4NY0A

Crystal structure of ferm domain of human focal adhesion kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
329
Chain Sequence
b'ERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGLRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYGEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Focal adhesion kinase 1
publication title FAK dimerization controls its kinase-dependent functions at focal adhesions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 329
sequence length 329
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF18038 FERM_N_2 FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4ny0A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4ny0A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ny0A01
4HAWB 3N32A 2EMSA 4YL8A 2CHZA 1LM8B 2N7EA 4ZYNA 5HE0A 1NTVA 3QWMA 3ZNHB 2W2XD 1WGDA 4DHJB 2CHWA 3FEHA 1S1QB 4GN1A 3QA8A 1M7EA 4PQ0A 5JP4A 2ASQA 4MJSA 1NI2A 2HJ8A 5KQ1A 3NY5A 4BBKA 4DX90 2VRRB 2JWZA 4A3PA 1V81A 3TW1A 3B08A 3PLVA 2D9WA 5L83A 3UIOB 2LD9A 5DH9B 2MWNB 4OVUA 3RUIB 3PVUA 3SUZA 4B6WA 1VCBA 2NCNA 4HK2A 4CO7A 3O96A 2PE9A 4ZRJA 4WWPA 3HIZA 4MH0E 2ROVA 4HCPB 4A6FB 3GYPA 2BKFA 2N0YA 4DK5A 3SDLC 4NAWA 1GG3A 5D3WA 3Q3JA 3Q3FA 4HCNB 3RULA 2IYBA 3T06A 2JXXA 1BWNA 1X05A 4EKUA 2HRJA 1U5DA 4KZ0A 3UIPB 2V1YA 4AUQC 3VTUA 4FULA 1X86A 2WX0A 2VKIA 2MP2A 2FNJB 2ZCCA 4GSWA 3DBSA 2YS1A 4K7SA 1ZC4B 1WJUA 4DX8A 1LW3A 3QAQA 3V6EB 3H7SA 2YS5A 5DHFB 5G55A 1M94A 1U27A 1UNRA 2R0DA 2W9NA 2MFQA 1ACAA 1V5TA 4P7IA 3SD5A 1FAOA 1OEYA 2CHXA 1OMWA 3PTFC 2UVMA 4WQOB 4DXAB 1WE6A 4MGIE 2Y8GA 1FB8A 2I1KA 1JRUA 2HTHA 2ABDA 1FXTB 3T9LA 3A9KA 2COAA 2N7DA 5J3TA 3L0WB 2MKRA 4KIKA 2LG1A 2DKPA 2KCJA 4HB4B 4LCDE 4GOCA 1WX9A 2DAJA 4ICVA 3RCPA 3L08A 2MBBB 2X18A 3PEGA 2YSZA 3H7PB 2M17A 5J2RA 4NQLB 3G9WA 2V4LA 2MLBA 2JUOA 2O6VA 2RD0A 1ZC3B 2G3QB 4MGYE 4HB2B 3PV1A 5IAAC 4B95A 2J0JA 3U30A 5JHHA 1DDMA 3ODXA 2JF5A 1DBHA 2Y7BA 1WR6E 1GJZA 3ZNID 3LJ3A 1MIXA 2DFKA 4KHAA 3QJZA 4ANXA 3NZUA 2DAFA 2WYQA 3AXCA 3UF8A 1P3QU 4OVVA 3L13A 2KDBA 2KK8A 4DBBA 1J0WA 3EC8A 2GBNA 3SHQA 1K5GB 1NTYA 1ZGUB 5JHBA 3P2BA 3WA0A 3VH3B 4HAYB 5DIFB 3MJWA 2IZVB 4XX5A 1V89A 2GOWA 3FP5A 4MM3A 2B3AA 1WZ3A 1LXDA 1UBQA 3VTWA 2KTRA 2FCQA 1BAKA 5LONB 3CIKA 4HWIB 5LXHA 3L54A 3MTNB 1WMHA 1WR1A 2DZIA 3PP2A 3DPDA 4JGHB 4K81A 2BGFA 3ZNZB 4HPMB 2K2UA 3S2AA 1TXDA 2CKHB 2KJHB 5KHQA 4ANWA 4PNKA 3A4RA 5EFXA 3TBLD 3ULCA 2GCJA 4KSKC 4GDLA 4IWQA 3HW2B 2XK5B 4M8MA 2CRFA 3P7ZA 1WZ0A 3IBEA 4E71A 3TO1A 3KUZA 2R2QA 4RMAA 4IWOA 4WWOA 2OJRA 2MBEA 3ULBA 1OQNA 5LLIA 3LDZE 2RSGA 4MDKE 1DYNA 3A8PA 2C7HA 2AEHA 2DKQA 3JW0X 5HE3A 2HD5B 2DHIA 4HJKA 2C60A 1BTNA 2OQBA 2CU1A 5D3YA 1ZW7A 4LJOB 3SV1A 1P9DU 4GDKB 3V60A 1X1FA 2KWCA 3L17A 1OQYA 3ZLZA 2Z59B 2ZJDA 1YJ1A 2DX1A 2KFKB 4H8SA 4F7UP 2BYEA 1C3TA 3KYDD 2ZZPB 4Z2MB 1NVLA 4KZCA 4EOYA 2R09A 1DDVA 4TQ1A 2D9ZA 3A8QA 1GUAB 1V5PA 4MSQB 4AJYB 5J18A 1V88A 3DBLI 1RFAA 3A1QA 1Y19B 3BINA 2JRHA 2MBHA 2W2WA 4KHBB 3QX1A 2VSZA 1NTIA 2Z0EB 2L1CA 4W9LA 2CB8A 1PQSA 2NVUI 3JSVB 2P0DA 2UZSA 1TZ1A 3OJ3A 2LUEA 4G0NB 2K6QA 2LVQA 4WAAA 4HAZB 5FR6A 2MX2A 1UGMA 3HM6X 2P0HA 2ZEQA 4W9FA 4TYZA 2N4FA 2NBWB 4A5KA 2LWPA 4URKA 4KHOA 2KWVB 3TIXA 5FI1A 1Q5WB 4MY6A 4NNJB 1K8RB 3ZVVA 2LVOA 4GGQA 2PEAA 3A9JA 2JVCA 2RGFA 4EZLA 1WM3A 2LOXA 3QC8B 5LXIB 1SE9A 2RLOA 3GYOA 2M38A 1WH3A 2QKLA 2ZVOA 5D7GA 2DN6A 1Q1OA 2MWSB 1YQBA 1WX8A 4IWPA 1RLFA 3IFWB 4BKSA 1CMXB 2CAYA 3ZDTA 2DYOA 4GPTB 2N9PC 4HXDA 2LULA 2D10A 5D2MB 2GS0A 1QZEA 1EO6A 2DA0A 3R66C 3RD2A 4DDGD 2C9WB 4ZRIA 1TBEA 2FAZA 2M0XA 2D9XA 2RVBB 4NAWB 1PFJA 4M0WB 2KMAA 3UGBB 4GIVA 2DZKA 2DZJA 1S3SG 2JT4B 3KY9A 4NJ7A 2FCSA 4WJNA 2O2VB 5D6JB 4ANUA 2WDTB 4TUUA 2D9YA 3WANA 4BBNF 1OY2A 4HB0B 1Y8RC 4MT7A 2NR2A 3CF6E 3VUYA 1Z87A 1P1AA 4NJ6A 3AI5A 2L8JA 3SU8X 2D3GA 1H4RA 2CQUA 1E7VA 4IUMB 4CHJA 2OTXA 2LRUA 5L81A 5C1ZA 2K00A 1WIAA 3AJ4A 3V6CB 4WWNA 3HHMA 2GBRA 3GOEA 1OGWA 2REXA 4EUTA 3UQAA 5E6PA 4BOSC 1HE8A 2AL6A 4CHMA 5HKHA 2CY5A 1UPRA 4J6IA 5CHVC 4F7HA 4HVBA 2MBQA 2NPTB 4ZRKA 4BFRA 1P98A 2BF8B 2UWQA 1RJ2A 3TL5A 3KVFB 1D3ZA 2LGYA 2XBBC 2FUHB 2RNRB 4EZJA 4W9EA 3RZFA 1IPGA 3WAMA 3L10B 2KKCA 1V2YA 1W1HA 2LXCA 2M4NA 4NSWA 1WY8A 1RRPB 4G3XB 4NPNA 5G2NA 4IM3A 2PZ1A 3QWZB 5AZHA 5C16A 1MKEA 1WXAA 5J17A 3R3MA 2L0FA 3D32A 3NOBA 4A6FA 1NU2A 1E8XA 2COFA 1MK7B 4IG7B 1EF1A 4GZUA 4G11A 4AJWA 2WX1A 3H6NA 5CX3A 3MDBC 2NS5A 3OANA 4WVFB 5CLLB 3VDZA 3B0AA 1Z2MA 4A6HA 3DXCA 3FLVA 1FHXA 5DHAB 2ZNVB 4F7ZA 3APCA 1MIZB 4HDQA 2DENB 1H10A 4W9CA 4ANVA 1I35A 3TCAA 1WFYA 1F9JA 4IW0A 2EJ8A 1G6JA 5DPSA 2FIFA 1KZGA 2DYBA 5CHFA 2KDIA 2KC1A 3VIAA 4KDLB 2R2OA 1P3RA 5JZEB 2KLCA 2KDEB 2H7DA 2CS4A 2YVCA 4AOFA 1SIFA 4IFSA 3RCZA 4C0AA 2DHJA 3I3TB 4NY0A 5HE2A 1LFDA 2KD0A 3D8EA 4W9KA 3ML8A 2K6DB 1EF5A 2MDXA 5CHWA 1XKEA 2G4DB 4EMOA 1HBKA 2L3ZA 4WJPA 1EVHA 3X23A 3WAOA 2V76A 2P8VA 3ZKJC 3VUWA 4N9F4 4MGKE 2PJHA 4ZDVA 1IRSA 1ST7A 4GB9A 4RM9A 1AARA 5E6NA 1WXMA 2KOXA 3M1IB 1WRDB 4E3CA 2UZRA 4GMXB 4W9DA 3H7PA 2RQ1A 3A33B 4FLHA 1WXVA 1SGHA 5GOWB 2DX5B 1YX6B 1C1YB 3SYXA 4FJYA 5D27A 1GNUA 3OAWA 3PZDA 3EHVA 3K9PB 2C7NB 4PS3A 2KDFB 4WJQA 1ZKHA 3WAPA 2BPSA 3JVZX 4RM8A 3RT3B 1WI0A 3A98B 1YIWA 5C5BA 4BKTA 3T8MA 1WX7A 4II3B 1P6SA 1V49A 2LYDA 3KUDB 3VAWA 3ZIMA 2NBVB 2K1FA 3DCGA 1I42A 4JQWC 1U4AA 1WXSA 4JL9A 2DZMA 4B9KA 2O6VD 2MCNB 3KZ1A 1X1GA 1HB6A 3KYCD 2J0MA 2D11A 1TJ6A 3N3KB 3U8ZA 1UNPA 2BWFA 3IVFA 5DPWA 3AU4A 1V9JA 1WGRA 4II2B 3ZTDA 2GBMA 1J0GA 3VFKA 2ELAA 1V80A 4W9HA 1RAXA 4AP4C 3AULA 2CY4A 2K8CA 1HB8A 4HB3B 3V62A 1WG7A 1ZSQA 4LJPB 3ZO5B 2Y5BB 1LB1A 5JLJB 1W1DA 1Y5OA 5AZFA 2JY6A 5HE1A 4F1SA 2K25A 2WH5A 1E8WA 2XK5A 2KMCA 4HLEA 2IY0B 4GXBA 2LASA 1B55A 2KX3A 2JZZA 1UZXB 1J19A 3O65B 3VHTC 1WJ6A 4HAVB 4TKNA 1AWEA 2FJ9A 2DHKA 3VTVA 4K7WA 4A6KA 3DBRI 2ADZA 4IAPA 1QQGA 1MPHA 3QBVB 2L0TA 2C7MB 3EPYA 2ZPNA 4GDKA 4I6LB 2PE6B 1WI1A 2K8HA 3PRMB 4MGZE 1XX0A 4BOZB 1TTNA 1R4MI 5JHGA 5D94A 2KFKA 1A5RA 3P6AA 4EFOA 1WGQA 1KLVA 2QHOA 4CYEA 4PYZA 1U5EA 3A4SC 3VOQA 2IO2B 2CR5A 2COCA 4FADA 1XR0B 3DXDA 4MJSB 4W9IA 2QKMA 3KSYA 3DVGX 3SNHA 1QC6A 2PPHA 1YD8U 5D3VA 1E5WA 4IC7B 2M14A 4FJVB 3ZTCA 1UELA 3JSVA 1BT0A 3LJUX 1UBIA 3UQBA 2D2QA 2FIDA 2Z0OA 2K39A 2KLGA 1WGHA 5C6RA 4BKGA 3KUCB 1EUVB 5IJMA 1WYWB 2K2JA 2RGNB 5DPTA 4KAXB 2ZCBA 2L2IA 3EECA 2L00B 1EAZA 4B6HA 4FHKA 1PLSA 2KO3A 2Z0PA 1KM7A 3BY4B 4XC2A 2I5CA 5DCNA 4DWFA 3CMMB 1ZM0A 2YS3A 5CTRC 3ML4A 2LGDA 3IHPC 1WF9A 2IO0B 2AYOB 3ZVRA 2MP2B 4ASWC 2KWUB 2L7RA 3ZNGC 2AL3A 2IO1B 2FCNA 4HPLB 1V5MA 2L76A 1Z5SB 4FJZA 1SHCA 1E7UA 4DHZE 2LZ6A 3DVNV 3FSSA 1FGZA 3TMPB 3ZW3A 3FM8C 1LQBA 1P0RA 4JIOU 1WJMA 1BTKA 4X57B 1YX5B 3ZRCA 3CSFA 2BKRB 2J7QB 2A5UA 5AEKB 1Q0WB 2KNBA 4IM2A 1U2BA 3K9OB 1UD7A 3W1YA 2NMBA 4Z2NA 2K8BA 3R7RA 4F7GA 3PSEB 1GC7A 3KRXA 2HTHB 2LVPA 4BKSD 2O2VA 3A9KB 1L7YA 2A4ZA 1E90A 1WJ1A 3B1LX 4IM0A 3TFMA 1DDWA 4A3OA 3ENEA 2KFJA 3KW5B 4A20A 4KIKB 4LDTD 2KQSA 1XODA 2D9VA 3ZRFA 1WM2A 2KGXB 1WVHA 4I6NB 3PT2B 3N7CA 2LRWA 1XT9B 2KJ6A 4KSLC 1TQZA 4YONA 2J59M 1KZ7A 1V5UA 1KJTA 2O6VB 2FJLA 2WWZA 4KV2A 1NBFC 3H9DA 2DLWA 3U7DA 3WALA 3BJIA 4DHZB 5EDSA 3PG7A 2RPQA 2JP2A 2P0FA 1PMSA 5DPRA 2CODA 1FHOA 3DXEA 2ZVNA 4K2PA 1Q67A 4PYUA 2NPTA 1ISNA 1I2HA 4K2OA 5CLQB 2ZPYA 2IFSA 3M62B 1OTRB 3RYTA 2D4QA 3PREA 3N30A 4K1RB 2JRIB 3AU5A 2NZ8B 3PS6A 5C23A 2N1WA 3C0RB 4MEMA 1UPQA 3IG3A 1R4NI 1U29A 2M1MA 2ROZB 2E2XA 1U5GA 5KQ4A 3JYUA 2KTFA 3GZNI 2N23A 1XCGA 4FBJB 2KTRB 4FN2A 1ZVRA 3M3JA 4WJOA 2YF0A 4HATB 3PRPB 4DHJD 1WMHB 3OJ4B 4I6PA 3PVWA 4EJNA 2Z0DB 5FI0A 3QARA 2KVRA 3L16A 2DTCA 3ALBA 4BBNC 2RR9A 2MSED 4K17A 4GDLB 2GBJA 4ICUA 5C5BB 4GU2A 4FHJA 2FCMA 2AWTA 2N9XA 3QCAA 2IBIB 5L95C 4CHKA 1V6EA 4L6EA 2N1VA 2GCLA 4Y94A 5KCVA 2N9EB 4EZKA 4PS8A 1IP9A 3APDA 1GC6A 2GMIC 1UNQA 1P5TA 4GMVA 3W1SA 2LKOA 3ZDMC 3EFUA 3NZSA 1WGUA 2YRYA 3M63B 4KDIC 2D07B 2IY1B 1J8CA 4K7UA 2LI5A 2ZNVC 4PS7A 4TQ0A 1MK9B 5GMVA 2MBOA 3X0WA 2J0KA 3UZTA 3KH0A 3DVNU 2RSUA 2BYVE 2Y8FA 3W1SC 2KQ7A 4W9GA 3F0WA 2I5FA 3NHEB 1RRBA 1XD4A 1UH6A 3ONSA 4TV3A 1FOEA 3MHSD 3D8FA 5D3XA 1WGYA 2G45B 1AQCA 2MQJA 2V3SA 3QHTA 2ELBA 3PPAA 2MW5A 4KVGB 4W9JA 1K5DB 2L05A 3WYFB 4DBGA 4WSFA 2YLMA 5IA7A 3A1QB 1NDDA 1FGYA 2EKEC 2KZRA 3QIJA 5JH5C 3CSTA 3H1UA 3ZUNA 5DI9B 2BWES 3QQ8B 1FHWA 2Q13A 3SO6A 2DYNA 5C79A 3DBHI 2RUKB 1L2NA 1M7RA 4G50A 4MK0A 5E6OA 2VRWB 1MAIA 3PGEA 2IO3B 3VQIA 4JLCA 3WIMA 2KANA 3OLMD 1XQQA 4D0NB 2DX5A 4XZ4A 2LGXA 3M95A 3HK0A 3RZWC 1EGXA 2BYFA 2MA9B 3CXBB 4DDID 1MG8A 2EMTA 2Z0QA 3PHWB 2YT1A 2KUPA 1W1GA 3DDCB 3PRZA 1V61A 3A9JB 3F5RA 2KC2A 2KXJA 3ML9A 2XQNM 1WJ4A 2M8SA 2NBUA 2G35A 2DYQA 1T0YA 1UEFA 3VXWA 2G4SA 1I7AA 2I1JA 5BO4B 2C5LC 3PSCA 4MSMB 4HAUB 3UINB 3D8DA 2UYZB 3DVGY 2COPA 1WE7A 2GBKA 2LJ5A 3TVVA 3V61A 3APFA 4E74A 1OEYJ 2JZ3B 2W2XC 4HAXB 1KI1B 2KX0A 2JPHA 4LDTB 3NS8A 3R7QA 2LXAA 2HE7A 2GJYA 1KOTA 2BCJA 1WJNA 1E8YA 2EC1A 1DROA 2MRPA 3PVLA 1N3HA 1X11A 2KN5A 1VD2A 5J3YA 2H7EA 4IOYX 3QK0A 2IYDB 3NSUA 4MELA 3ODWA 1U5FA 2YT0A 2FDQA 3PHXB 1X1MA 1V86A 4HHVA 4NQKE 2DHZA 3TJPA 2KHWB 1E8ZA 3DQVA 4XWXA 3HQCA 2KJRA 1WGGA 2OOBB 3MPXA 4WJ7A 3KRWA 2XEWA 5LOPB 5J3QA 3VVWB 4M8NA 5TR5A 3HM3A 3PLUA 5AZGA 3ECIA 4HDOA 4FA6A 5KHOA 3ODOA 4BVUC 3DOWA 5JHAA 2LOZA 1V5OA 3VH4B 2LBBA 1TGZB 4AWJA 4F8CB 4EEWA 3V5WA 3VUXA 1IYFA 1XD3B 1H8CA 2DYMA
chains in the Genus database with same CATH superfamily
4HAWB 3N32A 2EMSA 4YL8A 1ZDVA 1YMHE 3EGRA 1PFDA 3GS2A 2CHZA 1LM8B 2N7EA 2JZPA 4ZYNA 5HE0A 1NTVA 3QWMA 1TJEA 4XYCA 2J52A 3ZNHB 1JWMD 2W2XD 2NMQA 1WGDA 4DHJB 1FXIA 2CHWA 3FEHA 1S1QB 1DOXA 4GN1A 3B2FA 3QA8A 1M7EA 4PQ0A 5JP4A 1FNUA 2ASQA 4MJSA 1NI2A 4L23A 2HJ8A 5KQ1A 2DWQA 2Z8LA 3NY5A 4BBKA 4DX90 3FILB 2VRRB 2JWZA 3HSAA 1KLUD 5IN7A 4A3PA 3P4RB 1V81A 1HTOA 1VDVA 3TW1A 3B08A 1TS4A 3PLVA 2D9WA 5L83A 3RNBC 3UIOB 2LD9A 5DH9B 2MWNB 1STEA 4OVUA 1KTKA 1FO4A 4KKJA 3C8YA 3PVUA 3RUIB 3SUZA 2MJ3A 4B6WA 1VCBA 2NCNA 4HK2A 4CO7A 3O96A 1L4ZB 2PE9A 4ZRJA 1CZPA 4WWPA 1CJEA 1FIQA 3HIZA 4MH0E 2ROVA 1C4CA 2E3TA 4HCPB 4A6FB 3GYPA 2BKFA 4R3DA 2N0YA 4DK5A 2XNAC 3SDLC 4NAWA 1PDXA 1ZUD2 1GG3A 5D3WA 3UI3A 3Q3JA 3Q3FA 5AUKA 2WDVB 1FNVA 3CIRB 4HCNB 1UUPA 1N6ZA 3RULA 1ENFA 2IYBA 3T06A 4WURA 3AEBB 2JXXA 1BWNA 1X05A 4EKUA 2HRJA 2D3BA 1U5DA 4KZ0A 3UIPB 4C56C 2V1YA 4LLGM 2D5GA 4AUQC 3VTUA 1M4VA 3W9CB 4FULA 1X86A 1HZ5A 3NVZA 1IBXB 2WX0A 2VKIA 2MP2A 3U12A 2FNJB 4YSZB 2ZCCA 1AW7A 1KF6B 4GSWA 3DBSA 2YS1A 1FFVA 4K7SA 1ZC4B 3DCXA 1WJUA 4DX8A 1LW3A 1XXGA 3QAQA 3V6EB 3TEWA 4ZHPA 1DOIA 4MT5A 3H7SA 2YS5A 5DHFB 5G55A 1M94A 2D3CA 1U27A 1UNRA 4EE2A 2R0DA 2W9NA 3AE7B 3A58A 2MFQA 1D5XC 1QOFA 1ACAA 3KWLA 4DXFA 2BS4B 1V5TA 4P7IA 1XLPA 3SD5A 1FAOA 2JWUA 1OEYA 2CHXA 3VR9B 1NYQA 1OMWA 3AE2B 3Q69A 3PTFC 2RRFA 2UVMA 4WQOB 4DXAB 1WE6A 4MGIE 2Y8GA 1FB8A 2ZKMX 2I1KA 1JRUA 2HTHA 2ABDA 1FXTB 1LO5D 4C7YA 2AX5A 3T9LA 4JKAA 3A9KA 2COAA 2N9KA 2N7DA 5J3TA 3AM9A 2MKRA 3L0WB 4KIKA 2LG1A 2DKPA 2KCJA 2K5PA 1D5ZC 4HB4B 4LCDE 4GOCA 1WX9A 3NRZA 2DAJA 4ICVA 3RCPA 3L08A 2MBBB 4DIXA 2X18A 3PEGA 2YSZA 5FK9C 1WXQA 2M17A 3H7PB 5J2RA 4NQLB 2DLBA 3G9WA 2JU6X 5IRSA 2JUOA 5I2SA 2MLBA 1ZC3B 2O6VA 2RD0A 1YN3A 2G3QB 2W82A 4MGYE 4HB2B 2V3NA 3PV1A 3AEAB 1TS5A 5IAAC 4B95A 2WXJA 2J0JA 2INDC 3U30A 2BB6A 5JHHA 1DDMA 1VJKA 3SR6A 3ODXA 1IGCA 2L52A 2JF5A 1DBHA 2Y7BA 1AN8A 1QKZA 1WR6E 2MH7A 1GJZA 1IUEA 4N6EB 1FXAA 4DQOC 3ZNID 3LJ3A 1MIXA 2DFKA 2YT2A 4KHAA 3QJZA 4ANXA 3FC4A 4NAMA 4YSXB 3NZUA 1GGOA 2DAFA 2WYQA 3AXCA 2K9XA 3MP9A 3UF8A 1P3QU 4OVVA 3L13A 2KDBA 3NS1A 3B2GA 1PUTA 1XLNA 2KK8A 4RFBA 4DBBA 3DBRB 1J0WA 3EC8A 2GBNA 4RNAA 3SHQA 1K5GB 1NTYA 1ZGUB 2BBCA 5JHBA 3P2BA 1NI3A 3WA0A 3LB8C 3VH3B 4HAYB 5DIFB 1EM7A 3MJWA 1ZXHA 2IZVB 1L0XB 4XX5A 1V89A 4OHJA 2IGDA 2GOWA 1J7CA 1MFWA 1QILA 3FP5A 1R4MB 3E9PA 4MM3A 5MPOA 3RNAC 1XCTL 2B3AA 4P6VF 1WZ3A 1LXDA 1MPEA 1UBQA 3VTWA 3O13A 2KTRA 4JE3B 1WWTA 2G9HD 2FCQA 1BAKA 5LONB 3CIKA 4HWIB 1HQRD 5LXHA 3L54A 3MTNB 1WMHA 1WR1A 2DZIA 3PP2A 3DPDA 2HJ1A 4JGHB 4K81A 4N58A 2BGFA 3ZNZB 3Q14C 4HPMB 2K2UA 3TEXA 4CQNA 1TXDA 2CKHB 3S2AA 2KJHB 5KHQA 3TUOA 4ANWA 3FAHA 1L5PA 4K3CA 4PNKA 3A4RA 5EFXA 1B1ZA 2FBWB 1T77A 3TBLD 3E9OA 3ULCA 4RGOS 3RNEC 2GCJA 2OJWA 1ET9A 3E56A 1I4RA 4KSKC 4XE0A 4GDLA 4IWQA 3HW2B 2XK5B 2M56B 3I63C 1UWMA 4M8MA 3I9V1 2CRFA 3P7ZA 4WIPA 1WZ0A 3IBEA 2ZW0A 4E71A 3TO1A 3KUZA 2R2QA 4RMAA 1TZOA 3NG0A 1MI0A 3AECB 4IWOA 2I38A 2INCC 4WWOA 2OJRA 2MBEA 3ULBA 1OQNA 3BK2A 5LLIA 5BMGA 4ILGB 3LDZE 2RSGA 4QJ4B 4MDKE 1DYNA 3A8PA 3SBGA 2C7HA 2AEHA 2DKQA 3JW0X 5HE3A 2R2YA 1JQ4A 2HD5B 2DHIA 4HJKA 2C60A 1BTNA 2OQBA 1V1PB 3DWMA 2CU1A 5D3YA 1ZW7A 4LJOB 4WQMA 3SV1A 1P9DU 4GDKB 3V60A 1X1FA 2KWCA 3L17A 1OQYA 3ZLZA 2Z59B 3P1MA 2ZJDA 1KH0A 2DX1A 1K50A 1YJ1A 3BZDB 2KFKB 3HIEA 4H8SA 2KWDA 4F7UP 2BYEA 1C3TA 4OZCA 1TY2A 3KYDD 5BMHA 2ZZPB 4Z2MB 2KMMA 1NVLA 2GRIA 4KZCA 2WXNA 5IP4D 3ZJTA 4EOYA 3ABVB 2R09A 1DDVA 4TQ1A 2D9ZA 3A8QA 1GUAB 4LTUA 1V5PA 4MSQB 4AJYB 5J18A 2WNMA 4YTMB 1V88A 3DBLI 1P7EA 1RFAA 3A1QA 1QQRA 1Y19B 3OWEB 3AN1A 3BINA 2JRHA 2MBHA 1BXTA 1D4BA 2W2WA 1VBGA 1JWUD 4KHBB 2CJOA 3QX1A 2VSZA 1NTIA 2Z0EB 2L1CA 4W9LA 3Q2AC 2CB8A 1PQSA 2NVUI 4M01A 3JSVB 3AE4B 2LMCA 2BS3B 2J4XA 2KQ4X 2P0DA 2UZSA 1TZ1A 4A8XC 3OJ3A 2LUEA 1F1HA 4G0NB 3AV8A 2K6QA 3AH7A 1GAQB 2LVQA 1L0VB 4HAZB 4WAAA 5FR6A 2MX2A 1UGMA 3HM6X 2K22A 2Q5WD 4HEA1 2P0HA 3J9CA 1YQ3B 2RPVA 2ZEQA 4W9FA 5E6JA 4TYZA 4QJ3B 2N4FA 4YT0B 2NBWB 4A5KA 2LWPA 4URKA 4KHOA 4YTNB 4B0EA 2KWVB 3TIXA 5FI1A 1Q5WB 4REZA 4MY6A 4NNJB 4P16A 1K8RB 3ZVVA 2KIEA 2LVOA 4GGQA 1HA5A 1NENB 2PEAA 1QOGA 3A9JA 4M00A 4QJ5B 1T3QA 1YN4A 2RDGA 2JVCA 1NEKB 2KT7A 2RGFA 3KQ4A 4CSQA 3RPFC 4EZLA 2PIAA 1WM3A 3KWVA 2LOXA 3QC8B 5LXIB 1SE9A 4XDDA 2RLOA 3GYOA 4PT5A 2M38A 1WH3A 2QKLA 2ZVOA 5BMIA 5D7GA 2DN6A 1Q1OA 3R2IA 3T3NA 2MWSB 1YQBA 2CU3A 1WX8A 2PLPA 1MG4A 4IWPA 4IOIE 1RLFA 2NTSA 4JK8A 5D3DA 3IFWB 5HG2A 4BKSA 1CMXB 2CAYA 2QMTA 4ARIA 1RFKA 2BTEA 3BYYB 1WRIA 3Q8EA 2JX5A 3ZDTA 2DYOA 3Q3NC 4GPTB 1L4DB 2N9PC 4HXDA 2LULA 2D10A 5D2MB 2GS0A 1QZEA 2MEKA 2BB5A 2X38A 1EO6A 2DA0A 1JCKB 1ZPSA 3P63A 3R66C 3RD2A 4DDGD 2C9WB 4ZRIA 1TBEA 2FAZA 1D5MC 2M0XA 3I5JC 2D9XA 2RVBB 4NAWB 1PFJA 4M0WB 4JK9A 2KMAA 2PW9A 3UGBB 4GIVA 1EU3A 1ET6A 2DZKA 2VZKD 2DZJA 1S3SG 1R4NB 3DHGC 2JT4B 3KY9A 2TSSA 3H8HA 4NJ7A 2FCSA 4WJNA 2O2VB 3GZNB 3P42A 5D6JB 4ANUA 1HTQA 2WDTB 4TUUA 2D9YA 3WANA 4BBNF 1OY2A 4HB0B 4QXAB 5I2MA 4XWTA 1UWXA 1Y8RC 4MT7A 2NR2A 3CF6E 3EUB2 3VUYA 1Z87A 1HZ6A 1P1AA 2Z14A 4NJ6A 3Q6BA 3AI5A 2L8JA 4OT1A 1D6EC 5EE3A 5EE1A 2WDRB 5IOIA 3SU8X 2D3GA 1F52A 1H4RA 2CQUA 1E7VA 2WGSA 4IUMB 2LJIA 4XGAB 4CHJA 2KYWA 2OTXA 1GB1A 2LRUA 5L81A 2WXRA 1FNWA 1WYGA 3EA6A 4OZBA 1AWDA 3AMZA 3PZ8A 5C1ZA 2K00A 1WIAA 1RM6C 3AJ4A 2JYTA 3V6CB 4WWNA 3HHMA 2KN4A 2GBRA 3GOEA 1SJHD 1XF5L 3TSSA 1UGJA 4MH8A 3NJTA 1OGWA 2REXA 4EUTA 3UQAA 5E6PA 4BOSC 1E10A 1HE8A 2KACA 2AL6A 4CHMA 5HKHA 2CY5A 1UPRA 4J6IA 3E9LA 4F7HA 5CHVC 4HVBA 2MBQA 4WAFA 2NPTB 3DHHC 4ZRKA 4BFRA 1P98A 1ROEA 5FR3A 5IO9A 2BF8B 1ACCA 4HSIA 3RI7C 2W3RA 2UWQA 1RJ2A 1C76A 2QEJC 3TL5A 3KVFB 2LUMA 1D3ZA 2LGYA 2XBBC 2FUHB 1PGAA 5JXVA 2RNRB 4EZJA 4W9EA 1N60A 3FILA 3RZFA 1IPGA 3WAMA 3L10B 4Q2JA 2KKCA 1V2YA 2FJUB 1W1HA 3N1XC 2LXCA 4YWGG 5GXGB 2M4NA 4BZAA 4NSWA 1WY8A 1RRPB 3ZYYX 4RGNA 2M19A 4G3XB 4NPNA 2GLSA 5G2NA 4IM3A 2PZ1A 3QWZB 3GB1A 5EE9A 5AZHA 5C16A 1MKEA 1WXAA 3CWIA 3MJ5A 5J17A 3R3MA 2L0FA 3D32A 3ENBA 3MHZA 4ITKA 2IPKD 4ZRPA 3NOBA 2G1EA 3AE5B 2L83A 2NTTA 4A6FA 1NU2A 1E8XA 2COFA 3P4SB 1MK7B 4IG7B 1EF1A 4GZUA 3ETRA 4G11A 1RYJA 4AJWA 2WX1A 3E9SA 3H6NA 5CX3A 3MDBC 2NS5A 1SXTA 3OANA 1PGBA 3C19A 4WVFB 5CLLB 2JXTA 3VDZA 3B0AA 1Z2MA 4A6HA 3DBHB 3DXCA 3FLVA 3LYYA 2K8EA 3NUHB 3RFZB 1N5WA 1FPYA 1IBXA 1FHXA 3HVZA 5DHAB 2ZNVB 2WU5B 4F7ZA 3APCA 1MIZB 4XDCA 4HDQA 1T0SC 2DENB 1VZ7A 1H10A 4W9CA 5IKCM 3DHIC 4ANVA 2IGHA 1I35A 3TCAA 1K51A 1WSPA 2DIKA 4WWMA 1WFYA 1F9JA 4IW0A 2EJ8A 1G6JA 5DPSA 2FIFA 2V9HA 1KZGA 2DYBA 3NVWA 2N7JA 5CHFA 2KDIA 4ZYSA 2KC1A 3VIAA 1NYRA 4KDLB 3ZQ4A 2R2OA 1P3RA 5JZEB 1K52A 2KLCA 2KDEB 2H7DA 2WLBA 2CS4A 2YVCA 2VH1A 1F2RI 4AOFA 1I4PA 1SIFA 4RF0A 4IFSA 3RCZA 4C0AA 2DHJA 3I3TB 2LHEA 2WXMA 4NY0A 5HE2A 1LFDA 4ILJA 2KD0A 4KGSA 3D8EA 4W9KA 3GE3C 4ARCA 3ML8A 2K6DB 4LK0M 2WP9B 1SE2A 1EF5A 1FRDA 3AEEB 2MDXA 5CHWA 1ZE3D 1XKEA 2G4DB 4EMOA 1HBKA 1MHXA 2L3ZA 3AE8B 3DWGC 4WJPA 4O1NA 4C4VB 1FD6A 1EVHA 3X23A 3ZXRA 3WAOA 2V76A 1C9FA 2P8VA 1XO3A 3ZKJC 3VUWA 4N9F4 4MGKE 2PJHA 4ZDVA 1IRSA 1KC7A 1ST7A 4GB9A 1T5XD 4RM9A 1AARA 5E6NA 2K3UA 1WXMA 1T0QC 4JWUC 2KOXA 3M1IB 3P4QB 2IDYA 2OEDA 1AYFA 1WRDB 5BYQA 4E3CA 2UZRA 2WXFA 4ZRQA 4GMXB 4W9DA 1R7SA 5H8YE 3H7PA 2X0SA 1UNSA 2RQ1A 1BMLC 4D6WA 2WXLA 3T3OA 1YQ4B 3A33B 4FLHA 1WXVA 1SGHA 2QC8A 5GOWB 2WXPA 4LNOA 2DX5B 1YX6B 4YSYB 1C1YB 3SYXA 4FJYA 3LXFA 5D27A 1GNUA 3VR8B 1T6BX 3OAWA 3PZDA 1QT9A 3EHVA 3K9PB 2C7NB 4PS3A 1TIFA 2KDFB 4WJQA 1ZKHA 2Y3AA 3WAPA 2X8XX 2BPSA 3JVZX 4RM8A 3RT3B 3FVCA 4MACA 3SEBA 1FRRA 4JKCA 1WI0A 3A98B 1YIWA 5C5BA 2WS3B 4BKTA 3T8MA 1WX7A 4II3B 1P6SA 4ZOHC 1V49A 3TEZA 2LYDA 1TY0A 3KUDB 3VAWA 3ZIMA 4QAYA 2WDQB 2NBVB 3SFDB 3EFCA 1XLQA 2K1FA 3RNFC 4HPPA 3DCGA 1I42A 2K49A 3N20C 4JQWC 1U4AA 1WXSA 4JL9A 2DZMA 4B9KA 2Z13A 2O6VD 2MCNB 5HHDG 3KZ1A 2VZKB 3RNCC 2W55A 5C3JB 1X1GA 1HB6A 3KYCD 2J0MA 2D11A 4C80A 1FMAD 1JDEA 1TJ6A 5HFYA 3OG5A 3N3KB 3U8ZA 1UNPA 1CK1A 1EWCA 2BWFA 2PMVA 4IDIA 3IVFA 3W5VB 1FM0D 5DPWA 3AU4A 1V9JA 1WGRA 2ON8A 4II2B 3ZTDA 2GBMA 1J0GA 3VFKA 1TT5B 2ELAA 4OZAA 1V80A 1J7BA 4W9HA 1RAXA 4AP4C 3AULA 2CY4A 2K8CA 1DOYA 1HB8A 4HB3B 3N1YC 5AUIA 3V62A 3NWFA 4UDUC 2R82A 3U4EG 1WG7A 1ZSQA 4LJPB 1E6EB 3ZO5B 2Y5BB 1LB1A 5JLJB 1N63A 1GB4A 4AS1A 5M4YB 1W1DA 1Y5OA 5AZFA 2JY6A 3MFGA 4US9A 5HE1A 4YTPB 4F1SA 1MHHE 2K25A 2WH5A 1E8WA 2XK5A 2KMCA 1E0ZA 1L0YB 2KIGA 1F77A 4HLEA 2IY0B 4GXBA 1TKGA 2LASA 1B55A 2KX3A 2BT6A 4NJCA 2JZZA 1UZXB 1J19A 3O65B 2WXQA 3VHTC 3R2TA 3URYA 1WJ6A 4HAVB 4TKNA 1C77A 1XEEA 1AWEA 2FJ9A 2DHKA 2J42A 3PO0A 3VTVA 2BYTA 2WXIA 4K7WA 4A6KA 3DBRI 2QCZA 4JKGB 2ADZA 3NW8A 4LNNA 4IAPA 1QQGA 1I7HA 1MPHA 1V1PA 1LGRA 3QBVB 2L0TA 2C7MB 3EPYA 2ZPNA 4GDKA 4I6LB 2PE6B 1WI1A 2K8HA 3PRMB 1VZ6A 4MGZE 1XX0A 2Z59A 4BOZB 1TTNA 4A55A 1R4MI 5JHGA 2UU7A 5D94A 1F0ZA 4KGRA 2KFKA 1A5RA 4GLSC 3P6AA 1N62A 1FCLA 3MC8A 4EFOA 1WGQA 2JSVX 1KLVA 2QHOA 1C4PA 1OQRA 5I4DA 4CYEA 3BIID 4PYZA 1YNTE 1U5EA 3ZXVA 3A4SC 3NVVA 3VOQA 2MHJA 2IO2B 2CR5A 4WH4A 2COCA 4FADA 1XR0B 3DXDA 4MJSB 4W9IA 2QKMA 3TEYA 3KSYA 3DVGX 3SNHA 1QC6A 3RMKC 2PPHA 1VLBA 4KHBA 1YD8U 5D3VA 1E5WA 3SBTA 4IC7B 2M14A 2V0GA 4FJVB 3ZTCA 2W54A 1UELA 1E9MA 3JSVA 3NVYA 1BT0A 3LJUX 1UBIA 2K0PA 2CJNA 3AB5A 3HVDA 3P4PB 3UQBA 2D2QA 1WGKA 2FIDA 1Q10A 3NWDA 2Z0OA 2K39A 2KLGA 1WGHA 5C6RA 4BKGA 3KUCB 1EUVB 5IJMA 1WYWB 2K2JA 2N9LA 3ZJUA 2RGNB 4RH6A 5DPTA 4KAXB 2ZCBA 4S17A 2ACZB 1EWYC 2L2IA 2XN9C 3EECA 2L00B 1EAZA 2Y5PA 4LNIA 1ESFA 2N0SB 4XWWA 4S0RA 4B6HA 2QDFA 4FHKA 4FXCA 4HRSA 1PLSA 1KRHA 2Z0PA 1KM7A 2KO3A 3BY4B 4XC2A 2I5CA 5DCNA 4DWFA 4HJGE 3CMMB 3W5UB 1ZM0A 2YS3A 2I2YA 3BVZA 5CTRC 3ML4A 2LGDA 1SJED 4GNKB 4A9AA 3IHPC 1WF9A 2IO0B 2AYOB 3ZVRA 2MP2B 4ASWC 2KWUB 2L7RA 3ZNGC 1RWSA 2AL3A 2IO1B 2FCNA 3AE9B 3AEFB 4HPLB 1V5MA 2L76A 1Z5SB 4FJZA 3IT4B 1SHCA 1E7UA 4DHZE 2LFIA 2LZ6A 1ZDXA 1C4AA 1I4QA 3DVNV 3FSSA 1FGZA 3TMPB 3ZW3A 3FM8C 2L1AA 3N9YC 1LQBA 1GPXA 1P0RA 4JIOU 1WJMA 1T0RC 3GE8C 1BTKA 4X57B 1YX5B 3ZRCA 3CSFA 3R8BA 2BKRB 2J7QB 2A5UA 1VRAB 1SE4A 3MC0B 5AEKB 2MJDA 1Q0WB 2RDHA 2KNBA 1ZXIA 4IM2A 1U2BA 3K9OB 1UD7A 3W1YA 4HKZE 4M0WA 1OFFA 2NMBA 3RNGC 3B9JA 4Z2NA 2V4LA 2PKOA 2K8BA 4M02A 1ZYIA 3R7RA 4F7GA 4K3BA 3PSEB 1GC7A 4JKBA 3KRXA 3AE3B 2HTHB 2LVPA 1DIKA 3SFEB 1SEBD 1KBLA 4BKSD 4C00A 2O2VA 3A9KB 1J7AA 1L7YA 4JKEA 2A4ZA 1E90A 1WJ1A 1CQVA 3B1LX 4IM0A 2L32A 2WQYB 1YOVB 3TFMA 1DDWA 2IGGA 4A3OA 3ENEA 2KFJA 3KW5B 4A20A 1QF6A 4KIKB 4LDTD 2KQSA 1XODA 4JKHA 2D9VA 2BVCA 3ZRFA 1WM2A 2KGXB 1WVHA 1OQQA 4I6NB 4JKDA 3N1ZC 2PTLA 1PGXA 3IT6B 3PT2B 2H88B 3N7CA 2FE8A 1XT9B 2KJ6A 2LRWA 4KSLC 3VRBB 1TQZA 4YONA 2J59M 1KZ7A 2ZW1A 1V5UA 1KJTA 2O6VB 3GP7A 2FJLA 1K53A 2WWZA 1JRPA 4KV2A 1F2RC 4ZHOA 1NBFC 4RGMA 1YJJA 3H9DA 1JW9D 2DLWA 1MVKA 2H89B 3Q8AA 1YJIA 3U7DA 2WXGA 3WALA 3BJIA 4DHZB 4RGTA 5EDSA 3PG7A 3FKYA 2RPQA 1PYWD 1FFUA 2JP2A 2P0FA 1PMSA 1XLOA 5DPRA 2CODA 1FHOA 3DXEA 2EKIA 4K2PA 1Q67A 2ZVNA 4PYUA 2NPTA 1ISNA 1I2HA 4K2OA 5CLQB 2ZPYA 2IFSA 2R61A 2WHIA 2PVOD 1OTRB 3M62B 3RYTA 2D4QA 3BK1A 3PREA 2PVGC 2DBYA 1NVID 2QSDA 2HTME 3N30A 4K1RB 2JRIB 3AU5A 2NZ8B 3PS6A 4JWSC 5C23A 4P1BC 2N1WA 3C0RB 2VH2A 4MEMA 2LGSA 2V3PA 3U52E 1UPQA 4KGTA 4RCOA 3IG3A 1R4NI 1U29A 2M1MA 3W2DA 4A90A 2ROZB 4MM3B 2E2XA 1U5GA 5KQ4A 3JYUA 3L4PA 1V8CA 2KTFA 2QIEB 3GZNI 1JALA 2N23A 1XCGA 1I4XA 3AEDB 5FKAC 3Q8FA 4FBJB 2KTRB 4N59A 4FN2A 5G5GA 4TMAB 1ZVRA 3M3JA 2ICIA 4WJOA 2YF0A 4HATB 3PRPB 4DHJD 1WMHB 3OJ4B 3KLSX 4I6PA 2Z4DA 1TS2A 3HRDD 2Y5CA 3DBLB 3AEGB 3PVWA 4EJNA 2Z0DB 1IGDA 2D3AA 4L1BA 2WXKA 5FI0A 1QOBA 3QARA 2KVRA 1BUIC 3L16A 2DTCA 3ALBA 4BBNC 2J53A 2KDMA 2RR9A 2MSED 4K17A 4GDLB 2GBJA 3AE6B 4ICUA 3NZ3A 5T8IA 1JMLA 5C5BB 4GU2A 4J3OD 4FHJA 2FCMA 4L2YA 1DYQA 1JROA 2AWTA 2N9XA 1HEZE 3Q3MC 2IBIB 3QCAA 5L95C 2AQ2B 4CHKA 1V6EA 4L6EA 2N1VA 2GCLA 3ZGZA 4Y94A 2FUG1 5KCVA 4DXGA 2N9EB 4EZKA 4AQ7A 1E7PB 2HDEA 4PS8A 1IP9A 3APDA 1GC6A 5G5HA 2GMIC 1UNQA 1P5TA 4GMVA 4OVZA 3W1SA 4HKQA 2LKOA 3ZDMC 1HXYD 2JYEA 3EFUA 3NZSA 1WGUA 2YRYA 2AQ3B 3M63B 4KDIC 2D07B 3IAM1 2SAKA 2IY1B 2WXOA 1J8CA 4K7UA 3IXSA 2LI5A 2ZNVC 4PS7A 4TQ0A 1MK9B 2B76B 1N61A 1C79A 2W3SA 4NZLB 2MBOA 4JK7A 5GMVA 3VRAB 3X0WA 2J0KA 3UZTA 3KH0A 5EE0A 4HROA 3DVNU 2BQQA 2LHDA 2RSUA 2BYVE 2LGIA 3E66A 2BS2B 2Y8FA 3W1SC 5C2TB 2KQ7A 1DGJA 4W9GA 4ILHA 1V97A 3F0WA 1KFYB 3PZ7A 2I5FA 1MI1A 3NHEB 1RRBA 1XD4A 1UH6A 3ONSA 4TV3A 4A6QA 1FOEA 3MHSD 3D8FA 5D3XA 1WGYA 2G45B 1AQCA 2MQJA 2V3SA 3QHTA 2ELBA 3BVGA 3PPAA 2MW5A 4KVGB 4W9JA 1K5DB 2OHFA 4C4VA 1SIJA 2GI9A 2L05A 3WYFB 2JQRB 1JWSD 4DBGA 3V3XA 4WSFA 2YLMA 4P1CC 5IA7A 3A1QB 1NDDA 1FGYA 2EKEC 2KZRA 4B0MA 3QIJA 5JH5C 3CSTA 5LNK1 3H1UA 3ZUNA 1B9RA 5DI9B 2BWES 3QQ8B 1FHWA 2Q13A 3SO6A 2DYNA 5C79A 1I4GA 3NWAA 3DBHI 3V05A 1VR9A 2KR0A 3BWUD 2RUKB 1L2NA 2AQ1B 1M7RA 4G50A 1FEHA 4MK0A 5E6OA 2INPE 4USAA 4LNFA 2VRWB 3OHMB 1MAIA 3PGEA 2IO3B 3HUIA 4KKIA 3VQIA 4JLCA 4BAXA 3WIMA 2KANA 3OLMD 1XQQA 4D0NB 2DX5A 4XZ4A 2LGXA 3M95A 3HK0A 3RZWC 3MC9A 1EGXA 2BYFA 1SB3C 2MA9B 5BYSA 3CXBB 1TS3A 1SBBB 4DDID 1MG8A 2EMTA 1TYGB 2KVZA 2IJ0A 2LEKA 2Z0QA 3PHWB 2YT1A 2KUPA 1W1GA 3DDCB 1ZP0B 2V4IB 3PRZA 1V61A 2ONQA 3A9JB 3F5RA 2YEPF 2KC2A 2DNFA 2KXJA 3ML9A 3U7ZA 2XQNM 1WJ4A 2M8SA 2NBUA 1KLGD 2G35A 3Q3OC 2NBVA 2DYQA 2RDBC 1T0YA 4LNKA 4D2KA 1UEFA 3VXWA 2G4SA 1I7AA 5HI1A 2I1JA 5BYRA 5BO4B 2C5LC 3PSCA 1SSNA 4MSMB 4HAUB 3UINB 4ACFA 3D8DA 2UYZB 3DVGY 4JPSA 2COPA 4JKFA 1WE7A 4YXDB 2GBKA 2LJ5A 4IKGA 1Y56A 3TVVA 3V61A 1SE3A 1QOAA 3APFA 4E74A 1VBHA 1OEYJ 2JZ3B 2W2XC 5TSSA 4HAXB 1V1OA 1KI1B 2KX0A 2JPHA 3BVMA 4LDTB 3NS8A 3R7QA 2E6XA 4KX6B 2LXAA 2HE7A 2GJYA 1KOTA 1MJDA 1JWAD 2BCJA 1WJNA 4US8A 1E8YA 4GOUA 2EC1A 1DROA 2MRPA 3Q8BA 1L6VA 1ZOYB 3PVLA 3IAS1 1N3HA 1X11A 4PK1A 2MJEA 2KN5A 1L6UA 2WXHA 1VD2A 1I4HA 5J3YA 1UF0A 2H7EA 4IOYX 3QK0A 1FCCC 2IYDB 3NSUA 3I57A 4MELA 3ODWA 1U5FA 3BYTB 2YT0A 2FDQA 3PHXB 3Q8CA 1X1MA 1V86A 3ZJVA 1TKEA 4HHVA 2RMMA 4NQKE 4L1RA 1TKYA 2DHZA 3TJPA 2KHWB 5LG4B 1E8ZA 5D3IB 3DQVA 4XWXA 3HQCA 2KJRA 1WGGA 2OOBB 3MPXA 4WJ7A 3RN9C 3KRWA 4OSNA 2XEWA 5LOPB 5J3QA 3VVWB 4M8NA 5TR5A 3HM3A 3AE1B 3PLUA 5AZGA 3ECIA 2EELA 4HDOA 4FA6A 2QJLA 1YN5A 1VZ8A 5KHOA 4TSSA 4RF1A 1C78A 3B77A 4H2AA 3ODOA 4OW0A 4BVUC 3DOWA 5JVLA 5JHAA 2YEPB 1SF0A 1XCQL 2LOZA 4JKGA 1A70A 4JX1C 2QILA 1V5OA 3VH4B 2LBBA 1EU4A 1N5XA 4C7ZA 1TGZB 1P7FA 4AWJA 4F8CB 2GB1A 2INNE 1QLBB 4EEWA 3V5WA 2GUMA 3WCQA 2KAJA 1GOZA 2M0AA 5H92C 3VUXA 1IYFA 1XD3B 2WU2B 2SEBD 2BW2A 3U2SC 1H8CA 2DYMA 1JWBD 2KUQA
chains in the Genus database with same CATH topology
4HAWB 3N32A 2EMSA 4YL8A 2CHZA 1LM8B 2N7EA 4ZYNA 5HE0A 1NTVA 3QWMA 3ZNHB 2W2XD 1WGDA 4DHJB 2CHWA 3FEHA 1S1QB 4GN1A 3QA8A 1M7EA 4PQ0A 5JP4A 2ASQA 4MJSA 1NI2A 2HJ8A 5KQ1A 3NY5A 4BBKA 4DX90 2VRRB 2JWZA 4A3PA 1V81A 3TW1A 3B08A 3PLVA 2D9WA 5L83A 3UIOB 2LD9A 5DH9B 2MWNB 4OVUA 3RUIB 3PVUA 3SUZA 4B6WA 1VCBA 2NCNA 4HK2A 4CO7A 3O96A 2PE9A 4ZRJA 4WWPA 3HIZA 4MH0E 2ROVA 4HCPB 4A6FB 3GYPA 2BKFA 2N0YA 4DK5A 3SDLC 4NAWA 1GG3A 5D3WA 3Q3JA 3Q3FA 4HCNB 3RULA 2IYBA 3T06A 2JXXA 1BWNA 1X05A 4EKUA 2HRJA 1U5DA 4KZ0A 3UIPB 2V1YA 4AUQC 3VTUA 4FULA 1X86A 2WX0A 2VKIA 2MP2A 2FNJB 2ZCCA 4GSWA 3DBSA 2YS1A 4K7SA 1ZC4B 1WJUA 4DX8A 1LW3A 3QAQA 3V6EB 3H7SA 2YS5A 5DHFB 5G55A 1M94A 1U27A 1UNRA 2R0DA 2W9NA 2MFQA 1ACAA 1V5TA 4P7IA 3SD5A 1FAOA 1OEYA 2CHXA 1OMWA 3PTFC 2UVMA 4WQOB 4DXAB 1WE6A 4MGIE 2Y8GA 1FB8A 2I1KA 1JRUA 2HTHA 2ABDA 1FXTB 3T9LA 4JKAA 3A9KA 2COAA 2N7DA 5J3TA 3L0WB 2MKRA 4KIKA 2LG1A 2DKPA 2KCJA 4HB4B 4LCDE 4GOCA 1WX9A 2DAJA 4ICVA 3RCPA 3L08A 2MBBB 2X18A 3PEGA 2YSZA 3H7PB 2M17A 5J2RA 4NQLB 3G9WA 2V4LA 2MLBA 2JUOA 2O6VA 2RD0A 1ZC3B 2G3QB 4MGYE 4HB2B 3PV1A 5IAAC 4B95A 2J0JA 3U30A 5JHHA 1DDMA 3ODXA 2JF5A 1DBHA 2Y7BA 1WR6E 1GJZA 3ZNID 3LJ3A 1MIXA 2DFKA 4KHAA 3QJZA 4ANXA 3NZUA 1GGOA 2DAFA 2WYQA 3AXCA 3UF8A 1P3QU 4OVVA 3L13A 2KDBA 2KK8A 4DBBA 1J0WA 3EC8A 2GBNA 3SHQA 1K5GB 1NTYA 1ZGUB 5JHBA 3P2BA 3WA0A 3VH3B 4HAYB 5DIFB 3MJWA 2IZVB 4XX5A 1V89A 2GOWA 3FP5A 3E9PA 4MM3A 2B3AA 1WZ3A 1LXDA 1UBQA 3VTWA 2KTRA 2FCQA 1BAKA 5LONB 3CIKA 4HWIB 5LXHA 3L54A 3MTNB 1WMHA 1WR1A 2DZIA 3PP2A 3DPDA 4JGHB 4K81A 2BGFA 3ZNZB 4HPMB 2K2UA 3S2AA 1TXDA 2CKHB 2KJHB 5KHQA 4ANWA 4PNKA 3A4RA 5EFXA 3TBLD 3E9OA 3ULCA 2GCJA 4KSKC 4GDLA 4IWQA 3HW2B 2XK5B 4M8MA 2CRFA 3P7ZA 1WZ0A 3IBEA 4E71A 3TO1A 3KUZA 2R2QA 4RMAA 4IWOA 4WWOA 2OJRA 2MBEA 3ULBA 1OQNA 5LLIA 4ILGB 3LDZE 2RSGA 4MDKE 1DYNA 3A8PA 3SBGA 2C7HA 2AEHA 2DKQA 3JW0X 5HE3A 2HD5B 2DHIA 4HJKA 2C60A 1BTNA 2OQBA 2CU1A 5D3YA 1ZW7A 4LJOB 3SV1A 1P9DU 4GDKB 3V60A 1X1FA 2KWCA 3L17A 1OQYA 3ZLZA 2Z59B 2ZJDA 1YJ1A 2DX1A 2KFKB 4H8SA 4F7UP 2BYEA 1C3TA 3KYDD 2ZZPB 4Z2MB 1NVLA 4KZCA 4EOYA 2R09A 1DDVA 4TQ1A 2D9ZA 3A8QA 1GUAB 1V5PA 4MSQB 4AJYB 5J18A 1V88A 3DBLI 1RFAA 3A1QA 1Y19B 3BINA 2JRHA 2MBHA 2W2WA 1VBGA 4KHBB 3QX1A 2VSZA 1NTIA 2Z0EB 2L1CA 4W9LA 2CB8A 1PQSA 2NVUI 3JSVB 2P0DA 2UZSA 1TZ1A 3OJ3A 2LUEA 4G0NB 2K6QA 2LVQA 4WAAA 4HAZB 5FR6A 2MX2A 1UGMA 3HM6X 2P0HA 2ZEQA 4W9FA 4TYZA 2N4FA 2NBWB 4A5KA 2LWPA 4URKA 4KHOA 2KWVB 3TIXA 5FI1A 1Q5WB 4MY6A 4NNJB 1K8RB 3ZVVA 2LVOA 4GGQA 2PEAA 3A9JA 2JVCA 2RGFA 4EZLA 1WM3A 2LOXA 3QC8B 5LXIB 1SE9A 2RLOA 3GYOA 2M38A 1WH3A 2QKLA 2ZVOA 5D7GA 2DN6A 1Q1OA 2MWSB 1YQBA 1WX8A 4IWPA 1RLFA 4JK8A 3IFWB 4BKSA 1CMXB 2CAYA 3ZDTA 2DYOA 4GPTB 2N9PC 4HXDA 2LULA 2D10A 5D2MB 2GS0A 1QZEA 1EO6A 2DA0A 3R66C 3RD2A 4DDGD 2C9WB 4ZRIA 1TBEA 2FAZA 2M0XA 2D9XA 2RVBB 4NAWB 1PFJA 4M0WB 4JK9A 2KMAA 3UGBB 4GIVA 2DZKA 2DZJA 1S3SG 2JT4B 3KY9A 4NJ7A 2FCSA 4WJNA 2O2VB 5D6JB 4ANUA 2WDTB 4TUUA 2D9YA 3WANA 4BBNF 1OY2A 4HB0B 1Y8RC 4MT7A 2NR2A 3CF6E 3VUYA 1Z87A 1P1AA 4NJ6A 3AI5A 2L8JA 3SU8X 2D3GA 1H4RA 2CQUA 1E7VA 4IUMB 4CHJA 2OTXA 2LRUA 5L81A 5C1ZA 2K00A 1WIAA 3AJ4A 3V6CB 4WWNA 3HHMA 2GBRA 3GOEA 1OGWA 2REXA 4EUTA 3UQAA 5E6PA 4BOSC 1HE8A 2AL6A 4CHMA 5HKHA 2CY5A 1UPRA 4J6IA 3E9LA 4F7HA 5CHVC 4HVBA 2MBQA 2NPTB 4ZRKA 4BFRA 1P98A 2BF8B 2UWQA 1RJ2A 3TL5A 3KVFB 1D3ZA 2LGYA 2XBBC 2FUHB 2RNRB 4EZJA 4W9EA 3RZFA 1IPGA 3WAMA 3L10B 2KKCA 1V2YA 1W1HA 2LXCA 2M4NA 4NSWA 1WY8A 1RRPB 4G3XB 4NPNA 5G2NA 4IM3A 2PZ1A 3QWZB 5AZHA 5C16A 1MKEA 1WXAA 5J17A 3R3MA 2L0FA 3D32A 3ENBA 3NOBA 4A6FA 1NU2A 1E8XA 2COFA 1MK7B 4IG7B 1EF1A 4GZUA 4G11A 4AJWA 2WX1A 3H6NA 5CX3A 3MDBC 2NS5A 3OANA 4WVFB 5CLLB 3VDZA 3B0AA 1Z2MA 4A6HA 3DXCA 3FLVA 1FHXA 5DHAB 2ZNVB 4F7ZA 3APCA 1MIZB 4HDQA 2DENB 1H10A 4W9CA 4ANVA 1I35A 3TCAA 2DIKA 1WFYA 1F9JA 4IW0A 2EJ8A 1G6JA 5DPSA 2FIFA 1KZGA 2DYBA 5CHFA 2KDIA 2KC1A 3VIAA 4KDLB 2R2OA 1P3RA 5JZEB 2KLCA 2KDEB 2H7DA 2CS4A 2YVCA 4AOFA 1SIFA 4IFSA 3RCZA 4C0AA 2DHJA 3I3TB 4NY0A 5HE2A 1LFDA 4ILJA 2KD0A 3D8EA 4W9KA 3ML8A 2K6DB 1EF5A 2MDXA 5CHWA 1XKEA 2G4DB 4EMOA 1HBKA 2L3ZA 4WJPA 1EVHA 3X23A 3WAOA 2V76A 2P8VA 3ZKJC 3VUWA 4N9F4 4MGKE 2PJHA 4ZDVA 1IRSA 1KC7A 1ST7A 4GB9A 4RM9A 1AARA 5E6NA 1WXMA 2KOXA 3M1IB 1WRDB 4E3CA 2UZRA 4GMXB 4W9DA 3H7PA 2X0SA 2RQ1A 3A33B 4FLHA 1WXVA 1SGHA 5GOWB 2DX5B 1YX6B 1C1YB 3SYXA 4FJYA 5D27A 1GNUA 3OAWA 3PZDA 3EHVA 3K9PB 2C7NB 4PS3A 2KDFB 4WJQA 1ZKHA 3WAPA 2BPSA 3JVZX 4RM8A 3RT3B 4JKCA 1WI0A 3A98B 1YIWA 5C5BA 4BKTA 3T8MA 1WX7A 4II3B 1P6SA 1V49A 2LYDA 3KUDB 3VAWA 3ZIMA 2NBVB 2K1FA 3DCGA 1I42A 4JQWC 1U4AA 1WXSA 4JL9A 2DZMA 4B9KA 2O6VD 2MCNB 3KZ1A 1X1GA 1HB6A 3KYCD 2J0MA 2D11A 1JDEA 1TJ6A 3N3KB 3U8ZA 1UNPA 2BWFA 3IVFA 5DPWA 3AU4A 1V9JA 1WGRA 4II2B 3ZTDA 2GBMA 1J0GA 3VFKA 2ELAA 1V80A 4W9HA 1RAXA 4AP4C 3AULA 2CY4A 2K8CA 1HB8A 4HB3B 3V62A 2R82A 1WG7A 1ZSQA 4LJPB 3ZO5B 2Y5BB 1LB1A 5JLJB 1W1DA 1Y5OA 5AZFA 2JY6A 5HE1A 4F1SA 2K25A 2WH5A 1E8WA 2XK5A 2KMCA 4HLEA 2IY0B 4GXBA 2LASA 1B55A 2KX3A 2JZZA 1UZXB 1J19A 3O65B 3VHTC 1WJ6A 4HAVB 4TKNA 1AWEA 2FJ9A 2DHKA 3VTVA 4K7WA 4A6KA 3DBRI 4JKGB 2ADZA 4IAPA 1QQGA 1MPHA 3QBVB 2L0TA 2C7MB 3EPYA 2ZPNA 4GDKA 4I6LB 2PE6B 1WI1A 2K8HA 3PRMB 4MGZE 1XX0A 4BOZB 1TTNA 1R4MI 5JHGA 5D94A 2KFKA 1A5RA 3P6AA 4EFOA 1WGQA 1KLVA 2QHOA 4CYEA 4PYZA 1U5EA 3A4SC 3VOQA 2IO2B 2CR5A 2COCA 4FADA 1XR0B 3DXDA 4MJSB 4W9IA 2QKMA 3KSYA 3DVGX 3SNHA 1QC6A 2PPHA 1YD8U 5D3VA 1E5WA 3SBTA 4IC7B 2M14A 4FJVB 3ZTCA 1UELA 3JSVA 1BT0A 3LJUX 1UBIA 3UQBA 2D2QA 2FIDA 2Z0OA 2K39A 2KLGA 1WGHA 5C6RA 4BKGA 3KUCB 1EUVB 5IJMA 1WYWB 2K2JA 2RGNB 5DPTA 4KAXB 2ZCBA 2L2IA 3EECA 2L00B 1EAZA 4B6HA 4FHKA 1PLSA 2KO3A 2Z0PA 1KM7A 3BY4B 4XC2A 2I5CA 5DCNA 4DWFA 3CMMB 1ZM0A 2YS3A 5CTRC 3ML4A 2LGDA 3IHPC 1WF9A 2IO0B 2AYOB 3ZVRA 2MP2B 4ASWC 2KWUB 2L7RA 3ZNGC 2AL3A 2IO1B 2FCNA 4HPLB 1V5MA 2L76A 1Z5SB 4FJZA 1SHCA 1E7UA 4DHZE 2LZ6A 3DVNV 3FSSA 1FGZA 3TMPB 3ZW3A 3FM8C 1LQBA 1P0RA 4JIOU 1WJMA 1BTKA 4X57B 1YX5B 3ZRCA 3CSFA 2BKRB 2J7QB 2A5UA 5AEKB 1Q0WB 2KNBA 4IM2A 1U2BA 3K9OB 1UD7A 3W1YA 2NMBA 4Z2NA 2K8BA 3R7RA 4F7GA 3PSEB 1GC7A 4JKBA 3KRXA 2HTHB 2LVPA 1DIKA 1KBLA 4BKSD 2O2VA 3A9KB 1L7YA 4JKEA 2A4ZA 1E90A 1WJ1A 3B1LX 4IM0A 3TFMA 1DDWA 4A3OA 3ENEA 2KFJA 3KW5B 4A20A 4KIKB 4LDTD 2KQSA 1XODA 4JKHA 2D9VA 3ZRFA 1WM2A 2KGXB 1WVHA 4I6NB 4JKDA 3PT2B 3N7CA 2LRWA 1XT9B 2KJ6A 4KSLC 1TQZA 4YONA 2J59M 1KZ7A 1V5UA 1KJTA 2O6VB 2FJLA 2WWZA 4KV2A 1NBFC 3H9DA 2DLWA 3U7DA 3WALA 3BJIA 4DHZB 5EDSA 3PG7A 2RPQA 2JP2A 2P0FA 1PMSA 5DPRA 2CODA 1FHOA 3DXEA 2ZVNA 4K2PA 1Q67A 4PYUA 2NPTA 1ISNA 1I2HA 4K2OA 5CLQB 2ZPYA 2IFSA 3M62B 1OTRB 3RYTA 2D4QA 3PREA 3N30A 4K1RB 2JRIB 3AU5A 2NZ8B 3PS6A 5C23A 2N1WA 3C0RB 4MEMA 1UPQA 3IG3A 1R4NI 1U29A 2M1MA 2ROZB 2E2XA 1U5GA 5KQ4A 3JYUA 2KTFA 3GZNI 2N23A 1XCGA 4FBJB 2KTRB 4FN2A 1ZVRA 3M3JA 4WJOA 2YF0A 4HATB 3PRPB 4DHJD 1WMHB 3OJ4B 4I6PA 3PVWA 4EJNA 2Z0DB 5FI0A 3QARA 2KVRA 3L16A 2DTCA 3ALBA 4BBNC 2RR9A 2MSED 4K17A 4GDLB 2GBJA 4ICUA 5C5BB 4GU2A 4FHJA 2FCMA 2AWTA 2N9XA 3QCAA 2IBIB 5L95C 4CHKA 1V6EA 4L6EA 2N1VA 2GCLA 4Y94A 5KCVA 2N9EB 4EZKA 4PS8A 1IP9A 3APDA 1GC6A 2GMIC 1UNQA 1P5TA 4GMVA 3W1SA 2LKOA 3ZDMC 3EFUA 3NZSA 1WGUA 2YRYA 3M63B 4KDIC 2D07B 2IY1B 1J8CA 4K7UA 2LI5A 2ZNVC 4PS7A 4TQ0A 1MK9B 5GMVA 2MBOA 4JK7A 3X0WA 2J0KA 3UZTA 3KH0A 3DVNU 2RSUA 2BYVE 3E66A 2Y8FA 3W1SC 2KQ7A 4W9GA 4ILHA 3F0WA 2I5FA 3NHEB 1RRBA 1XD4A 1UH6A 3ONSA 4TV3A 1FOEA 3MHSD 3D8FA 5D3XA 1WGYA 2G45B 1AQCA 2MQJA 2V3SA 3QHTA 2ELBA 3PPAA 2MW5A 4KVGB 4W9JA 1K5DB 2L05A 3WYFB 4DBGA 4WSFA 2YLMA 5IA7A 3A1QB 1NDDA 1FGYA 2EKEC 2KZRA 3QIJA 5JH5C 3CSTA 3H1UA 3ZUNA 5DI9B 2BWES 3QQ8B 1FHWA 2Q13A 3SO6A 2DYNA 5C79A 3DBHI 2RUKB 1L2NA 1M7RA 4G50A 4MK0A 5E6OA 2VRWB 1MAIA 3PGEA 2IO3B 3VQIA 4JLCA 3WIMA 2KANA 3OLMD 1XQQA 4D0NB 2DX5A 4XZ4A 2LGXA 3M95A 3HK0A 3RZWC 1EGXA 2BYFA 2MA9B 3CXBB 4DDID 1MG8A 2EMTA 2Z0QA 3PHWB 2YT1A 2KUPA 1W1GA 3DDCB 3PRZA 1V61A 3A9JB 3F5RA 2KC2A 2KXJA 3ML9A 2XQNM 1WJ4A 2M8SA 2NBUA 2G35A 2DYQA 1T0YA 1UEFA 3VXWA 2G4SA 1I7AA 2I1JA 5BO4B 2C5LC 3PSCA 4MSMB 4HAUB 3UINB 3D8DA 2UYZB 3DVGY 2COPA 4JKFA 1WE7A 2GBKA 2LJ5A 3TVVA 3V61A 3APFA 4E74A 1VBHA 1OEYJ 2JZ3B 2W2XC 4HAXB 1KI1B 2KX0A 2JPHA 4LDTB 3NS8A 3R7QA 2LXAA 2HE7A 2GJYA 1KOTA 2BCJA 1WJNA 1E8YA 2EC1A 1DROA 2MRPA 3PVLA 1N3HA 1X11A 2KN5A 1VD2A 5J3YA 2H7EA 4IOYX 3QK0A 2IYDB 3NSUA 4MELA 3ODWA 1U5FA 2YT0A 2FDQA 3PHXB 1X1MA 1V86A 4HHVA 4NQKE 2DHZA 3TJPA 2KHWB 1E8ZA 3DQVA 4XWXA 3HQCA 2KJRA 1WGGA 2OOBB 3MPXA 4WJ7A 3KRWA 2XEWA 5LOPB 5J3QA 3VVWB 4M8NA 5TR5A 3HM3A 3PLUA 5AZGA 3ECIA 4HDOA 4FA6A 5KHOA 3ODOA 4BVUC 3DOWA 5JVLA 5JHAA 2LOZA 4JKGA 1V5OA 3VH4B 2LBBA 1TGZB 4AWJA 4F8CB 4EEWA 3V5WA 3VUXA 1IYFA 1XD3B 1H8CA 2DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAW B;  3N32 A;  2EMS A;  4YL8 A;  2CHZ A;  1LM8 B;  2N7E A;  4ZYN A;  5HE0 A;  1NTV A;  3QWM A;  3ZNH B;  2W2X D;  1WGD A;  4DHJ B;  2CHW A;  3FEH A;  1S1Q B;  4GN1 A;  3QA8 A;  1M7E A;  4PQ0 A;  5JP4 A;  2ASQ A;  4MJS A;  1NI2 A;  2HJ8 A;  5KQ1 A;  3NY5 A;  4BBK A;  4DX9 0;  2VRR B;  2JWZ A;  4A3P A;  1V81 A;  3TW1 A;  3B08 A;  3PLV A;  2D9W A;  5L83 A;  3UIO B;  2LD9 A;  5DH9 B;  2MWN B;  4OVU A;  3RUI B;  3PVU A;  3SUZ A;  4B6W A;  1VCB A;  2NCN A;  4HK2 A;  4CO7 A;  3O96 A;  2PE9 A;  4ZRJ A;  4WWP A;  3HIZ A;  4MH0 E;  2ROV A;  4HCP B;  4A6F B;  3GYP A;  2BKF A;  2N0Y A;  4DK5 A;  3SDL C;  4NAW A;  1GG3 A;  5D3W A;  3Q3J A;  3Q3F A;  4HCN B;  3RUL A;  2IYB A;  3T06 A;  2JXX A;  1BWN A;  1X05 A;  4EKU A;  2HRJ A;  1U5D A;  4KZ0 A;  3UIP B;  2V1Y A;  4AUQ C;  3VTU A;  4FUL A;  1X86 A;  2WX0 A;  2VKI A;  2MP2 A;  2FNJ B;  2ZCC A;  4GSW A;  3DBS A;  2YS1 A;  4K7S A;  1ZC4 B;  1WJU A;  4DX8 A;  1LW3 A;  3QAQ A;  3V6E B;  3H7S A;  2YS5 A;  5DHF B;  5G55 A;  1M94 A;  1U27 A;  1UNR A;  2R0D A;  2W9N A;  2MFQ A;  1ACA A;  1V5T A;  4P7I A;  3SD5 A;  1FAO A;  1OEY A;  2CHX A;  1OMW A;  3PTF C;  2UVM A;  4WQO B;  4DXA B;  1WE6 A;  4MGI E;  2Y8G A;  1FB8 A;  2I1K A;  1JRU A;  2HTH A;  2ABD A;  1FXT B;  3T9L A;  3A9K A;  2COA A;  2N7D A;  5J3T A;  3L0W B;  2MKR A;  4KIK A;  2LG1 A;  2DKP A;  2KCJ A;  4HB4 B;  4LCD E;  4GOC A;  1WX9 A;  2DAJ A;  4ICV A;  3RCP A;  3L08 A;  2MBB B;  2X18 A;  3PEG A;  2YSZ A;  3H7P B;  2M17 A;  5J2R A;  4NQL B;  3G9W A;  2V4L A;  2MLB A;  2JUO A;  2O6V A;  2RD0 A;  1ZC3 B;  2G3Q B;  4MGY E;  4HB2 B;  3PV1 A;  5IAA C;  4B95 A;  2J0J A;  3U30 A;  5JHH A;  1DDM A;  3ODX A;  2JF5 A;  1DBH A;  2Y7B A;  1WR6 E;  1GJZ A;  3ZNI D;  3LJ3 A;  1MIX A;  2DFK A;  4KHA A;  3QJZ A;  4ANX A;  3NZU A;  2DAF A;  2WYQ A;  3AXC A;  3UF8 A;  1P3Q U;  4OVV A;  3L13 A;  2KDB A;  2KK8 A;  4DBB A;  1J0W A;  3EC8 A;  2GBN A;  3SHQ A;  1K5G B;  1NTY A;  1ZGU B;  5JHB A;  3P2B A;  3WA0 A;  3VH3 B;  4HAY B;  5DIF B;  3MJW A;  2IZV B;  4XX5 A;  1V89 A;  2GOW A;  3FP5 A;  4MM3 A;  2B3A A;  1WZ3 A;  1LXD A;  1UBQ A;  3VTW A;  2KTR A;  2FCQ A;  1BAK A;  5LON B;  3CIK A;  4HWI B;  5LXH A;  3L54 A;  3MTN B;  1WMH A;  1WR1 A;  2DZI A;  3PP2 A;  3DPD A;  4JGH B;  4K81 A;  2BGF A;  3ZNZ B;  4HPM B;  2K2U A;  3S2A A;  1TXD A;  2CKH B;  2KJH B;  5KHQ A;  4ANW A;  4PNK A;  3A4R A;  5EFX A;  3TBL D;  3ULC A;  2GCJ A;  4KSK C;  4GDL A;  4IWQ A;  3HW2 B;  2XK5 B;  4M8M A;  2CRF A;  3P7Z A;  1WZ0 A;  3IBE A;  4E71 A;  3TO1 A;  3KUZ A;  2R2Q A;  4RMA A;  4IWO A;  4WWO A;  2OJR A;  2MBE A;  3ULB A;  1OQN A;  5LLI A;  3LDZ E;  2RSG A;  4MDK E;  1DYN A;  3A8P A;  2C7H A;  2AEH A;  2DKQ A;  3JW0 X;  5HE3 A;  2HD5 B;  2DHI A;  4HJK A;  2C60 A;  1BTN A;  2OQB A;  2CU1 A;  5D3Y A;  1ZW7 A;  4LJO B;  3SV1 A;  1P9D U;  4GDK B;  3V60 A;  1X1F A;  2KWC A;  3L17 A;  1OQY A;  3ZLZ A;  2Z59 B;  2ZJD A;  1YJ1 A;  2DX1 A;  2KFK B;  4H8S A;  4F7U P;  2BYE A;  1C3T A;  3KYD D;  2ZZP B;  4Z2M B;  1NVL A;  4KZC A;  4EOY A;  2R09 A;  1DDV A;  4TQ1 A;  2D9Z A;  3A8Q A;  1GUA B;  1V5P A;  4MSQ B;  4AJY B;  5J18 A;  1V88 A;  3DBL I;  1RFA A;  3A1Q A;  1Y19 B;  3BIN A;  2JRH A;  2MBH A;  2W2W A;  4KHB B;  3QX1 A;  2VSZ A;  1NTI A;  2Z0E B;  2L1C A;  4W9L A;  2CB8 A;  1PQS A;  2NVU I;  3JSV B;  2P0D A;  2UZS A;  1TZ1 A;  3OJ3 A;  2LUE A;  4G0N B;  2K6Q A;  2LVQ A;  4WAA A;  4HAZ B;  5FR6 A;  2MX2 A;  1UGM A;  3HM6 X;  2P0H A;  2ZEQ A;  4W9F A;  4TYZ A;  2N4F A;  2NBW B;  4A5K A;  2LWP A;  4URK A;  4KHO A;  2KWV B;  3TIX A;  5FI1 A;  1Q5W B;  4MY6 A;  4NNJ B;  1K8R B;  3ZVV A;  2LVO A;  4GGQ A;  2PEA A;  3A9J A;  2JVC A;  2RGF A;  4EZL A;  1WM3 A;  2LOX A;  3QC8 B;  5LXI B;  1SE9 A;  2RLO A;  3GYO A;  2M38 A;  1WH3 A;  2QKL A;  2ZVO A;  5D7G A;  2DN6 A;  1Q1O A;  2MWS B;  1YQB A;  1WX8 A;  4IWP A;  1RLF A;  3IFW B;  4BKS A;  1CMX B;  2CAY A;  3ZDT A;  2DYO A;  4GPT B;  2N9P C;  4HXD A;  2LUL A;  2D10 A;  5D2M B;  2GS0 A;  1QZE A;  1EO6 A;  2DA0 A;  3R66 C;  3RD2 A;  4DDG D;  2C9W B;  4ZRI A;  1TBE A;  2FAZ A;  2M0X A;  2D9X A;  2RVB B;  4NAW B;  1PFJ A;  4M0W B;  2KMA A;  3UGB B;  4GIV A;  2DZK A;  2DZJ A;  1S3S G;  2JT4 B;  3KY9 A;  4NJ7 A;  2FCS A;  4WJN A;  2O2V B;  5D6J B;  4ANU A;  2WDT B;  4TUU A;  2D9Y A;  3WAN A;  4BBN F;  1OY2 A;  4HB0 B;  1Y8R C;  4MT7 A;  2NR2 A;  3CF6 E;  3VUY A;  1Z87 A;  1P1A A;  4NJ6 A;  3AI5 A;  2L8J A;  3SU8 X;  2D3G A;  1H4R A;  2CQU A;  1E7V A;  4IUM B;  4CHJ A;  2OTX A;  2LRU A;  5L81 A;  5C1Z A;  2K00 A;  1WIA A;  3AJ4 A;  3V6C B;  4WWN A;  3HHM A;  2GBR A;  3GOE A;  1OGW A;  2REX A;  4EUT A;  3UQA A;  5E6P A;  4BOS C;  1HE8 A;  2AL6 A;  4CHM A;  5HKH A;  2CY5 A;  1UPR A;  4J6I A;  5CHV C;  4F7H A;  4HVB A;  2MBQ A;  2NPT B;  4ZRK A;  4BFR A;  1P98 A;  2BF8 B;  2UWQ A;  1RJ2 A;  3TL5 A;  3KVF B;  1D3Z A;  2LGY A;  2XBB C;  2FUH B;  2RNR B;  4EZJ A;  4W9E A;  3RZF A;  1IPG A;  3WAM A;  3L10 B;  2KKC A;  1V2Y A;  1W1H A;  2LXC A;  2M4N A;  4NSW A;  1WY8 A;  1RRP B;  4G3X B;  4NPN A;  5G2N A;  4IM3 A;  2PZ1 A;  3QWZ B;  5AZH A;  5C16 A;  1MKE A;  1WXA A;  5J17 A;  3R3M A;  2L0F A;  3D32 A;  3NOB A;  4A6F A;  1NU2 A;  1E8X A;  2COF A;  1MK7 B;  4IG7 B;  1EF1 A;  4GZU A;  4G11 A;  4AJW A;  2WX1 A;  3H6N A;  5CX3 A;  3MDB C;  2NS5 A;  3OAN A;  4WVF B;  5CLL B;  3VDZ A;  3B0A A;  1Z2M A;  4A6H A;  3DXC A;  3FLV A;  1FHX A;  5DHA B;  2ZNV B;  4F7Z A;  3APC A;  1MIZ B;  4HDQ A;  2DEN B;  1H10 A;  4W9C A;  4ANV A;  1I35 A;  3TCA A;  1WFY A;  1F9J A;  4IW0 A;  2EJ8 A;  1G6J A;  5DPS A;  2FIF A;  1KZG A;  2DYB A;  5CHF A;  2KDI A;  2KC1 A;  3VIA A;  4KDL B;  2R2O A;  1P3R A;  5JZE B;  2KLC A;  2KDE B;  2H7D A;  2CS4 A;  2YVC A;  4AOF A;  1SIF A;  4IFS A;  3RCZ A;  4C0A A;  2DHJ A;  3I3T B;  4NY0 A;  5HE2 A;  1LFD A;  2KD0 A;  3D8E A;  4W9K A;  3ML8 A;  2K6D B;  1EF5 A;  2MDX A;  5CHW A;  1XKE A;  2G4D B;  4EMO A;  1HBK A;  2L3Z A;  4WJP A;  1EVH A;  3X23 A;  3WAO A;  2V76 A;  2P8V A;  3ZKJ C;  3VUW A;  4N9F 4;  4MGK E;  2PJH A;  4ZDV A;  1IRS A;  1ST7 A;  4GB9 A;  4RM9 A;  1AAR A;  5E6N A;  1WXM A;  2KOX A;  3M1I B;  1WRD B;  4E3C A;  2UZR A;  4GMX B;  4W9D A;  3H7P A;  2RQ1 A;  3A33 B;  4FLH A;  1WXV A;  1SGH A;  5GOW B;  2DX5 B;  1YX6 B;  1C1Y B;  3SYX A;  4FJY A;  5D27 A;  1GNU A;  3OAW A;  3PZD A;  3EHV A;  3K9P B;  2C7N B;  4PS3 A;  2KDF B;  4WJQ A;  1ZKH A;  3WAP A;  2BPS A;  3JVZ X;  4RM8 A;  3RT3 B;  1WI0 A;  3A98 B;  1YIW A;  5C5B A;  4BKT A;  3T8M A;  1WX7 A;  4II3 B;  1P6S A;  1V49 A;  2LYD A;  3KUD B;  3VAW A;  3ZIM A;  2NBV B;  2K1F A;  3DCG A;  1I42 A;  4JQW C;  1U4A A;  1WXS A;  4JL9 A;  2DZM A;  4B9K A;  2O6V D;  2MCN B;  3KZ1 A;  1X1G A;  1HB6 A;  3KYC D;  2J0M A;  2D11 A;  1TJ6 A;  3N3K B;  3U8Z A;  1UNP A;  2BWF A;  3IVF A;  5DPW A;  3AU4 A;  1V9J A;  1WGR A;  4II2 B;  3ZTD A;  2GBM A;  1J0G A;  3VFK A;  2ELA A;  1V80 A;  4W9H A;  1RAX A;  4AP4 C;  3AUL A;  2CY4 A;  2K8C A;  1HB8 A;  4HB3 B;  3V62 A;  1WG7 A;  1ZSQ A;  4LJP B;  3ZO5 B;  2Y5B B;  1LB1 A;  5JLJ B;  1W1D A;  1Y5O A;  5AZF A;  2JY6 A;  5HE1 A;  4F1S A;  2K25 A;  2WH5 A;  1E8W A;  2XK5 A;  2KMC A;  4HLE A;  2IY0 B;  4GXB A;  2LAS A;  1B55 A;  2KX3 A;  2JZZ A;  1UZX B;  1J19 A;  3O65 B;  3VHT C;  1WJ6 A;  4HAV B;  4TKN A;  1AWE A;  2FJ9 A;  2DHK A;  3VTV A;  4K7W A;  4A6K A;  3DBR I;  2ADZ A;  4IAP A;  1QQG A;  1MPH A;  3QBV B;  2L0T A;  2C7M B;  3EPY A;  2ZPN A;  4GDK A;  4I6L B;  2PE6 B;  1WI1 A;  2K8H A;  3PRM B;  4MGZ E;  1XX0 A;  4BOZ B;  1TTN A;  1R4M I;  5JHG A;  5D94 A;  2KFK A;  1A5R A;  3P6A A;  4EFO A;  1WGQ A;  1KLV A;  2QHO A;  4CYE A;  4PYZ A;  1U5E A;  3A4S C;  3VOQ A;  2IO2 B;  2CR5 A;  2COC A;  4FAD A;  1XR0 B;  3DXD A;  4MJS B;  4W9I A;  2QKM A;  3KSY A;  3DVG X;  3SNH A;  1QC6 A;  2PPH A;  1YD8 U;  5D3V A;  1E5W A;  4IC7 B;  2M14 A;  4FJV B;  3ZTC A;  1UEL A;  3JSV A;  1BT0 A;  3LJU X;  1UBI A;  3UQB A;  2D2Q A;  2FID A;  2Z0O A;  2K39 A;  2KLG A;  1WGH A;  5C6R A;  4BKG A;  3KUC B;  1EUV B;  5IJM A;  1WYW B;  2K2J A;  2RGN B;  5DPT A;  4KAX B;  2ZCB A;  2L2I A;  3EEC A;  2L00 B;  1EAZ A;  4B6H A;  4FHK A;  1PLS A;  2KO3 A;  2Z0P A;  1KM7 A;  3BY4 B;  4XC2 A;  2I5C A;  5DCN A;  4DWF A;  3CMM B;  1ZM0 A;  2YS3 A;  5CTR C;  3ML4 A;  2LGD A;  3IHP C;  1WF9 A;  2IO0 B;  2AYO B;  3ZVR A;  2MP2 B;  4ASW C;  2KWU B;  2L7R A;  3ZNG C;  2AL3 A;  2IO1 B;  2FCN A;  4HPL B;  1V5M A;  2L76 A;  1Z5S B;  4FJZ A;  1SHC A;  1E7U A;  4DHZ E;  2LZ6 A;  3DVN V;  3FSS A;  1FGZ A;  3TMP B;  3ZW3 A;  3FM8 C;  1LQB A;  1P0R A;  4JIO U;  1WJM A;  1BTK A;  4X57 B;  1YX5 B;  3ZRC A;  3CSF A;  2BKR B;  2J7Q B;  2A5U A;  5AEK B;  1Q0W B;  2KNB A;  4IM2 A;  1U2B A;  3K9O B;  1UD7 A;  3W1Y A;  2NMB A;  4Z2N A;  2K8B A;  3R7R A;  4F7G A;  3PSE B;  1GC7 A;  3KRX A;  2HTH B;  2LVP A;  4BKS D;  2O2V A;  3A9K B;  1L7Y A;  2A4Z A;  1E90 A;  1WJ1 A;  3B1L X;  4IM0 A;  3TFM A;  1DDW A;  4A3O A;  3ENE A;  2KFJ A;  3KW5 B;  4A20 A;  4KIK B;  4LDT D;  2KQS A;  1XOD A;  2D9V A;  3ZRF A;  1WM2 A;  2KGX B;  1WVH A;  4I6N B;  3PT2 B;  3N7C A;  2LRW A;  1XT9 B;  2KJ6 A;  4KSL C;  1TQZ A;  4YON A;  2J59 M;  1KZ7 A;  1V5U A;  1KJT A;  2O6V B;  2FJL A;  2WWZ A;  4KV2 A;  1NBF C;  3H9D A;  2DLW A;  3U7D A;  3WAL A;  3BJI A;  4DHZ B;  5EDS A;  3PG7 A;  2RPQ A;  2JP2 A;  2P0F A;  1PMS A;  5DPR A;  2COD A;  1FHO A;  3DXE A;  2ZVN A;  4K2P A;  1Q67 A;  4PYU A;  2NPT A;  1ISN A;  1I2H A;  4K2O A;  5CLQ B;  2ZPY A;  2IFS A;  3M62 B;  1OTR B;  3RYT A;  2D4Q A;  3PRE A;  3N30 A;  4K1R B;  2JRI B;  3AU5 A;  2NZ8 B;  3PS6 A;  5C23 A;  2N1W A;  3C0R B;  4MEM A;  1UPQ A;  3IG3 A;  1R4N I;  1U29 A;  2M1M A;  2ROZ B;  2E2X A;  1U5G A;  5KQ4 A;  3JYU A;  2KTF A;  3GZN I;  2N23 A;  1XCG A;  4FBJ B;  2KTR B;  4FN2 A;  1ZVR A;  3M3J A;  4WJO A;  2YF0 A;  4HAT B;  3PRP B;  4DHJ D;  1WMH B;  3OJ4 B;  4I6P A;  3PVW A;  4EJN A;  2Z0D B;  5FI0 A;  3QAR A;  2KVR A;  3L16 A;  2DTC A;  3ALB A;  4BBN C;  2RR9 A;  2MSE D;  4K17 A;  4GDL B;  2GBJ A;  4ICU A;  5C5B B;  4GU2 A;  4FHJ A;  2FCM A;  2AWT A;  2N9X A;  3QCA A;  2IBI B;  5L95 C;  4CHK A;  1V6E A;  4L6E A;  2N1V A;  2GCL A;  4Y94 A;  5KCV A;  2N9E B;  4EZK A;  4PS8 A;  1IP9 A;  3APD A;  1GC6 A;  2GMI C;  1UNQ A;  1P5T A;  4GMV A;  3W1S A;  2LKO A;  3ZDM C;  3EFU A;  3NZS A;  1WGU A;  2YRY A;  3M63 B;  4KDI C;  2D07 B;  2IY1 B;  1J8C A;  4K7U A;  2LI5 A;  2ZNV C;  4PS7 A;  4TQ0 A;  1MK9 B;  5GMV A;  2MBO A;  3X0W A;  2J0K A;  3UZT A;  3KH0 A;  3DVN U;  2RSU A;  2BYV E;  2Y8F A;  3W1S C;  2KQ7 A;  4W9G A;  3F0W A;  2I5F A;  3NHE B;  1RRB A;  1XD4 A;  1UH6 A;  3ONS A;  4TV3 A;  1FOE A;  3MHS D;  3D8F A;  5D3X A;  1WGY A;  2G45 B;  1AQC A;  2MQJ A;  2V3S A;  3QHT A;  2ELB A;  3PPA A;  2MW5 A;  4KVG B;  4W9J A;  1K5D B;  2L05 A;  3WYF B;  4DBG A;  4WSF A;  2YLM A;  5IA7 A;  3A1Q B;  1NDD A;  1FGY A;  2EKE C;  2KZR A;  3QIJ A;  5JH5 C;  3CST A;  3H1U A;  3ZUN A;  5DI9 B;  2BWE S;  3QQ8 B;  1FHW A;  2Q13 A;  3SO6 A;  2DYN A;  5C79 A;  3DBH I;  2RUK B;  1L2N A;  1M7R A;  4G50 A;  4MK0 A;  5E6O A;  2VRW B;  1MAI A;  3PGE A;  2IO3 B;  3VQI A;  4JLC A;  3WIM A;  2KAN A;  3OLM D;  1XQQ A;  4D0N B;  2DX5 A;  4XZ4 A;  2LGX A;  3M95 A;  3HK0 A;  3RZW C;  1EGX A;  2BYF A;  2MA9 B;  3CXB B;  4DDI D;  1MG8 A;  2EMT A;  2Z0Q A;  3PHW B;  2YT1 A;  2KUP A;  1W1G A;  3DDC B;  3PRZ A;  1V61 A;  3A9J B;  3F5R A;  2KC2 A;  2KXJ A;  3ML9 A;  2XQN M;  1WJ4 A;  2M8S A;  2NBU A;  2G35 A;  2DYQ A;  1T0Y A;  1UEF A;  3VXW A;  2G4S A;  1I7A A;  2I1J A;  5BO4 B;  2C5L C;  3PSC A;  4MSM B;  4HAU B;  3UIN B;  3D8D A;  2UYZ B;  3DVG Y;  2COP A;  1WE7 A;  2GBK A;  2LJ5 A;  3TVV A;  3V61 A;  3APF A;  4E74 A;  1OEY J;  2JZ3 B;  2W2X C;  4HAX B;  1KI1 B;  2KX0 A;  2JPH A;  4LDT B;  3NS8 A;  3R7Q A;  2LXA A;  2HE7 A;  2GJY A;  1KOT A;  2BCJ A;  1WJN A;  1E8Y A;  2EC1 A;  1DRO A;  2MRP A;  3PVL A;  1N3H A;  1X11 A;  2KN5 A;  1VD2 A;  5J3Y A;  2H7E A;  4IOY X;  3QK0 A;  2IYD B;  3NSU A;  4MEL A;  3ODW A;  1U5F A;  2YT0 A;  2FDQ A;  3PHX B;  1X1M A;  1V86 A;  4HHV A;  4NQK E;  2DHZ A;  3TJP A;  2KHW B;  1E8Z A;  3DQV A;  4XWX A;  3HQC A;  2KJR A;  1WGG A;  2OOB B;  3MPX A;  4WJ7 A;  3KRW A;  2XEW A;  5LOP B;  5J3Q A;  3VVW B;  4M8N A;  5TR5 A;  3HM3 A;  3PLU A;  5AZG A;  3ECI A;  4HDO A;  4FA6 A;  5KHO A;  3ODO A;  4BVU C;  3DOW A;  5JHA A;  2LOZ A;  1V5O A;  3VH4 B;  2LBB A;  1TGZ B;  4AWJ A;  4F8C B;  4EEW A;  3V5W A;  3VUX A;  1IYF A;  1XD3 B;  1H8C A;  2DYM A; 
#chains in the Genus database with same CATH topology
 4HAW B;  3N32 A;  2EMS A;  4YL8 A;  1ZDV A;  1YMH E;  3EGR A;  1PFD A;  3GS2 A;  2CHZ A;  1LM8 B;  2N7E A;  2JZP A;  4ZYN A;  5HE0 A;  1NTV A;  3QWM A;  1TJE A;  4XYC A;  2J52 A;  3ZNH B;  1JWM D;  2W2X D;  2NMQ A;  1WGD A;  4DHJ B;  1FXI A;  2CHW A;  3FEH A;  1S1Q B;  1DOX A;  4GN1 A;  3B2F A;  3QA8 A;  1M7E A;  4PQ0 A;  5JP4 A;  1FNU A;  2ASQ A;  4MJS A;  1NI2 A;  4L23 A;  2HJ8 A;  5KQ1 A;  2DWQ A;  2Z8L A;  3NY5 A;  4BBK A;  4DX9 0;  3FIL B;  2VRR B;  2JWZ A;  3HSA A;  1KLU D;  5IN7 A;  4A3P A;  3P4R B;  1V81 A;  1HTO A;  1VDV A;  3TW1 A;  3B08 A;  1TS4 A;  3PLV A;  2D9W A;  5L83 A;  3RNB C;  3UIO B;  2LD9 A;  5DH9 B;  2MWN B;  1STE A;  4OVU A;  1KTK A;  1FO4 A;  4KKJ A;  3C8Y A;  3PVU A;  3RUI B;  3SUZ A;  2MJ3 A;  4B6W A;  1VCB A;  2NCN A;  4HK2 A;  4CO7 A;  3O96 A;  1L4Z B;  2PE9 A;  4ZRJ A;  1CZP A;  4WWP A;  1CJE A;  1FIQ A;  3HIZ A;  4MH0 E;  2ROV A;  1C4C A;  2E3T A;  4HCP B;  4A6F B;  3GYP A;  2BKF A;  4R3D A;  2N0Y A;  4DK5 A;  2XNA C;  3SDL C;  4NAW A;  1PDX A;  1ZUD 2;  1GG3 A;  5D3W A;  3UI3 A;  3Q3J A;  3Q3F A;  5AUK A;  2WDV B;  1FNV A;  3CIR B;  4HCN B;  1UUP A;  1N6Z A;  3RUL A;  1ENF A;  2IYB A;  3T06 A;  4WUR A;  3AEB B;  2JXX A;  1BWN A;  1X05 A;  4EKU A;  2HRJ A;  2D3B A;  1U5D A;  4KZ0 A;  3UIP B;  4C56 C;  2V1Y A;  4LLG M;  2D5G A;  4AUQ C;  3VTU A;  1M4V A;  3W9C B;  4FUL A;  1X86 A;  1HZ5 A;  3NVZ A;  1IBX B;  2WX0 A;  2VKI A;  2MP2 A;  3U12 A;  2FNJ B;  4YSZ B;  2ZCC A;  1AW7 A;  1KF6 B;  4GSW A;  3DBS A;  2YS1 A;  1FFV A;  4K7S A;  1ZC4 B;  3DCX A;  1WJU A;  4DX8 A;  1LW3 A;  1XXG A;  3QAQ A;  3V6E B;  3TEW A;  4ZHP A;  1DOI A;  4MT5 A;  3H7S A;  2YS5 A;  5DHF B;  5G55 A;  1M94 A;  2D3C A;  1U27 A;  1UNR A;  4EE2 A;  2R0D A;  2W9N A;  3AE7 B;  3A58 A;  2MFQ A;  1D5X C;  1QOF A;  1ACA A;  3KWL A;  4DXF A;  2BS4 B;  1V5T A;  4P7I A;  1XLP A;  3SD5 A;  1FAO A;  2JWU A;  1OEY A;  2CHX A;  3VR9 B;  1NYQ A;  1OMW A;  3AE2 B;  3Q69 A;  3PTF C;  2RRF A;  2UVM A;  4WQO B;  4DXA B;  1WE6 A;  4MGI E;  2Y8G A;  1FB8 A;  2ZKM X;  2I1K A;  1JRU A;  2HTH A;  2ABD A;  1FXT B;  1LO5 D;  4C7Y A;  2AX5 A;  3T9L A;  4JKA A;  3A9K A;  2COA A;  2N9K A;  2N7D A;  5J3T A;  3AM9 A;  2MKR A;  3L0W B;  4KIK A;  2LG1 A;  2DKP A;  2KCJ A;  2K5P A;  1D5Z C;  4HB4 B;  4LCD E;  4GOC A;  1WX9 A;  3NRZ A;  2DAJ A;  4ICV A;  3RCP A;  3L08 A;  2MBB B;  4DIX A;  2X18 A;  3PEG A;  2YSZ A;  5FK9 C;  1WXQ A;  2M17 A;  3H7P B;  5J2R A;  4NQL B;  2DLB A;  3G9W A;  2JU6 X;  5IRS A;  2JUO A;  5I2S A;  2MLB A;  1ZC3 B;  2O6V A;  2RD0 A;  1YN3 A;  2G3Q B;  2W82 A;  4MGY E;  4HB2 B;  2V3N A;  3PV1 A;  3AEA B;  1TS5 A;  5IAA C;  4B95 A;  2WXJ A;  2J0J A;  2IND C;  3U30 A;  2BB6 A;  5JHH A;  1DDM A;  1VJK A;  3SR6 A;  3ODX A;  1IGC A;  2L52 A;  2JF5 A;  1DBH A;  2Y7B A;  1AN8 A;  1QKZ A;  1WR6 E;  2MH7 A;  1GJZ A;  1IUE A;  4N6E B;  1FXA A;  4DQO C;  3ZNI D;  3LJ3 A;  1MIX A;  2DFK A;  2YT2 A;  4KHA A;  3QJZ A;  4ANX A;  3FC4 A;  4NAM A;  4YSX B;  3NZU A;  1GGO A;  2DAF A;  2WYQ A;  3AXC A;  2K9X A;  3MP9 A;  3UF8 A;  1P3Q U;  4OVV A;  3L13 A;  2KDB A;  3NS1 A;  3B2G A;  1PUT A;  1XLN A;  2KK8 A;  4RFB A;  4DBB A;  3DBR B;  1J0W A;  3EC8 A;  2GBN A;  4RNA A;  3SHQ A;  1K5G B;  1NTY A;  1ZGU B;  2BBC A;  5JHB A;  3P2B A;  1NI3 A;  3WA0 A;  3LB8 C;  3VH3 B;  4HAY B;  5DIF B;  1EM7 A;  3MJW A;  1ZXH A;  2IZV B;  1L0X B;  4XX5 A;  1V89 A;  4OHJ A;  2IGD A;  2GOW A;  1J7C A;  1MFW A;  1QIL A;  3FP5 A;  1R4M B;  3E9P A;  4MM3 A;  5MPO A;  3RNA C;  1XCT L;  2B3A A;  4P6V F;  1WZ3 A;  1LXD A;  1MPE A;  1UBQ A;  3VTW A;  3O13 A;  2KTR A;  4JE3 B;  1WWT A;  2G9H D;  2FCQ A;  1BAK A;  5LON B;  3CIK A;  4HWI B;  1HQR D;  5LXH A;  3L54 A;  3MTN B;  1WMH A;  1WR1 A;  2DZI A;  3PP2 A;  3DPD A;  2HJ1 A;  4JGH B;  4K81 A;  4N58 A;  2BGF A;  3ZNZ B;  3Q14 C;  4HPM B;  2K2U A;  3TEX A;  4CQN A;  1TXD A;  2CKH B;  3S2A A;  2KJH B;  5KHQ A;  3TUO A;  4ANW A;  3FAH A;  1L5P A;  4K3C A;  4PNK A;  3A4R A;  5EFX A;  1B1Z A;  2FBW B;  1T77 A;  3TBL D;  3E9O A;  3ULC A;  4RGO S;  3RNE C;  2GCJ A;  2OJW A;  1ET9 A;  3E56 A;  1I4R A;  4KSK C;  4XE0 A;  4GDL A;  4IWQ A;  3HW2 B;  2XK5 B;  2M56 B;  3I63 C;  1UWM A;  4M8M A;  3I9V 1;  2CRF A;  3P7Z A;  4WIP A;  1WZ0 A;  3IBE A;  2ZW0 A;  4E71 A;  3TO1 A;  3KUZ A;  2R2Q A;  4RMA A;  1TZO A;  3NG0 A;  1MI0 A;  3AEC B;  4IWO A;  2I38 A;  2INC C;  4WWO A;  2OJR A;  2MBE A;  3ULB A;  1OQN A;  3BK2 A;  5LLI A;  5BMG A;  4ILG B;  3LDZ E;  2RSG A;  4QJ4 B;  4MDK E;  1DYN A;  3A8P A;  3SBG A;  2C7H A;  2AEH A;  2DKQ A;  3JW0 X;  5HE3 A;  2R2Y A;  1JQ4 A;  2HD5 B;  2DHI A;  4HJK A;  2C60 A;  1BTN A;  2OQB A;  1V1P B;  3DWM A;  2CU1 A;  5D3Y A;  1ZW7 A;  4LJO B;  4WQM A;  3SV1 A;  1P9D U;  4GDK B;  3V60 A;  1X1F A;  2KWC A;  3L17 A;  1OQY A;  3ZLZ A;  2Z59 B;  3P1M A;  2ZJD A;  1KH0 A;  2DX1 A;  1K50 A;  1YJ1 A;  3BZD B;  2KFK B;  3HIE A;  4H8S A;  2KWD A;  4F7U P;  2BYE A;  1C3T A;  4OZC A;  1TY2 A;  3KYD D;  5BMH A;  2ZZP B;  4Z2M B;  2KMM A;  1NVL A;  2GRI A;  4KZC A;  2WXN A;  5IP4 D;  3ZJT A;  4EOY A;  3ABV B;  2R09 A;  1DDV A;  4TQ1 A;  2D9Z A;  3A8Q A;  1GUA B;  4LTU A;  1V5P A;  4MSQ B;  4AJY B;  5J18 A;  2WNM A;  4YTM B;  1V88 A;  3DBL I;  1P7E A;  1RFA A;  3A1Q A;  1QQR A;  1Y19 B;  3OWE B;  3AN1 A;  3BIN A;  2JRH A;  2MBH A;  1BXT A;  1D4B A;  2W2W A;  1VBG A;  1JWU D;  4KHB B;  2CJO A;  3QX1 A;  2VSZ A;  1NTI A;  2Z0E B;  2L1C A;  4W9L A;  3Q2A C;  2CB8 A;  1PQS A;  2NVU I;  4M01 A;  3JSV B;  3AE4 B;  2LMC A;  2BS3 B;  2J4X A;  2KQ4 X;  2P0D A;  2UZS A;  1TZ1 A;  4A8X C;  3OJ3 A;  2LUE A;  1F1H A;  4G0N B;  3AV8 A;  2K6Q A;  3AH7 A;  1GAQ B;  2LVQ A;  1L0V B;  4HAZ B;  4WAA A;  5FR6 A;  2MX2 A;  1UGM A;  3HM6 X;  2K22 A;  2Q5W D;  4HEA 1;  2P0H A;  3J9C A;  1YQ3 B;  2RPV A;  2ZEQ A;  4W9F A;  5E6J A;  4TYZ A;  4QJ3 B;  2N4F A;  4YT0 B;  2NBW B;  4A5K A;  2LWP A;  4URK A;  4KHO A;  4YTN B;  4B0E A;  2KWV B;  3TIX A;  5FI1 A;  1Q5W B;  4REZ A;  4MY6 A;  4NNJ B;  4P16 A;  1K8R B;  3ZVV A;  2KIE A;  2LVO A;  4GGQ A;  1HA5 A;  1NEN B;  2PEA A;  1QOG A;  3A9J A;  4M00 A;  4QJ5 B;  1T3Q A;  1YN4 A;  2RDG A;  2JVC A;  1NEK B;  2KT7 A;  2RGF A;  3KQ4 A;  4CSQ A;  3RPF C;  4EZL A;  2PIA A;  1WM3 A;  3KWV A;  2LOX A;  3QC8 B;  5LXI B;  1SE9 A;  4XDD A;  2RLO A;  3GYO A;  4PT5 A;  2M38 A;  1WH3 A;  2QKL A;  2ZVO A;  5BMI A;  5D7G A;  2DN6 A;  1Q1O A;  3R2I A;  3T3N A;  2MWS B;  1YQB A;  2CU3 A;  1WX8 A;  2PLP A;  1MG4 A;  4IWP A;  4IOI E;  1RLF A;  2NTS A;  4JK8 A;  5D3D A;  3IFW B;  5HG2 A;  4BKS A;  1CMX B;  2CAY A;  2QMT A;  4ARI A;  1RFK A;  2BTE A;  3BYY B;  1WRI A;  3Q8E A;  2JX5 A;  3ZDT A;  2DYO A;  3Q3N C;  4GPT B;  1L4D B;  2N9P C;  4HXD A;  2LUL A;  2D10 A;  5D2M B;  2GS0 A;  1QZE A;  2MEK A;  2BB5 A;  2X38 A;  1EO6 A;  2DA0 A;  1JCK B;  1ZPS A;  3P63 A;  3R66 C;  3RD2 A;  4DDG D;  2C9W B;  4ZRI A;  1TBE A;  2FAZ A;  1D5M C;  2M0X A;  3I5J C;  2D9X A;  2RVB B;  4NAW B;  1PFJ A;  4M0W B;  4JK9 A;  2KMA A;  2PW9 A;  3UGB B;  4GIV A;  1EU3 A;  1ET6 A;  2DZK A;  2VZK D;  2DZJ A;  1S3S G;  1R4N B;  3DHG C;  2JT4 B;  3KY9 A;  2TSS A;  3H8H A;  4NJ7 A;  2FCS A;  4WJN A;  2O2V B;  3GZN B;  3P42 A;  5D6J B;  4ANU A;  1HTQ A;  2WDT B;  4TUU A;  2D9Y A;  3WAN A;  4BBN F;  1OY2 A;  4HB0 B;  4QXA B;  5I2M A;  4XWT A;  1UWX A;  1Y8R C;  4MT7 A;  2NR2 A;  3CF6 E;  3EUB 2;  3VUY A;  1Z87 A;  1HZ6 A;  1P1A A;  2Z14 A;  4NJ6 A;  3Q6B A;  3AI5 A;  2L8J A;  4OT1 A;  1D6E C;  5EE3 A;  5EE1 A;  2WDR B;  5IOI A;  3SU8 X;  2D3G A;  1F52 A;  1H4R A;  2CQU A;  1E7V A;  2WGS A;  4IUM B;  2LJI A;  4XGA B;  4CHJ A;  2KYW A;  2OTX A;  1GB1 A;  2LRU A;  5L81 A;  2WXR A;  1FNW A;  1WYG A;  3EA6 A;  4OZB A;  1AWD A;  3AMZ A;  3PZ8 A;  5C1Z A;  2K00 A;  1WIA A;  1RM6 C;  3AJ4 A;  2JYT A;  3V6C B;  4WWN A;  3HHM A;  2KN4 A;  2GBR A;  3GOE A;  1SJH D;  1XF5 L;  3TSS A;  1UGJ A;  4MH8 A;  3NJT A;  1OGW A;  2REX A;  4EUT A;  3UQA A;  5E6P A;  4BOS C;  1E10 A;  1HE8 A;  2KAC A;  2AL6 A;  4CHM A;  5HKH A;  2CY5 A;  1UPR A;  4J6I A;  3E9L A;  4F7H A;  5CHV C;  4HVB A;  2MBQ A;  4WAF A;  2NPT B;  3DHH C;  4ZRK A;  4BFR A;  1P98 A;  1ROE A;  5FR3 A;  5IO9 A;  2BF8 B;  1ACC A;  4HSI A;  3RI7 C;  2W3R A;  2UWQ A;  1RJ2 A;  1C76 A;  2QEJ C;  3TL5 A;  3KVF B;  2LUM A;  1D3Z A;  2LGY A;  2XBB C;  2FUH B;  1PGA A;  5JXV A;  2RNR B;  4EZJ A;  4W9E A;  1N60 A;  3FIL A;  3RZF A;  1IPG A;  3WAM A;  3L10 B;  4Q2J A;  2KKC A;  1V2Y A;  2FJU B;  1W1H A;  3N1X C;  2LXC A;  4YWG G;  5GXG B;  2M4N A;  4BZA A;  4NSW A;  1WY8 A;  1RRP B;  3ZYY X;  4RGN A;  2M19 A;  4G3X B;  4NPN A;  2GLS A;  5G2N A;  4IM3 A;  2PZ1 A;  3QWZ B;  3GB1 A;  5EE9 A;  5AZH A;  5C16 A;  1MKE A;  1WXA A;  3CWI A;  3MJ5 A;  5J17 A;  3R3M A;  2L0F A;  3D32 A;  3ENB A;  3MHZ A;  4ITK A;  2IPK D;  4ZRP A;  3NOB A;  2G1E A;  3AE5 B;  2L83 A;  2NTT A;  4A6F A;  1NU2 A;  1E8X A;  2COF A;  3P4S B;  1MK7 B;  4IG7 B;  1EF1 A;  4GZU A;  3ETR A;  4G11 A;  1RYJ A;  4AJW A;  2WX1 A;  3E9S A;  3H6N A;  5CX3 A;  3MDB C;  2NS5 A;  1SXT A;  3OAN A;  1PGB A;  3C19 A;  4WVF B;  5CLL B;  2JXT A;  3VDZ A;  3B0A A;  1Z2M A;  4A6H A;  3DBH B;  3DXC A;  3FLV A;  3LYY A;  2K8E A;  3NUH B;  3RFZ B;  1N5W A;  1FPY A;  1IBX A;  1FHX A;  3HVZ A;  5DHA B;  2ZNV B;  2WU5 B;  4F7Z A;  3APC A;  1MIZ B;  4XDC A;  4HDQ A;  1T0S C;  2DEN B;  1VZ7 A;  1H10 A;  4W9C A;  5IKC M;  3DHI C;  4ANV A;  2IGH A;  1I35 A;  3TCA A;  1K51 A;  1WSP A;  2DIK A;  4WWM A;  1WFY A;  1F9J A;  4IW0 A;  2EJ8 A;  1G6J A;  5DPS A;  2FIF A;  2V9H A;  1KZG A;  2DYB A;  3NVW A;  2N7J A;  5CHF A;  2KDI A;  4ZYS A;  2KC1 A;  3VIA A;  1NYR A;  4KDL B;  3ZQ4 A;  2R2O A;  1P3R A;  5JZE B;  1K52 A;  2KLC A;  2KDE B;  2H7D A;  2WLB A;  2CS4 A;  2YVC A;  2VH1 A;  1F2R I;  4AOF A;  1I4P A;  1SIF A;  4RF0 A;  4IFS A;  3RCZ A;  4C0A A;  2DHJ A;  3I3T B;  2LHE A;  2WXM A;  4NY0 A;  5HE2 A;  1LFD A;  4ILJ A;  2KD0 A;  4KGS A;  3D8E A;  4W9K A;  3GE3 C;  4ARC A;  3ML8 A;  2K6D B;  4LK0 M;  2WP9 B;  1SE2 A;  1EF5 A;  1FRD A;  3AEE B;  2MDX A;  5CHW A;  1ZE3 D;  1XKE A;  2G4D B;  4EMO A;  1HBK A;  1MHX A;  2L3Z A;  3AE8 B;  3DWG C;  4WJP A;  4O1N A;  4C4V B;  1FD6 A;  1EVH A;  3X23 A;  3ZXR A;  3WAO A;  2V76 A;  1C9F A;  2P8V A;  1XO3 A;  3ZKJ C;  3VUW A;  4N9F 4;  4MGK E;  2PJH A;  4ZDV A;  1IRS A;  1KC7 A;  1ST7 A;  4GB9 A;  1T5X D;  4RM9 A;  1AAR A;  5E6N A;  2K3U A;  1WXM A;  1T0Q C;  4JWU C;  2KOX A;  3M1I B;  3P4Q B;  2IDY A;  2OED A;  1AYF A;  1WRD B;  5BYQ A;  4E3C A;  2UZR A;  2WXF A;  4ZRQ A;  4GMX B;  4W9D A;  1R7S A;  5H8Y E;  3H7P A;  2X0S A;  1UNS A;  2RQ1 A;  1BML C;  4D6W A;  2WXL A;  3T3O A;  1YQ4 B;  3A33 B;  4FLH A;  1WXV A;  1SGH A;  2QC8 A;  5GOW B;  2WXP A;  4LNO A;  2DX5 B;  1YX6 B;  4YSY B;  1C1Y B;  3SYX A;  4FJY A;  3LXF A;  5D27 A;  1GNU A;  3VR8 B;  1T6B X;  3OAW A;  3PZD A;  1QT9 A;  3EHV A;  3K9P B;  2C7N B;  4PS3 A;  1TIF A;  2KDF B;  4WJQ A;  1ZKH A;  2Y3A A;  3WAP A;  2X8X X;  2BPS A;  3JVZ X;  4RM8 A;  3RT3 B;  3FVC A;  4MAC A;  3SEB A;  1FRR A;  4JKC A;  1WI0 A;  3A98 B;  1YIW A;  5C5B A;  2WS3 B;  4BKT A;  3T8M A;  1WX7 A;  4II3 B;  1P6S A;  4ZOH C;  1V49 A;  3TEZ A;  2LYD A;  1TY0 A;  3KUD B;  3VAW A;  3ZIM A;  4QAY A;  2WDQ B;  2NBV B;  3SFD B;  3EFC A;  1XLQ A;  2K1F A;  3RNF C;  4HPP A;  3DCG A;  1I42 A;  2K49 A;  3N20 C;  4JQW C;  1U4A A;  1WXS A;  4JL9 A;  2DZM A;  4B9K A;  2Z13 A;  2O6V D;  2MCN B;  5HHD G;  3KZ1 A;  2VZK B;  3RNC C;  2W55 A;  5C3J B;  1X1G A;  1HB6 A;  3KYC D;  2J0M A;  2D11 A;  4C80 A;  1FMA D;  1JDE A;  1TJ6 A;  5HFY A;  3OG5 A;  3N3K B;  3U8Z A;  1UNP A;  1CK1 A;  1EWC A;  2BWF A;  2PMV A;  4IDI A;  3IVF A;  3W5V B;  1FM0 D;  5DPW A;  3AU4 A;  1V9J A;  1WGR A;  2ON8 A;  4II2 B;  3ZTD A;  2GBM A;  1J0G A;  3VFK A;  1TT5 B;  2ELA A;  4OZA A;  1V80 A;  1J7B A;  4W9H A;  1RAX A;  4AP4 C;  3AUL A;  2CY4 A;  2K8C A;  1DOY A;  1HB8 A;  4HB3 B;  3N1Y C;  5AUI A;  3V62 A;  3NWF A;  4UDU C;  2R82 A;  3U4E G;  1WG7 A;  1ZSQ A;  4LJP B;  1E6E B;  3ZO5 B;  2Y5B B;  1LB1 A;  5JLJ B;  1N63 A;  1GB4 A;  4AS1 A;  5M4Y B;  1W1D A;  1Y5O A;  5AZF A;  2JY6 A;  3MFG A;  4US9 A;  5HE1 A;  4YTP B;  4F1S A;  1MHH E;  2K25 A;  2WH5 A;  1E8W A;  2XK5 A;  2KMC A;  1E0Z A;  1L0Y B;  2KIG A;  1F77 A;  4HLE A;  2IY0 B;  4GXB A;  1TKG A;  2LAS A;  1B55 A;  2KX3 A;  2BT6 A;  4NJC A;  2JZZ A;  1UZX B;  1J19 A;  3O65 B;  2WXQ A;  3VHT C;  3R2T A;  3URY A;  1WJ6 A;  4HAV B;  4TKN A;  1C77 A;  1XEE A;  1AWE A;  2FJ9 A;  2DHK A;  2J42 A;  3PO0 A;  3VTV A;  2BYT A;  2WXI A;  4K7W A;  4A6K A;  3DBR I;  2QCZ A;  4JKG B;  2ADZ A;  3NW8 A;  4LNN A;  4IAP A;  1QQG A;  1I7H A;  1MPH A;  1V1P A;  1LGR A;  3QBV B;  2L0T A;  2C7M B;  3EPY A;  2ZPN A;  4GDK A;  4I6L B;  2PE6 B;  1WI1 A;  2K8H A;  3PRM B;  1VZ6 A;  4MGZ E;  1XX0 A;  2Z59 A;  4BOZ B;  1TTN A;  4A55 A;  1R4M I;  5JHG A;  2UU7 A;  5D94 A;  1F0Z A;  4KGR A;  2KFK A;  1A5R A;  4GLS C;  3P6A A;  1N62 A;  1FCL A;  3MC8 A;  4EFO A;  1WGQ A;  2JSV X;  1KLV A;  2QHO A;  1C4P A;  1OQR A;  5I4D A;  4CYE A;  3BII D;  4PYZ A;  1YNT E;  1U5E A;  3ZXV A;  3A4S C;  3NVV A;  3VOQ A;  2MHJ A;  2IO2 B;  2CR5 A;  4WH4 A;  2COC A;  4FAD A;  1XR0 B;  3DXD A;  4MJS B;  4W9I A;  2QKM A;  3TEY A;  3KSY A;  3DVG X;  3SNH A;  1QC6 A;  3RMK C;  2PPH A;  1VLB A;  4KHB A;  1YD8 U;  5D3V A;  1E5W A;  3SBT A;  4IC7 B;  2M14 A;  2V0G A;  4FJV B;  3ZTC A;  2W54 A;  1UEL A;  1E9M A;  3JSV A;  3NVY A;  1BT0 A;  3LJU X;  1UBI A;  2K0P A;  2CJN A;  3AB5 A;  3HVD A;  3P4P B;  3UQB A;  2D2Q A;  1WGK A;  2FID A;  1Q10 A;  3NWD A;  2Z0O A;  2K39 A;  2KLG A;  1WGH A;  5C6R A;  4BKG A;  3KUC B;  1EUV B;  5IJM A;  1WYW B;  2K2J A;  2N9L A;  3ZJU A;  2RGN B;  4RH6 A;  5DPT A;  4KAX B;  2ZCB A;  4S17 A;  2ACZ B;  1EWY C;  2L2I A;  2XN9 C;  3EEC A;  2L00 B;  1EAZ A;  2Y5P A;  4LNI A;  1ESF A;  2N0S B;  4XWW A;  4S0R A;  4B6H A;  2QDF A;  4FHK A;  4FXC A;  4HRS A;  1PLS A;  1KRH A;  2Z0P A;  1KM7 A;  2KO3 A;  3BY4 B;  4XC2 A;  2I5C A;  5DCN A;  4DWF A;  4HJG E;  3CMM B;  3W5U B;  1ZM0 A;  2YS3 A;  2I2Y A;  3BVZ A;  5CTR C;  3ML4 A;  2LGD A;  1SJE D;  4GNK B;  4A9A A;  3IHP C;  1WF9 A;  2IO0 B;  2AYO B;  3ZVR A;  2MP2 B;  4ASW C;  2KWU B;  2L7R A;  3ZNG C;  1RWS A;  2AL3 A;  2IO1 B;  2FCN A;  3AE9 B;  3AEF B;  4HPL B;  1V5M A;  2L76 A;  1Z5S B;  4FJZ A;  3IT4 B;  1SHC A;  1E7U A;  4DHZ E;  2LFI A;  2LZ6 A;  1ZDX A;  1C4A A;  1I4Q A;  3DVN V;  3FSS A;  1FGZ A;  3TMP B;  3ZW3 A;  3FM8 C;  2L1A A;  3N9Y C;  1LQB A;  1GPX A;  1P0R A;  4JIO U;  1WJM A;  1T0R C;  3GE8 C;  1BTK A;  4X57 B;  1YX5 B;  3ZRC A;  3CSF A;  3R8B A;  2BKR B;  2J7Q B;  2A5U A;  1VRA B;  1SE4 A;  3MC0 B;  5AEK B;  2MJD A;  1Q0W B;  2RDH A;  2KNB A;  1ZXI A;  4IM2 A;  1U2B A;  3K9O B;  1UD7 A;  3W1Y A;  4HKZ E;  4M0W A;  1OFF A;  2NMB A;  3RNG C;  3B9J A;  4Z2N A;  2V4L A;  2PKO A;  2K8B A;  4M02 A;  1ZYI A;  3R7R A;  4F7G A;  4K3B A;  3PSE B;  1GC7 A;  4JKB A;  3KRX A;  3AE3 B;  2HTH B;  2LVP A;  1DIK A;  3SFE B;  1SEB D;  1KBL A;  4BKS D;  4C00 A;  2O2V A;  3A9K B;  1J7A A;  1L7Y A;  4JKE A;  2A4Z A;  1E90 A;  1WJ1 A;  1CQV A;  3B1L X;  4IM0 A;  2L32 A;  2WQY B;  1YOV B;  3TFM A;  1DDW A;  2IGG A;  4A3O A;  3ENE A;  2KFJ A;  3KW5 B;  4A20 A;  1QF6 A;  4KIK B;  4LDT D;  2KQS A;  1XOD A;  4JKH A;  2D9V A;  2BVC A;  3ZRF A;  1WM2 A;  2KGX B;  1WVH A;  1OQQ A;  4I6N B;  4JKD A;  3N1Z C;  2PTL A;  1PGX A;  3IT6 B;  3PT2 B;  2H88 B;  3N7C A;  2FE8 A;  1XT9 B;  2KJ6 A;  2LRW A;  4KSL C;  3VRB B;  1TQZ A;  4YON A;  2J59 M;  1KZ7 A;  2ZW1 A;  1V5U A;  1KJT A;  2O6V B;  3GP7 A;  2FJL A;  1K53 A;  2WWZ A;  1JRP A;  4KV2 A;  1F2R C;  4ZHO A;  1NBF C;  4RGM A;  1YJJ A;  3H9D A;  1JW9 D;  2DLW A;  1MVK A;  2H89 B;  3Q8A A;  1YJI A;  3U7D A;  2WXG A;  3WAL A;  3BJI A;  4DHZ B;  4RGT A;  5EDS A;  3PG7 A;  3FKY A;  2RPQ A;  1PYW D;  1FFU A;  2JP2 A;  2P0F A;  1PMS A;  1XLO A;  5DPR A;  2COD A;  1FHO A;  3DXE A;  2EKI A;  4K2P A;  1Q67 A;  2ZVN A;  4PYU A;  2NPT A;  1ISN A;  1I2H A;  4K2O A;  5CLQ B;  2ZPY A;  2IFS A;  2R61 A;  2WHI A;  2PVO D;  1OTR B;  3M62 B;  3RYT A;  2D4Q A;  3BK1 A;  3PRE A;  2PVG C;  2DBY A;  1NVI D;  2QSD A;  2HTM E;  3N30 A;  4K1R B;  2JRI B;  3AU5 A;  2NZ8 B;  3PS6 A;  4JWS C;  5C23 A;  4P1B C;  2N1W A;  3C0R B;  2VH2 A;  4MEM A;  2LGS A;  2V3P A;  3U52 E;  1UPQ A;  4KGT A;  4RCO A;  3IG3 A;  1R4N I;  1U29 A;  2M1M A;  3W2D A;  4A90 A;  2ROZ B;  4MM3 B;  2E2X A;  1U5G A;  5KQ4 A;  3JYU A;  3L4P A;  1V8C A;  2KTF A;  2QIE B;  3GZN I;  1JAL A;  2N23 A;  1XCG A;  1I4X A;  3AED B;  5FKA C;  3Q8F A;  4FBJ B;  2KTR B;  4N59 A;  4FN2 A;  5G5G A;  4TMA B;  1ZVR A;  3M3J A;  2ICI A;  4WJO A;  2YF0 A;  4HAT B;  3PRP B;  4DHJ D;  1WMH B;  3OJ4 B;  3KLS X;  4I6P A;  2Z4D A;  1TS2 A;  3HRD D;  2Y5C A;  3DBL B;  3AEG B;  3PVW A;  4EJN A;  2Z0D B;  1IGD A;  2D3A A;  4L1B A;  2WXK A;  5FI0 A;  1QOB A;  3QAR A;  2KVR A;  1BUI C;  3L16 A;  2DTC A;  3ALB A;  4BBN C;  2J53 A;  2KDM A;  2RR9 A;  2MSE D;  4K17 A;  4GDL B;  2GBJ A;  3AE6 B;  4ICU A;  3NZ3 A;  5T8I A;  1JML A;  5C5B B;  4GU2 A;  4J3O D;  4FHJ A;  2FCM A;  4L2Y A;  1DYQ A;  1JRO A;  2AWT A;  2N9X A;  1HEZ E;  3Q3M C;  2IBI B;  3QCA A;  5L95 C;  2AQ2 B;  4CHK A;  1V6E A;  4L6E A;  2N1V A;  2GCL A;  3ZGZ A;  4Y94 A;  2FUG 1;  5KCV A;  4DXG A;  2N9E B;  4EZK A;  4AQ7 A;  1E7P B;  2HDE A;  4PS8 A;  1IP9 A;  3APD A;  1GC6 A;  5G5H A;  2GMI C;  1UNQ A;  1P5T A;  4GMV A;  4OVZ A;  3W1S A;  4HKQ A;  2LKO A;  3ZDM C;  1HXY D;  2JYE A;  3EFU A;  3NZS A;  1WGU A;  2YRY A;  2AQ3 B;  3M63 B;  4KDI C;  2D07 B;  3IAM 1;  2SAK A;  2IY1 B;  2WXO A;  1J8C A;  4K7U A;  3IXS A;  2LI5 A;  2ZNV C;  4PS7 A;  4TQ0 A;  1MK9 B;  2B76 B;  1N61 A;  1C79 A;  2W3S A;  4NZL B;  2MBO A;  4JK7 A;  5GMV A;  3VRA B;  3X0W A;  2J0K A;  3UZT A;  3KH0 A;  5EE0 A;  4HRO A;  3DVN U;  2BQQ A;  2LHD A;  2RSU A;  2BYV E;  2LGI A;  3E66 A;  2BS2 B;  2Y8F A;  3W1S C;  5C2T B;  2KQ7 A;  1DGJ A;  4W9G A;  4ILH A;  1V97 A;  3F0W A;  1KFY B;  3PZ7 A;  2I5F A;  1MI1 A;  3NHE B;  1RRB A;  1XD4 A;  1UH6 A;  3ONS A;  4TV3 A;  4A6Q A;  1FOE A;  3MHS D;  3D8F A;  5D3X A;  1WGY A;  2G45 B;  1AQC A;  2MQJ A;  2V3S A;  3QHT A;  2ELB A;  3BVG A;  3PPA A;  2MW5 A;  4KVG B;  4W9J A;  1K5D B;  2OHF A;  4C4V A;  1SIJ A;  2GI9 A;  2L05 A;  3WYF B;  2JQR B;  1JWS D;  4DBG A;  3V3X A;  4WSF A;  2YLM A;  4P1C C;  5IA7 A;  3A1Q B;  1NDD A;  1FGY A;  2EKE C;  2KZR A;  4B0M A;  3QIJ A;  5JH5 C;  3CST A;  5LNK 1;  3H1U A;  3ZUN A;  1B9R A;  5DI9 B;  2BWE S;  3QQ8 B;  1FHW A;  2Q13 A;  3SO6 A;  2DYN A;  5C79 A;  1I4G A;  3NWA A;  3DBH I;  3V05 A;  1VR9 A;  2KR0 A;  3BWU D;  2RUK B;  1L2N A;  2AQ1 B;  1M7R A;  4G50 A;  1FEH A;  4MK0 A;  5E6O A;  2INP E;  4USA A;  4LNF A;  2VRW B;  3OHM B;  1MAI A;  3PGE A;  2IO3 B;  3HUI A;  4KKI A;  3VQI A;  4JLC A;  4BAX A;  3WIM A;  2KAN A;  3OLM D;  1XQQ A;  4D0N B;  2DX5 A;  4XZ4 A;  2LGX A;  3M95 A;  3HK0 A;  3RZW C;  3MC9 A;  1EGX A;  2BYF A;  1SB3 C;  2MA9 B;  5BYS A;  3CXB B;  1TS3 A;  1SBB B;  4DDI D;  1MG8 A;  2EMT A;  1TYG B;  2KVZ A;  2IJ0 A;  2LEK A;  2Z0Q A;  3PHW B;  2YT1 A;  2KUP A;  1W1G A;  3DDC B;  1ZP0 B;  2V4I B;  3PRZ A;  1V61 A;  2ONQ A;  3A9J B;  3F5R A;  2YEP F;  2KC2 A;  2DNF A;  2KXJ A;  3ML9 A;  3U7Z A;  2XQN M;  1WJ4 A;  2M8S A;  2NBU A;  1KLG D;  2G35 A;  3Q3O C;  2NBV A;  2DYQ A;  2RDB C;  1T0Y A;  4LNK A;  4D2K A;  1UEF A;  3VXW A;  2G4S A;  1I7A A;  5HI1 A;  2I1J A;  5BYR A;  5BO4 B;  2C5L C;  3PSC A;  1SSN A;  4MSM B;  4HAU B;  3UIN B;  4ACF A;  3D8D A;  2UYZ B;  3DVG Y;  4JPS A;  2COP A;  4JKF A;  1WE7 A;  4YXD B;  2GBK A;  2LJ5 A;  4IKG A;  1Y56 A;  3TVV A;  3V61 A;  1SE3 A;  1QOA A;  3APF A;  4E74 A;  1VBH A;  1OEY J;  2JZ3 B;  2W2X C;  5TSS A;  4HAX B;  1V1O A;  1KI1 B;  2KX0 A;  2JPH A;  3BVM A;  4LDT B;  3NS8 A;  3R7Q A;  2E6X A;  4KX6 B;  2LXA A;  2HE7 A;  2GJY A;  1KOT A;  1MJD A;  1JWA D;  2BCJ A;  1WJN A;  4US8 A;  1E8Y A;  4GOU A;  2EC1 A;  1DRO A;  2MRP A;  3Q8B A;  1L6V A;  1ZOY B;  3PVL A;  3IAS 1;  1N3H A;  1X11 A;  4PK1 A;  2MJE A;  2KN5 A;  1L6U A;  2WXH A;  1VD2 A;  1I4H A;  5J3Y A;  1UF0 A;  2H7E A;  4IOY X;  3QK0 A;  1FCC C;  2IYD B;  3NSU A;  3I57 A;  4MEL A;  3ODW A;  1U5F A;  3BYT B;  2YT0 A;  2FDQ A;  3PHX B;  3Q8C A;  1X1M A;  1V86 A;  3ZJV A;  1TKE A;  4HHV A;  2RMM A;  4NQK E;  4L1R A;  1TKY A;  2DHZ A;  3TJP A;  2KHW B;  5LG4 B;  1E8Z A;  5D3I B;  3DQV A;  4XWX A;  3HQC A;  2KJR A;  1WGG A;  2OOB B;  3MPX A;  4WJ7 A;  3RN9 C;  3KRW A;  4OSN A;  2XEW A;  5LOP B;  5J3Q A;  3VVW B;  4M8N A;  5TR5 A;  3HM3 A;  3AE1 B;  3PLU A;  5AZG A;  3ECI A;  2EEL A;  4HDO A;  4FA6 A;  2QJL A;  1YN5 A;  1VZ8 A;  5KHO A;  4TSS A;  4RF1 A;  1C78 A;  3B77 A;  4H2A A;  3ODO A;  4OW0 A;  4BVU C;  3DOW A;  5JVL A;  5JHA A;  2YEP B;  1SF0 A;  1XCQ L;  2LOZ A;  4JKG A;  1A70 A;  4JX1 C;  2QIL A;  1V5O A;  3VH4 B;  2LBB A;  1EU4 A;  1N5X A;  4C7Z A;  1TGZ B;  1P7F A;  4AWJ A;  4F8C B;  2GB1 A;  2INN E;  1QLB B;  4EEW A;  3V5W A;  2GUM A;  3WCQ A;  2KAJ A;  1GOZ A;  2M0A A;  5H92 C;  3VUX A;  1IYF A;  1XD3 B;  2WU2 B;  2SEB D;  2BW2 A;  3U2S C;  1H8C A;  2DYM A;  1JWB D;  2KUQ A; 
#chains in the Genus database with same CATH homology
 4HAW B;  3N32 A;  2EMS A;  4YL8 A;  2CHZ A;  1LM8 B;  2N7E A;  4ZYN A;  5HE0 A;  1NTV A;  3QWM A;  3ZNH B;  2W2X D;  1WGD A;  4DHJ B;  2CHW A;  3FEH A;  1S1Q B;  4GN1 A;  3QA8 A;  1M7E A;  4PQ0 A;  5JP4 A;  2ASQ A;  4MJS A;  1NI2 A;  2HJ8 A;  5KQ1 A;  3NY5 A;  4BBK A;  4DX9 0;  2VRR B;  2JWZ A;  4A3P A;  1V81 A;  3TW1 A;  3B08 A;  3PLV A;  2D9W A;  5L83 A;  3UIO B;  2LD9 A;  5DH9 B;  2MWN B;  4OVU A;  3RUI B;  3PVU A;  3SUZ A;  4B6W A;  1VCB A;  2NCN A;  4HK2 A;  4CO7 A;  3O96 A;  2PE9 A;  4ZRJ A;  4WWP A;  3HIZ A;  4MH0 E;  2ROV A;  4HCP B;  4A6F B;  3GYP A;  2BKF A;  2N0Y A;  4DK5 A;  3SDL C;  4NAW A;  1GG3 A;  5D3W A;  3Q3J A;  3Q3F A;  4HCN B;  3RUL A;  2IYB A;  3T06 A;  2JXX A;  1BWN A;  1X05 A;  4EKU A;  2HRJ A;  1U5D A;  4KZ0 A;  3UIP B;  2V1Y A;  4AUQ C;  3VTU A;  4FUL A;  1X86 A;  2WX0 A;  2VKI A;  2MP2 A;  2FNJ B;  2ZCC A;  4GSW A;  3DBS A;  2YS1 A;  4K7S A;  1ZC4 B;  1WJU A;  4DX8 A;  1LW3 A;  3QAQ A;  3V6E B;  3H7S A;  2YS5 A;  5DHF B;  5G55 A;  1M94 A;  1U27 A;  1UNR A;  2R0D A;  2W9N A;  2MFQ A;  1ACA A;  1V5T A;  4P7I A;  3SD5 A;  1FAO A;  1OEY A;  2CHX A;  1OMW A;  3PTF C;  2UVM A;  4WQO B;  4DXA B;  1WE6 A;  4MGI E;  2Y8G A;  1FB8 A;  2I1K A;  1JRU A;  2HTH A;  2ABD A;  1FXT B;  3T9L A;  4JKA A;  3A9K A;  2COA A;  2N7D A;  5J3T A;  3L0W B;  2MKR A;  4KIK A;  2LG1 A;  2DKP A;  2KCJ A;  4HB4 B;  4LCD E;  4GOC A;  1WX9 A;  2DAJ A;  4ICV A;  3RCP A;  3L08 A;  2MBB B;  2X18 A;  3PEG A;  2YSZ A;  3H7P B;  2M17 A;  5J2R A;  4NQL B;  3G9W A;  2V4L A;  2MLB A;  2JUO A;  2O6V A;  2RD0 A;  1ZC3 B;  2G3Q B;  4MGY E;  4HB2 B;  3PV1 A;  5IAA C;  4B95 A;  2J0J A;  3U30 A;  5JHH A;  1DDM A;  3ODX A;  2JF5 A;  1DBH A;  2Y7B A;  1WR6 E;  1GJZ A;  3ZNI D;  3LJ3 A;  1MIX A;  2DFK A;  4KHA A;  3QJZ A;  4ANX A;  3NZU A;  1GGO A;  2DAF A;  2WYQ A;  3AXC A;  3UF8 A;  1P3Q U;  4OVV A;  3L13 A;  2KDB A;  2KK8 A;  4DBB A;  1J0W A;  3EC8 A;  2GBN A;  3SHQ A;  1K5G B;  1NTY A;  1ZGU B;  5JHB A;  3P2B A;  3WA0 A;  3VH3 B;  4HAY B;  5DIF B;  3MJW A;  2IZV B;  4XX5 A;  1V89 A;  2GOW A;  3FP5 A;  3E9P A;  4MM3 A;  2B3A A;  1WZ3 A;  1LXD A;  1UBQ A;  3VTW A;  2KTR A;  2FCQ A;  1BAK A;  5LON B;  3CIK A;  4HWI B;  5LXH A;  3L54 A;  3MTN B;  1WMH A;  1WR1 A;  2DZI A;  3PP2 A;  3DPD A;  4JGH B;  4K81 A;  2BGF A;  3ZNZ B;  4HPM B;  2K2U A;  3S2A A;  1TXD A;  2CKH B;  2KJH B;  5KHQ A;  4ANW A;  4PNK A;  3A4R A;  5EFX A;  3TBL D;  3E9O A;  3ULC A;  2GCJ A;  4KSK C;  4GDL A;  4IWQ A;  3HW2 B;  2XK5 B;  4M8M A;  2CRF A;  3P7Z A;  1WZ0 A;  3IBE A;  4E71 A;  3TO1 A;  3KUZ A;  2R2Q A;  4RMA A;  4IWO A;  4WWO A;  2OJR A;  2MBE A;  3ULB A;  1OQN A;  5LLI A;  4ILG B;  3LDZ E;  2RSG A;  4MDK E;  1DYN A;  3A8P A;  3SBG A;  2C7H A;  2AEH A;  2DKQ A;  3JW0 X;  5HE3 A;  2HD5 B;  2DHI A;  4HJK A;  2C60 A;  1BTN A;  2OQB A;  2CU1 A;  5D3Y A;  1ZW7 A;  4LJO B;  3SV1 A;  1P9D U;  4GDK B;  3V60 A;  1X1F A;  2KWC A;  3L17 A;  1OQY A;  3ZLZ A;  2Z59 B;  2ZJD A;  1YJ1 A;  2DX1 A;  2KFK B;  4H8S A;  4F7U P;  2BYE A;  1C3T A;  3KYD D;  2ZZP B;  4Z2M B;  1NVL A;  4KZC A;  4EOY A;  2R09 A;  1DDV A;  4TQ1 A;  2D9Z A;  3A8Q A;  1GUA B;  1V5P A;  4MSQ B;  4AJY B;  5J18 A;  1V88 A;  3DBL I;  1RFA A;  3A1Q A;  1Y19 B;  3BIN A;  2JRH A;  2MBH A;  2W2W A;  1VBG A;  4KHB B;  3QX1 A;  2VSZ A;  1NTI A;  2Z0E B;  2L1C A;  4W9L A;  2CB8 A;  1PQS A;  2NVU I;  3JSV B;  2P0D A;  2UZS A;  1TZ1 A;  3OJ3 A;  2LUE A;  4G0N B;  2K6Q A;  2LVQ A;  4WAA A;  4HAZ B;  5FR6 A;  2MX2 A;  1UGM A;  3HM6 X;  2P0H A;  2ZEQ A;  4W9F A;  4TYZ A;  2N4F A;  2NBW B;  4A5K A;  2LWP A;  4URK A;  4KHO A;  2KWV B;  3TIX A;  5FI1 A;  1Q5W B;  4MY6 A;  4NNJ B;  1K8R B;  3ZVV A;  2LVO A;  4GGQ A;  2PEA A;  3A9J A;  2JVC A;  2RGF A;  4EZL A;  1WM3 A;  2LOX A;  3QC8 B;  5LXI B;  1SE9 A;  2RLO A;  3GYO A;  2M38 A;  1WH3 A;  2QKL A;  2ZVO A;  5D7G A;  2DN6 A;  1Q1O A;  2MWS B;  1YQB A;  1WX8 A;  4IWP A;  1RLF A;  4JK8 A;  3IFW B;  4BKS A;  1CMX B;  2CAY A;  3ZDT A;  2DYO A;  4GPT B;  2N9P C;  4HXD A;  2LUL A;  2D10 A;  5D2M B;  2GS0 A;  1QZE A;  1EO6 A;  2DA0 A;  3R66 C;  3RD2 A;  4DDG D;  2C9W B;  4ZRI A;  1TBE A;  2FAZ A;  2M0X A;  2D9X A;  2RVB B;  4NAW B;  1PFJ A;  4M0W B;  4JK9 A;  2KMA A;  3UGB B;  4GIV A;  2DZK A;  2DZJ A;  1S3S G;  2JT4 B;  3KY9 A;  4NJ7 A;  2FCS A;  4WJN A;  2O2V B;  5D6J B;  4ANU A;  2WDT B;  4TUU A;  2D9Y A;  3WAN A;  4BBN F;  1OY2 A;  4HB0 B;  1Y8R C;  4MT7 A;  2NR2 A;  3CF6 E;  3VUY A;  1Z87 A;  1P1A A;  4NJ6 A;  3AI5 A;  2L8J A;  3SU8 X;  2D3G A;  1H4R A;  2CQU A;  1E7V A;  4IUM B;  4CHJ A;  2OTX A;  2LRU A;  5L81 A;  5C1Z A;  2K00 A;  1WIA A;  3AJ4 A;  3V6C B;  4WWN A;  3HHM A;  2GBR A;  3GOE A;  1OGW A;  2REX A;  4EUT A;  3UQA A;  5E6P A;  4BOS C;  1HE8 A;  2AL6 A;  4CHM A;  5HKH A;  2CY5 A;  1UPR A;  4J6I A;  3E9L A;  4F7H A;  5CHV C;  4HVB A;  2MBQ A;  2NPT B;  4ZRK A;  4BFR A;  1P98 A;  2BF8 B;  2UWQ A;  1RJ2 A;  3TL5 A;  3KVF B;  1D3Z A;  2LGY A;  2XBB C;  2FUH B;  2RNR B;  4EZJ A;  4W9E A;  3RZF A;  1IPG A;  3WAM A;  3L10 B;  2KKC A;  1V2Y A;  1W1H A;  2LXC A;  2M4N A;  4NSW A;  1WY8 A;  1RRP B;  4G3X B;  4NPN A;  5G2N A;  4IM3 A;  2PZ1 A;  3QWZ B;  5AZH A;  5C16 A;  1MKE A;  1WXA A;  5J17 A;  3R3M A;  2L0F A;  3D32 A;  3ENB A;  3NOB A;  4A6F A;  1NU2 A;  1E8X A;  2COF A;  1MK7 B;  4IG7 B;  1EF1 A;  4GZU A;  4G11 A;  4AJW A;  2WX1 A;  3H6N A;  5CX3 A;  3MDB C;  2NS5 A;  3OAN A;  4WVF B;  5CLL B;  3VDZ A;  3B0A A;  1Z2M A;  4A6H A;  3DXC A;  3FLV A;  1FHX A;  5DHA B;  2ZNV B;  4F7Z A;  3APC A;  1MIZ B;  4HDQ A;  2DEN B;  1H10 A;  4W9C A;  4ANV A;  1I35 A;  3TCA A;  2DIK A;  1WFY A;  1F9J A;  4IW0 A;  2EJ8 A;  1G6J A;  5DPS A;  2FIF A;  1KZG A;  2DYB A;  5CHF A;  2KDI A;  2KC1 A;  3VIA A;  4KDL B;  2R2O A;  1P3R A;  5JZE B;  2KLC A;  2KDE B;  2H7D A;  2CS4 A;  2YVC A;  4AOF A;  1SIF A;  4IFS A;  3RCZ A;  4C0A A;  2DHJ A;  3I3T B;  4NY0 A;  5HE2 A;  1LFD A;  4ILJ A;  2KD0 A;  3D8E A;  4W9K A;  3ML8 A;  2K6D B;  1EF5 A;  2MDX A;  5CHW A;  1XKE A;  2G4D B;  4EMO A;  1HBK A;  2L3Z A;  4WJP A;  1EVH A;  3X23 A;  3WAO A;  2V76 A;  2P8V A;  3ZKJ C;  3VUW A;  4N9F 4;  4MGK E;  2PJH A;  4ZDV A;  1IRS A;  1KC7 A;  1ST7 A;  4GB9 A;  4RM9 A;  1AAR A;  5E6N A;  1WXM A;  2KOX A;  3M1I B;  1WRD B;  4E3C A;  2UZR A;  4GMX B;  4W9D A;  3H7P A;  2X0S A;  2RQ1 A;  3A33 B;  4FLH A;  1WXV A;  1SGH A;  5GOW B;  2DX5 B;  1YX6 B;  1C1Y B;  3SYX A;  4FJY A;  5D27 A;  1GNU A;  3OAW A;  3PZD A;  3EHV A;  3K9P B;  2C7N B;  4PS3 A;  2KDF B;  4WJQ A;  1ZKH A;  3WAP A;  2BPS A;  3JVZ X;  4RM8 A;  3RT3 B;  4JKC A;  1WI0 A;  3A98 B;  1YIW A;  5C5B A;  4BKT A;  3T8M A;  1WX7 A;  4II3 B;  1P6S A;  1V49 A;  2LYD A;  3KUD B;  3VAW A;  3ZIM A;  2NBV B;  2K1F A;  3DCG A;  1I42 A;  4JQW C;  1U4A A;  1WXS A;  4JL9 A;  2DZM A;  4B9K A;  2O6V D;  2MCN B;  3KZ1 A;  1X1G A;  1HB6 A;  3KYC D;  2J0M A;  2D11 A;  1JDE A;  1TJ6 A;  3N3K B;  3U8Z A;  1UNP A;  2BWF A;  3IVF A;  5DPW A;  3AU4 A;  1V9J A;  1WGR A;  4II2 B;  3ZTD A;  2GBM A;  1J0G A;  3VFK A;  2ELA A;  1V80 A;  4W9H A;  1RAX A;  4AP4 C;  3AUL A;  2CY4 A;  2K8C A;  1HB8 A;  4HB3 B;  3V62 A;  2R82 A;  1WG7 A;  1ZSQ A;  4LJP B;  3ZO5 B;  2Y5B B;  1LB1 A;  5JLJ B;  1W1D A;  1Y5O A;  5AZF A;  2JY6 A;  5HE1 A;  4F1S A;  2K25 A;  2WH5 A;  1E8W A;  2XK5 A;  2KMC A;  4HLE A;  2IY0 B;  4GXB A;  2LAS A;  1B55 A;  2KX3 A;  2JZZ A;  1UZX B;  1J19 A;  3O65 B;  3VHT C;  1WJ6 A;  4HAV B;  4TKN A;  1AWE A;  2FJ9 A;  2DHK A;  3VTV A;  4K7W A;  4A6K A;  3DBR I;  4JKG B;  2ADZ A;  4IAP A;  1QQG A;  1MPH A;  3QBV B;  2L0T A;  2C7M B;  3EPY A;  2ZPN A;  4GDK A;  4I6L B;  2PE6 B;  1WI1 A;  2K8H A;  3PRM B;  4MGZ E;  1XX0 A;  4BOZ B;  1TTN A;  1R4M I;  5JHG A;  5D94 A;  2KFK A;  1A5R A;  3P6A A;  4EFO A;  1WGQ A;  1KLV A;  2QHO A;  4CYE A;  4PYZ A;  1U5E A;  3A4S C;  3VOQ A;  2IO2 B;  2CR5 A;  2COC A;  4FAD A;  1XR0 B;  3DXD A;  4MJS B;  4W9I A;  2QKM A;  3KSY A;  3DVG X;  3SNH A;  1QC6 A;  2PPH A;  1YD8 U;  5D3V A;  1E5W A;  3SBT A;  4IC7 B;  2M14 A;  4FJV B;  3ZTC A;  1UEL A;  3JSV A;  1BT0 A;  3LJU X;  1UBI A;  3UQB A;  2D2Q A;  2FID A;  2Z0O A;  2K39 A;  2KLG A;  1WGH A;  5C6R A;  4BKG A;  3KUC B;  1EUV B;  5IJM A;  1WYW B;  2K2J A;  2RGN B;  5DPT A;  4KAX B;  2ZCB A;  2L2I A;  3EEC A;  2L00 B;  1EAZ A;  4B6H A;  4FHK A;  1PLS A;  2KO3 A;  2Z0P A;  1KM7 A;  3BY4 B;  4XC2 A;  2I5C A;  5DCN A;  4DWF A;  3CMM B;  1ZM0 A;  2YS3 A;  5CTR C;  3ML4 A;  2LGD A;  3IHP C;  1WF9 A;  2IO0 B;  2AYO B;  3ZVR A;  2MP2 B;  4ASW C;  2KWU B;  2L7R A;  3ZNG C;  2AL3 A;  2IO1 B;  2FCN A;  4HPL B;  1V5M A;  2L76 A;  1Z5S B;  4FJZ A;  1SHC A;  1E7U A;  4DHZ E;  2LZ6 A;  3DVN V;  3FSS A;  1FGZ A;  3TMP B;  3ZW3 A;  3FM8 C;  1LQB A;  1P0R A;  4JIO U;  1WJM A;  1BTK A;  4X57 B;  1YX5 B;  3ZRC A;  3CSF A;  2BKR B;  2J7Q B;  2A5U A;  5AEK B;  1Q0W B;  2KNB A;  4IM2 A;  1U2B A;  3K9O B;  1UD7 A;  3W1Y A;  2NMB A;  4Z2N A;  2K8B A;  3R7R A;  4F7G A;  3PSE B;  1GC7 A;  4JKB A;  3KRX A;  2HTH B;  2LVP A;  1DIK A;  1KBL A;  4BKS D;  2O2V A;  3A9K B;  1L7Y A;  4JKE A;  2A4Z A;  1E90 A;  1WJ1 A;  3B1L X;  4IM0 A;  3TFM A;  1DDW A;  4A3O A;  3ENE A;  2KFJ A;  3KW5 B;  4A20 A;  4KIK B;  4LDT D;  2KQS A;  1XOD A;  4JKH A;  2D9V A;  3ZRF A;  1WM2 A;  2KGX B;  1WVH A;  4I6N B;  4JKD A;  3PT2 B;  3N7C A;  2LRW A;  1XT9 B;  2KJ6 A;  4KSL C;  1TQZ A;  4YON A;  2J59 M;  1KZ7 A;  1V5U A;  1KJT A;  2O6V B;  2FJL A;  2WWZ A;  4KV2 A;  1NBF C;  3H9D A;  2DLW A;  3U7D A;  3WAL A;  3BJI A;  4DHZ B;  5EDS A;  3PG7 A;  2RPQ A;  2JP2 A;  2P0F A;  1PMS A;  5DPR A;  2COD A;  1FHO A;  3DXE A;  2ZVN A;  4K2P A;  1Q67 A;  4PYU A;  2NPT A;  1ISN A;  1I2H A;  4K2O A;  5CLQ B;  2ZPY A;  2IFS A;  3M62 B;  1OTR B;  3RYT A;  2D4Q A;  3PRE A;  3N30 A;  4K1R B;  2JRI B;  3AU5 A;  2NZ8 B;  3PS6 A;  5C23 A;  2N1W A;  3C0R B;  4MEM A;  1UPQ A;  3IG3 A;  1R4N I;  1U29 A;  2M1M A;  2ROZ B;  2E2X A;  1U5G A;  5KQ4 A;  3JYU A;  2KTF A;  3GZN I;  2N23 A;  1XCG A;  4FBJ B;  2KTR B;  4FN2 A;  1ZVR A;  3M3J A;  4WJO A;  2YF0 A;  4HAT B;  3PRP B;  4DHJ D;  1WMH B;  3OJ4 B;  4I6P A;  3PVW A;  4EJN A;  2Z0D B;  5FI0 A;  3QAR A;  2KVR A;  3L16 A;  2DTC A;  3ALB A;  4BBN C;  2RR9 A;  2MSE D;  4K17 A;  4GDL B;  2GBJ A;  4ICU A;  5C5B B;  4GU2 A;  4FHJ A;  2FCM A;  2AWT A;  2N9X A;  3QCA A;  2IBI B;  5L95 C;  4CHK A;  1V6E A;  4L6E A;  2N1V A;  2GCL A;  4Y94 A;  5KCV A;  2N9E B;  4EZK A;  4PS8 A;  1IP9 A;  3APD A;  1GC6 A;  2GMI C;  1UNQ A;  1P5T A;  4GMV A;  3W1S A;  2LKO A;  3ZDM C;  3EFU A;  3NZS A;  1WGU A;  2YRY A;  3M63 B;  4KDI C;  2D07 B;  2IY1 B;  1J8C A;  4K7U A;  2LI5 A;  2ZNV C;  4PS7 A;  4TQ0 A;  1MK9 B;  5GMV A;  2MBO A;  4JK7 A;  3X0W A;  2J0K A;  3UZT A;  3KH0 A;  3DVN U;  2RSU A;  2BYV E;  3E66 A;  2Y8F A;  3W1S C;  2KQ7 A;  4W9G A;  4ILH A;  3F0W A;  2I5F A;  3NHE B;  1RRB A;  1XD4 A;  1UH6 A;  3ONS A;  4TV3 A;  1FOE A;  3MHS D;  3D8F A;  5D3X A;  1WGY A;  2G45 B;  1AQC A;  2MQJ A;  2V3S A;  3QHT A;  2ELB A;  3PPA A;  2MW5 A;  4KVG B;  4W9J A;  1K5D B;  2L05 A;  3WYF B;  4DBG A;  4WSF A;  2YLM A;  5IA7 A;  3A1Q B;  1NDD A;  1FGY A;  2EKE C;  2KZR A;  3QIJ A;  5JH5 C;  3CST A;  3H1U A;  3ZUN A;  5DI9 B;  2BWE S;  3QQ8 B;  1FHW A;  2Q13 A;  3SO6 A;  2DYN A;  5C79 A;  3DBH I;  2RUK B;  1L2N A;  1M7R A;  4G50 A;  4MK0 A;  5E6O A;  2VRW B;  1MAI A;  3PGE A;  2IO3 B;  3VQI A;  4JLC A;  3WIM A;  2KAN A;  3OLM D;  1XQQ A;  4D0N B;  2DX5 A;  4XZ4 A;  2LGX A;  3M95 A;  3HK0 A;  3RZW C;  1EGX A;  2BYF A;  2MA9 B;  3CXB B;  4DDI D;  1MG8 A;  2EMT A;  2Z0Q A;  3PHW B;  2YT1 A;  2KUP A;  1W1G A;  3DDC B;  3PRZ A;  1V61 A;  3A9J B;  3F5R A;  2KC2 A;  2KXJ A;  3ML9 A;  2XQN M;  1WJ4 A;  2M8S A;  2NBU A;  2G35 A;  2DYQ A;  1T0Y A;  1UEF A;  3VXW A;  2G4S A;  1I7A A;  2I1J A;  5BO4 B;  2C5L C;  3PSC A;  4MSM B;  4HAU B;  3UIN B;  3D8D A;  2UYZ B;  3DVG Y;  2COP A;  4JKF A;  1WE7 A;  2GBK A;  2LJ5 A;  3TVV A;  3V61 A;  3APF A;  4E74 A;  1VBH A;  1OEY J;  2JZ3 B;  2W2X C;  4HAX B;  1KI1 B;  2KX0 A;  2JPH A;  4LDT B;  3NS8 A;  3R7Q A;  2LXA A;  2HE7 A;  2GJY A;  1KOT A;  2BCJ A;  1WJN A;  1E8Y A;  2EC1 A;  1DRO A;  2MRP A;  3PVL A;  1N3H A;  1X11 A;  2KN5 A;  1VD2 A;  5J3Y A;  2H7E A;  4IOY X;  3QK0 A;  2IYD B;  3NSU A;  4MEL A;  3ODW A;  1U5F A;  2YT0 A;  2FDQ A;  3PHX B;  1X1M A;  1V86 A;  4HHV A;  4NQK E;  2DHZ A;  3TJP A;  2KHW B;  1E8Z A;  3DQV A;  4XWX A;  3HQC A;  2KJR A;  1WGG A;  2OOB B;  3MPX A;  4WJ7 A;  3KRW A;  2XEW A;  5LOP B;  5J3Q A;  3VVW B;  4M8N A;  5TR5 A;  3HM3 A;  3PLU A;  5AZG A;  3ECI A;  4HDO A;  4FA6 A;  5KHO A;  3ODO A;  4BVU C;  3DOW A;  5JVL A;  5JHA A;  2LOZ A;  4JKG A;  1V5O A;  3VH4 B;  2LBB A;  1TGZ B;  4AWJ A;  4F8C B;  4EEW A;  3V5W A;  3VUX A;  1IYF A;  1XD3 B;  1H8C A;  2DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...