1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
2C7MB 4PS3A 4W9JA 2JRHA 4WJQA 4GB9A 4JLCA 2CHXA 2CRFA 4A6FB 3KY9A 2AL3A 2MW5A 2N4FA 2DTCA 1Y5OA 1KZ7A 1H10A 4MEMA 4EZKA 5LONB 3A9JB 2MBBB 4K7WA 4GIVA 3A1QB 2LVPA 4B6WA 2DAFA 5EDSA 4TV3A 5J2RA 1P3QU 1WIAA 2Z59B 3QWZB 1WI1A 3A33B 4K7UA 4NJ6A 3LJUX 2UYZB 1P1AA 4K17A 2LXAA 2COCA 4HDQA 2PE6B 5IA7A 5JZEB 4XWXA 1C3TA 4Z2MB 4HAZB 3NZSA 1WXVA 3D8FA 4KDLB 4LDTB 1V5MA 1I2HA 4IM2A 4BOZB 5GMVA 1ZW7A 2KXJA 3RZFA 2DFKA 2OJRA 3SUZA 2W2XC 3N7CA 3OAWA 4ANWA 4JGHB 2HTHB 2LJ5A 3APCA 1MK7B 4A6HA 2KKCA 1FHXA 1WGYA 1N3HA 2OOBB 2PE9A 2YRYA 2ZEQA 2WX0A 5LLIA 3JYUA 3L10B 4F7GA 4HDOA 2LULA 3KH0A 4NPNA 1M94A 2LGDA 5CTRC 5FR6A 2N1VA 1TTNA 2LWPA 2MWSB 1V5PA 3H7SA 1GNUA 5CLLB 1U2BA 4GMXB 5LXHA 1WZ0A 1D3ZA 5IJMA 2KMCA 1LB1A 3JSVA 4Y94A 4DX8A 1A5RA 1H4RA 1V9JA 2ZJDA 2MLBA 5AZGA 5L81A 3ML8A 4IWOA 2COAA 2KTRA 4FBJB 2H7DA 4K7SA 1MPHA 4ICUA 1FGZA 3VDZA 4E3CA 2JF5A 3NHEB 3PHXB 1WJ1A 3SYXA 2PEAA 2JWZA 1RLFA 5C16A 2KWCA 3ZIMA 3A9JA 3A1QA 2DHKA 4ICVA 3MDBC 2P0HA 2RGNB 4XX5A 2EKEC 1LXDA 1DROA 2L0TA 4AJYB 4GU2A 4FHKA 3DBLI 1E8WA 1DYNA 2BPSA 5DPSA 1PQSA 2Z0QA 2G4DB 3RD2A 3EECA 1Q67A 1V6EA 2D9XA 1BT0A 5AEKB 2REXA 1YX6B 4ANXA 2BYEA 3ODOA 1ZGUB 4EEWA 2GCJA 1E8ZA 1JRUA 2M38A 4IFSA 4FN2A 4IUMB 3QJZA 1OEYJ 4EUTA 4NSWA 2Y8FA 2RSGA 2YT1A 3OJ3A 2G3QB 2BWES 2NBVB 2V76A 2NBWB 4MGZE 2H7EA 3L08A 3M1IB 1IYFA 4CO7A 4NAWB 2XK5B 3N32A 5DHFB 3D32A 3TCAA 3GYOA 4HB3B 4NNJB 3GZNI 1WJ4A 3DBSA 3RULA 2NS5A 2DYQA 3EPYA 1RFAA 2D9WA 1I35A 2WWZA 2KWUB 3VTWA 2CHZA 1U5EA 1OMWA 3UIPB 4EJNA 1OQYA 3H9DA 5G2NA 4Z2NA 3APFA 1WJMA 1MAIA 3TVVA 1IP9A 3ZTDA 4TQ1A 2LZ6A 5KCVA 4XC2A 1WR6E 5D3XA 2XBBC 1WGDA 2XEWA 2L00B 3DXDA 2LGXA 2DZIA 4FHJA 1J19A 2MBHA 2MQJA 2KK8A 4EZLA 3WANA 1GG3A 2DLWA 3QHTA 4I6PA 2K39A 2RNRB 4F8CB 2YS3A 4PS7A 4FJZA 1OTRB 2LGYA 4KV2A 1J0WA 5IAAC 2O2VA 1AWEA 3QCAA 4KHAA 2K8BA 2KDFB 2FCNA 3DVNV 4II3B 5DPWA 1Y19B 2C9WB 2DKPA 1X1MA 3UGBB 2DX5A 3P6AA 3A4RA 2YF0A 2BGFA 1Q0WB 2ASQA 1HE8A 5DH9B 5GOWB 1I42A 3WAOA 2GS0A 1W1GA 3JW0X 2O6VD 4EZJA 1UPQA 2I5CA 2AWTA 3AU4A 3VXWA 3V60A 3B1LX 2ZNVB 5C23A 1UH6A 1MIZB 3FP5A 3QARA 2GOWA 1E5WA 1WMHA 4IW0A 5AZHA 3ML4A 2KD0A 2IYDB 5D94A 3VQIA 4LJOB 3SU8X 3BINA 3MTNB 1NTVA 2KX3A 2D10A 1EAZA 4I6LB 4B6HA 4AUQC 2MA9B 3CXBB 5CHWA 4J6IA 3PLUA 2G4SA 2NBUA 3F0WA 5CHVC 4AOFA 2Z0EB 4GDLA 1QQGA 4DBBA 3N30A 1DDMA 4HK2A 4CHKA 3PHWB 1W1HA 1Z5SB 2L3ZA 1NI2A 1XD3B 3PRZA 3VTUA 5EFXA 4GPTB 4W9GA 1U5DA 1SIFA 3EHVA 1WM3A 4ANVA 2GBRA 1RRBA 4P7IA 3TMPB 1ZC4B 1NDDA 3AU5A 2WH5A 5D3WA 3VH4B 2EJ8A 3R3MA 1WX7A 3KSYA 3HHMA 5D6JB 3UQAA 2D11A 2GBMA 3L13A 1WRDB 1T0YA 2RR9A 4PNKA 2YVCA 2N7DA 5L83A 3VUWA 2NCNA 2HD5B 3PVLA 5DI9B 3W1SA 2FJ9A 2KHWB 2PPHA 3JSVB 4FLHA 5DPTA 2MX2A 1Q5WB 3DXEA 1V81A 3AXCA 2K8CA 4W9LA 4DK5A 4HAXB 1L7YA 3F5RA 2KTRB 1X1FA 2KFKA 2J0KA 4AWJA 1Y8RC 1G6JA 3CF6E 1NBFC 4KZ0A 1XODA 5JHBA 1XX0A 4BBNF 2D9ZA 2NZ8B 3DPDA 3H7PA 2RLOA 4IM0A 4IM3A 2KX0A 4GMVA 2C60A 1YJ1A 3QK0A 5E6PA 3CMMB 1CMXB 1WF9A 3WAMA 1V61A 4WSFA 2W9NA 4FULA 2JT4B 3QQ8B 1ZM0A 3Q3FA 4DHJB 2Z0PA 2L2IA 3V61A 2FDQA 2C7HA 1UNPA 1KZGA 3I3TB 4K1RB 2W2XD 2CAYA 1VD2A 1WJNA 4LJPB 1WZ3A 4HB4B 1WXSA 2CB8A 2PZ1A 2ABDA 2AEHA 4HPMB 2KGXB 2K1FA 3PRPB 1FHWA 5FI1A 1ZVRA 1RRPB 2KQ7A 4NY0A 2R0DA 2JY6A 5C5BA 3DXCA 2GCLA 2DZKA 2A5UA 4HWIB 2GMIC 3ENEA 4HXDA 2QHOA 1Z2MA 1V88A 1TZ1A 2BKRB 2IBIB 1MG8A 3TBLD 3KYDD 4B9KA 3VIAA 2CR5A 2ZPYA 5FI0A 4D0NB 2JZ3B 1OEYA 1DDWA 3S2AA 4II2B 4ZRJA 1ZC3B 2Z0OA 2LXCA 2KDIA 2K6DB 1S3SG 1XT9B 3PVUA 4BVUC 2K00A 2Q13A 3P7ZA 3UINB 4A5KA 2R2OA 3MPXA 5JP4A 3U8ZA 1WG7A 1WI0A 2IY1B 1DDVA 1WGRA 5C6RA 4HATB 3ZDTA 2D2QA 1TXDA 1RAXA 2ZNVC 1X05A 2IYBA 3VUYA 2L8JA 4GGQA 4WVFB 3ALBA 2CU1A 3ZLZA 1FGYA 3SD5A 4F1SA 2X18A 4G0NB 3VFKA 2D9VA 2LVOA 2N9PC 2D07B 2MCNB 3P2BA 2CKHB 2BYVE 1U29A 5DIFB 3FSSA 2MRPA 3PVWA 2O2VB 2AL6A 3RYTA 3ZNID 2KFJA 1UPRA 4ANUA 2IO3B 2G35A 5JHHA 2DN6A 2M14A 2KZRA 3NS8A 2P0DA 5L95C 2DX5B 3T06A 4PS8A 3PS6A 3DVGX 2BWFA 2AYOB 4HB2B 2I5FA 2UZSA 4BKSD 3ZNHB 3PEGA 1MIXA 2LD9A 1EVHA 1MKEA 3IFWB 4E74A 4H8SA 3M62B 5CHFA 2W2WA 1FOEA 2LOZA 4G50A 3U7DA 1XCGA 5AZFA 4PYZA 1E90A 1HB6A 2K2JA 1E8XA 3FM8C 1WMHB 4KIKA 5JH5C 1FHOA 3SV1A 2QKMA 1NU2A 2L76A 2YT0A 2JVCA 3AULA 2KDEB 3SO6A 3L17A 2KMAA 2FCQA 2Y5BB 4EKUA 1KOTA 4GDLB 4MSQB 2CY4A 2DYOA 1NTYA 1OGWA 3VTVA 2RSUA 2UVMA 3T9LA 3VVWB 1X86A 1NVLA 3X0WA 4MH0E 3APDA 4G3XB 2MBOA 3EFUA 3UF8A 1R4NI 2VSZA 3KZ1A 2MFQA 3IVFA 3PPAA 2K8HA 3WAPA 1Q1OA 4HAWB 4MSMB 2CS4A 5KQ4A 3VH3B 3H1UA 4CHJA 4NJ7A 4HVBA 4JL9A 4HLEA 2FAZA 3RCZA 3PGEA 2NVUI 3M63B 4LDTD 3PRMB 3M3JA 2JZZA 3ZRFA 4BKTA 2WX1A 3KUCB 3ZKJC 4OVUA 1GC7A 5DCNA 1L2NA 3PV1A 1OY2A 2IO1B 2DA0A 2P8VA 2P0FA 3FEHA 2KJRA 1EUVB 1S1QB 5HKHA 3NSUA 2M8SA 1UEFA 5CLQB 4W9KA 4WJNA 4WJPA 1E7VA 4PYUA 3NOBA 1HBKA 4GOCA 1QZEA 2LKOA 2L7RA 2M4NA 3ZDMC 4B95A 2O6VA 1TBEA 2N1WA 1LM8B 2KFKB 4MT7A 4RMAA 3VHTC 4HAUB 3Q3JA 3H7PB 1J0GA 3A8QA 4X57B 2OTXA 2LUEA 5D7GA 1LFDA 2HJ8A 1U5FA 4KHBB 4DX90 4EOYA 5C1ZA 4M8MA 2Y7BA 2DZJA 4GDKA 3JVZX 4EMOA 4KAXB 2VRRB 3CSTA 4ZYNA 2DX1A 5KHOA 3DQVA 3HW2B 2DENB 2FJLA 1WY8A 3TIXA 1NTIA 5J17A 1EGXA 3BJIA 1IPGA 2LOXA 4MGKE 4KSKC 3WALA 3AJ4A 4E71A 2C5LC 2WYQA 3DOWA 2MKRA 2IO2B 2BCJA 5C5BB 2Y8GA 2PJHA 2JRIB 4YL8A 1WXMA 4A6KA 1V89A 4K2PA 3ULCA 4MDKE 3TW1A 2V4LA 2J7QB 5HE3A 4M0WB 4XZ4A 3BY4B 3V5WA 3CIKA 3PREA 3ZW3A 1UNRA 4TKNA 3IG3A 1SE9A 1BAKA 1WGUA 2UWQA 1AARA 4AP4C 1FXTB 2EMTA 3A98B 2JXXA 1FB8A 2IZVB 1V49A 4WJ7A 1WJ6A 4RM8A 3HM3A 4M8NA 2J0JA 1M7RA 2IO0B 4JQWC 2C7NB 4KZCA 1U27A 4W9CA 1GC6A 4HAVB 5JHAA 1R4MI 1GJZA 3IHPC 1P6SA 3ML9A 2GBKA 2N9XA 5J3TA 1BTNA 2BKFA 4AJWA 4GXBA 1Z87A 3ZTCA 2ZPNA 1KJTA 5D3VA 2DYMA 2KWVB 2NMBA 3HIZA 3UZTA 5HE1A 2ROVA 1MK9B 1UGMA 4MJSA 1WJUA 1WM2A 2B3AA 4FJYA 1LQBA 1WFYA 2HE7A 1GUAB 4IG7B 1WE7A 1HB8A 1PLSA 2MP2B 4BBKA 3B0AA 2FIDA 5DHAB 3KW5B 2YS5A 5JHGA 4EFOA 2MDXA 4CYEA 3ZUNA 4IOYX 4WWNA 4BFRA 3HQCA 2KO3A 4N9F4 2XQNM 4F7HA 2ELBA 2L1CA 2ZVNA 2D4QA 4WWOA 3R7QA 5KQ1A 2BF8B 1V80A 4C0AA 3PP2A 1M7EA 3KVFB 3HK0A 2FNJB 5D2MB 1YX5B 3UQBA 4I6NB 4KIKB 1IRSA 1PFJA 2J59M 1K8RB 1WYWB 5JLJB 4TQ0A 5G55A 1P0RA 3DVNU 4BBNC 2Z0DB 1WH3A 3ECIA 2FIFA 2RPQA 3N3KB 5CX3A 2DZMA 1SHCA 1UBIA 1TJ6A 4IC7B 2ELAA 3CSFA 2E2XA 3O96A 1C1YB 4DHZB 4FA6A 1XR0B 2V1YA 1YD8U 1UNQA 1WVHA 3W1SC 4TYZA 4KVGB 4KSLC 2KVRA 2CY5A 4WJOA 2DHZA 4F7UP 1V5UA 3KYCD 3VOQA 2YS1A 3RZWC 2RQ1A 2DYBA 5TR5A 4HCNB 4ZDVA 4JIOU 2I1JA 3RUIB 3TFMA 4IWQA 2NPTB 3WA0A 3T8MA 3A8PA 5J3YA 3A9KB 1YQBA 3PLVA 2EMSA 3ZVRA 4WAAA 3X23A 2G45B 4HCPB 3V6CB 1EF1A 2LRWA 3RCPA 4HPLB 3DBHI 4RM9A 3R66C 1ZKHA 2D3GA 4ZRIA 2KNBA 3L54A 4BKSA 1H8CA 2O6VB 5J18A 3GYPA 2DHIA 4GZUA 2LVQA 5BO4B 4W9IA 3QC8B 2DHJA 4W9EA 3V6EB 3ODWA 2KLGA 5LXIB 2MP2A 2VRWB 2KUPA 2KC2A 3VUXA 3M95A 1I7AA 3ZNZB 3K9PB 3NZUA 2ROZB 3MJWA 1W1DA 2M1MA 4A6FA 3PSCA 2I1KA 4GDKB 4A3OA 2RGFA 2YSZA 2V3SA 4FADA 3HM6X 4DBGA 5HE0A 1XQQA 4IAPA 1KI1B 3C0RB 4BOSC 4LCDE 1ZSQA 4CHMA 1K5GB 2KLCA 2MSED 1AQCA 2FCMA 1P5TA 2KJ6A 2N7EA 1WX8A 4MM3A 5KHQA 2VKIA 4YONA 2WDTB 3MHSD 4NQLB 4DDID 2COFA 4K2OA 2UZRA 2JPHA 1J8CA 1U5GA 3L0WB 3V62A 2CHWA 1ACAA 4HAYB 1UBQA 3LJ3A 3K9OB 3WYFB 2LG1A 3D8EA 1E7UA 1FAOA 1K5DB 1ST7A 4MK0A 2ZCBA 2GBJA 4DHJD 4KDIC 3LDZE 3DDCB 3KUDB 1TQZA 4A20A 4DHZE 3PTFC 1PMSA 2L0FA 4DWFA 4TUUA 3DCGA 2IY0B 3ZVVA 2RD0A 2RUKB 5DPRA 3TL5A 2K2UA 3EC8A 3D8DA 2ZZPB 5D27A 5E6NA 2NPTA 2HTHA 4MGYE 5E6OA 3A9KA 4A3PA 3QAQA 3VAWA 2KC1A 3B08A 2COPA 3SNHA 3U30A 4GN1A 1XD4A 3SDLC 3GOEA 4W9DA 1WR1A 3QBVB 4ZRKA 3TO1A 4DDGD 3PT2B 3W1YA 3H6NA 4KHOA 2N23A 4MY6A 3ONSA 4K81A 2R2QA 4DXAB 1V2YA 1F9JA 4MJSB 3WIMA 2GJYA 1BTKA 2R09A 2M0XA 2RVBB 3DVGY 3DBRI 2M17A 3R7RA 2DKQA 1WE6A 1U4AA 2NR2A 3A4SC 2ZVOA 2LI5A 3KRWA 2YLMA 2A4ZA 2CODA 2HRJA 3SHQA 3O65B 2OQBA 2KQSA 2KJHB 4NQKE 2GBNA 2JUOA 1ISNA 2KDBA 4MELA 2MBQA 2MWNB 3ZNGC 3IBEA 1V5OA 2QKLA 2K25A 1WXAA 3KUZA 5HE2A 2KN5A 3ZO5B 4HHVA 3QWMA 1VCBA 1WGHA 4BKGA 2KTFA 1P98A 2L05A 3OLMD 1OQNA 4HJKA 3UIOB 2KCJA 3ZRCA 1RJ2A 2DAJA 3ODXA 2N9EB 2JP2A 2FUHB 3ULBA 5J3QA 2DYNA 4L6EA 2LBBA 1BWNA 4PQ0A 1WX9A 3PSEB 2CQUA 1X1GA 1KLVA 3AI5A 2LASA 2MBEA 2EC1A 1P3RA 4NAWA 2XK5A 1EF5A 1E8YA 4G11A 4MGIE 4OVVA 2KOXA 3G9WA 2LYDA 3NY5A 1UELA 4WQOB 1YIWA 1WGQA 4URKA 1LW3A 1DBHA 1V5TA 3OANA 3QX1A 2KANA 5D3YA 1UD7A 3TJPA 3L16A 1EO6A 2ZCCA 4ASWC 3RT3B 1UZXB 1V86A 2IFSA 2LRUA 4F7ZA 4IWPA 3FLVA 2N0YA 1QC6A 2BYFA 3QIJA 5LOPB 3PG7A 5C79A 2J0MA 3PZDA 2ADZA 3KRXA 2K6QA 1X11A 4WWPA 1SGHA 3QA8A 1TGZB 1P9DU 3OJ4B 1KM7A 2FCSA 1WGGA 1B55A 4GSWA 4W9HA 1XKEA 2D9YA 4HB0B 4W9FA 4FJVB
chains in the Genus database with same CATH superfamily
3Q3OC 2RMMA 2C7MB 1RYJA 2WXLA 4PS3A 4W9JA 2JRHA 3AEFB 4WJQA 4GB9A 4JLCA 2CHXA 5HHDG 2CRFA 4A6FB 3KY9A 2AL3A 3Q8FA 2MW5A 1SB3C 2WDQB 1ZXIA 2N4FA 2DTCA 1VBGA 1Y5OA 1WSPA 1KZ7A 1H10A 4PK1A 4MEMA 3SEBA 4EZKA 4M00A 5LONB 4JKAA 2HDEA 3A9JB 1MI1A 4P6VF 3RFZB 2MBBB 4K7WA 4GIVA 3A1QB 1RWSA 1LGRA 3U52E 2LVPA 4B6WA 1MI0A 2DAFA 1EU3A 5EDSA 2WNMA 3AE5B 1UGJA 3U7ZA 4TV3A 2GB1A 4MM3B 5J2RA 2K9XA 1P3QU 1WIAA 2Z59B 3QWZB 1WI1A 2DBYA 3A33B 4K7UA 4NJ6A 3LJUX 2UYZB 1P1AA 4K17A 2LXAA 3NRZA 1VBHA 2COCA 4HDQA 1K52A 2PE6B 1SIJA 5IA7A 5JXVA 5JZEB 2Q5WD 2JYEA 4XWXA 1C3TA 4Z2MB 1P7FA 2KR0A 4HAZB 2D3CA 3AE4B 3N20C 3NZSA 1WXVA 2QILA 3D8FA 4KDLB 4LDTB 4R3DA 2LEKA 1IBXB 5AUKA 1FRRA 1V5MA 2KACA 3N1YC 1I2HA 4IM2A 4OZAA 4BOZB 1YQ3B 5GMVA 4YSZB 1NVID 1ZW7A 2WXKA 2KXJA 4KX6B 4H2AA 3MJ5A 3RZFA 1KC7A 5EE0A 1A70A 5E6JA 2DFKA 2OJRA 4KGTA 1QOBA 1TS4A 1I4PA 3R2TA 1PYWD 4JWSC 3SUZA 2W2XC 3PZ8A 3AEEB 4WWMA 2LMCA 3N7CA 2WDRB 4JKCA 1KRHA 3OAWA 4LNKA 3OG5A 4ANWA 4JGHB 2HTHB 2PLPA 2LJ5A 3ZJTA 3APCA 1MK7B 4A6HA 2KAJA 2KKCA 1FHXA 3N1XC 1WGYA 1C79A 1N3HA 1YJJA 2OOBB 2PE9A 5C3JB 2YRYA 2ZEQA 2WX0A 4DIXA 5LLIA 3JYUA 4HKQA 1GAQB 3P42A 1UUPA 3L10B 4F7GA 4HDOA 2LULA 3Q14C 3KH0A 1SXTA 4NPNA 1M94A 2LGDA 5CTRC 5FR6A 2N1VA 1TTNA 2LWPA 2MWSB 1V5PA 3H7SA 3AH7A 1GNUA 1L0VB 5CLLB 4MT5A 1U2BA 4GMXB 1V8CA 1WZ0A 5LXHA 1D3ZA 1CZPA 5IJMA 2KMCA 1LB1A 1VZ7A 3JSVA 1KLGD 4ARIA 1STEA 4LK0M 4Y94A 1TS5A 4DX8A 3BYYB 3Q8EA 1A5RA 1H4RA 1V9JA 2ZJDA 1C78A 2MLBA 5AZGA 2X38A 3P4QB 5L81A 3ML8A 4IWOA 2COAA 2KTRA 1UWMA 4FBJB 2H7DA 4K7SA 1MPHA 4ICUA 3FVCA 1FGZA 3VDZA 1C4AA 4E3CA 2JF5A 3NHEB 5FKAC 1L0YB 5BMGA 3NWFA 1XLPA 3PHXB 2KUQA 1WJ1A 3SYXA 2PEAA 1KLUD 2JWZA 1RLFA 1ZDVA 4HJGE 5C16A 1F77A 1L6VA 2KWCA 3ZIMA 3A9JA 1IGCA 1PGXA 1I4XA 3FILB 1HQRD 4YTPB 2KVZA 1NYQA 3A1QA 3IT6B 2DHKA 4ICVA 3AECB 2RDGA 3MDBC 4XDDA 2P0HA 2RGNB 4XX5A 2EKEC 2X0SA 1LXDA 5H8YE 1DROA 3H8HA 2L0TA 2D3AA 4AJYB 4GU2A 4FHKA 3DBLI 3AMZA 2Z59A 1E8WA 3AE3B 1DYNA 3HUIA 2WP9B 2BPSA 3VR8B 5DPSA 1PQSA 2G1EA 1EU4A 2Z0QA 1MHXA 2G4DB 2TSSA 3RD2A 3BK2A 3EECA 1Q67A 1OFFA 1V6EA 2D9XA 2SEBD 1BT0A 5AEKB 4REZA 4GLSC 2REXA 1YX6B 3BVMA 2BYEA 4ANXA 4C56C 3ODOA 1ZGUB 4EEWA 2GCJA 5JVLA 1E8ZA 1JRUA 2M38A 4IFSA 4CSQA 4FN2A 4IUMB 3QJZA 1OEYJ 4EUTA 4NSWA 2Y8FA 2RSGA 2QJLA 2YT1A 3OJ3A 2G3QB 2BWES 2NBVB 3AE7B 2V76A 2NBWB 4MGZE 2H7EA 2RPVA 2KIGA 3L08A 3M1IB 1T0RC 1L4ZB 1IYFA 4CO7A 4PT5A 4RGNA 4NAWB 2Z13A 2XK5B 3N32A 5DHFB 3D32A 2AQ1B 3FAHA 3TCAA 3TEXA 3GYOA 4HB3B 2WXQA 4NNJB 1TJEA 3GZNI 1WJ4A 3DBSA 1KF6B 3Q8CA 2NS5A 3RULA 1TS2A 2DYQA 3EPYA 1RFAA 4A6QA 2D9WA 4K3CA 2QMTA 1I35A 2WWZA 2KWUB 3VTWA 2CHZA 3TSSA 1U5EA 1OMWA 3UIPB 4EJNA 4ITKA 1OQYA 2UU7A 3H9DA 5G2NA 3AE8B 1D6EC 2JQRB 4Z2NA 3APFA 1WJMA 4OZBA 1MAIA 3TVVA 2BS2B 1IP9A 3ZYYX 3ZTDA 4ILHA 4TQ1A 2LZ6A 4C4VB 5KCVA 4XC2A 1WR6E 5D3XA 1QKZA 2XBBC 1WGDA 4HRSA 1TKEA 2XEWA 2L00B 3ETRA 2IGHA 1D5XC 3DXDA 2LGXA 2DZIA 4FHJA 1J19A 2MBHA 2MQJA 2FBWB 1F1HA 2KK8A 4EZLA 4C7YA 3WANA 5G5HA 3C19A 1GG3A 1ZYIA 1HA5A 2WHIA 4A90A 2DLWA 3QHTA 4I6PA 2K39A 3SFEB 2RNRB 1FFVA 4F8CB 2KT7A 2YS3A 4PS7A 2CU3A 3EGRA 1ZP0B 4FJZA 1OTRB 1JWBD 3DBLB 2LGYA 4O1NA 5EE1A 4KV2A 1J0WA 5IAAC 2O2VA 3KLSX 2LUMA 1AWEA 3QCAA 4KHAA 4DXGA 2K8BA 2KDFB 2FCNA 3DVNV 4II3B 5DPWA 1Y19B 1XLQA 2C9WB 2DKPA 1X1MA 3UGBB 4IKGA 2DX5A 1N63A 3P6AA 2VZKB 3A4RA 1I4RA 2YF0A 2BGFA 1Q0WB 2ASQA 1HE8A 5DH9B 1FMAD 5GOWB 2MHJA 3HVDA 1I42A 2CJNA 3IAM1 3WAOA 2GS0A 1W1GA 3JW0X 2O6VD 3GB1A 4EZJA 1WXQA 1UPQA 2I5CA 2SAKA 3RNFC 2AWTA 1YN4A 3MC9A 3AU4A 2AQ2B 3V60A 3VXWA 2WDVB 3B1LX 4EE2A 2ZNVB 5C23A 4ZOHC 1UH6A 4C00A 4KGSA 1TS3A 4QXAB 1MIZB 3FP5A 3QARA 2GOWA 4ZRPA 1MJDA 1E5WA 1WMHA 4IW0A 5AZHA 3ML4A 1QOGA 2JU6X 2KD0A 2IYDB 5D94A 3GZNB 3VQIA 4LJOB 3SU8X 3BINA 4L1RA 3BK1A 1NTVA 2KX3A 2D10A 3MTNB 2BS4B 1EAZA 4I6LB 1I4GA 4C80A 4B6HA 4AUQC 2MA9B 1QQRA 3CXBB 5CHWA 3PLUA 4J6IA 2G4SA 2NBUA 3F0WA 3NS1A 2WXOA 1JALA 5CHVC 4RNAA 4AOFA 2Y5CA 2Z0EB 4GDLA 1J7BA 1QQGA 3V3XA 4DBBA 3N30A 1DDMA 3MC8A 2NBVA 4HK2A 4CHKA 4NAMA 3NW8A 3PHWB 4JKGB 1W1HA 1MHHE 1Z5SB 1NI2A 1AWDA 2L3ZA 1XD3B 3PRZA 4JKFA 3VTUA 5EFXA 4GPTB 4UDUC 1D5MC 2X8XX 4W9GA 1U5DA 1SIFA 3EHVA 1WM3A 4ANVA 1FIQA 3ZJUA 2GBRA 1LO5D 1RRBA 2JSVX 4RH6A 4P7IA 4OSNA 3TMPB 1ZC4B 1BMLC 1TKGA 1F0ZA 1NDDA 3RN9C 3AU5A 2WH5A 1L6UA 5D3WA 1YJIA 3N1ZC 2L1AA 2PKOA 3VH4B 2EJ8A 3R3MA 4KGRA 1WX7A 1FCLA 1VLBA 3KSYA 3HHMA 5D6JB 2QDFA 3UQAA 2D11A 2GBMA 3L13A 1WRDB 1T0YA 2RR9A 2WXIA 3RNCC 4PNKA 4C4VA 2YVCA 2JX5A 5HFYA 3BWUD 2N7DA 5L83A 3VUWA 2NCNA 2HD5B 3PVLA 5DI9B 1GB4A 3W1SA 2ACZB 2FJ9A 3W5UB 3RI7C 5LG4B 2KHWB 2PPHA 3JSVB 4Q2JA 3AE9B 4FLHA 5DPTA 2MX2A 1Q5WB 1SBBB 3DXEA 1V81A 3AXCA 1DIKA 2K8CA 4N58A 4W9LA 1GOZA 2BS3B 4DK5A 4HAXB 1L7YA 3F5RA 3DHGC 3C8YA 2KTRB 1X1FA 2KFKA 2KWDA 2J0KA 4AWJA 1Y8RC 1DOXA 3B9JA 1G6JA 3CF6E 1NBFC 4KZ0A 1XODA 5JHBA 2JXTA 1XX0A 3Q6BA 3RNGC 4BBNF 4HROA 2Z4DA 2D9ZA 2NZ8B 3DPDA 3H7PA 1MVKA 1SJED 1FXIA 1C4PA 3B2GA 2RLOA 2XNAC 4IM0A 4IM3A 2KX0A 4GMVA 5IO9A 2C60A 2WXRA 3AEDB 1ZUD2 1YJ1A 3QK0A 5E6PA 3CMMB 1CMXB 2GLSA 1WF9A 3WAMA 5G5GA 1V61A 4WSFA 1N6ZA 2W9NA 2JT4B 4FULA 3QQ8B 1ZM0A 1XLNA 3Q3FA 1SF0A 1BUIC 2WXNA 2Z0PA 2L2IA 4DHJB 4JX1C 3V61A 2FDQA 2C7HA 4NJCA 4XE0A 1UNPA 1KZGA 3I3TB 4K1RB 4WQMA 2W2XD 2CAYA 1ZDXA 1IGDA 2QCZA 2ZW1A 1VD2A 1WJNA 2E3TA 4LJPB 1QLBB 1WZ3A 4HB4B 1WXSA 2CB8A 2BQQA 2PZ1A 4BAXA 2ABDA 2AEHA 4HPMB 2KGXB 1E10A 3VRBB 2K1FA 3PRPB 1FHWA 5FI1A 1ZVRA 4XWWA 2I2YA 1RRPB 2KQ7A 4NY0A 2R0DA 1QOFA 4RGOS 2JY6A 3RNEC 4YWGG 3BVGA 3GE8C 5C5BA 3FC4A 3DXCA 2GCLA 2DZKA 2A5UA 4US8A 2BVCA 4HWIB 4JKGA 2GMIC 3ENEA 1UWXA 4HXDA 2QHOA 3RMKC 2KDMA 1Z2MA 1V88A 1QT9A 4M0WA 1TZ1A 2BKRB 2IBIB 1MG8A 1FNVA 2MJEA 3TBLD 3DHHC 3KYDD 2WXFA 2J53A 2JWUA 3ZXVA 4B9KA 1VZ8A 3VIAA 5H92C 2CR5A 2ZPYA 5FI0A 4D0NB 2NTTA 2JZ3B 1Y56A 1QOAA 4ZYSA 1OEYA 1DDWA 3S2AA 1C4CA 4II2B 5FK9C 1YOVB 4ZRJA 1ZC3B 1HEZE 4IOIE 3GS2A 2ZW0A 3KQ4A 2Z0OA 2LXCA 3KWLA 2KDIA 2K6DB 1S3SG 1PUTA 1XT9B 3PVUA 2K49A 2LJIA 1GPXA 1JMLA 4L23A 4BVUC 2K00A 2MJDA 4RF1A 2Q13A 2YEPF 3P7ZA 1FFUA 3UINB 4A5KA 2R2OA 4YTMB 3MPXA 3TEZA 5JP4A 3U8ZA 1ESFA 1WG7A 1WI0A 2IY1B 1DDVA 4M02A 1MG4A 1WGRA 5C6RA 2K0PA 3ABVB 3BZDB 4HATB 3W2DA 3ZDTA 2D2QA 1TXDA 1RAXA 3DWMA 2ZNVC 1UNSA 1X05A 1GGOA 2IYBA 3LXFA 3VUYA 2L8JA 2IJ0A 4GGQA 4WVFB 3ALBA 1K51A 2CU1A 3VRAB 1F2RI 5AUIA 1FGYA 3ZLZA 3SD5A 1SE2A 4TSSA 4F1SA 2X18A 4G0NB 3VFKA 2D9VA 2LVOA 2N9PC 2D07B 2MCNB 3P2BA 2CKHB 2BYVE 1U29A 5DIFB 3FSSA 2WXJA 2MRPA 3PVWA 2O2VB 2AL6A 3RYTA 3ZNID 1ET6A 1V97A 2KFJA 1UPRA 4LNOA 4ANUA 4HSIA 2IO3B 2PIAA 2G35A 5JHHA 2JZPA 2DN6A 2M14A 2KZRA 3NS8A 2P0DA 5L95C 2DX5B 3T06A 4PS8A 3PS6A 3DVGX 2BWFA 2AYOB 4HB2B 2I5FA 2UZSA 1I4HA 2N7JA 1DYQA 3OHMB 4BKSD 3AEAB 3ZNHB 3PEGA 3NJTA 1MIXA 2LD9A 1EVHA 1MKEA 3IFWB 4E74A 4H8SA 1JWMD 3M62B 4A9AA 5CHFA 2W2WA 1FOEA 2LOZA 1JQ4A 4G50A 3U7DA 1XCGA 5AZFA 4PYZA 2LGSA 1E90A 1XXGA 1HB6A 2K2JA 1R7SA 2G9HD 1E8XA 3FM8C 1JRPA 1TY2A 1WMHB 4KIKA 5JH5C 1FHOA 2R61A 3SV1A 2QKMA 1NU2A 3MFGA 1C77A 2L76A 3IAS1 2YT0A 2JVCA 2KIEA 1I4QA 3DCXA 2KDEB 3SO6A 3AULA 3L17A 2KMAA 2FCQA 2Y5BB 4EKUA 2L52A 1KOTA 4GDLB 1XLOA 3AB5A 4MSQB 2CY4A 4JK8A 2V3PA 4DQOC 2DYOA 2INNE 1NTYA 2Y3AA 1OGWA 3VTVA 2RSUA 1WWTA 2RDBC 2UVMA 3T9LA 3VVWB 1X86A 1NVLA 3X0WA 3DHIC 3I57A 4MH0E 3APDA 2LHEA 4G3XB 2MBOA 1F52A 4OVZA 1I7HA 3EFUA 3UF8A 3URYA 2WXHA 3IT4B 4MH8A 1R4NI 2VSZA 3KZ1A 2VH2A 2MFQA 3IVFA 3PPAA 2K8HA 3WAPA 4QJ4B 1FNUA 1Q1OA 1HZ6A 2DIKA 3NVWA 3W9CB 4ARCA 4HAWB 2AQ3B 3DBHB 4MSMB 2CS4A 5KQ4A 3VH3B 3H1UA 4CHJA 4NJ7A 4HVBA 4JL9A 4HLEA 4B0EA 5BYQA 2FAZA 4US9A 3RCZA 1YN3A 3PGEA 2NVUI 3M63B 4LDTD 3P1MA 3PRMB 3NWAA 1N62A 3M3JA 4S17A 2JZZA 3ZRFA 4BKTA 2WX1A 3Q3NC 2L32A 3KUCB 3ZKJC 4OVUA 1GC7A 5DCNA 1L2NA 3PV1A 3IXSA 3NZ3A 1OY2A 2IO1B 2DA0A 2P8VA 2P0FA 3FEHA 2KJRA 4WAFA 4FXCA 1EUVB 1S1QB 5HKHA 3NSUA 2M8SA 1UEFA 5CLQB 4W9KA 4WJNA 4WJPA 1E7VA 4PYUA 3EA6A 3NOBA 1HBKA 5M4YB 1TY0A 1QZEA 4GOCA 1SEBD 4C7ZA 2WXMA 2LKOA 2L7RA 2M4NA 3ZDMC 1HXYD 1XF5L 1KTKA 2O6VA 4B95A 1TBEA 2N1WA 1LM8B 1VJKA 3GP7A 2KFKB 5IOIA 2H89B 4MT7A 4RMAA 3VHTC 1GB1A 4HAUB 1FXAA 3Q3JA 2FUG1 3H7PB 3P4RB 4YXDB 3V05A 1J0GA 3A8QA 4X57B 4LNNA 2Y5PA 4W9FA 2OTXA 2LUEA 5D7GA 1DGJA 1LFDA 2HJ8A 2HJ1A 1Q10A 4YTNB 2K22A 1FO4A 1U5FA 4J3OD 4OZCA 4KHBB 4DX90 4EOYA 4JKEA 2W3RA 5C1ZA 1TT5B 3Q69A 1P7EA 4M8MA 3P63A 2Y7BA 3SBTA 2DZJA 4GDKA 3JVZX 4EMOA 1CQVA 4KAXB 2VRRB 3CSTA 4ZYNA 5BYSA 2DX1A 5KHOA 4KKJA 4OHJA 1AN8A 3DQVA 3HW2B 2DENB 1T6BX 2FJLA 1WY8A 1R4NB 3TIXA 1NTIA 5I2SA 1EGXA 3BJIA 2BB6A 4L1BA 5J17A 1IPGA 3J9CA 2LOXA 4MGKE 5EE9A 3ZXRA 3MC0B 3BYTB 4KSKC 3WALA 3AJ4A 1IUEA 4E71A 4IDIA 2C5LC 2WYQA 3DOWA 3NWDA 2MKRA 2OEDA 1WGKA 1B9RA 1KFYB 2IO2B 2BCJA 5C5BB 4WURA 2YEPB 2Y8GA 4YSXB 2PJHA 2JRIB 2R82A 4YL8A 1EWCA 1WXMA 4A6KA 1V89A 4K2PA 1WRIA 2V0GA 3ULCA 3HRDD 5I4DA 4MDKE 3TW1A 1JWAD 2V4LA 3E56A 2J7QB 5HE3A 4M0WB 3HVZA 5BMHA 4XZ4A 1T0SC 3BY4B 3V5WA 1E7PB 3CIKA 3PREA 3ZW3A 1UNRA 1N5XA 4TKNA 3IG3A 1SE9A 1BAKA 1RM6C 1JROA 1WGUA 2VH1A 4YT0B 2UWQA 4ZHOA 4GOUA 1N60A 1AARA 4AP4C 4M01A 1FXTB 2EMTA 3A98B 2JXXA 2WQYB 1FB8A 1EWYC 2D3BA 2IZVB 1V49A 4WJ7A 3GE3C 1WJ6A 4RM8A 1ZOYB 3I5JC 3HM3A 4JKDA 5HG2A 2N9LA 2J0JA 4M8NA 2BW2A 1M7RA 2IO0B 1OQQA 4JQWC 2INCC 2C7NB 4KZCA 2XN9C 1U27A 4W9CA 3I9V1 1GC6A 4HAVB 2WXGA 5JHAA 2MH7A 1R4MI 1DOIA 3O13A 1E0ZA 3IHPC 1P6SA 3ML9A 4K3BA 2ZKMX 5IP4D 1GJZA 2V4IB 4LNIA 2GBKA 2KN4A 2N9XA 2OJWA 4BZAA 5J3TA 1BTNA 2BKFA 4AJWA 4GXBA 1Z87A 5EE3A 3ZTCA 2ZPNA 1KJTA 5D3VA 2DYMA 2KWVB 3LB8C 5BYRA 2NMBA 3HIZA 2J4XA 3UZTA 5HE1A 2ROVA 1MK9B 1UGMA 1V1PA 4MJSA 1WJUA 1WM2A 2B3AA 3P4SB 4FJYA 1LQBA 2V3NA 1WFYA 2HE7A 5I2MA 4TMAB 1GUAB 4IG7B 1XEEA 1WE7A 3Q8BA 3I63C 1D4BA 1HB8A 2Z8LA 1T3QA 3DWGC 3AM9A 1PLSA 2MP2B 4BBKA 3B0AA 2DNFA 2FIDA 2MEKA 5DHAB 1TKYA 3KW5B 3SR6A 2YS5A 5JHGA 4EFOA 1ROEA 1KH0A 4AS1A 2MDXA 4CYEA 3ZUNA 1V1OA 1DOYA 4IOYX 3ZQ4A 4KHBA 4WWNA 4BFRA 3L4PA 5LNK1 3HQCA 2KO3A 4N9F4 4RF0A 2XQNM 1N61A 4F7HA 2ELBA 2L1CA 2GUMA 2ZVNA 2D4QA 3EUB2 4WWOA 3R7QA 5KQ1A 2BBCA 2BF8B 1V80A 2CJOA 4C0AA 4P1CC 2Z14A 3PP2A 4LLGM 1ZE3D 1M7EA 3KVFB 3HK0A 1N5WA 2FNJB 5D2MB 4ILGB 1SJHD 2K3UA 2JYTA 1YX5B 3UQBA 4I6NB 4JKBA 4KIKB 1IRSA 1PFJA 2J59M 1K8RB 2DLBA 2PW9A 3RPFC 1WYWB 5JLJB 4TQ0A 5G55A 1P0RA 3DVNU 2N9KA 1F2RC 4XDCA 4BBNC 2Z0DB 1NI3A 2PTLA 1WH3A 3ECIA 2FIFA 2RPQA 3NVYA 2ICIA 3N3KB 5CX3A 3R2IA 2DZMA 1SHCA 1UBIA 1TJ6A 4IC7B 4QJ3B 2ELAA 2VZKD 3CSFA 2E2XA 1HTQA 3O96A 1C1YB 4DHZB 4FA6A 1XR0B 2INPE 4RCOA 2V1YA 1ZXHA 4OT1A 1YD8U 1UNQA 1WVHA 2RRFA 3W1SC 4TYZA 4HEA1 4KVGB 1YMHE 2MJ3A 2GRIA 4KSLC 3AN1A 1R4MB 3NVVA 2NTSA 2KVRA 2CY5A 4WJOA 5FR3A 1T0QC 1E6EB 4OW0A 2DHZA 4F7UP 1V5UA 3KYCD 1FNWA 3VOQA 2YS1A 3RZWC 2RQ1A 2DYBA 3FKYA 5TR5A 2M56B 3Q3MC 4HCNB 4P1BC 4ZDVA 4JIOU 2KQ4X 2I1JA 4WIPA 3RUIB 3TFMA 3AE2B 4IWQA 2NPTB 3WA0A 3T8MA 3A8PA 5J3YA 3A9KB 1YQBA 2W3SA 3PLVA 2EMSA 1MFWA 1OQRA 3ZVRA 4KKIA 3MP9A 2WS3B 2AX5A 4WAAA 3X23A 1PFDA 2G45B 1MPEA 3T3NA 2D5GA 1FCCC 4HCPB 3V6CB 1EF1A 1VDVA 2LRWA 3RCPA 3AEGB 4ZRQA 4HPLB 3DBHI 4RM9A 3R66C 3E9LA 1ZKHA 2D3GA 3ENBA 4ZRIA 2KNBA 1TIFA 1YNTE 3L54A 4BKSA 3UI3A 1H8CA 2O6VB 5J18A 3GYPA 2DWQA 1FM0D 2DHIA 1JCKB 1E9MA 5HI1A 4GZUA 3HIEA 2L83A 1KBLA 4MACA 2LVQA 5BO4B 4W9IA 4XGAB 3QC8B 2DHJA 4W9EA 3V6EB 1PDXA 3ODWA 3RNAC 1SE3A 4RGTA 2KLGA 5LXIB 2MP2A 2VRWB 1J7CA 2KUPA 3B77A 2KC2A 3VUXA 3M95A 4LTUA 1I7AA 3ZNZB 1UF0A 3K9PB 3NZUA 2ROZB 3MJWA 4CQNA 2WU5B 1W1DA 2M1MA 4A6FA 3PSCA 1CJEA 2I1KA 4WH4A 1D5ZC 4GDKB 2OHFA 2RGFA 4A3OA 2YSZA 2V3SA 4FADA 3HM6X 1EM7A 3Q8AA 4DBGA 5HE0A 3VR9B 1XQQA 1QF6A 4IAPA 1KI1B 3C0RB 4BOSC 4LCDE 1ZSQA 4CHMA 1K5GB 2KLCA 2MSED 1AQCA 2FCMA 1P5TA 2BYTA 1ZPSA 2KJ6A 2N7EA 1WX8A 4MM3A 5TSSA 5KHQA 2VKIA 4YONA 2WDTB 3WCQA 3MHSD 4NQLB 4DDID 2COFA 4XWTA 4USAA 3NVZA 2J42A 2INDC 3U2SC 4K2OA 3P4PB 2GI9A 1C9FA 2UZRA 2JPHA 1J8CA 1U5GA 3L0WB 3AV8A 4RFBA 3V62A 2CHWA 1ACAA 2WU2B 3W5VB 4HAYB 1UBQA 2NMQA 2LGIA 3LJ3A 4JK9A 3K9OB 3WYFB 1IBXA 2LG1A 3D8EA 5BMIA 1E7UA 1FAOA 2V9HA 4JK7A 1K5DB 1ST7A 1JWUD 2EELA 2IPKD 4MK0A 1RFKA 2HTME 2ZCBA 2BB5A 2GBJA 4DHJD 4KDIC 3LDZE 3DDCB 1AW7A 3KUDB 1TQZA 1YN5A 4A20A 4DHZE 3NUHB 2BTEA 1VRAB 3PTFC 1PMSA 3R8BA 2L0FA 4DWFA 4TUUA 2IY0B 3ZVVA 2RD0A 1K53A 2RUKB 5IRSA 4ILJA 4L2YA 4GNKB 3A58A 5DPRA 3CIRB 3U4EG 3TL5A 2K2UA 3EC8A 3D8DA 2ZZPB 3CWIA 2W54A 5D27A 5E6NA 2NPTA 2HTHA 2WLBA 4MGYE 5E6OA 1FRDA 1B1ZA 3A9KA 4A3PA 2E6XA 3QAQA 1VR9A 3VAWA 2KC1A 3B08A 2COPA 1C76A 3SNHA 3AE1B 1AYFA 1JW9D 1L5PA 3U30A 4GN1A 2H88B 2I38A 3U12A 3T3OA 1WYGA 5GXGB 3PO0A 1XD4A 3SDLC 3GOEA 4ZHPA 2WXPA 2IDYA 2N0SB 4W9DA 1WR1A 3QBVB 4ZRKA 3TO1A 4DDGD 3PT2B 3W1YA 2IGGA 3H6NA 4KHOA 2N23A 4MY6A 3ONSA 2LHDA 4K81A 2R2QA 4DXAB 1V2YA 1F9JA 1V1PB 2ONQA 1JDEA 4MJSB 3WIMA 4P16A 2GJYA 1BTKA 3E66A 2R09A 2M0XA 2RVBB 2W82A 3DVGY 3DBRI 1XO3A 2M17A 3R7RA 2DKQA 1WE6A 1U4AA 2NR2A 3A4SC 1L4DB 2ZVOA 2LI5A 1FD6A 3KRWA 4HPPA 2YLMA 2A4ZA 3B2FA 2CODA 2HRJA 3AE6B 3SHQA 1L0XB 1BXTA 4JE3B 3SBGA 2OQBA 3EFCA 3O65B 1XCTL 2KQSA 2KJHB 4NQKE 2GBNA 2PMVA 2ON8A 2FE8A 2WGSA 2JUOA 4LNFA 1ISNA 2KDBA 4MELA 3BVZA 1VZ6A 4N6EB 2MBQA 2MWNB 3ZNGC 5D3DA 1J7AA 5IN7A 3IBEA 1V5OA 2W55A 2K5PA 2K25A 2QKLA 1WXAA 3KUZA 5HE2A 4HKZE 3RNBC 2KN5A 1NEKB 3LYYA 3ZO5B 3TEYA 4HHVA 1HTOA 5D3IB 3QWMA 3FILA 4AQ7A 1PGAA 3PZ7A 1VCBA 1M4VA 1WGHA 1T5XD 4BKGA 2KTFA 4JWUC 2QSDA 1P98A 2J52A 4A8XC 3E9OA 2L05A 3OLMD 1OQNA 4HJKA 1FPYA 3UIOB 1JWSD 2KCJA 3ZRCA 1ET9A 1RJ2A 2DAJA 3ODXA 3MHZA 2N9EB 2JP2A 2FUHB 1TZOA 3ULBA 5J3QA 4JKHA 4N59A 1FEHA 2QIEB 2DYNA 2QEJC 1XCQL 4L6EA 5C2TB 2LBBA 1BWNA 4PQ0A 1WX9A 3PSEB 1ACCA 2CQUA 3BIID 1QILA 2R2YA 2EKIA 1X1GA 4B0MA 4QJ5B 3ZJVA 2PVOD 3NG0A 1ENFA 3KWVA 1KLVA 3AI5A 3SFDB 2LASA 2MBEA 2EC1A 1P3RA 3N9YC 4D6WA 1TYGB 2M0AA 2PVGC 4NAWA 5T8IA 2QC8A 2XK5A 1EF5A 1E8YA 2K8EA 4G11A 1SSNA 2FJUB 4MGIE 4OVVA 2KOXA 4YSYB 3G9WA 2LYDA 3NY5A 1UELA 2BT6A 4WQOB 1T77A 1YIWA 1WGQA 3DBRB 3TUOA 4URKA 3Q2AC 1LW3A 1NYRA 1DBHA 1V5TA 3OANA 2RDHA 3HSAA 3QX1A 4ACFA 5MPOA 2YT2A 1CK1A 1NENB 1PGBA 2KANA 5D3YA 1UD7A 3TJPA 2M19A 4D2KA 3L16A 1K50A 4S0RA 1EO6A 2B76B 2ZCCA 4ASWC 3RT3B 4DXFA 1HZ5A 1YQ4B 1UZXB 1V86A 4JPSA 2IFSA 2LRUA 4F7ZA 4XYCA 4IWPA 3ZGZA 3FLVA 2N0YA 2KYWA 1QC6A 5IKCM 2BYFA 3QIJA 2LFIA 5LOPB 3PG7A 5C79A 4RGMA 2J0MA 3PZDA 2ADZA 3KRXA 2K6QA 4NZLB 4QAYA 3TEWA 1X11A 4A55A 4WWPA 1SGHA 2KMMA 3E9PA 3QA8A 1TGZB 1P9DU 3AEBB 3OJ4B 1KM7A 1SE4A 2FCSA 1WGGA 1B55A 4GSWA 4W9HA 3OWEB 1XKEA 3E9SA 2D9YA 4HB0B 2IGDA 3DCGA 4FJVB
chains in the Genus database with same CATH topology
2C7MB 4PS3A 4W9JA 2JRHA 4WJQA 4GB9A 4JLCA 2CHXA 2CRFA 4A6FB 3KY9A 2AL3A 2MW5A 2N4FA 2DTCA 1VBGA 1Y5OA 1KZ7A 1H10A 4MEMA 4EZKA 5LONB 4JKAA 3A9JB 2MBBB 4K7WA 4GIVA 3A1QB 2LVPA 4B6WA 2DAFA 5EDSA 4TV3A 5J2RA 1P3QU 1WIAA 2Z59B 3QWZB 1WI1A 3A33B 4K7UA 4NJ6A 3LJUX 2UYZB 1P1AA 4K17A 2LXAA 1VBHA 2COCA 4HDQA 2PE6B 5IA7A 5JZEB 4XWXA 1C3TA 4Z2MB 4HAZB 3NZSA 1WXVA 3D8FA 4KDLB 4LDTB 1V5MA 1I2HA 4IM2A 4BOZB 5GMVA 1ZW7A 2KXJA 3RZFA 1KC7A 2DFKA 2OJRA 3SUZA 2W2XC 3N7CA 4JKCA 3OAWA 4ANWA 4JGHB 2HTHB 2LJ5A 3APCA 1MK7B 4A6HA 2KKCA 1FHXA 1WGYA 1N3HA 2OOBB 2PE9A 2YRYA 2ZEQA 2WX0A 5LLIA 3JYUA 3L10B 4F7GA 4HDOA 2LULA 3KH0A 4NPNA 1M94A 2LGDA 5CTRC 5FR6A 2N1VA 1TTNA 2LWPA 2MWSB 1V5PA 3H7SA 1GNUA 5CLLB 1U2BA 4GMXB 5LXHA 1WZ0A 1D3ZA 5IJMA 2KMCA 1LB1A 3JSVA 4Y94A 4DX8A 1A5RA 1H4RA 1V9JA 2ZJDA 2MLBA 5AZGA 5L81A 3ML8A 4IWOA 2COAA 2KTRA 4FBJB 2H7DA 4K7SA 1MPHA 4ICUA 1FGZA 3VDZA 4E3CA 2JF5A 3NHEB 3PHXB 1WJ1A 3SYXA 2PEAA 2JWZA 1RLFA 5C16A 2KWCA 3ZIMA 3A9JA 3A1QA 2DHKA 4ICVA 3MDBC 2P0HA 2RGNB 4XX5A 2EKEC 2X0SA 1LXDA 1DROA 2L0TA 4AJYB 4GU2A 4FHKA 3DBLI 1E8WA 1DYNA 2BPSA 5DPSA 1PQSA 2Z0QA 2G4DB 3RD2A 3EECA 1Q67A 1V6EA 2D9XA 1BT0A 5AEKB 2REXA 1YX6B 4ANXA 2BYEA 3ODOA 1ZGUB 4EEWA 2GCJA 5JVLA 1E8ZA 1JRUA 2M38A 4IFSA 4FN2A 4IUMB 3QJZA 1OEYJ 4EUTA 4NSWA 2Y8FA 2RSGA 2YT1A 3OJ3A 2G3QB 2BWES 2NBVB 2V76A 2NBWB 4MGZE 2H7EA 3L08A 3M1IB 1IYFA 4CO7A 4NAWB 2XK5B 3N32A 5DHFB 3D32A 3TCAA 3GYOA 4HB3B 4NNJB 3GZNI 1WJ4A 3DBSA 3RULA 2NS5A 2DYQA 3EPYA 1RFAA 2D9WA 1I35A 2WWZA 2KWUB 3VTWA 2CHZA 1U5EA 1OMWA 3UIPB 4EJNA 1OQYA 3H9DA 5G2NA 4Z2NA 3APFA 1WJMA 1MAIA 3TVVA 1IP9A 3ZTDA 4ILHA 4TQ1A 2LZ6A 5KCVA 4XC2A 1WR6E 5D3XA 2XBBC 1WGDA 2XEWA 2L00B 3DXDA 2LGXA 2DZIA 4FHJA 1J19A 2MBHA 2MQJA 2KK8A 4EZLA 3WANA 1GG3A 2DLWA 3QHTA 4I6PA 2K39A 2RNRB 4F8CB 2YS3A 4PS7A 4FJZA 1OTRB 2LGYA 4KV2A 1J0WA 5IAAC 2O2VA 1AWEA 3QCAA 4KHAA 2K8BA 2KDFB 2FCNA 3DVNV 4II3B 5DPWA 1Y19B 2C9WB 2DKPA 1X1MA 3UGBB 2DX5A 3P6AA 3A4RA 2YF0A 2BGFA 1Q0WB 2ASQA 1HE8A 5DH9B 5GOWB 1I42A 3WAOA 2GS0A 1W1GA 3JW0X 2O6VD 4EZJA 1UPQA 2I5CA 2AWTA 3AU4A 3V60A 3VXWA 3B1LX 2ZNVB 5C23A 1UH6A 1MIZB 3FP5A 3QARA 2GOWA 1E5WA 1WMHA 4IW0A 5AZHA 3ML4A 2KD0A 2IYDB 5D94A 3VQIA 4LJOB 3SU8X 3BINA 3MTNB 1NTVA 2KX3A 2D10A 1EAZA 4I6LB 4B6HA 4AUQC 2MA9B 3CXBB 5CHWA 4J6IA 3PLUA 2G4SA 2NBUA 3F0WA 5CHVC 4AOFA 2Z0EB 4GDLA 1QQGA 4DBBA 3N30A 1DDMA 4HK2A 4CHKA 3PHWB 4JKGB 1W1HA 1Z5SB 2L3ZA 1NI2A 1XD3B 3PRZA 4JKFA 3VTUA 5EFXA 4GPTB 4W9GA 1U5DA 1SIFA 3EHVA 1WM3A 4ANVA 2GBRA 1RRBA 4P7IA 3TMPB 1ZC4B 1NDDA 3AU5A 2WH5A 5D3WA 3VH4B 2EJ8A 3R3MA 1WX7A 3KSYA 3HHMA 5D6JB 3UQAA 2D11A 2GBMA 3L13A 1WRDB 1T0YA 2RR9A 4PNKA 2YVCA 2N7DA 5L83A 3VUWA 2NCNA 2HD5B 3PVLA 5DI9B 3W1SA 2FJ9A 2KHWB 2PPHA 3JSVB 4FLHA 5DPTA 2MX2A 1Q5WB 3DXEA 1V81A 3AXCA 1DIKA 2K8CA 4W9LA 4DK5A 4HAXB 1L7YA 3F5RA 2KTRB 1X1FA 2KFKA 2J0KA 4AWJA 1Y8RC 1G6JA 3CF6E 1NBFC 4KZ0A 1XODA 5JHBA 1XX0A 4BBNF 2D9ZA 2NZ8B 3DPDA 3H7PA 2RLOA 4IM0A 4IM3A 2KX0A 4GMVA 2C60A 1YJ1A 3QK0A 5E6PA 3CMMB 1CMXB 1WF9A 3WAMA 1V61A 4WSFA 2W9NA 4FULA 2JT4B 3QQ8B 1ZM0A 3Q3FA 4DHJB 2Z0PA 2L2IA 3V61A 2FDQA 2C7HA 1UNPA 1KZGA 3I3TB 4K1RB 2W2XD 2CAYA 1VD2A 1WJNA 4LJPB 1WZ3A 4HB4B 1WXSA 2CB8A 2PZ1A 2ABDA 2AEHA 4HPMB 2KGXB 2K1FA 3PRPB 1FHWA 5FI1A 1ZVRA 1RRPB 2KQ7A 4NY0A 2R0DA 2JY6A 5C5BA 3DXCA 2GCLA 2DZKA 2A5UA 4HWIB 4JKGA 2GMIC 3ENEA 4HXDA 2QHOA 1Z2MA 1V88A 1TZ1A 2BKRB 2IBIB 1MG8A 3TBLD 3KYDD 4B9KA 3VIAA 2CR5A 2ZPYA 5FI0A 4D0NB 2JZ3B 1OEYA 1DDWA 3S2AA 4II2B 4ZRJA 1ZC3B 2Z0OA 2LXCA 2KDIA 2K6DB 1S3SG 1XT9B 3PVUA 4BVUC 2K00A 2Q13A 3P7ZA 3UINB 4A5KA 2R2OA 3MPXA 5JP4A 3U8ZA 1WG7A 1WI0A 2IY1B 1DDVA 1WGRA 5C6RA 4HATB 3ZDTA 2D2QA 1TXDA 1RAXA 2ZNVC 1X05A 1GGOA 2IYBA 3VUYA 2L8JA 4GGQA 4WVFB 3ALBA 2CU1A 3ZLZA 1FGYA 3SD5A 4F1SA 2X18A 4G0NB 3VFKA 2D9VA 2LVOA 2N9PC 2D07B 2MCNB 3P2BA 2CKHB 2BYVE 1U29A 5DIFB 3FSSA 2MRPA 3PVWA 2O2VB 2AL6A 3RYTA 3ZNID 2KFJA 1UPRA 4ANUA 2IO3B 2G35A 5JHHA 2DN6A 2M14A 2KZRA 3NS8A 2P0DA 5L95C 2DX5B 3T06A 4PS8A 3PS6A 3DVGX 2BWFA 2AYOB 4HB2B 2I5FA 2UZSA 4BKSD 3ZNHB 3PEGA 1MIXA 2LD9A 1EVHA 1MKEA 3IFWB 4E74A 4H8SA 3M62B 5CHFA 2W2WA 1FOEA 2LOZA 4G50A 3U7DA 1XCGA 5AZFA 4PYZA 1E90A 1HB6A 2K2JA 1E8XA 3FM8C 1WMHB 4KIKA 5JH5C 1FHOA 3SV1A 2QKMA 1NU2A 2L76A 2YT0A 2JVCA 3AULA 2KDEB 3SO6A 3L17A 2KMAA 2FCQA 2Y5BB 4EKUA 1KOTA 4GDLB 4MSQB 2CY4A 4JK8A 2DYOA 1NTYA 1OGWA 3VTVA 2RSUA 2UVMA 3T9LA 3VVWB 1X86A 1NVLA 3X0WA 4MH0E 3APDA 4G3XB 2MBOA 3EFUA 3UF8A 1R4NI 2VSZA 3KZ1A 2MFQA 3IVFA 3PPAA 2K8HA 3WAPA 1Q1OA 2DIKA 4HAWB 4MSMB 2CS4A 5KQ4A 3VH3B 3H1UA 4CHJA 4NJ7A 4HVBA 4JL9A 4HLEA 2FAZA 3RCZA 3PGEA 2NVUI 3M63B 4LDTD 3PRMB 3M3JA 2JZZA 3ZRFA 4BKTA 2WX1A 3KUCB 3ZKJC 4OVUA 1GC7A 5DCNA 1L2NA 3PV1A 1OY2A 2IO1B 2DA0A 2P8VA 2P0FA 3FEHA 2KJRA 1EUVB 1S1QB 5HKHA 3NSUA 2M8SA 1UEFA 5CLQB 4W9KA 4WJNA 4WJPA 1E7VA 4PYUA 3NOBA 1HBKA 4GOCA 1QZEA 2LKOA 2L7RA 2M4NA 3ZDMC 4B95A 2O6VA 1TBEA 2N1WA 1LM8B 2KFKB 4MT7A 4RMAA 3VHTC 4HAUB 3Q3JA 3H7PB 1J0GA 3A8QA 4X57B 2OTXA 2LUEA 5D7GA 1LFDA 2HJ8A 1U5FA 4KHBB 4DX90 4EOYA 4JKEA 5C1ZA 4M8MA 2Y7BA 3SBTA 2DZJA 4GDKA 3JVZX 4EMOA 4KAXB 2VRRB 3CSTA 4ZYNA 2DX1A 5KHOA 3DQVA 3HW2B 2DENB 2FJLA 1WY8A 3TIXA 1NTIA 5J17A 1EGXA 3BJIA 1IPGA 2LOXA 4MGKE 4KSKC 3WALA 3AJ4A 4E71A 2C5LC 2WYQA 3DOWA 2MKRA 2IO2B 2BCJA 5C5BB 2Y8GA 2PJHA 2JRIB 2R82A 4YL8A 1WXMA 4A6KA 1V89A 4K2PA 3ULCA 4MDKE 3TW1A 2V4LA 2J7QB 5HE3A 4M0WB 4XZ4A 3BY4B 3V5WA 3CIKA 3PREA 3ZW3A 1UNRA 4TKNA 3IG3A 1SE9A 1BAKA 1WGUA 2UWQA 1AARA 4AP4C 1FXTB 2EMTA 3A98B 2JXXA 1FB8A 2IZVB 1V49A 4WJ7A 1WJ6A 4RM8A 3HM3A 4JKDA 4M8NA 2J0JA 1M7RA 2IO0B 4JQWC 2C7NB 4KZCA 1U27A 4W9CA 1GC6A 4HAVB 5JHAA 1R4MI 1GJZA 3IHPC 1P6SA 3ML9A 2GBKA 2N9XA 5J3TA 1BTNA 2BKFA 4AJWA 4GXBA 1Z87A 3ZTCA 2ZPNA 1KJTA 5D3VA 2DYMA 2KWVB 2NMBA 3HIZA 3UZTA 5HE1A 2ROVA 1MK9B 1UGMA 4MJSA 1WJUA 1WM2A 2B3AA 4FJYA 1LQBA 1WFYA 2HE7A 1GUAB 4IG7B 1WE7A 1HB8A 1PLSA 2MP2B 4BBKA 3B0AA 2FIDA 5DHAB 3KW5B 2YS5A 5JHGA 4EFOA 2MDXA 4CYEA 3ZUNA 4IOYX 4WWNA 4BFRA 3HQCA 2KO3A 4N9F4 2XQNM 4F7HA 2ELBA 2L1CA 2ZVNA 2D4QA 4WWOA 3R7QA 5KQ1A 2BF8B 1V80A 4C0AA 3PP2A 1M7EA 3KVFB 3HK0A 2FNJB 5D2MB 4ILGB 1YX5B 3UQBA 4I6NB 4JKBA 4KIKB 1IRSA 1PFJA 2J59M 1K8RB 1WYWB 5JLJB 4TQ0A 5G55A 1P0RA 3DVNU 4BBNC 2Z0DB 1WH3A 3ECIA 2FIFA 2RPQA 3N3KB 5CX3A 2DZMA 1SHCA 1UBIA 1TJ6A 4IC7B 2ELAA 3CSFA 2E2XA 3O96A 1C1YB 4DHZB 4FA6A 1XR0B 2V1YA 1YD8U 1UNQA 1WVHA 3W1SC 4TYZA 4KVGB 4KSLC 2KVRA 2CY5A 4WJOA 2DHZA 4F7UP 1V5UA 3KYCD 3VOQA 2YS1A 3RZWC 2RQ1A 2DYBA 5TR5A 4HCNB 4ZDVA 4JIOU 2I1JA 3RUIB 3TFMA 4IWQA 2NPTB 3WA0A 3T8MA 3A8PA 5J3YA 3A9KB 1YQBA 3PLVA 2EMSA 3ZVRA 4WAAA 3X23A 2G45B 4HCPB 3V6CB 1EF1A 2LRWA 3RCPA 4HPLB 3DBHI 4RM9A 3R66C 3E9LA 1ZKHA 2D3GA 3ENBA 4ZRIA 2KNBA 3L54A 4BKSA 1H8CA 2O6VB 5J18A 3GYPA 2DHIA 4GZUA 1KBLA 2LVQA 5BO4B 4W9IA 3QC8B 2DHJA 4W9EA 3V6EB 3ODWA 2KLGA 5LXIB 2MP2A 2VRWB 2KUPA 2KC2A 3VUXA 3M95A 1I7AA 3ZNZB 3K9PB 3NZUA 2ROZB 3MJWA 1W1DA 2M1MA 4A6FA 3PSCA 2I1KA 4GDKB 4A3OA 2RGFA 2YSZA 2V3SA 4FADA 3HM6X 4DBGA 5HE0A 1XQQA 4IAPA 1KI1B 3C0RB 4BOSC 4LCDE 1ZSQA 4CHMA 1K5GB 2KLCA 2MSED 1AQCA 2FCMA 1P5TA 2KJ6A 2N7EA 1WX8A 4MM3A 5KHQA 2VKIA 4YONA 2WDTB 3MHSD 4NQLB 4DDID 2COFA 4K2OA 2UZRA 2JPHA 1J8CA 1U5GA 3L0WB 3V62A 2CHWA 1ACAA 4HAYB 1UBQA 3LJ3A 4JK9A 3K9OB 3WYFB 2LG1A 3D8EA 1E7UA 1FAOA 4JK7A 1K5DB 1ST7A 4MK0A 2ZCBA 2GBJA 4DHJD 4KDIC 3LDZE 3DDCB 3KUDB 1TQZA 4A20A 4DHZE 3PTFC 1PMSA 2L0FA 4DWFA 4TUUA 3DCGA 2IY0B 3ZVVA 2RD0A 2RUKB 4ILJA 5DPRA 3TL5A 2K2UA 3EC8A 3D8DA 2ZZPB 5D27A 5E6NA 2NPTA 2HTHA 4MGYE 5E6OA 3A9KA 4A3PA 3QAQA 3VAWA 2KC1A 3B08A 2COPA 3SNHA 3U30A 4GN1A 1XD4A 3SDLC 3GOEA 4W9DA 1WR1A 3QBVB 4ZRKA 3TO1A 4DDGD 3PT2B 3W1YA 3H6NA 4KHOA 2N23A 4MY6A 3ONSA 4K81A 2R2QA 4DXAB 1V2YA 1F9JA 4MJSB 1JDEA 3WIMA 2GJYA 1BTKA 3E66A 2R09A 2M0XA 2RVBB 3DVGY 3DBRI 2M17A 3R7RA 2DKQA 1WE6A 1U4AA 2NR2A 3A4SC 2ZVOA 2LI5A 3KRWA 2YLMA 2A4ZA 2CODA 2HRJA 3SHQA 3SBGA 2OQBA 3O65B 2KQSA 2KJHB 4NQKE 2GBNA 2JUOA 1ISNA 2KDBA 4MELA 2MBQA 2MWNB 3ZNGC 3IBEA 1V5OA 2QKLA 2K25A 1WXAA 3KUZA 5HE2A 2KN5A 3ZO5B 4HHVA 3QWMA 1VCBA 1WGHA 4BKGA 2KTFA 1P98A 3E9OA 2L05A 3OLMD 1OQNA 4HJKA 3UIOB 2KCJA 3ZRCA 1RJ2A 2DAJA 3ODXA 2N9EB 2JP2A 2FUHB 3ULBA 5J3QA 4JKHA 2DYNA 4L6EA 2LBBA 1BWNA 4PQ0A 1WX9A 3PSEB 2CQUA 1X1GA 1KLVA 3AI5A 2LASA 2MBEA 2EC1A 1P3RA 4NAWA 2XK5A 1EF5A 1E8YA 4G11A 4MGIE 4OVVA 2KOXA 3G9WA 2LYDA 3NY5A 1UELA 4WQOB 1YIWA 1WGQA 4URKA 1LW3A 1DBHA 1V5TA 3OANA 3QX1A 2KANA 5D3YA 1UD7A 3TJPA 3L16A 1EO6A 2ZCCA 4ASWC 3RT3B 1UZXB 1V86A 2IFSA 2LRUA 4F7ZA 4IWPA 3FLVA 2N0YA 1QC6A 2BYFA 3QIJA 5LOPB 3PG7A 5C79A 2J0MA 3PZDA 2ADZA 3KRXA 2K6QA 1X11A 4WWPA 1SGHA 3E9PA 3QA8A 1TGZB 1P9DU 3OJ4B 1KM7A 2FCSA 1WGGA 1B55A 4GSWA 4W9HA 1XKEA 2D9YA 4HB0B 4W9FA 4FJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7M B;  4PS3 A;  4W9J A;  2JRH A;  4WJQ A;  4GB9 A;  4JLC A;  2CHX A;  2CRF A;  4A6F B;  3KY9 A;  2AL3 A;  2MW5 A;  2N4F A;  2DTC A;  1Y5O A;  1KZ7 A;  1H10 A;  4MEM A;  4EZK A;  5LON B;  3A9J B;  2MBB B;  4K7W A;  4GIV A;  3A1Q B;  2LVP A;  4B6W A;  2DAF A;  5EDS A;  4TV3 A;  5J2R A;  1P3Q U;  1WIA A;  2Z59 B;  3QWZ B;  1WI1 A;  3A33 B;  4K7U A;  4NJ6 A;  3LJU X;  2UYZ B;  1P1A A;  4K17 A;  2LXA A;  2COC A;  4HDQ A;  2PE6 B;  5IA7 A;  5JZE B;  4XWX A;  1C3T A;  4Z2M B;  4HAZ B;  3NZS A;  1WXV A;  3D8F A;  4KDL B;  4LDT B;  1V5M A;  1I2H A;  4IM2 A;  4BOZ B;  5GMV A;  1ZW7 A;  2KXJ A;  3RZF A;  2DFK A;  2OJR A;  3SUZ A;  2W2X C;  3N7C A;  3OAW A;  4ANW A;  4JGH B;  2HTH B;  2LJ5 A;  3APC A;  1MK7 B;  4A6H A;  2KKC A;  1FHX A;  1WGY A;  1N3H A;  2OOB B;  2PE9 A;  2YRY A;  2ZEQ A;  2WX0 A;  5LLI A;  3JYU A;  3L10 B;  4F7G A;  4HDO A;  2LUL A;  3KH0 A;  4NPN A;  1M94 A;  2LGD A;  5CTR C;  5FR6 A;  2N1V A;  1TTN A;  2LWP A;  2MWS B;  1V5P A;  3H7S A;  1GNU A;  5CLL B;  1U2B A;  4GMX B;  5LXH A;  1WZ0 A;  1D3Z A;  5IJM A;  2KMC A;  1LB1 A;  3JSV A;  4Y94 A;  4DX8 A;  1A5R A;  1H4R A;  1V9J A;  2ZJD A;  2MLB A;  5AZG A;  5L81 A;  3ML8 A;  4IWO A;  2COA A;  2KTR A;  4FBJ B;  2H7D A;  4K7S A;  1MPH A;  4ICU A;  1FGZ A;  3VDZ A;  4E3C A;  2JF5 A;  3NHE B;  3PHX B;  1WJ1 A;  3SYX A;  2PEA A;  2JWZ A;  1RLF A;  5C16 A;  2KWC A;  3ZIM A;  3A9J A;  3A1Q A;  2DHK A;  4ICV A;  3MDB C;  2P0H A;  2RGN B;  4XX5 A;  2EKE C;  1LXD A;  1DRO A;  2L0T A;  4AJY B;  4GU2 A;  4FHK A;  3DBL I;  1E8W A;  1DYN A;  2BPS A;  5DPS A;  1PQS A;  2Z0Q A;  2G4D B;  3RD2 A;  3EEC A;  1Q67 A;  1V6E A;  2D9X A;  1BT0 A;  5AEK B;  2REX A;  1YX6 B;  4ANX A;  2BYE A;  3ODO A;  1ZGU B;  4EEW A;  2GCJ A;  1E8Z A;  1JRU A;  2M38 A;  4IFS A;  4FN2 A;  4IUM B;  3QJZ A;  1OEY J;  4EUT A;  4NSW A;  2Y8F A;  2RSG A;  2YT1 A;  3OJ3 A;  2G3Q B;  2BWE S;  2NBV B;  2V76 A;  2NBW B;  4MGZ E;  2H7E A;  3L08 A;  3M1I B;  1IYF A;  4CO7 A;  4NAW B;  2XK5 B;  3N32 A;  5DHF B;  3D32 A;  3TCA A;  3GYO A;  4HB3 B;  4NNJ B;  3GZN I;  1WJ4 A;  3DBS A;  3RUL A;  2NS5 A;  2DYQ A;  3EPY A;  1RFA A;  2D9W A;  1I35 A;  2WWZ A;  2KWU B;  3VTW A;  2CHZ A;  1U5E A;  1OMW A;  3UIP B;  4EJN A;  1OQY A;  3H9D A;  5G2N A;  4Z2N A;  3APF A;  1WJM A;  1MAI A;  3TVV A;  1IP9 A;  3ZTD A;  4TQ1 A;  2LZ6 A;  5KCV A;  4XC2 A;  1WR6 E;  5D3X A;  2XBB C;  1WGD A;  2XEW A;  2L00 B;  3DXD A;  2LGX A;  2DZI A;  4FHJ A;  1J19 A;  2MBH A;  2MQJ A;  2KK8 A;  4EZL A;  3WAN A;  1GG3 A;  2DLW A;  3QHT A;  4I6P A;  2K39 A;  2RNR B;  4F8C B;  2YS3 A;  4PS7 A;  4FJZ A;  1OTR B;  2LGY A;  4KV2 A;  1J0W A;  5IAA C;  2O2V A;  1AWE A;  3QCA A;  4KHA A;  2K8B A;  2KDF B;  2FCN A;  3DVN V;  4II3 B;  5DPW A;  1Y19 B;  2C9W B;  2DKP A;  1X1M A;  3UGB B;  2DX5 A;  3P6A A;  3A4R A;  2YF0 A;  2BGF A;  1Q0W B;  2ASQ A;  1HE8 A;  5DH9 B;  5GOW B;  1I42 A;  3WAO A;  2GS0 A;  1W1G A;  3JW0 X;  2O6V D;  4EZJ A;  1UPQ A;  2I5C A;  2AWT A;  3AU4 A;  3VXW A;  3V60 A;  3B1L X;  2ZNV B;  5C23 A;  1UH6 A;  1MIZ B;  3FP5 A;  3QAR A;  2GOW A;  1E5W A;  1WMH A;  4IW0 A;  5AZH A;  3ML4 A;  2KD0 A;  2IYD B;  5D94 A;  3VQI A;  4LJO B;  3SU8 X;  3BIN A;  3MTN B;  1NTV A;  2KX3 A;  2D10 A;  1EAZ A;  4I6L B;  4B6H A;  4AUQ C;  2MA9 B;  3CXB B;  5CHW A;  4J6I A;  3PLU A;  2G4S A;  2NBU A;  3F0W A;  5CHV C;  4AOF A;  2Z0E B;  4GDL A;  1QQG A;  4DBB A;  3N30 A;  1DDM A;  4HK2 A;  4CHK A;  3PHW B;  1W1H A;  1Z5S B;  2L3Z A;  1NI2 A;  1XD3 B;  3PRZ A;  3VTU A;  5EFX A;  4GPT B;  4W9G A;  1U5D A;  1SIF A;  3EHV A;  1WM3 A;  4ANV A;  2GBR A;  1RRB A;  4P7I A;  3TMP B;  1ZC4 B;  1NDD A;  3AU5 A;  2WH5 A;  5D3W A;  3VH4 B;  2EJ8 A;  3R3M A;  1WX7 A;  3KSY A;  3HHM A;  5D6J B;  3UQA A;  2D11 A;  2GBM A;  3L13 A;  1WRD B;  1T0Y A;  2RR9 A;  4PNK A;  2YVC A;  2N7D A;  5L83 A;  3VUW A;  2NCN A;  2HD5 B;  3PVL A;  5DI9 B;  3W1S A;  2FJ9 A;  2KHW B;  2PPH A;  3JSV B;  4FLH A;  5DPT A;  2MX2 A;  1Q5W B;  3DXE A;  1V81 A;  3AXC A;  2K8C A;  4W9L A;  4DK5 A;  4HAX B;  1L7Y A;  3F5R A;  2KTR B;  1X1F A;  2KFK A;  2J0K A;  4AWJ A;  1Y8R C;  1G6J A;  3CF6 E;  1NBF C;  4KZ0 A;  1XOD A;  5JHB A;  1XX0 A;  4BBN F;  2D9Z A;  2NZ8 B;  3DPD A;  3H7P A;  2RLO A;  4IM0 A;  4IM3 A;  2KX0 A;  4GMV A;  2C60 A;  1YJ1 A;  3QK0 A;  5E6P A;  3CMM B;  1CMX B;  1WF9 A;  3WAM A;  1V61 A;  4WSF A;  2W9N A;  4FUL A;  2JT4 B;  3QQ8 B;  1ZM0 A;  3Q3F A;  4DHJ B;  2Z0P A;  2L2I A;  3V61 A;  2FDQ A;  2C7H A;  1UNP A;  1KZG A;  3I3T B;  4K1R B;  2W2X D;  2CAY A;  1VD2 A;  1WJN A;  4LJP B;  1WZ3 A;  4HB4 B;  1WXS A;  2CB8 A;  2PZ1 A;  2ABD A;  2AEH A;  4HPM B;  2KGX B;  2K1F A;  3PRP B;  1FHW A;  5FI1 A;  1ZVR A;  1RRP B;  2KQ7 A;  4NY0 A;  2R0D A;  2JY6 A;  5C5B A;  3DXC A;  2GCL A;  2DZK A;  2A5U A;  4HWI B;  2GMI C;  3ENE A;  4HXD A;  2QHO A;  1Z2M A;  1V88 A;  1TZ1 A;  2BKR B;  2IBI B;  1MG8 A;  3TBL D;  3KYD D;  4B9K A;  3VIA A;  2CR5 A;  2ZPY A;  5FI0 A;  4D0N B;  2JZ3 B;  1OEY A;  1DDW A;  3S2A A;  4II2 B;  4ZRJ A;  1ZC3 B;  2Z0O A;  2LXC A;  2KDI A;  2K6D B;  1S3S G;  1XT9 B;  3PVU A;  4BVU C;  2K00 A;  2Q13 A;  3P7Z A;  3UIN B;  4A5K A;  2R2O A;  3MPX A;  5JP4 A;  3U8Z A;  1WG7 A;  1WI0 A;  2IY1 B;  1DDV A;  1WGR A;  5C6R A;  4HAT B;  3ZDT A;  2D2Q A;  1TXD A;  1RAX A;  2ZNV C;  1X05 A;  2IYB A;  3VUY A;  2L8J A;  4GGQ A;  4WVF B;  3ALB A;  2CU1 A;  3ZLZ A;  1FGY A;  3SD5 A;  4F1S A;  2X18 A;  4G0N B;  3VFK A;  2D9V A;  2LVO A;  2N9P C;  2D07 B;  2MCN B;  3P2B A;  2CKH B;  2BYV E;  1U29 A;  5DIF B;  3FSS A;  2MRP A;  3PVW A;  2O2V B;  2AL6 A;  3RYT A;  3ZNI D;  2KFJ A;  1UPR A;  4ANU A;  2IO3 B;  2G35 A;  5JHH A;  2DN6 A;  2M14 A;  2KZR A;  3NS8 A;  2P0D A;  5L95 C;  2DX5 B;  3T06 A;  4PS8 A;  3PS6 A;  3DVG X;  2BWF A;  2AYO B;  4HB2 B;  2I5F A;  2UZS A;  4BKS D;  3ZNH B;  3PEG A;  1MIX A;  2LD9 A;  1EVH A;  1MKE A;  3IFW B;  4E74 A;  4H8S A;  3M62 B;  5CHF A;  2W2W A;  1FOE A;  2LOZ A;  4G50 A;  3U7D A;  1XCG A;  5AZF A;  4PYZ A;  1E90 A;  1HB6 A;  2K2J A;  1E8X A;  3FM8 C;  1WMH B;  4KIK A;  5JH5 C;  1FHO A;  3SV1 A;  2QKM A;  1NU2 A;  2L76 A;  2YT0 A;  2JVC A;  3AUL A;  2KDE B;  3SO6 A;  3L17 A;  2KMA A;  2FCQ A;  2Y5B B;  4EKU A;  1KOT A;  4GDL B;  4MSQ B;  2CY4 A;  2DYO A;  1NTY A;  1OGW A;  3VTV A;  2RSU A;  2UVM A;  3T9L A;  3VVW B;  1X86 A;  1NVL A;  3X0W A;  4MH0 E;  3APD A;  4G3X B;  2MBO A;  3EFU A;  3UF8 A;  1R4N I;  2VSZ A;  3KZ1 A;  2MFQ A;  3IVF A;  3PPA A;  2K8H A;  3WAP A;  1Q1O A;  4HAW B;  4MSM B;  2CS4 A;  5KQ4 A;  3VH3 B;  3H1U A;  4CHJ A;  4NJ7 A;  4HVB A;  4JL9 A;  4HLE A;  2FAZ A;  3RCZ A;  3PGE A;  2NVU I;  3M63 B;  4LDT D;  3PRM B;  3M3J A;  2JZZ A;  3ZRF A;  4BKT A;  2WX1 A;  3KUC B;  3ZKJ C;  4OVU A;  1GC7 A;  5DCN A;  1L2N A;  3PV1 A;  1OY2 A;  2IO1 B;  2DA0 A;  2P8V A;  2P0F A;  3FEH A;  2KJR A;  1EUV B;  1S1Q B;  5HKH A;  3NSU A;  2M8S A;  1UEF A;  5CLQ B;  4W9K A;  4WJN A;  4WJP A;  1E7V A;  4PYU A;  3NOB A;  1HBK A;  4GOC A;  1QZE A;  2LKO A;  2L7R A;  2M4N A;  3ZDM C;  4B95 A;  2O6V A;  1TBE A;  2N1W A;  1LM8 B;  2KFK B;  4MT7 A;  4RMA A;  3VHT C;  4HAU B;  3Q3J A;  3H7P B;  1J0G A;  3A8Q A;  4X57 B;  2OTX A;  2LUE A;  5D7G A;  1LFD A;  2HJ8 A;  1U5F A;  4KHB B;  4DX9 0;  4EOY A;  5C1Z A;  4M8M A;  2Y7B A;  2DZJ A;  4GDK A;  3JVZ X;  4EMO A;  4KAX B;  2VRR B;  3CST A;  4ZYN A;  2DX1 A;  5KHO A;  3DQV A;  3HW2 B;  2DEN B;  2FJL A;  1WY8 A;  3TIX A;  1NTI A;  5J17 A;  1EGX A;  3BJI A;  1IPG A;  2LOX A;  4MGK E;  4KSK C;  3WAL A;  3AJ4 A;  4E71 A;  2C5L C;  2WYQ A;  3DOW A;  2MKR A;  2IO2 B;  2BCJ A;  5C5B B;  2Y8G A;  2PJH A;  2JRI B;  4YL8 A;  1WXM A;  4A6K A;  1V89 A;  4K2P A;  3ULC A;  4MDK E;  3TW1 A;  2V4L A;  2J7Q B;  5HE3 A;  4M0W B;  4XZ4 A;  3BY4 B;  3V5W A;  3CIK A;  3PRE A;  3ZW3 A;  1UNR A;  4TKN A;  3IG3 A;  1SE9 A;  1BAK A;  1WGU A;  2UWQ A;  1AAR A;  4AP4 C;  1FXT B;  2EMT A;  3A98 B;  2JXX A;  1FB8 A;  2IZV B;  1V49 A;  4WJ7 A;  1WJ6 A;  4RM8 A;  3HM3 A;  4M8N A;  2J0J A;  1M7R A;  2IO0 B;  4JQW C;  2C7N B;  4KZC A;  1U27 A;  4W9C A;  1GC6 A;  4HAV B;  5JHA A;  1R4M I;  1GJZ A;  3IHP C;  1P6S A;  3ML9 A;  2GBK A;  2N9X A;  5J3T A;  1BTN A;  2BKF A;  4AJW A;  4GXB A;  1Z87 A;  3ZTC A;  2ZPN A;  1KJT A;  5D3V A;  2DYM A;  2KWV B;  2NMB A;  3HIZ A;  3UZT A;  5HE1 A;  2ROV A;  1MK9 B;  1UGM A;  4MJS A;  1WJU A;  1WM2 A;  2B3A A;  4FJY A;  1LQB A;  1WFY A;  2HE7 A;  1GUA B;  4IG7 B;  1WE7 A;  1HB8 A;  1PLS A;  2MP2 B;  4BBK A;  3B0A A;  2FID A;  5DHA B;  3KW5 B;  2YS5 A;  5JHG A;  4EFO A;  2MDX A;  4CYE A;  3ZUN A;  4IOY X;  4WWN A;  4BFR A;  3HQC A;  2KO3 A;  4N9F 4;  2XQN M;  4F7H A;  2ELB A;  2L1C A;  2ZVN A;  2D4Q A;  4WWO A;  3R7Q A;  5KQ1 A;  2BF8 B;  1V80 A;  4C0A A;  3PP2 A;  1M7E A;  3KVF B;  3HK0 A;  2FNJ B;  5D2M B;  1YX5 B;  3UQB A;  4I6N B;  4KIK B;  1IRS A;  1PFJ A;  2J59 M;  1K8R B;  1WYW B;  5JLJ B;  4TQ0 A;  5G55 A;  1P0R A;  3DVN U;  4BBN C;  2Z0D B;  1WH3 A;  3ECI A;  2FIF A;  2RPQ A;  3N3K B;  5CX3 A;  2DZM A;  1SHC A;  1UBI A;  1TJ6 A;  4IC7 B;  2ELA A;  3CSF A;  2E2X A;  3O96 A;  1C1Y B;  4DHZ B;  4FA6 A;  1XR0 B;  2V1Y A;  1YD8 U;  1UNQ A;  1WVH A;  3W1S C;  4TYZ A;  4KVG B;  4KSL C;  2KVR A;  2CY5 A;  4WJO A;  2DHZ A;  4F7U P;  1V5U A;  3KYC D;  3VOQ A;  2YS1 A;  3RZW C;  2RQ1 A;  2DYB A;  5TR5 A;  4HCN B;  4ZDV A;  4JIO U;  2I1J A;  3RUI B;  3TFM A;  4IWQ A;  2NPT B;  3WA0 A;  3T8M A;  3A8P A;  5J3Y A;  3A9K B;  1YQB A;  3PLV A;  2EMS A;  3ZVR A;  4WAA A;  3X23 A;  2G45 B;  4HCP B;  3V6C B;  1EF1 A;  2LRW A;  3RCP A;  4HPL B;  3DBH I;  4RM9 A;  3R66 C;  1ZKH A;  2D3G A;  4ZRI A;  2KNB A;  3L54 A;  4BKS A;  1H8C A;  2O6V B;  5J18 A;  3GYP A;  2DHI A;  4GZU A;  2LVQ A;  5BO4 B;  4W9I A;  3QC8 B;  2DHJ A;  4W9E A;  3V6E B;  3ODW A;  2KLG A;  5LXI B;  2MP2 A;  2VRW B;  2KUP A;  2KC2 A;  3VUX A;  3M95 A;  1I7A A;  3ZNZ B;  3K9P B;  3NZU A;  2ROZ B;  3MJW A;  1W1D A;  2M1M A;  4A6F A;  3PSC A;  2I1K A;  4GDK B;  4A3O A;  2RGF A;  2YSZ A;  2V3S A;  4FAD A;  3HM6 X;  4DBG A;  5HE0 A;  1XQQ A;  4IAP A;  1KI1 B;  3C0R B;  4BOS C;  4LCD E;  1ZSQ A;  4CHM A;  1K5G B;  2KLC A;  2MSE D;  1AQC A;  2FCM A;  1P5T A;  2KJ6 A;  2N7E A;  1WX8 A;  4MM3 A;  5KHQ A;  2VKI A;  4YON A;  2WDT B;  3MHS D;  4NQL B;  4DDI D;  2COF A;  4K2O A;  2UZR A;  2JPH A;  1J8C A;  1U5G A;  3L0W B;  3V62 A;  2CHW A;  1ACA A;  4HAY B;  1UBQ A;  3LJ3 A;  3K9O B;  3WYF B;  2LG1 A;  3D8E A;  1E7U A;  1FAO A;  1K5D B;  1ST7 A;  4MK0 A;  2ZCB A;  2GBJ A;  4DHJ D;  4KDI C;  3LDZ E;  3DDC B;  3KUD B;  1TQZ A;  4A20 A;  4DHZ E;  3PTF C;  1PMS A;  2L0F A;  4DWF A;  4TUU A;  3DCG A;  2IY0 B;  3ZVV A;  2RD0 A;  2RUK B;  5DPR A;  3TL5 A;  2K2U A;  3EC8 A;  3D8D A;  2ZZP B;  5D27 A;  5E6N A;  2NPT A;  2HTH A;  4MGY E;  5E6O A;  3A9K A;  4A3P A;  3QAQ A;  3VAW A;  2KC1 A;  3B08 A;  2COP A;  3SNH A;  3U30 A;  4GN1 A;  1XD4 A;  3SDL C;  3GOE A;  4W9D A;  1WR1 A;  3QBV B;  4ZRK A;  3TO1 A;  4DDG D;  3PT2 B;  3W1Y A;  3H6N A;  4KHO A;  2N23 A;  4MY6 A;  3ONS A;  4K81 A;  2R2Q A;  4DXA B;  1V2Y A;  1F9J A;  4MJS B;  3WIM A;  2GJY A;  1BTK A;  2R09 A;  2M0X A;  2RVB B;  3DVG Y;  3DBR I;  2M17 A;  3R7R A;  2DKQ A;  1WE6 A;  1U4A A;  2NR2 A;  3A4S C;  2ZVO A;  2LI5 A;  3KRW A;  2YLM A;  2A4Z A;  2COD A;  2HRJ A;  3SHQ A;  3O65 B;  2OQB A;  2KQS A;  2KJH B;  4NQK E;  2GBN A;  2JUO A;  1ISN A;  2KDB A;  4MEL A;  2MBQ A;  2MWN B;  3ZNG C;  3IBE A;  1V5O A;  2QKL A;  2K25 A;  1WXA A;  3KUZ A;  5HE2 A;  2KN5 A;  3ZO5 B;  4HHV A;  3QWM A;  1VCB A;  1WGH A;  4BKG A;  2KTF A;  1P98 A;  2L05 A;  3OLM D;  1OQN A;  4HJK A;  3UIO B;  2KCJ A;  3ZRC A;  1RJ2 A;  2DAJ A;  3ODX A;  2N9E B;  2JP2 A;  2FUH B;  3ULB A;  5J3Q A;  2DYN A;  4L6E A;  2LBB A;  1BWN A;  4PQ0 A;  1WX9 A;  3PSE B;  2CQU A;  1X1G A;  1KLV A;  3AI5 A;  2LAS A;  2MBE A;  2EC1 A;  1P3R A;  4NAW A;  2XK5 A;  1EF5 A;  1E8Y A;  4G11 A;  4MGI E;  4OVV A;  2KOX A;  3G9W A;  2LYD A;  3NY5 A;  1UEL A;  4WQO B;  1YIW A;  1WGQ A;  4URK A;  1LW3 A;  1DBH A;  1V5T A;  3OAN A;  3QX1 A;  2KAN A;  5D3Y A;  1UD7 A;  3TJP A;  3L16 A;  1EO6 A;  2ZCC A;  4ASW C;  3RT3 B;  1UZX B;  1V86 A;  2IFS A;  2LRU A;  4F7Z A;  4IWP A;  3FLV A;  2N0Y A;  1QC6 A;  2BYF A;  3QIJ A;  5LOP B;  3PG7 A;  5C79 A;  2J0M A;  3PZD A;  2ADZ A;  3KRX A;  2K6Q A;  1X11 A;  4WWP A;  1SGH A;  3QA8 A;  1TGZ B;  1P9D U;  3OJ4 B;  1KM7 A;  2FCS A;  1WGG A;  1B55 A;  4GSW A;  4W9H A;  1XKE A;  2D9Y A;  4HB0 B;  4W9F A;  4FJV B; 
#chains in the Genus database with same CATH topology
 3Q3O C;  2RMM A;  2C7M B;  1RYJ A;  2WXL A;  4PS3 A;  4W9J A;  2JRH A;  3AEF B;  4WJQ A;  4GB9 A;  4JLC A;  2CHX A;  5HHD G;  2CRF A;  4A6F B;  3KY9 A;  2AL3 A;  3Q8F A;  2MW5 A;  1SB3 C;  2WDQ B;  1ZXI A;  2N4F A;  2DTC A;  1VBG A;  1Y5O A;  1WSP A;  1KZ7 A;  1H10 A;  4PK1 A;  4MEM A;  3SEB A;  4EZK A;  4M00 A;  5LON B;  4JKA A;  2HDE A;  3A9J B;  1MI1 A;  4P6V F;  3RFZ B;  2MBB B;  4K7W A;  4GIV A;  3A1Q B;  1RWS A;  1LGR A;  3U52 E;  2LVP A;  4B6W A;  1MI0 A;  2DAF A;  1EU3 A;  5EDS A;  2WNM A;  3AE5 B;  1UGJ A;  3U7Z A;  4TV3 A;  2GB1 A;  4MM3 B;  5J2R A;  2K9X A;  1P3Q U;  1WIA A;  2Z59 B;  3QWZ B;  1WI1 A;  2DBY A;  3A33 B;  4K7U A;  4NJ6 A;  3LJU X;  2UYZ B;  1P1A A;  4K17 A;  2LXA A;  3NRZ A;  1VBH A;  2COC A;  4HDQ A;  1K52 A;  2PE6 B;  1SIJ A;  5IA7 A;  5JXV A;  5JZE B;  2Q5W D;  2JYE A;  4XWX A;  1C3T A;  4Z2M B;  1P7F A;  2KR0 A;  4HAZ B;  2D3C A;  3AE4 B;  3N20 C;  3NZS A;  1WXV A;  2QIL A;  3D8F A;  4KDL B;  4LDT B;  4R3D A;  2LEK A;  1IBX B;  5AUK A;  1FRR A;  1V5M A;  2KAC A;  3N1Y C;  1I2H A;  4IM2 A;  4OZA A;  4BOZ B;  1YQ3 B;  5GMV A;  4YSZ B;  1NVI D;  1ZW7 A;  2WXK A;  2KXJ A;  4KX6 B;  4H2A A;  3MJ5 A;  3RZF A;  1KC7 A;  5EE0 A;  1A70 A;  5E6J A;  2DFK A;  2OJR A;  4KGT A;  1QOB A;  1TS4 A;  1I4P A;  3R2T A;  1PYW D;  4JWS C;  3SUZ A;  2W2X C;  3PZ8 A;  3AEE B;  4WWM A;  2LMC A;  3N7C A;  2WDR B;  4JKC A;  1KRH A;  3OAW A;  4LNK A;  3OG5 A;  4ANW A;  4JGH B;  2HTH B;  2PLP A;  2LJ5 A;  3ZJT A;  3APC A;  1MK7 B;  4A6H A;  2KAJ A;  2KKC A;  1FHX A;  3N1X C;  1WGY A;  1C79 A;  1N3H A;  1YJJ A;  2OOB B;  2PE9 A;  5C3J B;  2YRY A;  2ZEQ A;  2WX0 A;  4DIX A;  5LLI A;  3JYU A;  4HKQ A;  1GAQ B;  3P42 A;  1UUP A;  3L10 B;  4F7G A;  4HDO A;  2LUL A;  3Q14 C;  3KH0 A;  1SXT A;  4NPN A;  1M94 A;  2LGD A;  5CTR C;  5FR6 A;  2N1V A;  1TTN A;  2LWP A;  2MWS B;  1V5P A;  3H7S A;  3AH7 A;  1GNU A;  1L0V B;  5CLL B;  4MT5 A;  1U2B A;  4GMX B;  1V8C A;  1WZ0 A;  5LXH A;  1D3Z A;  1CZP A;  5IJM A;  2KMC A;  1LB1 A;  1VZ7 A;  3JSV A;  1KLG D;  4ARI A;  1STE A;  4LK0 M;  4Y94 A;  1TS5 A;  4DX8 A;  3BYY B;  3Q8E A;  1A5R A;  1H4R A;  1V9J A;  2ZJD A;  1C78 A;  2MLB A;  5AZG A;  2X38 A;  3P4Q B;  5L81 A;  3ML8 A;  4IWO A;  2COA A;  2KTR A;  1UWM A;  4FBJ B;  2H7D A;  4K7S A;  1MPH A;  4ICU A;  3FVC A;  1FGZ A;  3VDZ A;  1C4A A;  4E3C A;  2JF5 A;  3NHE B;  5FKA C;  1L0Y B;  5BMG A;  3NWF A;  1XLP A;  3PHX B;  2KUQ A;  1WJ1 A;  3SYX A;  2PEA A;  1KLU D;  2JWZ A;  1RLF A;  1ZDV A;  4HJG E;  5C16 A;  1F77 A;  1L6V A;  2KWC A;  3ZIM A;  3A9J A;  1IGC A;  1PGX A;  1I4X A;  3FIL B;  1HQR D;  4YTP B;  2KVZ A;  1NYQ A;  3A1Q A;  3IT6 B;  2DHK A;  4ICV A;  3AEC B;  2RDG A;  3MDB C;  4XDD A;  2P0H A;  2RGN B;  4XX5 A;  2EKE C;  2X0S A;  1LXD A;  5H8Y E;  1DRO A;  3H8H A;  2L0T A;  2D3A A;  4AJY B;  4GU2 A;  4FHK A;  3DBL I;  3AMZ A;  2Z59 A;  1E8W A;  3AE3 B;  1DYN A;  3HUI A;  2WP9 B;  2BPS A;  3VR8 B;  5DPS A;  1PQS A;  2G1E A;  1EU4 A;  2Z0Q A;  1MHX A;  2G4D B;  2TSS A;  3RD2 A;  3BK2 A;  3EEC A;  1Q67 A;  1OFF A;  1V6E A;  2D9X A;  2SEB D;  1BT0 A;  5AEK B;  4REZ A;  4GLS C;  2REX A;  1YX6 B;  3BVM A;  2BYE A;  4ANX A;  4C56 C;  3ODO A;  1ZGU B;  4EEW A;  2GCJ A;  5JVL A;  1E8Z A;  1JRU A;  2M38 A;  4IFS A;  4CSQ A;  4FN2 A;  4IUM B;  3QJZ A;  1OEY J;  4EUT A;  4NSW A;  2Y8F A;  2RSG A;  2QJL A;  2YT1 A;  3OJ3 A;  2G3Q B;  2BWE S;  2NBV B;  3AE7 B;  2V76 A;  2NBW B;  4MGZ E;  2H7E A;  2RPV A;  2KIG A;  3L08 A;  3M1I B;  1T0R C;  1L4Z B;  1IYF A;  4CO7 A;  4PT5 A;  4RGN A;  4NAW B;  2Z13 A;  2XK5 B;  3N32 A;  5DHF B;  3D32 A;  2AQ1 B;  3FAH A;  3TCA A;  3TEX A;  3GYO A;  4HB3 B;  2WXQ A;  4NNJ B;  1TJE A;  3GZN I;  1WJ4 A;  3DBS A;  1KF6 B;  3Q8C A;  2NS5 A;  3RUL A;  1TS2 A;  2DYQ A;  3EPY A;  1RFA A;  4A6Q A;  2D9W A;  4K3C A;  2QMT A;  1I35 A;  2WWZ A;  2KWU B;  3VTW A;  2CHZ A;  3TSS A;  1U5E A;  1OMW A;  3UIP B;  4EJN A;  4ITK A;  1OQY A;  2UU7 A;  3H9D A;  5G2N A;  3AE8 B;  1D6E C;  2JQR B;  4Z2N A;  3APF A;  1WJM A;  4OZB A;  1MAI A;  3TVV A;  2BS2 B;  1IP9 A;  3ZYY X;  3ZTD A;  4ILH A;  4TQ1 A;  2LZ6 A;  4C4V B;  5KCV A;  4XC2 A;  1WR6 E;  5D3X A;  1QKZ A;  2XBB C;  1WGD A;  4HRS A;  1TKE A;  2XEW A;  2L00 B;  3ETR A;  2IGH A;  1D5X C;  3DXD A;  2LGX A;  2DZI A;  4FHJ A;  1J19 A;  2MBH A;  2MQJ A;  2FBW B;  1F1H A;  2KK8 A;  4EZL A;  4C7Y A;  3WAN A;  5G5H A;  3C19 A;  1GG3 A;  1ZYI A;  1HA5 A;  2WHI A;  4A90 A;  2DLW A;  3QHT A;  4I6P A;  2K39 A;  3SFE B;  2RNR B;  1FFV A;  4F8C B;  2KT7 A;  2YS3 A;  4PS7 A;  2CU3 A;  3EGR A;  1ZP0 B;  4FJZ A;  1OTR B;  1JWB D;  3DBL B;  2LGY A;  4O1N A;  5EE1 A;  4KV2 A;  1J0W A;  5IAA C;  2O2V A;  3KLS X;  2LUM A;  1AWE A;  3QCA A;  4KHA A;  4DXG A;  2K8B A;  2KDF B;  2FCN A;  3DVN V;  4II3 B;  5DPW A;  1Y19 B;  1XLQ A;  2C9W B;  2DKP A;  1X1M A;  3UGB B;  4IKG A;  2DX5 A;  1N63 A;  3P6A A;  2VZK B;  3A4R A;  1I4R A;  2YF0 A;  2BGF A;  1Q0W B;  2ASQ A;  1HE8 A;  5DH9 B;  1FMA D;  5GOW B;  2MHJ A;  3HVD A;  1I42 A;  2CJN A;  3IAM 1;  3WAO A;  2GS0 A;  1W1G A;  3JW0 X;  2O6V D;  3GB1 A;  4EZJ A;  1WXQ A;  1UPQ A;  2I5C A;  2SAK A;  3RNF C;  2AWT A;  1YN4 A;  3MC9 A;  3AU4 A;  2AQ2 B;  3V60 A;  3VXW A;  2WDV B;  3B1L X;  4EE2 A;  2ZNV B;  5C23 A;  4ZOH C;  1UH6 A;  4C00 A;  4KGS A;  1TS3 A;  4QXA B;  1MIZ B;  3FP5 A;  3QAR A;  2GOW A;  4ZRP A;  1MJD A;  1E5W A;  1WMH A;  4IW0 A;  5AZH A;  3ML4 A;  1QOG A;  2JU6 X;  2KD0 A;  2IYD B;  5D94 A;  3GZN B;  3VQI A;  4LJO B;  3SU8 X;  3BIN A;  4L1R A;  3BK1 A;  1NTV A;  2KX3 A;  2D10 A;  3MTN B;  2BS4 B;  1EAZ A;  4I6L B;  1I4G A;  4C80 A;  4B6H A;  4AUQ C;  2MA9 B;  1QQR A;  3CXB B;  5CHW A;  3PLU A;  4J6I A;  2G4S A;  2NBU A;  3F0W A;  3NS1 A;  2WXO A;  1JAL A;  5CHV C;  4RNA A;  4AOF A;  2Y5C A;  2Z0E B;  4GDL A;  1J7B A;  1QQG A;  3V3X A;  4DBB A;  3N30 A;  1DDM A;  3MC8 A;  2NBV A;  4HK2 A;  4CHK A;  4NAM A;  3NW8 A;  3PHW B;  4JKG B;  1W1H A;  1MHH E;  1Z5S B;  1NI2 A;  1AWD A;  2L3Z A;  1XD3 B;  3PRZ A;  4JKF A;  3VTU A;  5EFX A;  4GPT B;  4UDU C;  1D5M C;  2X8X X;  4W9G A;  1U5D A;  1SIF A;  3EHV A;  1WM3 A;  4ANV A;  1FIQ A;  3ZJU A;  2GBR A;  1LO5 D;  1RRB A;  2JSV X;  4RH6 A;  4P7I A;  4OSN A;  3TMP B;  1ZC4 B;  1BML C;  1TKG A;  1F0Z A;  1NDD A;  3RN9 C;  3AU5 A;  2WH5 A;  1L6U A;  5D3W A;  1YJI A;  3N1Z C;  2L1A A;  2PKO A;  3VH4 B;  2EJ8 A;  3R3M A;  4KGR A;  1WX7 A;  1FCL A;  1VLB A;  3KSY A;  3HHM A;  5D6J B;  2QDF A;  3UQA A;  2D11 A;  2GBM A;  3L13 A;  1WRD B;  1T0Y A;  2RR9 A;  2WXI A;  3RNC C;  4PNK A;  4C4V A;  2YVC A;  2JX5 A;  5HFY A;  3BWU D;  2N7D A;  5L83 A;  3VUW A;  2NCN A;  2HD5 B;  3PVL A;  5DI9 B;  1GB4 A;  3W1S A;  2ACZ B;  2FJ9 A;  3W5U B;  3RI7 C;  5LG4 B;  2KHW B;  2PPH A;  3JSV B;  4Q2J A;  3AE9 B;  4FLH A;  5DPT A;  2MX2 A;  1Q5W B;  1SBB B;  3DXE A;  1V81 A;  3AXC A;  1DIK A;  2K8C A;  4N58 A;  4W9L A;  1GOZ A;  2BS3 B;  4DK5 A;  4HAX B;  1L7Y A;  3F5R A;  3DHG C;  3C8Y A;  2KTR B;  1X1F A;  2KFK A;  2KWD A;  2J0K A;  4AWJ A;  1Y8R C;  1DOX A;  3B9J A;  1G6J A;  3CF6 E;  1NBF C;  4KZ0 A;  1XOD A;  5JHB A;  2JXT A;  1XX0 A;  3Q6B A;  3RNG C;  4BBN F;  4HRO A;  2Z4D A;  2D9Z A;  2NZ8 B;  3DPD A;  3H7P A;  1MVK A;  1SJE D;  1FXI A;  1C4P A;  3B2G A;  2RLO A;  2XNA C;  4IM0 A;  4IM3 A;  2KX0 A;  4GMV A;  5IO9 A;  2C60 A;  2WXR A;  3AED B;  1ZUD 2;  1YJ1 A;  3QK0 A;  5E6P A;  3CMM B;  1CMX B;  2GLS A;  1WF9 A;  3WAM A;  5G5G A;  1V61 A;  4WSF A;  1N6Z A;  2W9N A;  2JT4 B;  4FUL A;  3QQ8 B;  1ZM0 A;  1XLN A;  3Q3F A;  1SF0 A;  1BUI C;  2WXN A;  2Z0P A;  2L2I A;  4DHJ B;  4JX1 C;  3V61 A;  2FDQ A;  2C7H A;  4NJC A;  4XE0 A;  1UNP A;  1KZG A;  3I3T B;  4K1R B;  4WQM A;  2W2X D;  2CAY A;  1ZDX A;  1IGD A;  2QCZ A;  2ZW1 A;  1VD2 A;  1WJN A;  2E3T A;  4LJP B;  1QLB B;  1WZ3 A;  4HB4 B;  1WXS A;  2CB8 A;  2BQQ A;  2PZ1 A;  4BAX A;  2ABD A;  2AEH A;  4HPM B;  2KGX B;  1E10 A;  3VRB B;  2K1F A;  3PRP B;  1FHW A;  5FI1 A;  1ZVR A;  4XWW A;  2I2Y A;  1RRP B;  2KQ7 A;  4NY0 A;  2R0D A;  1QOF A;  4RGO S;  2JY6 A;  3RNE C;  4YWG G;  3BVG A;  3GE8 C;  5C5B A;  3FC4 A;  3DXC A;  2GCL A;  2DZK A;  2A5U A;  4US8 A;  2BVC A;  4HWI B;  4JKG A;  2GMI C;  3ENE A;  1UWX A;  4HXD A;  2QHO A;  3RMK C;  2KDM A;  1Z2M A;  1V88 A;  1QT9 A;  4M0W A;  1TZ1 A;  2BKR B;  2IBI B;  1MG8 A;  1FNV A;  2MJE A;  3TBL D;  3DHH C;  3KYD D;  2WXF A;  2J53 A;  2JWU A;  3ZXV A;  4B9K A;  1VZ8 A;  3VIA A;  5H92 C;  2CR5 A;  2ZPY A;  5FI0 A;  4D0N B;  2NTT A;  2JZ3 B;  1Y56 A;  1QOA A;  4ZYS A;  1OEY A;  1DDW A;  3S2A A;  1C4C A;  4II2 B;  5FK9 C;  1YOV B;  4ZRJ A;  1ZC3 B;  1HEZ E;  4IOI E;  3GS2 A;  2ZW0 A;  3KQ4 A;  2Z0O A;  2LXC A;  3KWL A;  2KDI A;  2K6D B;  1S3S G;  1PUT A;  1XT9 B;  3PVU A;  2K49 A;  2LJI A;  1GPX A;  1JML A;  4L23 A;  4BVU C;  2K00 A;  2MJD A;  4RF1 A;  2Q13 A;  2YEP F;  3P7Z A;  1FFU A;  3UIN B;  4A5K A;  2R2O A;  4YTM B;  3MPX A;  3TEZ A;  5JP4 A;  3U8Z A;  1ESF A;  1WG7 A;  1WI0 A;  2IY1 B;  1DDV A;  4M02 A;  1MG4 A;  1WGR A;  5C6R A;  2K0P A;  3ABV B;  3BZD B;  4HAT B;  3W2D A;  3ZDT A;  2D2Q A;  1TXD A;  1RAX A;  3DWM A;  2ZNV C;  1UNS A;  1X05 A;  1GGO A;  2IYB A;  3LXF A;  3VUY A;  2L8J A;  2IJ0 A;  4GGQ A;  4WVF B;  3ALB A;  1K51 A;  2CU1 A;  3VRA B;  1F2R I;  5AUI A;  1FGY A;  3ZLZ A;  3SD5 A;  1SE2 A;  4TSS A;  4F1S A;  2X18 A;  4G0N B;  3VFK A;  2D9V A;  2LVO A;  2N9P C;  2D07 B;  2MCN B;  3P2B A;  2CKH B;  2BYV E;  1U29 A;  5DIF B;  3FSS A;  2WXJ A;  2MRP A;  3PVW A;  2O2V B;  2AL6 A;  3RYT A;  3ZNI D;  1ET6 A;  1V97 A;  2KFJ A;  1UPR A;  4LNO A;  4ANU A;  4HSI A;  2IO3 B;  2PIA A;  2G35 A;  5JHH A;  2JZP A;  2DN6 A;  2M14 A;  2KZR A;  3NS8 A;  2P0D A;  5L95 C;  2DX5 B;  3T06 A;  4PS8 A;  3PS6 A;  3DVG X;  2BWF A;  2AYO B;  4HB2 B;  2I5F A;  2UZS A;  1I4H A;  2N7J A;  1DYQ A;  3OHM B;  4BKS D;  3AEA B;  3ZNH B;  3PEG A;  3NJT A;  1MIX A;  2LD9 A;  1EVH A;  1MKE A;  3IFW B;  4E74 A;  4H8S A;  1JWM D;  3M62 B;  4A9A A;  5CHF A;  2W2W A;  1FOE A;  2LOZ A;  1JQ4 A;  4G50 A;  3U7D A;  1XCG A;  5AZF A;  4PYZ A;  2LGS A;  1E90 A;  1XXG A;  1HB6 A;  2K2J A;  1R7S A;  2G9H D;  1E8X A;  3FM8 C;  1JRP A;  1TY2 A;  1WMH B;  4KIK A;  5JH5 C;  1FHO A;  2R61 A;  3SV1 A;  2QKM A;  1NU2 A;  3MFG A;  1C77 A;  2L76 A;  3IAS 1;  2YT0 A;  2JVC A;  2KIE A;  1I4Q A;  3DCX A;  2KDE B;  3SO6 A;  3AUL A;  3L17 A;  2KMA A;  2FCQ A;  2Y5B B;  4EKU A;  2L52 A;  1KOT A;  4GDL B;  1XLO A;  3AB5 A;  4MSQ B;  2CY4 A;  4JK8 A;  2V3P A;  4DQO C;  2DYO A;  2INN E;  1NTY A;  2Y3A A;  1OGW A;  3VTV A;  2RSU A;  1WWT A;  2RDB C;  2UVM A;  3T9L A;  3VVW B;  1X86 A;  1NVL A;  3X0W A;  3DHI C;  3I57 A;  4MH0 E;  3APD A;  2LHE A;  4G3X B;  2MBO A;  1F52 A;  4OVZ A;  1I7H A;  3EFU A;  3UF8 A;  3URY A;  2WXH A;  3IT4 B;  4MH8 A;  1R4N I;  2VSZ A;  3KZ1 A;  2VH2 A;  2MFQ A;  3IVF A;  3PPA A;  2K8H A;  3WAP A;  4QJ4 B;  1FNU A;  1Q1O A;  1HZ6 A;  2DIK A;  3NVW A;  3W9C B;  4ARC A;  4HAW B;  2AQ3 B;  3DBH B;  4MSM B;  2CS4 A;  5KQ4 A;  3VH3 B;  3H1U A;  4CHJ A;  4NJ7 A;  4HVB A;  4JL9 A;  4HLE A;  4B0E A;  5BYQ A;  2FAZ A;  4US9 A;  3RCZ A;  1YN3 A;  3PGE A;  2NVU I;  3M63 B;  4LDT D;  3P1M A;  3PRM B;  3NWA A;  1N62 A;  3M3J A;  4S17 A;  2JZZ A;  3ZRF A;  4BKT A;  2WX1 A;  3Q3N C;  2L32 A;  3KUC B;  3ZKJ C;  4OVU A;  1GC7 A;  5DCN A;  1L2N A;  3PV1 A;  3IXS A;  3NZ3 A;  1OY2 A;  2IO1 B;  2DA0 A;  2P8V A;  2P0F A;  3FEH A;  2KJR A;  4WAF A;  4FXC A;  1EUV B;  1S1Q B;  5HKH A;  3NSU A;  2M8S A;  1UEF A;  5CLQ B;  4W9K A;  4WJN A;  4WJP A;  1E7V A;  4PYU A;  3EA6 A;  3NOB A;  1HBK A;  5M4Y B;  1TY0 A;  1QZE A;  4GOC A;  1SEB D;  4C7Z A;  2WXM A;  2LKO A;  2L7R A;  2M4N A;  3ZDM C;  1HXY D;  1XF5 L;  1KTK A;  2O6V A;  4B95 A;  1TBE A;  2N1W A;  1LM8 B;  1VJK A;  3GP7 A;  2KFK B;  5IOI A;  2H89 B;  4MT7 A;  4RMA A;  3VHT C;  1GB1 A;  4HAU B;  1FXA A;  3Q3J A;  2FUG 1;  3H7P B;  3P4R B;  4YXD B;  3V05 A;  1J0G A;  3A8Q A;  4X57 B;  4LNN A;  2Y5P A;  4W9F A;  2OTX A;  2LUE A;  5D7G A;  1DGJ A;  1LFD A;  2HJ8 A;  2HJ1 A;  1Q10 A;  4YTN B;  2K22 A;  1FO4 A;  1U5F A;  4J3O D;  4OZC A;  4KHB B;  4DX9 0;  4EOY A;  4JKE A;  2W3R A;  5C1Z A;  1TT5 B;  3Q69 A;  1P7E A;  4M8M A;  3P63 A;  2Y7B A;  3SBT A;  2DZJ A;  4GDK A;  3JVZ X;  4EMO A;  1CQV A;  4KAX B;  2VRR B;  3CST A;  4ZYN A;  5BYS A;  2DX1 A;  5KHO A;  4KKJ A;  4OHJ A;  1AN8 A;  3DQV A;  3HW2 B;  2DEN B;  1T6B X;  2FJL A;  1WY8 A;  1R4N B;  3TIX A;  1NTI A;  5I2S A;  1EGX A;  3BJI A;  2BB6 A;  4L1B A;  5J17 A;  1IPG A;  3J9C A;  2LOX A;  4MGK E;  5EE9 A;  3ZXR A;  3MC0 B;  3BYT B;  4KSK C;  3WAL A;  3AJ4 A;  1IUE A;  4E71 A;  4IDI A;  2C5L C;  2WYQ A;  3DOW A;  3NWD A;  2MKR A;  2OED A;  1WGK A;  1B9R A;  1KFY B;  2IO2 B;  2BCJ A;  5C5B B;  4WUR A;  2YEP B;  2Y8G A;  4YSX B;  2PJH A;  2JRI B;  2R82 A;  4YL8 A;  1EWC A;  1WXM A;  4A6K A;  1V89 A;  4K2P A;  1WRI A;  2V0G A;  3ULC A;  3HRD D;  5I4D A;  4MDK E;  3TW1 A;  1JWA D;  2V4L A;  3E56 A;  2J7Q B;  5HE3 A;  4M0W B;  3HVZ A;  5BMH A;  4XZ4 A;  1T0S C;  3BY4 B;  3V5W A;  1E7P B;  3CIK A;  3PRE A;  3ZW3 A;  1UNR A;  1N5X A;  4TKN A;  3IG3 A;  1SE9 A;  1BAK A;  1RM6 C;  1JRO A;  1WGU A;  2VH1 A;  4YT0 B;  2UWQ A;  4ZHO A;  4GOU A;  1N60 A;  1AAR A;  4AP4 C;  4M01 A;  1FXT B;  2EMT A;  3A98 B;  2JXX A;  2WQY B;  1FB8 A;  1EWY C;  2D3B A;  2IZV B;  1V49 A;  4WJ7 A;  3GE3 C;  1WJ6 A;  4RM8 A;  1ZOY B;  3I5J C;  3HM3 A;  4JKD A;  5HG2 A;  2N9L A;  2J0J A;  4M8N A;  2BW2 A;  1M7R A;  2IO0 B;  1OQQ A;  4JQW C;  2INC C;  2C7N B;  4KZC A;  2XN9 C;  1U27 A;  4W9C A;  3I9V 1;  1GC6 A;  4HAV B;  2WXG A;  5JHA A;  2MH7 A;  1R4M I;  1DOI A;  3O13 A;  1E0Z A;  3IHP C;  1P6S A;  3ML9 A;  4K3B A;  2ZKM X;  5IP4 D;  1GJZ A;  2V4I B;  4LNI A;  2GBK A;  2KN4 A;  2N9X A;  2OJW A;  4BZA A;  5J3T A;  1BTN A;  2BKF A;  4AJW A;  4GXB A;  1Z87 A;  5EE3 A;  3ZTC A;  2ZPN A;  1KJT A;  5D3V A;  2DYM A;  2KWV B;  3LB8 C;  5BYR A;  2NMB A;  3HIZ A;  2J4X A;  3UZT A;  5HE1 A;  2ROV A;  1MK9 B;  1UGM A;  1V1P A;  4MJS A;  1WJU A;  1WM2 A;  2B3A A;  3P4S B;  4FJY A;  1LQB A;  2V3N A;  1WFY A;  2HE7 A;  5I2M A;  4TMA B;  1GUA B;  4IG7 B;  1XEE A;  1WE7 A;  3Q8B A;  3I63 C;  1D4B A;  1HB8 A;  2Z8L A;  1T3Q A;  3DWG C;  3AM9 A;  1PLS A;  2MP2 B;  4BBK A;  3B0A A;  2DNF A;  2FID A;  2MEK A;  5DHA B;  1TKY A;  3KW5 B;  3SR6 A;  2YS5 A;  5JHG A;  4EFO A;  1ROE A;  1KH0 A;  4AS1 A;  2MDX A;  4CYE A;  3ZUN A;  1V1O A;  1DOY A;  4IOY X;  3ZQ4 A;  4KHB A;  4WWN A;  4BFR A;  3L4P A;  5LNK 1;  3HQC A;  2KO3 A;  4N9F 4;  4RF0 A;  2XQN M;  1N61 A;  4F7H A;  2ELB A;  2L1C A;  2GUM A;  2ZVN A;  2D4Q A;  3EUB 2;  4WWO A;  3R7Q A;  5KQ1 A;  2BBC A;  2BF8 B;  1V80 A;  2CJO A;  4C0A A;  4P1C C;  2Z14 A;  3PP2 A;  4LLG M;  1ZE3 D;  1M7E A;  3KVF B;  3HK0 A;  1N5W A;  2FNJ B;  5D2M B;  4ILG B;  1SJH D;  2K3U A;  2JYT A;  1YX5 B;  3UQB A;  4I6N B;  4JKB A;  4KIK B;  1IRS A;  1PFJ A;  2J59 M;  1K8R B;  2DLB A;  2PW9 A;  3RPF C;  1WYW B;  5JLJ B;  4TQ0 A;  5G55 A;  1P0R A;  3DVN U;  2N9K A;  1F2R C;  4XDC A;  4BBN C;  2Z0D B;  1NI3 A;  2PTL A;  1WH3 A;  3ECI A;  2FIF A;  2RPQ A;  3NVY A;  2ICI A;  3N3K B;  5CX3 A;  3R2I A;  2DZM A;  1SHC A;  1UBI A;  1TJ6 A;  4IC7 B;  4QJ3 B;  2ELA A;  2VZK D;  3CSF A;  2E2X A;  1HTQ A;  3O96 A;  1C1Y B;  4DHZ B;  4FA6 A;  1XR0 B;  2INP E;  4RCO A;  2V1Y A;  1ZXH A;  4OT1 A;  1YD8 U;  1UNQ A;  1WVH A;  2RRF A;  3W1S C;  4TYZ A;  4HEA 1;  4KVG B;  1YMH E;  2MJ3 A;  2GRI A;  4KSL C;  3AN1 A;  1R4M B;  3NVV A;  2NTS A;  2KVR A;  2CY5 A;  4WJO A;  5FR3 A;  1T0Q C;  1E6E B;  4OW0 A;  2DHZ A;  4F7U P;  1V5U A;  3KYC D;  1FNW A;  3VOQ A;  2YS1 A;  3RZW C;  2RQ1 A;  2DYB A;  3FKY A;  5TR5 A;  2M56 B;  3Q3M C;  4HCN B;  4P1B C;  4ZDV A;  4JIO U;  2KQ4 X;  2I1J A;  4WIP A;  3RUI B;  3TFM A;  3AE2 B;  4IWQ A;  2NPT B;  3WA0 A;  3T8M A;  3A8P A;  5J3Y A;  3A9K B;  1YQB A;  2W3S A;  3PLV A;  2EMS A;  1MFW A;  1OQR A;  3ZVR A;  4KKI A;  3MP9 A;  2WS3 B;  2AX5 A;  4WAA A;  3X23 A;  1PFD A;  2G45 B;  1MPE A;  3T3N A;  2D5G A;  1FCC C;  4HCP B;  3V6C B;  1EF1 A;  1VDV A;  2LRW A;  3RCP A;  3AEG B;  4ZRQ A;  4HPL B;  3DBH I;  4RM9 A;  3R66 C;  3E9L A;  1ZKH A;  2D3G A;  3ENB A;  4ZRI A;  2KNB A;  1TIF A;  1YNT E;  3L54 A;  4BKS A;  3UI3 A;  1H8C A;  2O6V B;  5J18 A;  3GYP A;  2DWQ A;  1FM0 D;  2DHI A;  1JCK B;  1E9M A;  5HI1 A;  4GZU A;  3HIE A;  2L83 A;  1KBL A;  4MAC A;  2LVQ A;  5BO4 B;  4W9I A;  4XGA B;  3QC8 B;  2DHJ A;  4W9E A;  3V6E B;  1PDX A;  3ODW A;  3RNA C;  1SE3 A;  4RGT A;  2KLG A;  5LXI B;  2MP2 A;  2VRW B;  1J7C A;  2KUP A;  3B77 A;  2KC2 A;  3VUX A;  3M95 A;  4LTU A;  1I7A A;  3ZNZ B;  1UF0 A;  3K9P B;  3NZU A;  2ROZ B;  3MJW A;  4CQN A;  2WU5 B;  1W1D A;  2M1M A;  4A6F A;  3PSC A;  1CJE A;  2I1K A;  4WH4 A;  1D5Z C;  4GDK B;  2OHF A;  2RGF A;  4A3O A;  2YSZ A;  2V3S A;  4FAD A;  3HM6 X;  1EM7 A;  3Q8A A;  4DBG A;  5HE0 A;  3VR9 B;  1XQQ A;  1QF6 A;  4IAP A;  1KI1 B;  3C0R B;  4BOS C;  4LCD E;  1ZSQ A;  4CHM A;  1K5G B;  2KLC A;  2MSE D;  1AQC A;  2FCM A;  1P5T A;  2BYT A;  1ZPS A;  2KJ6 A;  2N7E A;  1WX8 A;  4MM3 A;  5TSS A;  5KHQ A;  2VKI A;  4YON A;  2WDT B;  3WCQ A;  3MHS D;  4NQL B;  4DDI D;  2COF A;  4XWT A;  4USA A;  3NVZ A;  2J42 A;  2IND C;  3U2S C;  4K2O A;  3P4P B;  2GI9 A;  1C9F A;  2UZR A;  2JPH A;  1J8C A;  1U5G A;  3L0W B;  3AV8 A;  4RFB A;  3V62 A;  2CHW A;  1ACA A;  2WU2 B;  3W5V B;  4HAY B;  1UBQ A;  2NMQ A;  2LGI A;  3LJ3 A;  4JK9 A;  3K9O B;  3WYF B;  1IBX A;  2LG1 A;  3D8E A;  5BMI A;  1E7U A;  1FAO A;  2V9H A;  4JK7 A;  1K5D B;  1ST7 A;  1JWU D;  2EEL A;  2IPK D;  4MK0 A;  1RFK A;  2HTM E;  2ZCB A;  2BB5 A;  2GBJ A;  4DHJ D;  4KDI C;  3LDZ E;  3DDC B;  1AW7 A;  3KUD B;  1TQZ A;  1YN5 A;  4A20 A;  4DHZ E;  3NUH B;  2BTE A;  1VRA B;  3PTF C;  1PMS A;  3R8B A;  2L0F A;  4DWF A;  4TUU A;  2IY0 B;  3ZVV A;  2RD0 A;  1K53 A;  2RUK B;  5IRS A;  4ILJ A;  4L2Y A;  4GNK B;  3A58 A;  5DPR A;  3CIR B;  3U4E G;  3TL5 A;  2K2U A;  3EC8 A;  3D8D A;  2ZZP B;  3CWI A;  2W54 A;  5D27 A;  5E6N A;  2NPT A;  2HTH A;  2WLB A;  4MGY E;  5E6O A;  1FRD A;  1B1Z A;  3A9K A;  4A3P A;  2E6X A;  3QAQ A;  1VR9 A;  3VAW A;  2KC1 A;  3B08 A;  2COP A;  1C76 A;  3SNH A;  3AE1 B;  1AYF A;  1JW9 D;  1L5P A;  3U30 A;  4GN1 A;  2H88 B;  2I38 A;  3U12 A;  3T3O A;  1WYG A;  5GXG B;  3PO0 A;  1XD4 A;  3SDL C;  3GOE A;  4ZHP A;  2WXP A;  2IDY A;  2N0S B;  4W9D A;  1WR1 A;  3QBV B;  4ZRK A;  3TO1 A;  4DDG D;  3PT2 B;  3W1Y A;  2IGG A;  3H6N A;  4KHO A;  2N23 A;  4MY6 A;  3ONS A;  2LHD A;  4K81 A;  2R2Q A;  4DXA B;  1V2Y A;  1F9J A;  1V1P B;  2ONQ A;  1JDE A;  4MJS B;  3WIM A;  4P16 A;  2GJY A;  1BTK A;  3E66 A;  2R09 A;  2M0X A;  2RVB B;  2W82 A;  3DVG Y;  3DBR I;  1XO3 A;  2M17 A;  3R7R A;  2DKQ A;  1WE6 A;  1U4A A;  2NR2 A;  3A4S C;  1L4D B;  2ZVO A;  2LI5 A;  1FD6 A;  3KRW A;  4HPP A;  2YLM A;  2A4Z A;  3B2F A;  2COD A;  2HRJ A;  3AE6 B;  3SHQ A;  1L0X B;  1BXT A;  4JE3 B;  3SBG A;  2OQB A;  3EFC A;  3O65 B;  1XCT L;  2KQS A;  2KJH B;  4NQK E;  2GBN A;  2PMV A;  2ON8 A;  2FE8 A;  2WGS A;  2JUO A;  4LNF A;  1ISN A;  2KDB A;  4MEL A;  3BVZ A;  1VZ6 A;  4N6E B;  2MBQ A;  2MWN B;  3ZNG C;  5D3D A;  1J7A A;  5IN7 A;  3IBE A;  1V5O A;  2W55 A;  2K5P A;  2K25 A;  2QKL A;  1WXA A;  3KUZ A;  5HE2 A;  4HKZ E;  3RNB C;  2KN5 A;  1NEK B;  3LYY A;  3ZO5 B;  3TEY A;  4HHV A;  1HTO A;  5D3I B;  3QWM A;  3FIL A;  4AQ7 A;  1PGA A;  3PZ7 A;  1VCB A;  1M4V A;  1WGH A;  1T5X D;  4BKG A;  2KTF A;  4JWU C;  2QSD A;  1P98 A;  2J52 A;  4A8X C;  3E9O A;  2L05 A;  3OLM D;  1OQN A;  4HJK A;  1FPY A;  3UIO B;  1JWS D;  2KCJ A;  3ZRC A;  1ET9 A;  1RJ2 A;  2DAJ A;  3ODX A;  3MHZ A;  2N9E B;  2JP2 A;  2FUH B;  1TZO A;  3ULB A;  5J3Q A;  4JKH A;  4N59 A;  1FEH A;  2QIE B;  2DYN A;  2QEJ C;  1XCQ L;  4L6E A;  5C2T B;  2LBB A;  1BWN A;  4PQ0 A;  1WX9 A;  3PSE B;  1ACC A;  2CQU A;  3BII D;  1QIL A;  2R2Y A;  2EKI A;  1X1G A;  4B0M A;  4QJ5 B;  3ZJV A;  2PVO D;  3NG0 A;  1ENF A;  3KWV A;  1KLV A;  3AI5 A;  3SFD B;  2LAS A;  2MBE A;  2EC1 A;  1P3R A;  3N9Y C;  4D6W A;  1TYG B;  2M0A A;  2PVG C;  4NAW A;  5T8I A;  2QC8 A;  2XK5 A;  1EF5 A;  1E8Y A;  2K8E A;  4G11 A;  1SSN A;  2FJU B;  4MGI E;  4OVV A;  2KOX A;  4YSY B;  3G9W A;  2LYD A;  3NY5 A;  1UEL A;  2BT6 A;  4WQO B;  1T77 A;  1YIW A;  1WGQ A;  3DBR B;  3TUO A;  4URK A;  3Q2A C;  1LW3 A;  1NYR A;  1DBH A;  1V5T A;  3OAN A;  2RDH A;  3HSA A;  3QX1 A;  4ACF A;  5MPO A;  2YT2 A;  1CK1 A;  1NEN B;  1PGB A;  2KAN A;  5D3Y A;  1UD7 A;  3TJP A;  2M19 A;  4D2K A;  3L16 A;  1K50 A;  4S0R A;  1EO6 A;  2B76 B;  2ZCC A;  4ASW C;  3RT3 B;  4DXF A;  1HZ5 A;  1YQ4 B;  1UZX B;  1V86 A;  4JPS A;  2IFS A;  2LRU A;  4F7Z A;  4XYC A;  4IWP A;  3ZGZ A;  3FLV A;  2N0Y A;  2KYW A;  1QC6 A;  5IKC M;  2BYF A;  3QIJ A;  2LFI A;  5LOP B;  3PG7 A;  5C79 A;  4RGM A;  2J0M A;  3PZD A;  2ADZ A;  3KRX A;  2K6Q A;  4NZL B;  4QAY A;  3TEW A;  1X11 A;  4A55 A;  4WWP A;  1SGH A;  2KMM A;  3E9P A;  3QA8 A;  1TGZ B;  1P9D U;  3AEB B;  3OJ4 B;  1KM7 A;  1SE4 A;  2FCS A;  1WGG A;  1B55 A;  4GSW A;  4W9H A;  3OWE B;  1XKE A;  3E9S A;  2D9Y A;  4HB0 B;  2IGD A;  3DCG A;  4FJV B; 
#chains in the Genus database with same CATH homology
 2C7M B;  4PS3 A;  4W9J A;  2JRH A;  4WJQ A;  4GB9 A;  4JLC A;  2CHX A;  2CRF A;  4A6F B;  3KY9 A;  2AL3 A;  2MW5 A;  2N4F A;  2DTC A;  1VBG A;  1Y5O A;  1KZ7 A;  1H10 A;  4MEM A;  4EZK A;  5LON B;  4JKA A;  3A9J B;  2MBB B;  4K7W A;  4GIV A;  3A1Q B;  2LVP A;  4B6W A;  2DAF A;  5EDS A;  4TV3 A;  5J2R A;  1P3Q U;  1WIA A;  2Z59 B;  3QWZ B;  1WI1 A;  3A33 B;  4K7U A;  4NJ6 A;  3LJU X;  2UYZ B;  1P1A A;  4K17 A;  2LXA A;  1VBH A;  2COC A;  4HDQ A;  2PE6 B;  5IA7 A;  5JZE B;  4XWX A;  1C3T A;  4Z2M B;  4HAZ B;  3NZS A;  1WXV A;  3D8F A;  4KDL B;  4LDT B;  1V5M A;  1I2H A;  4IM2 A;  4BOZ B;  5GMV A;  1ZW7 A;  2KXJ A;  3RZF A;  1KC7 A;  2DFK A;  2OJR A;  3SUZ A;  2W2X C;  3N7C A;  4JKC A;  3OAW A;  4ANW A;  4JGH B;  2HTH B;  2LJ5 A;  3APC A;  1MK7 B;  4A6H A;  2KKC A;  1FHX A;  1WGY A;  1N3H A;  2OOB B;  2PE9 A;  2YRY A;  2ZEQ A;  2WX0 A;  5LLI A;  3JYU A;  3L10 B;  4F7G A;  4HDO A;  2LUL A;  3KH0 A;  4NPN A;  1M94 A;  2LGD A;  5CTR C;  5FR6 A;  2N1V A;  1TTN A;  2LWP A;  2MWS B;  1V5P A;  3H7S A;  1GNU A;  5CLL B;  1U2B A;  4GMX B;  5LXH A;  1WZ0 A;  1D3Z A;  5IJM A;  2KMC A;  1LB1 A;  3JSV A;  4Y94 A;  4DX8 A;  1A5R A;  1H4R A;  1V9J A;  2ZJD A;  2MLB A;  5AZG A;  5L81 A;  3ML8 A;  4IWO A;  2COA A;  2KTR A;  4FBJ B;  2H7D A;  4K7S A;  1MPH A;  4ICU A;  1FGZ A;  3VDZ A;  4E3C A;  2JF5 A;  3NHE B;  3PHX B;  1WJ1 A;  3SYX A;  2PEA A;  2JWZ A;  1RLF A;  5C16 A;  2KWC A;  3ZIM A;  3A9J A;  3A1Q A;  2DHK A;  4ICV A;  3MDB C;  2P0H A;  2RGN B;  4XX5 A;  2EKE C;  2X0S A;  1LXD A;  1DRO A;  2L0T A;  4AJY B;  4GU2 A;  4FHK A;  3DBL I;  1E8W A;  1DYN A;  2BPS A;  5DPS A;  1PQS A;  2Z0Q A;  2G4D B;  3RD2 A;  3EEC A;  1Q67 A;  1V6E A;  2D9X A;  1BT0 A;  5AEK B;  2REX A;  1YX6 B;  4ANX A;  2BYE A;  3ODO A;  1ZGU B;  4EEW A;  2GCJ A;  5JVL A;  1E8Z A;  1JRU A;  2M38 A;  4IFS A;  4FN2 A;  4IUM B;  3QJZ A;  1OEY J;  4EUT A;  4NSW A;  2Y8F A;  2RSG A;  2YT1 A;  3OJ3 A;  2G3Q B;  2BWE S;  2NBV B;  2V76 A;  2NBW B;  4MGZ E;  2H7E A;  3L08 A;  3M1I B;  1IYF A;  4CO7 A;  4NAW B;  2XK5 B;  3N32 A;  5DHF B;  3D32 A;  3TCA A;  3GYO A;  4HB3 B;  4NNJ B;  3GZN I;  1WJ4 A;  3DBS A;  3RUL A;  2NS5 A;  2DYQ A;  3EPY A;  1RFA A;  2D9W A;  1I35 A;  2WWZ A;  2KWU B;  3VTW A;  2CHZ A;  1U5E A;  1OMW A;  3UIP B;  4EJN A;  1OQY A;  3H9D A;  5G2N A;  4Z2N A;  3APF A;  1WJM A;  1MAI A;  3TVV A;  1IP9 A;  3ZTD A;  4ILH A;  4TQ1 A;  2LZ6 A;  5KCV A;  4XC2 A;  1WR6 E;  5D3X A;  2XBB C;  1WGD A;  2XEW A;  2L00 B;  3DXD A;  2LGX A;  2DZI A;  4FHJ A;  1J19 A;  2MBH A;  2MQJ A;  2KK8 A;  4EZL A;  3WAN A;  1GG3 A;  2DLW A;  3QHT A;  4I6P A;  2K39 A;  2RNR B;  4F8C B;  2YS3 A;  4PS7 A;  4FJZ A;  1OTR B;  2LGY A;  4KV2 A;  1J0W A;  5IAA C;  2O2V A;  1AWE A;  3QCA A;  4KHA A;  2K8B A;  2KDF B;  2FCN A;  3DVN V;  4II3 B;  5DPW A;  1Y19 B;  2C9W B;  2DKP A;  1X1M A;  3UGB B;  2DX5 A;  3P6A A;  3A4R A;  2YF0 A;  2BGF A;  1Q0W B;  2ASQ A;  1HE8 A;  5DH9 B;  5GOW B;  1I42 A;  3WAO A;  2GS0 A;  1W1G A;  3JW0 X;  2O6V D;  4EZJ A;  1UPQ A;  2I5C A;  2AWT A;  3AU4 A;  3V60 A;  3VXW A;  3B1L X;  2ZNV B;  5C23 A;  1UH6 A;  1MIZ B;  3FP5 A;  3QAR A;  2GOW A;  1E5W A;  1WMH A;  4IW0 A;  5AZH A;  3ML4 A;  2KD0 A;  2IYD B;  5D94 A;  3VQI A;  4LJO B;  3SU8 X;  3BIN A;  3MTN B;  1NTV A;  2KX3 A;  2D10 A;  1EAZ A;  4I6L B;  4B6H A;  4AUQ C;  2MA9 B;  3CXB B;  5CHW A;  4J6I A;  3PLU A;  2G4S A;  2NBU A;  3F0W A;  5CHV C;  4AOF A;  2Z0E B;  4GDL A;  1QQG A;  4DBB A;  3N30 A;  1DDM A;  4HK2 A;  4CHK A;  3PHW B;  4JKG B;  1W1H A;  1Z5S B;  2L3Z A;  1NI2 A;  1XD3 B;  3PRZ A;  4JKF A;  3VTU A;  5EFX A;  4GPT B;  4W9G A;  1U5D A;  1SIF A;  3EHV A;  1WM3 A;  4ANV A;  2GBR A;  1RRB A;  4P7I A;  3TMP B;  1ZC4 B;  1NDD A;  3AU5 A;  2WH5 A;  5D3W A;  3VH4 B;  2EJ8 A;  3R3M A;  1WX7 A;  3KSY A;  3HHM A;  5D6J B;  3UQA A;  2D11 A;  2GBM A;  3L13 A;  1WRD B;  1T0Y A;  2RR9 A;  4PNK A;  2YVC A;  2N7D A;  5L83 A;  3VUW A;  2NCN A;  2HD5 B;  3PVL A;  5DI9 B;  3W1S A;  2FJ9 A;  2KHW B;  2PPH A;  3JSV B;  4FLH A;  5DPT A;  2MX2 A;  1Q5W B;  3DXE A;  1V81 A;  3AXC A;  1DIK A;  2K8C A;  4W9L A;  4DK5 A;  4HAX B;  1L7Y A;  3F5R A;  2KTR B;  1X1F A;  2KFK A;  2J0K A;  4AWJ A;  1Y8R C;  1G6J A;  3CF6 E;  1NBF C;  4KZ0 A;  1XOD A;  5JHB A;  1XX0 A;  4BBN F;  2D9Z A;  2NZ8 B;  3DPD A;  3H7P A;  2RLO A;  4IM0 A;  4IM3 A;  2KX0 A;  4GMV A;  2C60 A;  1YJ1 A;  3QK0 A;  5E6P A;  3CMM B;  1CMX B;  1WF9 A;  3WAM A;  1V61 A;  4WSF A;  2W9N A;  4FUL A;  2JT4 B;  3QQ8 B;  1ZM0 A;  3Q3F A;  4DHJ B;  2Z0P A;  2L2I A;  3V61 A;  2FDQ A;  2C7H A;  1UNP A;  1KZG A;  3I3T B;  4K1R B;  2W2X D;  2CAY A;  1VD2 A;  1WJN A;  4LJP B;  1WZ3 A;  4HB4 B;  1WXS A;  2CB8 A;  2PZ1 A;  2ABD A;  2AEH A;  4HPM B;  2KGX B;  2K1F A;  3PRP B;  1FHW A;  5FI1 A;  1ZVR A;  1RRP B;  2KQ7 A;  4NY0 A;  2R0D A;  2JY6 A;  5C5B A;  3DXC A;  2GCL A;  2DZK A;  2A5U A;  4HWI B;  4JKG A;  2GMI C;  3ENE A;  4HXD A;  2QHO A;  1Z2M A;  1V88 A;  1TZ1 A;  2BKR B;  2IBI B;  1MG8 A;  3TBL D;  3KYD D;  4B9K A;  3VIA A;  2CR5 A;  2ZPY A;  5FI0 A;  4D0N B;  2JZ3 B;  1OEY A;  1DDW A;  3S2A A;  4II2 B;  4ZRJ A;  1ZC3 B;  2Z0O A;  2LXC A;  2KDI A;  2K6D B;  1S3S G;  1XT9 B;  3PVU A;  4BVU C;  2K00 A;  2Q13 A;  3P7Z A;  3UIN B;  4A5K A;  2R2O A;  3MPX A;  5JP4 A;  3U8Z A;  1WG7 A;  1WI0 A;  2IY1 B;  1DDV A;  1WGR A;  5C6R A;  4HAT B;  3ZDT A;  2D2Q A;  1TXD A;  1RAX A;  2ZNV C;  1X05 A;  1GGO A;  2IYB A;  3VUY A;  2L8J A;  4GGQ A;  4WVF B;  3ALB A;  2CU1 A;  3ZLZ A;  1FGY A;  3SD5 A;  4F1S A;  2X18 A;  4G0N B;  3VFK A;  2D9V A;  2LVO A;  2N9P C;  2D07 B;  2MCN B;  3P2B A;  2CKH B;  2BYV E;  1U29 A;  5DIF B;  3FSS A;  2MRP A;  3PVW A;  2O2V B;  2AL6 A;  3RYT A;  3ZNI D;  2KFJ A;  1UPR A;  4ANU A;  2IO3 B;  2G35 A;  5JHH A;  2DN6 A;  2M14 A;  2KZR A;  3NS8 A;  2P0D A;  5L95 C;  2DX5 B;  3T06 A;  4PS8 A;  3PS6 A;  3DVG X;  2BWF A;  2AYO B;  4HB2 B;  2I5F A;  2UZS A;  4BKS D;  3ZNH B;  3PEG A;  1MIX A;  2LD9 A;  1EVH A;  1MKE A;  3IFW B;  4E74 A;  4H8S A;  3M62 B;  5CHF A;  2W2W A;  1FOE A;  2LOZ A;  4G50 A;  3U7D A;  1XCG A;  5AZF A;  4PYZ A;  1E90 A;  1HB6 A;  2K2J A;  1E8X A;  3FM8 C;  1WMH B;  4KIK A;  5JH5 C;  1FHO A;  3SV1 A;  2QKM A;  1NU2 A;  2L76 A;  2YT0 A;  2JVC A;  3AUL A;  2KDE B;  3SO6 A;  3L17 A;  2KMA A;  2FCQ A;  2Y5B B;  4EKU A;  1KOT A;  4GDL B;  4MSQ B;  2CY4 A;  4JK8 A;  2DYO A;  1NTY A;  1OGW A;  3VTV A;  2RSU A;  2UVM A;  3T9L A;  3VVW B;  1X86 A;  1NVL A;  3X0W A;  4MH0 E;  3APD A;  4G3X B;  2MBO A;  3EFU A;  3UF8 A;  1R4N I;  2VSZ A;  3KZ1 A;  2MFQ A;  3IVF A;  3PPA A;  2K8H A;  3WAP A;  1Q1O A;  2DIK A;  4HAW B;  4MSM B;  2CS4 A;  5KQ4 A;  3VH3 B;  3H1U A;  4CHJ A;  4NJ7 A;  4HVB A;  4JL9 A;  4HLE A;  2FAZ A;  3RCZ A;  3PGE A;  2NVU I;  3M63 B;  4LDT D;  3PRM B;  3M3J A;  2JZZ A;  3ZRF A;  4BKT A;  2WX1 A;  3KUC B;  3ZKJ C;  4OVU A;  1GC7 A;  5DCN A;  1L2N A;  3PV1 A;  1OY2 A;  2IO1 B;  2DA0 A;  2P8V A;  2P0F A;  3FEH A;  2KJR A;  1EUV B;  1S1Q B;  5HKH A;  3NSU A;  2M8S A;  1UEF A;  5CLQ B;  4W9K A;  4WJN A;  4WJP A;  1E7V A;  4PYU A;  3NOB A;  1HBK A;  4GOC A;  1QZE A;  2LKO A;  2L7R A;  2M4N A;  3ZDM C;  4B95 A;  2O6V A;  1TBE A;  2N1W A;  1LM8 B;  2KFK B;  4MT7 A;  4RMA A;  3VHT C;  4HAU B;  3Q3J A;  3H7P B;  1J0G A;  3A8Q A;  4X57 B;  2OTX A;  2LUE A;  5D7G A;  1LFD A;  2HJ8 A;  1U5F A;  4KHB B;  4DX9 0;  4EOY A;  4JKE A;  5C1Z A;  4M8M A;  2Y7B A;  3SBT A;  2DZJ A;  4GDK A;  3JVZ X;  4EMO A;  4KAX B;  2VRR B;  3CST A;  4ZYN A;  2DX1 A;  5KHO A;  3DQV A;  3HW2 B;  2DEN B;  2FJL A;  1WY8 A;  3TIX A;  1NTI A;  5J17 A;  1EGX A;  3BJI A;  1IPG A;  2LOX A;  4MGK E;  4KSK C;  3WAL A;  3AJ4 A;  4E71 A;  2C5L C;  2WYQ A;  3DOW A;  2MKR A;  2IO2 B;  2BCJ A;  5C5B B;  2Y8G A;  2PJH A;  2JRI B;  2R82 A;  4YL8 A;  1WXM A;  4A6K A;  1V89 A;  4K2P A;  3ULC A;  4MDK E;  3TW1 A;  2V4L A;  2J7Q B;  5HE3 A;  4M0W B;  4XZ4 A;  3BY4 B;  3V5W A;  3CIK A;  3PRE A;  3ZW3 A;  1UNR A;  4TKN A;  3IG3 A;  1SE9 A;  1BAK A;  1WGU A;  2UWQ A;  1AAR A;  4AP4 C;  1FXT B;  2EMT A;  3A98 B;  2JXX A;  1FB8 A;  2IZV B;  1V49 A;  4WJ7 A;  1WJ6 A;  4RM8 A;  3HM3 A;  4JKD A;  4M8N A;  2J0J A;  1M7R A;  2IO0 B;  4JQW C;  2C7N B;  4KZC A;  1U27 A;  4W9C A;  1GC6 A;  4HAV B;  5JHA A;  1R4M I;  1GJZ A;  3IHP C;  1P6S A;  3ML9 A;  2GBK A;  2N9X A;  5J3T A;  1BTN A;  2BKF A;  4AJW A;  4GXB A;  1Z87 A;  3ZTC A;  2ZPN A;  1KJT A;  5D3V A;  2DYM A;  2KWV B;  2NMB A;  3HIZ A;  3UZT A;  5HE1 A;  2ROV A;  1MK9 B;  1UGM A;  4MJS A;  1WJU A;  1WM2 A;  2B3A A;  4FJY A;  1LQB A;  1WFY A;  2HE7 A;  1GUA B;  4IG7 B;  1WE7 A;  1HB8 A;  1PLS A;  2MP2 B;  4BBK A;  3B0A A;  2FID A;  5DHA B;  3KW5 B;  2YS5 A;  5JHG A;  4EFO A;  2MDX A;  4CYE A;  3ZUN A;  4IOY X;  4WWN A;  4BFR A;  3HQC A;  2KO3 A;  4N9F 4;  2XQN M;  4F7H A;  2ELB A;  2L1C A;  2ZVN A;  2D4Q A;  4WWO A;  3R7Q A;  5KQ1 A;  2BF8 B;  1V80 A;  4C0A A;  3PP2 A;  1M7E A;  3KVF B;  3HK0 A;  2FNJ B;  5D2M B;  4ILG B;  1YX5 B;  3UQB A;  4I6N B;  4JKB A;  4KIK B;  1IRS A;  1PFJ A;  2J59 M;  1K8R B;  1WYW B;  5JLJ B;  4TQ0 A;  5G55 A;  1P0R A;  3DVN U;  4BBN C;  2Z0D B;  1WH3 A;  3ECI A;  2FIF A;  2RPQ A;  3N3K B;  5CX3 A;  2DZM A;  1SHC A;  1UBI A;  1TJ6 A;  4IC7 B;  2ELA A;  3CSF A;  2E2X A;  3O96 A;  1C1Y B;  4DHZ B;  4FA6 A;  1XR0 B;  2V1Y A;  1YD8 U;  1UNQ A;  1WVH A;  3W1S C;  4TYZ A;  4KVG B;  4KSL C;  2KVR A;  2CY5 A;  4WJO A;  2DHZ A;  4F7U P;  1V5U A;  3KYC D;  3VOQ A;  2YS1 A;  3RZW C;  2RQ1 A;  2DYB A;  5TR5 A;  4HCN B;  4ZDV A;  4JIO U;  2I1J A;  3RUI B;  3TFM A;  4IWQ A;  2NPT B;  3WA0 A;  3T8M A;  3A8P A;  5J3Y A;  3A9K B;  1YQB A;  3PLV A;  2EMS A;  3ZVR A;  4WAA A;  3X23 A;  2G45 B;  4HCP B;  3V6C B;  1EF1 A;  2LRW A;  3RCP A;  4HPL B;  3DBH I;  4RM9 A;  3R66 C;  3E9L A;  1ZKH A;  2D3G A;  3ENB A;  4ZRI A;  2KNB A;  3L54 A;  4BKS A;  1H8C A;  2O6V B;  5J18 A;  3GYP A;  2DHI A;  4GZU A;  1KBL A;  2LVQ A;  5BO4 B;  4W9I A;  3QC8 B;  2DHJ A;  4W9E A;  3V6E B;  3ODW A;  2KLG A;  5LXI B;  2MP2 A;  2VRW B;  2KUP A;  2KC2 A;  3VUX A;  3M95 A;  1I7A A;  3ZNZ B;  3K9P B;  3NZU A;  2ROZ B;  3MJW A;  1W1D A;  2M1M A;  4A6F A;  3PSC A;  2I1K A;  4GDK B;  4A3O A;  2RGF A;  2YSZ A;  2V3S A;  4FAD A;  3HM6 X;  4DBG A;  5HE0 A;  1XQQ A;  4IAP A;  1KI1 B;  3C0R B;  4BOS C;  4LCD E;  1ZSQ A;  4CHM A;  1K5G B;  2KLC A;  2MSE D;  1AQC A;  2FCM A;  1P5T A;  2KJ6 A;  2N7E A;  1WX8 A;  4MM3 A;  5KHQ A;  2VKI A;  4YON A;  2WDT B;  3MHS D;  4NQL B;  4DDI D;  2COF A;  4K2O A;  2UZR A;  2JPH A;  1J8C A;  1U5G A;  3L0W B;  3V62 A;  2CHW A;  1ACA A;  4HAY B;  1UBQ A;  3LJ3 A;  4JK9 A;  3K9O B;  3WYF B;  2LG1 A;  3D8E A;  1E7U A;  1FAO A;  4JK7 A;  1K5D B;  1ST7 A;  4MK0 A;  2ZCB A;  2GBJ A;  4DHJ D;  4KDI C;  3LDZ E;  3DDC B;  3KUD B;  1TQZ A;  4A20 A;  4DHZ E;  3PTF C;  1PMS A;  2L0F A;  4DWF A;  4TUU A;  3DCG A;  2IY0 B;  3ZVV A;  2RD0 A;  2RUK B;  4ILJ A;  5DPR A;  3TL5 A;  2K2U A;  3EC8 A;  3D8D A;  2ZZP B;  5D27 A;  5E6N A;  2NPT A;  2HTH A;  4MGY E;  5E6O A;  3A9K A;  4A3P A;  3QAQ A;  3VAW A;  2KC1 A;  3B08 A;  2COP A;  3SNH A;  3U30 A;  4GN1 A;  1XD4 A;  3SDL C;  3GOE A;  4W9D A;  1WR1 A;  3QBV B;  4ZRK A;  3TO1 A;  4DDG D;  3PT2 B;  3W1Y A;  3H6N A;  4KHO A;  2N23 A;  4MY6 A;  3ONS A;  4K81 A;  2R2Q A;  4DXA B;  1V2Y A;  1F9J A;  4MJS B;  1JDE A;  3WIM A;  2GJY A;  1BTK A;  3E66 A;  2R09 A;  2M0X A;  2RVB B;  3DVG Y;  3DBR I;  2M17 A;  3R7R A;  2DKQ A;  1WE6 A;  1U4A A;  2NR2 A;  3A4S C;  2ZVO A;  2LI5 A;  3KRW A;  2YLM A;  2A4Z A;  2COD A;  2HRJ A;  3SHQ A;  3SBG A;  2OQB A;  3O65 B;  2KQS A;  2KJH B;  4NQK E;  2GBN A;  2JUO A;  1ISN A;  2KDB A;  4MEL A;  2MBQ A;  2MWN B;  3ZNG C;  3IBE A;  1V5O A;  2QKL A;  2K25 A;  1WXA A;  3KUZ A;  5HE2 A;  2KN5 A;  3ZO5 B;  4HHV A;  3QWM A;  1VCB A;  1WGH A;  4BKG A;  2KTF A;  1P98 A;  3E9O A;  2L05 A;  3OLM D;  1OQN A;  4HJK A;  3UIO B;  2KCJ A;  3ZRC A;  1RJ2 A;  2DAJ A;  3ODX A;  2N9E B;  2JP2 A;  2FUH B;  3ULB A;  5J3Q A;  4JKH A;  2DYN A;  4L6E A;  2LBB A;  1BWN A;  4PQ0 A;  1WX9 A;  3PSE B;  2CQU A;  1X1G A;  1KLV A;  3AI5 A;  2LAS A;  2MBE A;  2EC1 A;  1P3R A;  4NAW A;  2XK5 A;  1EF5 A;  1E8Y A;  4G11 A;  4MGI E;  4OVV A;  2KOX A;  3G9W A;  2LYD A;  3NY5 A;  1UEL A;  4WQO B;  1YIW A;  1WGQ A;  4URK A;  1LW3 A;  1DBH A;  1V5T A;  3OAN A;  3QX1 A;  2KAN A;  5D3Y A;  1UD7 A;  3TJP A;  3L16 A;  1EO6 A;  2ZCC A;  4ASW C;  3RT3 B;  1UZX B;  1V86 A;  2IFS A;  2LRU A;  4F7Z A;  4IWP A;  3FLV A;  2N0Y A;  1QC6 A;  2BYF A;  3QIJ A;  5LOP B;  3PG7 A;  5C79 A;  2J0M A;  3PZD A;  2ADZ A;  3KRX A;  2K6Q A;  1X11 A;  4WWP A;  1SGH A;  3E9P A;  3QA8 A;  1TGZ B;  1P9D U;  3OJ4 B;  1KM7 A;  2FCS A;  1WGG A;  1B55 A;  4GSW A;  4W9H A;  1XKE A;  2D9Y A;  4HB0 B;  4W9F A;  4FJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...