A 1HZ6A 2DYBA 3APFA 3APCA 1HE8A 2NBUA 4PQ0A 2VZKD 1SHCA 2WXFA 1KZGA 3OG5A 1IBXB 3F0WA 4ARIA 1C76A 2W2WA 2L52A 1UWMA 2GRIA 1EWYC 1P1AA 4A90A 1I35A 2LRWA 3U30A 4N6EB 3ENEA 3DHIC 1E6EB 2G45B 3TFMA 1OQNA 3QHTA 2R61A 1TGZB 2CS4A 2VRWB 1TS3A 1I4HA 1NTIA 4ZRPA 2MX2A 1L4DB 1VZ6A 4HAUB 3B2GA 2CAYA 2J4XA 2KANA 2BYFA 2KJ6A 2FUG1 3H1UA 3HSAA 1M7EA 4MH8A 3KYCD 4F7ZA 2QEJC 1DDWA 2D9ZA 3T8MA 1HB8A 2XK5B 2MFQA 5EE3A 2LGIA 3P4PB 3S2AA 2KD0A 1L2NA 1Z87A 3ZGZA 4NNJB 2D5GA 3SR6A 1F1HA 1DYNA 2IO1B 3DBHI 1QKZA 5JHAA 4K2OA 5JHBA 2COCA 2WXJA 3AU4A 2MWNB 2GBJA 3HVZA 2D9WA 3ML9A 3R7RA 1LO5D 4QJ3B 1KJTA 4GXBA 4AUQC 2BS3B 1J7BA 4RMAA 2INPE 1S3SG 3U7DA 2J59M 2IY0B 4M00A 3P63A 4EE2A 4IW0A 1U29A 1OGWA 4K1RB 2KFKB 1AW7A 2EKEC 4G50A 4KZCA 2KMMA 3PT2B 1JCKB 1N63A 3L17A 3RNEC 2D10A 4JKBA 2ONQA 4FJZA 3DXCA 3M63B 1FB8A 4GOCA 2Z0DB 4DHJD 1AARA 1LQBA 2DZIA 3LJUX 4LDTD 3M3JA 3N1ZC 2WU2B 1OEYJ 4M02A 2PKOA 1B55A 1KI1B 3BINA 2I1KA 1OEYA 4AOFA 1UD7A 1UGJA 4ILJA 2P0DA 1PFDA 2MKRA 5E6OA 2KUQA 3AN1A 2HTHB 2CY4A 3PPAA 4ANWA 2KMAA 3NG0A 4GZUA 4YL8A 3KWVA 2DHJA 2DN6A 1Y8RC 2WDVB 3AE4B 3DBLB 2K5PA 3DBRI 1VZ7A 2R82A 1H8CA 4F7HA 2ROVA 3RZFA 3FILB 2CQUA 3U8ZA 2CJOA 2WQYB 1Q1OA 3LDZE 2KWUB 4B9KA 3IHPC 2VZKB 1D5XC 2YEPF 4FLHA 2N9LA 1WZ0A 1GG3A 3A8PA 3Q8BA 3AEEB 3Q8CA 2J52A 4IWQA 2K8BA 4JE3B 5H8YE 4DX8A 1FHXA 3HIEA 1N5WA 2L32A 4PS8A 2MDXA 2V3NA 2JPHA 3SDLC 2RDHA 1U5EA 4L1RA 3ZVVA 4RM8A 3GB1A 3PREA 2M1MA 2EMTA 4IM2A 3TUOA 5IP4D 4JKGB 2RUKB 5IA7A 3EUB2 4ZRIA 3N1YC 1C3TA 1H10A 1I4XA 2REXA 3AE3B 3BWUD 4K3CA 2MP2A 5HE3A 2KJRA 1F0ZA 3ECIA 2LUEA 1T3QA 4RF0A 1K8RB 3ZKJC 2PJHA 2ZVNA 1JRUA 4C4VB 2BTEA 2V4IB 2ZNVC 3A9KA 4FULA 2MBHA 4HAZB 1UPRA 1XQQA 4TQ1A 2CODA 1M4VA 2VSZA 1XO3A 1DIKA 3ENBA 1STEA 1WIAA 2MLBA 5LXIB 3KRWA 4KV2A 1EF1A 5FR3A 1FCCC 1LM8B 2WP9B 2MRPA 4EFOA 3O65B 1AWDA 3GS2A 3RN9C 4CQNA 5J3QA 1VR9A 5G55A 4KSKC 5GMVA 1XLNA 2OJRA 1EO6A 1WGHA 2Y8FA 2FJUB 2Z59B 2SEBD 4JK8A 3TL5A 2B3AA 3DHGC 1KLVA 2IBIB 1HB6A 1HA5A 4PNKA 4MJSA 1NVLA 4EJNA 4C80A 1U5FA 2L2IA 2WYQA 4EEWA 3ZUNA 1SIJA 3UZTA 1KFYB 3P4SB 5C23A 3ODXA 5J3YA 5C5BB 2VH2A 1ZOYB 2C7NB 2EELA 4RGNA 4BZAA 1I4QA 4A9AA 2HTME 2KDIA 4HSIA 1FHWA 4LDTB 2J42A 4OSNA 1HXYD 1KTKA 2KZRA 4M8MA 3E9SA 1NBFC 2JY6A 2R2YA 3LJ3A 4JKDA 1TIFA 1ISNA 2COAA 1AN8A 4L6EA 1J0GA 2W9NA 2GCJA 4ZRKA 3ABVB 3PVWA 2CY5A 1WRIA 4JKEA 2OQBA 4XWTA 4H8SA 1YJ1A 3X23A 4EZLA 3W2DA 2BWES 2G35A 4L1BA 3Q3MC 2L1CA 2KTRA 5IKCM 3KWLA 4YSZB 2K49A 1SJHD 1TZ1A 3L16A 3SYXA 1NENB 3CIKA 2MJ3A 3SBTA 5EFXA 2KN5A 2A5UA 4WJQA 1Q67A 4IG7B 4DWFA 3HK0A 2D11A 3SFDB 3UF8A 1SXTA 3AH7A 4HATB 2VH1A 1SE9A 1UELA 2C5LC 1EU4A 3PZ8A 2ZW0A 1FRRA 3DBRB 2PE9A 4NJ6A 2DX5A 4JGHB 4JIOU 4DXGA 1FD6A 3VH3B 4TYZA 3CXBB 2IYBA 2OJWA 2YVCA 5D3VA 2WS3B 4CO7A 3MHSD 2O2VA 2D9YA 1RJ2A 3EECA 5C1ZA 2JU6X 1K52A 4XDCA 5EE1A 4NY0A 1SB3C 3NOBA 3FSSA 1FAOA 2DLWA 1TJ6A 3D32A 2K22A 5HE0A 4IWPA 5HI1A 2C7HA 4JLCA 3TCAA 2WDTB 3DWGC 2UU7A 4OVVA 2L7RA 1FGZA 2KKCA 2LJ5A 4PYUA 1FM0D
chains in the Genus database with same CATH topology
2NVUI 4AP4C 4ILHA 2DHZA 2MBBB 2C9WB 2V3SA 3ZNHB 2NR2A 2JVCA 3A4SC 5FI1A 1WJUA 3PEGA 2KXJA 2I5CA 1Z5SB 2D07B 2R2QA 2RGNB 4W9GA 3W1SC 2PE6B 3RT3B 5L95C 4IFSA 2K2UA 4KDLB 1V61A 1TBEA 2D3GA 4K7UA 4J6IA 3M1IB 1IYFA 1WI0A 3ZNZB 4JL9A 4CHKA 2KCJA 1LW3A 2YRYA 3ODWA 2YS3A 3M95A 2GBMA 4KHAA 3KRXA 3DXDA 3NHEB 1WE6A 1DROA 2KOXA 2H7DA 1ZC3B 3WALA 2M17A 3ML8A 2AYOB 2LVPA 4FN2A 3W1SA 3E9OA 2ZPYA 2J7QB 4G3XB 2G4SA 2RNRB 1XCGA 5CTRC 2P0FA 1PMSA 2HD5B 2O6VD 2KC1A 2FAZA 1WGUA 5FI0A 3WA0A 5KHQA 3A9JA 4HLEA 3KZ1A 3ULCA 4A20A 3VH4B 2V1YA 3IG3A 2EMSA 5J2RA 1EVHA 3T9LA 3D8DA 4ANXA 2LGYA 5L81A 2KVRA 2HJ8A 2ZJDA 2W2XC 1I7AA 2AEHA 1BAKA 2LVQA 4EKUA 1ZM0A 4EZKA 2XBBC 4G0NB 3E9LA 2Z0QA 3FP5A 1VBHA 4DHZB 4KIKB 1UNPA 3OANA 3A1QB 5J3TA 1OMWA 1X1FA 2EC1A 1E90A 5CHFA 4A5KA 4HXDA 2FCQA 4JKCA 5JHGA 3PLUA 3L0WB 3DOWA 2WX0A 2IYDB 2RLOA 2UZRA 4TQ0A 4IWOA 5AEKB 2QHOA 1E7UA 1VD2A 4G11A 1SIFA 3QJZA 3K9OB 4BOSC 1UEFA 4DX90 4MSQB 3PTFC 3NY5A 3NZUA 5TR5A 4MT7A 4GGQA 2P8VA 2CHWA 4W9KA 1PLSA 4W9EA 4WJ7A 3GZNI 2DYNA 2ELBA 2KLCA 5AZHA 3WIMA 2ZZPB 2UVMA 2N7DA 3KH0A 4B95A 1S1QB 5DCNA 3ZRFA 5HKHA 2Q13A 3IBEA 3SHQA 2O6VB 2R0DA 5DHFB 5DHAB 3UQAA 2PEAA 3VOQA 2KX3A 1WX7A 4NAWA 1WMHA 3JYUA 1QC6A 4EMOA 4E74A 3DVNV 1WGYA 2YLMA 2RSUA 2FUHB 2K1FA 4FJVB 5D3YA 5JZEB 2WWZA 1E5WA 3OJ4B 3H7PA 2CHZA 3ZNGC 1U2BA 2Z0EB 4MELA 4Z2MB 5KQ1A 4D0NB 2IFSA 3H6NA 1W1DA 2UYZB 5AZGA 2XQNM 4F7UP 4ZDVA 4HAXB 2L00B 1WGDA 1V49A 4EOYA 1UZXB 1PQSA 1WJNA 4BKSA 3VDZA 4GDLA 4W9HA 4NJ7A 4BKGA 3QC8B 1WXVA 3AJ4A 4HCPB 3UGBB 3VAWA 3WYFB 5JVLA 5C79A 2KX0A 1U4AA 1DDVA 2CB8A 3HM3A 3KY9A 1RLFA 3N32A 3PVUA 4HAYB 2NPTB 3AU5A 5D2MB 3PVLA 1UBIA 3PSCA 4JKFA 2DHKA 3PP2A 2DKQA 5DH9B 5L83A 5LLIA 2Y5BB 1YX6B 2L76A 3WAOA 4GMVA 3V61A 1X86A 4WJPA 4URKA 1W1GA 1WGRA 2K00A 2ABDA 3ZO5B 3IFWB 1H4RA 3HM6X 4MM3A 3RULA 5G2NA 3BJIA 1P3QU 3VXWA 5D27A 3SV1A 1GGOA 1K5GB 2A4ZA 2LZ6A 5LOPB 5CX3A 3JSVA 3FM8C 3ZIMA 1XODA 4GDKA 2BGFA 3EHVA 5CHWA 1P0RA 4B6HA 1WM3A 5BO4B 1LXDA 2J0MA 2ROZB 3R66C 2X0SA 1BTKA 4A6FA 3OJ3A 2FDQA 1WGGA 3DVNU 2MA9B 4ANVA 1VBGA 5EDSA 2N7EA 2M14A 1X1GA 4W9LA 2FCSA 1X11A 1V89A 2CRFA 2L0FA 4KDIC 4OVUA 1KOTA 1V5PA 3K9PB 2DZMA 2LASA 4GU2A 1EUVB 2COFA 4WWPA 4MGKE 4E71A 1WX9A 4HB2B 3DVGY 5DPTA 4XC2A 1LB1A 1Y5OA 4I6PA 3B08A 3OLMD 4GSWA 3ZDMC 2AL3A 2MBEA 4JK9A 2E2XA 4HDOA 2QKMA 1I2HA 3WAPA 1XR0B 4JQWC 5E6NA 2MBOA 3CSFA 1UPQA 1C1YB 3DVGX 1TQZA 4BBKA 2L0TA 3TMPB 3ULBA 1WXMA 2V76A 1WXAA 1VCBA 1IRSA 1IP9A 4NPNA 1AWEA 2K25A 1M7RA 2VKIA 3VUWA 2AWTA 1UNQA 3DBSA 3B0AA 2ZVOA 1ZKHA 1GUAB 3KUZA 2MP2B 1V80A 4A3PA 2COPA 3DQVA 1BT0A 4HHVA 2GMIC 1E8XA 3A9KB 1V86A 2V4LA 2M4NA 1DBHA 2X18A 4KAXB 2KNBA 1NDDA 1EF5A 3QBVB 4A6FB 1Q0WB 3UQBA 1KM7A 3JW0X 1A5RA 4I6NB 2FJLA 4MJSB 3DDCB 2N4FA 4FBJB 2C60A 3AI5A 5E6PA 2D9XA 2N9PC 2DKPA 2DIKA 2JZZA 2K6DB 1ZVRA 3KUDB 1NI2A 2DZKA 1GC6A 3PRMB 1V88A 2EJ8A 5LXHA 2N23A 2BYVE 2DAFA 5AZFA 4K17A 2LGXA 3VTUA 2FIDA 3MDBC 4HVBA 2LG1A 3HQCA 1XD3B 1WZ3A 2KWCA 2LOZA 2HRJA 2KTRB 4W9JA 2KDFB 2BYEA 4HPLB 1DDMA 3P7ZA 1FHOA 4HB4B 3V5WA 3FEHA 3EC8A 3NZSA 1BWNA 1KC7A 1WYWB 2MWSB 2IO0B 1K5DB 3RUIB 4F7GA 1D3ZA 4JK7A 2DX5B 1RFAA 3TO1A 2L05A 3KVFB 2KFJA 2CU1A 1OQYA 1V9JA 1JDEA 2O2VB 3TVVA 5D3WA 4WAAA 3PV1A 4ILGB 1QQGA 1XKEA 2KQSA 3PS6A 4WJOA 2Z0OA 3QA8A 4HAWB 1Y19B 1WJ1A 1WGQA 3VVWB 1CMXB 4LJOB 2CHXA 5DPSA 4BKTA 4II2B 2MBQA 5CHVC 1X05A 4ZYNA 5KCVA 1W1HA 4N9F4 3TJPA 1MAIA 3ML4A 4AJWA 4DK5A 2KHWB 3OAWA 1NTVA 1WXSA 1V5MA 3RZWC 2MCNB 1N3HA 3UIOB 1GJZA 3WAMA 2XK5A 3MTNB 2FCNA 1WF9A 2N0YA 2W2XD 2KC2A 4WWNA 4ICVA 4ICUA 2LRUA 3DCGA 3VTWA 2UZSA 1ST7A 1EAZA 3DXEA 1V5OA 3B1LX 5JP4A 2FNJB 3ZVRA 3SD5A 5HE1A 3DBLI 3PSEB 4W9DA 1XX0A 4PYZA 1MK7B 2KFKA 4TKNA 4JKHA 2DHIA 4RM9A 1E8WA 2I5FA 5JLJB 4F1SA 2N1WA 3NS8A 3P2BA 4MEMA 2NCNA 2BWFA 2D2QA 1NTYA 2G4DB 3G9WA 3D8FA 3UIPB 5DPRA 2Y7BA 2JRHA 4HWIB 3H7SA 2KQ7A 3SUZA 4KZ0A 2KLGA 1RRPB 2BPSA 2DFKA 1LFDA 2HTHA 3A9JB 1WM2A 5KQ4A 1GNUA 1WR6E 3T06A 4ZRJA 2ELAA 4LJPB 2JRIB 3GOEA 4M8NA 3RD2A 3VFKA 4FHJA 1WI1A 1MIXA 2IY1B 1J0WA 3PG7A 3ZW3A 2NBWB 4GMXB 4E3CA 1OY2A 2L8JA 4M0WB 2RSGA 1X1MA 2LVOA 4JKGA 1J8CA 4KHOA 2MW5A 5CLLB 3L13A 3L08A 4X57B 5KHOA 3CF6E 3SU8X 2LULA 2K39A 3P6AA 2DA0A 1IPGA 5D7GA 2GS0A 3VIAA 2LD9A 2JF5A 2KO3A 3V6CB 4WWOA 4BKSD 3I3TB 3ZLZA 2YS5A 3MJWA 1MIZB 3O96A 5JH5C 5CLQB 3GYPA 5D3XA 3PHWB 4DBBA 1KZ7A 4HJKA 4WSFA 5D94A 2RD0A 1WX8A 4KSLC 2D4QA 5JHHA 3QWMA 4BBNC 2BKRB 2Y8GA 3SO6A 2ADZA 5C5BA 4DDGD 2RQ1A 2GJYA 4BFRA 3R7QA 3VUYA 1BTNA 3VUXA 3NSUA 2GBKA 2DTCA 1E8ZA 1WJ4A 3JVZX 1WJMA 5HE2A 2IO3B 3R3MA 3PZDA 4GN1A 3CSTA 4DXAB 3F5RA 5DI9B 4NAWB 4A6KA 1WMHB 1V6EA 5IAAC 4MGYE 1T0YA 1I42A 3D8EA 4HCNB 4A3OA 3V6EB 4EZJA 2WH5A 3ODOA 2OTXA 1FOEA 3AXCA 3H7PB 3KSYA 2J0KA 2N9EB 2LKOA 1NU2A 4HB0B 2ASQA 1U5DA 1ZGUB 3ONSA 3IVFA 1ZSQA 3HHMA 5D6JB 1YQBA 2LXAA 3TW1A 2LOXA 1E8YA 1J19A 2KDBA 4FA6A 3X0WA 2IZVB 4Y94A 4DDID 3PRPB 3PGEA 1WY8A 3H9DA 4GDLB 2FJ9A 3ZRCA 3QCAA 4YONA 1PFJA 1G6JA 2K2JA 2OOBB 4GIVA 4CYEA 4CHMA 1MG8A 3EFUA 4XX5A 2LXCA 3VQIA 2KUPA 3ZDTA 4LCDE 2UWQA 2MQJA 1V81A 1QZEA 3EPYA 3APDA 3V60A 2L3ZA 2DZJA 4WJNA 2YT0A 1R4NI 1E7VA 1M94A 2LBBA 4PS7A 1AQCA 4TUUA 2WX1A 4K2PA 4TV3A 4MSMB 2RPQA 3E66A 2JXXA 4DHJB 2PPHA 3W1YA 1MK9B 2FIFA 2ZPNA 1V2YA 3QIJA 3V62A 3QARA 2CKHB 1FGYA 1WFYA 4IOYX 3HIZA 3N7CA 1WRDB 3Q3FA 2LYDA 1YIWA 3QK0A 4FADA 4DBGA 3FLVA 2DAJA 4BVUC 2GOWA 3KUCB 4CHJA 1P3RA 2Z0PA 5C16A 1UNRA 1R4MI 3JSVB 4IC7B 4BOZB 2MSED 2LGDA 2KMCA 4HDQA 4GDKB 1P5TA 2G3QB 2LI5A 4WVFB 4FHKA 4IUMB 1MKEA 2RGFA 2M8SA 2JWZA 1GC7A 1Q5WB 1V5TA 4HAVB 2KGXB 2K6QA 4B6WA 4XZ4A 1UH6A 2PZ1A 4NSWA 1TXDA 5DIFB 2AL6A 4JKAA 4BBNF 2ZCBA 5DPWA 3L10B 1ACAA 5C6RA 2N9XA 4MGZE 2BCJA 4IM3A 2DYMA 2BF8B 3A98B 2ZNVB 2N1VA 2YF0A 4GB9A 2JT4B 1XD4A 2DYOA 4WQOB 1ZW7A 2GBNA 3ZNID 3QX1A 1F9JA 4MGIE 3KW5B 3A8QA 2LWPA 3M62B 3QQ8B 2CR5A 4K7WA 4W9CA 4GPTB 2JZ3B 4KIKA 3VHTC 4AJYB 1WJ6A 2XEWA 3A1QA 3N30A 4ASWC 4FJYA 1WR1A 3TBLD 5GOWB 1L7YA 2K8HA 5IJMA 1SGHA 4HB3B 2JP2A 2P0HA 3BY4B 1WE7A 2BKFA 4W9FA 2R2OA 4Z2NA 2QKLA 1YD8U 1ZC4B 5LONB 2JUOA 2RVBB 4HPMB 3RYTA 2NMBA 2M38A 4PS3A 3ZTDA 2YSZA 3E9PA 3SBGA 4C0AA 2IO2B 3SNHA 1WVHA 1EGXA 3UINB 3A33B 2ZEQA 4W9IA 2NBVB 3L54A 3ALBA 3WANA 4II3B 3ZTCA 3PRZA 3TIXA 3DPDA 2O6VA 1MPHA 1WG7A 4MH0E 2R09A 4IAPA 1Z2MA 3N3KB 4K7SA 2KK8A 3RCZA 4NQLB 4XWXA 4MDKE 3Q3JA 2J0JA 4AWJA 5J18A 1U5GA 2I1JA 1UGMA 1U27A 1FXTB 4KHBB 4P7IA 4NQKE 2DX1A 2KDEB 1KBLA 2NZ8B 4A6HA 3VTVA 1RRBA 3KYDD 1YX5B 4DHZE 3HW2B 1P9DU 2GCLA 2GBRA 1OTRB 4HK2A 2HE7A 3MPXA 1P6SA 2D9VA 2H7EA 2M0XA 2NS5A 3QWZB 2C7MB 4ANUA 1RAXA 2DYQA 1HBKA 2FCMA 2KJHB 1V5UA 3GYOA 2KWVB 3AULA 4IM0A 1TTNA 2ZCCA 2YT1A 4MK0A 1XT9B 4MY6A 4KVGB 3CMMB 4K81A 2KTFA 4I6LB 3C0RB 5J17A 3PLVA 3A4RA 4EUTA 4F8CB 2K8CA 1WH3A 3PHXB 3QAQA 1UBQA 3RCPA 2VRRB 5FR6A 2NPTA 2DENB 2YS1A 2RR9A 1P98A 2DYBA 3APFA 3APCA 1HE8A 2NBUA 4PQ0A 1SHCA 1KZGA 3F0WA 2W2WA 1P1AA 1I35A 2LRWA 3U30A 3ENEA 2G45B 3TFMA 1OQNA 3QHTA 1TGZB 2CS4A 2VRWB 1NTIA 2MX2A 4HAUB 2CAYA 2KANA 2BYFA 2KJ6A 3H1UA 1M7EA 3KYCD 4F7ZA 1DDWA 2D9ZA 3T8MA 1HB8A 2XK5B 2MFQA 3S2AA 2KD0A 1L2NA 1Z87A 4NNJB 1DYNA 2IO1B 3DBHI 5JHAA 4K2OA 5JHBA 2COCA 3AU4A 2MWNB 2GBJA 2D9WA 3ML9A 3R7RA 1KJTA 4GXBA 4AUQC 4RMAA 1S3SG 3U7DA 2J59M 2IY0B 4IW0A 1U29A 1OGWA 4K1RB 2KFKB 4G50A 2EKEC 4KZCA 3PT2B 3L17A 2D10A 4JKBA 4FJZA 4GOCA 3DXCA 3M63B 1FB8A 2Z0DB 4DHJD 1AARA 1LQBA 2DZIA 3LJUX 4LDTD 3M3JA 1OEYJ 1B55A 1KI1B 3BINA 2I1KA 1OEYA 4AOFA 1UD7A 4ILJA 2P0DA 5E6OA 2MKRA 2HTHB 2CY4A 3PPAA 4ANWA 2KMAA 4GZUA 4YL8A 2DHJA 2DN6A 1Y8RC 3DBRI 2R82A 1H8CA 4F7HA 2ROVA 3RZFA 2CQUA 3U8ZA 1Q1OA 3LDZE 2KWUB 4B9KA 3IHPC 4FLHA 1WZ0A 1GG3A 3A8PA 4IWQA 2K8BA 4DX8A 1FHXA 4PS8A 2MDXA 2JPHA 3SDLC 1U5EA 3ZVVA 4RM8A 3PREA 2M1MA 2EMTA 4IM2A 4JKGB 2RUKB 5IA7A 4ZRIA 1C3TA 1H10A 2REXA 2MP2A 5HE3A 2KJRA 3ECIA 2LUEA 1K8RB 3ZKJC 2PJHA 2ZVNA 1JRUA 2ZNVC 3A9KA 4FULA 2MBHA 4HAZB 1UPRA 1XQQA 4TQ1A 2CODA 2VSZA 1DIKA 3ENBA 1WIAA 2MLBA 5LXIB 3KRWA 4KV2A 1EF1A 1LM8B 2MRPA 4EFOA 3O65B 5J3QA 5G55A 4KSKC 5GMVA 2OJRA 1EO6A 1WGHA 2Y8FA 2Z59B 4JK8A 3TL5A 2B3AA 1KLVA 2IBIB 1HB6A 4PNKA 4MJSA 1NVLA 4EJNA 1U5FA 2L2IA 2WYQA 4EEWA 3ZUNA 3UZTA 5C23A 3ODXA 5J3YA 5C5BB 2C7NB 2KDIA 1FHWA 4LDTB 2KZRA 4M8MA 1NBFC 2JY6A 3LJ3A 4JKDA 1ISNA 2COAA 4L6EA 1J0GA 2W9NA 2GCJA 4ZRKA 3PVWA 2CY5A 4JKEA 2OQBA 4H8SA 1YJ1A 3X23A 4EZLA 2BWES 2G35A 2L1CA 2KTRA 1TZ1A 3L16A 3SYXA 3CIKA 3SBTA 5EFXA 2KN5A 2A5UA 4WJQA 1Q67A 4IG7B 4DWFA 3HK0A 2D11A 3UF8A 4HATB 1SE9A 1UELA 2C5LC 2PE9A 4NJ6A 2DX5A 4JGHB 4JIOU 3VH3B 4TYZA 3CXBB 2IYBA 2YVCA 5D3VA 4CO7A 3MHSD 2O2VA 2D9YA 1RJ2A 3EECA 5C1ZA 4NY0A 3NOBA 3FSSA 1FAOA 2DLWA 1TJ6A 3D32A 5HE0A 4IWPA 2C7HA 4JLCA 3TCAA 2WDTB 4OVVA 2L7RA 1FGZA 2KKCA 2LJ5A 4PYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVU I;  4AP4 C;  2DHZ A;  2MBB B;  2C9W B;  2V3S A;  3ZNH B;  2NR2 A;  2JVC A;  3A4S C;  5FI1 A;  1WJU A;  3PEG A;  2KXJ A;  2I5C A;  1Z5S B;  2D07 B;  2R2Q A;  2RGN B;  4W9G A;  3W1S C;  2PE6 B;  3RT3 B;  5L95 C;  4IFS A;  2K2U A;  4KDL B;  1V61 A;  1TBE A;  2D3G A;  4K7U A;  4J6I A;  3M1I B;  1IYF A;  1WI0 A;  3ZNZ B;  4JL9 A;  4CHK A;  2KCJ A;  1LW3 A;  2YRY A;  3ODW A;  2YS3 A;  3M95 A;  2GBM A;  4KHA A;  3KRX A;  3DXD A;  3NHE B;  1WE6 A;  1DRO A;  2KOX A;  2H7D A;  1ZC3 B;  3WAL A;  2M17 A;  3ML8 A;  2AYO B;  2LVP A;  4FN2 A;  3W1S A;  2ZPY A;  2J7Q B;  4G3X B;  2G4S A;  2RNR B;  1XCG A;  5CTR C;  2P0F A;  1PMS A;  2HD5 B;  2O6V D;  2KC1 A;  2FAZ A;  1WGU A;  5FI0 A;  3WA0 A;  5KHQ A;  3A9J A;  4HLE A;  3KZ1 A;  3ULC A;  4A20 A;  3VH4 B;  2V1Y A;  3IG3 A;  2EMS A;  5J2R A;  1EVH A;  3T9L A;  3D8D A;  4ANX A;  2LGY A;  5L81 A;  2KVR A;  2HJ8 A;  2ZJD A;  2W2X C;  1I7A A;  2AEH A;  1BAK A;  2LVQ A;  4EKU A;  1ZM0 A;  4EZK A;  2XBB C;  4G0N B;  2Z0Q A;  3FP5 A;  4DHZ B;  4KIK B;  1UNP A;  3OAN A;  3A1Q B;  5J3T A;  1OMW A;  1X1F A;  2EC1 A;  1E90 A;  5CHF A;  4A5K A;  4HXD A;  2FCQ A;  5JHG A;  3PLU A;  3L0W B;  3DOW A;  2WX0 A;  2IYD B;  2RLO A;  2UZR A;  4TQ0 A;  4IWO A;  5AEK B;  2QHO A;  1E7U A;  1VD2 A;  4G11 A;  1SIF A;  3QJZ A;  3K9O B;  4BOS C;  1UEF A;  4DX9 0;  4MSQ B;  3PTF C;  3NY5 A;  3NZU A;  5TR5 A;  4MT7 A;  4GGQ A;  2P8V A;  2CHW A;  4W9K A;  1PLS A;  4W9E A;  4WJ7 A;  3GZN I;  2DYN A;  2ELB A;  2KLC A;  5AZH A;  3WIM A;  2ZZP B;  2UVM A;  2N7D A;  3KH0 A;  4B95 A;  1S1Q B;  5DCN A;  3ZRF A;  5HKH A;  2Q13 A;  3IBE A;  3SHQ A;  2O6V B;  2R0D A;  5DHF B;  5DHA B;  3UQA A;  2PEA A;  3VOQ A;  2KX3 A;  1WX7 A;  4NAW A;  1WMH A;  3JYU A;  1QC6 A;  4EMO A;  4E74 A;  3DVN V;  1WGY A;  2YLM A;  2RSU A;  2FUH B;  2K1F A;  4FJV B;  5D3Y A;  5JZE B;  2WWZ A;  1E5W A;  3OJ4 B;  3H7P A;  2CHZ A;  3ZNG C;  1U2B A;  2Z0E B;  4MEL A;  4Z2M B;  5KQ1 A;  4D0N B;  2IFS A;  3H6N A;  1W1D A;  2UYZ B;  5AZG A;  2XQN M;  4F7U P;  4ZDV A;  4HAX B;  2L00 B;  1WGD A;  1V49 A;  4EOY A;  1UZX B;  1PQS A;  1WJN A;  4BKS A;  3VDZ A;  4GDL A;  4W9H A;  4NJ7 A;  4BKG A;  3QC8 B;  1WXV A;  3AJ4 A;  4HCP B;  3UGB B;  3VAW A;  3WYF B;  5C79 A;  2KX0 A;  1U4A A;  1DDV A;  2CB8 A;  3HM3 A;  3KY9 A;  1RLF A;  3N32 A;  3PVU A;  4HAY B;  2NPT B;  3AU5 A;  5D2M B;  3PVL A;  1UBI A;  3PSC A;  2DHK A;  3PP2 A;  2DKQ A;  5DH9 B;  5L83 A;  5LLI A;  2Y5B B;  1YX6 B;  2L76 A;  3WAO A;  4GMV A;  3V61 A;  1X86 A;  4WJP A;  4URK A;  1W1G A;  1WGR A;  2K00 A;  2ABD A;  3ZO5 B;  3IFW B;  1H4R A;  3HM6 X;  4MM3 A;  3RUL A;  5G2N A;  3BJI A;  1P3Q U;  3VXW A;  5D27 A;  3SV1 A;  1K5G B;  2A4Z A;  2LZ6 A;  5LOP B;  5CX3 A;  3JSV A;  3FM8 C;  3ZIM A;  1XOD A;  4GDK A;  2BGF A;  3EHV A;  5CHW A;  1P0R A;  4B6H A;  1WM3 A;  5BO4 B;  1LXD A;  2J0M A;  2ROZ B;  3R66 C;  1BTK A;  4A6F A;  3OJ3 A;  2FDQ A;  1WGG A;  3DVN U;  2MA9 B;  4ANV A;  5EDS A;  2N7E A;  2M14 A;  1X1G A;  4W9L A;  2FCS A;  1X11 A;  1V89 A;  2CRF A;  2L0F A;  4KDI C;  4OVU A;  1KOT A;  1V5P A;  3K9P B;  2DZM A;  2LAS A;  4GU2 A;  1EUV B;  2COF A;  4WWP A;  4MGK E;  4E71 A;  1WX9 A;  4HB2 B;  3DVG Y;  5DPT A;  4XC2 A;  1LB1 A;  1Y5O A;  4I6P A;  3B08 A;  3OLM D;  4GSW A;  3ZDM C;  2AL3 A;  2MBE A;  2E2X A;  4HDO A;  2QKM A;  1I2H A;  3WAP A;  1XR0 B;  4JQW C;  5E6N A;  2MBO A;  3CSF A;  1UPQ A;  1C1Y B;  3DVG X;  1TQZ A;  4BBK A;  2L0T A;  3TMP B;  3ULB A;  1WXM A;  2V76 A;  1WXA A;  1VCB A;  1IRS A;  1IP9 A;  4NPN A;  1AWE A;  2K25 A;  1M7R A;  2VKI A;  3VUW A;  2AWT A;  1UNQ A;  3DBS A;  3B0A A;  2ZVO A;  1ZKH A;  1GUA B;  3KUZ A;  2MP2 B;  1V80 A;  4A3P A;  2COP A;  3DQV A;  1BT0 A;  4HHV A;  2GMI C;  1E8X A;  3A9K B;  1V86 A;  2V4L A;  2M4N A;  1DBH A;  2X18 A;  4KAX B;  2KNB A;  1NDD A;  1EF5 A;  3QBV B;  4A6F B;  1Q0W B;  3UQB A;  1KM7 A;  3JW0 X;  1A5R A;  4I6N B;  2FJL A;  4MJS B;  3DDC B;  2N4F A;  4FBJ B;  2C60 A;  3AI5 A;  5E6P A;  2D9X A;  2N9P C;  2DKP A;  2JZZ A;  2K6D B;  1ZVR A;  3KUD B;  1NI2 A;  2DZK A;  1GC6 A;  3PRM B;  1V88 A;  2EJ8 A;  5LXH A;  2N23 A;  2BYV E;  2DAF A;  5AZF A;  4K17 A;  2LGX A;  3VTU A;  2FID A;  3MDB C;  4HVB A;  2LG1 A;  3HQC A;  1XD3 B;  1WZ3 A;  2KWC A;  2LOZ A;  2HRJ A;  2KTR B;  4W9J A;  2KDF B;  2BYE A;  4HPL B;  1DDM A;  3P7Z A;  1FHO A;  4HB4 B;  3V5W A;  3FEH A;  3EC8 A;  3NZS A;  1BWN A;  1WYW B;  2MWS B;  2IO0 B;  1K5D B;  3RUI B;  4F7G A;  1D3Z A;  2DX5 B;  1RFA A;  3TO1 A;  2L05 A;  3KVF B;  2KFJ A;  2CU1 A;  1OQY A;  1V9J A;  2O2V B;  3TVV A;  5D3W A;  4WAA A;  3PV1 A;  1QQG A;  1XKE A;  2KQS A;  3PS6 A;  4WJO A;  2Z0O A;  3QA8 A;  4HAW B;  1Y19 B;  1WJ1 A;  1WGQ A;  3VVW B;  1CMX B;  4LJO B;  2CHX A;  5DPS A;  4BKT A;  4II2 B;  2MBQ A;  5CHV C;  1X05 A;  4ZYN A;  5KCV A;  1W1H A;  4N9F 4;  3TJP A;  1MAI A;  3ML4 A;  4AJW A;  4DK5 A;  2KHW B;  3OAW A;  1NTV A;  1WXS A;  1V5M A;  3RZW C;  2MCN B;  1N3H A;  3UIO B;  1GJZ A;  3WAM A;  2XK5 A;  3MTN B;  2FCN A;  1WF9 A;  2N0Y A;  2W2X D;  2KC2 A;  4WWN A;  4ICV A;  4ICU A;  2LRU A;  3DCG A;  3VTW A;  2UZS A;  1ST7 A;  1EAZ A;  3DXE A;  1V5O A;  3B1L X;  5JP4 A;  2FNJ B;  3ZVR A;  3SD5 A;  5HE1 A;  3DBL I;  3PSE B;  4W9D A;  1XX0 A;  4PYZ A;  1MK7 B;  2KFK A;  4TKN A;  2DHI A;  4RM9 A;  1E8W A;  2I5F A;  5JLJ B;  4F1S A;  2N1W A;  3NS8 A;  3P2B A;  4MEM A;  2NCN A;  2BWF A;  2D2Q A;  1NTY A;  2G4D B;  3G9W A;  3D8F A;  3UIP B;  5DPR A;  2Y7B A;  2JRH A;  4HWI B;  3H7S A;  2KQ7 A;  3SUZ A;  4KZ0 A;  2KLG A;  1RRP B;  2BPS A;  2DFK A;  1LFD A;  2HTH A;  3A9J B;  1WM2 A;  5KQ4 A;  1GNU A;  1WR6 E;  3T06 A;  4ZRJ A;  2ELA A;  4LJP B;  2JRI B;  3GOE A;  4M8N A;  3RD2 A;  3VFK A;  4FHJ A;  1WI1 A;  1MIX A;  2IY1 B;  1J0W A;  3PG7 A;  3ZW3 A;  2NBW B;  4GMX B;  4E3C A;  1OY2 A;  2L8J A;  4M0W B;  2RSG A;  1X1M A;  2LVO A;  1J8C A;  4KHO A;  2MW5 A;  5CLL B;  3L13 A;  3L08 A;  4X57 B;  5KHO A;  3CF6 E;  3SU8 X;  2LUL A;  2K39 A;  3P6A A;  2DA0 A;  1IPG A;  5D7G A;  2GS0 A;  3VIA A;  2LD9 A;  2JF5 A;  2KO3 A;  3V6C B;  4WWO A;  4BKS D;  3I3T B;  3ZLZ A;  2YS5 A;  3MJW A;  1MIZ B;  3O96 A;  5JH5 C;  5CLQ B;  3GYP A;  5D3X A;  3PHW B;  4DBB A;  1KZ7 A;  4HJK A;  4WSF A;  5D94 A;  2RD0 A;  1WX8 A;  4KSL C;  2D4Q A;  5JHH A;  3QWM A;  4BBN C;  2BKR B;  2Y8G A;  3SO6 A;  2ADZ A;  5C5B A;  4DDG D;  2RQ1 A;  2GJY A;  4BFR A;  3R7Q A;  3VUY A;  1BTN A;  3VUX A;  3NSU A;  2GBK A;  2DTC A;  1E8Z A;  1WJ4 A;  3JVZ X;  1WJM A;  5HE2 A;  2IO3 B;  3R3M A;  3PZD A;  4GN1 A;  3CST A;  4DXA B;  3F5R A;  5DI9 B;  4NAW B;  4A6K A;  1WMH B;  1V6E A;  5IAA C;  4MGY E;  1T0Y A;  1I42 A;  3D8E A;  4HCN B;  4A3O A;  3V6E B;  4EZJ A;  2WH5 A;  3ODO A;  2OTX A;  1FOE A;  3AXC A;  3H7P B;  3KSY A;  2J0K A;  2N9E B;  2LKO A;  1NU2 A;  4HB0 B;  2ASQ A;  1U5D A;  1ZGU B;  3ONS A;  3IVF A;  1ZSQ A;  3HHM A;  5D6J B;  1YQB A;  2LXA A;  3TW1 A;  2LOX A;  1E8Y A;  1J19 A;  2KDB A;  4FA6 A;  3X0W A;  2IZV B;  4Y94 A;  4DDI D;  3PRP B;  3PGE A;  1WY8 A;  3H9D A;  4GDL B;  2FJ9 A;  3ZRC A;  3QCA A;  4YON A;  1PFJ A;  1G6J A;  2K2J A;  2OOB B;  4GIV A;  4CYE A;  4CHM A;  1MG8 A;  3EFU A;  4XX5 A;  2LXC A;  3VQI A;  2KUP A;  3ZDT A;  4LCD E;  2UWQ A;  2MQJ A;  1V81 A;  1QZE A;  3EPY A;  3V60 A;  3APD A;  2L3Z A;  2DZJ A;  4WJN A;  2YT0 A;  1R4N I;  1E7V A;  1M94 A;  2LBB A;  4PS7 A;  1AQC A;  4TUU A;  2WX1 A;  4K2P A;  4TV3 A;  4MSM B;  2RPQ A;  2JXX A;  4DHJ B;  2PPH A;  3W1Y A;  1MK9 B;  2FIF A;  2ZPN A;  1V2Y A;  3QIJ A;  3V62 A;  3QAR A;  2CKH B;  1FGY A;  1WFY A;  4IOY X;  3HIZ A;  3N7C A;  1WRD B;  3Q3F A;  2LYD A;  1YIW A;  3QK0 A;  4FAD A;  4DBG A;  3FLV A;  2DAJ A;  4BVU C;  2GOW A;  3KUC B;  4CHJ A;  1P3R A;  2Z0P A;  5C16 A;  1UNR A;  1R4M I;  3JSV B;  4IC7 B;  4BOZ B;  2MSE D;  2LGD A;  2KMC A;  4HDQ A;  4GDK B;  1P5T A;  2G3Q B;  2LI5 A;  4WVF B;  4FHK A;  4IUM B;  1MKE A;  2RGF A;  2M8S A;  2JWZ A;  1GC7 A;  1Q5W B;  1V5T A;  4HAV B;  2KGX B;  2K6Q A;  4B6W A;  4XZ4 A;  1UH6 A;  2PZ1 A;  4NSW A;  1TXD A;  5DIF B;  2AL6 A;  4BBN F;  2ZCB A;  5DPW A;  3L10 B;  1ACA A;  5C6R A;  2N9X A;  4MGZ E;  2BCJ A;  4IM3 A;  2DYM A;  2BF8 B;  3A98 B;  2ZNV B;  2N1V A;  2YF0 A;  4GB9 A;  2JT4 B;  1XD4 A;  2DYO A;  4WQO B;  1ZW7 A;  2GBN A;  3ZNI D;  3QX1 A;  1F9J A;  4MGI E;  3KW5 B;  3A8Q A;  2LWP A;  3M62 B;  3QQ8 B;  2CR5 A;  4K7W A;  4W9C A;  4GPT B;  2JZ3 B;  4KIK A;  3VHT C;  4AJY B;  1WJ6 A;  2XEW A;  3A1Q A;  3N30 A;  4ASW C;  4FJY A;  1WR1 A;  3TBL D;  5GOW B;  1L7Y A;  2K8H A;  5IJM A;  1SGH A;  4HB3 B;  2JP2 A;  2P0H A;  3BY4 B;  1WE7 A;  2BKF A;  4W9F A;  2R2O A;  4Z2N A;  2QKL A;  1YD8 U;  1ZC4 B;  5LON B;  2JUO A;  2RVB B;  4HPM B;  3RYT A;  2NMB A;  2M38 A;  4PS3 A;  3ZTD A;  2YSZ A;  4C0A A;  2IO2 B;  3SNH A;  1WVH A;  1EGX A;  3UIN B;  3A33 B;  2ZEQ A;  4W9I A;  2NBV B;  3L54 A;  3ALB A;  3WAN A;  4II3 B;  3ZTC A;  3PRZ A;  3TIX A;  3DPD A;  2O6V A;  1MPH A;  1WG7 A;  4MH0 E;  2R09 A;  4IAP A;  1Z2M A;  3N3K B;  4K7S A;  2KK8 A;  3RCZ A;  4NQL B;  4XWX A;  4MDK E;  3Q3J A;  2J0J A;  4AWJ A;  5J18 A;  1U5G A;  2I1J A;  1UGM A;  1U27 A;  1FXT B;  4KHB B;  4P7I A;  4NQK E;  2DX1 A;  2KDE B;  2NZ8 B;  4A6H A;  3VTV A;  1RRB A;  3KYD D;  1YX5 B;  4DHZ E;  3HW2 B;  1P9D U;  2GCL A;  2GBR A;  1OTR B;  4HK2 A;  2HE7 A;  3MPX A;  1P6S A;  2D9V A;  2H7E A;  2M0X A;  2NS5 A;  3QWZ B;  2C7M B;  4ANU A;  1RAX A;  2DYQ A;  1HBK A;  2FCM A;  2KJH B;  1V5U A;  3GYO A;  2KWV B;  3AUL A;  4IM0 A;  1TTN A;  2ZCC A;  2YT1 A;  4MK0 A;  1XT9 B;  4MY6 A;  4KVG B;  3CMM B;  4K81 A;  2KTF A;  4I6L B;  3C0R B;  5J17 A;  3PLV A;  3A4R A;  4EUT A;  4F8C B;  2K8C A;  1WH3 A;  3PHX B;  3QAQ A;  1UBQ A;  3RCP A;  2VRR B;  5FR6 A;  2NPT A;  2DEN B;  2YS1 A;  2RR9 A;  1P98 A;  2DYB A;  3APF A;  3APC A;  1HE8 A;  2NBU A;  4PQ0 A;  1SHC A;  1KZG A;  3F0W A;  2W2W A;  1P1A A;  1I35 A;  2LRW A;  3U30 A;  3ENE A;  2G45 B;  3TFM A;  1OQN A;  3QHT A;  1TGZ B;  2CS4 A;  2VRW B;  1NTI A;  2MX2 A;  4HAU B;  2CAY A;  2KAN A;  2BYF A;  2KJ6 A;  3H1U A;  1M7E A;  3KYC D;  4F7Z A;  1DDW A;  2D9Z A;  3T8M A;  1HB8 A;  2XK5 B;  2MFQ A;  3S2A A;  2KD0 A;  1L2N A;  1Z87 A;  4NNJ B;  1DYN A;  2IO1 B;  3DBH I;  5JHA A;  4K2O A;  5JHB A;  2COC A;  3AU4 A;  2MWN B;  2GBJ A;  2D9W A;  3ML9 A;  3R7R A;  1KJT A;  4GXB A;  4AUQ C;  4RMA A;  1S3S G;  3U7D A;  2J59 M;  2IY0 B;  4IW0 A;  1U29 A;  1OGW A;  4K1R B;  2KFK B;  4G50 A;  2EKE C;  4KZC A;  3PT2 B;  3L17 A;  2D10 A;  4FJZ A;  4GOC A;  3DXC A;  3M63 B;  1FB8 A;  2Z0D B;  4DHJ D;  1AAR A;  1LQB A;  2DZI A;  3LJU X;  4LDT D;  3M3J A;  1OEY J;  1B55 A;  1KI1 B;  3BIN A;  2I1K A;  1OEY A;  4AOF A;  1UD7 A;  2P0D A;  5E6O A;  2MKR A;  2HTH B;  2CY4 A;  3PPA A;  4ANW A;  2KMA A;  4GZU A;  4YL8 A;  2DHJ A;  2DN6 A;  1Y8R C;  3DBR I;  1H8C A;  4F7H A;  2ROV A;  3RZF A;  2CQU A;  3U8Z A;  1Q1O A;  3LDZ E;  2KWU B;  4B9K A;  3IHP C;  4FLH A;  1WZ0 A;  1GG3 A;  3A8P A;  4IWQ A;  2K8B A;  4DX8 A;  1FHX A;  4PS8 A;  2MDX A;  2JPH A;  3SDL C;  1U5E A;  3ZVV A;  4RM8 A;  3PRE A;  2M1M A;  2EMT A;  4IM2 A;  2RUK B;  5IA7 A;  4ZRI A;  1C3T A;  1H10 A;  2REX A;  2MP2 A;  5HE3 A;  2KJR A;  3ECI A;  2LUE A;  1K8R B;  3ZKJ C;  2PJH A;  2ZVN A;  1JRU A;  2ZNV C;  3A9K A;  4FUL A;  2MBH A;  4HAZ B;  1UPR A;  1XQQ A;  4TQ1 A;  2COD A;  2VSZ A;  1WIA A;  2MLB A;  5LXI B;  3KRW A;  4KV2 A;  1EF1 A;  1LM8 B;  2MRP A;  4EFO A;  3O65 B;  5J3Q A;  5G55 A;  4KSK C;  5GMV A;  2OJR A;  1EO6 A;  1WGH A;  2Y8F A;  2Z59 B;  3TL5 A;  2B3A A;  1KLV A;  2IBI B;  1HB6 A;  4PNK A;  4MJS A;  1NVL A;  4EJN A;  1U5F A;  2L2I A;  2WYQ A;  4EEW A;  3ZUN A;  3UZT A;  5C23 A;  3ODX A;  5J3Y A;  5C5B B;  2C7N B;  2KDI A;  1FHW A;  4LDT B;  2KZR A;  4M8M A;  1NBF C;  2JY6 A;  3LJ3 A;  1ISN A;  2COA A;  4L6E A;  1J0G A;  2W9N A;  2GCJ A;  4ZRK A;  3PVW A;  2CY5 A;  2OQB A;  4H8S A;  1YJ1 A;  3X23 A;  4EZL A;  2BWE S;  2G35 A;  2L1C A;  2KTR A;  1TZ1 A;  3L16 A;  3SYX A;  3CIK A;  5EFX A;  2KN5 A;  2A5U A;  4WJQ A;  1Q67 A;  4IG7 B;  4DWF A;  3HK0 A;  2D11 A;  3UF8 A;  4HAT B;  1SE9 A;  1UEL A;  2C5L C;  2PE9 A;  4NJ6 A;  2DX5 A;  4JGH B;  4JIO U;  3VH3 B;  4TYZ A;  3CXB B;  2IYB A;  2YVC A;  5D3V A;  4CO7 A;  3MHS D;  2O2V A;  2D9Y A;  1RJ2 A;  3EEC A;  5C1Z A;  4NY0 A;  3NOB A;  3FSS A;  1FAO A;  2DLW A;  1TJ6 A;  3D32 A;  5HE0 A;  4IWP A;  2C7H A;  4JLC A;  3TCA A;  2WDT B;  4OVV A;  2L7R A;  1FGZ A;  2KKC A;  2LJ5 A;  4PYU A; 
#chains in the Genus database with same CATH topology
 2NVU I;  4AP4 C;  4ILH A;  2DHZ A;  2MBB B;  1RYJ A;  2C9W B;  2V3S A;  4R3D A;  1N62 A;  1IGD A;  3ZNH B;  1HTO A;  2NR2 A;  2JVC A;  3A4S C;  5FI1 A;  3ZJT A;  1WJU A;  1L4Z B;  1VRA B;  3PEG A;  2KXJ A;  2QJL A;  2I5C A;  1Z5S B;  4LNF A;  5D3I B;  2D07 B;  2R2Q A;  5IOI A;  2RGN B;  4W9G A;  2PIA A;  1SEB D;  3W1S C;  2PE6 B;  1DOY A;  2KT7 A;  3RT3 B;  5L95 C;  1SBB B;  4IFS A;  2K2U A;  4KDL B;  1V61 A;  1TBE A;  2D3G A;  4K7U A;  4J6I A;  3M1I B;  1E10 A;  1IYF A;  1WI0 A;  1GB4 A;  3ZNZ B;  2NTT A;  4JL9 A;  4CHK A;  2KCJ A;  4ZRQ A;  1LW3 A;  2DBY A;  2YRY A;  5EE9 A;  3ODW A;  2YS3 A;  3IAM 1;  1R4N B;  3M95 A;  3BII D;  2WU5 B;  2GBM A;  2W82 A;  3TEY A;  4KHA A;  3KRX A;  1TKE A;  3DXD A;  3NHE B;  1WE6 A;  1JWS D;  2ON8 A;  1DRO A;  2KOX A;  1J7C A;  2H7D A;  1ZC3 B;  3WAL A;  2M17 A;  3ML8 A;  2AYO B;  2LVP A;  4FN2 A;  3EFC A;  3W1S A;  3E9O A;  2ZPY A;  2J7Q B;  3BZD B;  3FC4 A;  1CQV A;  4G3X B;  2V3P A;  5BMH A;  2G4S A;  2RNR B;  3IAS 1;  2M56 B;  1XCG A;  5CTR C;  2P0F A;  1PMS A;  2HD5 B;  2O6V D;  2KC1 A;  2FAZ A;  1WGU A;  5FI0 A;  3WA0 A;  5KHQ A;  1D6E C;  1GAQ B;  3A9J A;  2MHJ A;  4HLE A;  3KZ1 A;  3ULC A;  3I63 C;  3AEG B;  4A20 A;  2Z8L A;  1YJJ A;  3VH4 B;  2V1Y A;  5HHD G;  3IG3 A;  2EMS A;  5J2R A;  2E3T A;  4RGT A;  1EVH A;  3T9L A;  3D8D A;  3NVZ A;  4PK1 A;  4ANX A;  2LGY A;  5L81 A;  2KVR A;  4HJG E;  2KQ4 X;  2GI9 A;  2HJ8 A;  1C79 A;  2ZJD A;  2W2X C;  1FXI A;  1RFK A;  1OQQ A;  1I7A A;  2AEH A;  4M0W A;  5BYQ A;  3BYT B;  1BAK A;  4O1N A;  2LVQ A;  4EKU A;  1ZM0 A;  5LG4 B;  4EZK A;  2XBB C;  1HZ5 A;  4G0N B;  3E9L A;  2Z0Q A;  2WXG A;  2Z13 A;  4A8X C;  3FP5 A;  2JZP A;  1VBH A;  3ZXV A;  4DHZ B;  4KIK B;  1UNP A;  2INC C;  3OAN A;  3WCQ A;  3A1Q B;  5J3T A;  1CJE A;  1OMW A;  2RPV A;  3AM9 A;  1J7A A;  1X1F A;  2EC1 A;  1BXT A;  1L0V B;  1E90 A;  2QIL A;  3VR9 B;  5CHF A;  3NVY A;  4A5K A;  4HXD A;  2FCQ A;  4JKC A;  5JHG A;  3PLU A;  3L0W B;  1XLO A;  3DOW A;  2WX0 A;  5C2T B;  2IYD B;  2RLO A;  2UZR A;  4B0M A;  1ZPS A;  4WIP A;  4TQ0 A;  4IWO A;  5AEK B;  2QHO A;  1E7U A;  1VD2 A;  4ZHO A;  1JWU D;  4G11 A;  4USA A;  3A58 A;  4IKG A;  3AE5 B;  1SIF A;  3QJZ A;  3K9O B;  2NMQ A;  4BOS C;  1UEF A;  4ACF A;  4DX9 0;  4MSQ B;  3PTF C;  3NY5 A;  3NZU A;  5TR5 A;  4YSX B;  4MT7 A;  4GGQ A;  2P8V A;  2CHW A;  4W9K A;  1PLS A;  2Y3A A;  4W9E A;  4WJ7 A;  4A55 A;  3GZN I;  3OHM B;  1PDX A;  4FXC A;  2DYN A;  2ELB A;  2KLC A;  5AZH A;  3WIM A;  3NW8 A;  2ZZP B;  2UVM A;  2N7D A;  1D5Z C;  2WXH A;  2N0S B;  3KH0 A;  3P4R B;  4B95 A;  1S1Q B;  3TEX A;  2N7J A;  4AS1 A;  5DCN A;  3ZRF A;  5HKH A;  1TY2 A;  2Q13 A;  3IBE A;  3SHQ A;  1C77 A;  2O6V B;  2R0D A;  5DHF B;  5DHA B;  2WXQ A;  3UQA A;  2PEA A;  2IND C;  3VOQ A;  2KX3 A;  4IOI E;  3AE9 B;  1WX7 A;  1FPY A;  4NAW A;  1IGC A;  1WMH A;  3JYU A;  1UUP A;  2BBC A;  5BYS A;  1I4G A;  1T0Q C;  1QC6 A;  4EMO A;  4E74 A;  3DVN V;  1C78 A;  1WGY A;  2YLM A;  2RSU A;  2FUH B;  2K1F A;  4FJV B;  5D3Y A;  5D3D A;  5JZE B;  1C9F A;  3H8H A;  2WWZ A;  4WAF A;  2K8E A;  1V1P A;  1NYQ A;  1CZP A;  1E5W A;  3OJ4 B;  3H7P A;  1ACC A;  4C7Y A;  1UNS A;  2CHZ A;  3ZNG C;  1U2B A;  2Z0E B;  2ZW1 A;  4MEL A;  4Z2M B;  1ET6 A;  5KQ1 A;  4D0N B;  2IFS A;  3H6N A;  3R2T A;  1TS5 A;  1W1D A;  2UYZ B;  5AZG A;  2XQN M;  1MI1 A;  3AV8 A;  4F7U P;  4ZDV A;  4HAX B;  2L00 B;  1WGD A;  1XLQ A;  1V49 A;  4EOY A;  3AMZ A;  1PGX A;  4TMA B;  1UZX B;  2D3C A;  1TKY A;  2BB5 A;  1DOX A;  1PQS A;  1WJN A;  4BKS A;  2INN E;  1T5X D;  3VDZ A;  4GDL A;  4W9H A;  2WDQ B;  4HRS A;  3Q69 A;  2MH7 A;  4NJ7 A;  4BKG A;  3QC8 B;  4K3B A;  3TEZ A;  1WXV A;  3AJ4 A;  4HCP B;  3UGB B;  4LNK A;  3VAW A;  3WYF B;  5JVL A;  5C79 A;  3U52 E;  3KQ4 A;  2KX0 A;  1JML A;  1U4A A;  3N20 C;  4OZC A;  5G5G A;  1DDV A;  4RF1 A;  2CB8 A;  3HM3 A;  3KY9 A;  2AQ3 B;  1RLF A;  3N32 A;  2Y5P A;  1VLB A;  5IN7 A;  2IGH A;  3PVU A;  4HAY B;  2NPT B;  3AU5 A;  5AUK A;  5D2M B;  1N60 A;  3PVL A;  1C4A A;  1UBI A;  3PSC A;  4JKF A;  2DHK A;  3PP2 A;  2DKQ A;  5DH9 B;  1BUI C;  5L83 A;  5LLI A;  2Y5B B;  4LNI A;  2KWD A;  3NWA A;  1YX6 B;  5FK9 C;  4NAM A;  2L76 A;  3WAO A;  2DWQ A;  1CK1 A;  3Q3O C;  4GMV A;  4GNK B;  1RM6 C;  2WGS A;  3V61 A;  1X86 A;  4OHJ A;  3EGR A;  2LFI A;  4WJP A;  4URK A;  1W1G A;  1QT9 A;  2CU3 A;  1K53 A;  1WGR A;  1V97 A;  2WXM A;  2K00 A;  5EE0 A;  2ABD A;  3ZO5 B;  3IFW B;  1H4R A;  1MJD A;  3HM6 X;  2WXO A;  4MM3 A;  3RUL A;  3GZN B;  4XYC A;  4LLG M;  5G2N A;  3BJI A;  4HPP A;  3HVD A;  1P3Q U;  3VXW A;  5D27 A;  3SV1 A;  1GGO A;  1K5G B;  2A4Z A;  2LZ6 A;  5LOP B;  5CX3 A;  4N58 A;  3JSV A;  3FM8 C;  3ZIM A;  2IPK D;  4S17 A;  4YT0 B;  3NJT A;  3CIR B;  1XOD A;  2NTS A;  4GDK A;  2BGF A;  2WXI A;  3GE8 C;  3EHV A;  5CHW A;  1P0R A;  2QDF A;  1ZDX A;  4B6H A;  1WM3 A;  1P7E A;  5BO4 B;  1LXD A;  2J0M A;  2ROZ B;  3R66 C;  2X0S A;  1ENF A;  2BVC A;  1BTK A;  4CSQ A;  2JQR B;  4A6F A;  3OJ3 A;  1QOB A;  3RMK C;  3GE3 C;  2FDQ A;  1XEE A;  2PTL A;  2DNF A;  1WGG A;  3DVN U;  2MA9 B;  1V8C A;  1ZDV A;  4ANV A;  3AED B;  1VBG A;  5EDS A;  2N7E A;  2M14 A;  1X1G A;  4W9L A;  2FCS A;  1X11 A;  1V89 A;  2CRF A;  2L0F A;  4KDI C;  3Q8A A;  4OVU A;  5E6J A;  1KOT A;  4TSS A;  1V5P A;  3K9P B;  2DZM A;  2LAS A;  2IGG A;  4GU2 A;  1EUV B;  3AB5 A;  2COF A;  4WWP A;  4MGK E;  4E71 A;  1WX9 A;  2JSV X;  1SE4 A;  4HB2 B;  3DVG Y;  4OZB A;  5DPT A;  3DBH B;  3NVV A;  3BK1 A;  4XC2 A;  1QQR A;  1LB1 A;  1Y5O A;  4C7Z A;  4XWW A;  5G5H A;  4I6P A;  3B08 A;  3OLM D;  4RCO A;  4GSW A;  3ZDM C;  1WSP A;  2AL3 A;  4YTP B;  1N6Z A;  3NWF A;  2MBE A;  4JK9 A;  5GXG B;  2E2X A;  4HDO A;  2QKM A;  1I2H A;  2ICI A;  1IUE A;  1TZO A;  3WAP A;  1XR0 B;  4JQW C;  5E6N A;  2GUM A;  2MBO A;  3B2F A;  3CSF A;  1UPQ A;  1C1Y B;  1PGA A;  3DVG X;  1TQZ A;  4BBK A;  2L0T A;  3DCX A;  3U4E G;  3TMP B;  3AE2 B;  5T8I A;  2PVO D;  3VR8 B;  3ULB A;  3RNB C;  3MJ5 A;  1WXM A;  3E56 A;  2V76 A;  4NZL B;  1WXA A;  1VCB A;  2LJI A;  1IRS A;  1SE2 A;  1IP9 A;  1ZYI A;  3Q8E A;  4NPN A;  1AWE A;  4JWU C;  2K25 A;  1M7R A;  1I7H A;  2VKI A;  3NUH B;  3VUW A;  2EKI A;  2AWT A;  1UNQ A;  3Q2A C;  4HKQ A;  3DBS A;  3B0A A;  2ZVO A;  1ZKH A;  1GUA B;  1YN3 A;  1TT5 B;  2MP2 B;  3KUZ A;  4XE0 A;  1B1Z A;  1V80 A;  5BYR A;  1QF6 A;  4N59 A;  2WXP A;  4A3P A;  2COP A;  3DQV A;  1BT0 A;  2KVZ A;  4RGM A;  4HHV A;  2GMI C;  1E8X A;  3A9K B;  1V86 A;  3V3X A;  1FMA D;  2V4L A;  2NBV A;  1N5X A;  2M4N A;  5IRS A;  1DBH A;  2X18 A;  1PYW D;  4KAX B;  2KNB A;  1NDD A;  2W3S A;  3MP9 A;  1EF5 A;  3QBV B;  1TS4 A;  2CJN A;  4OVZ A;  4A6F B;  1NVI D;  1EU3 A;  3FKY A;  1Q0W B;  2TSS A;  2RRF A;  2D3B A;  3UQB A;  1KM7 A;  5BMG A;  3JW0 X;  5HG2 A;  1A5R A;  4I6N B;  2FJL A;  2BW2 A;  4MJS B;  3DDC B;  2IJ0 A;  2N4F A;  4FBJ B;  2C60 A;  2D3A A;  1C4P A;  3AI5 A;  5E6P A;  3P4Q B;  2D9X A;  1YOV B;  2N9P C;  3AEA B;  3AE1 B;  3DHH C;  2DKP A;  2LUM A;  2DIK A;  4KHB A;  2JYT A;  2JZZ A;  2K6D B;  1ZVR A;  3KUD B;  1NI2 A;  2DZK A;  3OWE B;  1GC6 A;  3C19 A;  3PRM B;  1T77 A;  1MPE A;  2JWU A;  1V88 A;  2EJ8 A;  5LXH A;  2N23 A;  2BYV E;  2MJE A;  2GLS A;  2DAF A;  5AZF A;  4K17 A;  3L4P A;  2LGX A;  3VTU A;  4J3O D;  2FID A;  3MDB C;  4HVB A;  3AE6 B;  2LG1 A;  3HQC A;  1YQ3 B;  4LK0 M;  1XD3 B;  1FFV A;  1WZ3 A;  4YXD B;  2KWC A;  1QOA A;  4US9 A;  1K51 A;  1FFU A;  4ZYS A;  2LOZ A;  2HRJ A;  2KTR B;  1JWA D;  4W9J A;  1L0Y B;  2KDF B;  2BYE A;  2RMM A;  1B9R A;  4HPL B;  1DDM A;  2FE8 A;  1PUT A;  3P7Z A;  1MVK A;  3PZ7 A;  1FHO A;  4HB4 B;  2QCZ A;  3V5W A;  3FEH A;  2M19 A;  3NS1 A;  1WWT A;  3EC8 A;  3NZS A;  3TEW A;  1BWN A;  1KC7 A;  1WYW B;  2MWS B;  2IGD A;  1K5D B;  2IO0 B;  3RUI B;  4F7G A;  1LGR A;  1D3Z A;  4JK7 A;  2DX5 B;  1RFA A;  3TO1 A;  3I5J C;  2L05 A;  1I4P A;  3KVF B;  2H88 B;  4KKJ A;  2BB6 A;  2KFJ A;  3FVC A;  2CU1 A;  1OQY A;  1V9J A;  4YSY B;  1JDE A;  1GB1 A;  2O2V B;  3TVV A;  5D3W A;  1TKG A;  4WAA A;  2Y5C A;  3V05 A;  3PV1 A;  4ILG B;  1QQG A;  1XKE A;  2KQS A;  3PS6 A;  1R7S A;  4WJO A;  2Z0O A;  3LB8 C;  1KLG D;  2QIE B;  1IBX A;  4MT5 A;  2N9K A;  3QA8 A;  4HAW B;  1Y19 B;  1E0Z A;  1WJ1 A;  1WGQ A;  3VVW B;  1CMX B;  4LJO B;  4XDD A;  2CHX A;  5DPS A;  4BKT A;  4II2 B;  2MBQ A;  5CHV C;  1X05 A;  4ZYN A;  5KCV A;  1W1H A;  4N9F 4;  2I38 A;  2PLP A;  3TJP A;  1MAI A;  3CWI A;  3ML4 A;  4AJW A;  3IXS A;  1MHH E;  4DK5 A;  2KHW B;  3OAW A;  3IT6 B;  2ACZ B;  1NTV A;  1WXS A;  1V5M A;  4ARC A;  3RZW C;  2MCN B;  2YT2 A;  1N3H A;  3UIO B;  1YNT E;  2Z14 A;  1GJZ A;  3U12 A;  1ZXI A;  2KIG A;  3WAM A;  2XK5 A;  1JRP A;  3MTN B;  1NEK B;  2FCN A;  2LHE A;  1WF9 A;  2N0Y A;  5MPO A;  2KN4 A;  2W2X D;  2KC2 A;  4WWN A;  4ICV A;  2RDB C;  1T0S C;  1SJE D;  2XN9 C;  4P1B C;  4ICU A;  2LRU A;  3DCG A;  3VTW A;  2UZS A;  1ST7 A;  3MC8 A;  5JXV A;  1EAZ A;  3DXE A;  1V5O A;  3B1L X;  5JP4 A;  2FNJ B;  4DQO C;  3ZVR A;  2BT6 A;  3SD5 A;  5HE1 A;  3RFZ B;  3DBL I;  3PSE B;  4C56 C;  1SE3 A;  4W9D A;  1XX0 A;  4PYZ A;  4AQ7 A;  1MK7 B;  1PGB A;  2KFK A;  1ZP0 B;  4TKN A;  3BVG A;  4JKH A;  2DHI A;  4RM9 A;  1E8W A;  2I5F A;  1T6B X;  5JLJ B;  2L83 A;  4F1S A;  2N1W A;  3NS8 A;  2W3R A;  1OQR A;  3P2B A;  4MEM A;  2NCN A;  2BWF A;  2D2Q A;  1NTY A;  2G4D B;  4PT5 A;  1ZUD 2;  3G9W A;  3D8F A;  1VZ8 A;  3UIP B;  5DPR A;  4YTN B;  2Y7B A;  3LXF A;  3MC0 B;  3P1M A;  2JRH A;  4HWI B;  3H7S A;  2KQ7 A;  3SUZ A;  3AEC B;  4KZ0 A;  2KLG A;  1RRP B;  2BPS A;  2DFK A;  1LFD A;  2HTH A;  3A9J B;  3W5V B;  1WM2 A;  4YTM B;  5KQ4 A;  1D5M C;  1GNU A;  1WR6 E;  3ZQ4 A;  3T06 A;  4ZRJ A;  2ELA A;  4LJP B;  2JRI B;  2JXT A;  2BS2 B;  2WXL A;  3GOE A;  3FIL A;  4M8N A;  1E7P B;  3RD2 A;  1NI3 A;  3VFK A;  2KYW A;  4JX1 C;  2XNA C;  3Q14 C;  4FHJ A;  1WI1 A;  1MIX A;  2IY1 B;  1VJK A;  1GOZ A;  1JW9 D;  1J0W A;  3PG7 A;  3ZW3 A;  4D6W A;  2Z4D A;  5I2M A;  2NBW B;  4GMX B;  3ZXR A;  4E3C A;  3J9C A;  1OY2 A;  1FRD A;  2L8J A;  4M0W B;  2RSG A;  1X1M A;  2LVO A;  1AYF A;  4JKG A;  1E9M A;  1ROE A;  1J8C A;  4KHO A;  2MW5 A;  5CLL B;  3L13 A;  3L08 A;  3Q3N C;  4X57 B;  5KHO A;  3CF6 E;  3SU8 X;  2LUL A;  2K39 A;  5IO9 A;  3P6A A;  2DA0 A;  1IPG A;  2GS0 A;  3VIA A;  2LD9 A;  2JF5 A;  5D7G A;  4C4V A;  4JWS C;  2KO3 A;  3AE7 B;  3V6C B;  4WWO A;  4BKS D;  3I3T B;  3ZLZ A;  2YS5 A;  1FIQ A;  4UDU C;  3MJW A;  3URY A;  4Q2J A;  4OT1 A;  1TJE A;  1ESF A;  4LNN A;  4GOU A;  1MIZ B;  3O96 A;  2YEP B;  3AE8 B;  3NVW A;  4XGA B;  5JH5 C;  2K3U A;  2KAC A;  3RNG C;  5CLQ B;  3U7Z A;  3GYP A;  5D3X A;  4P16 A;  3PHW B;  4DBB A;  3HRD D;  1C4C A;  1KZ7 A;  3VRA B;  2Z59 A;  4HJK A;  4QXA B;  4WSF A;  5D94 A;  2MJD A;  5H92 C;  2RD0 A;  1ET9 A;  1WX8 A;  4KSL C;  4RNA A;  3VRB B;  3ZJU A;  1D4B A;  3RNF C;  2D4Q A;  1F2R C;  5JHH A;  3QWM A;  1L6V A;  1ZE3 D;  4REZ A;  4BBN C;  2BKR B;  2Y8G A;  1F2R I;  1HEZ E;  3RNA C;  3SO6 A;  2ADZ A;  5C5B A;  4WUR A;  1NYR A;  1OFF A;  4WH4 A;  1EM7 A;  2G9H D;  4DDG D;  2RQ1 A;  2GJY A;  4BFR A;  3R7Q A;  1UF0 A;  3VUY A;  1BTN A;  3VUX A;  1N61 A;  3NSU A;  2GBK A;  2DTC A;  1YN4 A;  1E8Z A;  1WJ4 A;  3JVZ X;  3C8Y A;  4GLS C;  1WJM A;  5HE2 A;  1MFW A;  2IO3 B;  3R3M A;  3PZD A;  4GN1 A;  4C00 A;  1BML C;  2K9X A;  2OED A;  3CST A;  4DXA B;  4OW0 A;  3F5R A;  5DI9 B;  1QLB B;  3T3O A;  4NAW B;  4A6K A;  3SEB A;  3U2S C;  1WMH B;  1V6E A;  1TS2 A;  1JRO A;  2AQ2 B;  2M0A A;  4KX6 B;  5IAA C;  4MGY E;  1FNV A;  1T0Y A;  3D8E A;  2W55 A;  2X8X X;  1I42 A;  4HCN B;  2WHI A;  3B77 A;  4A3O A;  1L5P A;  3V6E B;  4BAX A;  1V1P B;  4EZJ A;  2WH5 A;  3ODO A;  2RDG A;  2OTX A;  1FOE A;  4LNO A;  2Q5W D;  3AXC A;  3H7P B;  3KSY A;  2J0K A;  4S0R A;  2N9E B;  2LKO A;  1NU2 A;  2LHD A;  4HB0 B;  1FEH A;  3FAH A;  2ASQ A;  4H2A A;  1XCQ L;  1U5D A;  1ZGU B;  3ONS A;  3IVF A;  1ZSQ A;  3HHM A;  5D6J B;  1YQB A;  2KDM A;  1F77 A;  2LXA A;  3TW1 A;  3W9C B;  2FBW B;  2LOX A;  1E8Y A;  1J19 A;  5AUI A;  2KDB A;  2WLB A;  4FA6 A;  3X0W A;  2IZV B;  4Y94 A;  4DDI D;  3PRP B;  3PGE A;  3ZYY X;  1WY8 A;  3H9D A;  4GDL B;  2FJ9 A;  1WYG A;  3ZRC A;  3QCA A;  4YON A;  1PFJ A;  1G6J A;  2K2J A;  2OOB B;  4GIV A;  1V1O A;  5I2S A;  4ZHP A;  1KRH A;  4CYE A;  4CHM A;  1MG8 A;  3EFU A;  2MEK A;  1L6U A;  4XX5 A;  2LXC A;  3VQI A;  2V0G A;  1QOF A;  2KUP A;  3ZDT A;  2PVG C;  4LCD E;  2V9H A;  3UI3 A;  2UWQ A;  3IT4 B;  2MQJ A;  1V81 A;  3NRZ A;  1QZE A;  3EPY A;  2K0P A;  3APD A;  2L3Z A;  2DZJ A;  4JPS A;  3V60 A;  4WJN A;  2YT0 A;  1DGJ A;  2WDR B;  1VDV A;  3Q8F A;  1R4N I;  1E7V A;  2I2Y A;  1M94 A;  2LBB A;  4PS7 A;  1EWC A;  1AQC A;  4M01 A;  4L23 A;  4TUU A;  2WX1 A;  4K2P A;  4TV3 A;  2QMT A;  4MSM B;  2RPQ A;  3E66 A;  2JXX A;  2WXK A;  4DHJ B;  2PPH A;  3W1Y A;  5LNK 1;  2QSD A;  1MK9 B;  2FIF A;  2ZPN A;  1V2Y A;  4P1C C;  3TSS A;  3I9V 1;  3AEB B;  2ZKM X;  4HKZ E;  2PMV A;  3QIJ A;  3V62 A;  2WXR A;  2DLB A;  3QAR A;  2CKH B;  1FGY A;  1JWB D;  5M4Y B;  1WFY A;  1FO4 A;  2B76 B;  4NJC A;  4IOY X;  3HIZ A;  3N7C A;  1WRD B;  3Q3F A;  4RFB A;  2KAJ A;  3MFG A;  2LYD A;  1YIW A;  3QK0 A;  4LTU A;  2L1A A;  3HUI A;  4DBG A;  4FAD A;  4QJ4 B;  1FCL A;  3FLV A;  4MM3 B;  2DAJ A;  4BVU C;  2GOW A;  3KUC B;  2JX5 A;  4CHJ A;  1P3R A;  2Z0P A;  5C16 A;  2BQQ A;  1YJI A;  1UNR A;  1R4M I;  3Q6B A;  1KH0 A;  3JSV B;  4IC7 B;  1FNU A;  4BOZ B;  2MSE D;  2LGD A;  1SF0 A;  2KMC A;  4HDQ A;  4GDK B;  1P5T A;  2G3Q B;  2LI5 A;  4WVF B;  4FHK A;  4IUM B;  4P6V F;  1MKE A;  2KR0 A;  1XF5 L;  2RGF A;  3GP7 A;  2M8S A;  2JWZ A;  1Q10 A;  1GC7 A;  3R8B A;  3MHZ A;  1Q5W B;  1V5T A;  4HAV B;  2KGX B;  2K6Q A;  4B6W A;  3LYY A;  2KIE A;  4QJ5 B;  1YQ4 B;  4XZ4 A;  1UH6 A;  2PZ1 A;  3T3N A;  3MC9 A;  4NSW A;  2SAK A;  1RWS A;  2HJ1 A;  1TXD A;  5DIF B;  2AL6 A;  4JKA A;  2J53 A;  2ZCB A;  4BBN F;  5DPW A;  3DWM A;  3L10 B;  1ACA A;  5C6R A;  1JAL A;  2E6X A;  2N9X A;  4MGZ E;  2BCJ A;  4MAC A;  4IM3 A;  2DYM A;  4KGS A;  2BF8 B;  3A98 B;  1T0R C;  2ZNV B;  2N1V A;  2YF0 A;  4D2K A;  4GB9 A;  1MG4 A;  2JT4 B;  1XD4 A;  2DYO A;  4A6Q A;  4WQO B;  1ZW7 A;  2GB1 A;  2GBN A;  3ZNI D;  2PW9 A;  1F9J A;  3QX1 A;  4MGI E;  3KW5 B;  3NZ3 A;  3A8Q A;  2LWP A;  3M62 B;  3QQ8 B;  2CR5 A;  1JQ4 A;  4K7W A;  4W9C A;  4GPT B;  3O13 A;  2JZ3 B;  4KIK A;  3VHT C;  2JYE A;  4AJY B;  1MI0 A;  1WJ6 A;  2XEW A;  3A1Q A;  1HTQ A;  3N30 A;  4RH6 A;  4ASW C;  3EA6 A;  4FJY A;  2LEK A;  1WR1 A;  3TBL D;  5GOW B;  1L7Y A;  2K8H A;  5IJM A;  3BVM A;  1SGH A;  4HB3 B;  4ZOH C;  2JP2 A;  2P0H A;  1MHX A;  4ITK A;  3BY4 B;  3ZJV A;  2AQ1 B;  1WE7 A;  2LGS A;  2BKF A;  4W9F A;  2R2O A;  4L2Y A;  4Z2N A;  2QKL A;  5I4D A;  1YD8 U;  1ZC4 B;  3AEF B;  5LON B;  1TY0 A;  2JUO A;  1KLU D;  3KLS X;  1WXQ A;  2RVB B;  4HPM B;  3P42 A;  3RYT A;  3BK2 A;  3N9Y C;  3BVZ A;  2NMB A;  3W5U B;  3RPF C;  2M38 A;  4PS3 A;  3ZTD A;  3N1X C;  2YSZ A;  1XLP A;  3E9P A;  2G1E A;  4DXF A;  3SBG A;  1TYG B;  2IDY A;  2WXN A;  4C0A A;  5HFY A;  1A70 A;  1DOI A;  2IO2 B;  3SNH A;  4B0E A;  1WVH A;  2AX5 A;  1EGX A;  3UIN B;  3A33 B;  3RI7 C;  2ZEQ A;  4W9I A;  1K50 A;  2NBV B;  3L54 A;  3ALB A;  1WGK A;  3WAN A;  4II3 B;  3ZTC A;  1SSN A;  3PRZ A;  5FKA C;  1DYQ A;  2LMC A;  3TIX A;  3DPD A;  2O6V A;  1MPH A;  1WG7 A;  4IDI A;  4MH0 E;  2QC8 A;  3RNC C;  2R09 A;  4IAP A;  1Z2M A;  3N3K B;  4OZA A;  4K7S A;  2KK8 A;  1XXG A;  4US8 A;  2WNM A;  1YN5 A;  3RCZ A;  1R4M B;  4NQL B;  4XWX A;  4MDK E;  4WWM A;  3Q3J A;  2H89 B;  2HDE A;  2J0J A;  4AWJ A;  4KKI A;  3BYY B;  5J18 A;  1U5G A;  2I1J A;  1UGM A;  1HQR D;  1QOG A;  3B9J A;  3NWD A;  1U27 A;  1KF6 B;  1FXT B;  4KHB B;  4P7I A;  1YMH E;  4NQK E;  2DX1 A;  4QAY A;  5C3J B;  1UWX A;  1JWM D;  2KDE B;  1KBL A;  2NZ8 B;  4DIX A;  4A6H A;  3VTV A;  4HEA 1;  1RRB A;  3KYD D;  1YX5 B;  4DHZ E;  3HW2 B;  3I57 A;  1P9D U;  2GCL A;  2GBR A;  1OTR B;  4WQM A;  4HK2 A;  2HE7 A;  3MPX A;  1P6S A;  2D9V A;  2H7E A;  2M0X A;  2NS5 A;  3QWZ B;  2C7M B;  4ANU A;  1RAX A;  1XCT L;  3R2I A;  2DYQ A;  1HBK A;  2FCM A;  2KJH B;  1V5U A;  3GYO A;  1GPX A;  2KWV B;  3AUL A;  4IM0 A;  1TTN A;  1F52 A;  2ZCC A;  2YT1 A;  1P7F A;  4MK0 A;  1FXA A;  4RGO S;  1XT9 B;  4MY6 A;  1I4R A;  2BS4 B;  4KVG B;  4YWG G;  1L0X B;  3CMM B;  2OHF A;  5BMI A;  4K81 A;  2KTF A;  4I6L B;  3C0R B;  4HRO A;  5J17 A;  3PLV A;  3A4R A;  3PO0 A;  4EUT A;  4F8C B;  1QIL A;  2K8C A;  3ETR A;  1WH3 A;  3PHX B;  3QAQ A;  2W54 A;  1UBQ A;  3RCP A;  2X38 A;  2VRR B;  5FR6 A;  4KGT A;  1FNW A;  4KGR A;  1Y56 A;  2NPT A;  3SFE B;  2BYT A;  5TSS A;  1ZXH A;  2DEN B;  2YS1 A;  2RR9 A;  1P98 A;  1HZ6 A;  2DYB A;  3APF A;  3APC A;  1HE8 A;  2NBU A;  4PQ0 A;  2VZK D;  1SHC A;  2WXF A;  1KZG A;  3OG5 A;  1IBX B;  3F0W A;  4ARI A;  1C76 A;  2W2W A;  2L52 A;  1UWM A;  2GRI A;  1EWY C;  1P1A A;  4A90 A;  1I35 A;  2LRW A;  3U30 A;  4N6E B;  3ENE A;  3DHI C;  1E6E B;  2G45 B;  3TFM A;  1OQN A;  3QHT A;  2R61 A;  1TGZ B;  2CS4 A;  2VRW B;  1TS3 A;  1I4H A;  1NTI A;  4ZRP A;  2MX2 A;  1L4D B;  1VZ6 A;  4HAU B;  3B2G A;  2CAY A;  2J4X A;  2KAN A;  2BYF A;  2KJ6 A;  2FUG 1;  3H1U A;  3HSA A;  1M7E A;  4MH8 A;  3KYC D;  4F7Z A;  2QEJ C;  1DDW A;  2D9Z A;  3T8M A;  1HB8 A;  2XK5 B;  2MFQ A;  5EE3 A;  2LGI A;  3P4P B;  3S2A A;  2KD0 A;  1L2N A;  1Z87 A;  3ZGZ A;  4NNJ B;  2D5G A;  3SR6 A;  1F1H A;  1DYN A;  2IO1 B;  3DBH I;  1QKZ A;  5JHA A;  4K2O A;  5JHB A;  2COC A;  2WXJ A;  3AU4 A;  2MWN B;  2GBJ A;  3HVZ A;  2D9W A;  3ML9 A;  3R7R A;  1LO5 D;  4QJ3 B;  1KJT A;  4GXB A;  4AUQ C;  2BS3 B;  1J7B A;  4RMA A;  2INP E;  1S3S G;  3U7D A;  2J59 M;  2IY0 B;  4M00 A;  3P63 A;  4EE2 A;  4IW0 A;  1U29 A;  1OGW A;  4K1R B;  2KFK B;  1AW7 A;  2EKE C;  4G50 A;  4KZC A;  2KMM A;  3PT2 B;  1JCK B;  1N63 A;  3L17 A;  3RNE C;  2D10 A;  4JKB A;  2ONQ A;  4FJZ A;  3DXC A;  3M63 B;  1FB8 A;  4GOC A;  2Z0D B;  4DHJ D;  1AAR A;  1LQB A;  2DZI A;  3LJU X;  4LDT D;  3M3J A;  3N1Z C;  2WU2 B;  1OEY J;  4M02 A;  2PKO A;  1B55 A;  1KI1 B;  3BIN A;  2I1K A;  1OEY A;  4AOF A;  1UD7 A;  1UGJ A;  4ILJ A;  2P0D A;  1PFD A;  2MKR A;  5E6O A;  2KUQ A;  3AN1 A;  2HTH B;  2CY4 A;  3PPA A;  4ANW A;  2KMA A;  3NG0 A;  4GZU A;  4YL8 A;  3KWV A;  2DHJ A;  2DN6 A;  1Y8R C;  2WDV B;  3AE4 B;  3DBL B;  2K5P A;  3DBR I;  1VZ7 A;  2R82 A;  1H8C A;  4F7H A;  2ROV A;  3RZF A;  3FIL B;  2CQU A;  3U8Z A;  2CJO A;  2WQY B;  1Q1O A;  3LDZ E;  2KWU B;  4B9K A;  3IHP C;  2VZK B;  1D5X C;  2YEP F;  4FLH A;  2N9L A;  1WZ0 A;  1GG3 A;  3A8P A;  3Q8B A;  3AEE B;  3Q8C A;  2J52 A;  4IWQ A;  2K8B A;  4JE3 B;  5H8Y E;  4DX8 A;  1FHX A;  3HIE A;  1N5W A;  2L32 A;  4PS8 A;  2MDX A;  2V3N A;  2JPH A;  3SDL C;  2RDH A;  1U5E A;  4L1R A;  3ZVV A;  4RM8 A;  3GB1 A;  3PRE A;  2M1M A;  2EMT A;  4IM2 A;  3TUO A;  5IP4 D;  4JKG B;  2RUK B;  5IA7 A;  3EUB 2;  4ZRI A;  3N1Y C;  1C3T A;  1H10 A;  1I4X A;  2REX A;  3AE3 B;  3BWU D;  4K3C A;  2MP2 A;  5HE3 A;  2KJR A;  1F0Z A;  3ECI A;  2LUE A;  1T3Q A;  4RF0 A;  1K8R B;  3ZKJ C;  2PJH A;  2ZVN A;  1JRU A;  4C4V B;  2BTE A;  2V4I B;  2ZNV C;  3A9K A;  4FUL A;  2MBH A;  4HAZ B;  1UPR A;  1XQQ A;  4TQ1 A;  2COD A;  1M4V A;  2VSZ A;  1XO3 A;  1DIK A;  3ENB A;  1STE A;  1WIA A;  2MLB A;  5LXI B;  3KRW A;  4KV2 A;  1EF1 A;  5FR3 A;  1FCC C;  1LM8 B;  2WP9 B;  2MRP A;  4EFO A;  3O65 B;  1AWD A;  3GS2 A;  3RN9 C;  4CQN A;  5J3Q A;  1VR9 A;  5G55 A;  4KSK C;  5GMV A;  1XLN A;  2OJR A;  1EO6 A;  1WGH A;  2Y8F A;  2FJU B;  2Z59 B;  2SEB D;  4JK8 A;  3TL5 A;  2B3A A;  3DHG C;  1KLV A;  2IBI B;  1HB6 A;  1HA5 A;  4PNK A;  4MJS A;  1NVL A;  4EJN A;  4C80 A;  1U5F A;  2L2I A;  2WYQ A;  4EEW A;  3ZUN A;  1SIJ A;  3UZT A;  1KFY B;  3P4S B;  5C23 A;  3ODX A;  5J3Y A;  5C5B B;  2VH2 A;  1ZOY B;  2C7N B;  2EEL A;  4RGN A;  4BZA A;  1I4Q A;  4A9A A;  2HTM E;  2KDI A;  4HSI A;  1FHW A;  4LDT B;  2J42 A;  4OSN A;  1HXY D;  1KTK A;  2KZR A;  4M8M A;  3E9S A;  1NBF C;  2JY6 A;  2R2Y A;  3LJ3 A;  4JKD A;  1TIF A;  1ISN A;  2COA A;  1AN8 A;  4L6E A;  1J0G A;  2W9N A;  2GCJ A;  4ZRK A;  3ABV B;  3PVW A;  2CY5 A;  1WRI A;  4JKE A;  2OQB A;  4XWT A;  4H8S A;  1YJ1 A;  3X23 A;  4EZL A;  3W2D A;  2BWE S;  2G35 A;  4L1B A;  3Q3M C;  2L1C A;  2KTR A;  5IKC M;  3KWL A;  4YSZ B;  2K49 A;  1SJH D;  1TZ1 A;  3L16 A;  3SYX A;  1NEN B;  3CIK A;  2MJ3 A;  3SBT A;  5EFX A;  2KN5 A;  2A5U A;  4WJQ A;  1Q67 A;  4IG7 B;  4DWF A;  3HK0 A;  2D11 A;  3SFD B;  3UF8 A;  1SXT A;  3AH7 A;  4HAT B;  2VH1 A;  1SE9 A;  1UEL A;  2C5L C;  1EU4 A;  3PZ8 A;  2ZW0 A;  1FRR A;  3DBR B;  2PE9 A;  4NJ6 A;  2DX5 A;  4JGH B;  4JIO U;  4DXG A;  1FD6 A;  3VH3 B;  4TYZ A;  3CXB B;  2IYB A;  2OJW A;  2YVC A;  5D3V A;  2WS3 B;  4CO7 A;  3MHS D;  2O2V A;  2D9Y A;  1RJ2 A;  3EEC A;  5C1Z A;  2JU6 X;  1K52 A;  4XDC A;  5EE1 A;  4NY0 A;  1SB3 C;  3NOB A;  3FSS A;  1FAO A;  2DLW A;  1TJ6 A;  3D32 A;  2K22 A;  5HE0 A;  4IWP A;  5HI1 A;  2C7H A;  4JLC A;  3TCA A;  2WDT B;  3DWG C;  2UU7 A;  4OVV A;  2L7R A;  1FGZ A;  2KKC A;  2LJ5 A;  4PYU A;  1FM0 D; 
#chains in the Genus database with same CATH homology
 2NVU I;  4AP4 C;  4ILH A;  2DHZ A;  2MBB B;  2C9W B;  2V3S A;  3ZNH B;  2NR2 A;  2JVC A;  3A4S C;  5FI1 A;  1WJU A;  3PEG A;  2KXJ A;  2I5C A;  1Z5S B;  2D07 B;  2R2Q A;  2RGN B;  4W9G A;  3W1S C;  2PE6 B;  3RT3 B;  5L95 C;  4IFS A;  2K2U A;  4KDL B;  1V61 A;  1TBE A;  2D3G A;  4K7U A;  4J6I A;  3M1I B;  1IYF A;  1WI0 A;  3ZNZ B;  4JL9 A;  4CHK A;  2KCJ A;  1LW3 A;  2YRY A;  3ODW A;  2YS3 A;  3M95 A;  2GBM A;  4KHA A;  3KRX A;  3DXD A;  3NHE B;  1WE6 A;  1DRO A;  2KOX A;  2H7D A;  1ZC3 B;  3WAL A;  2M17 A;  3ML8 A;  2AYO B;  2LVP A;  4FN2 A;  3W1S A;  3E9O A;  2ZPY A;  2J7Q B;  4G3X B;  2G4S A;  2RNR B;  1XCG A;  5CTR C;  2P0F A;  1PMS A;  2HD5 B;  2O6V D;  2KC1 A;  2FAZ A;  1WGU A;  5FI0 A;  3WA0 A;  5KHQ A;  3A9J A;  4HLE A;  3KZ1 A;  3ULC A;  4A20 A;  3VH4 B;  2V1Y A;  3IG3 A;  2EMS A;  5J2R A;  1EVH A;  3T9L A;  3D8D A;  4ANX A;  2LGY A;  5L81 A;  2KVR A;  2HJ8 A;  2ZJD A;  2W2X C;  1I7A A;  2AEH A;  1BAK A;  2LVQ A;  4EKU A;  1ZM0 A;  4EZK A;  2XBB C;  4G0N B;  3E9L A;  2Z0Q A;  3FP5 A;  1VBH A;  4DHZ B;  4KIK B;  1UNP A;  3OAN A;  3A1Q B;  5J3T A;  1OMW A;  1X1F A;  2EC1 A;  1E90 A;  5CHF A;  4A5K A;  4HXD A;  2FCQ A;  4JKC A;  5JHG A;  3PLU A;  3L0W B;  3DOW A;  2WX0 A;  2IYD B;  2RLO A;  2UZR A;  4TQ0 A;  4IWO A;  5AEK B;  2QHO A;  1E7U A;  1VD2 A;  4G11 A;  1SIF A;  3QJZ A;  3K9O B;  4BOS C;  1UEF A;  4DX9 0;  4MSQ B;  3PTF C;  3NY5 A;  3NZU A;  5TR5 A;  4MT7 A;  4GGQ A;  2P8V A;  2CHW A;  4W9K A;  1PLS A;  4W9E A;  4WJ7 A;  3GZN I;  2DYN A;  2ELB A;  2KLC A;  5AZH A;  3WIM A;  2ZZP B;  2UVM A;  2N7D A;  3KH0 A;  4B95 A;  1S1Q B;  5DCN A;  3ZRF A;  5HKH A;  2Q13 A;  3IBE A;  3SHQ A;  2O6V B;  2R0D A;  5DHF B;  5DHA B;  3UQA A;  2PEA A;  3VOQ A;  2KX3 A;  1WX7 A;  4NAW A;  1WMH A;  3JYU A;  1QC6 A;  4EMO A;  4E74 A;  3DVN V;  1WGY A;  2YLM A;  2RSU A;  2FUH B;  2K1F A;  4FJV B;  5D3Y A;  5JZE B;  2WWZ A;  1E5W A;  3OJ4 B;  3H7P A;  2CHZ A;  3ZNG C;  1U2B A;  2Z0E B;  4MEL A;  4Z2M B;  5KQ1 A;  4D0N B;  2IFS A;  3H6N A;  1W1D A;  2UYZ B;  5AZG A;  2XQN M;  4F7U P;  4ZDV A;  4HAX B;  2L00 B;  1WGD A;  1V49 A;  4EOY A;  1UZX B;  1PQS A;  1WJN A;  4BKS A;  3VDZ A;  4GDL A;  4W9H A;  4NJ7 A;  4BKG A;  3QC8 B;  1WXV A;  3AJ4 A;  4HCP B;  3UGB B;  3VAW A;  3WYF B;  5JVL A;  5C79 A;  2KX0 A;  1U4A A;  1DDV A;  2CB8 A;  3HM3 A;  3KY9 A;  1RLF A;  3N32 A;  3PVU A;  4HAY B;  2NPT B;  3AU5 A;  5D2M B;  3PVL A;  1UBI A;  3PSC A;  4JKF A;  2DHK A;  3PP2 A;  2DKQ A;  5DH9 B;  5L83 A;  5LLI A;  2Y5B B;  1YX6 B;  2L76 A;  3WAO A;  4GMV A;  3V61 A;  1X86 A;  4WJP A;  4URK A;  1W1G A;  1WGR A;  2K00 A;  2ABD A;  3ZO5 B;  3IFW B;  1H4R A;  3HM6 X;  4MM3 A;  3RUL A;  5G2N A;  3BJI A;  1P3Q U;  3VXW A;  5D27 A;  3SV1 A;  1GGO A;  1K5G B;  2A4Z A;  2LZ6 A;  5LOP B;  5CX3 A;  3JSV A;  3FM8 C;  3ZIM A;  1XOD A;  4GDK A;  2BGF A;  3EHV A;  5CHW A;  1P0R A;  4B6H A;  1WM3 A;  5BO4 B;  1LXD A;  2J0M A;  2ROZ B;  3R66 C;  2X0S A;  1BTK A;  4A6F A;  3OJ3 A;  2FDQ A;  1WGG A;  3DVN U;  2MA9 B;  4ANV A;  1VBG A;  5EDS A;  2N7E A;  2M14 A;  1X1G A;  4W9L A;  2FCS A;  1X11 A;  1V89 A;  2CRF A;  2L0F A;  4KDI C;  4OVU A;  1KOT A;  1V5P A;  3K9P B;  2DZM A;  2LAS A;  4GU2 A;  1EUV B;  2COF A;  4WWP A;  4MGK E;  4E71 A;  1WX9 A;  4HB2 B;  3DVG Y;  5DPT A;  4XC2 A;  1LB1 A;  1Y5O A;  4I6P A;  3B08 A;  3OLM D;  4GSW A;  3ZDM C;  2AL3 A;  2MBE A;  4JK9 A;  2E2X A;  4HDO A;  2QKM A;  1I2H A;  3WAP A;  1XR0 B;  4JQW C;  5E6N A;  2MBO A;  3CSF A;  1UPQ A;  1C1Y B;  3DVG X;  1TQZ A;  4BBK A;  2L0T A;  3TMP B;  3ULB A;  1WXM A;  2V76 A;  1WXA A;  1VCB A;  1IRS A;  1IP9 A;  4NPN A;  1AWE A;  2K25 A;  1M7R A;  2VKI A;  3VUW A;  2AWT A;  1UNQ A;  3DBS A;  3B0A A;  2ZVO A;  1ZKH A;  1GUA B;  3KUZ A;  2MP2 B;  1V80 A;  4A3P A;  2COP A;  3DQV A;  1BT0 A;  4HHV A;  2GMI C;  1E8X A;  3A9K B;  1V86 A;  2V4L A;  2M4N A;  1DBH A;  2X18 A;  4KAX B;  2KNB A;  1NDD A;  1EF5 A;  3QBV B;  4A6F B;  1Q0W B;  3UQB A;  1KM7 A;  3JW0 X;  1A5R A;  4I6N B;  2FJL A;  4MJS B;  3DDC B;  2N4F A;  4FBJ B;  2C60 A;  3AI5 A;  5E6P A;  2D9X A;  2N9P C;  2DKP A;  2DIK A;  2JZZ A;  2K6D B;  1ZVR A;  3KUD B;  1NI2 A;  2DZK A;  1GC6 A;  3PRM B;  1V88 A;  2EJ8 A;  5LXH A;  2N23 A;  2BYV E;  2DAF A;  5AZF A;  4K17 A;  2LGX A;  3VTU A;  2FID A;  3MDB C;  4HVB A;  2LG1 A;  3HQC A;  1XD3 B;  1WZ3 A;  2KWC A;  2LOZ A;  2HRJ A;  2KTR B;  4W9J A;  2KDF B;  2BYE A;  4HPL B;  1DDM A;  3P7Z A;  1FHO A;  4HB4 B;  3V5W A;  3FEH A;  3EC8 A;  3NZS A;  1BWN A;  1KC7 A;  1WYW B;  2MWS B;  2IO0 B;  1K5D B;  3RUI B;  4F7G A;  1D3Z A;  4JK7 A;  2DX5 B;  1RFA A;  3TO1 A;  2L05 A;  3KVF B;  2KFJ A;  2CU1 A;  1OQY A;  1V9J A;  1JDE A;  2O2V B;  3TVV A;  5D3W A;  4WAA A;  3PV1 A;  4ILG B;  1QQG A;  1XKE A;  2KQS A;  3PS6 A;  4WJO A;  2Z0O A;  3QA8 A;  4HAW B;  1Y19 B;  1WJ1 A;  1WGQ A;  3VVW B;  1CMX B;  4LJO B;  2CHX A;  5DPS A;  4BKT A;  4II2 B;  2MBQ A;  5CHV C;  1X05 A;  4ZYN A;  5KCV A;  1W1H A;  4N9F 4;  3TJP A;  1MAI A;  3ML4 A;  4AJW A;  4DK5 A;  2KHW B;  3OAW A;  1NTV A;  1WXS A;  1V5M A;  3RZW C;  2MCN B;  1N3H A;  3UIO B;  1GJZ A;  3WAM A;  2XK5 A;  3MTN B;  2FCN A;  1WF9 A;  2N0Y A;  2W2X D;  2KC2 A;  4WWN A;  4ICV A;  4ICU A;  2LRU A;  3DCG A;  3VTW A;  2UZS A;  1ST7 A;  1EAZ A;  3DXE A;  1V5O A;  3B1L X;  5JP4 A;  2FNJ B;  3ZVR A;  3SD5 A;  5HE1 A;  3DBL I;  3PSE B;  4W9D A;  1XX0 A;  4PYZ A;  1MK7 B;  2KFK A;  4TKN A;  4JKH A;  2DHI A;  4RM9 A;  1E8W A;  2I5F A;  5JLJ B;  4F1S A;  2N1W A;  3NS8 A;  3P2B A;  4MEM A;  2NCN A;  2BWF A;  2D2Q A;  1NTY A;  2G4D B;  3G9W A;  3D8F A;  3UIP B;  5DPR A;  2Y7B A;  2JRH A;  4HWI B;  3H7S A;  2KQ7 A;  3SUZ A;  4KZ0 A;  2KLG A;  1RRP B;  2BPS A;  2DFK A;  1LFD A;  2HTH A;  3A9J B;  1WM2 A;  5KQ4 A;  1GNU A;  1WR6 E;  3T06 A;  4ZRJ A;  2ELA A;  4LJP B;  2JRI B;  3GOE A;  4M8N A;  3RD2 A;  3VFK A;  4FHJ A;  1WI1 A;  1MIX A;  2IY1 B;  1J0W A;  3PG7 A;  3ZW3 A;  2NBW B;  4GMX B;  4E3C A;  1OY2 A;  2L8J A;  4M0W B;  2RSG A;  1X1M A;  2LVO A;  4JKG A;  1J8C A;  4KHO A;  2MW5 A;  5CLL B;  3L13 A;  3L08 A;  4X57 B;  5KHO A;  3CF6 E;  3SU8 X;  2LUL A;  2K39 A;  3P6A A;  2DA0 A;  1IPG A;  5D7G A;  2GS0 A;  3VIA A;  2LD9 A;  2JF5 A;  2KO3 A;  3V6C B;  4WWO A;  4BKS D;  3I3T B;  3ZLZ A;  2YS5 A;  3MJW A;  1MIZ B;  3O96 A;  5JH5 C;  5CLQ B;  3GYP A;  5D3X A;  3PHW B;  4DBB A;  1KZ7 A;  4HJK A;  4WSF A;  5D94 A;  2RD0 A;  1WX8 A;  4KSL C;  2D4Q A;  5JHH A;  3QWM A;  4BBN C;  2BKR B;  2Y8G A;  3SO6 A;  2ADZ A;  5C5B A;  4DDG D;  2RQ1 A;  2GJY A;  4BFR A;  3R7Q A;  3VUY A;  1BTN A;  3VUX A;  3NSU A;  2GBK A;  2DTC A;  1E8Z A;  1WJ4 A;  3JVZ X;  1WJM A;  5HE2 A;  2IO3 B;  3R3M A;  3PZD A;  4GN1 A;  3CST A;  4DXA B;  3F5R A;  5DI9 B;  4NAW B;  4A6K A;  1WMH B;  1V6E A;  5IAA C;  4MGY E;  1T0Y A;  1I42 A;  3D8E A;  4HCN B;  4A3O A;  3V6E B;  4EZJ A;  2WH5 A;  3ODO A;  2OTX A;  1FOE A;  3AXC A;  3H7P B;  3KSY A;  2J0K A;  2N9E B;  2LKO A;  1NU2 A;  4HB0 B;  2ASQ A;  1U5D A;  1ZGU B;  3ONS A;  3IVF A;  1ZSQ A;  3HHM A;  5D6J B;  1YQB A;  2LXA A;  3TW1 A;  2LOX A;  1E8Y A;  1J19 A;  2KDB A;  4FA6 A;  3X0W A;  2IZV B;  4Y94 A;  4DDI D;  3PRP B;  3PGE A;  1WY8 A;  3H9D A;  4GDL B;  2FJ9 A;  3ZRC A;  3QCA A;  4YON A;  1PFJ A;  1G6J A;  2K2J A;  2OOB B;  4GIV A;  4CYE A;  4CHM A;  1MG8 A;  3EFU A;  4XX5 A;  2LXC A;  3VQI A;  2KUP A;  3ZDT A;  4LCD E;  2UWQ A;  2MQJ A;  1V81 A;  1QZE A;  3EPY A;  3APD A;  3V60 A;  2L3Z A;  2DZJ A;  4WJN A;  2YT0 A;  1R4N I;  1E7V A;  1M94 A;  2LBB A;  4PS7 A;  1AQC A;  4TUU A;  2WX1 A;  4K2P A;  4TV3 A;  4MSM B;  2RPQ A;  3E66 A;  2JXX A;  4DHJ B;  2PPH A;  3W1Y A;  1MK9 B;  2FIF A;  2ZPN A;  1V2Y A;  3QIJ A;  3V62 A;  3QAR A;  2CKH B;  1FGY A;  1WFY A;  4IOY X;  3HIZ A;  3N7C A;  1WRD B;  3Q3F A;  2LYD A;  1YIW A;  3QK0 A;  4FAD A;  4DBG A;  3FLV A;  2DAJ A;  4BVU C;  2GOW A;  3KUC B;  4CHJ A;  1P3R A;  2Z0P A;  5C16 A;  1UNR A;  1R4M I;  3JSV B;  4IC7 B;  4BOZ B;  2MSE D;  2LGD A;  2KMC A;  4HDQ A;  4GDK B;  1P5T A;  2G3Q B;  2LI5 A;  4WVF B;  4FHK A;  4IUM B;  1MKE A;  2RGF A;  2M8S A;  2JWZ A;  1GC7 A;  1Q5W B;  1V5T A;  4HAV B;  2KGX B;  2K6Q A;  4B6W A;  4XZ4 A;  1UH6 A;  2PZ1 A;  4NSW A;  1TXD A;  5DIF B;  2AL6 A;  4JKA A;  4BBN F;  2ZCB A;  5DPW A;  3L10 B;  1ACA A;  5C6R A;  2N9X A;  4MGZ E;  2BCJ A;  4IM3 A;  2DYM A;  2BF8 B;  3A98 B;  2ZNV B;  2N1V A;  2YF0 A;  4GB9 A;  2JT4 B;  1XD4 A;  2DYO A;  4WQO B;  1ZW7 A;  2GBN A;  3ZNI D;  3QX1 A;  1F9J A;  4MGI E;  3KW5 B;  3A8Q A;  2LWP A;  3M62 B;  3QQ8 B;  2CR5 A;  4K7W A;  4W9C A;  4GPT B;  2JZ3 B;  4KIK A;  3VHT C;  4AJY B;  1WJ6 A;  2XEW A;  3A1Q A;  3N30 A;  4ASW C;  4FJY A;  1WR1 A;  3TBL D;  5GOW B;  1L7Y A;  2K8H A;  5IJM A;  1SGH A;  4HB3 B;  2JP2 A;  2P0H A;  3BY4 B;  1WE7 A;  2BKF A;  4W9F A;  2R2O A;  4Z2N A;  2QKL A;  1YD8 U;  1ZC4 B;  5LON B;  2JUO A;  2RVB B;  4HPM B;  3RYT A;  2NMB A;  2M38 A;  4PS3 A;  3ZTD A;  2YSZ A;  3E9P A;  3SBG A;  4C0A A;  2IO2 B;  3SNH A;  1WVH A;  1EGX A;  3UIN B;  3A33 B;  2ZEQ A;  4W9I A;  2NBV B;  3L54 A;  3ALB A;  3WAN A;  4II3 B;  3ZTC A;  3PRZ A;  3TIX A;  3DPD A;  2O6V A;  1MPH A;  1WG7 A;  4MH0 E;  2R09 A;  4IAP A;  1Z2M A;  3N3K B;  4K7S A;  2KK8 A;  3RCZ A;  4NQL B;  4XWX A;  4MDK E;  3Q3J A;  2J0J A;  4AWJ A;  5J18 A;  1U5G A;  2I1J A;  1UGM A;  1U27 A;  1FXT B;  4KHB B;  4P7I A;  4NQK E;  2DX1 A;  2KDE B;  1KBL A;  2NZ8 B;  4A6H A;  3VTV A;  1RRB A;  3KYD D;  1YX5 B;  4DHZ E;  3HW2 B;  1P9D U;  2GCL A;  2GBR A;  1OTR B;  4HK2 A;  2HE7 A;  3MPX A;  1P6S A;  2D9V A;  2H7E A;  2M0X A;  2NS5 A;  3QWZ B;  2C7M B;  4ANU A;  1RAX A;  2DYQ A;  1HBK A;  2FCM A;  2KJH B;  1V5U A;  3GYO A;  2KWV B;  3AUL A;  4IM0 A;  1TTN A;  2ZCC A;  2YT1 A;  4MK0 A;  1XT9 B;  4MY6 A;  4KVG B;  3CMM B;  4K81 A;  2KTF A;  4I6L B;  3C0R B;  5J17 A;  3PLV A;  3A4R A;  4EUT A;  4F8C B;  2K8C A;  1WH3 A;  3PHX B;  3QAQ A;  1UBQ A;  3RCP A;  2VRR B;  5FR6 A;  2NPT A;  2DEN B;  2YS1 A;  2RR9 A;  1P98 A;  2DYB A;  3APF A;  3APC A;  1HE8 A;  2NBU A;  4PQ0 A;  1SHC A;  1KZG A;  3F0W A;  2W2W A;  1P1A A;  1I35 A;  2LRW A;  3U30 A;  3ENE A;  2G45 B;  3TFM A;  1OQN A;  3QHT A;  1TGZ B;  2CS4 A;  2VRW B;  1NTI A;  2MX2 A;  4HAU B;  2CAY A;  2KAN A;  2BYF A;  2KJ6 A;  3H1U A;  1M7E A;  3KYC D;  4F7Z A;  1DDW A;  2D9Z A;  3T8M A;  1HB8 A;  2XK5 B;  2MFQ A;  3S2A A;  2KD0 A;  1L2N A;  1Z87 A;  4NNJ B;  1DYN A;  2IO1 B;  3DBH I;  5JHA A;  4K2O A;  5JHB A;  2COC A;  3AU4 A;  2MWN B;  2GBJ A;  2D9W A;  3ML9 A;  3R7R A;  1KJT A;  4GXB A;  4AUQ C;  4RMA A;  1S3S G;  3U7D A;  2J59 M;  2IY0 B;  4IW0 A;  1U29 A;  1OGW A;  4K1R B;  2KFK B;  4G50 A;  2EKE C;  4KZC A;  3PT2 B;  3L17 A;  2D10 A;  4JKB A;  4FJZ A;  4GOC A;  3DXC A;  3M63 B;  1FB8 A;  2Z0D B;  4DHJ D;  1AAR A;  1LQB A;  2DZI A;  3LJU X;  4LDT D;  3M3J A;  1OEY J;  1B55 A;  1KI1 B;  3BIN A;  2I1K A;  1OEY A;  4AOF A;  1UD7 A;  4ILJ A;  2P0D A;  5E6O A;  2MKR A;  2HTH B;  2CY4 A;  3PPA A;  4ANW A;  2KMA A;  4GZU A;  4YL8 A;  2DHJ A;  2DN6 A;  1Y8R C;  3DBR I;  2R82 A;  1H8C A;  4F7H A;  2ROV A;  3RZF A;  2CQU A;  3U8Z A;  1Q1O A;  3LDZ E;  2KWU B;  4B9K A;  3IHP C;  4FLH A;  1WZ0 A;  1GG3 A;  3A8P A;  4IWQ A;  2K8B A;  4DX8 A;  1FHX A;  4PS8 A;  2MDX A;  2JPH A;  3SDL C;  1U5E A;  3ZVV A;  4RM8 A;  3PRE A;  2M1M A;  2EMT A;  4IM2 A;  4JKG B;  2RUK B;  5IA7 A;  4ZRI A;  1C3T A;  1H10 A;  2REX A;  2MP2 A;  5HE3 A;  2KJR A;  3ECI A;  2LUE A;  1K8R B;  3ZKJ C;  2PJH A;  2ZVN A;  1JRU A;  2ZNV C;  3A9K A;  4FUL A;  2MBH A;  4HAZ B;  1UPR A;  1XQQ A;  4TQ1 A;  2COD A;  2VSZ A;  1DIK A;  3ENB A;  1WIA A;  2MLB A;  5LXI B;  3KRW A;  4KV2 A;  1EF1 A;  1LM8 B;  2MRP A;  4EFO A;  3O65 B;  5J3Q A;  5G55 A;  4KSK C;  5GMV A;  2OJR A;  1EO6 A;  1WGH A;  2Y8F A;  2Z59 B;  4JK8 A;  3TL5 A;  2B3A A;  1KLV A;  2IBI B;  1HB6 A;  4PNK A;  4MJS A;  1NVL A;  4EJN A;  1U5F A;  2L2I A;  2WYQ A;  4EEW A;  3ZUN A;  3UZT A;  5C23 A;  3ODX A;  5J3Y A;  5C5B B;  2C7N B;  2KDI A;  1FHW A;  4LDT B;  2KZR A;  4M8M A;  1NBF C;  2JY6 A;  3LJ3 A;  4JKD A;  1ISN A;  2COA A;  4L6E A;  1J0G A;  2W9N A;  2GCJ A;  4ZRK A;  3PVW A;  2CY5 A;  4JKE A;  2OQB A;  4H8S A;  1YJ1 A;  3X23 A;  4EZL A;  2BWE S;  2G35 A;  2L1C A;  2KTR A;  1TZ1 A;  3L16 A;  3SYX A;  3CIK A;  3SBT A;  5EFX A;  2KN5 A;  2A5U A;  4WJQ A;  1Q67 A;  4IG7 B;  4DWF A;  3HK0 A;  2D11 A;  3UF8 A;  4HAT B;  1SE9 A;  1UEL A;  2C5L C;  2PE9 A;  4NJ6 A;  2DX5 A;  4JGH B;  4JIO U;  3VH3 B;  4TYZ A;  3CXB B;  2IYB A;  2YVC A;  5D3V A;  4CO7 A;  3MHS D;  2O2V A;  2D9Y A;  1RJ2 A;  3EEC A;  5C1Z A;  4NY0 A;  3NOB A;  3FSS A;  1FAO A;  2DLW A;  1TJ6 A;  3D32 A;  5HE0 A;  4IWP A;  2C7H A;  4JLC A;  3TCA A;  2WDT B;  4OVV A;  2L7R A;  1FGZ A;  2KKC A;  2LJ5 A;  4PYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...