4NY0A

Crystal structure of ferm domain of human focal adhesion kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
ERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGLRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAK dimerization controls its kinase-dependent functions at focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 97
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ny0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ny0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ny0A01
1OGWA 2IO3B 3A8PA 2LASA 2NBVB 1WF9A 2R2QA 4EJNA 2DZKA 1QQGA 1AQCA 2N23A 1PQSA 1VD2A 2JRHA 2ELBA 3L08A 4TYZA 3PRZA 3ZNHB 4BKSD 3QBVB 2LJ5A 4F7GA 4KDIC 3KUDB 5D7GA 1V5UA 3TL5A 3V5WA 3PVLA 3ZDTA 4KHOA 2IO2B 2KDFB 1FOEA 3F0WA 3GYOA 3SU8X 5HKHA 4IM2A 1HE8A 4D0NB 1Q0WB 1UBQA 4XC2A 1LXDA 4G50A 2ZZPB 4WAAA 4BKTA 4ZRKA 4EZKA 4GMXB 2HE7A 4JIOU 2BWES 3OJ3A 3EPYA 3VFKA 5C5BB 2GS0A 2K00A 2Z0OA 2EC1A 3DVGX 3KYCD 4HPMB 3PSEB 1UPQA 2CAYA 2QHOA 2K6DB 3R7RA 3ML9A 3A9JA 5CHFA 5C23A 2GCLA 1X1MA 2KTRB 2PJHA 1DDWA 4MGYE 1XKEA 1XR0B 4HDOA 2FCSA 2JY6A 2K2UA 2KFJA 3OLMD 4LJPB 4HK2A 2N9PC 3QWMA 2BKFA 2ZPNA 3ZVVA 1Y8RC 1TXDA 2N7DA 1I2HA 1AARA 1NVLA 2MP2B 4EZLA 2ABDA 5CHVC 2V76A 4HPLB 4PS3A 1U5DA 2D9YA 2D3GA 2LGYA 3AI5A 3B1LX 3LJ3A 2R09A 2Y7BA 3PEGA 2DFKA 1NTIA 2JXXA 3DCGA 4GDKA 2KK8A 4MJSB 4AP4C 4A6KA 4ANXA 4DHZB 2KXJA 2LRUA 3PSCA 2KX0A 3EFUA 3AU5A 5LOPB 1WJMA 1MAIA 3AULA 3T8MA 1RAXA 5LXHA 3K9PB 2OTXA 3LJUX 3D8DA 2ROVA 3W1SA 3GOEA 4MGIE 2WX0A 5GOWB 1RRPB 4E74A 3MDBC 5D3YA 2LG1A 5TR5A 2KC1A 1J0WA 4DDGD 2COAA 1WX9A 2KNBA 5JHBA 4AOFA 3R7QA 4BVUC 3PHWB 3CMMB 3L54A 1WXMA 4FJYA 4KIKB 4MDKE 4W9KA 4DHJD 2CHXA 2KANA 4DWFA 5JZEB 2AL3A 2VSZA 1UGMA 1U5FA 3PP2A 4NPNA 2D10A 5D6JB 2CODA 4W9HA 1J8CA 4MK0A 3UINB 2DYQA 3DOWA 2ZVNA 1WMHA 2K6QA 4FHKA 2NZ8B 2FCMA 4FLHA 4WWPA 4FBJB 1OQYA 3QX1A 3A9JB 1JRUA 4XWXA 2VRWB 1V49A 4WJNA 4MJSA 1P1AA 1KJTA 4I6PA 2UZSA 3PVUA 2DZIA 1H4RA 1V6EA 3BY4B 1W1HA 4MM3A 4W9GA 3X0WA 1WG7A 3H7SA 3A4SC 3ZRFA 2DHZA 5FI1A 2C7NB 3ODXA 2IBIB 1LB1A 3OAWA 4HAVB 3PV1A 1UNRA 4WSFA 1EO6A 3TCAA 1GUAB 1M7EA 3ECIA 3PHXB 3QC8B 1NU2A 4PYUA 1WE7A 3RD2A 2GBRA 3UF8A 1U29A 3DVNV 4LCDE 3QIJA 3SHQA 3UQAA 5HE0A 3PREA 1U5GA 5C16A 1WH3A 4ZYNA 1KZGA 1YX6B 2DKPA 2O2VB 5J3TA 4FJZA 1R4MI 2FAZA 2L3ZA 3MPXA 1UELA 3PRMB 4MH0E 4BKSA 4ANWA 3KVFB 3U7DA 2KN5A 3P2BA 2ZCCA 3R66C 2GBKA 4I6LB 3ZTDA 1H10A 1DROA 3QK0A 1E8ZA 3ZVRA 2JUOA 1WM3A 2NBWB 3HQCA 2BCJA 2KJ6A 2MBBB 4B9KA 4GDLB 4KZCA 4EMOA 1ZVRA 3QWZB 2PPHA 2RSUA 1J19A 2N1VA 2DYMA 4G3XB 4WVFB 2Z0PA 4WJPA 3ALBA 3A8QA 4A5KA 3B0AA 5KHOA 3SUZA 5DI9B 2CRFA 4HB3B 1PMSA 2ELAA 5LLIA 5C5BA 2KDIA 2YS3A 3PVWA 1Y19B 5L83A 1P5TA 4HVBA 2RNRB 2LXAA 4GU2A 4DHJB 1WJ1A 2COPA 2N0YA 5LONB 2BYEA 4DHZE 1GC6A 4MEMA 4HAXB 2KD0A 4MGKE 4RM8A 2RR9A 1NDDA 2Y5BB 2ZCBA 1GC7A 2K1FA 5CLLB 4II2B 5CHWA 5IAAC 5BO4B 2L76A 4ZRIA 2BKRB 4MT7A 2LZ6A 3PS6A 4PS8A 3WALA 3ZUNA 1X1GA 4AJYB 2L2IA 2MBHA 2M0XA 4A6HA 2CHZA 5CTRC 3GYPA 4NAWB 2V3SA 2LOXA 1E5WA 4KVGB 1A5RA 1OY2A 4IWOA 3MTNB 2KWCA 2VRRB 1LM8B 4II3B 2FIDA 2D9WA 2LGXA 3H9DA 4GSWA 2LKOA 4NNJB 2DX5B 1Z87A 4XZ4A 5JH5C 2YRYA 4ZDVA 1YIWA 3TO1A 3A33B 1BAKA 3JSVB 2MBQA 3OJ4B 1V5TA 2FIFA 1RRBA 2Z59B 3PGEA 4HWIB 5J3QA 2QKLA 5KCVA 2ASQA 2XBBC 1YJ1A 3PG7A 4B6HA 2DHKA 3APDA 3NZUA 5D27A 3HM3A 3V60A 4HCNB 2BPSA 1BT0A 3K9OB 4EEWA 2L0TA 3QHTA 2LGDA 2CY5A 3UIOB 4MELA 4YL8A 2I5CA 1AWEA 4B6WA 3CSTA 1D3ZA 3VTWA 2MWNB 2BYVE 5GMVA 1IPGA 2W9NA 2B3AA 2RSGA 2KJRA 1ZKHA 2RLOA 5KQ1A 3AXCA 3WAMA 5DPRA 4C0AA 2IYDB 1EF5A 4A6FB 2J0JA 4G0NB 3WAOA 2JT4B 5DPWA 4F7ZA 1P3RA 2KOXA 3W1SC 4HAWB 2VKIA 2KC2A 5D3WA 2D9VA 1P3QU 3A9KB 2KLCA 2CHWA 1MK9B 3ZDMC 2KGXB 3UQBA 3WA0A 3U30A 2G4DB 1V86A 3ML4A 2OQBA 2COCA 3ODOA 3AU4A 2E2XA 4KHBB 3CXBB 1IRSA 3DXEA 4TUUA 1TTNA 4WWNA 2L8JA 4Z2MB 1C3TA 5CLQB 3H6NA 2LD9A 2LXCA 2EMTA 1BTKA 1V88A 3KY9A 5C6RA 3SYXA 2ZNVC 4M8NA 1P98A 1WI1A 4BOZB 4LDTD 3TJPA 4E71A 1P0RA 4RM9A 4KAXB 4CO7A 2LRWA 2ZEQA 4DDID 3ZLZA 3VUXA 4TKNA 1S1QB 3TVVA 5JHGA 2M17A 1DDMA 5E6NA 1WM2A 4HB0B 2GBJA 3A1QB 4WJQA 2DLWA 2D4QA 3DXCA 1I42A 2M8SA 3RYTA 2BGFA 4GB9A 4F7HA 5JLJB 2G3QB 1BWNA 4IFSA 1Z5SB 1N3HA 4K2OA 4K81A 1EF1A 1W1DA 1B55A 2DHIA 1MG8A 3D32A 4FADA 4DX8A 4IG7B 1SGHA 1Y5OA 2Z0QA 2JP2A 2MBEA 4PYZA 2DHJA 2XEWA 1WYWB 1MKEA 1V2YA 4DBBA 3KRWA 2JRIB 1RFAA 3DVNU 1MIXA 2FCNA 5D3XA 2Z0EB 3R3MA 3AJ4A 2MW5A 4X57B 2KLGA 3N32A 4NSWA 3RCZA 2MDXA 4NY0A 1K5DB 3ODWA 3L13A 4M0WB 2W2XD 1YD8U 5L81A 4JGHB 2WDTB 5HE2A 2K39A 2PEAA 1FB8A 4F1SA 1KM7A 5KQ4A 3S2AA 4HAUB 3ZO5B 1XD3B 1V9JA 1WZ0A 4LDTB 4DX90 4EOYA 1X05A 2DYBA 3Q3JA 4DXAB 1HB6A 3M63B 4TQ0A 2D11A 2REXA 2G4SA 1XD4A 3IHPC 3VXWA 2M38A 2DKQA 4K2PA 3QQ8B 1WGRA 2KHWB 3M62B 1SIFA 1V5OA 2M4NA 5J2RA 2JF5A 2LUEA 1NTVA 1WJ4A 3DVGY 1FHXA 3Q3FA 2KWVB 4W9DA 4W9FA 4G11A 5CX3A 3L10B 3ONSA 4PNKA 2EJ8A 2NBUA 5J18A 2HTHA 5DPSA 2GCJA 2K25A 3ZNID 2ZNVB 3ULCA 2AL6A 2MP2A 2K8BA 3SV1A 2L7RA 3ULBA 2R2OA 4IC7B 1X1FA 1ZC4B 1WR1A 3NZSA 2AEHA 2WX1A 2N7EA 2NVUI 5IA7A 2LBBA 2CR5A 2KMAA 3NS8A 1MIZB 4HB2B 1E7UA 3ZIMA 2MRPA 3UZTA 1C1YB 4KSLC 5E6PA 1HB8A 1M7RA 4YONA 1U27A 4GOCA 4IOYX 4W9CA 4KZ0A 2NPTA 3TMPB 2HRJA 2J0MA 2A4ZA 1NBFC 1ZSQA 2XQNM 3WYFB 2DENB 2MLBA 1ACAA 2M1MA 3JYUA 3UIPB 2LYDA 5HE3A 4FN2A 4NQKE 1W1GA 1PFJA 1FGZA 5AZGA 3RZFA 5DHFB 2KDBA 2PE6B 4BKGA 2L00B 3DBLI 4AWJA 3X23A 3O65B 2KX3A 1GJZA 1V80A 2JVCA 2GMIC 1WX8A 2EMSA 2ZJDA 4FHJA 3PT2B 3VHTC 5C1ZA 4KV2A 3TIXA 2DTCA 2L05A 1V81A 2YF0A 2GBNA 2RGFA 2O6VB 4HHVA 1Z2MA 5DCNA 4ASWC 1WVHA 2CY4A 2W2WA 2IFSA 2LVQA 3CIKA 1K5GB 2C9WB 3TFMA 3CSFA 2I5FA 4JL9A 5D94A 3KH0A 3KYDD 3RUIB 2FCQA 4F7UP 4WQOB 2N9EB 4AJWA 5C79A 1WXAA 3A98B 1KOTA 2I1JA 4GMVA 1R4NI 2N1WA 2UWQA 1WX7A 3PLUA 4IUMB 4WJOA 3RZWC 3ZNZB 2P0FA 1UEFA 3APCA 2A5UA 4ZRJA 3FP5A 4HDQA 4K7WA 2XK5A 5L95C 2MA9B 4FA6A 3VH4B 3WIMA 1NI2A 5G55A 2IYBA 2BF8B 4OVUA 4GXBA 4HLEA 3QARA 4W9LA 2J0KA 3ZW3A 4HXDA 4PS7A 3FEHA 4RMAA 1OTRB 1U5EA 3PTFC 1P6SA 2KFKB 3NY5A 3V6CB 1SE9A 1ISNA 3CF6E 4OVVA 1EAZA 3TBLD 3M3JA 3ZTCA 1FXTB 2IZVB 2CQUA 2H7DA 4BFRA 2FUHB 3EECA 4KDLB 3EC8A 4TQ1A 1X11A 5FR6A 3VIAA 2LVOA 1MK7B 4CYEA 3B08A 3N7CA 1LW3A 2Q13A 1WJUA 2YT1A 1BTNA 3A4RA 4HCPB 4ICVA 2LWPA 2M14A 2RGNB 3M1IB 2KUPA 2RVBB 2HD5B 2K8CA 2DYNA 2OOBB 2RPQA 3HM6X 1IYFA 4HATB 2CS4A 4F8CB 4GN1A 3HHMA 4HAYB 2GBMA 4DBGA 2H7EA 1WE6A 4FULA 3VH3B 2PE9A 1U2BA 1VCBA 4AUQC 1WGQA 3ZNGC 2V4LA 2AYOB 4Y94A 3VAWA 4URKA 1WXSA 2ROZB 4KHAA 2KJHB 3IBEA 2FJLA 2O6VA 5JHAA 1DYNA 1TQZA 2X18A 2YT0A 2HJ8A 4MSMB 4XX5A 3UGBB 2DA0A 2KDEB 2NPTB 3MHSD 3WANA 1TGZB 4A3PA 2YS5A 1WMHB 1E8YA 1OEYA 1YX5B 2KWUB 3VQIA 2WWZA 4EZJA 2NCNA 1YQBA 2C7MB 2KKCA 3V6EB 3WAPA 2CB8A 2LVPA 3ENEA 1KLVA 2YVCA 1KZ7A 3L17A 5FI0A 4KIKA 4NAWA 4EUTA 2D2QA 2XK5B 5J3YA 2Y8FA 1PLSA 4NQLB 4B95A 2KQ7A 3JSVA 1U4AA 1XCGA 1LFDA 1XT9B 3A1QA 4L6EA 2Z0DB 2KTFA 4K7SA 3SDLC 3VTVA 2DX5A 4ICUA 3KRXA 2UYZB 2ZVOA 2FDQA 4W9EA 2MFQA 5AZHA 2WYQA 1WIAA 1CMXB 2RD0A 2Y8GA 1OQNA 2N4FA 3BJIA 2KFKA 2NR2A 2O2VA 1I7AA 3VTUA 3M95A 1ZM0A 1WRDB 2LULA 2UVMA 3V62A 2YS1A 3KW5B 2KZRA 4CHMA 1UD7A 1UZXB 1MPHA 2MX2A 3N3KB 1FHWA 3F5RA 4NJ6A 5EDSA 1L2NA 3SO6A 3LDZE 1WGGA 1E7VA 4MY6A 1QZEA 2C7HA 1UPRA 2MKRA 4TV3A 2BYFA 3T9LA 2LI5A 1GNUA 4H8SA 2DAJA 4HAZB 4ANUA 2PZ1A 3VOQA 1WJNA 1XQQA 1FGYA 4K17A 4A6FA 4HJKA 4JQWC 4NJ7A 2DZMA 1E8XA 1RJ2A 2D07B 5E6OA 1RLFA 2P0DA 1EVHA 2IO1B 2KQSA 3G9WA 1K8RB 1WI0A 2IY1B 4A20A 3T06A 1ZC3B 2NS5A 4P7IA 1X86A 2DN6A 3H7PA 3IFWB 1E90A 5AEKB 4IM3A 3PZDA 2CKHB 3PPAA 4JLCA 1J0GA 2K8HA 2GJYA 3VVWB 3D8FA 3HIZA 3RT3B 5J17A 3FLVA 1XX0A 5DHAB 3DBSA 4DK5A 2COFA 2P0HA 3IG3A 3ML8A 4IWPA 1IP9A 3KSYA 1P9DU 2IO0B 4EFOA 2KCJA 5DIFB 2J7QB 2ADZA 4GPTB 1UNQA 2DZJA 2MWSB 3KUCB 3D8EA 3W1YA 2O6VD 2C60A 2L0FA 4MSQB 3IVFA 1TBEA 5DPTA 4BBKA 3EHVA 1G6JA 5JP4A 3BINA 1E8WA 2C5LC 2MSED 1OEYJ 3P6AA 1QC6A 1DBHA 1TZ1A 5KHQA 1WR6E 3U8ZA 3FM8C 2G45B 1OMWA 1V61A 1WGUA 3SD5A 4CHKA 1SHCA 1I35A 3P7ZA 2GOWA 3N30A 2EKEC 4EKUA 3DPDA 3I3TB 2JZ3B 1Q5WB 3DBHI 4FJVB 1L7YA 2UZRA 4BBNF 2FNJB 1T0YA 2YSZA 3VDZA 1Q67A 3VUYA 4BBNC 2MBOA 1FAOA 1F9JA 1WGYA 3A9KA 2V1YA 3KUZA 3H7PB 4GIVA 3SNHA 2N9XA 4KSKC 3APFA 2QKMA 1EGXA 4IW0A 1H8CA 4Z2NA 2AWTA 1EUVB 1WFYA 1M94A 5D3VA 3NSUA 3FSSA 4I6NB 5LXIB 2DX1A 1LQBA 1WGDA 1ZW7A 2DYOA 2JZZA 2KO3A 2DAFA 2OJRA 3JW0X 4K7UA 4W9JA 4PQ0A 3ZRCA 4E3CA 2CU1A 4ANVA 1V5MA 2G35A 2I1KA 3VUWA 1XODA 4K1RB 3OANA 2W2XC 1WZ3A 2KVRA 3GZNI 4GDLA 1FHOA 2JPHA 2D9XA 1WJ6A 3NHEB 3O96A 3MJWA 4WJ7A 1WXVA 5JHHA 2IY0B 5IJMA 2J59M 4GZUA 1V5PA 1V89A 2L1CA 4IAPA 5EFXA 4CHJA 2R0DA 1UNPA 2JWZA 3DXDA 3L0WB 3NOBA 4J6IA 4N9F4 5D2MB 3QCAA 2WH5A 1Q1OA 4W9IA 1TJ6A 4HB4B 1WY8A 1HBKA 1DDVA 2LOZA 1UH6A 3JVZX 3L16A 3H1UA 3DQVA 4WWOA 2MCNB 4M8MA 3PRPB 1ZGUB 4IM0A 4LJOB 1ST7A 1WGHA 2D9ZA 1UBIA 3QA8A 4GDKB 1KI1B 3QJZA 5DH9B 4A3OA 2YLMA 2MQJA 5G2NA 5HE1A 3RCPA 3PLVA 5AZFA 2RUKB 2KMCA 2BWFA 3C0RB 3HW2B 3QAQA 2NMBA 4IWQA 4MGZE 1GG3A 3ZKJC 3DBRI 3HK0A 3RULA 4BOSC 2FJ9A 3KZ1A 2RQ1A 2P8VA 2ZPYA 1NTYA 3TW1A 3DDCB 3V61A 2K2JA 2HTHB 1S3SG 2KTRA 4GGQA
chains in the Genus database with same CATH superfamily
2L32A 1XLQA 5LNK1 3ZNHB 2RDGA 3PRZA 4BKSD 3KUDB 1V5UA 3TL5A 3V5WA 2KDFB 3AE2B 3GYOA 1WRIA 1L6UA 4XC2A 4G50A 2PLPA 4BKTA 2ACZB 2HE7A 4JIOU 2BWES 3EPYA 5C5BB 4ITKA 1LO5D 4JWUC 5CHFA 4HDOA 4JKAA 4LJPB 4HK2A 2N9PC 3QWMA 2BKFA 2DNFA 2MP2B 2D3GA 2LGYA 1XXGA 2Y7BA 1JROA 2DFKA 3DCGA 4MJSB 4ANXA 4A6KA 2KXJA 3AU5A 2PIAA 2CU3A 3AULA 1MG4A 3K9PB 3NWAA 3ZJUA 5GOWB 1RRPB 3MDBC 2KC1A 2COAA 5JHBA 1V8CA 2PKOA 3PHWB 4MDKE 4W9KA 2CHXA 2N9LA 2VSZA 1UGMA 3PP2A 4NPNA 1XCQL 1KRHA 5D6JB 4L1BA 1OQQA 2DYQA 5M4YB 1XO3A 4FLHA 1P1AA 1ZXIA 2UZSA 1H4RA 3BY4B 3X0WA 1HZ6A 3Q2AC 4RGMA 4M00A 3OAWA 4RM9A 2IBIB 4PYUA 3ECIA 2GBRA 1U29A 3QIJA 3PO0A 1WH3A 2O2VB 5BYSA 1I4XA 4B0EA 1C4AA 1JWBD 3U7DA 3R66C 2ZCCA 3ZTDA 2GBKA 1C4PA 1DROA 3HQCA 1FFUA 4RCOA 3U12A 3CIRB 1BUIC 4EMOA 1UNSA 4O1NA 2N1VA 3R8BA 2I38A 3R2TA 3ALBA 5DI9B 5LLIA 1GPXA 1Y19B 3AE6B 5L83A 1SSNA 4OVZA 1T5XD 2RNRB 2LXAA 4GU2A 1KH0A 1F77A 3BWUD 4HAXB 5IAAC 4II2B 4ZRIA 2BKRB 3PS6A 3ZUNA 2X38A 2L2IA 4MACA 3B2FA 3ZXRA 4KVGB 2V3PA 4IWOA 3MTNB 2KWCA 1LM8B 1WSPA 3H9DA 4GSWA 2WXPA 4NNJB 3E9OA 1OFFA 5JH5C 3AH7A 1V5TA 2FIFA 2Z59B 4M02A 2QKLA 2DHKA 4WH4A 3HM3A 2D3CA 3V60A 4EEWA 2BPSA 2L0TA 3NUHB 2KMMA 2W54A 2CY5A 2AQ3B 5AUKA 4B6WA 3VTWA 2MWNB 2BYVE 5GMVA 4A90A 1VR9A 1FNVA 3V05A 3AXCA 2WXKA 2KT7A 2VH1A 2J0JA 3E9LA 2KOXA 2OJWA 2VKIA 3A9KB 4JE3B 1KLGD 3ODOA 1IRSA 5D3IB 4Z2MB 2LD9A 4M8NA 2ZNVC 4BOZB 3T3NA 4BAXA 4XWWA 3NRZA 2QMTA 2QCZA 1WM2A 4HB0B 1IGDA 4USAA 4JKEA 1BWNA 4IFSA 3MJ5A 5JXVA 1N3HA 3Q6BA 3D32A 1B55A 1N5WA 1TT5B 4DXGA 4FADA 4DX8A 1SGHA 1YMHE 2MBEA 1KBLA 5HHDG 1I7HA 2WXHA 1V2YA 1I4QA 1RFAA 3ZXVA 5LG4B 5D3XA 2FCNA 2Z0EB 1MJDA 3L13A 4NY0A 1L5PA 1YD8U 5HE2A 2K39A 2PEAA 1FB8A 3W5UB 4F1SA 1ET9A 1JWMD 4HAUB 1VZ6A 3ZO5B 1V9JA 4JKFA 3Q3JA 1NYRA 2L1AA 2D11A 2G4SA 2KACA 2KHWB 3M62B 1SIFA 4C56C 1RYJA 3Q3FA 1NTVA 4G11A 1WGKA 3ONSA 4PNKA 2EJ8A 1C76A 2M0AA 2W3RA 4LNOA 4MT5A 2K25A 3ULCA 2K8BA 3SV1A 2L7RA 4ARCA 1ENFA 1ZC4B 2AEHA 2WX1A 1T0QC 2KMAA 4IOIE 3UZTA 4OZAA 1MPEA 4YONA 4GOCA 4W9CA 1NBFC 3WYFB 2DENB 3BIID 2PE6B 3OWEB 2KX3A 2JVCA 4N59A 1XCTL 4KV2A 2DTCA 2L05A 2KVZA 3AMZA 4HHVA 5HFYA 2CY4A 2LVQA 4EZJA 2C9WB 2I5FA 4JL9A 3KH0A 2FCQA 4WQOB 3A98B 1KOTA 2I1JA 4WJOA 3BYYB 4IUMB 5FKAC 3APCA 2A5UA 1MI0A 5BYQA 4ZOHC 4K3BA 3GZNB 4FXCA 1RWSA 5HI1A 2NTTA 4RMAA 1OTRB 3PTFC 4ACFA 3CF6E 2IZVB 2H7DA 2FUHB 3EECA 4KDLB 4TQ1A 3EFCA 3FKYA 3N7CA 4D6WA 2YT1A 1TKGA 2J53A 2LWPA 3AN1A 2RGNB 3M1IB 2Q5WD 1ZXHA 3NS1A 3FAHA 4HATB 3HHMA 4HAYB 4P16A 3VH3B 1B9RA 3ZNGC 3VAWA 1SBBB 2ROZB 5H92C 1TQZA 2HJ8A 4C7YA 2KDEB 2NPTB 2BQQA 3MHSD 4A3PA 1AW7A 2W82A 2NCNA 2KKCA 3WAPA 2CB8A 1ZDXA 4QXAB 3ENEA 1KLVA 4NAWA 3L17A 4EUTA 1PLSA 1ET6A 4NQLB 4JKHA 4B95A 3DWGC 1XCGA 1LFDA 4QJ3B 3SDLC 2DX5A 1C79A 2ZVOA 4GOUA 2MFQA 1CMXB 2VZKB 2N4FA 2KFKA 3BK2A 5G5HA 3KW5B 3FC4A 1VBHA 4L2YA 4NJ6A 5EDSA 3SO6A 1WGGA 4HJGE 4P6VF 3IAM1 1HTQA 1UPRA 2MH7A 1GNUA 2DAJA 2GLSA 4HAZB 2PZ1A 1XQQA 1FGYA 4JQWC 2D07B 1RLFA 1EVHA 3CWIA 3G9WA 2IY1B 5C3JB 1E10A 3NWDA 4ILGB 1C78A 3IFWB 3TSSA 1JCKB 4JLCA 4YTMB 3D8FA 3FLVA 5DHAB 2DIKA 3I5JC 2WU5B 3Q69A 4IWPA 1P9DU 1NI3A 2KCJA 2J7QB 3KUCB 1UNQA 2O6VD 4CQNA 1IGCA 5DPTA 5JP4A 2OEDA 3BINA 2JU6X 1OEYJ 1DBHA 2HJ1A 5KHQA 3FM8C 2WXJA 2XNAC 2EKEC 1TS3A 2JZ3B 2MHJA 3BK1A 2OHFA 3A9KA 1WGYA 2V1YA 3HIEA 4IW0A 1EUVB 2KIGA 5LXIB 2PW9A 2CU1A 3ZGZA 4GLSC 4K1RB 1FNWA 3OANA 1WZ3A 3GZNI 2JPHA 2D9XA 3MJWA 1WXVA 5IJMA 2WU2B 2R0DA 4N9F4 1E6EB 3QCAA 3HVZA 2EKIA 2LOZA 3H1UA 3KWVA 3AEBB 4LJOB 2BT6A 2D9ZA 1E0ZA 4GDKB 3QJZA 5DH9B 3TUOA 2J42A 1ZUD2 2YLMA 2MQJA 5G2NA 3FILA 5AZFA 2RUKB 3QAQA 3C0RB 3RMKC 1T3QA 3TW1A 3AB5A 1YNTE 2LASA 1EM7A 1K50A 1AQCA 2JRHA 3L08A 3Q8FA 2LJ5A 4F7GA 4XDCA 4C80A 3FVCA 2IO2B 3SU8X 3AE5B 1TY2A 3NVZA 1HE8A 1UBQA 2HTME 2ZZPB 1L0XB 3AEAB 3OJ3A 1F0ZA 2GS0A 2K00A 3KYCD 1UPQA 2CAYA 1PUTA 2K6DB 3ML9A 5C23A 4JKCA 2GCLA 1X1MA 2PJHA 2FCSA 1SE4A 3ZVVA 1AARA 3TEWA 5E6JA 5CHVC 4HPLB 4LTUA 1U5DA 2D9YA 2R09A 4BBNF 2JXXA 3U7ZA 2KK8A 1DOXA 1WWTA 3PSCA 1YJIA 1RAXA 2GB1A 2OTXA 3D8DA 2ROVA 3LXFA 4MGIE 2LG1A 1NYQA 1WX9A 4S17A 4AOFA 3Q3MC 3L54A 1J7AA 2AL3A 3AE3B 2WDVB 2CODA 4W9HA 1QF6A 2K6QA 2FCMA 1IUEA 3A9JB 1V49A 1T6BX 4I6PA 4MM3A 1W1HA 3ZRFA 2DHZA 5FI1A 2C7NB 1QILA 4HAVB 1UNRA 4LLGM 2WXFA 3AEEB 1T77A 2Y5PA 3SHQA 3UQAA 5H8YE 2VZKD 1KTKA 2LEKA 4ZYNA 4RGTA 3IT6B 1UELA 4MH0E 3KVFB 1VBGA 1NEKB 4I6LB 1MFWA 2JUOA 1WM3A 2NBWB 2MBBB 2BCJA 4B9KA 4GDLB 3QWZB 2WGSA 3GE3C 1VLBA 4WAFA 3SUZA 2CRFA 2INNE 2ELAA 4XYCA 1L6VA 2KDIA 3PVWA 2M56B 2LGSA 1FRRA 2JWUA 4HVBA 4YSZB 2COPA 3AE8B 1GC6A 2V4IB 4OSNA 2ZCBA 3HVDA 1IBXA 5BO4B 1XLNA 2L76A 1V1PB 4AJYB 4MT7A 1YQ3B 5IRSA 3WALA 1AYFA 1PGXA 5CTRC 2LOXA 4JKDA 1ACCA 4II3B 4US8A 2LGXA 3E56A 3TO1A 2WLBA 3VR9B 3JSVB 3SBGA 1RRBA 2ASQA 2QILA 3APDA 1HTOA 4HCNB 2GI9A 3C8YA 1FMAD 1F52A 3UIOB 1D3ZA 1F2RI 1IPGA 2KJRA 2WNMA 2RLOA 5DPRA 1EF5A 4A6FB 2JT4B 1P3RA 3W1SC 2KC2A 5D3WA 2D9VA 3RPFC 2DWQA 3ZDMC 3UQBA 1D6EC 2OQBA 2COCA 4MH8A 2E2XA 4KHBB 3CXBB 3N1ZC 4TUUA 4WWNA 3H6NA 4DWFA 5C6RA 2LUMA 1P98A 1WI1A 1M4VA 2LRWA 3VUXA 4M0WA 5JHGA 4KGRA 4WJQA 4LNIA 3RYTA 1EU4A 2BGFA 4F7HA 5MPOA 4XDDA 4DXFA 4K81A 1EF1A 1W1DA 1JALA 1VZ7A 4JWSC 2JP2A 2NBVA 2DHJA 4PYZA 2XEWA 3NVVA 3KRWA 1A70A 1SIJA 3RFZB 3AJ4A 2MW5A 2KLGA 3N32A 4A9AA 1VRAB 2Y5CA 4M0WB 2WDTB 1FEHA 3NJTA 5TSSA 4LDTB 1X05A 2R82A 2DYBA 2DKQA 1TKEA 2FJUB 2LUEA 1WJ4A 1TJEA 2D3BA 2KQ4X 1SJHD 3UI3A 3LYYA 1HA5A 1PYWD 5DPSA 2GCJA 3SFDB 2N7EA 3NS8A 1MIZB 5GXGB 3DBRB 1I4HA 2JSVX 1M7RA 2PVGC 4KZ0A 3TMPB 5EE9A 2A4ZA 2WXNA 2MLBA 1Y56A 1ACAA 3JYUA 1TY0A 2LYDA 2EELA 1PFJA 5AZGA 2KDBA 2QEJC 3DBLI 2CJNA 2WDQB 1L4DB 2ZJDA 3AECB 2YF0A 3CIKA 3KYDD 1DGJA 3EUB2 3ZYYX 3PLUA 2P0FA 3GP7A 3FP5A 4HDQA 2XK5A 5L95C 2MA9B 4FA6A 4WURA 3VH4B 5G55A 4OVUA 4HLEA 4HXDA 4PS7A 3FEHA 1P6SA 3V6CB 2N7JA 2QJLA 2CQUA 4DIXA 3EC8A 5FR6A 2LVOA 4CYEA 1LW3A 4JPSA 4ICVA 2DYNA 2OOBB 1QOBA 3HM6X 4PK1A 2CS4A 3ETRA 1HZ5A 4DBGA 2IGGA 4FULA 4KKJA 1VCBA 1WGQA 1TZOA 2V4LA 2L52A 1FRDA 4URKA 2FJLA 2O6VA 2M19A 1DYNA 4C7ZA 2WHIA 1TGZB 4JKGA 1WMHB 1OEYA 2KWUB 3IXSA 3VQIA 1YQBA 1PFDA 2LVPA 2YVCA 1KZ7A 5FI0A 2Y8FA 2K5PA 3JSVA 3RNAC 2Z0DB 2KTFA 3VTVA 2UYZB 4P1BC 4W9EA 3VR8B 1WIAA 1STEA 4RF1A 2NR2A 2Y8GA 1J7BA 3VTUA 3M95A 2UVMA 1Q10A 3AM9A 2YS1A 2BB5A 1JWAD 1UD7A 1UZXB 3F5RA 1CQVA 1E7VA 4MY6A 2C7HA 3UIPB 3T9LA 1XEEA 1SXTA 2BW2A 4X57B 3VOQA 4PS3A 4K17A 1SJED 2DZMA 2NTSA 2KQSA 2GUMA 1K8RB 4KHBA 2E3TA 4A20A 1QOGA 1ZC3B 3DBHB 1YQ4B 4P7IA 2NS5A 1X86A 1E90A 5AEKB 3PZDA 3PPAA 2GJYA 3I63C 4DK5A 2P0HA 5I2MA 2IO0B 3W1YA 3D8EA 2C60A 3EHVA 5BYRA 1G6JA 1SEBD 2KTRA 4L23A 3P6AA 1QC6A 1A5RA 1V61A 2GOWA 3DPDA 4OT1A 4D2KA 4RF0A 1T0YA 2YSZA 4BBNC 1Q67A 3KUZA 4BFRA 3H7PB 4AS1A 1EGXA 5IO9A 1TS4A 2V3NA 3E66A 1WFYA 1M94A 1SF0A 2QDFA 3NSUA 3FSSA 4ILJA 1FXAA 1LQBA 1WGDA 1FIQA 1ZW7A 2JZZA 2OJRA 2DAFA 3ZRCA 1V5MA 3VUWA 4GDLA 1WJ6A 2IY0B 1OQRA 2J59M 5BMIA 4CHJA 3DHIC 1UNPA 3NOBA 3DXDA 2W3SA 4HEA1 4HB4B 1WY8A 4A8XC 3L16A 4HKQA 4L1RA 1ZGUB 3VRAB 1KI1B 3U4EG 4A3OA 4C00A 2JYTA 3PLVA 2NMBA 2WXGA 3DBRI 4BOSC 2RQ1A 2P8VA 1D4BA 2K2JA 1YJJA 3B9JA 4LNKA 4GGQA 1OGWA 2IO3B 4HROA 1WF9A 4EJNA 1PQSA 2N23A 1YN3A 2ELBA 4TYZA 3QBVB 4KDIC 4ZYSA 3PVLA 1PGBA 4KHOA 5HKHA 3F0WA 1MVKA 4D0NB 1Q0WB 1EU3A 2NMQA 4YXDB 1L0VB 4EZKA 4GMXB 2Z0OA 4HPMB 3DVGX 2WXQA 1VZ8A 2R61A 2FE8A 3A9JA 1E7PB 2KIEA 2KTRB 1TKYA 4MGYE 2JY6A 2WXRA 2K2UA 2ZPNA 1BMLC 3B1LX 1HQRD 3LJ3A 3AI5A 1D5ZC 3PZ8A 1UUPA 3PEGA 1I4PA 1NTIA 2KX0A 4LNNA 1N63A 1WJMA 1QQRA 3T8MA 3LJUX 3GOEA 2WX0A 5D3YA 5TR5A 2INCC 2KNBA 4FJYA 1WXMA 3P1MA 4KIKB 4H2AA 5JZEB 2K22A 4MK0A 3UINB 2ZVNA 4JKGB 1WMHA 4REZA 2NZ8B 4FBJB 4XWXA 3AV8A 2VRWB 4MJSA 2J52A 1KJTA 3PVUA 3TEZA 2RPVA 1WG7A 4ZHPA 4DHZB 1LB1A 4WSFA 1GUAB 1EO6A 1N62A 3QC8B 3PHXB 3GB1A 3RD2A 5I4DA 3DVNV 4LCDE 2Z59A 2B76B 3PREA 1U5GA 2X0SA 2DKPA 1R4MI 2FAZA 3PRMB 3MPXA 4AQ7A 1L0YB 3NWFA 2BS3B 3P2BA 4OZCA 2VH2A 3QK0A 1E8ZA 4DQOC 1YOVB 1EWCA 2QIEB 1ZVRA 4PT5A 2RSUA 1J19A 4WVFB 3W2DA 2Z0PA 4HB3B 4C4VB 3Q8EA 3N9YC 1P5TA 4YSYB 1GB1A 1P7EA 3MC8A 2N0YA 5LONB 4DHZE 1GOZA 4MEMA 4NAMA 2RR9A 4XGAB 1NDDA 1GC7A 5CLLB 1QT9A 2MBHA 2M0XA 2CHZA 1I4GA 4NAWB 1FPYA 2V3SA 1OY2A 2VRRB 2FIDA 2D9WA 2DX5B 1FCCC 2YRYA 4ZDVA 4A55A 1YIWA 3A33B 1BAKA 3OJ4B 2MBQA 4HWIB 3PGEA 3OG5A 5J3QA 3URYA 5KCVA 2XBBC 4B6HA 3NZUA 1GB4A 5D27A 2CJOA 1BT0A 4YWGG 3QHTA 4MM3B 1FM0D 1PGAA 3CSTA 3A58A 5G5GA 1R4NB 2W9NA 1JWUD 1ZKHA 3ZJVA 4G0NB 5DPWA 4F7ZA 4HAWB 2LGIA 2CHWA 1UF0A 3WA0A 1SB3C 1V86A 3AU4A 1C3TA 2L8JA 5CLQB 2LXCA 3KY9A 2BBCA 3SYXA 2J4XA 4E71A 1P0RA 4ILHA 4DDID 3ZLZA 5C2TB 3TVVA 1YN5A 2M17A 3H8HA 5E6NA 2GBJA 2M8SA 3RI7C 4GB9A 5EE1A 5JLJB 4K2OA 2DHIA 1Y5OA 2Z0QA 1WYWB 4DBBA 2DBYA 2JRIB 3DVNU 3NVWA 2QC8A 1MIXA 2KWDA 3R3MA 4JX1C 2MDXA 1K51A 1K5DB 3ODWA 4ZHOA 4JGHB 4A6QA 3S2AA 2JQRB 3AEDB 1T0SC 1ZPSA 1WZ0A 1KFYB 4DXAB 2REXA 2N0SB 1XD4A 3QQ8B 1V5OA 1MHXA 2M4NA 2JF5A 1C4CA 2PMVA 3DVGY 1FHXA 2KWVB 4W9DA 3SEBA 5CX3A 2K49A 2BYTA 2NBUA 5J18A 3ZNID 2ZNVB 3P4RB 2MP2A 2AL6A 4JKBA 2E6XA 3NZSA 4QAYA 5IOIA 5IA7A 2NVUI 3ZIMA 2Z4DA 4OW0A 4KSLC 5E6PA 1XLOA 1HB8A 2BTEA 1U27A 4IOYX 3MC0B 2J0MA 2XQNM 5HE3A 4FN2A 3BZDB 4NQKE 3DHGC 1W1GA 3RZFA 5DHFB 2L00B 4EE2A 3O65B 1GJZA 1V80A 2GMIC 1WX8A 4FHJA 3PT2B 3VHTC 3I9V1 4ARIA 1V81A 1Z2MA 5DCNA 4ASWC 1WVHA 3PZ7A 2Z8LA 3VFKA 1K5GB 1I42A 3RUIB 1N61A 3ENBA 4HPPA 2N1WA 2UWQA 1P7FA 1WX7A 2WXLA 2D3AA 4K7WA 4IKGA 1AWDA 1NI2A 2BF8B 3J9CA 4GXBA 4W9LA 2J0KA 4HKZE 2KFKB 4QJ5B 1KF6B 3I57A 3EGRA 1T0RC 1FXTB 2LHEA 2WS3B 1MK7B 1NENB 3B08A 1WJUA 2M14A 2KUPA 2RVBB 2HD5B 2K8CA 1MHHE 2RPQA 2LJIA 1QOAA 4RNAA 3R2IA 2H7EA 4AUQC 2AYOB 4Y94A 1WXSA 3IBEA 5JHAA 1ROEA 4Q2JA 4MSMB 3ZJTA 2YT0A 2ONQA 4XX5A 2DA0A 2GRIA 1DOYA 2HDEA 2AQ1B 2FUG1 2INDC 3IAS1 1D5MC 2D2QA 3U2SC 5J3YA 1U4AA 1XT9B 1UWMA 4L6EA 4K7SA 1C77A 4ICUA 3AE1B 2FDQA 1NVID 2RD0A 2WYQA 2MJEA 1HEZE 4C4VA 1OQNA 3BJIA 2LFIA 2I2YA 2WQYB 4DHJB 2KZRA 4CHMA 1MPHA 3N3KB 1FHWA 3LDZE 4CSQA 4OHJA 3MHZA 5FR3A 2MKRA 4TV3A 2BYFA 2IGDA 4ANUA 4H8SA 2IPKD 5AUIA 2P0DA 1WI0A 1WYGA 2L83A 3DBLB 4R3DA 4IM3A 1J0GA 3RT3B 1XX0A 3ML8A 3IG3A 2ZKMX 3GS2A 4OZBA 5DIFB 3ABVB 2DZJA 1LGRA 2L0FA 2K3UA 4BBKA 3TEXA 1E8WA 5FK9C 2C5LC 1V97A 1FCLA 3U8ZA 3P63A 1KC7A 1OMWA 4CHKA 2IJ0A 1FD6A 1SHCA 1I35A 3P7ZA 3N30A 3B77A 1Q5WB 3DBHI 3NZ3A 4FJVB 2UZRA 3KLSX 3VUYA 2MJDA 1FAOA 1F9JA 4GIVA 4KSKC 3SNHA 2N9XA 2QKMA 1J7CA 1CZPA 3W9CB 2V0GA 1DIKA 5D3VA 3ZQ4A 4I6NB 3Q8AA 2KO3A 3JW0X 1TIFA 2G9HD 2K8EA 2G35A 2W2XC 1FHOA 2KYWA 2KN4A 3NHEB 1V5PA 1V89A 2L1CA 2W55A 2JWZA 3L0WB 4J6IA 1JDEA 5D2MB 4WWMA 1TJ6A 3JVZX 2MCNB 3DQVA 3PRPB 3N20C 4IM0A 2SAKA 1ZYIA 4JK7A 1K52A 5HE1A 3DHHC 2KMCA 2BWFA 3Q14C 4MGZE 1GG3A 3ZKJC 1R7SA 2FJ9A 3KZ1A 4YSXB 2WXIA 1NTYA 4N58A 2HTHB 3HUIA 2ICIA 3A8PA 2NBVB 2R2QA 2DZKA 1QQGA 1VD2A 5D7GA 3ZDTA 1IBXB 1FOEA 2TSSA 4IM2A 1V1OA 3Q3NC 1LXDA 4WAAA 3OHMB 1ZP0B 4ZRKA 3BVGA 4US9A 4UDUC 1GGOA 2EC1A 3PSEB 1HXYD 2QHOA 3R7RA 3MC9A 5JVLA 4RFBA 3T3OA 1AN8A 1DDWA 1XKEA 1XR0B 2KFJA 3OLMD 1Y8RC 1TXDA 2N7DA 1I2HA 4EZLA 1NVLA 3AE4B 2ABDA 2V76A 3P42A 2IGHA 4AP4C 4GDKA 2LRUA 3EFUA 2H89B 5LOPB 1MAIA 5LXHA 2RRFA 2PTLA 3W1SA 1UWXA 4KX6B 4E74A 2IDYA 1J0WA 4DDGD 1ZE3D 3R7QA 4BVUC 5IKCM 3CMMB 2KANA 1U5FA 2D10A 4WQMA 1J8CA 3DOWA 4WWPA 4FHKA 3B2GA 4N6EB 1OQYA 3HRDD 3QX1A 1JRUA 1SE2A 4WJNA 4W9GA 1CK1A 2DZIA 1V6EA 2INPE 4BKSA 1F2RC 3H7SA 3A4SC 3PV1A 3ODXA 2PVOD 4DHJD 3TCAA 1M7EA 1NU2A 2AQ2B 1WE7A 3UF8A 3RNEC 2Z14A 1WXQA 5HE0A 5C16A 1KZGA 1YX6B 4FJZA 5J3TA 2ZW0A 4QJ4B 2L3ZA 4ANWA 2KN5A 2JZPA 1H10A 4K3CA 1XF5L 3ZVRA 2BB6A 2JXTA 2KJ6A 1TS5A 4KZCA 3IT4B 2UU7A 2PPHA 2RMMA 2DYMA 4G3XB 2WXOA 4WJPA 3SR6A 3A8QA 4A5KA 3B0AA 5KHOA 1PMSA 3Q8CA 5C5BA 2YS3A 4LK0M 3V3XA 1D5XC 4XE0A 1WJ1A 1KLUD 3HSAA 2BYEA 4RM8A 2KD0A 4MGKE 5IN7A 2Y5BB 1SE3A 2K1FA 5CHWA 1N60A 3RNFC 4YT0B 2LZ6A 3Q3OC 4PS8A 1X1GA 4NZLB 4A6HA 3U52E 2XN9C 3GYPA 1L4ZB 2KUQA 1E5WA 2MJ3A 2K9XA 2WP9B 5EE0A 2H88B 2LKOA 3N1YC 1Z87A 4XZ4A 4JK9A 2KDMA 2ON8A 4XWTA 1YJ1A 3PG7A 3AE9B 3K9OB 2BVCA 5HG2A 4ZRPA 2LGDA 4MELA 4YL8A 2I5CA 1AWEA 1V1PA 2B3AA 2RSGA 5KQ1A 2QSDA 3WAMA 4C0AA 2IYDB 3WAOA 2YT2A 1P3QU 2KLCA 1MK9B 3FILB 2KGXB 3U30A 2G4DB 3ML4A 3DXEA 1TTNA 1DOIA 3TEYA 2EMTA 1BTKA 1V88A 4TMAB 3E9SA 4LDTD 3TJPA 4YTNB 4CO7A 4KAXB 3RNBC 2ZEQA 4TKNA 1JW9D 2N9KA 1S1QB 1DDMA 3NW8A 3A1QB 2DLWA 2D4QA 3DXCA 3BYTB 2G3QB 1Z5SB 2JYEA 1MG8A 4M01A 4IG7B 4YTPB 3L4PA 1MKEA 3C19A 1ZOYB 1JMLA 4B0MA 3LB8C 4NSWA 3RCZA 3EA6A 2W2XD 5L81A 3AEGB 1F1HA 1KM7A 5KQ4A 1ESFA 1XD3B 4EOYA 4DX90 3P4PB 4TQ0A 1HB6A 3M63B 3VXWA 3IHPC 2M38A 4K2PA 1WGRA 5J2RA 4W9FA 4ZRQA 3L10B 5IP4D 2HTHA 2R2OA 4IC7B 2KR0A 3ULBA 1X1FA 1WR1A 2LBBA 3SBTA 2CR5A 4TSSA 4HB2B 1E7UA 3BVZA 3N1XC 2MRPA 1C1YB 4WIPA 2K0PA 1B1ZA 2NPTA 2HRJA 1ZSQA 2MEKA 2M1MA 3NG0A 1TYGB 1FGZA 4BKGA 3Q8BA 1JQ4A 2DLBA 3X23A 4AWJA 1E9MA 2EMSA 1CJEA 4S0RA 3TIXA 2GBNA 2RGFA 1YN4A 2O6VB 2W2WA 2IFSA 5C1ZA 3CSFA 5D94A 3TFMA 2V9HA 4F7UP 1R4MB 2N9EB 5C79A 1WXAA 4AJWA 4JK8A 4GMVA 1R4NI 2RDHA 3RZWC 1QOFA 1GAQB 1UEFA 4ZRJA 1K53A 2Y3AA 4KGTA 3WIMA 2AX5A 2IYBA 3KQ4A 1QKZA 3DCXA 3QARA 2BS2B 5T8IA 3ZW3A 1VDVA 1U5EA 3AE7B 5D3DA 3NY5A 1SE9A 1ISNA 4OVVA 1EAZA 3AEFB 5BMGA 3TBLD 3M3JA 3ZTCA 1ZDVA 1RM6C 4IDIA 3DWMA 3W5VB 1X11A 2X8XX 3VIAA 1N6ZA 1JRPA 2YEPB 2Q13A 4HCPB 3A4RA 1BTNA 2KAJA 1FNUA 1IYFA 3VRBB 4F8CB 4GN1A 3BVMA 2GBMA 1WE6A 2PE9A 1U2BA 1FFVA 2KJHB 2ZW1A 4KHAA 2RDBC 2X18A 3UGBB 3WANA 2YS5A 1E8YA 1YX5B 2SEBD 4HSIA 2WWZA 2C7MB 3V6EB 4KIKA 2XK5B 2KQ7A 3A1QA 3RN9C 3KRXA 5AZHA 1TS2A 2O2VA 1I7AA 1UGJA 1VJKA 2LMCA 1ZM0A 1WRDB 4RGOS 2LULA 3WCQA 3V62A 1QLBB 3MP9A 1L2NA 2MX2A 3SFEB 1QZEA 3KWLA 3NVYA 2LI5A 5BMHA 4NJ7A 1EWYC 1WJNA 4HJKA 4A6FA 3E9PA 1E8XA 1RJ2A 3O13A 5E6OA 4RH6A 2IO1B 1PDXA 1FXIA 3T06A 1RFKA 3H7PA 2DN6A 2CKHB 2K8HA 3VVWB 4LNFA 3HIZA 5J17A 4KKIA 3DBSA 2COFA 2G1EA 3RNGC 4HRSA 5I2SA 1IP9A 3KSYA 2FBWB 2YEPF 4EFOA 1MI1A 1C9FA 2BS4B 2ADZA 4GPTB 2MWSB 2WXMA 4MSQB 2R2YA 3IVFA 1TBEA 2WDRB 1FO4A 1TZ1A 1WR6E 2G45B 3SD5A 1WGUA 1DYQA 4EKUA 3I3TB 1L7YA 4RGNA 2FNJB 3RNCC 3VDZA 3P4QB 2MBOA 2D5GA 4P1CC 3APFA 1H8CA 2Z13A 4Z2NA 2AWTA 4KGSA 2DX1A 2DYOA 4W9JA 4K7UA 4PQ0A 3MFGA 4E3CA 1N5XA 4ANVA 2I1KA 4J3OD 1XODA 2KVRA 3O96A 4WJ7A 2LHDA 5JHHA 5EFXA 4GZUA 4IAPA 3GE8C 3ZNZB 2WH5A 1Q1OA 2JX5A 1XLPA 4W9IA 4BZAA 4GNKB 1HBKA 1BXTA 1DDVA 1UH6A 4WWOA 1JWSD 4M8MA 4NJCA 1ST7A 1WGHA 1UBIA 3QA8A 1I4RA 3RCPA 3P4SB 3HW2B 4IWQA 5EE3A 3HK0A 3RULA 3DDCB 2ZPYA 3V61A 1S3SG 2MSED
chains in the Genus database with same CATH topology
3ZNHB 3PRZA 4BKSD 3KUDB 1V5UA 3TL5A 3V5WA 2KDFB 3GYOA 4XC2A 4G50A 4BKTA 2HE7A 4JIOU 2BWES 3EPYA 5C5BB 5CHFA 4HDOA 4JKAA 4LJPB 4HK2A 2N9PC 3QWMA 2BKFA 2MP2B 2D3GA 2LGYA 2Y7BA 3DCGA 2DFKA 4MJSB 4ANXA 4A6KA 2KXJA 3AU5A 3AULA 3K9PB 5GOWB 1RRPB 3MDBC 2KC1A 2COAA 5JHBA 3PHWB 4MDKE 4W9KA 2CHXA 2VSZA 1UGMA 3PP2A 4NPNA 5D6JB 2DYQA 4FLHA 1P1AA 2UZSA 1H4RA 3BY4B 3X0WA 3OAWA 4RM9A 2IBIB 4PYUA 3ECIA 2GBRA 1U29A 3QIJA 1WH3A 2O2VB 3U7DA 3R66C 2ZCCA 3ZTDA 2GBKA 1DROA 3HQCA 4EMOA 2N1VA 3ALBA 5DI9B 5LLIA 1Y19B 5L83A 2RNRB 2LXAA 4GU2A 4HAXB 5IAAC 4II2B 4ZRIA 2BKRB 3PS6A 3ZUNA 2L2IA 4KVGB 4IWOA 3MTNB 2KWCA 1LM8B 3H9DA 4GSWA 4NNJB 3E9OA 5JH5C 1V5TA 2FIFA 2Z59B 2QKLA 2DHKA 3HM3A 3V60A 4EEWA 2BPSA 2L0TA 2CY5A 4B6WA 3VTWA 2MWNB 2BYVE 5GMVA 3AXCA 2J0JA 3E9LA 2KOXA 2VKIA 3A9KB 3ODOA 1IRSA 4Z2MB 2LD9A 4M8NA 2ZNVC 4BOZB 1WM2A 4HB0B 4JKEA 1BWNA 4IFSA 1N3HA 3D32A 1B55A 4FADA 4DX8A 1SGHA 2MBEA 1KBLA 1V2YA 1RFAA 2FCNA 5D3XA 2Z0EB 3L13A 4NY0A 1YD8U 5HE2A 2K39A 2PEAA 1FB8A 4F1SA 4HAUB 3ZO5B 1V9JA 4JKFA 3Q3JA 2D11A 2G4SA 2KHWB 3M62B 1SIFA 3Q3FA 1NTVA 4G11A 3ONSA 4PNKA 2EJ8A 2K25A 3ULCA 2K8BA 3SV1A 2L7RA 1ZC4B 2AEHA 2WX1A 2KMAA 3UZTA 4YONA 4GOCA 4W9CA 1NBFC 3WYFB 2DENB 2PE6B 2KX3A 2JVCA 4KV2A 2DTCA 2L05A 4HHVA 2CY4A 2LVQA 4EZJA 2C9WB 2I5FA 4JL9A 3KH0A 2FCQA 4WQOB 3A98B 1KOTA 2I1JA 4WJOA 4IUMB 3APCA 2A5UA 4RMAA 1OTRB 3PTFC 3CF6E 2IZVB 2H7DA 2FUHB 3EECA 4KDLB 4TQ1A 3N7CA 2YT1A 2LWPA 2RGNB 3M1IB 4HATB 3HHMA 4HAYB 3VH3B 3ZNGC 3VAWA 2ROZB 1TQZA 2HJ8A 2KDEB 2NPTB 3MHSD 4A3PA 2NCNA 2KKCA 3WAPA 2CB8A 3ENEA 1KLVA 4NAWA 3L17A 4EUTA 1PLSA 4NQLB 4JKHA 4B95A 1XCGA 1LFDA 3SDLC 2DX5A 2ZVOA 2MFQA 1CMXB 2N4FA 2KFKA 3KW5B 1VBHA 5EDSA 4NJ6A 3SO6A 1WGGA 1UPRA 1GNUA 2DAJA 4HAZB 2PZ1A 1XQQA 1FGYA 4JQWC 2D07B 1RLFA 1EVHA 3G9WA 2IY1B 4ILGB 3IFWB 4JLCA 3D8FA 3FLVA 5DHAB 2DIKA 4IWPA 1P9DU 2KCJA 2J7QB 3KUCB 1UNQA 2O6VD 5DPTA 5JP4A 3BINA 1OEYJ 1DBHA 5KHQA 3FM8C 2EKEC 2JZ3B 3A9KA 1WGYA 2V1YA 4IW0A 1EUVB 5LXIB 2CU1A 4K1RB 3OANA 1WZ3A 3GZNI 2JPHA 2D9XA 3MJWA 1WXVA 5IJMA 2R0DA 4N9F4 3QCAA 2LOZA 3H1UA 4LJOB 2D9ZA 4GDKB 3QJZA 5DH9B 2YLMA 2MQJA 5G2NA 5AZFA 2RUKB 3QAQA 3C0RB 3TW1A 2LASA 1AQCA 2JRHA 3L08A 2LJ5A 4F7GA 2IO2B 3SU8X 1HE8A 1UBQA 2ZZPB 3OJ3A 2GS0A 2K00A 3KYCD 1UPQA 2CAYA 2K6DB 3ML9A 5C23A 4JKCA 2GCLA 1X1MA 2PJHA 2FCSA 3ZVVA 1AARA 5CHVC 4HPLB 1U5DA 2D9YA 2R09A 4BBNF 2JXXA 2KK8A 3PSCA 1RAXA 2OTXA 3D8DA 2ROVA 4MGIE 2LG1A 1WX9A 4AOFA 3L54A 2AL3A 2CODA 4W9HA 2K6QA 2FCMA 3A9JB 1V49A 4I6PA 4MM3A 1W1HA 3ZRFA 2DHZA 5FI1A 2C7NB 4HAVB 1UNRA 3SHQA 3UQAA 4ZYNA 1UELA 4MH0E 3KVFB 1VBGA 4I6LB 2JUOA 1WM3A 2NBWB 2MBBB 2BCJA 4B9KA 4GDLB 3QWZB 3SUZA 2CRFA 2ELAA 2KDIA 3PVWA 4HVBA 2COPA 1GC6A 2ZCBA 5BO4B 2L76A 4AJYB 4MT7A 3WALA 5CTRC 2LOXA 4JKDA 4II3B 2LGXA 3TO1A 3JSVB 3SBGA 1RRBA 2ASQA 3APDA 4HCNB 3UIOB 1D3ZA 1IPGA 2KJRA 2RLOA 5DPRA 1EF5A 4A6FB 2JT4B 1P3RA 3W1SC 2KC2A 5D3WA 2D9VA 3ZDMC 3UQBA 2OQBA 2COCA 2E2XA 4KHBB 3CXBB 4TUUA 4WWNA 3H6NA 4DWFA 5C6RA 1P98A 1WI1A 2LRWA 3VUXA 5JHGA 4WJQA 3RYTA 2BGFA 4F7HA 4K81A 1EF1A 1W1DA 2JP2A 4PYZA 2DHJA 2XEWA 3KRWA 3AJ4A 2MW5A 2KLGA 3N32A 4M0WB 2WDTB 4LDTB 1X05A 2R82A 2DYBA 2DKQA 2LUEA 1WJ4A 5DPSA 2GCJA 2N7EA 3NS8A 1MIZB 1M7RA 4KZ0A 3TMPB 2A4ZA 2MLBA 1ACAA 3JYUA 2LYDA 1PFJA 5AZGA 2KDBA 3DBLI 2ZJDA 2YF0A 3CIKA 3KYDD 3PLUA 2P0FA 3FP5A 4HDQA 2XK5A 5L95C 2MA9B 4FA6A 3VH4B 5G55A 4OVUA 4HLEA 4HXDA 4PS7A 3FEHA 1P6SA 3V6CB 2CQUA 3EC8A 5FR6A 2LVOA 4CYEA 1LW3A 4ICVA 2DYNA 2OOBB 3HM6X 2CS4A 4DBGA 4FULA 1VCBA 1WGQA 2V4LA 4URKA 2FJLA 2O6VA 1DYNA 1TGZB 4JKGA 1WMHB 1OEYA 2KWUB 3VQIA 1YQBA 2LVPA 2YVCA 1KZ7A 5FI0A 2Y8FA 3JSVA 2Z0DB 2KTFA 3VTVA 2UYZB 4W9EA 1WIAA 2Y8GA 2NR2A 3VTUA 3M95A 2UVMA 2YS1A 1UD7A 1UZXB 3F5RA 1E7VA 4MY6A 2C7HA 3UIPB 3T9LA 4X57B 4PS3A 3VOQA 4K17A 2DZMA 2KQSA 1K8RB 4A20A 1ZC3B 2NS5A 4P7IA 1X86A 1E90A 5AEKB 3PZDA 3PPAA 2GJYA 4DK5A 2P0HA 2IO0B 3W1YA 3D8EA 2C60A 3EHVA 1G6JA 2KTRA 3P6AA 1A5RA 1QC6A 1V61A 2GOWA 3DPDA 1T0YA 2YSZA 4BBNC 1Q67A 4BFRA 3KUZA 3H7PB 1EGXA 3E66A 1WFYA 1M94A 3NSUA 3FSSA 4ILJA 1LQBA 1ZW7A 1WGDA 2JZZA 2OJRA 2DAFA 3ZRCA 1V5MA 3VUWA 4GDLA 1WJ6A 2IY0B 2J59M 4CHJA 1UNPA 3NOBA 3DXDA 4HB4B 1WY8A 3L16A 1ZGUB 1KI1B 4A3OA 3PLVA 2NMBA 3DBRI 4BOSC 2RQ1A 2P8VA 2K2JA 4GGQA 1OGWA 2IO3B 1WF9A 4EJNA 1PQSA 2N23A 2ELBA 4TYZA 3QBVB 4KDIC 3PVLA 4KHOA 5HKHA 3F0WA 4D0NB 1Q0WB 4EZKA 4GMXB 2Z0OA 4HPMB 3DVGX 3A9JA 2KTRB 4MGYE 2JY6A 2K2UA 2ZPNA 3B1LX 3LJ3A 3AI5A 3PEGA 1NTIA 2KX0A 1WJMA 3T8MA 3LJUX 3GOEA 2WX0A 5D3YA 5TR5A 2KNBA 4FJYA 1WXMA 4KIKB 5JZEB 4MK0A 3UINB 2ZVNA 4JKGB 1WMHA 4FBJB 2NZ8B 4XWXA 2VRWB 4MJSA 1KJTA 3PVUA 1WG7A 4DHZB 1LB1A 4WSFA 1GUAB 1EO6A 3QC8B 3PHXB 3RD2A 3DVNV 4LCDE 3PREA 1U5GA 2X0SA 2DKPA 1R4MI 2FAZA 3PRMB 3MPXA 3P2BA 3QK0A 1E8ZA 1ZVRA 2RSUA 1J19A 4WVFB 2Z0PA 4HB3B 1P5TA 2N0YA 5LONB 4DHZE 4MEMA 2RR9A 1NDDA 1GC7A 5CLLB 2MBHA 2M0XA 2CHZA 4NAWB 2V3SA 1OY2A 2VRRB 2FIDA 2D9WA 2DX5B 2YRYA 4ZDVA 1YIWA 3A33B 1BAKA 3OJ4B 2MBQA 4HWIB 3PGEA 5J3QA 5KCVA 2XBBC 4B6HA 3NZUA 5D27A 1BT0A 3QHTA 3CSTA 2W9NA 1ZKHA 4G0NB 5DPWA 4F7ZA 4HAWB 2CHWA 3WA0A 1V86A 3AU4A 1C3TA 2L8JA 5CLQB 2LXCA 3KY9A 3SYXA 4E71A 1P0RA 4ILHA 4DDID 3ZLZA 3TVVA 2M17A 5E6NA 2GBJA 2M8SA 4GB9A 5JLJB 4K2OA 2DHIA 1Y5OA 2Z0QA 1WYWB 4DBBA 3DVNU 2JRIB 1MIXA 3R3MA 2MDXA 1K5DB 3ODWA 4JGHB 3S2AA 1WZ0A 4DXAB 2REXA 1XD4A 3QQ8B 1V5OA 2M4NA 2JF5A 3DVGY 1FHXA 2KWVB 4W9DA 5CX3A 2NBUA 5J18A 3ZNID 2ZNVB 2AL6A 4JKBA 2MP2A 3NZSA 5IA7A 2NVUI 3ZIMA 4KSLC 5E6PA 1HB8A 1U27A 4IOYX 2J0MA 2XQNM 5HE3A 4FN2A 4NQKE 1W1GA 3RZFA 5DHFB 2L00B 3O65B 1GJZA 1V80A 2GMIC 1WX8A 4FHJA 3PT2B 3VHTC 1V81A 1Z2MA 5DCNA 4ASWC 1WVHA 3VFKA 1I42A 1K5GB 3RUIB 3ENBA 2N1WA 2UWQA 1WX7A 4K7WA 1NI2A 2BF8B 4GXBA 4W9LA 2J0KA 2KFKB 1FXTB 1MK7B 3B08A 1WJUA 2M14A 2KUPA 2RVBB 2HD5B 2K8CA 2RPQA 2H7EA 4AUQC 2AYOB 4Y94A 1WXSA 3IBEA 5JHAA 4MSMB 2YT0A 4XX5A 2DA0A 2D2QA 5J3YA 1U4AA 1XT9B 4L6EA 4K7SA 4ICUA 2FDQA 2WYQA 2RD0A 1OQNA 3BJIA 4DHJB 2KZRA 4CHMA 1MPHA 3N3KB 1FHWA 3LDZE 2MKRA 4TV3A 2BYFA 4ANUA 4H8SA 2P0DA 1WI0A 4IM3A 1J0GA 3RT3B 1XX0A 3ML8A 3IG3A 5DIFB 2DZJA 2L0FA 4BBKA 1E8WA 2C5LC 3U8ZA 1KC7A 1OMWA 4CHKA 1SHCA 1I35A 3P7ZA 3N30A 1Q5WB 3DBHI 4FJVB 2UZRA 3VUYA 1FAOA 1F9JA 4GIVA 4KSKC 3SNHA 2N9XA 2QKMA 1DIKA 5D3VA 4I6NB 2KO3A 3JW0X 2G35A 2W2XC 1FHOA 3NHEB 1V5PA 1V89A 2L1CA 2JWZA 3L0WB 4J6IA 1JDEA 5D2MB 1TJ6A 3JVZX 2MCNB 3DQVA 3PRPB 4IM0A 4JK7A 5HE1A 2KMCA 2BWFA 4MGZE 1GG3A 3ZKJC 2FJ9A 3KZ1A 1NTYA 2HTHB 3A8PA 2NBVB 2R2QA 2DZKA 1QQGA 1VD2A 5D7GA 3ZDTA 1FOEA 4IM2A 1LXDA 4WAAA 4ZRKA 1GGOA 2EC1A 3PSEB 2QHOA 3R7RA 5JVLA 1DDWA 1XKEA 1XR0B 2KFJA 3OLMD 1Y8RC 1TXDA 2N7DA 1I2HA 4EZLA 1NVLA 2ABDA 2V76A 4AP4C 4GDKA 2LRUA 3EFUA 5LOPB 1MAIA 5LXHA 3W1SA 4E74A 1J0WA 4DDGD 3R7QA 4BVUC 3CMMB 2KANA 1U5FA 2D10A 1J8CA 3DOWA 4WWPA 4FHKA 1OQYA 3QX1A 1JRUA 4WJNA 4W9GA 4BKSA 2DZIA 1V6EA 3H7SA 3A4SC 3PV1A 3ODXA 4DHJD 3TCAA 1M7EA 1NU2A 1WE7A 3UF8A 5HE0A 5C16A 1KZGA 1YX6B 4FJZA 5J3TA 2L3ZA 4ANWA 2KN5A 1H10A 3ZVRA 2KJ6A 4KZCA 2PPHA 2DYMA 4G3XB 4WJPA 3A8QA 4A5KA 3B0AA 5KHOA 1PMSA 5C5BA 2YS3A 1WJ1A 2BYEA 4RM8A 2KD0A 4MGKE 2Y5BB 2K1FA 5CHWA 2LZ6A 4PS8A 1X1GA 4A6HA 3GYPA 1E5WA 2LKOA 1Z87A 4XZ4A 4JK9A 1YJ1A 3PG7A 3K9OB 2LGDA 4MELA 4YL8A 2I5CA 1AWEA 2B3AA 2RSGA 5KQ1A 3WAMA 4C0AA 2IYDB 3WAOA 1P3QU 2KLCA 1MK9B 2KGXB 3U30A 2G4DB 3ML4A 3DXEA 1TTNA 2EMTA 1BTKA 1V88A 4LDTD 3TJPA 4CO7A 4KAXB 2ZEQA 4TKNA 1S1QB 1DDMA 3A1QB 2DLWA 2D4QA 3DXCA 2G3QB 1Z5SB 1MG8A 4IG7B 1MKEA 4NSWA 3RCZA 2W2XD 5L81A 1KM7A 5KQ4A 1XD3B 4EOYA 4DX90 4TQ0A 1HB6A 3M63B 3VXWA 3IHPC 2M38A 4K2PA 1WGRA 5J2RA 4W9FA 3L10B 2HTHA 2R2OA 4IC7B 3ULBA 1X1FA 1WR1A 2LBBA 3SBTA 2CR5A 4HB2B 1E7UA 2MRPA 1C1YB 2NPTA 2HRJA 1ZSQA 2M1MA 1FGZA 4BKGA 4AWJA 3X23A 2EMSA 3TIXA 2GBNA 2RGFA 2O6VB 2W2WA 2IFSA 5C1ZA 3CSFA 5D94A 3TFMA 4F7UP 2N9EB 4AJWA 5C79A 1WXAA 4JK8A 4GMVA 1R4NI 3RZWC 1UEFA 4ZRJA 3WIMA 2IYBA 3QARA 3ZW3A 1U5EA 3NY5A 1SE9A 1ISNA 4OVVA 1EAZA 3TBLD 3M3JA 3ZTCA 1X11A 3VIAA 2Q13A 4HCPB 3A4RA 1BTNA 1IYFA 4F8CB 4GN1A 2GBMA 1WE6A 2PE9A 1U2BA 2KJHB 4KHAA 2X18A 3UGBB 3WANA 2YS5A 1E8YA 1YX5B 2WWZA 2C7MB 3V6EB 4KIKA 2XK5B 2KQ7A 3A1QA 3KRXA 5AZHA 2O2VA 1I7AA 1ZM0A 1WRDB 2LULA 3V62A 1L2NA 2MX2A 1QZEA 2LI5A 4NJ7A 4HJKA 1WJNA 4A6FA 3E9PA 1E8XA 1RJ2A 5E6OA 2IO1B 3T06A 3H7PA 2DN6A 2CKHB 2K8HA 3VVWB 5J17A 3HIZA 3DBSA 2COFA 1IP9A 3KSYA 4EFOA 2MWSB 2ADZA 4GPTB 4MSQB 3IVFA 1TBEA 1TZ1A 1WR6E 2G45B 3SD5A 1WGUA 4EKUA 3I3TB 1L7YA 2FNJB 3VDZA 2MBOA 3APFA 1H8CA 4Z2NA 2AWTA 2DX1A 2DYOA 4W9JA 4K7UA 4PQ0A 4E3CA 4ANVA 2I1KA 1XODA 2KVRA 3O96A 4WJ7A 5JHHA 5EFXA 4GZUA 4IAPA 3ZNZB 2WH5A 1Q1OA 4W9IA 1HBKA 1DDVA 1UH6A 4WWOA 4M8MA 1ST7A 1WGHA 1UBIA 3QA8A 3RCPA 3HW2B 4IWQA 3HK0A 3RULA 3DDCB 2ZPYA 3V61A 1S3SG 2MSED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGW A;  2IO3 B;  3A8P A;  2LAS A;  2NBV B;  1WF9 A;  2R2Q A;  4EJN A;  2DZK A;  1QQG A;  1AQC A;  2N23 A;  1PQS A;  1VD2 A;  2JRH A;  2ELB A;  3L08 A;  4TYZ A;  3PRZ A;  3ZNH B;  4BKS D;  3QBV B;  2LJ5 A;  4F7G A;  4KDI C;  3KUD B;  5D7G A;  1V5U A;  3TL5 A;  3V5W A;  3PVL A;  3ZDT A;  4KHO A;  2IO2 B;  2KDF B;  1FOE A;  3F0W A;  3GYO A;  3SU8 X;  5HKH A;  4IM2 A;  1HE8 A;  4D0N B;  1Q0W B;  1UBQ A;  4XC2 A;  1LXD A;  4G50 A;  2ZZP B;  4WAA A;  4BKT A;  4ZRK A;  4EZK A;  4GMX B;  2HE7 A;  4JIO U;  2BWE S;  3OJ3 A;  3EPY A;  3VFK A;  5C5B B;  2GS0 A;  2K00 A;  2Z0O A;  2EC1 A;  3DVG X;  3KYC D;  4HPM B;  3PSE B;  1UPQ A;  2CAY A;  2QHO A;  2K6D B;  3R7R A;  3ML9 A;  3A9J A;  5CHF A;  5C23 A;  2GCL A;  1X1M A;  2KTR B;  2PJH A;  1DDW A;  4MGY E;  1XKE A;  1XR0 B;  4HDO A;  2FCS A;  2JY6 A;  2K2U A;  2KFJ A;  3OLM D;  4LJP B;  4HK2 A;  2N9P C;  3QWM A;  2BKF A;  2ZPN A;  3ZVV A;  1Y8R C;  1TXD A;  2N7D A;  1I2H A;  1AAR A;  1NVL A;  2MP2 B;  4EZL A;  2ABD A;  5CHV C;  2V76 A;  4HPL B;  4PS3 A;  1U5D A;  2D9Y A;  2D3G A;  2LGY A;  3AI5 A;  3B1L X;  3LJ3 A;  2R09 A;  2Y7B A;  3PEG A;  2DFK A;  1NTI A;  2JXX A;  3DCG A;  4GDK A;  2KK8 A;  4MJS B;  4AP4 C;  4A6K A;  4ANX A;  4DHZ B;  2KXJ A;  2LRU A;  3PSC A;  2KX0 A;  3EFU A;  3AU5 A;  5LOP B;  1WJM A;  1MAI A;  3AUL A;  3T8M A;  1RAX A;  5LXH A;  3K9P B;  2OTX A;  3LJU X;  3D8D A;  2ROV A;  3W1S A;  3GOE A;  4MGI E;  2WX0 A;  5GOW B;  1RRP B;  4E74 A;  3MDB C;  5D3Y A;  2LG1 A;  5TR5 A;  2KC1 A;  1J0W A;  4DDG D;  2COA A;  1WX9 A;  2KNB A;  5JHB A;  4AOF A;  3R7Q A;  4BVU C;  3PHW B;  3CMM B;  3L54 A;  1WXM A;  4FJY A;  4KIK B;  4MDK E;  4W9K A;  4DHJ D;  2CHX A;  2KAN A;  4DWF A;  5JZE B;  2AL3 A;  2VSZ A;  1UGM A;  1U5F A;  3PP2 A;  4NPN A;  2D10 A;  5D6J B;  2COD A;  4W9H A;  1J8C A;  4MK0 A;  3UIN B;  2DYQ A;  3DOW A;  2ZVN A;  1WMH A;  2K6Q A;  4FHK A;  2NZ8 B;  2FCM A;  4FLH A;  4WWP A;  4FBJ B;  1OQY A;  3QX1 A;  3A9J B;  1JRU A;  4XWX A;  2VRW B;  1V49 A;  4WJN A;  4MJS A;  1P1A A;  1KJT A;  4I6P A;  2UZS A;  3PVU A;  2DZI A;  1H4R A;  1V6E A;  3BY4 B;  1W1H A;  4MM3 A;  4W9G A;  3X0W A;  1WG7 A;  3H7S A;  3A4S C;  3ZRF A;  2DHZ A;  5FI1 A;  2C7N B;  3ODX A;  2IBI B;  1LB1 A;  3OAW A;  4HAV B;  3PV1 A;  1UNR A;  4WSF A;  1EO6 A;  3TCA A;  1GUA B;  1M7E A;  3ECI A;  3PHX B;  3QC8 B;  1NU2 A;  4PYU A;  1WE7 A;  3RD2 A;  2GBR A;  3UF8 A;  1U29 A;  3DVN V;  4LCD E;  3QIJ A;  3SHQ A;  3UQA A;  5HE0 A;  3PRE A;  1U5G A;  5C16 A;  1WH3 A;  4ZYN A;  1KZG A;  1YX6 B;  2DKP A;  2O2V B;  5J3T A;  4FJZ A;  1R4M I;  2FAZ A;  2L3Z A;  3MPX A;  1UEL A;  3PRM B;  4MH0 E;  4BKS A;  4ANW A;  3KVF B;  3U7D A;  2KN5 A;  3P2B A;  2ZCC A;  3R66 C;  2GBK A;  4I6L B;  3ZTD A;  1H10 A;  1DRO A;  3QK0 A;  1E8Z A;  3ZVR A;  2JUO A;  1WM3 A;  2NBW B;  3HQC A;  2BCJ A;  2KJ6 A;  2MBB B;  4B9K A;  4GDL B;  4KZC A;  4EMO A;  1ZVR A;  3QWZ B;  2PPH A;  2RSU A;  1J19 A;  2N1V A;  2DYM A;  4G3X B;  4WVF B;  2Z0P A;  4WJP A;  3ALB A;  3A8Q A;  4A5K A;  3B0A A;  5KHO A;  3SUZ A;  5DI9 B;  2CRF A;  4HB3 B;  1PMS A;  2ELA A;  5LLI A;  5C5B A;  2KDI A;  2YS3 A;  3PVW A;  1Y19 B;  5L83 A;  1P5T A;  4HVB A;  2RNR B;  2LXA A;  4GU2 A;  4DHJ B;  1WJ1 A;  2COP A;  2N0Y A;  5LON B;  2BYE A;  4DHZ E;  1GC6 A;  4MEM A;  4HAX B;  2KD0 A;  4MGK E;  4RM8 A;  2RR9 A;  1NDD A;  2Y5B B;  2ZCB A;  1GC7 A;  2K1F A;  5CLL B;  4II2 B;  5CHW A;  5IAA C;  5BO4 B;  2L76 A;  4ZRI A;  2BKR B;  4MT7 A;  2LZ6 A;  3PS6 A;  4PS8 A;  3WAL A;  3ZUN A;  1X1G A;  4AJY B;  2L2I A;  2MBH A;  2M0X A;  4A6H A;  2CHZ A;  5CTR C;  3GYP A;  4NAW B;  2V3S A;  2LOX A;  1E5W A;  4KVG B;  1A5R A;  1OY2 A;  4IWO A;  3MTN B;  2KWC A;  2VRR B;  1LM8 B;  4II3 B;  2FID A;  2D9W A;  2LGX A;  3H9D A;  4GSW A;  2LKO A;  4NNJ B;  2DX5 B;  1Z87 A;  4XZ4 A;  5JH5 C;  2YRY A;  4ZDV A;  1YIW A;  3TO1 A;  3A33 B;  1BAK A;  3JSV B;  2MBQ A;  3OJ4 B;  1V5T A;  2FIF A;  1RRB A;  2Z59 B;  3PGE A;  4HWI B;  5J3Q A;  2QKL A;  5KCV A;  2ASQ A;  2XBB C;  1YJ1 A;  3PG7 A;  4B6H A;  2DHK A;  3APD A;  3NZU A;  5D27 A;  3HM3 A;  3V60 A;  4HCN B;  2BPS A;  1BT0 A;  3K9O B;  4EEW A;  2L0T A;  3QHT A;  2LGD A;  2CY5 A;  3UIO B;  4MEL A;  4YL8 A;  2I5C A;  1AWE A;  4B6W A;  3CST A;  1D3Z A;  3VTW A;  2MWN B;  2BYV E;  5GMV A;  1IPG A;  2W9N A;  2B3A A;  2RSG A;  2KJR A;  1ZKH A;  2RLO A;  5KQ1 A;  3AXC A;  3WAM A;  5DPR A;  4C0A A;  2IYD B;  1EF5 A;  4A6F B;  2J0J A;  4G0N B;  3WAO A;  2JT4 B;  5DPW A;  4F7Z A;  1P3R A;  2KOX A;  3W1S C;  4HAW B;  2VKI A;  2KC2 A;  5D3W A;  2D9V A;  1P3Q U;  3A9K B;  2KLC A;  2CHW A;  1MK9 B;  3ZDM C;  2KGX B;  3UQB A;  3WA0 A;  3U30 A;  2G4D B;  1V86 A;  3ML4 A;  2OQB A;  2COC A;  3ODO A;  3AU4 A;  2E2X A;  4KHB B;  3CXB B;  1IRS A;  3DXE A;  4TUU A;  1TTN A;  4WWN A;  2L8J A;  4Z2M B;  1C3T A;  5CLQ B;  3H6N A;  2LD9 A;  2LXC A;  2EMT A;  1BTK A;  1V88 A;  3KY9 A;  5C6R A;  3SYX A;  2ZNV C;  4M8N A;  1P98 A;  1WI1 A;  4BOZ B;  4LDT D;  3TJP A;  4E71 A;  1P0R A;  4RM9 A;  4KAX B;  4CO7 A;  2LRW A;  2ZEQ A;  4DDI D;  3ZLZ A;  3VUX A;  4TKN A;  1S1Q B;  3TVV A;  5JHG A;  2M17 A;  1DDM A;  5E6N A;  1WM2 A;  4HB0 B;  2GBJ A;  3A1Q B;  4WJQ A;  2DLW A;  2D4Q A;  3DXC A;  1I42 A;  2M8S A;  3RYT A;  2BGF A;  4GB9 A;  4F7H A;  5JLJ B;  2G3Q B;  1BWN A;  4IFS A;  1Z5S B;  1N3H A;  4K2O A;  4K81 A;  1EF1 A;  1W1D A;  1B55 A;  2DHI A;  1MG8 A;  3D32 A;  4FAD A;  4DX8 A;  4IG7 B;  1SGH A;  1Y5O A;  2Z0Q A;  2JP2 A;  2MBE A;  4PYZ A;  2DHJ A;  2XEW A;  1WYW B;  1MKE A;  1V2Y A;  4DBB A;  3KRW A;  2JRI B;  1RFA A;  3DVN U;  1MIX A;  2FCN A;  5D3X A;  2Z0E B;  3R3M A;  3AJ4 A;  2MW5 A;  4X57 B;  2KLG A;  3N32 A;  4NSW A;  3RCZ A;  2MDX A;  4NY0 A;  1K5D B;  3ODW A;  3L13 A;  4M0W B;  2W2X D;  1YD8 U;  5L81 A;  4JGH B;  2WDT B;  5HE2 A;  2K39 A;  2PEA A;  1FB8 A;  4F1S A;  1KM7 A;  5KQ4 A;  3S2A A;  4HAU B;  3ZO5 B;  1XD3 B;  1V9J A;  1WZ0 A;  4LDT B;  4DX9 0;  4EOY A;  1X05 A;  2DYB A;  3Q3J A;  4DXA B;  1HB6 A;  3M63 B;  4TQ0 A;  2D11 A;  2REX A;  2G4S A;  1XD4 A;  3IHP C;  3VXW A;  2M38 A;  2DKQ A;  4K2P A;  3QQ8 B;  1WGR A;  2KHW B;  3M62 B;  1SIF A;  1V5O A;  2M4N A;  5J2R A;  2JF5 A;  2LUE A;  1NTV A;  1WJ4 A;  3DVG Y;  1FHX A;  3Q3F A;  2KWV B;  4W9D A;  4W9F A;  4G11 A;  5CX3 A;  3L10 B;  3ONS A;  4PNK A;  2EJ8 A;  2NBU A;  5J18 A;  2HTH A;  5DPS A;  2GCJ A;  2K25 A;  3ZNI D;  2ZNV B;  3ULC A;  2AL6 A;  2MP2 A;  2K8B A;  3SV1 A;  2L7R A;  3ULB A;  2R2O A;  4IC7 B;  1X1F A;  1ZC4 B;  1WR1 A;  3NZS A;  2AEH A;  2WX1 A;  2N7E A;  2NVU I;  5IA7 A;  2LBB A;  2CR5 A;  2KMA A;  3NS8 A;  1MIZ B;  4HB2 B;  1E7U A;  3ZIM A;  2MRP A;  3UZT A;  1C1Y B;  4KSL C;  5E6P A;  1HB8 A;  1M7R A;  4YON A;  1U27 A;  4GOC A;  4IOY X;  4W9C A;  4KZ0 A;  2NPT A;  3TMP B;  2HRJ A;  2J0M A;  2A4Z A;  1NBF C;  1ZSQ A;  2XQN M;  3WYF B;  2DEN B;  2MLB A;  1ACA A;  2M1M A;  3JYU A;  3UIP B;  2LYD A;  5HE3 A;  4FN2 A;  4NQK E;  1W1G A;  1PFJ A;  1FGZ A;  5AZG A;  3RZF A;  5DHF B;  2KDB A;  2PE6 B;  4BKG A;  2L00 B;  3DBL I;  4AWJ A;  3X23 A;  3O65 B;  2KX3 A;  1GJZ A;  1V80 A;  2JVC A;  2GMI C;  1WX8 A;  2EMS A;  2ZJD A;  4FHJ A;  3PT2 B;  3VHT C;  5C1Z A;  4KV2 A;  3TIX A;  2DTC A;  2L05 A;  1V81 A;  2YF0 A;  2GBN A;  2RGF A;  2O6V B;  4HHV A;  1Z2M A;  5DCN A;  4ASW C;  1WVH A;  2CY4 A;  2W2W A;  2IFS A;  2LVQ A;  3CIK A;  1K5G B;  2C9W B;  3TFM A;  3CSF A;  2I5F A;  4JL9 A;  5D94 A;  3KH0 A;  3KYD D;  3RUI B;  2FCQ A;  4F7U P;  4WQO B;  2N9E B;  4AJW A;  5C79 A;  1WXA A;  3A98 B;  1KOT A;  2I1J A;  4GMV A;  1R4N I;  2N1W A;  2UWQ A;  1WX7 A;  3PLU A;  4IUM B;  4WJO A;  3RZW C;  3ZNZ B;  2P0F A;  1UEF A;  3APC A;  2A5U A;  4ZRJ A;  3FP5 A;  4HDQ A;  4K7W A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  3VH4 B;  3WIM A;  1NI2 A;  5G55 A;  2IYB A;  2BF8 B;  4OVU A;  4GXB A;  4HLE A;  3QAR A;  4W9L A;  2J0K A;  3ZW3 A;  4HXD A;  4PS7 A;  3FEH A;  4RMA A;  1OTR B;  1U5E A;  3PTF C;  1P6S A;  2KFK B;  3NY5 A;  3V6C B;  1SE9 A;  1ISN A;  3CF6 E;  4OVV A;  1EAZ A;  3TBL D;  3M3J A;  3ZTC A;  1FXT B;  2IZV B;  2CQU A;  2H7D A;  4BFR A;  2FUH B;  3EEC A;  4KDL B;  3EC8 A;  4TQ1 A;  1X11 A;  5FR6 A;  3VIA A;  2LVO A;  1MK7 B;  4CYE A;  3B08 A;  3N7C A;  1LW3 A;  2Q13 A;  1WJU A;  2YT1 A;  1BTN A;  3A4R A;  4HCP B;  4ICV A;  2LWP A;  2M14 A;  2RGN B;  3M1I B;  2KUP A;  2RVB B;  2HD5 B;  2K8C A;  2DYN A;  2OOB B;  2RPQ A;  3HM6 X;  1IYF A;  4HAT B;  2CS4 A;  4F8C B;  4GN1 A;  3HHM A;  4HAY B;  2GBM A;  4DBG A;  2H7E A;  1WE6 A;  4FUL A;  3VH3 B;  2PE9 A;  1U2B A;  1VCB A;  4AUQ C;  1WGQ A;  3ZNG C;  2V4L A;  2AYO B;  4Y94 A;  3VAW A;  4URK A;  1WXS A;  2ROZ B;  4KHA A;  2KJH B;  3IBE A;  2FJL A;  2O6V A;  5JHA A;  1DYN A;  1TQZ A;  2X18 A;  2YT0 A;  2HJ8 A;  4MSM B;  4XX5 A;  3UGB B;  2DA0 A;  2KDE B;  2NPT B;  3MHS D;  3WAN A;  1TGZ B;  4A3P A;  2YS5 A;  1WMH B;  1E8Y A;  1OEY A;  1YX5 B;  2KWU B;  3VQI A;  2WWZ A;  4EZJ A;  2NCN A;  1YQB A;  2C7M B;  2KKC A;  3V6E B;  3WAP A;  2CB8 A;  2LVP A;  3ENE A;  1KLV A;  2YVC A;  1KZ7 A;  3L17 A;  5FI0 A;  4KIK A;  4NAW A;  4EUT A;  2D2Q A;  2XK5 B;  5J3Y A;  2Y8F A;  1PLS A;  4NQL B;  4B95 A;  2KQ7 A;  3JSV A;  1U4A A;  1XCG A;  1LFD A;  1XT9 B;  3A1Q A;  4L6E A;  2Z0D B;  2KTF A;  4K7S A;  3SDL C;  3VTV A;  2DX5 A;  4ICU A;  3KRX A;  2UYZ B;  2ZVO A;  2FDQ A;  4W9E A;  2MFQ A;  5AZH A;  2WYQ A;  1WIA A;  1CMX B;  2RD0 A;  2Y8G A;  1OQN A;  2N4F A;  3BJI A;  2KFK A;  2NR2 A;  2O2V A;  1I7A A;  3VTU A;  3M95 A;  1ZM0 A;  1WRD B;  2LUL A;  2UVM A;  3V62 A;  2YS1 A;  3KW5 B;  2KZR A;  4CHM A;  1UD7 A;  1UZX B;  1MPH A;  2MX2 A;  3N3K B;  1FHW A;  3F5R A;  4NJ6 A;  5EDS A;  1L2N A;  3SO6 A;  3LDZ E;  1WGG A;  1E7V A;  4MY6 A;  1QZE A;  2C7H A;  1UPR A;  2MKR A;  4TV3 A;  2BYF A;  3T9L A;  2LI5 A;  1GNU A;  4H8S A;  2DAJ A;  4HAZ B;  4ANU A;  2PZ1 A;  3VOQ A;  1WJN A;  1XQQ A;  1FGY A;  4K17 A;  4A6F A;  4HJK A;  4JQW C;  4NJ7 A;  2DZM A;  1E8X A;  1RJ2 A;  2D07 B;  5E6O A;  1RLF A;  2P0D A;  1EVH A;  2IO1 B;  2KQS A;  3G9W A;  1K8R B;  1WI0 A;  2IY1 B;  4A20 A;  3T06 A;  1ZC3 B;  2NS5 A;  4P7I A;  1X86 A;  2DN6 A;  3H7P A;  3IFW B;  1E90 A;  5AEK B;  4IM3 A;  3PZD A;  2CKH B;  3PPA A;  4JLC A;  1J0G A;  2K8H A;  2GJY A;  3VVW B;  3D8F A;  3HIZ A;  3RT3 B;  5J17 A;  3FLV A;  1XX0 A;  5DHA B;  3DBS A;  4DK5 A;  2COF A;  2P0H A;  3IG3 A;  3ML8 A;  4IWP A;  1IP9 A;  3KSY A;  1P9D U;  2IO0 B;  4EFO A;  2KCJ A;  5DIF B;  2J7Q B;  2ADZ A;  4GPT B;  1UNQ A;  2DZJ A;  2MWS B;  3KUC B;  3D8E A;  3W1Y A;  2O6V D;  2C60 A;  2L0F A;  4MSQ B;  3IVF A;  1TBE A;  5DPT A;  4BBK A;  3EHV A;  1G6J A;  5JP4 A;  3BIN A;  1E8W A;  2C5L C;  2MSE D;  1OEY J;  3P6A A;  1QC6 A;  1DBH A;  1TZ1 A;  5KHQ A;  1WR6 E;  3U8Z A;  3FM8 C;  2G45 B;  1OMW A;  1V61 A;  1WGU A;  3SD5 A;  4CHK A;  1SHC A;  1I35 A;  3P7Z A;  2GOW A;  3N30 A;  2EKE C;  4EKU A;  3DPD A;  3I3T B;  2JZ3 B;  1Q5W B;  3DBH I;  4FJV B;  1L7Y A;  2UZR A;  4BBN F;  2FNJ B;  1T0Y A;  2YSZ A;  3VDZ A;  1Q67 A;  3VUY A;  4BBN C;  2MBO A;  1FAO A;  1F9J A;  1WGY A;  3A9K A;  2V1Y A;  3KUZ A;  3H7P B;  4GIV A;  3SNH A;  2N9X A;  4KSK C;  3APF A;  2QKM A;  1EGX A;  4IW0 A;  1H8C A;  4Z2N A;  2AWT A;  1EUV B;  1WFY A;  1M94 A;  5D3V A;  3NSU A;  3FSS A;  4I6N B;  5LXI B;  2DX1 A;  1LQB A;  1WGD A;  1ZW7 A;  2DYO A;  2JZZ A;  2KO3 A;  2DAF A;  2OJR A;  3JW0 X;  4K7U A;  4W9J A;  4PQ0 A;  3ZRC A;  4E3C A;  2CU1 A;  4ANV A;  1V5M A;  2G35 A;  2I1K A;  3VUW A;  1XOD A;  4K1R B;  3OAN A;  2W2X C;  1WZ3 A;  2KVR A;  3GZN I;  4GDL A;  1FHO A;  2JPH A;  2D9X A;  1WJ6 A;  3NHE B;  3O96 A;  3MJW A;  4WJ7 A;  1WXV A;  5JHH A;  2IY0 B;  5IJM A;  2J59 M;  4GZU A;  1V5P A;  1V89 A;  2L1C A;  4IAP A;  5EFX A;  4CHJ A;  2R0D A;  1UNP A;  2JWZ A;  3DXD A;  3L0W B;  3NOB A;  4J6I A;  4N9F 4;  5D2M B;  3QCA A;  2WH5 A;  1Q1O A;  4W9I A;  1TJ6 A;  4HB4 B;  1WY8 A;  1HBK A;  1DDV A;  2LOZ A;  1UH6 A;  3JVZ X;  3L16 A;  3H1U A;  3DQV A;  4WWO A;  2MCN B;  4M8M A;  3PRP B;  1ZGU B;  4IM0 A;  4LJO B;  1ST7 A;  1WGH A;  2D9Z A;  1UBI A;  3QA8 A;  4GDK B;  1KI1 B;  3QJZ A;  5DH9 B;  4A3O A;  2YLM A;  2MQJ A;  5G2N A;  5HE1 A;  3RCP A;  3PLV A;  5AZF A;  2RUK B;  2KMC A;  2BWF A;  3C0R B;  3HW2 B;  3QAQ A;  2NMB A;  4IWQ A;  4MGZ E;  1GG3 A;  3ZKJ C;  3DBR I;  3HK0 A;  3RUL A;  4BOS C;  2FJ9 A;  3KZ1 A;  2RQ1 A;  2P8V A;  2ZPY A;  1NTY A;  3TW1 A;  3DDC B;  3V61 A;  2K2J A;  2HTH B;  1S3S G;  2KTR A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 2L32 A;  1XLQ A;  5LNK 1;  3ZNH B;  2RDG A;  3PRZ A;  4BKS D;  3KUD B;  1V5U A;  3TL5 A;  3V5W A;  2KDF B;  3AE2 B;  3GYO A;  1WRI A;  1L6U A;  4XC2 A;  4G50 A;  2PLP A;  4BKT A;  2ACZ B;  2HE7 A;  4JIO U;  2BWE S;  3EPY A;  5C5B B;  4ITK A;  1LO5 D;  4JWU C;  5CHF A;  4HDO A;  4JKA A;  4LJP B;  4HK2 A;  2N9P C;  3QWM A;  2BKF A;  2DNF A;  2MP2 B;  2D3G A;  2LGY A;  1XXG A;  2Y7B A;  1JRO A;  2DFK A;  3DCG A;  4MJS B;  4ANX A;  4A6K A;  2KXJ A;  3AU5 A;  2PIA A;  2CU3 A;  3AUL A;  1MG4 A;  3K9P B;  3NWA A;  3ZJU A;  5GOW B;  1RRP B;  3MDB C;  2KC1 A;  2COA A;  5JHB A;  1V8C A;  2PKO A;  3PHW B;  4MDK E;  4W9K A;  2CHX A;  2N9L A;  2VSZ A;  1UGM A;  3PP2 A;  4NPN A;  1XCQ L;  1KRH A;  5D6J B;  4L1B A;  1OQQ A;  2DYQ A;  5M4Y B;  1XO3 A;  4FLH A;  1P1A A;  1ZXI A;  2UZS A;  1H4R A;  3BY4 B;  3X0W A;  1HZ6 A;  3Q2A C;  4RGM A;  4M00 A;  3OAW A;  4RM9 A;  2IBI B;  4PYU A;  3ECI A;  2GBR A;  1U29 A;  3QIJ A;  3PO0 A;  1WH3 A;  2O2V B;  5BYS A;  1I4X A;  4B0E A;  1C4A A;  1JWB D;  3U7D A;  3R66 C;  2ZCC A;  3ZTD A;  2GBK A;  1C4P A;  1DRO A;  3HQC A;  1FFU A;  4RCO A;  3U12 A;  3CIR B;  1BUI C;  4EMO A;  1UNS A;  4O1N A;  2N1V A;  3R8B A;  2I38 A;  3R2T A;  3ALB A;  5DI9 B;  5LLI A;  1GPX A;  1Y19 B;  3AE6 B;  5L83 A;  1SSN A;  4OVZ A;  1T5X D;  2RNR B;  2LXA A;  4GU2 A;  1KH0 A;  1F77 A;  3BWU D;  4HAX B;  5IAA C;  4II2 B;  4ZRI A;  2BKR B;  3PS6 A;  3ZUN A;  2X38 A;  2L2I A;  4MAC A;  3B2F A;  3ZXR A;  4KVG B;  2V3P A;  4IWO A;  3MTN B;  2KWC A;  1LM8 B;  1WSP A;  3H9D A;  4GSW A;  2WXP A;  4NNJ B;  3E9O A;  1OFF A;  5JH5 C;  3AH7 A;  1V5T A;  2FIF A;  2Z59 B;  4M02 A;  2QKL A;  2DHK A;  4WH4 A;  3HM3 A;  2D3C A;  3V60 A;  4EEW A;  2BPS A;  2L0T A;  3NUH B;  2KMM A;  2W54 A;  2CY5 A;  2AQ3 B;  5AUK A;  4B6W A;  3VTW A;  2MWN B;  2BYV E;  5GMV A;  4A90 A;  1VR9 A;  1FNV A;  3V05 A;  3AXC A;  2WXK A;  2KT7 A;  2VH1 A;  2J0J A;  3E9L A;  2KOX A;  2OJW A;  2VKI A;  3A9K B;  4JE3 B;  1KLG D;  3ODO A;  1IRS A;  5D3I B;  4Z2M B;  2LD9 A;  4M8N A;  2ZNV C;  4BOZ B;  3T3N A;  4BAX A;  4XWW A;  3NRZ A;  2QMT A;  2QCZ A;  1WM2 A;  4HB0 B;  1IGD A;  4USA A;  4JKE A;  1BWN A;  4IFS A;  3MJ5 A;  5JXV A;  1N3H A;  3Q6B A;  3D32 A;  1B55 A;  1N5W A;  1TT5 B;  4DXG A;  4FAD A;  4DX8 A;  1SGH A;  1YMH E;  2MBE A;  1KBL A;  5HHD G;  1I7H A;  2WXH A;  1V2Y A;  1I4Q A;  1RFA A;  3ZXV A;  5LG4 B;  5D3X A;  2FCN A;  2Z0E B;  1MJD A;  3L13 A;  4NY0 A;  1L5P A;  1YD8 U;  5HE2 A;  2K39 A;  2PEA A;  1FB8 A;  3W5U B;  4F1S A;  1ET9 A;  1JWM D;  4HAU B;  1VZ6 A;  3ZO5 B;  1V9J A;  4JKF A;  3Q3J A;  1NYR A;  2L1A A;  2D11 A;  2G4S A;  2KAC A;  2KHW B;  3M62 B;  1SIF A;  4C56 C;  1RYJ A;  3Q3F A;  1NTV A;  4G11 A;  1WGK A;  3ONS A;  4PNK A;  2EJ8 A;  1C76 A;  2M0A A;  2W3R A;  4LNO A;  4MT5 A;  2K25 A;  3ULC A;  2K8B A;  3SV1 A;  2L7R A;  4ARC A;  1ENF A;  1ZC4 B;  2AEH A;  2WX1 A;  1T0Q C;  2KMA A;  4IOI E;  3UZT A;  4OZA A;  1MPE A;  4YON A;  4GOC A;  4W9C A;  1NBF C;  3WYF B;  2DEN B;  3BII D;  2PE6 B;  3OWE B;  2KX3 A;  2JVC A;  4N59 A;  1XCT L;  4KV2 A;  2DTC A;  2L05 A;  2KVZ A;  3AMZ A;  4HHV A;  5HFY A;  2CY4 A;  2LVQ A;  4EZJ A;  2C9W B;  2I5F A;  4JL9 A;  3KH0 A;  2FCQ A;  4WQO B;  3A98 B;  1KOT A;  2I1J A;  4WJO A;  3BYY B;  4IUM B;  5FKA C;  3APC A;  2A5U A;  1MI0 A;  5BYQ A;  4ZOH C;  4K3B A;  3GZN B;  4FXC A;  1RWS A;  5HI1 A;  2NTT A;  4RMA A;  1OTR B;  3PTF C;  4ACF A;  3CF6 E;  2IZV B;  2H7D A;  2FUH B;  3EEC A;  4KDL B;  4TQ1 A;  3EFC A;  3FKY A;  3N7C A;  4D6W A;  2YT1 A;  1TKG A;  2J53 A;  2LWP A;  3AN1 A;  2RGN B;  3M1I B;  2Q5W D;  1ZXH A;  3NS1 A;  3FAH A;  4HAT B;  3HHM A;  4HAY B;  4P16 A;  3VH3 B;  1B9R A;  3ZNG C;  3VAW A;  1SBB B;  2ROZ B;  5H92 C;  1TQZ A;  2HJ8 A;  4C7Y A;  2KDE B;  2NPT B;  2BQQ A;  3MHS D;  4A3P A;  1AW7 A;  2W82 A;  2NCN A;  2KKC A;  3WAP A;  2CB8 A;  1ZDX A;  4QXA B;  3ENE A;  1KLV A;  4NAW A;  3L17 A;  4EUT A;  1PLS A;  1ET6 A;  4NQL B;  4JKH A;  4B95 A;  3DWG C;  1XCG A;  1LFD A;  4QJ3 B;  3SDL C;  2DX5 A;  1C79 A;  2ZVO A;  4GOU A;  2MFQ A;  1CMX B;  2VZK B;  2N4F A;  2KFK A;  3BK2 A;  5G5H A;  3KW5 B;  3FC4 A;  1VBH A;  4L2Y A;  4NJ6 A;  5EDS A;  3SO6 A;  1WGG A;  4HJG E;  4P6V F;  3IAM 1;  1HTQ A;  1UPR A;  2MH7 A;  1GNU A;  2DAJ A;  2GLS A;  4HAZ B;  2PZ1 A;  1XQQ A;  1FGY A;  4JQW C;  2D07 B;  1RLF A;  1EVH A;  3CWI A;  3G9W A;  2IY1 B;  5C3J B;  1E10 A;  3NWD A;  4ILG B;  1C78 A;  3IFW B;  3TSS A;  1JCK B;  4JLC A;  4YTM B;  3D8F A;  3FLV A;  5DHA B;  2DIK A;  3I5J C;  2WU5 B;  3Q69 A;  4IWP A;  1P9D U;  1NI3 A;  2KCJ A;  2J7Q B;  3KUC B;  1UNQ A;  2O6V D;  4CQN A;  1IGC A;  5DPT A;  5JP4 A;  2OED A;  3BIN A;  2JU6 X;  1OEY J;  1DBH A;  2HJ1 A;  5KHQ A;  3FM8 C;  2WXJ A;  2XNA C;  2EKE C;  1TS3 A;  2JZ3 B;  2MHJ A;  3BK1 A;  2OHF A;  3A9K A;  1WGY A;  2V1Y A;  3HIE A;  4IW0 A;  1EUV B;  2KIG A;  5LXI B;  2PW9 A;  2CU1 A;  3ZGZ A;  4GLS C;  4K1R B;  1FNW A;  3OAN A;  1WZ3 A;  3GZN I;  2JPH A;  2D9X A;  3MJW A;  1WXV A;  5IJM A;  2WU2 B;  2R0D A;  4N9F 4;  1E6E B;  3QCA A;  3HVZ A;  2EKI A;  2LOZ A;  3H1U A;  3KWV A;  3AEB B;  4LJO B;  2BT6 A;  2D9Z A;  1E0Z A;  4GDK B;  3QJZ A;  5DH9 B;  3TUO A;  2J42 A;  1ZUD 2;  2YLM A;  2MQJ A;  5G2N A;  3FIL A;  5AZF A;  2RUK B;  3QAQ A;  3C0R B;  3RMK C;  1T3Q A;  3TW1 A;  3AB5 A;  1YNT E;  2LAS A;  1EM7 A;  1K50 A;  1AQC A;  2JRH A;  3L08 A;  3Q8F A;  2LJ5 A;  4F7G A;  4XDC A;  4C80 A;  3FVC A;  2IO2 B;  3SU8 X;  3AE5 B;  1TY2 A;  3NVZ A;  1HE8 A;  1UBQ A;  2HTM E;  2ZZP B;  1L0X B;  3AEA B;  3OJ3 A;  1F0Z A;  2GS0 A;  2K00 A;  3KYC D;  1UPQ A;  2CAY A;  1PUT A;  2K6D B;  3ML9 A;  5C23 A;  4JKC A;  2GCL A;  1X1M A;  2PJH A;  2FCS A;  1SE4 A;  3ZVV A;  1AAR A;  3TEW A;  5E6J A;  5CHV C;  4HPL B;  4LTU A;  1U5D A;  2D9Y A;  2R09 A;  4BBN F;  2JXX A;  3U7Z A;  2KK8 A;  1DOX A;  1WWT A;  3PSC A;  1YJI A;  1RAX A;  2GB1 A;  2OTX A;  3D8D A;  2ROV A;  3LXF A;  4MGI E;  2LG1 A;  1NYQ A;  1WX9 A;  4S17 A;  4AOF A;  3Q3M C;  3L54 A;  1J7A A;  2AL3 A;  3AE3 B;  2WDV B;  2COD A;  4W9H A;  1QF6 A;  2K6Q A;  2FCM A;  1IUE A;  3A9J B;  1V49 A;  1T6B X;  4I6P A;  4MM3 A;  1W1H A;  3ZRF A;  2DHZ A;  5FI1 A;  2C7N B;  1QIL A;  4HAV B;  1UNR A;  4LLG M;  2WXF A;  3AEE B;  1T77 A;  2Y5P A;  3SHQ A;  3UQA A;  5H8Y E;  2VZK D;  1KTK A;  2LEK A;  4ZYN A;  4RGT A;  3IT6 B;  1UEL A;  4MH0 E;  3KVF B;  1VBG A;  1NEK B;  4I6L B;  1MFW A;  2JUO A;  1WM3 A;  2NBW B;  2MBB B;  2BCJ A;  4B9K A;  4GDL B;  3QWZ B;  2WGS A;  3GE3 C;  1VLB A;  4WAF A;  3SUZ A;  2CRF A;  2INN E;  2ELA A;  4XYC A;  1L6V A;  2KDI A;  3PVW A;  2M56 B;  2LGS A;  1FRR A;  2JWU A;  4HVB A;  4YSZ B;  2COP A;  3AE8 B;  1GC6 A;  2V4I B;  4OSN A;  2ZCB A;  3HVD A;  1IBX A;  5BO4 B;  1XLN A;  2L76 A;  1V1P B;  4AJY B;  4MT7 A;  1YQ3 B;  5IRS A;  3WAL A;  1AYF A;  1PGX A;  5CTR C;  2LOX A;  4JKD A;  1ACC A;  4II3 B;  4US8 A;  2LGX A;  3E56 A;  3TO1 A;  2WLB A;  3VR9 B;  3JSV B;  3SBG A;  1RRB A;  2ASQ A;  2QIL A;  3APD A;  1HTO A;  4HCN B;  2GI9 A;  3C8Y A;  1FMA D;  1F52 A;  3UIO B;  1D3Z A;  1F2R I;  1IPG A;  2KJR A;  2WNM A;  2RLO A;  5DPR A;  1EF5 A;  4A6F B;  2JT4 B;  1P3R A;  3W1S C;  2KC2 A;  5D3W A;  2D9V A;  3RPF C;  2DWQ A;  3ZDM C;  3UQB A;  1D6E C;  2OQB A;  2COC A;  4MH8 A;  2E2X A;  4KHB B;  3CXB B;  3N1Z C;  4TUU A;  4WWN A;  3H6N A;  4DWF A;  5C6R A;  2LUM A;  1P98 A;  1WI1 A;  1M4V A;  2LRW A;  3VUX A;  4M0W A;  5JHG A;  4KGR A;  4WJQ A;  4LNI A;  3RYT A;  1EU4 A;  2BGF A;  4F7H A;  5MPO A;  4XDD A;  4DXF A;  4K81 A;  1EF1 A;  1W1D A;  1JAL A;  1VZ7 A;  4JWS C;  2JP2 A;  2NBV A;  2DHJ A;  4PYZ A;  2XEW A;  3NVV A;  3KRW A;  1A70 A;  1SIJ A;  3RFZ B;  3AJ4 A;  2MW5 A;  2KLG A;  3N32 A;  4A9A A;  1VRA B;  2Y5C A;  4M0W B;  2WDT B;  1FEH A;  3NJT A;  5TSS A;  4LDT B;  1X05 A;  2R82 A;  2DYB A;  2DKQ A;  1TKE A;  2FJU B;  2LUE A;  1WJ4 A;  1TJE A;  2D3B A;  2KQ4 X;  1SJH D;  3UI3 A;  3LYY A;  1HA5 A;  1PYW D;  5DPS A;  2GCJ A;  3SFD B;  2N7E A;  3NS8 A;  1MIZ B;  5GXG B;  3DBR B;  1I4H A;  2JSV X;  1M7R A;  2PVG C;  4KZ0 A;  3TMP B;  5EE9 A;  2A4Z A;  2WXN A;  2MLB A;  1Y56 A;  1ACA A;  3JYU A;  1TY0 A;  2LYD A;  2EEL A;  1PFJ A;  5AZG A;  2KDB A;  2QEJ C;  3DBL I;  2CJN A;  2WDQ B;  1L4D B;  2ZJD A;  3AEC B;  2YF0 A;  3CIK A;  3KYD D;  1DGJ A;  3EUB 2;  3ZYY X;  3PLU A;  2P0F A;  3GP7 A;  3FP5 A;  4HDQ A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  4WUR A;  3VH4 B;  5G55 A;  4OVU A;  4HLE A;  4HXD A;  4PS7 A;  3FEH A;  1P6S A;  3V6C B;  2N7J A;  2QJL A;  2CQU A;  4DIX A;  3EC8 A;  5FR6 A;  2LVO A;  4CYE A;  1LW3 A;  4JPS A;  4ICV A;  2DYN A;  2OOB B;  1QOB A;  3HM6 X;  4PK1 A;  2CS4 A;  3ETR A;  1HZ5 A;  4DBG A;  2IGG A;  4FUL A;  4KKJ A;  1VCB A;  1WGQ A;  1TZO A;  2V4L A;  2L52 A;  1FRD A;  4URK A;  2FJL A;  2O6V A;  2M19 A;  1DYN A;  4C7Z A;  2WHI A;  1TGZ B;  4JKG A;  1WMH B;  1OEY A;  2KWU B;  3IXS A;  3VQI A;  1YQB A;  1PFD A;  2LVP A;  2YVC A;  1KZ7 A;  5FI0 A;  2Y8F A;  2K5P A;  3JSV A;  3RNA C;  2Z0D B;  2KTF A;  3VTV A;  2UYZ B;  4P1B C;  4W9E A;  3VR8 B;  1WIA A;  1STE A;  4RF1 A;  2NR2 A;  2Y8G A;  1J7B A;  3VTU A;  3M95 A;  2UVM A;  1Q10 A;  3AM9 A;  2YS1 A;  2BB5 A;  1JWA D;  1UD7 A;  1UZX B;  3F5R A;  1CQV A;  1E7V A;  4MY6 A;  2C7H A;  3UIP B;  3T9L A;  1XEE A;  1SXT A;  2BW2 A;  4X57 B;  3VOQ A;  4PS3 A;  4K17 A;  1SJE D;  2DZM A;  2NTS A;  2KQS A;  2GUM A;  1K8R B;  4KHB A;  2E3T A;  4A20 A;  1QOG A;  1ZC3 B;  3DBH B;  1YQ4 B;  4P7I A;  2NS5 A;  1X86 A;  1E90 A;  5AEK B;  3PZD A;  3PPA A;  2GJY A;  3I63 C;  4DK5 A;  2P0H A;  5I2M A;  2IO0 B;  3W1Y A;  3D8E A;  2C60 A;  3EHV A;  5BYR A;  1G6J A;  1SEB D;  2KTR A;  4L23 A;  3P6A A;  1QC6 A;  1A5R A;  1V61 A;  2GOW A;  3DPD A;  4OT1 A;  4D2K A;  4RF0 A;  1T0Y A;  2YSZ A;  4BBN C;  1Q67 A;  3KUZ A;  4BFR A;  3H7P B;  4AS1 A;  1EGX A;  5IO9 A;  1TS4 A;  2V3N A;  3E66 A;  1WFY A;  1M94 A;  1SF0 A;  2QDF A;  3NSU A;  3FSS A;  4ILJ A;  1FXA A;  1LQB A;  1WGD A;  1FIQ A;  1ZW7 A;  2JZZ A;  2OJR A;  2DAF A;  3ZRC A;  1V5M A;  3VUW A;  4GDL A;  1WJ6 A;  2IY0 B;  1OQR A;  2J59 M;  5BMI A;  4CHJ A;  3DHI C;  1UNP A;  3NOB A;  3DXD A;  2W3S A;  4HEA 1;  4HB4 B;  1WY8 A;  4A8X C;  3L16 A;  4HKQ A;  4L1R A;  1ZGU B;  3VRA B;  1KI1 B;  3U4E G;  4A3O A;  4C00 A;  2JYT A;  3PLV A;  2NMB A;  2WXG A;  3DBR I;  4BOS C;  2RQ1 A;  2P8V A;  1D4B A;  2K2J A;  1YJJ A;  3B9J A;  4LNK A;  4GGQ A;  1OGW A;  2IO3 B;  4HRO A;  1WF9 A;  4EJN A;  1PQS A;  2N23 A;  1YN3 A;  2ELB A;  4TYZ A;  3QBV B;  4KDI C;  4ZYS A;  3PVL A;  1PGB A;  4KHO A;  5HKH A;  3F0W A;  1MVK A;  4D0N B;  1Q0W B;  1EU3 A;  2NMQ A;  4YXD B;  1L0V B;  4EZK A;  4GMX B;  2Z0O A;  4HPM B;  3DVG X;  2WXQ A;  1VZ8 A;  2R61 A;  2FE8 A;  3A9J A;  1E7P B;  2KIE A;  2KTR B;  1TKY A;  4MGY E;  2JY6 A;  2WXR A;  2K2U A;  2ZPN A;  1BML C;  3B1L X;  1HQR D;  3LJ3 A;  3AI5 A;  1D5Z C;  3PZ8 A;  1UUP A;  3PEG A;  1I4P A;  1NTI A;  2KX0 A;  4LNN A;  1N63 A;  1WJM A;  1QQR A;  3T8M A;  3LJU X;  3GOE A;  2WX0 A;  5D3Y A;  5TR5 A;  2INC C;  2KNB A;  4FJY A;  1WXM A;  3P1M A;  4KIK B;  4H2A A;  5JZE B;  2K22 A;  4MK0 A;  3UIN B;  2ZVN A;  4JKG B;  1WMH A;  4REZ A;  2NZ8 B;  4FBJ B;  4XWX A;  3AV8 A;  2VRW B;  4MJS A;  2J52 A;  1KJT A;  3PVU A;  3TEZ A;  2RPV A;  1WG7 A;  4ZHP A;  4DHZ B;  1LB1 A;  4WSF A;  1GUA B;  1EO6 A;  1N62 A;  3QC8 B;  3PHX B;  3GB1 A;  3RD2 A;  5I4D A;  3DVN V;  4LCD E;  2Z59 A;  2B76 B;  3PRE A;  1U5G A;  2X0S A;  2DKP A;  1R4M I;  2FAZ A;  3PRM B;  3MPX A;  4AQ7 A;  1L0Y B;  3NWF A;  2BS3 B;  3P2B A;  4OZC A;  2VH2 A;  3QK0 A;  1E8Z A;  4DQO C;  1YOV B;  1EWC A;  2QIE B;  1ZVR A;  4PT5 A;  2RSU A;  1J19 A;  4WVF B;  3W2D A;  2Z0P A;  4HB3 B;  4C4V B;  3Q8E A;  3N9Y C;  1P5T A;  4YSY B;  1GB1 A;  1P7E A;  3MC8 A;  2N0Y A;  5LON B;  4DHZ E;  1GOZ A;  4MEM A;  4NAM A;  2RR9 A;  4XGA B;  1NDD A;  1GC7 A;  5CLL B;  1QT9 A;  2MBH A;  2M0X A;  2CHZ A;  1I4G A;  4NAW B;  1FPY A;  2V3S A;  1OY2 A;  2VRR B;  2FID A;  2D9W A;  2DX5 B;  1FCC C;  2YRY A;  4ZDV A;  4A55 A;  1YIW A;  3A33 B;  1BAK A;  3OJ4 B;  2MBQ A;  4HWI B;  3PGE A;  3OG5 A;  5J3Q A;  3URY A;  5KCV A;  2XBB C;  4B6H A;  3NZU A;  1GB4 A;  5D27 A;  2CJO A;  1BT0 A;  4YWG G;  3QHT A;  4MM3 B;  1FM0 D;  1PGA A;  3CST A;  3A58 A;  5G5G A;  1R4N B;  2W9N A;  1JWU D;  1ZKH A;  3ZJV A;  4G0N B;  5DPW A;  4F7Z A;  4HAW B;  2LGI A;  2CHW A;  1UF0 A;  3WA0 A;  1SB3 C;  1V86 A;  3AU4 A;  1C3T A;  2L8J A;  5CLQ B;  2LXC A;  3KY9 A;  2BBC A;  3SYX A;  2J4X A;  4E71 A;  1P0R A;  4ILH A;  4DDI D;  3ZLZ A;  5C2T B;  3TVV A;  1YN5 A;  2M17 A;  3H8H A;  5E6N A;  2GBJ A;  2M8S A;  3RI7 C;  4GB9 A;  5EE1 A;  5JLJ B;  4K2O A;  2DHI A;  1Y5O A;  2Z0Q A;  1WYW B;  4DBB A;  2DBY A;  2JRI B;  3DVN U;  3NVW A;  2QC8 A;  1MIX A;  2KWD A;  3R3M A;  4JX1 C;  2MDX A;  1K51 A;  1K5D B;  3ODW A;  4ZHO A;  4JGH B;  4A6Q A;  3S2A A;  2JQR B;  3AED B;  1T0S C;  1ZPS A;  1WZ0 A;  1KFY B;  4DXA B;  2REX A;  2N0S B;  1XD4 A;  3QQ8 B;  1V5O A;  1MHX A;  2M4N A;  2JF5 A;  1C4C A;  2PMV A;  3DVG Y;  1FHX A;  2KWV B;  4W9D A;  3SEB A;  5CX3 A;  2K49 A;  2BYT A;  2NBU A;  5J18 A;  3ZNI D;  2ZNV B;  3P4R B;  2MP2 A;  2AL6 A;  4JKB A;  2E6X A;  3NZS A;  4QAY A;  5IOI A;  5IA7 A;  2NVU I;  3ZIM A;  2Z4D A;  4OW0 A;  4KSL C;  5E6P A;  1XLO A;  1HB8 A;  2BTE A;  1U27 A;  4IOY X;  3MC0 B;  2J0M A;  2XQN M;  5HE3 A;  4FN2 A;  3BZD B;  4NQK E;  3DHG C;  1W1G A;  3RZF A;  5DHF B;  2L00 B;  4EE2 A;  3O65 B;  1GJZ A;  1V80 A;  2GMI C;  1WX8 A;  4FHJ A;  3PT2 B;  3VHT C;  3I9V 1;  4ARI A;  1V81 A;  1Z2M A;  5DCN A;  4ASW C;  1WVH A;  3PZ7 A;  2Z8L A;  3VFK A;  1K5G B;  1I42 A;  3RUI B;  1N61 A;  3ENB A;  4HPP A;  2N1W A;  2UWQ A;  1P7F A;  1WX7 A;  2WXL A;  2D3A A;  4K7W A;  4IKG A;  1AWD A;  1NI2 A;  2BF8 B;  3J9C A;  4GXB A;  4W9L A;  2J0K A;  4HKZ E;  2KFK B;  4QJ5 B;  1KF6 B;  3I57 A;  3EGR A;  1T0R C;  1FXT B;  2LHE A;  2WS3 B;  1MK7 B;  1NEN B;  3B08 A;  1WJU A;  2M14 A;  2KUP A;  2RVB B;  2HD5 B;  2K8C A;  1MHH E;  2RPQ A;  2LJI A;  1QOA A;  4RNA A;  3R2I A;  2H7E A;  4AUQ C;  2AYO B;  4Y94 A;  1WXS A;  3IBE A;  5JHA A;  1ROE A;  4Q2J A;  4MSM B;  3ZJT A;  2YT0 A;  2ONQ A;  4XX5 A;  2DA0 A;  2GRI A;  1DOY A;  2HDE A;  2AQ1 B;  2FUG 1;  2IND C;  3IAS 1;  1D5M C;  2D2Q A;  3U2S C;  5J3Y A;  1U4A A;  1XT9 B;  1UWM A;  4L6E A;  4K7S A;  1C77 A;  4ICU A;  3AE1 B;  2FDQ A;  1NVI D;  2RD0 A;  2WYQ A;  2MJE A;  1HEZ E;  4C4V A;  1OQN A;  3BJI A;  2LFI A;  2I2Y A;  2WQY B;  4DHJ B;  2KZR A;  4CHM A;  1MPH A;  3N3K B;  1FHW A;  3LDZ E;  4CSQ A;  4OHJ A;  3MHZ A;  5FR3 A;  2MKR A;  4TV3 A;  2BYF A;  2IGD A;  4ANU A;  4H8S A;  2IPK D;  5AUI A;  2P0D A;  1WI0 A;  1WYG A;  2L83 A;  3DBL B;  4R3D A;  4IM3 A;  1J0G A;  3RT3 B;  1XX0 A;  3ML8 A;  3IG3 A;  2ZKM X;  3GS2 A;  4OZB A;  5DIF B;  3ABV B;  2DZJ A;  1LGR A;  2L0F A;  2K3U A;  4BBK A;  3TEX A;  1E8W A;  5FK9 C;  2C5L C;  1V97 A;  1FCL A;  3U8Z A;  3P63 A;  1KC7 A;  1OMW A;  4CHK A;  2IJ0 A;  1FD6 A;  1SHC A;  1I35 A;  3P7Z A;  3N30 A;  3B77 A;  1Q5W B;  3DBH I;  3NZ3 A;  4FJV B;  2UZR A;  3KLS X;  3VUY A;  2MJD A;  1FAO A;  1F9J A;  4GIV A;  4KSK C;  3SNH A;  2N9X A;  2QKM A;  1J7C A;  1CZP A;  3W9C B;  2V0G A;  1DIK A;  5D3V A;  3ZQ4 A;  4I6N B;  3Q8A A;  2KO3 A;  3JW0 X;  1TIF A;  2G9H D;  2K8E A;  2G35 A;  2W2X C;  1FHO A;  2KYW A;  2KN4 A;  3NHE B;  1V5P A;  1V89 A;  2L1C A;  2W55 A;  2JWZ A;  3L0W B;  4J6I A;  1JDE A;  5D2M B;  4WWM A;  1TJ6 A;  3JVZ X;  2MCN B;  3DQV A;  3PRP B;  3N20 C;  4IM0 A;  2SAK A;  1ZYI A;  4JK7 A;  1K52 A;  5HE1 A;  3DHH C;  2KMC A;  2BWF A;  3Q14 C;  4MGZ E;  1GG3 A;  3ZKJ C;  1R7S A;  2FJ9 A;  3KZ1 A;  4YSX B;  2WXI A;  1NTY A;  4N58 A;  2HTH B;  3HUI A;  2ICI A;  3A8P A;  2NBV B;  2R2Q A;  2DZK A;  1QQG A;  1VD2 A;  5D7G A;  3ZDT A;  1IBX B;  1FOE A;  2TSS A;  4IM2 A;  1V1O A;  3Q3N C;  1LXD A;  4WAA A;  3OHM B;  1ZP0 B;  4ZRK A;  3BVG A;  4US9 A;  4UDU C;  1GGO A;  2EC1 A;  3PSE B;  1HXY D;  2QHO A;  3R7R A;  3MC9 A;  5JVL A;  4RFB A;  3T3O A;  1AN8 A;  1DDW A;  1XKE A;  1XR0 B;  2KFJ A;  3OLM D;  1Y8R C;  1TXD A;  2N7D A;  1I2H A;  4EZL A;  1NVL A;  3AE4 B;  2ABD A;  2V76 A;  3P42 A;  2IGH A;  4AP4 C;  4GDK A;  2LRU A;  3EFU A;  2H89 B;  5LOP B;  1MAI A;  5LXH A;  2RRF A;  2PTL A;  3W1S A;  1UWX A;  4KX6 B;  4E74 A;  2IDY A;  1J0W A;  4DDG D;  1ZE3 D;  3R7Q A;  4BVU C;  5IKC M;  3CMM B;  2KAN A;  1U5F A;  2D10 A;  4WQM A;  1J8C A;  3DOW A;  4WWP A;  4FHK A;  3B2G A;  4N6E B;  1OQY A;  3HRD D;  3QX1 A;  1JRU A;  1SE2 A;  4WJN A;  4W9G A;  1CK1 A;  2DZI A;  1V6E A;  2INP E;  4BKS A;  1F2R C;  3H7S A;  3A4S C;  3PV1 A;  3ODX A;  2PVO D;  4DHJ D;  3TCA A;  1M7E A;  1NU2 A;  2AQ2 B;  1WE7 A;  3UF8 A;  3RNE C;  2Z14 A;  1WXQ A;  5HE0 A;  5C16 A;  1KZG A;  1YX6 B;  4FJZ A;  5J3T A;  2ZW0 A;  4QJ4 B;  2L3Z A;  4ANW A;  2KN5 A;  2JZP A;  1H10 A;  4K3C A;  1XF5 L;  3ZVR A;  2BB6 A;  2JXT A;  2KJ6 A;  1TS5 A;  4KZC A;  3IT4 B;  2UU7 A;  2PPH A;  2RMM A;  2DYM A;  4G3X B;  2WXO A;  4WJP A;  3SR6 A;  3A8Q A;  4A5K A;  3B0A A;  5KHO A;  1PMS A;  3Q8C A;  5C5B A;  2YS3 A;  4LK0 M;  3V3X A;  1D5X C;  4XE0 A;  1WJ1 A;  1KLU D;  3HSA A;  2BYE A;  4RM8 A;  2KD0 A;  4MGK E;  5IN7 A;  2Y5B B;  1SE3 A;  2K1F A;  5CHW A;  1N60 A;  3RNF C;  4YT0 B;  2LZ6 A;  3Q3O C;  4PS8 A;  1X1G A;  4NZL B;  4A6H A;  3U52 E;  2XN9 C;  3GYP A;  1L4Z B;  2KUQ A;  1E5W A;  2MJ3 A;  2K9X A;  2WP9 B;  5EE0 A;  2H88 B;  2LKO A;  3N1Y C;  1Z87 A;  4XZ4 A;  4JK9 A;  2KDM A;  2ON8 A;  4XWT A;  1YJ1 A;  3PG7 A;  3AE9 B;  3K9O B;  2BVC A;  5HG2 A;  4ZRP A;  2LGD A;  4MEL A;  4YL8 A;  2I5C A;  1AWE A;  1V1P A;  2B3A A;  2RSG A;  5KQ1 A;  2QSD A;  3WAM A;  4C0A A;  2IYD B;  3WAO A;  2YT2 A;  1P3Q U;  2KLC A;  1MK9 B;  3FIL B;  2KGX B;  3U30 A;  2G4D B;  3ML4 A;  3DXE A;  1TTN A;  1DOI A;  3TEY A;  2EMT A;  1BTK A;  1V88 A;  4TMA B;  3E9S A;  4LDT D;  3TJP A;  4YTN B;  4CO7 A;  4KAX B;  3RNB C;  2ZEQ A;  4TKN A;  1JW9 D;  2N9K A;  1S1Q B;  1DDM A;  3NW8 A;  3A1Q B;  2DLW A;  2D4Q A;  3DXC A;  3BYT B;  2G3Q B;  1Z5S B;  2JYE A;  1MG8 A;  4M01 A;  4IG7 B;  4YTP B;  3L4P A;  1MKE A;  3C19 A;  1ZOY B;  1JML A;  4B0M A;  3LB8 C;  4NSW A;  3RCZ A;  3EA6 A;  2W2X D;  5L81 A;  3AEG B;  1F1H A;  1KM7 A;  5KQ4 A;  1ESF A;  1XD3 B;  4EOY A;  4DX9 0;  3P4P B;  4TQ0 A;  1HB6 A;  3M63 B;  3VXW A;  3IHP C;  2M38 A;  4K2P A;  1WGR A;  5J2R A;  4W9F A;  4ZRQ A;  3L10 B;  5IP4 D;  2HTH A;  2R2O A;  4IC7 B;  2KR0 A;  3ULB A;  1X1F A;  1WR1 A;  2LBB A;  3SBT A;  2CR5 A;  4TSS A;  4HB2 B;  1E7U A;  3BVZ A;  3N1X C;  2MRP A;  1C1Y B;  4WIP A;  2K0P A;  1B1Z A;  2NPT A;  2HRJ A;  1ZSQ A;  2MEK A;  2M1M A;  3NG0 A;  1TYG B;  1FGZ A;  4BKG A;  3Q8B A;  1JQ4 A;  2DLB A;  3X23 A;  4AWJ A;  1E9M A;  2EMS A;  1CJE A;  4S0R A;  3TIX A;  2GBN A;  2RGF A;  1YN4 A;  2O6V B;  2W2W A;  2IFS A;  5C1Z A;  3CSF A;  5D94 A;  3TFM A;  2V9H A;  4F7U P;  1R4M B;  2N9E B;  5C79 A;  1WXA A;  4AJW A;  4JK8 A;  4GMV A;  1R4N I;  2RDH A;  3RZW C;  1QOF A;  1GAQ B;  1UEF A;  4ZRJ A;  1K53 A;  2Y3A A;  4KGT A;  3WIM A;  2AX5 A;  2IYB A;  3KQ4 A;  1QKZ A;  3DCX A;  3QAR A;  2BS2 B;  5T8I A;  3ZW3 A;  1VDV A;  1U5E A;  3AE7 B;  5D3D A;  3NY5 A;  1SE9 A;  1ISN A;  4OVV A;  1EAZ A;  3AEF B;  5BMG A;  3TBL D;  3M3J A;  3ZTC A;  1ZDV A;  1RM6 C;  4IDI A;  3DWM A;  3W5V B;  1X11 A;  2X8X X;  3VIA A;  1N6Z A;  1JRP A;  2YEP B;  2Q13 A;  4HCP B;  3A4R A;  1BTN A;  2KAJ A;  1FNU A;  1IYF A;  3VRB B;  4F8C B;  4GN1 A;  3BVM A;  2GBM A;  1WE6 A;  2PE9 A;  1U2B A;  1FFV A;  2KJH B;  2ZW1 A;  4KHA A;  2RDB C;  2X18 A;  3UGB B;  3WAN A;  2YS5 A;  1E8Y A;  1YX5 B;  2SEB D;  4HSI A;  2WWZ A;  2C7M B;  3V6E B;  4KIK A;  2XK5 B;  2KQ7 A;  3A1Q A;  3RN9 C;  3KRX A;  5AZH A;  1TS2 A;  2O2V A;  1I7A A;  1UGJ A;  1VJK A;  2LMC A;  1ZM0 A;  1WRD B;  4RGO S;  2LUL A;  3WCQ A;  3V62 A;  1QLB B;  3MP9 A;  1L2N A;  2MX2 A;  3SFE B;  1QZE A;  3KWL A;  3NVY A;  2LI5 A;  5BMH A;  4NJ7 A;  1EWY C;  1WJN A;  4HJK A;  4A6F A;  3E9P A;  1E8X A;  1RJ2 A;  3O13 A;  5E6O A;  4RH6 A;  2IO1 B;  1PDX A;  1FXI A;  3T06 A;  1RFK A;  3H7P A;  2DN6 A;  2CKH B;  2K8H A;  3VVW B;  4LNF A;  3HIZ A;  5J17 A;  4KKI A;  3DBS A;  2COF A;  2G1E A;  3RNG C;  4HRS A;  5I2S A;  1IP9 A;  3KSY A;  2FBW B;  2YEP F;  4EFO A;  1MI1 A;  1C9F A;  2BS4 B;  2ADZ A;  4GPT B;  2MWS B;  2WXM A;  4MSQ B;  2R2Y A;  3IVF A;  1TBE A;  2WDR B;  1FO4 A;  1TZ1 A;  1WR6 E;  2G45 B;  3SD5 A;  1WGU A;  1DYQ A;  4EKU A;  3I3T B;  1L7Y A;  4RGN A;  2FNJ B;  3RNC C;  3VDZ A;  3P4Q B;  2MBO A;  2D5G A;  4P1C C;  3APF A;  1H8C A;  2Z13 A;  4Z2N A;  2AWT A;  4KGS A;  2DX1 A;  2DYO A;  4W9J A;  4K7U A;  4PQ0 A;  3MFG A;  4E3C A;  1N5X A;  4ANV A;  2I1K A;  4J3O D;  1XOD A;  2KVR A;  3O96 A;  4WJ7 A;  2LHD A;  5JHH A;  5EFX A;  4GZU A;  4IAP A;  3GE8 C;  3ZNZ B;  2WH5 A;  1Q1O A;  2JX5 A;  1XLP A;  4W9I A;  4BZA A;  4GNK B;  1HBK A;  1BXT A;  1DDV A;  1UH6 A;  4WWO A;  1JWS D;  4M8M A;  4NJC A;  1ST7 A;  1WGH A;  1UBI A;  3QA8 A;  1I4R A;  3RCP A;  3P4S B;  3HW2 B;  4IWQ A;  5EE3 A;  3HK0 A;  3RUL A;  3DDC B;  2ZPY A;  3V61 A;  1S3S G;  2MSE D; 
#chains in the Genus database with same CATH homology
 3ZNH B;  3PRZ A;  4BKS D;  3KUD B;  1V5U A;  3TL5 A;  3V5W A;  2KDF B;  3GYO A;  4XC2 A;  4G50 A;  4BKT A;  2HE7 A;  4JIO U;  2BWE S;  3EPY A;  5C5B B;  5CHF A;  4HDO A;  4JKA A;  4LJP B;  4HK2 A;  2N9P C;  3QWM A;  2BKF A;  2MP2 B;  2D3G A;  2LGY A;  2Y7B A;  3DCG A;  2DFK A;  4MJS B;  4ANX A;  4A6K A;  2KXJ A;  3AU5 A;  3AUL A;  3K9P B;  5GOW B;  1RRP B;  3MDB C;  2KC1 A;  2COA A;  5JHB A;  3PHW B;  4MDK E;  4W9K A;  2CHX A;  2VSZ A;  1UGM A;  3PP2 A;  4NPN A;  5D6J B;  2DYQ A;  4FLH A;  1P1A A;  2UZS A;  1H4R A;  3BY4 B;  3X0W A;  3OAW A;  4RM9 A;  2IBI B;  4PYU A;  3ECI A;  2GBR A;  1U29 A;  3QIJ A;  1WH3 A;  2O2V B;  3U7D A;  3R66 C;  2ZCC A;  3ZTD A;  2GBK A;  1DRO A;  3HQC A;  4EMO A;  2N1V A;  3ALB A;  5DI9 B;  5LLI A;  1Y19 B;  5L83 A;  2RNR B;  2LXA A;  4GU2 A;  4HAX B;  5IAA C;  4II2 B;  4ZRI A;  2BKR B;  3PS6 A;  3ZUN A;  2L2I A;  4KVG B;  4IWO A;  3MTN B;  2KWC A;  1LM8 B;  3H9D A;  4GSW A;  4NNJ B;  3E9O A;  5JH5 C;  1V5T A;  2FIF A;  2Z59 B;  2QKL A;  2DHK A;  3HM3 A;  3V60 A;  4EEW A;  2BPS A;  2L0T A;  2CY5 A;  4B6W A;  3VTW A;  2MWN B;  2BYV E;  5GMV A;  3AXC A;  2J0J A;  3E9L A;  2KOX A;  2VKI A;  3A9K B;  3ODO A;  1IRS A;  4Z2M B;  2LD9 A;  4M8N A;  2ZNV C;  4BOZ B;  1WM2 A;  4HB0 B;  4JKE A;  1BWN A;  4IFS A;  1N3H A;  3D32 A;  1B55 A;  4FAD A;  4DX8 A;  1SGH A;  2MBE A;  1KBL A;  1V2Y A;  1RFA A;  2FCN A;  5D3X A;  2Z0E B;  3L13 A;  4NY0 A;  1YD8 U;  5HE2 A;  2K39 A;  2PEA A;  1FB8 A;  4F1S A;  4HAU B;  3ZO5 B;  1V9J A;  4JKF A;  3Q3J A;  2D11 A;  2G4S A;  2KHW B;  3M62 B;  1SIF A;  3Q3F A;  1NTV A;  4G11 A;  3ONS A;  4PNK A;  2EJ8 A;  2K25 A;  3ULC A;  2K8B A;  3SV1 A;  2L7R A;  1ZC4 B;  2AEH A;  2WX1 A;  2KMA A;  3UZT A;  4YON A;  4GOC A;  4W9C A;  1NBF C;  3WYF B;  2DEN B;  2PE6 B;  2KX3 A;  2JVC A;  4KV2 A;  2DTC A;  2L05 A;  4HHV A;  2CY4 A;  2LVQ A;  4EZJ A;  2C9W B;  2I5F A;  4JL9 A;  3KH0 A;  2FCQ A;  4WQO B;  3A98 B;  1KOT A;  2I1J A;  4WJO A;  4IUM B;  3APC A;  2A5U A;  4RMA A;  1OTR B;  3PTF C;  3CF6 E;  2IZV B;  2H7D A;  2FUH B;  3EEC A;  4KDL B;  4TQ1 A;  3N7C A;  2YT1 A;  2LWP A;  2RGN B;  3M1I B;  4HAT B;  3HHM A;  4HAY B;  3VH3 B;  3ZNG C;  3VAW A;  2ROZ B;  1TQZ A;  2HJ8 A;  2KDE B;  2NPT B;  3MHS D;  4A3P A;  2NCN A;  2KKC A;  3WAP A;  2CB8 A;  3ENE A;  1KLV A;  4NAW A;  3L17 A;  4EUT A;  1PLS A;  4NQL B;  4JKH A;  4B95 A;  1XCG A;  1LFD A;  3SDL C;  2DX5 A;  2ZVO A;  2MFQ A;  1CMX B;  2N4F A;  2KFK A;  3KW5 B;  1VBH A;  5EDS A;  4NJ6 A;  3SO6 A;  1WGG A;  1UPR A;  1GNU A;  2DAJ A;  4HAZ B;  2PZ1 A;  1XQQ A;  1FGY A;  4JQW C;  2D07 B;  1RLF A;  1EVH A;  3G9W A;  2IY1 B;  4ILG B;  3IFW B;  4JLC A;  3D8F A;  3FLV A;  5DHA B;  2DIK A;  4IWP A;  1P9D U;  2KCJ A;  2J7Q B;  3KUC B;  1UNQ A;  2O6V D;  5DPT A;  5JP4 A;  3BIN A;  1OEY J;  1DBH A;  5KHQ A;  3FM8 C;  2EKE C;  2JZ3 B;  3A9K A;  1WGY A;  2V1Y A;  4IW0 A;  1EUV B;  5LXI B;  2CU1 A;  4K1R B;  3OAN A;  1WZ3 A;  3GZN I;  2JPH A;  2D9X A;  3MJW A;  1WXV A;  5IJM A;  2R0D A;  4N9F 4;  3QCA A;  2LOZ A;  3H1U A;  4LJO B;  2D9Z A;  4GDK B;  3QJZ A;  5DH9 B;  2YLM A;  2MQJ A;  5G2N A;  5AZF A;  2RUK B;  3QAQ A;  3C0R B;  3TW1 A;  2LAS A;  1AQC A;  2JRH A;  3L08 A;  2LJ5 A;  4F7G A;  2IO2 B;  3SU8 X;  1HE8 A;  1UBQ A;  2ZZP B;  3OJ3 A;  2GS0 A;  2K00 A;  3KYC D;  1UPQ A;  2CAY A;  2K6D B;  3ML9 A;  5C23 A;  4JKC A;  2GCL A;  1X1M A;  2PJH A;  2FCS A;  3ZVV A;  1AAR A;  5CHV C;  4HPL B;  1U5D A;  2D9Y A;  2R09 A;  4BBN F;  2JXX A;  2KK8 A;  3PSC A;  1RAX A;  2OTX A;  3D8D A;  2ROV A;  4MGI E;  2LG1 A;  1WX9 A;  4AOF A;  3L54 A;  2AL3 A;  2COD A;  4W9H A;  2K6Q A;  2FCM A;  3A9J B;  1V49 A;  4I6P A;  4MM3 A;  1W1H A;  3ZRF A;  2DHZ A;  5FI1 A;  2C7N B;  4HAV B;  1UNR A;  3SHQ A;  3UQA A;  4ZYN A;  1UEL A;  4MH0 E;  3KVF B;  1VBG A;  4I6L B;  2JUO A;  1WM3 A;  2NBW B;  2MBB B;  2BCJ A;  4B9K A;  4GDL B;  3QWZ B;  3SUZ A;  2CRF A;  2ELA A;  2KDI A;  3PVW A;  4HVB A;  2COP A;  1GC6 A;  2ZCB A;  5BO4 B;  2L76 A;  4AJY B;  4MT7 A;  3WAL A;  5CTR C;  2LOX A;  4JKD A;  4II3 B;  2LGX A;  3TO1 A;  3JSV B;  3SBG A;  1RRB A;  2ASQ A;  3APD A;  4HCN B;  3UIO B;  1D3Z A;  1IPG A;  2KJR A;  2RLO A;  5DPR A;  1EF5 A;  4A6F B;  2JT4 B;  1P3R A;  3W1S C;  2KC2 A;  5D3W A;  2D9V A;  3ZDM C;  3UQB A;  2OQB A;  2COC A;  2E2X A;  4KHB B;  3CXB B;  4TUU A;  4WWN A;  3H6N A;  4DWF A;  5C6R A;  1P98 A;  1WI1 A;  2LRW A;  3VUX A;  5JHG A;  4WJQ A;  3RYT A;  2BGF A;  4F7H A;  4K81 A;  1EF1 A;  1W1D A;  2JP2 A;  4PYZ A;  2DHJ A;  2XEW A;  3KRW A;  3AJ4 A;  2MW5 A;  2KLG A;  3N32 A;  4M0W B;  2WDT B;  4LDT B;  1X05 A;  2R82 A;  2DYB A;  2DKQ A;  2LUE A;  1WJ4 A;  5DPS A;  2GCJ A;  2N7E A;  3NS8 A;  1MIZ B;  1M7R A;  4KZ0 A;  3TMP B;  2A4Z A;  2MLB A;  1ACA A;  3JYU A;  2LYD A;  1PFJ A;  5AZG A;  2KDB A;  3DBL I;  2ZJD A;  2YF0 A;  3CIK A;  3KYD D;  3PLU A;  2P0F A;  3FP5 A;  4HDQ A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  3VH4 B;  5G55 A;  4OVU A;  4HLE A;  4HXD A;  4PS7 A;  3FEH A;  1P6S A;  3V6C B;  2CQU A;  3EC8 A;  5FR6 A;  2LVO A;  4CYE A;  1LW3 A;  4ICV A;  2DYN A;  2OOB B;  3HM6 X;  2CS4 A;  4DBG A;  4FUL A;  1VCB A;  1WGQ A;  2V4L A;  4URK A;  2FJL A;  2O6V A;  1DYN A;  1TGZ B;  4JKG A;  1WMH B;  1OEY A;  2KWU B;  3VQI A;  1YQB A;  2LVP A;  2YVC A;  1KZ7 A;  5FI0 A;  2Y8F A;  3JSV A;  2Z0D B;  2KTF A;  3VTV A;  2UYZ B;  4W9E A;  1WIA A;  2Y8G A;  2NR2 A;  3VTU A;  3M95 A;  2UVM A;  2YS1 A;  1UD7 A;  1UZX B;  3F5R A;  1E7V A;  4MY6 A;  2C7H A;  3UIP B;  3T9L A;  4X57 B;  4PS3 A;  3VOQ A;  4K17 A;  2DZM A;  2KQS A;  1K8R B;  4A20 A;  1ZC3 B;  2NS5 A;  4P7I A;  1X86 A;  1E90 A;  5AEK B;  3PZD A;  3PPA A;  2GJY A;  4DK5 A;  2P0H A;  2IO0 B;  3W1Y A;  3D8E A;  2C60 A;  3EHV A;  1G6J A;  2KTR A;  3P6A A;  1A5R A;  1QC6 A;  1V61 A;  2GOW A;  3DPD A;  1T0Y A;  2YSZ A;  4BBN C;  1Q67 A;  4BFR A;  3KUZ A;  3H7P B;  1EGX A;  3E66 A;  1WFY A;  1M94 A;  3NSU A;  3FSS A;  4ILJ A;  1LQB A;  1ZW7 A;  1WGD A;  2JZZ A;  2OJR A;  2DAF A;  3ZRC A;  1V5M A;  3VUW A;  4GDL A;  1WJ6 A;  2IY0 B;  2J59 M;  4CHJ A;  1UNP A;  3NOB A;  3DXD A;  4HB4 B;  1WY8 A;  3L16 A;  1ZGU B;  1KI1 B;  4A3O A;  3PLV A;  2NMB A;  3DBR I;  4BOS C;  2RQ1 A;  2P8V A;  2K2J A;  4GGQ A;  1OGW A;  2IO3 B;  1WF9 A;  4EJN A;  1PQS A;  2N23 A;  2ELB A;  4TYZ A;  3QBV B;  4KDI C;  3PVL A;  4KHO A;  5HKH A;  3F0W A;  4D0N B;  1Q0W B;  4EZK A;  4GMX B;  2Z0O A;  4HPM B;  3DVG X;  3A9J A;  2KTR B;  4MGY E;  2JY6 A;  2K2U A;  2ZPN A;  3B1L X;  3LJ3 A;  3AI5 A;  3PEG A;  1NTI A;  2KX0 A;  1WJM A;  3T8M A;  3LJU X;  3GOE A;  2WX0 A;  5D3Y A;  5TR5 A;  2KNB A;  4FJY A;  1WXM A;  4KIK B;  5JZE B;  4MK0 A;  3UIN B;  2ZVN A;  4JKG B;  1WMH A;  4FBJ B;  2NZ8 B;  4XWX A;  2VRW B;  4MJS A;  1KJT A;  3PVU A;  1WG7 A;  4DHZ B;  1LB1 A;  4WSF A;  1GUA B;  1EO6 A;  3QC8 B;  3PHX B;  3RD2 A;  3DVN V;  4LCD E;  3PRE A;  1U5G A;  2X0S A;  2DKP A;  1R4M I;  2FAZ A;  3PRM B;  3MPX A;  3P2B A;  3QK0 A;  1E8Z A;  1ZVR A;  2RSU A;  1J19 A;  4WVF B;  2Z0P A;  4HB3 B;  1P5T A;  2N0Y A;  5LON B;  4DHZ E;  4MEM A;  2RR9 A;  1NDD A;  1GC7 A;  5CLL B;  2MBH A;  2M0X A;  2CHZ A;  4NAW B;  2V3S A;  1OY2 A;  2VRR B;  2FID A;  2D9W A;  2DX5 B;  2YRY A;  4ZDV A;  1YIW A;  3A33 B;  1BAK A;  3OJ4 B;  2MBQ A;  4HWI B;  3PGE A;  5J3Q A;  5KCV A;  2XBB C;  4B6H A;  3NZU A;  5D27 A;  1BT0 A;  3QHT A;  3CST A;  2W9N A;  1ZKH A;  4G0N B;  5DPW A;  4F7Z A;  4HAW B;  2CHW A;  3WA0 A;  1V86 A;  3AU4 A;  1C3T A;  2L8J A;  5CLQ B;  2LXC A;  3KY9 A;  3SYX A;  4E71 A;  1P0R A;  4ILH A;  4DDI D;  3ZLZ A;  3TVV A;  2M17 A;  5E6N A;  2GBJ A;  2M8S A;  4GB9 A;  5JLJ B;  4K2O A;  2DHI A;  1Y5O A;  2Z0Q A;  1WYW B;  4DBB A;  3DVN U;  2JRI B;  1MIX A;  3R3M A;  2MDX A;  1K5D B;  3ODW A;  4JGH B;  3S2A A;  1WZ0 A;  4DXA B;  2REX A;  1XD4 A;  3QQ8 B;  1V5O A;  2M4N A;  2JF5 A;  3DVG Y;  1FHX A;  2KWV B;  4W9D A;  5CX3 A;  2NBU A;  5J18 A;  3ZNI D;  2ZNV B;  2AL6 A;  4JKB A;  2MP2 A;  3NZS A;  5IA7 A;  2NVU I;  3ZIM A;  4KSL C;  5E6P A;  1HB8 A;  1U27 A;  4IOY X;  2J0M A;  2XQN M;  5HE3 A;  4FN2 A;  4NQK E;  1W1G A;  3RZF A;  5DHF B;  2L00 B;  3O65 B;  1GJZ A;  1V80 A;  2GMI C;  1WX8 A;  4FHJ A;  3PT2 B;  3VHT C;  1V81 A;  1Z2M A;  5DCN A;  4ASW C;  1WVH A;  3VFK A;  1I42 A;  1K5G B;  3RUI B;  3ENB A;  2N1W A;  2UWQ A;  1WX7 A;  4K7W A;  1NI2 A;  2BF8 B;  4GXB A;  4W9L A;  2J0K A;  2KFK B;  1FXT B;  1MK7 B;  3B08 A;  1WJU A;  2M14 A;  2KUP A;  2RVB B;  2HD5 B;  2K8C A;  2RPQ A;  2H7E A;  4AUQ C;  2AYO B;  4Y94 A;  1WXS A;  3IBE A;  5JHA A;  4MSM B;  2YT0 A;  4XX5 A;  2DA0 A;  2D2Q A;  5J3Y A;  1U4A A;  1XT9 B;  4L6E A;  4K7S A;  4ICU A;  2FDQ A;  2WYQ A;  2RD0 A;  1OQN A;  3BJI A;  4DHJ B;  2KZR A;  4CHM A;  1MPH A;  3N3K B;  1FHW A;  3LDZ E;  2MKR A;  4TV3 A;  2BYF A;  4ANU A;  4H8S A;  2P0D A;  1WI0 A;  4IM3 A;  1J0G A;  3RT3 B;  1XX0 A;  3ML8 A;  3IG3 A;  5DIF B;  2DZJ A;  2L0F A;  4BBK A;  1E8W A;  2C5L C;  3U8Z A;  1KC7 A;  1OMW A;  4CHK A;  1SHC A;  1I35 A;  3P7Z A;  3N30 A;  1Q5W B;  3DBH I;  4FJV B;  2UZR A;  3VUY A;  1FAO A;  1F9J A;  4GIV A;  4KSK C;  3SNH A;  2N9X A;  2QKM A;  1DIK A;  5D3V A;  4I6N B;  2KO3 A;  3JW0 X;  2G35 A;  2W2X C;  1FHO A;  3NHE B;  1V5P A;  1V89 A;  2L1C A;  2JWZ A;  3L0W B;  4J6I A;  1JDE A;  5D2M B;  1TJ6 A;  3JVZ X;  2MCN B;  3DQV A;  3PRP B;  4IM0 A;  4JK7 A;  5HE1 A;  2KMC A;  2BWF A;  4MGZ E;  1GG3 A;  3ZKJ C;  2FJ9 A;  3KZ1 A;  1NTY A;  2HTH B;  3A8P A;  2NBV B;  2R2Q A;  2DZK A;  1QQG A;  1VD2 A;  5D7G A;  3ZDT A;  1FOE A;  4IM2 A;  1LXD A;  4WAA A;  4ZRK A;  1GGO A;  2EC1 A;  3PSE B;  2QHO A;  3R7R A;  5JVL A;  1DDW A;  1XKE A;  1XR0 B;  2KFJ A;  3OLM D;  1Y8R C;  1TXD A;  2N7D A;  1I2H A;  4EZL A;  1NVL A;  2ABD A;  2V76 A;  4AP4 C;  4GDK A;  2LRU A;  3EFU A;  5LOP B;  1MAI A;  5LXH A;  3W1S A;  4E74 A;  1J0W A;  4DDG D;  3R7Q A;  4BVU C;  3CMM B;  2KAN A;  1U5F A;  2D10 A;  1J8C A;  3DOW A;  4WWP A;  4FHK A;  1OQY A;  3QX1 A;  1JRU A;  4WJN A;  4W9G A;  4BKS A;  2DZI A;  1V6E A;  3H7S A;  3A4S C;  3PV1 A;  3ODX A;  4DHJ D;  3TCA A;  1M7E A;  1NU2 A;  1WE7 A;  3UF8 A;  5HE0 A;  5C16 A;  1KZG A;  1YX6 B;  4FJZ A;  5J3T A;  2L3Z A;  4ANW A;  2KN5 A;  1H10 A;  3ZVR A;  2KJ6 A;  4KZC A;  2PPH A;  2DYM A;  4G3X B;  4WJP A;  3A8Q A;  4A5K A;  3B0A A;  5KHO A;  1PMS A;  5C5B A;  2YS3 A;  1WJ1 A;  2BYE A;  4RM8 A;  2KD0 A;  4MGK E;  2Y5B B;  2K1F A;  5CHW A;  2LZ6 A;  4PS8 A;  1X1G A;  4A6H A;  3GYP A;  1E5W A;  2LKO A;  1Z87 A;  4XZ4 A;  4JK9 A;  1YJ1 A;  3PG7 A;  3K9O B;  2LGD A;  4MEL A;  4YL8 A;  2I5C A;  1AWE A;  2B3A A;  2RSG A;  5KQ1 A;  3WAM A;  4C0A A;  2IYD B;  3WAO A;  1P3Q U;  2KLC A;  1MK9 B;  2KGX B;  3U30 A;  2G4D B;  3ML4 A;  3DXE A;  1TTN A;  2EMT A;  1BTK A;  1V88 A;  4LDT D;  3TJP A;  4CO7 A;  4KAX B;  2ZEQ A;  4TKN A;  1S1Q B;  1DDM A;  3A1Q B;  2DLW A;  2D4Q A;  3DXC A;  2G3Q B;  1Z5S B;  1MG8 A;  4IG7 B;  1MKE A;  4NSW A;  3RCZ A;  2W2X D;  5L81 A;  1KM7 A;  5KQ4 A;  1XD3 B;  4EOY A;  4DX9 0;  4TQ0 A;  1HB6 A;  3M63 B;  3VXW A;  3IHP C;  2M38 A;  4K2P A;  1WGR A;  5J2R A;  4W9F A;  3L10 B;  2HTH A;  2R2O A;  4IC7 B;  3ULB A;  1X1F A;  1WR1 A;  2LBB A;  3SBT A;  2CR5 A;  4HB2 B;  1E7U A;  2MRP A;  1C1Y B;  2NPT A;  2HRJ A;  1ZSQ A;  2M1M A;  1FGZ A;  4BKG A;  4AWJ A;  3X23 A;  2EMS A;  3TIX A;  2GBN A;  2RGF A;  2O6V B;  2W2W A;  2IFS A;  5C1Z A;  3CSF A;  5D94 A;  3TFM A;  4F7U P;  2N9E B;  4AJW A;  5C79 A;  1WXA A;  4JK8 A;  4GMV A;  1R4N I;  3RZW C;  1UEF A;  4ZRJ A;  3WIM A;  2IYB A;  3QAR A;  3ZW3 A;  1U5E A;  3NY5 A;  1SE9 A;  1ISN A;  4OVV A;  1EAZ A;  3TBL D;  3M3J A;  3ZTC A;  1X11 A;  3VIA A;  2Q13 A;  4HCP B;  3A4R A;  1BTN A;  1IYF A;  4F8C B;  4GN1 A;  2GBM A;  1WE6 A;  2PE9 A;  1U2B A;  2KJH B;  4KHA A;  2X18 A;  3UGB B;  3WAN A;  2YS5 A;  1E8Y A;  1YX5 B;  2WWZ A;  2C7M B;  3V6E B;  4KIK A;  2XK5 B;  2KQ7 A;  3A1Q A;  3KRX A;  5AZH A;  2O2V A;  1I7A A;  1ZM0 A;  1WRD B;  2LUL A;  3V62 A;  1L2N A;  2MX2 A;  1QZE A;  2LI5 A;  4NJ7 A;  4HJK A;  1WJN A;  4A6F A;  3E9P A;  1E8X A;  1RJ2 A;  5E6O A;  2IO1 B;  3T06 A;  3H7P A;  2DN6 A;  2CKH B;  2K8H A;  3VVW B;  5J17 A;  3HIZ A;  3DBS A;  2COF A;  1IP9 A;  3KSY A;  4EFO A;  2MWS B;  2ADZ A;  4GPT B;  4MSQ B;  3IVF A;  1TBE A;  1TZ1 A;  1WR6 E;  2G45 B;  3SD5 A;  1WGU A;  4EKU A;  3I3T B;  1L7Y A;  2FNJ B;  3VDZ A;  2MBO A;  3APF A;  1H8C A;  4Z2N A;  2AWT A;  2DX1 A;  2DYO A;  4W9J A;  4K7U A;  4PQ0 A;  4E3C A;  4ANV A;  2I1K A;  1XOD A;  2KVR A;  3O96 A;  4WJ7 A;  5JHH A;  5EFX A;  4GZU A;  4IAP A;  3ZNZ B;  2WH5 A;  1Q1O A;  4W9I A;  1HBK A;  1DDV A;  1UH6 A;  4WWO A;  4M8M A;  1ST7 A;  1WGH A;  1UBI A;  3QA8 A;  3RCP A;  3HW2 B;  4IWQ A;  3HK0 A;  3RUL A;  3DDC B;  2ZPY A;  3V61 A;  1S3S G;  2MSE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...