1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
b'MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
4GMVA 1DDWA 4XWXA 2N4FA 1V5MA 4NQKE 3UQAA 4K2OA 4E74A 2K6QA 1Y19B 1L7YA 5JHAA 2NZ8B 1Z87A 3DOWA 3HHMA 3JSVB 4NAWA 3M3JA 4BFRA 2KD0A 4ASWC 4F8CB 5J3YA 3WANA 1FHXA 3TO1A 2GBRA 5LLIA 2IO1B 2CB8A 4DHZE 2C9WB 3UINB 2RGFA 2L1CA 1RAXA 3H9DA 2ZCCA 1OEYJ 3ZNGC 2LJ5A 3RCZA 4W9DA 2PPHA 4MJSB 3LJUX 1WJMA 2KZRA 1G6JA 3U7DA 2BYFA 3U30A 3TCAA 3CSFA 3H1UA 2M1MA 2ROVA 2DHZA 5CHFA 3V61A 4JL9A 2LWPA 3NY5A 4DX90 2K00A 4YONA 4PS7A 1E8WA 1Y8RC 2FAZA 2N0YA 4KV2A 3BINA 3QAQA 2V4LA 2G35A 4ICUA 5IAAC 5D27A 1XD4A 3SHQA 1LB1A 4W9LA 5C5BB 3V6CB 5AEKB 5EFXA 1EO6A 2MDXA 2D11A 1VCBA 2CRFA 3N7CA 2DHKA 2Q13A 2CHZA 3AU4A 1H4RA 3U8ZA 4GMXB 2HD5B 1UGMA 2MRPA 2LXAA 1C3TA 4EZKA 5IA7A 1GUAB 2LVOA 4BBNF 2ZNVC 2RPQA 2Y5BB 5DHAB 1FGYA 3R66C 1HB8A 2UWQA 3JVZX 4CHJA 3PG7A 1FHOA 4GGQA 3ULBA 4IOYX 1B55A 2N7DA 2J0KA 1SIFA 1YJ1A 3VH3B 4CO7A 4LJOB 2RQ1A 5JZEB 3QHTA 3OLMD 2CAYA 3KH0A 1M7EA 4BVUC 1KOTA 1Q1OA 1KI1B 1XCGA 1RLFA 2HRJA 1LXDA 4IW0A 3ZVRA 3FLVA 3NS8A 1TGZB 2BCJA 4CHMA 3V60A 4G3XB 4JGHB 3A98B 2KLCA 3HQCA 4HAZB 3HM3A 4ZRJA 1WX8A 1I2HA 3R7RA 4B6WA 3ZW3A 2K25A 1FAOA 3VHTC 2GOWA 1MIZB 1MIXA 1P5TA 1LQBA 2R09A 1LM8B 2VRWB 4BKTA 3O96A 3ZTDA 3V5WA 3ML8A 3PP2A 4G0NB 2KFKA 3KUZA 4WJNA 3L54A 2KGXB 1KJTA 3RCPA 3C0RB 2VKIA 3NSUA 1XX0A 2N9EB 3PRMB 3D8DA 2ABDA 2KJHB 2J0MA 2I5CA 1WY8A 2VRRB 1GNUA 2DHIA 2IFSA 4AUQC 2MBHA 4DK5A 4BKGA 3ONSA 1ISNA 3WIMA 5JHBA 2DZIA 4BKSD 3PV1A 3G9WA 1DBHA 3P2BA 2KK8A 3VUXA 2JY6A 3ZNZB 2GBKA 2D9ZA 1ZM0A 1P98A 2GBMA 1FOEA 3A1QA 4ZRKA 4GN1A 3IFWB 5FI0A 4KDIC 2NMBA 3A9KA 2ZPYA 2MKRA 3RULA 2KANA 4MGYE 2CODA 1QQGA 3AXCA 4DWFA 5J18A 2WDTB 2Z0QA 1OQYA 2KX3A 1XKEA 1M94A 4ANUA 4BOSC 2W2XD 2EKEC 4TKNA 1DDVA 3DQVA 4DDGD 2GBNA 2NR2A 4MT7A 1UPQA 2LBBA 2GBJA 5GMVA 3LDZE 1P3RA 4RM9A 5DPRA 2CR5A 2HTHA 1WE6A 3PHWB 3ML4A 2KFKB 4GSWA 2YT0A 1QZEA 1J8CA 4ZDVA 4BBKA 5CLQB 5CLLB 3MHSD 2L05A 2K8BA 2LOZA 5L95C 1WE7A 4W9GA 3OAWA 4LCDE 3QX1A 2D10A 3QARA 4MK0A 1J0GA 4HB3B 3NZSA 4AWJA 4BOZB 3SU8X 5D6JB 3T9LA 1J0WA 2NPTA 4W9IA 2MFQA 5AZFA 2COAA 2KDEB 1V49A 1R4NI 1K5DB 5AZGA 3A9JA 2DX5A 4HAXB 4GB9A 1UZXB 3VQIA 4FJVB 3WAPA 4NY0A 1XR0B 4PS3A 2NBVB 3A8QA 2QKMA 2BKRB 2Y8GA 4EZLA 3DVGX 2LRWA 3B0AA 3S2AA 1OEYA 2A4ZA 2UYZB 2M0XA 5DI9B 1NTIA 5D3XA 1ZVRA 4L6EA 4EKUA 4FJYA 2PEAA 3PRZA 2LUEA 3ECIA 2L3ZA 2GCLA 2N9XA 2FIFA 1F9JA 2R2OA 2RD0A 5TR5A 3NHEB 3KYDD 4D0NB 1K8RB 1U4AA 5BO4B 2HTHB 5CHVC 2K8HA 1W1GA 3TBLD 3EPYA 3PZDA 5C79A 5C6RA 2EJ8A 3QQ8B 2N1VA 4A6KA 1WGGA 2PE9A 1BAKA 1ACAA 2BPSA 2CU1A 3DBLI 3ULCA 2DTCA 4MH0E 2L0TA 1WZ3A 4LJPB 4MJSA 3RYTA 1FB8A 4MDKE 4NJ6A 4MSMB 1EGXA 2ZNVB 2PZ1A 2BYEA 1WXMA 4WAAA 2MBQA 3DXDA 4II2B 2L2IA 2JXXA 2NCNA 1ST7A 4W9EA 2AEHA 2BGFA 2M38A 1YIWA 2FCSA 1GC7A 2FNJB 1NVLA 1V5PA 2Z0DB 5L81A 5DCNA 1WJ6A 2JWZA 5JHHA 4DBGA 2D4QA 2LULA 3QIJA 4M0WB 4LDTB 2J0JA 1QC6A 1P0RA 5C5BA 4J6IA 4NPNA 4HB0B 4YL8A 2KTFA 2ELBA 1NBFC 3UGBB 1E8YA 4AOFA 3SO6A 3DCGA 1P6SA 3DDCB 4KZ0A 3IHPC 3D8FA 1U29A 4E71A 2G4SA 4FA6A 1MK9B 3QK0A 1TJ6A 4PQ0A 1UBQA 2KC1A 2DYQA 1TQZA 4W9FA 3V6EB 2IYDB 1V5UA 1JRUA 2MBOA 1TZ1A 4M8MA 4KSLC 2RGNB 4TV3A 4HPLB 1P9DU 4FHKA 5G2NA 3AJ4A 4N9F4 3TVVA 4ZRIA 2COFA 1M7RA 3PEGA 3VIAA 2IO0B 3ODOA 1XD3B 4HXDA 4HAUB 2JT4B 3AI5A 2M14A 1SGHA 2PJHA 1XQQA 3B1LX 2W9NA 3CSTA 4IAPA 3RZWC 3A4RA 1K5GB 3EECA 1WJ1A 4JQWC 3L08A 4KZCA 3PLVA 1C1YB 1Q5WB 2JZ3B 3PREA 1X1GA 2YVCA 4HDOA 2JP2A 5L83A 4CYEA 3RT3B 2FJ9A 2C5LC 2P0FA 3KSYA 1WX9A 2COCA 1WGDA 1WVHA 1HB6A 3ZO5B 3FEHA 3HIZA 4GXBA 2LRUA 1CMXB 3ALBA 3VFKA 2M17A 3PRPB 3SDLC 2DYOA 4IC7B 2ZCBA 3PHXB 5HE0A 3VAWA 1KZ7A 1E90A 1WFYA 3PSEB 4HATB 3M1IB 3ZRFA 1X1MA 3CIKA 5D94A 1W1DA 3QJZA 2GJYA 3Q3FA 3V62A 3VH4B 4ANVA 4F7HA 4EMOA 2QKLA 3SUZA 1LW3A 4A6HA 4F1SA 4WJ7A 2D2QA 3DBSA 4WWPA 2P0HA 2DKQA 2H7DA 1MK7B 2YSZA 2JRHA 3KUDB 3DXEA 4GU2A 1I42A 4GDLB 2LVQA 3TL5A 3TW1A 1UH6A 3ZRCA 3UIOB 1ZC4B 2REXA 1WXVA 3T8MA 3HW2B 3DXCA 1WYWB 4I6LB 1BT0A 4CHKA 4RMAA 3QWZB 2FCQA 3VUWA 1GG3A 1UEFA 1W1HA 2D9WA 3RUIB 1UPRA 1EUVB 1SE9A 1OY2A 5JH5C 1NDDA 3L16A 1Q0WB 4HCNB 3OJ3A 2R0DA 3M62B 2O2VB 4PNKA 4A6FB 1YX6B 4Z2NA 2Z0EB 4HK2A 4II3B 1WF9A 2OJRA 2EC1A 4H8SA 3NZUA 1NU2A 3N3KB 5HKHA 4X57B 2LGXA 4EUTA 1NI2A 4MGKE 1WIAA 4TUUA 5DPSA 2KCJA 3QWMA 4C0AA 4B6HA 3APCA 2RUKB 3MDBC 2RSUA 1V5OA 2A5UA 2O6VD 2LGDA 4XC2A 1WRDB 4ZYNA 2I5FA 1WMHA 5GOWB 3VDZA 2YLMA 1PFJA 4WWNA 3MPXA 2KC2A 5G55A 3ZUNA 4FBJB 1WM2A 1EAZA 3BY4B 3GYPA 2V1YA 4TYZA 4FN2A 4MGZE 2PE6B 2FJLA 1WXAA 5D2MB 1Z2MA 1V81A 4FULA 2KWUB 4BBNC 2LVPA 2MWSB 5LXIB 2WWZA 1V86A 3DBHI 3PGEA 1V88A 4KVGB 1NTVA 3I3TB 1KLVA 4EZJA 5EDSA 1RJ2A 5CTRC 4HAYB 1OTRB 4EFOA 4NQLB 5KQ4A 5E6NA 3M63B 3VUYA 3WALA 2X18A 4GOCA 1PMSA 2CS4A 4HAVB 4HDQA 4DX8A 5CHWA 3PPAA 4WWOA 1I7AA 4A3PA 3SNHA 3VTVA 4Z2MB 3WAMA 4DXAB 1EF5A 4NJ7A 2N23A 2O6VB 5J3TA 2WX1A 2K8CA 5C1ZA 2KJ6A 3KUCB 1WJ4A 3M95A 2LOXA 1V80A 1Z5SB 1OGWA 3QA8A 1U2BA 4KSKC 1OQNA 1AWEA 3ZTCA 1WMHB 3EC8A 4HJKA 1E7UA 1WGHA 2AL6A 3W1YA 4B9KA 2RVBB 2HJ8A 4TQ0A 4KHOA 1EVHA 2V3SA 1IYFA 2KFJA 5LXHA 1IP9A 4HB2B 3D8EA 3P7ZA 4Y94A 1U5GA 2YS3A 2L00B 2FCNA 4A3OA 2RNRB 2KWVB 2MQJA 2KDBA 4MGIE 3FP5A 5E6OA 3W1SA 2ZEQA 3DPDA 1GJZA 4M8NA 2KWCA 4HCPB 2D9XA 5E6PA 1UNPA 2BYVE 2ELAA 3L10B 4OVVA 3B08A 1YX5B 1U5FA 5LOPB 2AYOB 1AARA 2YF0A 4HLEA 3D32A 4FHJA 1TTNA 1MG8A 2Z0OA 2EMSA 3KW5B 2ROZB 2GMIC 2J59M 4MM3A 4FADA 2LKOA 1KM7A 5D7GA 3PVLA 2K2JA 1VD2A 2YS5A 3ENEA 4W9JA 2ZZPB 3AULA 3NOBA 4K7UA 1Q67A 2UZRA 2C7MB 4HAWB 5DPWA 3H7SA 3ZKJC 2I1JA 5DHFB 2MP2B 5AZHA 4F7GA 2COPA 2DX1A 3Q3JA 2NBUA 1V5TA 3SD5A 4IFSA 2DLWA 2Y7BA 1ZC3B 3H7PA 4F7UP 3WYFB 3FSSA 3DVGY 2LG1A 2ASQA 2AWTA 1WXSA 1E7VA 5D3YA 3PVWA 1BWNA 2IO2B 4KHBB 1V61A 3KY9A 2NVUI 4DHJD 5JP4A 2L0FA 3KVFB 5KQ1A 2CHXA 2OOBB 5KHOA 2M8SA 1H10A 1WJUA 3N30A 5C23A 4JLCA 4IM2A 1WI0A 2DAJA 2ZVOA 4IWQA 4TQ1A 3QCAA 4FJZA 5IJMA 3IVFA 3F0WA 4WQOB 3T06A 5HE2A 4W9KA 2KNBA 5KCVA 4WJPA 2W2XC 3TMPB 1RFAA 4GZUA 3H6NA 2G4DB 2WX0A 2LGYA 3A4SC 1TBEA 4KHAA 2DN6A 1UBIA 3EFUA 1MAIA 2DZMA 1BTKA 1SHCA 2RLOA 2G3QB 2H7EA 1U5EA 3PSCA 4HWIB 1I35A 2JVCA 3HM6X 1DROA 1V6EA 4P7IA 2BWES 4K1RB 3KRWA 4PYZA 5KHQA 1J19A 2ZPNA 4KIKB 1IRSA 4WSFA 1YD8U 1ZKHA 3LJ3A 3H7PB 4DHJB 2MW5A 2V76A 3ZIMA 4JIOU 1X11A 3UQBA 1WJNA 4GDLA 2BKFA 2KTRB 3MTNB 2KHWB 1KZGA 1H8CA 3O65B 2DA0A 1D3ZA 2OTXA 4XZ4A 2NBWB 1X05A 1X1FA 2C7HA 1X86A 2DYNA 1FXTB 3PT2B 2XK5A 1V9JA 1U27A 2KJRA 1AQCA 2IO3B 1PLSA 1WZ0A 4HB4B 4AJYB 4G11A 4NAWB 2DHJA 3APDA 1GC6A 2XBBC 4PS8A 2LASA 1E8XA 2O2VA 3ZNHB 2GS0A 4A6FA 2C60A 4URKA 2MBBB 1UNRA 4I6NB 2WH5A 5LONB 3RZFA 2W2WA 2RSGA 2HE7A 3DBRI 2IYBA 4MEMA 2BWFA 1EF1A 1A5RA 1ZSQA 3MJWA 3IG3A 4A20A 3ZNID 2LYDA 1P3QU 2MLBA 1PQSA 2FDQA 2KLGA 2XEWA 4W9CA 1BTNA 2KVRA 2G45B 2DAFA 2JZZA 4MSQB 2KUPA 2N7EA 2OQBA 3A8PA 4K7WA 2L8JA 2JRIB 1ZGUB 2DZKA 1YQBA 2JUOA 2KQSA 3A33B 1WH3A 3X0WA 2IZVB 1TXDA 2CY5A 2NS5A 3W1SC 4HHVA 2Z0PA 2LI5A 2D9VA 3PTFC 1RRPB 2KKCA 2CQUA 3ZDMC 1UD7A 4BKSA 5CX3A 2XK5B 3UF8A 2KXJA 4AJWA 1V89A 2QHOA 3ODXA 5JLJB 1T0YA 3QC8B 4IG7B 2N1WA 4DDID 2MWNB 2UVMA 1WR6E 3IBEA 2CHWA 4FLHA 2UZSA 2YRYA 1DDMA 1R4MI 2O6VA 2DKPA 4I6PA 2LD9A 3PLUA 3SV1A 1WGUA 3CMMB 3DVNU 2IY0B 2CY4A 2KOXA 2E2XA 2IY1B 3UIPB 3CXBB 3UZTA 3VXWA 1DYNA 2MBEA 2GCJA 3OJ4B 4MELA 4IWOA 4B95A 2K2UA 2Y8FA 3JW0X 3K9OB 4PYUA 2Z59B 4IUMB 3AU5A 3ML9A 3K9PB 2FUHB 2AL3A 2IBIB 3KRXA 2M4NA 3VTUA 1FGZA 2MSED 3FM8C 1WR1A 4WJOA 2K39A 1S1QB 2ADZA 1NTYA 5DIFB 5HE3A 3L17A 2DENB 1IPGA 2KMAA 2FCMA 3GOEA 2N9PC 5DH9B 2ZVNA 4K7SA 2MX2A 3JYUA 1E5WA 4NNJB 3BJIA 3GZNI 3N32A 2ZJDA 4KDLB 1S3SG 2KDIA 4ANXA 2LXCA 5J17A 2FIDA 1MPHA 4DHZB 2RR9A 5J3QA 2CKHB 2KO3A 1V2YA 4GDKA 1UELA 3X23A 4A5KA 3L0WB 2J7QB 1MKEA 3APFA 3TIXA 2L76A 2DZJA 2MCNB 3OANA 2C7NB 2JPHA 2YT1A 2K6DB 3CF6E 1HBKA 2D3GA 3ZDTA 4WJQA 2XQNM 3GYOA 5FI1A 4EEWA 4EJNA 4MY6A 2JF5A 1OMWA 3KZ1A 4EOYA 5FR6A 4RM8A 3ZLZA 2MP2A 3F5RA 3A1QB 5HE1A 2YS1A 1WM3A 1FHWA 4GIVA 4WVFB 1L2NA 3R3MA 1WGRA 3A9KB 4IM0A 2KN5A 4K17A 5D3WA 3KYCD 4F7ZA 1XODA 2WYQA 4ICVA 2EMTA 2DFKA 4AP4C 2KMCA 2KDFB 4IM3A 5DPTA 1ZW7A 5JHGA 3L13A 3WA0A 1WI1A 4GPTB 3DVNV 3HK0A 4W9HA 2P0DA 4K2PA 3JSVA 4LDTD 1WX7A 4DBBA 2DYMA 3VTWA 4HPMB 3SYXA 1WGQA 1RRBA 3WAOA 4E3CA 3VVWB 5J2RA 3VOQA 2L7RA 3RD2A 1N3HA 4NSWA 3P6AA 2P8VA 4GDKB 3PS6A 2R2QA 5D3VA 1UNQA 2KX0A 2VSZA 2NPTB 1HE8A 3PVUA 2D9YA 2D07B 4IWPA 2MA9B 1P1AA 4HVBA 1LFDA 4KAXB 1WGYA 2BF8B 2KQ7A 3A9JB 1WG7A 2DX5B 4XX5A 4ANWA 2K1FA 2B3AA 4KIKA 1XT9B 2DYBA 3ZVVA 1E8ZA 1U5DA 4OVUA 4G50A 4K81A 5C16A 2LZ6A 2I1KA 1Y5OA 2KTRA 3TFMA 3TJPA 3QBVB 3EHVA 3R7QA 3ODWA
chains in the Genus database with same CATH superfamily
1KRHA 2I2YA 4GMVA 4HROA 1DDWA 4XWXA 2N4FA 1V5MA 4NQKE 1MI1A 1FMAD 3UQAA 4K2OA 1KBLA 4E74A 2K6QA 1Y19B 1L7YA 5JHAA 2NZ8B 1Z87A 3DOWA 3IXSA 3HHMA 3JSVB 3I9V1 1ZYIA 5T8IA 1I4GA 2RRFA 2BT6A 4NAWA 3M3JA 3AMZA 4IOIE 2J53A 1ET9A 3Q2AC 4BFRA 4QJ3B 2KD0A 2DLBA 2QEJC 4ASWC 4F8CB 5J3YA 3WANA 3T3NA 4UDUC 1FHXA 3TO1A 2GBRA 3U52E 5LLIA 2D3AA 2IO1B 3EUB2 3DCXA 2CB8A 3AE2B 4DHZE 4JWUC 2C9WB 4PT5A 4BAXA 3UINB 2RGFA 4ILGB 3R8BA 2L1CA 1B1ZA 1RAXA 3H9DA 2ZCCA 1ZOYB 1OEYJ 4RF1A 3ZNGC 2LJ5A 3RCZA 2X0SA 5JVLA 4W9DA 2PPHA 4MJSB 3LJUX 4H2AA 1WJMA 2KZRA 1G6JA 3U7DA 3OHMB 2BYFA 3U30A 3TCAA 2HTME 3CSFA 3H1UA 4JK8A 2M1MA 2ROVA 1AYFA 2DHZA 2WXPA 5CHFA 2RDHA 3RMKC 1RM6C 2G1EA 4LTUA 3V61A 4JL9A 1C79A 2LWPA 3NY5A 1N6ZA 3AEFB 4DX90 2K00A 4CQNA 4YONA 1D4BA 4PS7A 1E8WA 1Y8RC 2FAZA 2N0YA 3Q6BA 4KV2A 4RNAA 3BINA 3QAQA 2WXRA 2V4LA 1E10A 2G35A 4ICUA 5IAAC 3E9PA 5D27A 1FRDA 1XD4A 3SHQA 1FNWA 1LB1A 3Q3OC 4W9LA 4LNFA 5C5BB 3U4EG 2W3SA 3AECB 2JWUA 3BVMA 3V6CB 2RDGA 5AEKB 5EFXA 1EO6A 2INCC 2MDXA 2D11A 1VCBA 4YTNB 2CRFA 3N7CA 5EE0A 3OWEB 1N5WA 2DHKA 2Q13A 2CHZA 2CJNA 3AU4A 1H4RA 3U8ZA 4GMXB 4ZYSA 2HD5B 1UGMA 2MRPA 2LXAA 1C3TA 4EZKA 2L83A 5IA7A 1GUAB 2LVOA 4BBNF 2ZNVC 2RPQA 2LMCA 2Y5BB 5DHAB 1FGYA 2E3TA 2PTLA 3R66C 1HB8A 2UWQA 3JVZX 3OG5A 1NEKB 2XNAC 4CHJA 1SJHD 3PG7A 1FHOA 4GGQA 3ULBA 4IOYX 1TS3A 1B55A 2N7DA 2J0KA 3HIEA 1SIFA 1FFUA 1YJ1A 3VH3B 1C77A 2ICIA 4CO7A 2DBYA 4LJOB 2RQ1A 5JZEB 3BZDB 5LG4B 3QHTA 3C8YA 3OLMD 4ZOHC 1MHHE 2CAYA 1SIJA 3KH0A 1M7EA 2ZKMX 4BVUC 1KOTA 1Q1OA 3ZJVA 1JALA 1ZPSA 1KI1B 2BTEA 1XCGA 2Z59A 1RLFA 2HRJA 1LXDA 4IW0A 2PW9A 3ZVRA 3FLVA 3NS8A 1TGZB 4USAA 2BCJA 4CHMA 3V60A 4G3XB 4JGHB 3A98B 2KLCA 1BUIC 1YN3A 3HQCA 2PVOD 1HA5A 4HAZB 1STEA 3HM3A 4ZRJA 2KAJA 1WX8A 3FILB 4K3BA 1I2HA 3HVDA 1UWXA 3R7RA 4B6WA 4JK9A 1K50A 3ZW3A 5I4DA 2K25A 1FAOA 3VHTC 2GOWA 1MIZB 2H89B 1VR9A 2LFIA 2QSDA 1MIXA 1P5TA 1LQBA 2R09A 1LM8B 2VRWB 4BKTA 3O96A 2WHIA 4AS1A 3ZTDA 3V5WA 3ML8A 3PP2A 4G0NB 2KFKA 3KUZA 4YTPB 4WJNA 3L54A 2KGXB 1KJTA 3RCPA 3C0RB 1V1PA 2VKIA 2WXOA 3NSUA 3AE7B 1XX0A 2N9EB 3PRMB 4ITKA 2KIEA 3D8DA 2ABDA 2KJHB 2J0MA 2I5CA 1WY8A 2VRRB 1GNUA 2DHIA 2IFSA 1SE3A 2LHDA 3BYTB 1J7CA 4ZRPA 2MBHA 4AUQC 4DK5A 3HUIA 4BKGA 1N63A 1WSPA 2W82A 3ONSA 1ISNA 2BS3B 3WIMA 5JHBA 2DZIA 4BKSD 3PV1A 3G9WA 1DBHA 3P2BA 3MFGA 3TEWA 2KK8A 4GLSC 3VUXA 2JY6A 2ONQA 3DBLB 3ZNZB 1IBXA 2GBKA 2D9ZA 1QOBA 5BMHA 1ZM0A 3J9CA 2Y5CA 4LLGM 3B2FA 1P98A 2GLSA 4JKHA 4OW0A 1KLUD 4BZAA 2GBMA 4ZRQA 1FOEA 3A1QA 4ZRKA 1VBGA 2WXHA 4GN1A 3IFWB 1L6VA 2NBVA 1JWBD 1KF6B 5FI0A 4KDIC 2NMBA 2XN9C 3A9KA 2ZPYA 2MKRA 3RULA 1ACCA 3PO0A 2PLPA 2KANA 4A6QA 4MGYE 4P6VF 2CODA 1QQGA 1FEHA 1KTKA 3AXCA 4DWFA 5J18A 2WDTB 4WAFA 4EE2A 2Z0QA 1OQYA 4HSIA 1XKEA 2KX3A 1M94A 4ANUA 3DWGC 4BOSC 2LGSA 4OZBA 2W2XD 3AM9A 2EKEC 4TKNA 1DDVA 2J52A 3DQVA 4DDGD 2V4IB 3GE8C 3AE3B 2GBNA 2NR2A 4MT7A 2QJLA 4DQOC 1UPQA 4JPSA 1XLNA 2INPE 2LBBA 2BYTA 2GBJA 2DIKA 3E56A 1BXTA 3LDZE 5GMVA 1P3RA 3Q69A 4RM9A 3P42A 4L1RA 5DPRA 2CR5A 2EELA 2HTHA 1WE6A 3PHWB 1AWDA 3ML4A 2KFKB 4GSWA 1XLPA 5G5HA 1FCLA 1FIQA 1P7FA 2YT0A 1N61A 4AQ7A 1GB1A 1QZEA 1JMLA 4ZDVA 4BBKA 2BQQA 5CLQB 2Q5WD 1J8CA 5CLLB 2BBCA 5EE3A 3MHSD 2L05A 2K8BA 2LOZA 5L95C 4JKCA 1WE7A 4W9GA 3OAWA 4LCDE 3QX1A 2D10A 3QARA 4MK0A 4OSNA 4XDCA 1J0GA 2IGGA 4HB3B 3I57A 1BMLC 3NZSA 4AWJA 4BOZB 3SU8X 2WQYB 2L52A 5D6JB 3T9LA 3U12A 1J0WA 4N58A 4RGTA 2NPTA 4W9IA 2MFQA 3P4RB 2JYTA 5AZFA 4JKBA 2COAA 2KDEB 1TKYA 1V49A 1R4NI 1K5DB 1L4ZB 5AZGA 2KUQA 2X8XX 3A9JA 2DX5A 4HAXB 4GB9A 1UZXB 3VQIA 4FJVB 4NY0A 3WAPA 1XR0B 4PS3A 3P63A 3SEBA 2NBVB 2GUMA 4DXGA 3A8QA 2QKMA 2KN4A 2BKRB 3AN1A 2Y8GA 1FO4A 4EZLA 4TSSA 4JE3B 3DVGX 2LRWA 2QIEB 3B0AA 1PGXA 3S2AA 4HEA1 4RH6A 1OEYA 2A4ZA 4HKZE 2UYZB 2JU6X 2WNMA 2M0XA 5DI9B 3FVCA 5FR3A 1NTIA 1VJKA 3Q3NC 5D3XA 1ZUD2 1WRIA 1ZVRA 1T5XD 1E0ZA 2Z4DA 4L6EA 4EKUA 4FJYA 2PEAA 3PRZA 2LUEA 3SBGA 3ECIA 1VRAB 4L1BA 2L3ZA 2GCLA 2N9XA 2FIFA 3HSAA 1F9JA 2K49A 2R2OA 2RD0A 5TR5A 4XWWA 1WYGA 3NHEB 3KYDD 5TSSA 2I38A 4D0NB 1K8RB 1VDVA 5HFYA 1U4AA 5BO4B 1K53A 2HTHB 4A8XC 5CHVC 2K8HA 2X38A 4NJCA 1W1GA 1DOIA 4DXFA 3TBLD 3EPYA 3PZDA 1HZ6A 4P1CC 5LNK1 5C79A 5C6RA 2EJ8A 3AEDB 4LNNA 2NMQA 3QQ8B 1I4HA 2WXIA 3R2TA 2N1VA 4M01A 4A6KA 1WGGA 4JKFA 2PE9A 1BAKA 4HJGE 1ACAA 2BPSA 2CU1A 3DBLI 3ULCA 2DTCA 4MH0E 4RGOS 2L0TA 1WZ3A 4LJPB 4MJSA 3RYTA 1FB8A 4MDKE 4NJ6A 4MSMB 1EGXA 2BW2A 2ZNVB 2PZ1A 1GPXA 2BYEA 5EE1A 1WXMA 3ETRA 3U2SC 3IT6B 4WAAA 2MBQA 3DXDA 2R2YA 3IT4B 4II2B 2L2IA 2JXXA 2NCNA 2WGSA 1ST7A 1ZXIA 4W9EA 2AEHA 5BMGA 2BGFA 2M38A 1YIWA 2AQ2B 1GC7A 2FCSA 2TSSA 2FNJB 4ILJA 1NVLA 1V5PA 2N9KA 2Z0DB 5L81A 1EU4A 1I4PA 5DCNA 1WJ6A 2J4XA 2JWZA 4YSXB 1C4CA 5JHHA 4DBGA 2D4QA 2LULA 3QIJA 4CSQA 5IO9A 4M0WB 4LDTB 4OVZA 2J0JA 1QC6A 1P0RA 5C5BA 4J6IA 4NPNA 4HB0B 4YL8A 2KTFA 2ELBA 2QILA 2M19A 3URYA 1NBFC 2INDC 1E8YA 3UGBB 4AOFA 3SO6A 1L0YB 4WH4A 1V8CA 3DCGA 1D6EC 1P6SA 1MG4A 3DDCB 2LJIA 4KZ0A 4US9A 3GP7A 3IHPC 3D8FA 1U29A 4QXAB 4E71A 1T6BX 1CQVA 2G4SA 2YT2A 4FA6A 1MK9B 3BIID 4C7YA 3QK0A 1TJ6A 4PQ0A 2IJ0A 1UBQA 1JRPA 1NYRA 2KC1A 4C4VA 2DYQA 1JDEA 1TQZA 3SBTA 4OHJA 4W9FA 3GE3C 4LK0M 3V6EB 3NVZA 2IYDB 1V5UA 3N1XC 1JRUA 1XO3A 2MBOA 1TZ1A 3ZXVA 4M8MA 1YJJA 1T3QA 4C00A 4KGSA 4KSLC 1E7PB 2RGNB 4TV3A 4HPLB 2PIAA 1P9DU 4FHKA 4IDIA 2V3PA 3Q8FA 5G2NA 3AJ4A 2B76B 1L4DB 2R82A 1R4MB 4MM3B 4N9F4 1I4RA 4YSYB 3TVVA 1JWUD 3UI3A 4ZRIA 5C2TB 2COFA 1M7RA 3PEGA 3VIAA 2D3BA 3P1MA 4HRSA 1UGJA 3FILA 2IO0B 3ODOA 1XD3B 4HXDA 4HAUB 2JT4B 3AI5A 2M14A 2WXGA 1JW9D 4B0MA 5EE9A 1SGHA 2PJHA 4JKGB 1F77A 1XQQA 3B1LX 1PUTA 2W9NA 3CSTA 4IAPA 3RZWC 1QLBB 3A4RA 1K5GB 3EECA 1WJ1A 4JQWC 3L08A 1E9MA 2KVZA 4M00A 4KZCA 3PLVA 2EKIA 1C1YB 1Q5WB 2JZ3B 5IOIA 1K52A 3V3XA 3PREA 1Q10A 1X1GA 1TS4A 4YWGG 4GOUA 1HQRD 2YVCA 4HDOA 1F1HA 3HVZA 2JP2A 3RFZB 1RFKA 4CYEA 2FBWB 5L83A 3RT3B 2FJ9A 2C5LC 2P0FA 3KSYA 1WX9A 2COCA 1WGDA 4XE0A 1OQQA 1WVHA 3DBHB 1HB6A 3ZO5B 3FEHA 1T0RC 4C4VB 4C56C 3HIZA 4GXBA 3GZNB 1EWCA 2WLBA 2LRUA 3N1YC 2Z8LA 3AV8A 1CMXB 3ALBA 3VFKA 1TZOA 2BVCA 2M17A 3PRPB 3NVYA 3SDLC 2DYOA 3DHHC 4IC7B 2ZCBA 3PHXB 3VRAB 1ZE3D 5HE0A 3VAWA 1C4AA 1KZ7A 1E90A 1WFYA 3O13A 2VZKD 3PSEB 1L0VB 3AEBB 1D5XC 5H92C 1KH0A 4HATB 3M1IB 3ZRFA 1X1MA 3AEGB 3AEAB 5HG2A 1GGOA 3CIKA 5D94A 1W1DA 2IDYA 3QJZA 1XLQA 1PGAA 2GJYA 3Q3FA 3V62A 4QJ5B 3VH4B 4ANVA 1FD6A 3NZ3A 4F7HA 4EMOA 2QC8A 2CJOA 2QKLA 3SUZA 1LW3A 4A6HA 3E9LA 4F1SA 4WJ7A 2D2QA 1NI3A 3DBSA 4WWPA 5FK9C 2P0HA 3SR6A 2DKQA 1FXAA 2H7DA 1MK7B 1JQ4A 2YSZA 2JRHA 3KUDB 3DXEA 4GU2A 1I42A 4WQMA 4GDLB 2LVQA 3TL5A 3TW1A 1UH6A 3ZRCA 1QOGA 1EM7A 3UIOB 1ZC4B 2WU2B 1TS2A 2REXA 3W5VB 1TY2A 1WXVA 3T8MA 1ROEA 3HW2B 1C4PA 3DXCA 1WYWB 5JXVA 4I6LB 1BT0A 4CHKA 1TYGB 1QT9A 4RMAA 4ZHOA 2KT7A 3HRDD 3RNEC 3QWZB 3LXFA 2FCQA 1B9RA 3N20C 3TSSA 1KLGD 3VUWA 1GG3A 1UEFA 1W1HA 2NTTA 2D9WA 1DIKA 3RUIB 1UPRA 2ZW0A 1EUVB 1D5ZC 1SE9A 1OY2A 5JH5C 1SE4A 1NDDA 3W9CB 1MHXA 1V1OA 3L16A 2VZKB 1Q0WB 4HCNB 1J7BA 3OJ3A 2R0DA 3M62B 4TMAB 2O2VB 4PNKA 2SEBD 2IPKD 4A6FB 1YX6B 4Z2NA 3NW8A 5M4YB 2WXKA 2Z0EB 4HK2A 5D3DA 2MH7A 4IKGA 4II3B 1WF9A 2OJRA 2EC1A 2Z14A 4H8SA 3NZUA 1NU2A 1GAQB 4RF0A 3N3KB 5HKHA 2D3CA 4X57B 2LGXA 4EUTA 1NI2A 4MGKE 3RNCC 4OZCA 1ZP0B 1WIAA 5D3IB 3CWIA 2KYWA 4TUUA 5DPSA 1C78A 2KCJA 3QWMA 4C0AA 1J7AA 1A70A 4B6HA 3APCA 2RUKB 3MDBC 2RSUA 1V5OA 2A5UA 2O6VD 2ZW1A 2LGDA 2R61A 4XC2A 3E9OA 3MJ5A 1WRDB 4ZYNA 4ILHA 2I5FA 1WMHA 5GOWB 1YN4A 4LNIA 4XWTA 3VDZA 2MJEA 2YLMA 1PFJA 3NWDA 4WWNA 3MPXA 2KC2A 5AUKA 5G55A 1L5PA 3ZUNA 4FBJB 1GOZA 5IKCM 1WM2A 3Q14C 3AE9B 3AEEB 1EAZA 1IUEA 3BY4B 3GYPA 2V1YA 2KIGA 4TYZA 4FN2A 1GB4A 4US8A 4MGZE 2PE6B 3NWFA 2FJLA 2BS2B 1WXAA 5D2MB 1Z2MA 1V81A 4FULA 2KWUB 1JWSD 4BBNC 2LVPA 2MWSB 1YQ3B 2V9HA 5LXIB 1SE2A 2WWZA 1V86A 3DBHI 2WXJA 3PGEA 1V88A 4KVGB 3Q8BA 3E66A 4HKQA 1NTVA 2PKOA 1TKEA 3I3TB 1KLVA 4EZJA 5EDSA 1RJ2A 3RNFC 1D5MC 1T0QC 5CTRC 1XLOA 4HAYB 1OTRB 1HTOA 4NQLB 4EFOA 5KQ4A 5E6NA 3M63B 3VUYA 4A9AA 2MEKA 3WALA 1ZXHA 2X18A 4GOCA 1PMSA 2W55A 2CS4A 4HAVB 4HDQA 4DX8A 5CHWA 3PPAA 5BYQA 4WWOA 2MJ3A 1I7AA 4A3PA 1RWSA 4MACA 3B77A 5I2SA 3SNHA 4M02A 3VTVA 4Z2MB 1CK1A 2WU5B 3WAMA 4DXAB 1EF5A 1HZ5A 4NJ7A 2N23A 2O6VB 4ZHPA 5J3TA 1L0XB 2W3RA 4YTMB 3NUHB 2JX5A 2WX1A 4O1NA 5IRSA 2K8CA 1OQRA 5C1ZA 4MH8A 2KJ6A 4L23A 4NAMA 2ON8A 3KUCB 1WJ4A 1QOAA 2RPVA 3M95A 3DHGC 2LOXA 1V80A 4P1BC 1Z5SB 1OGWA 4ARCA 3QA8A 1U2BA 4KSKC 1OQNA 1AWEA 3ZTCA 3L4PA 3ZGZA 1WMHB 3EC8A 4HJKA 1E7UA 1WGHA 2AL6A 3W1YA 4M0WA 4N59A 4B9KA 3V05A 2RVBB 3I5JC 2HJ8A 1QILA 4TQ0A 4KHOA 1EVHA 2V3SA 1VZ7A 1IYFA 2KFJA 5LXHA 4KX6B 2JQRB 3KLSX 1CJEA 1IP9A 4HB2B 3D8EA 3P7ZA 4Y94A 1U5GA 1HEZE 3C19A 1SEBD 2YS3A 4KHBA 2L00B 4ACFA 3TEXA 2FCNA 3SFDB 4A3OA 1PGBA 2RNRB 2KWVB 2MQJA 3N1ZC 5AUIA 2KDBA 4OT1A 4MGIE 3FP5A 2WS3B 5E6OA 3W1SA 2ZEQA 4OZAA 3DPDA 4J3OD 1GJZA 2PVGC 2KMMA 4M8NA 3RI7C 1TT5B 2KWCA 4HCPB 5BMIA 2SAKA 3NWAA 2WXNA 3AE1B 2D9XA 1FRRA 5E6PA 1UNPA 2BYVE 2ELAA 4ARIA 3L10B 4OVVA 1SBBB 3B08A 1T0SC 1YX5B 1TJEA 1MI0A 1TY0A 1U5FA 3B2GA 5LOPB 2AYOB 3NRZA 1AARA 2YF0A 2Y5PA 2WXQA 4HLEA 3T3OA 3D32A 4FHJA 2Y3AA 1TTNA 1MG8A 1MVKA 2Z0OA 3ABVB 2EMSA 3KW5B 2ROZB 4WWMA 2GMIC 2J59M 1KFYB 2KR0A 4MM3A 4FADA 2LKOA 1KM7A 3DBRB 4RGNA 5D7GA 3PVLA 2K2JA 1VD2A 2YS5A 3ENEA 4W9JA 2Z13A 2ZZPB 1UNSA 3NS1A 1UWMA 3AULA 1XCTL 3EGRA 3NOBA 4K7UA 1Q67A 1AN8A 2UZRA 2C7MB 4HAWB 2WXLA 5DPWA 2HDEA 3H7SA 1XXGA 3ZKJC 2I1JA 5DHFB 2MP2B 2RMMA 5AZHA 3W2DA 1I7HA 4F7GA 2COPA 2DX1A 5BYSA 3Q3JA 2NBUA 1V5TA 1E6EB 3SD5A 4IFSA 2DLWA 4JKGA 2Y7BA 1ZC3B 3H7PA 4F7UP 3WYFB 3SFEB 2HJ1A 3FSSA 3DVGY 2LG1A 3VR8B 1NYQA 2LGIA 2ASQA 2AWTA 4B0EA 1WXSA 1E7VA 5D3YA 3PVWA 1BWNA 1SJED 4P16A 3MC0B 1HTQA 2IO2B 2MJDA 4XDDA 4KHBB 1V61A 3KWLA 3KY9A 2NVUI 4DHJD 5JP4A 2L0FA 3VR9B 2WDQB 3KVFB 1YJIA 5KQ1A 2CHXA 2OOBB 3Q8CA 5KHOA 5H8YE 2M8SA 1H10A 1WJUA 3N30A 5C23A 4JLCA 2K8EA 3ZXRA 4IM2A 3IAM1 3KWVA 2N0SB 1Y56A 1WI0A 3R2IA 2DAJA 2ZVOA 4IWQA 4TQ1A 3U7ZA 3QCAA 4FJZA 5IJMA 3IVFA 3F0WA 4WQOB 4JKDA 3T06A 5HE2A 4W9KA 3MC8A 1TIFA 3BYYB 3Q8AA 2KNBA 5KCVA 4WJPA 2W2XC 3RNAC 3TMPB 1KC7A 1RFAA 1UUPA 4A55A 2KACA 2W54A 4GZUA 3H6NA 2G4DB 2WX0A 2LGYA 3A4SC 1TBEA 4KHAA 5I2MA 2DN6A 1UBIA 1IGCA 3EFUA 1MAIA 1MPEA 2DZMA 3GS2A 1QOFA 2DWQA 1BTKA 1SHCA 2G3QB 2RLOA 2H7EA 1U5EA 3PSCA 2QDFA 4DIXA 3DWMA 4HWIB 1VBHA 1XF5L 1I35A 2JVCA 2M0AA 3HM6X 1JWMD 1DROA 1V6EA 4P7IA 2BWES 4K1RB 3KRWA 4PYZA 5KHQA 1J19A 2ZPNA 4KIKB 1WXQA 4REZA 1IRSA 4WSFA 3N9YC 3AB5A 1YD8U 3AH7A 1ZKHA 3LJ3A 3H7PB 4DHJB 2YEPF 2MW5A 2V76A 3ZIMA 4JIOU 1X11A 3UQBA 1WJNA 1OFFA 4GDLA 1ET6A 1JROA 2BKFA 2LHEA 3NG0A 2KTRB 3MTNB 2KHWB 2M56B 1EWYC 1KZGA 1H8CA 2YEPB 3RPFC 3O65B 2DA0A 1D3ZA 2FE8A 1JWAD 2OTXA 4S0RA 2MHJA 2PMVA 4XZ4A 2K3UA 2NBWB 1X05A 1TS5A 1X1FA 5C3JB 2BS4B 2C7HA 1X86A 1EU3A 1SXTA 2DYNA 1FXTB 3PT2B 2AQ1B 5IP4D 2XK5A 1V9JA 1U27A 2KJRA 3EA6A 3RNGC 1AQCA 2IO3B 1N60A 1JCKB 1PLSA 1WZ0A 4HB4B 2J42A 4G11A 1VZ8A 4AJYB 4NAWB 2DHJA 1FXIA 4XGAB 2AX5A 3ENBA 1LO5D 3APDA 4PK1A 4WURA 4RGMA 3ZQ4A 5G5GA 1GC6A 3PZ7A 2XBBC 4PS8A 2LASA 1E8XA 2O2VA 4RFBA 3ZNHB 2GS0A 4A6FA 2C60A 4URKA 2KDMA 5MPOA 2MBBB 1UNRA 2KQ4X 4I6NB 2WH5A 1R7SA 5LONB 3NVWA 3RZFA 1DOYA 5HHDG 2W2WA 1DOXA 2RSGA 2HE7A 3DBRI 2IYBA 4MEMA 2BWFA 1EF1A 1A5RA 1ZSQA 1FFVA 1SSNA 2JXTA 1F0ZA 3RN9C 3MJWA 3IG3A 1V97A 4A20A 3ZNID 1FNUA 2LYDA 1P3QU 2MLBA 1PQSA 2FDQA 2GRIA 2JZPA 1XCQL 2KLGA 2XEWA 4W9CA 1BTNA 2KVRA 2G45B 2DAFA 2JZZA 1IGDA 1R4NB 2VH2A 4MSQB 2KUPA 2N7EA 1T77A 2OQBA 3A8PA 4K7WA 2L8JA 2JRIB 4D2KA 1ZGUB 2DZKA 1YQBA 4YSZB 3B9JA 2FJUB 1WWTA 2JUOA 2KQSA 3A33B 1WH3A 3X0WA 2IZVB 3RNBC 1TXDA 2CY5A 2NS5A 3W1SC 2UU7A 4HHVA 3AE4B 2Z0PA 2LI5A 2D9VA 4JWSC 1YOVB 3PTFC 1SB3C 1DGJA 1YQ4B 4N6EB 2QCZA 1RRPB 2KKCA 2CQUA 1K51A 3ZDMC 1UD7A 4BKSA 5CX3A 2XK5B 3MHZA 3UF8A 2KXJA 4XYCA 4AJWA 1V89A 2QHOA 3KQ4A 2K0PA 3ODXA 4D6WA 4R3DA 3AE8B 2G9HD 2WDRB 1PFDA 5JLJB 1T0YA 3QC8B 4IG7B 2OEDA 2N1WA 4WIPA 1LGRA 4DDID 2MWNB 4C7ZA 4C80A 2UVMA 1NENB 1WR6E 3IBEA 3WCQA 2V0GA 2CHWA 4FLHA 2UZSA 2YRYA 1DDMA 1R4MI 2O6VA 2DKPA 4KGRA 4I6PA 3ZJUA 1ENFA 2LD9A 3BK1A 3PLUA 3SV1A 1WGUA 3CMMB 3DVNU 3BWUD 2IY0B 4KGTA 2CY4A 3ZYYX 2WXMA 2KOXA 4A90A 3NVVA 1I4XA 1VLBA 1RYJA 5E6JA 2E2XA 2IY1B 2BB6A 3UIPB 4FXCA 4JK7A 3CXBB 3UZTA 3VXWA 1DYNA 2MBEA 2GCJA 3DHIC 3OJ4B 4MELA 4IWOA 3ZJTA 3MP9A 4B95A 2K2UA 2Y8FA 3JW0X 3K9OB 4LNOA 4PYUA 3VRBB 2Z59B 1WGKA 4IUMB 3AU5A 3AE6B 3ML9A 3K9PB 2FUHB 3TUOA 5IN7A 3W5UB 1F2RC 1FCCC 2OHFA 2OJWA 4L2YA 2AL3A 2IBIB 3KRXA 4YXDB 1QQRA 2M4NA 2LEKA 1QKZA 2IGDA 3VTUA 1FGZA 2MSED 1F2RI 1HXYD 3FM8C 1WR1A 2VH1A 4WJOA 2K39A 1S1QB 3NJTA 2ADZA 1NTYA 5DIFB 5HE3A 3L17A 2DENB 2INNE 4YT0B 1IPGA 2KMAA 2K9XA 4JKEA 2FCMA 2N9PC 2NTSA 3GOEA 3TEYA 5DH9B 2K5PA 2ZVNA 4K7SA 2MX2A 3TEZA 3JYUA 1E5WA 1PDXA 4NNJB 3BJIA 3GZNI 2ACZB 3N32A 2ZJDA 4K3CA 1DYQA 2WP9B 2KWDA 4KDLB 3EFCA 5FKAC 1S3SG 2KDIA 1V1PB 4ANXA 3BK2A 2L1AA 2LXCA 5J17A 5HI1A 2FIDA 1FNVA 1MPHA 2N7JA 4DHZB 2RR9A 2LUMA 5J3QA 2CKHB 3Q8EA 2KO3A 1V2YA 4GDKA 1UELA 1M4VA 3GB1A 3X23A 4A5KA 1YMHE 2J7QB 3L0WB 1MKEA 1ZDVA 3APFA 3TIXA 2L76A 2DZJA 1MJDA 5GXGB 2RDBC 2MCNB 3OANA 2C7NB 1YNTE 2JPHA 2H88B 2YT1A 2K6DB 2E6XA 3CF6E 1HBKA 1AW7A 2D3GA 2WDVB 3ZDTA 1IBXB 4WJQA 2XQNM 2D5GA 3GYOA 5FI1A 4EEWA 4EJNA 4MY6A 2GB1A 2JF5A 1OMWA 3KZ1A 3BVZA 1ESFA 4EOYA 5FR6A 4RM8A 3ZLZA 2MP2A 3F5RA 2V3NA 3A1QB 5HE1A 4JKAA 1L6UA 2YS1A 1WM3A 3FKYA 2WXFA 1FHWA 4GIVA 4WVFB 1L2NA 3R3MA 1WGRA 3A9KB 4IM0A 1ZDXA 3FAHA 2FUG1 2KN5A 2L32A 3IAS1 4K17A 5D3WA 4Q2JA 3KYCD 4F7ZA 1XODA 2WYQA 4ICVA 2EMTA 2DFKA 4AP4C 3P4QB 3BVGA 2KMCA 2KDFB 4IM3A 5DPTA 1ZW7A 1C76A 1FM0D 5JHGA 3L13A 1YN5A 2QMTA 4HPPA 3WA0A 1WI1A 1MFWA 4GPTB 3DVNV 3HK0A 4LNKA 1XEEA 1CZPA 4W9HA 1FPYA 2JYEA 1F52A 2P0DA 4K2PA 1NVID 3JSVA 1PYWD 4LDTD 1WX7A 1QF6A 1SF0A 4DBBA 2DYMA 2JSVX 1N5XA 4GNKB 3VTWA 4KKIA 3PZ8A 4HPMB 3SYXA 1WGQA 1RRBA 2AQ3B 3WAOA 4E3CA 3AE5B 1TKGA 3VVWB 5J2RA 3VOQA 1I4QA 1N62A 4KKJA 3I63C 3P4SB 4NZLB 2L7RA 1N3HA 4NSWA 3RD2A 3LYYA 3P6AA 4QAYA 2P8VA 4GDKB 5BYRA 3PS6A 3P4PB 5D3VA 2R2QA 3LB8C 3CIRB 2K22A 1UNQA 2KX0A 2VSZA 2NPTB 2N9LA 3FC4A 1HE8A 2IGHA 3H8HA 3E9SA 3PVUA 2D9YA 2D07B 4IWPA 2MA9B 1P1AA 4HVBA 4S17A 2GI9A 4RCOA 2DNFA 1LFDA 4KAXB 1WGYA 2BF8B 4QJ4B 2KQ7A 3A9JB 1WG7A 2DX5B 4XX5A 4JX1C 4ANWA 1C9FA 2K1FA 1VZ6A 2B3AA 3Q3MC 4KIKA 3A58A 1XT9B 2BB5A 2DYBA 3ZVVA 1E8ZA 1U5DA 4OVUA 4G50A 1P7EA 4K81A 5C16A 2LZ6A 2I1KA 4MT5A 1Y5OA 2KTRA 3TFMA 3TJPA 3QBVB 3EHVA 3MC9A 1UF0A 3R7QA 3ODWA 2CU3A
chains in the Genus database with same CATH topology
4GMVA 1DDWA 4XWXA 2N4FA 1V5MA 4NQKE 3UQAA 4K2OA 1KBLA 4E74A 2K6QA 1Y19B 1L7YA 5JHAA 2NZ8B 1Z87A 3DOWA 3HHMA 3JSVB 4NAWA 3M3JA 4BFRA 2KD0A 4ASWC 4F8CB 5J3YA 3WANA 1FHXA 3TO1A 2GBRA 5LLIA 2IO1B 2CB8A 4DHZE 2C9WB 3UINB 2RGFA 4ILGB 2L1CA 1RAXA 3H9DA 2ZCCA 1OEYJ 3ZNGC 2LJ5A 3RCZA 2X0SA 5JVLA 4W9DA 2PPHA 4MJSB 3LJUX 1WJMA 2KZRA 1G6JA 3U7DA 2BYFA 3U30A 3TCAA 3CSFA 3H1UA 4JK8A 2M1MA 2ROVA 2DHZA 5CHFA 3V61A 4JL9A 2LWPA 3NY5A 4DX90 2K00A 4YONA 4PS7A 1E8WA 1Y8RC 2FAZA 2N0YA 4KV2A 3BINA 3QAQA 2V4LA 2G35A 4ICUA 5IAAC 3E9PA 5D27A 1XD4A 3SHQA 1LB1A 4W9LA 5C5BB 3V6CB 5AEKB 5EFXA 1EO6A 2MDXA 2D11A 1VCBA 2CRFA 3N7CA 2DHKA 2Q13A 2CHZA 3AU4A 1H4RA 3U8ZA 4GMXB 2HD5B 1UGMA 2MRPA 2LXAA 1C3TA 4EZKA 5IA7A 1GUAB 2LVOA 4BBNF 2ZNVC 2RPQA 2Y5BB 5DHAB 1FGYA 3R66C 1HB8A 2UWQA 3JVZX 4CHJA 3PG7A 1FHOA 4GGQA 3ULBA 4IOYX 1B55A 2N7DA 2J0KA 1SIFA 1YJ1A 3VH3B 4CO7A 4LJOB 2RQ1A 5JZEB 3QHTA 3OLMD 2CAYA 3KH0A 1M7EA 4BVUC 1KOTA 1Q1OA 1KI1B 1XCGA 1RLFA 2HRJA 1LXDA 4IW0A 3ZVRA 3FLVA 3NS8A 1TGZB 2BCJA 4CHMA 3V60A 4G3XB 4JGHB 3A98B 2KLCA 3HQCA 4HAZB 3HM3A 4ZRJA 1WX8A 1I2HA 3R7RA 4B6WA 4JK9A 3ZW3A 2K25A 1FAOA 3VHTC 2GOWA 1MIZB 1MIXA 1P5TA 1LQBA 2R09A 1LM8B 2VRWB 4BKTA 3O96A 3ZTDA 3V5WA 3ML8A 3PP2A 4G0NB 2KFKA 3KUZA 4WJNA 3L54A 2KGXB 1KJTA 3RCPA 3C0RB 2VKIA 3NSUA 1XX0A 2N9EB 3PRMB 3D8DA 2ABDA 2KJHB 2J0MA 2I5CA 1WY8A 2VRRB 1GNUA 2DHIA 2IFSA 4AUQC 2MBHA 4DK5A 4BKGA 3ONSA 1ISNA 3WIMA 5JHBA 2DZIA 4BKSD 3PV1A 3G9WA 1DBHA 3P2BA 2KK8A 3VUXA 2JY6A 3ZNZB 2GBKA 2D9ZA 1ZM0A 1P98A 4JKHA 2GBMA 1FOEA 3A1QA 4ZRKA 1VBGA 4GN1A 3IFWB 5FI0A 4KDIC 2NMBA 3A9KA 2ZPYA 2MKRA 3RULA 2KANA 4MGYE 2CODA 1QQGA 3AXCA 4DWFA 5J18A 2WDTB 2Z0QA 1OQYA 2KX3A 1XKEA 1M94A 4ANUA 4BOSC 2W2XD 2EKEC 4TKNA 1DDVA 3DQVA 4DDGD 2GBNA 2NR2A 4MT7A 1UPQA 2LBBA 2GBJA 2DIKA 5GMVA 3LDZE 1P3RA 4RM9A 5DPRA 2CR5A 2HTHA 1WE6A 3PHWB 3ML4A 2KFKB 4GSWA 2YT0A 1QZEA 1J8CA 4ZDVA 4BBKA 5CLQB 5CLLB 3MHSD 2L05A 2K8BA 2LOZA 5L95C 4JKCA 1WE7A 4W9GA 3OAWA 4LCDE 3QX1A 2D10A 3QARA 4MK0A 1J0GA 4HB3B 3NZSA 4AWJA 4BOZB 3SU8X 5D6JB 3T9LA 1J0WA 2NPTA 4W9IA 2MFQA 5AZFA 4JKBA 2COAA 2KDEB 1V49A 1R4NI 1K5DB 5AZGA 3A9JA 2DX5A 4HAXB 4GB9A 1UZXB 3VQIA 4FJVB 4NY0A 3WAPA 1XR0B 4PS3A 2NBVB 3A8QA 2QKMA 2BKRB 2Y8GA 4EZLA 3DVGX 2LRWA 3B0AA 3S2AA 1OEYA 2A4ZA 2UYZB 2M0XA 5DI9B 1NTIA 5D3XA 1ZVRA 4L6EA 4EKUA 4FJYA 2PEAA 3PRZA 2LUEA 3SBGA 3ECIA 2L3ZA 2GCLA 2N9XA 2FIFA 1F9JA 2R2OA 2RD0A 5TR5A 3NHEB 3KYDD 4D0NB 1K8RB 1U4AA 5BO4B 2HTHB 5CHVC 2K8HA 1W1GA 3TBLD 3EPYA 3PZDA 5C79A 5C6RA 2EJ8A 3QQ8B 2N1VA 4A6KA 1WGGA 4JKFA 2PE9A 1BAKA 1ACAA 2BPSA 2CU1A 3DBLI 3ULCA 2DTCA 4MH0E 2L0TA 1WZ3A 4LJPB 4MJSA 3RYTA 1FB8A 4MDKE 4NJ6A 4MSMB 1EGXA 2ZNVB 2PZ1A 2BYEA 1WXMA 4WAAA 2MBQA 3DXDA 4II2B 2L2IA 2JXXA 2NCNA 1ST7A 4W9EA 2AEHA 2BGFA 2M38A 1YIWA 2FCSA 1GC7A 2FNJB 4ILJA 1NVLA 1V5PA 2Z0DB 5L81A 5DCNA 1WJ6A 2JWZA 5JHHA 4DBGA 2D4QA 2LULA 3QIJA 4M0WB 4LDTB 2J0JA 1QC6A 1P0RA 5C5BA 4J6IA 4NPNA 4HB0B 4YL8A 2KTFA 2ELBA 1NBFC 3UGBB 1E8YA 4AOFA 3SO6A 3DCGA 1P6SA 3DDCB 4KZ0A 3IHPC 3D8FA 1U29A 4E71A 2G4SA 4FA6A 1MK9B 3QK0A 1TJ6A 4PQ0A 1UBQA 2KC1A 2DYQA 1JDEA 1TQZA 3SBTA 4W9FA 3V6EB 2IYDB 1V5UA 1JRUA 2MBOA 1TZ1A 4M8MA 4KSLC 2RGNB 4TV3A 4HPLB 1P9DU 4FHKA 5G2NA 3AJ4A 2R82A 4N9F4 3TVVA 4ZRIA 2COFA 1M7RA 3PEGA 3VIAA 2IO0B 3ODOA 1XD3B 4HXDA 4HAUB 2JT4B 3AI5A 2M14A 1SGHA 2PJHA 4JKGB 1XQQA 3B1LX 2W9NA 3CSTA 4IAPA 3RZWC 3A4RA 1K5GB 3EECA 1WJ1A 4JQWC 3L08A 4KZCA 3PLVA 1C1YB 1Q5WB 2JZ3B 3PREA 1X1GA 2YVCA 4HDOA 2JP2A 5L83A 4CYEA 3RT3B 2FJ9A 2C5LC 2P0FA 3KSYA 1WX9A 2COCA 1WGDA 1WVHA 1HB6A 3ZO5B 3FEHA 3HIZA 4GXBA 2LRUA 1CMXB 3ALBA 3VFKA 2M17A 3PRPB 3SDLC 2DYOA 4IC7B 2ZCBA 3PHXB 5HE0A 3VAWA 1KZ7A 1E90A 1WFYA 3PSEB 4HATB 3M1IB 3ZRFA 1X1MA 1GGOA 3CIKA 5D94A 1W1DA 3QJZA 2GJYA 3Q3FA 3V62A 3VH4B 4ANVA 4F7HA 4EMOA 2QKLA 3SUZA 1LW3A 4A6HA 3E9LA 4F1SA 4WJ7A 2D2QA 3DBSA 4WWPA 2P0HA 2DKQA 2H7DA 1MK7B 2YSZA 2JRHA 3KUDB 3DXEA 4GU2A 1I42A 4GDLB 2LVQA 3TL5A 3TW1A 1UH6A 3ZRCA 3UIOB 1ZC4B 2REXA 1WXVA 3T8MA 3HW2B 3DXCA 1WYWB 4I6LB 1BT0A 4CHKA 4RMAA 3QWZB 2FCQA 3VUWA 1GG3A 1UEFA 1W1HA 2D9WA 1DIKA 3RUIB 1UPRA 1EUVB 1SE9A 1OY2A 5JH5C 1NDDA 3L16A 1Q0WB 4HCNB 3OJ3A 2R0DA 3M62B 2O2VB 4PNKA 4A6FB 1YX6B 4Z2NA 2Z0EB 4HK2A 4II3B 1WF9A 2OJRA 2EC1A 4H8SA 3NZUA 1NU2A 3N3KB 5HKHA 4X57B 2LGXA 4EUTA 1NI2A 4MGKE 1WIAA 4TUUA 5DPSA 2KCJA 3QWMA 4C0AA 4B6HA 3APCA 2RUKB 3MDBC 2RSUA 1V5OA 2A5UA 2O6VD 2LGDA 4XC2A 3E9OA 1WRDB 4ZYNA 4ILHA 2I5FA 1WMHA 5GOWB 3VDZA 2YLMA 1PFJA 4WWNA 3MPXA 2KC2A 5G55A 3ZUNA 4FBJB 1WM2A 1EAZA 3BY4B 3GYPA 2V1YA 4TYZA 4FN2A 4MGZE 2PE6B 2FJLA 1WXAA 5D2MB 1Z2MA 1V81A 4FULA 2KWUB 4BBNC 2LVPA 2MWSB 5LXIB 2WWZA 1V86A 3DBHI 3PGEA 1V88A 4KVGB 3E66A 1NTVA 3I3TB 1KLVA 4EZJA 5EDSA 1RJ2A 5CTRC 4HAYB 1OTRB 4EFOA 4NQLB 5KQ4A 5E6NA 3M63B 3VUYA 3WALA 2X18A 4GOCA 1PMSA 2CS4A 4HAVB 4HDQA 4DX8A 5CHWA 3PPAA 4WWOA 1I7AA 4A3PA 3SNHA 3VTVA 4Z2MB 3WAMA 4DXAB 1EF5A 4NJ7A 2N23A 2O6VB 5J3TA 2WX1A 2K8CA 5C1ZA 2KJ6A 3KUCB 1WJ4A 3M95A 2LOXA 1V80A 1Z5SB 1OGWA 3QA8A 1U2BA 4KSKC 1OQNA 1AWEA 3ZTCA 1WMHB 3EC8A 4HJKA 1E7UA 1WGHA 2AL6A 3W1YA 4B9KA 2RVBB 2HJ8A 4TQ0A 4KHOA 1EVHA 2V3SA 1IYFA 2KFJA 5LXHA 1IP9A 4HB2B 3D8EA 3P7ZA 4Y94A 1U5GA 2YS3A 2L00B 2FCNA 4A3OA 2RNRB 2KWVB 2MQJA 2KDBA 4MGIE 3FP5A 5E6OA 3W1SA 2ZEQA 3DPDA 1GJZA 4M8NA 2KWCA 4HCPB 2D9XA 5E6PA 1UNPA 2BYVE 2ELAA 3L10B 4OVVA 3B08A 1YX5B 1U5FA 5LOPB 2AYOB 1AARA 2YF0A 4HLEA 3D32A 4FHJA 1TTNA 1MG8A 2Z0OA 2EMSA 3KW5B 2ROZB 2GMIC 2J59M 4MM3A 4FADA 2LKOA 1KM7A 5D7GA 3PVLA 2K2JA 1VD2A 2YS5A 3ENEA 4W9JA 2ZZPB 3AULA 3NOBA 4K7UA 1Q67A 2UZRA 2C7MB 4HAWB 5DPWA 3H7SA 3ZKJC 2I1JA 5DHFB 2MP2B 5AZHA 4F7GA 2COPA 2DX1A 3Q3JA 2NBUA 1V5TA 3SD5A 4IFSA 2DLWA 4JKGA 2Y7BA 1ZC3B 3H7PA 4F7UP 3WYFB 3FSSA 3DVGY 2LG1A 2ASQA 2AWTA 1WXSA 1E7VA 5D3YA 3PVWA 1BWNA 2IO2B 4KHBB 1V61A 3KY9A 2NVUI 4DHJD 5JP4A 2L0FA 3KVFB 5KQ1A 2CHXA 2OOBB 5KHOA 2M8SA 1H10A 1WJUA 3N30A 5C23A 4JLCA 4IM2A 1WI0A 2DAJA 2ZVOA 4IWQA 4TQ1A 3QCAA 4FJZA 5IJMA 3IVFA 3F0WA 4WQOB 4JKDA 3T06A 5HE2A 4W9KA 2KNBA 5KCVA 4WJPA 2W2XC 3TMPB 1KC7A 1RFAA 4GZUA 3H6NA 2G4DB 2WX0A 2LGYA 3A4SC 1TBEA 4KHAA 2DN6A 1UBIA 3EFUA 1MAIA 2DZMA 1BTKA 1SHCA 2RLOA 2G3QB 2H7EA 1U5EA 3PSCA 4HWIB 1VBHA 1I35A 2JVCA 3HM6X 1DROA 1V6EA 4P7IA 2BWES 4K1RB 3KRWA 4PYZA 5KHQA 1J19A 2ZPNA 4KIKB 1IRSA 4WSFA 1YD8U 1ZKHA 3LJ3A 3H7PB 4DHJB 2MW5A 2V76A 3ZIMA 4JIOU 1X11A 3UQBA 1WJNA 4GDLA 2BKFA 2KTRB 3MTNB 2KHWB 1KZGA 1H8CA 3O65B 2DA0A 1D3ZA 2OTXA 4XZ4A 2NBWB 1X05A 1X1FA 2C7HA 1X86A 2DYNA 1FXTB 3PT2B 2XK5A 1V9JA 1U27A 2KJRA 1AQCA 2IO3B 1PLSA 1WZ0A 4HB4B 4AJYB 4G11A 4NAWB 2DHJA 3ENBA 3APDA 1GC6A 2XBBC 4PS8A 2LASA 1E8XA 2O2VA 3ZNHB 2GS0A 4A6FA 2C60A 4URKA 2MBBB 1UNRA 4I6NB 2WH5A 5LONB 3RZFA 2W2WA 2RSGA 2HE7A 3DBRI 2IYBA 4MEMA 2BWFA 1EF1A 1A5RA 1ZSQA 3MJWA 3IG3A 4A20A 3ZNID 2LYDA 1P3QU 2MLBA 1PQSA 2FDQA 2KLGA 2XEWA 4W9CA 1BTNA 2KVRA 2G45B 2DAFA 2JZZA 4MSQB 2KUPA 2N7EA 2OQBA 3A8PA 4K7WA 2L8JA 2JRIB 1ZGUB 2DZKA 1YQBA 2JUOA 2KQSA 3A33B 1WH3A 3X0WA 2IZVB 1TXDA 2CY5A 2NS5A 3W1SC 4HHVA 2Z0PA 2LI5A 2D9VA 3PTFC 1RRPB 2KKCA 2CQUA 3ZDMC 1UD7A 4BKSA 5CX3A 2XK5B 3UF8A 2KXJA 4AJWA 1V89A 2QHOA 3ODXA 5JLJB 1T0YA 3QC8B 4IG7B 2N1WA 4DDID 2MWNB 2UVMA 1WR6E 3IBEA 2CHWA 4FLHA 2UZSA 2YRYA 1DDMA 1R4MI 2O6VA 2DKPA 4I6PA 2LD9A 3PLUA 3SV1A 1WGUA 3CMMB 3DVNU 2IY0B 2CY4A 2KOXA 2E2XA 2IY1B 3UIPB 4JK7A 3CXBB 3UZTA 3VXWA 1DYNA 2MBEA 2GCJA 3OJ4B 4MELA 4IWOA 4B95A 2K2UA 2Y8FA 3JW0X 3K9OB 4PYUA 2Z59B 4IUMB 3AU5A 3ML9A 3K9PB 2FUHB 2AL3A 2IBIB 3KRXA 2M4NA 3VTUA 1FGZA 2MSED 3FM8C 1WR1A 4WJOA 2K39A 1S1QB 2ADZA 1NTYA 5DIFB 5HE3A 3L17A 2DENB 1IPGA 2KMAA 4JKEA 2FCMA 2N9PC 3GOEA 5DH9B 2ZVNA 4K7SA 2MX2A 3JYUA 1E5WA 4NNJB 3BJIA 3GZNI 3N32A 2ZJDA 4KDLB 1S3SG 2KDIA 4ANXA 2LXCA 5J17A 2FIDA 1MPHA 4DHZB 2RR9A 5J3QA 2CKHB 2KO3A 1V2YA 4GDKA 1UELA 3X23A 4A5KA 3L0WB 2J7QB 1MKEA 3APFA 3TIXA 2L76A 2DZJA 2MCNB 3OANA 2C7NB 2JPHA 2YT1A 2K6DB 3CF6E 1HBKA 2D3GA 3ZDTA 4WJQA 2XQNM 3GYOA 5FI1A 4EEWA 4EJNA 4MY6A 2JF5A 1OMWA 3KZ1A 4EOYA 5FR6A 4RM8A 3ZLZA 2MP2A 3F5RA 3A1QB 5HE1A 4JKAA 2YS1A 1WM3A 1FHWA 4GIVA 4WVFB 1L2NA 3R3MA 1WGRA 3A9KB 4IM0A 2KN5A 4K17A 5D3WA 3KYCD 4F7ZA 1XODA 2WYQA 4ICVA 2EMTA 2DFKA 4AP4C 2KMCA 2KDFB 4IM3A 5DPTA 1ZW7A 5JHGA 3L13A 3WA0A 1WI1A 4GPTB 3DVNV 3HK0A 4W9HA 2P0DA 4K2PA 3JSVA 4LDTD 1WX7A 4DBBA 2DYMA 3VTWA 4HPMB 3SYXA 1WGQA 1RRBA 3WAOA 4E3CA 3VVWB 5J2RA 3VOQA 2L7RA 3RD2A 1N3HA 4NSWA 3P6AA 2P8VA 4GDKB 3PS6A 2R2QA 5D3VA 1UNQA 2KX0A 2VSZA 2NPTB 1HE8A 3PVUA 2D9YA 2D07B 4IWPA 2MA9B 1P1AA 4HVBA 1LFDA 4KAXB 1WGYA 2BF8B 2KQ7A 3A9JB 1WG7A 2DX5B 4XX5A 4ANWA 2K1FA 2B3AA 4KIKA 1XT9B 2DYBA 3ZVVA 1E8ZA 1U5DA 4OVUA 4G50A 4K81A 5C16A 2LZ6A 2I1KA 1Y5OA 2KTRA 3TFMA 3TJPA 3QBVB 3EHVA 3R7QA 3ODWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMV A;  1DDW A;  4XWX A;  2N4F A;  1V5M A;  4NQK E;  3UQA A;  4K2O A;  4E74 A;  2K6Q A;  1Y19 B;  1L7Y A;  5JHA A;  2NZ8 B;  1Z87 A;  3DOW A;  3HHM A;  3JSV B;  4NAW A;  3M3J A;  4BFR A;  2KD0 A;  4ASW C;  4F8C B;  5J3Y A;  3WAN A;  1FHX A;  3TO1 A;  2GBR A;  5LLI A;  2IO1 B;  2CB8 A;  4DHZ E;  2C9W B;  3UIN B;  2RGF A;  2L1C A;  1RAX A;  3H9D A;  2ZCC A;  1OEY J;  3ZNG C;  2LJ5 A;  3RCZ A;  4W9D A;  2PPH A;  4MJS B;  3LJU X;  1WJM A;  2KZR A;  1G6J A;  3U7D A;  2BYF A;  3U30 A;  3TCA A;  3CSF A;  3H1U A;  2M1M A;  2ROV A;  2DHZ A;  5CHF A;  3V61 A;  4JL9 A;  2LWP A;  3NY5 A;  4DX9 0;  2K00 A;  4YON A;  4PS7 A;  1E8W A;  1Y8R C;  2FAZ A;  2N0Y A;  4KV2 A;  3BIN A;  3QAQ A;  2V4L A;  2G35 A;  4ICU A;  5IAA C;  5D27 A;  1XD4 A;  3SHQ A;  1LB1 A;  4W9L A;  5C5B B;  3V6C B;  5AEK B;  5EFX A;  1EO6 A;  2MDX A;  2D11 A;  1VCB A;  2CRF A;  3N7C A;  2DHK A;  2Q13 A;  2CHZ A;  3AU4 A;  1H4R A;  3U8Z A;  4GMX B;  2HD5 B;  1UGM A;  2MRP A;  2LXA A;  1C3T A;  4EZK A;  5IA7 A;  1GUA B;  2LVO A;  4BBN F;  2ZNV C;  2RPQ A;  2Y5B B;  5DHA B;  1FGY A;  3R66 C;  1HB8 A;  2UWQ A;  3JVZ X;  4CHJ A;  3PG7 A;  1FHO A;  4GGQ A;  3ULB A;  4IOY X;  1B55 A;  2N7D A;  2J0K A;  1SIF A;  1YJ1 A;  3VH3 B;  4CO7 A;  4LJO B;  2RQ1 A;  5JZE B;  3QHT A;  3OLM D;  2CAY A;  3KH0 A;  1M7E A;  4BVU C;  1KOT A;  1Q1O A;  1KI1 B;  1XCG A;  1RLF A;  2HRJ A;  1LXD A;  4IW0 A;  3ZVR A;  3FLV A;  3NS8 A;  1TGZ B;  2BCJ A;  4CHM A;  3V60 A;  4G3X B;  4JGH B;  3A98 B;  2KLC A;  3HQC A;  4HAZ B;  3HM3 A;  4ZRJ A;  1WX8 A;  1I2H A;  3R7R A;  4B6W A;  3ZW3 A;  2K25 A;  1FAO A;  3VHT C;  2GOW A;  1MIZ B;  1MIX A;  1P5T A;  1LQB A;  2R09 A;  1LM8 B;  2VRW B;  4BKT A;  3O96 A;  3ZTD A;  3V5W A;  3ML8 A;  3PP2 A;  4G0N B;  2KFK A;  3KUZ A;  4WJN A;  3L54 A;  2KGX B;  1KJT A;  3RCP A;  3C0R B;  2VKI A;  3NSU A;  1XX0 A;  2N9E B;  3PRM B;  3D8D A;  2ABD A;  2KJH B;  2J0M A;  2I5C A;  1WY8 A;  2VRR B;  1GNU A;  2DHI A;  2IFS A;  4AUQ C;  2MBH A;  4DK5 A;  4BKG A;  3ONS A;  1ISN A;  3WIM A;  5JHB A;  2DZI A;  4BKS D;  3PV1 A;  3G9W A;  1DBH A;  3P2B A;  2KK8 A;  3VUX A;  2JY6 A;  3ZNZ B;  2GBK A;  2D9Z A;  1ZM0 A;  1P98 A;  2GBM A;  1FOE A;  3A1Q A;  4ZRK A;  4GN1 A;  3IFW B;  5FI0 A;  4KDI C;  2NMB A;  3A9K A;  2ZPY A;  2MKR A;  3RUL A;  2KAN A;  4MGY E;  2COD A;  1QQG A;  3AXC A;  4DWF A;  5J18 A;  2WDT B;  2Z0Q A;  1OQY A;  2KX3 A;  1XKE A;  1M94 A;  4ANU A;  4BOS C;  2W2X D;  2EKE C;  4TKN A;  1DDV A;  3DQV A;  4DDG D;  2GBN A;  2NR2 A;  4MT7 A;  1UPQ A;  2LBB A;  2GBJ A;  5GMV A;  3LDZ E;  1P3R A;  4RM9 A;  5DPR A;  2CR5 A;  2HTH A;  1WE6 A;  3PHW B;  3ML4 A;  2KFK B;  4GSW A;  2YT0 A;  1QZE A;  1J8C A;  4ZDV A;  4BBK A;  5CLQ B;  5CLL B;  3MHS D;  2L05 A;  2K8B A;  2LOZ A;  5L95 C;  1WE7 A;  4W9G A;  3OAW A;  4LCD E;  3QX1 A;  2D10 A;  3QAR A;  4MK0 A;  1J0G A;  4HB3 B;  3NZS A;  4AWJ A;  4BOZ B;  3SU8 X;  5D6J B;  3T9L A;  1J0W A;  2NPT A;  4W9I A;  2MFQ A;  5AZF A;  2COA A;  2KDE B;  1V49 A;  1R4N I;  1K5D B;  5AZG A;  3A9J A;  2DX5 A;  4HAX B;  4GB9 A;  1UZX B;  3VQI A;  4FJV B;  3WAP A;  4NY0 A;  1XR0 B;  4PS3 A;  2NBV B;  3A8Q A;  2QKM A;  2BKR B;  2Y8G A;  4EZL A;  3DVG X;  2LRW A;  3B0A A;  3S2A A;  1OEY A;  2A4Z A;  2UYZ B;  2M0X A;  5DI9 B;  1NTI A;  5D3X A;  1ZVR A;  4L6E A;  4EKU A;  4FJY A;  2PEA A;  3PRZ A;  2LUE A;  3ECI A;  2L3Z A;  2GCL A;  2N9X A;  2FIF A;  1F9J A;  2R2O A;  2RD0 A;  5TR5 A;  3NHE B;  3KYD D;  4D0N B;  1K8R B;  1U4A A;  5BO4 B;  2HTH B;  5CHV C;  2K8H A;  1W1G A;  3TBL D;  3EPY A;  3PZD A;  5C79 A;  5C6R A;  2EJ8 A;  3QQ8 B;  2N1V A;  4A6K A;  1WGG A;  2PE9 A;  1BAK A;  1ACA A;  2BPS A;  2CU1 A;  3DBL I;  3ULC A;  2DTC A;  4MH0 E;  2L0T A;  1WZ3 A;  4LJP B;  4MJS A;  3RYT A;  1FB8 A;  4MDK E;  4NJ6 A;  4MSM B;  1EGX A;  2ZNV B;  2PZ1 A;  2BYE A;  1WXM A;  4WAA A;  2MBQ A;  3DXD A;  4II2 B;  2L2I A;  2JXX A;  2NCN A;  1ST7 A;  4W9E A;  2AEH A;  2BGF A;  2M38 A;  1YIW A;  2FCS A;  1GC7 A;  2FNJ B;  1NVL A;  1V5P A;  2Z0D B;  5L81 A;  5DCN A;  1WJ6 A;  2JWZ A;  5JHH A;  4DBG A;  2D4Q A;  2LUL A;  3QIJ A;  4M0W B;  4LDT B;  2J0J A;  1QC6 A;  1P0R A;  5C5B A;  4J6I A;  4NPN A;  4HB0 B;  4YL8 A;  2KTF A;  2ELB A;  1NBF C;  3UGB B;  1E8Y A;  4AOF A;  3SO6 A;  3DCG A;  1P6S A;  3DDC B;  4KZ0 A;  3IHP C;  3D8F A;  1U29 A;  4E71 A;  2G4S A;  4FA6 A;  1MK9 B;  3QK0 A;  1TJ6 A;  4PQ0 A;  1UBQ A;  2KC1 A;  2DYQ A;  1TQZ A;  4W9F A;  3V6E B;  2IYD B;  1V5U A;  1JRU A;  2MBO A;  1TZ1 A;  4M8M A;  4KSL C;  2RGN B;  4TV3 A;  4HPL B;  1P9D U;  4FHK A;  5G2N A;  3AJ4 A;  4N9F 4;  3TVV A;  4ZRI A;  2COF A;  1M7R A;  3PEG A;  3VIA A;  2IO0 B;  3ODO A;  1XD3 B;  4HXD A;  4HAU B;  2JT4 B;  3AI5 A;  2M14 A;  1SGH A;  2PJH A;  1XQQ A;  3B1L X;  2W9N A;  3CST A;  4IAP A;  3RZW C;  3A4R A;  1K5G B;  3EEC A;  1WJ1 A;  4JQW C;  3L08 A;  4KZC A;  3PLV A;  1C1Y B;  1Q5W B;  2JZ3 B;  3PRE A;  1X1G A;  2YVC A;  4HDO A;  2JP2 A;  5L83 A;  4CYE A;  3RT3 B;  2FJ9 A;  2C5L C;  2P0F A;  3KSY A;  1WX9 A;  2COC A;  1WGD A;  1WVH A;  1HB6 A;  3ZO5 B;  3FEH A;  3HIZ A;  4GXB A;  2LRU A;  1CMX B;  3ALB A;  3VFK A;  2M17 A;  3PRP B;  3SDL C;  2DYO A;  4IC7 B;  2ZCB A;  3PHX B;  5HE0 A;  3VAW A;  1KZ7 A;  1E90 A;  1WFY A;  3PSE B;  4HAT B;  3M1I B;  3ZRF A;  1X1M A;  3CIK A;  5D94 A;  1W1D A;  3QJZ A;  2GJY A;  3Q3F A;  3V62 A;  3VH4 B;  4ANV A;  4F7H A;  4EMO A;  2QKL A;  3SUZ A;  1LW3 A;  4A6H A;  4F1S A;  4WJ7 A;  2D2Q A;  3DBS A;  4WWP A;  2P0H A;  2DKQ A;  2H7D A;  1MK7 B;  2YSZ A;  2JRH A;  3KUD B;  3DXE A;  4GU2 A;  1I42 A;  4GDL B;  2LVQ A;  3TL5 A;  3TW1 A;  1UH6 A;  3ZRC A;  3UIO B;  1ZC4 B;  2REX A;  1WXV A;  3T8M A;  3HW2 B;  3DXC A;  1WYW B;  4I6L B;  1BT0 A;  4CHK A;  4RMA A;  3QWZ B;  2FCQ A;  3VUW A;  1GG3 A;  1UEF A;  1W1H A;  2D9W A;  3RUI B;  1UPR A;  1EUV B;  1SE9 A;  1OY2 A;  5JH5 C;  1NDD A;  3L16 A;  1Q0W B;  4HCN B;  3OJ3 A;  2R0D A;  3M62 B;  2O2V B;  4PNK A;  4A6F B;  1YX6 B;  4Z2N A;  2Z0E B;  4HK2 A;  4II3 B;  1WF9 A;  2OJR A;  2EC1 A;  4H8S A;  3NZU A;  1NU2 A;  3N3K B;  5HKH A;  4X57 B;  2LGX A;  4EUT A;  1NI2 A;  4MGK E;  1WIA A;  4TUU A;  5DPS A;  2KCJ A;  3QWM A;  4C0A A;  4B6H A;  3APC A;  2RUK B;  3MDB C;  2RSU A;  1V5O A;  2A5U A;  2O6V D;  2LGD A;  4XC2 A;  1WRD B;  4ZYN A;  2I5F A;  1WMH A;  5GOW B;  3VDZ A;  2YLM A;  1PFJ A;  4WWN A;  3MPX A;  2KC2 A;  5G55 A;  3ZUN A;  4FBJ B;  1WM2 A;  1EAZ A;  3BY4 B;  3GYP A;  2V1Y A;  4TYZ A;  4FN2 A;  4MGZ E;  2PE6 B;  2FJL A;  1WXA A;  5D2M B;  1Z2M A;  1V81 A;  4FUL A;  2KWU B;  4BBN C;  2LVP A;  2MWS B;  5LXI B;  2WWZ A;  1V86 A;  3DBH I;  3PGE A;  1V88 A;  4KVG B;  1NTV A;  3I3T B;  1KLV A;  4EZJ A;  5EDS A;  1RJ2 A;  5CTR C;  4HAY B;  1OTR B;  4EFO A;  4NQL B;  5KQ4 A;  5E6N A;  3M63 B;  3VUY A;  3WAL A;  2X18 A;  4GOC A;  1PMS A;  2CS4 A;  4HAV B;  4HDQ A;  4DX8 A;  5CHW A;  3PPA A;  4WWO A;  1I7A A;  4A3P A;  3SNH A;  3VTV A;  4Z2M B;  3WAM A;  4DXA B;  1EF5 A;  4NJ7 A;  2N23 A;  2O6V B;  5J3T A;  2WX1 A;  2K8C A;  5C1Z A;  2KJ6 A;  3KUC B;  1WJ4 A;  3M95 A;  2LOX A;  1V80 A;  1Z5S B;  1OGW A;  3QA8 A;  1U2B A;  4KSK C;  1OQN A;  1AWE A;  3ZTC A;  1WMH B;  3EC8 A;  4HJK A;  1E7U A;  1WGH A;  2AL6 A;  3W1Y A;  4B9K A;  2RVB B;  2HJ8 A;  4TQ0 A;  4KHO A;  1EVH A;  2V3S A;  1IYF A;  2KFJ A;  5LXH A;  1IP9 A;  4HB2 B;  3D8E A;  3P7Z A;  4Y94 A;  1U5G A;  2YS3 A;  2L00 B;  2FCN A;  4A3O A;  2RNR B;  2KWV B;  2MQJ A;  2KDB A;  4MGI E;  3FP5 A;  5E6O A;  3W1S A;  2ZEQ A;  3DPD A;  1GJZ A;  4M8N A;  2KWC A;  4HCP B;  2D9X A;  5E6P A;  1UNP A;  2BYV E;  2ELA A;  3L10 B;  4OVV A;  3B08 A;  1YX5 B;  1U5F A;  5LOP B;  2AYO B;  1AAR A;  2YF0 A;  4HLE A;  3D32 A;  4FHJ A;  1TTN A;  1MG8 A;  2Z0O A;  2EMS A;  3KW5 B;  2ROZ B;  2GMI C;  2J59 M;  4MM3 A;  4FAD A;  2LKO A;  1KM7 A;  5D7G A;  3PVL A;  2K2J A;  1VD2 A;  2YS5 A;  3ENE A;  4W9J A;  2ZZP B;  3AUL A;  3NOB A;  4K7U A;  1Q67 A;  2UZR A;  2C7M B;  4HAW B;  5DPW A;  3H7S A;  3ZKJ C;  2I1J A;  5DHF B;  2MP2 B;  5AZH A;  4F7G A;  2COP A;  2DX1 A;  3Q3J A;  2NBU A;  1V5T A;  3SD5 A;  4IFS A;  2DLW A;  2Y7B A;  1ZC3 B;  3H7P A;  4F7U P;  3WYF B;  3FSS A;  3DVG Y;  2LG1 A;  2ASQ A;  2AWT A;  1WXS A;  1E7V A;  5D3Y A;  3PVW A;  1BWN A;  2IO2 B;  4KHB B;  1V61 A;  3KY9 A;  2NVU I;  4DHJ D;  5JP4 A;  2L0F A;  3KVF B;  5KQ1 A;  2CHX A;  2OOB B;  5KHO A;  2M8S A;  1H10 A;  1WJU A;  3N30 A;  5C23 A;  4JLC A;  4IM2 A;  1WI0 A;  2DAJ A;  2ZVO A;  4IWQ A;  4TQ1 A;  3QCA A;  4FJZ A;  5IJM A;  3IVF A;  3F0W A;  4WQO B;  3T06 A;  5HE2 A;  4W9K A;  2KNB A;  5KCV A;  4WJP A;  2W2X C;  3TMP B;  1RFA A;  4GZU A;  3H6N A;  2G4D B;  2WX0 A;  2LGY A;  3A4S C;  1TBE A;  4KHA A;  2DN6 A;  1UBI A;  3EFU A;  1MAI A;  2DZM A;  1BTK A;  1SHC A;  2RLO A;  2G3Q B;  2H7E A;  1U5E A;  3PSC A;  4HWI B;  1I35 A;  2JVC A;  3HM6 X;  1DRO A;  1V6E A;  4P7I A;  2BWE S;  4K1R B;  3KRW A;  4PYZ A;  5KHQ A;  1J19 A;  2ZPN A;  4KIK B;  1IRS A;  4WSF A;  1YD8 U;  1ZKH A;  3LJ3 A;  3H7P B;  4DHJ B;  2MW5 A;  2V76 A;  3ZIM A;  4JIO U;  1X11 A;  3UQB A;  1WJN A;  4GDL A;  2BKF A;  2KTR B;  3MTN B;  2KHW B;  1KZG A;  1H8C A;  3O65 B;  2DA0 A;  1D3Z A;  2OTX A;  4XZ4 A;  2NBW B;  1X05 A;  1X1F A;  2C7H A;  1X86 A;  2DYN A;  1FXT B;  3PT2 B;  2XK5 A;  1V9J A;  1U27 A;  2KJR A;  1AQC A;  2IO3 B;  1PLS A;  1WZ0 A;  4HB4 B;  4AJY B;  4G11 A;  4NAW B;  2DHJ A;  3APD A;  1GC6 A;  2XBB C;  4PS8 A;  2LAS A;  1E8X A;  2O2V A;  3ZNH B;  2GS0 A;  4A6F A;  2C60 A;  4URK A;  2MBB B;  1UNR A;  4I6N B;  2WH5 A;  5LON B;  3RZF A;  2W2W A;  2RSG A;  2HE7 A;  3DBR I;  2IYB A;  4MEM A;  2BWF A;  1EF1 A;  1A5R A;  1ZSQ A;  3MJW A;  3IG3 A;  4A20 A;  3ZNI D;  2LYD A;  1P3Q U;  2MLB A;  1PQS A;  2FDQ A;  2KLG A;  2XEW A;  4W9C A;  1BTN A;  2KVR A;  2G45 B;  2DAF A;  2JZZ A;  4MSQ B;  2KUP A;  2N7E A;  2OQB A;  3A8P A;  4K7W A;  2L8J A;  2JRI B;  1ZGU B;  2DZK A;  1YQB A;  2JUO A;  2KQS A;  3A33 B;  1WH3 A;  3X0W A;  2IZV B;  1TXD A;  2CY5 A;  2NS5 A;  3W1S C;  4HHV A;  2Z0P A;  2LI5 A;  2D9V A;  3PTF C;  1RRP B;  2KKC A;  2CQU A;  3ZDM C;  1UD7 A;  4BKS A;  5CX3 A;  2XK5 B;  3UF8 A;  2KXJ A;  4AJW A;  1V89 A;  2QHO A;  3ODX A;  5JLJ B;  1T0Y A;  3QC8 B;  4IG7 B;  2N1W A;  4DDI D;  2MWN B;  2UVM A;  1WR6 E;  3IBE A;  2CHW A;  4FLH A;  2UZS A;  2YRY A;  1DDM A;  1R4M I;  2O6V A;  2DKP A;  4I6P A;  2LD9 A;  3PLU A;  3SV1 A;  1WGU A;  3CMM B;  3DVN U;  2IY0 B;  2CY4 A;  2KOX A;  2E2X A;  2IY1 B;  3UIP B;  3CXB B;  3UZT A;  3VXW A;  1DYN A;  2MBE A;  2GCJ A;  3OJ4 B;  4MEL A;  4IWO A;  4B95 A;  2K2U A;  2Y8F A;  3JW0 X;  3K9O B;  4PYU A;  2Z59 B;  4IUM B;  3AU5 A;  3ML9 A;  3K9P B;  2FUH B;  2AL3 A;  2IBI B;  3KRX A;  2M4N A;  3VTU A;  1FGZ A;  2MSE D;  3FM8 C;  1WR1 A;  4WJO A;  2K39 A;  1S1Q B;  2ADZ A;  1NTY A;  5DIF B;  5HE3 A;  3L17 A;  2DEN B;  1IPG A;  2KMA A;  2FCM A;  3GOE A;  2N9P C;  5DH9 B;  2ZVN A;  4K7S A;  2MX2 A;  3JYU A;  1E5W A;  4NNJ B;  3BJI A;  3GZN I;  3N32 A;  2ZJD A;  4KDL B;  1S3S G;  2KDI A;  4ANX A;  2LXC A;  5J17 A;  2FID A;  1MPH A;  4DHZ B;  2RR9 A;  5J3Q A;  2CKH B;  2KO3 A;  1V2Y A;  4GDK A;  1UEL A;  3X23 A;  4A5K A;  3L0W B;  2J7Q B;  1MKE A;  3APF A;  3TIX A;  2L76 A;  2DZJ A;  2MCN B;  3OAN A;  2C7N B;  2JPH A;  2YT1 A;  2K6D B;  3CF6 E;  1HBK A;  2D3G A;  3ZDT A;  4WJQ A;  2XQN M;  3GYO A;  5FI1 A;  4EEW A;  4EJN A;  4MY6 A;  2JF5 A;  1OMW A;  3KZ1 A;  4EOY A;  5FR6 A;  4RM8 A;  3ZLZ A;  2MP2 A;  3F5R A;  3A1Q B;  5HE1 A;  2YS1 A;  1WM3 A;  1FHW A;  4GIV A;  4WVF B;  1L2N A;  3R3M A;  1WGR A;  3A9K B;  4IM0 A;  2KN5 A;  4K17 A;  5D3W A;  3KYC D;  4F7Z A;  1XOD A;  2WYQ A;  4ICV A;  2EMT A;  2DFK A;  4AP4 C;  2KMC A;  2KDF B;  4IM3 A;  5DPT A;  1ZW7 A;  5JHG A;  3L13 A;  3WA0 A;  1WI1 A;  4GPT B;  3DVN V;  3HK0 A;  4W9H A;  2P0D A;  4K2P A;  3JSV A;  4LDT D;  1WX7 A;  4DBB A;  2DYM A;  3VTW A;  4HPM B;  3SYX A;  1WGQ A;  1RRB A;  3WAO A;  4E3C A;  3VVW B;  5J2R A;  3VOQ A;  2L7R A;  3RD2 A;  1N3H A;  4NSW A;  3P6A A;  2P8V A;  4GDK B;  3PS6 A;  2R2Q A;  5D3V A;  1UNQ A;  2KX0 A;  2VSZ A;  2NPT B;  1HE8 A;  3PVU A;  2D9Y A;  2D07 B;  4IWP A;  2MA9 B;  1P1A A;  4HVB A;  1LFD A;  4KAX B;  1WGY A;  2BF8 B;  2KQ7 A;  3A9J B;  1WG7 A;  2DX5 B;  4XX5 A;  4ANW A;  2K1F A;  2B3A A;  4KIK A;  1XT9 B;  2DYB A;  3ZVV A;  1E8Z A;  1U5D A;  4OVU A;  4G50 A;  4K81 A;  5C16 A;  2LZ6 A;  2I1K A;  1Y5O A;  2KTR A;  3TFM A;  3TJP A;  3QBV B;  3EHV A;  3R7Q A;  3ODW A; 
#chains in the Genus database with same CATH topology
 1KRH A;  2I2Y A;  4GMV A;  4HRO A;  1DDW A;  4XWX A;  2N4F A;  1V5M A;  4NQK E;  1MI1 A;  1FMA D;  3UQA A;  4K2O A;  1KBL A;  4E74 A;  2K6Q A;  1Y19 B;  1L7Y A;  5JHA A;  2NZ8 B;  1Z87 A;  3DOW A;  3IXS A;  3HHM A;  3JSV B;  3I9V 1;  1ZYI A;  5T8I A;  1I4G A;  2RRF A;  2BT6 A;  4NAW A;  3M3J A;  3AMZ A;  4IOI E;  2J53 A;  1ET9 A;  3Q2A C;  4BFR A;  4QJ3 B;  2KD0 A;  2DLB A;  2QEJ C;  4ASW C;  4F8C B;  5J3Y A;  3WAN A;  3T3N A;  4UDU C;  1FHX A;  3TO1 A;  2GBR A;  3U52 E;  5LLI A;  2D3A A;  2IO1 B;  3EUB 2;  3DCX A;  2CB8 A;  3AE2 B;  4DHZ E;  4JWU C;  2C9W B;  4PT5 A;  4BAX A;  3UIN B;  2RGF A;  4ILG B;  3R8B A;  2L1C A;  1B1Z A;  1RAX A;  3H9D A;  2ZCC A;  1ZOY B;  1OEY J;  4RF1 A;  3ZNG C;  2LJ5 A;  3RCZ A;  2X0S A;  5JVL A;  4W9D A;  2PPH A;  4MJS B;  3LJU X;  4H2A A;  1WJM A;  2KZR A;  1G6J A;  3U7D A;  3OHM B;  2BYF A;  3U30 A;  3TCA A;  2HTM E;  3CSF A;  3H1U A;  4JK8 A;  2M1M A;  2ROV A;  1AYF A;  2DHZ A;  2WXP A;  5CHF A;  2RDH A;  3RMK C;  1RM6 C;  2G1E A;  4LTU A;  3V61 A;  4JL9 A;  1C79 A;  2LWP A;  3NY5 A;  1N6Z A;  3AEF B;  4DX9 0;  2K00 A;  4CQN A;  4YON A;  1D4B A;  4PS7 A;  1E8W A;  1Y8R C;  2FAZ A;  2N0Y A;  3Q6B A;  4KV2 A;  4RNA A;  3BIN A;  3QAQ A;  2WXR A;  2V4L A;  1E10 A;  2G35 A;  4ICU A;  5IAA C;  3E9P A;  5D27 A;  1FRD A;  1XD4 A;  3SHQ A;  1FNW A;  1LB1 A;  3Q3O C;  4W9L A;  4LNF A;  5C5B B;  3U4E G;  2W3S A;  3AEC B;  2JWU A;  3BVM A;  3V6C B;  2RDG A;  5AEK B;  5EFX A;  1EO6 A;  2INC C;  2MDX A;  2D11 A;  1VCB A;  4YTN B;  2CRF A;  3N7C A;  5EE0 A;  3OWE B;  1N5W A;  2DHK A;  2Q13 A;  2CHZ A;  2CJN A;  3AU4 A;  1H4R A;  3U8Z A;  4GMX B;  4ZYS A;  2HD5 B;  1UGM A;  2MRP A;  2LXA A;  1C3T A;  4EZK A;  2L83 A;  5IA7 A;  1GUA B;  2LVO A;  4BBN F;  2ZNV C;  2RPQ A;  2LMC A;  2Y5B B;  5DHA B;  1FGY A;  2E3T A;  2PTL A;  3R66 C;  1HB8 A;  2UWQ A;  3JVZ X;  3OG5 A;  1NEK B;  2XNA C;  4CHJ A;  1SJH D;  3PG7 A;  1FHO A;  4GGQ A;  3ULB A;  4IOY X;  1TS3 A;  1B55 A;  2N7D A;  2J0K A;  3HIE A;  1SIF A;  1FFU A;  1YJ1 A;  3VH3 B;  1C77 A;  2ICI A;  4CO7 A;  2DBY A;  4LJO B;  2RQ1 A;  5JZE B;  3BZD B;  5LG4 B;  3QHT A;  3C8Y A;  3OLM D;  4ZOH C;  1MHH E;  2CAY A;  1SIJ A;  3KH0 A;  1M7E A;  2ZKM X;  4BVU C;  1KOT A;  1Q1O A;  3ZJV A;  1JAL A;  1ZPS A;  1KI1 B;  2BTE A;  1XCG A;  2Z59 A;  1RLF A;  2HRJ A;  1LXD A;  4IW0 A;  2PW9 A;  3ZVR A;  3FLV A;  3NS8 A;  1TGZ B;  4USA A;  2BCJ A;  4CHM A;  3V60 A;  4G3X B;  4JGH B;  3A98 B;  2KLC A;  1BUI C;  1YN3 A;  3HQC A;  2PVO D;  1HA5 A;  4HAZ B;  1STE A;  3HM3 A;  4ZRJ A;  2KAJ A;  1WX8 A;  3FIL B;  4K3B A;  1I2H A;  3HVD A;  1UWX A;  3R7R A;  4B6W A;  4JK9 A;  1K50 A;  3ZW3 A;  5I4D A;  2K25 A;  1FAO A;  3VHT C;  2GOW A;  1MIZ B;  2H89 B;  1VR9 A;  2LFI A;  2QSD A;  1MIX A;  1P5T A;  1LQB A;  2R09 A;  1LM8 B;  2VRW B;  4BKT A;  3O96 A;  2WHI A;  4AS1 A;  3ZTD A;  3V5W A;  3ML8 A;  3PP2 A;  4G0N B;  2KFK A;  3KUZ A;  4YTP B;  4WJN A;  3L54 A;  2KGX B;  1KJT A;  3RCP A;  3C0R B;  1V1P A;  2VKI A;  2WXO A;  3NSU A;  3AE7 B;  1XX0 A;  2N9E B;  3PRM B;  4ITK A;  2KIE A;  3D8D A;  2ABD A;  2KJH B;  2J0M A;  2I5C A;  1WY8 A;  2VRR B;  1GNU A;  2DHI A;  2IFS A;  1SE3 A;  2LHD A;  3BYT B;  1J7C A;  4ZRP A;  2MBH A;  4AUQ C;  4DK5 A;  3HUI A;  4BKG A;  1N63 A;  1WSP A;  2W82 A;  3ONS A;  1ISN A;  2BS3 B;  3WIM A;  5JHB A;  2DZI A;  4BKS D;  3PV1 A;  3G9W A;  1DBH A;  3P2B A;  3MFG A;  3TEW A;  2KK8 A;  4GLS C;  3VUX A;  2JY6 A;  2ONQ A;  3DBL B;  3ZNZ B;  1IBX A;  2GBK A;  2D9Z A;  1QOB A;  5BMH A;  1ZM0 A;  3J9C A;  2Y5C A;  4LLG M;  3B2F A;  1P98 A;  2GLS A;  4JKH A;  4OW0 A;  1KLU D;  4BZA A;  2GBM A;  4ZRQ A;  1FOE A;  3A1Q A;  4ZRK A;  1VBG A;  2WXH A;  4GN1 A;  3IFW B;  1L6V A;  2NBV A;  1JWB D;  1KF6 B;  5FI0 A;  4KDI C;  2NMB A;  2XN9 C;  3A9K A;  2ZPY A;  2MKR A;  3RUL A;  1ACC A;  3PO0 A;  2PLP A;  2KAN A;  4A6Q A;  4MGY E;  4P6V F;  2COD A;  1QQG A;  1FEH A;  1KTK A;  3AXC A;  4DWF A;  5J18 A;  2WDT B;  4WAF A;  4EE2 A;  2Z0Q A;  1OQY A;  4HSI A;  1XKE A;  2KX3 A;  1M94 A;  4ANU A;  3DWG C;  4BOS C;  2LGS A;  4OZB A;  2W2X D;  3AM9 A;  2EKE C;  4TKN A;  1DDV A;  2J52 A;  3DQV A;  4DDG D;  2V4I B;  3GE8 C;  3AE3 B;  2GBN A;  2NR2 A;  4MT7 A;  2QJL A;  4DQO C;  1UPQ A;  4JPS A;  1XLN A;  2INP E;  2LBB A;  2BYT A;  2GBJ A;  2DIK A;  3E56 A;  1BXT A;  3LDZ E;  5GMV A;  1P3R A;  3Q69 A;  4RM9 A;  3P42 A;  4L1R A;  5DPR A;  2CR5 A;  2EEL A;  2HTH A;  1WE6 A;  3PHW B;  1AWD A;  3ML4 A;  2KFK B;  4GSW A;  1XLP A;  5G5H A;  1FCL A;  1FIQ A;  1P7F A;  2YT0 A;  1N61 A;  4AQ7 A;  1GB1 A;  1QZE A;  1JML A;  4ZDV A;  4BBK A;  2BQQ A;  5CLQ B;  2Q5W D;  1J8C A;  5CLL B;  2BBC A;  5EE3 A;  3MHS D;  2L05 A;  2K8B A;  2LOZ A;  5L95 C;  4JKC A;  1WE7 A;  4W9G A;  3OAW A;  4LCD E;  3QX1 A;  2D10 A;  3QAR A;  4MK0 A;  4OSN A;  4XDC A;  1J0G A;  2IGG A;  4HB3 B;  3I57 A;  1BML C;  3NZS A;  4AWJ A;  4BOZ B;  3SU8 X;  2WQY B;  2L52 A;  5D6J B;  3T9L A;  3U12 A;  1J0W A;  4N58 A;  4RGT A;  2NPT A;  4W9I A;  2MFQ A;  3P4R B;  2JYT A;  5AZF A;  4JKB A;  2COA A;  2KDE B;  1TKY A;  1V49 A;  1R4N I;  1K5D B;  1L4Z B;  5AZG A;  2KUQ A;  2X8X X;  3A9J A;  2DX5 A;  4HAX B;  4GB9 A;  1UZX B;  3VQI A;  4FJV B;  4NY0 A;  3WAP A;  1XR0 B;  4PS3 A;  3P63 A;  3SEB A;  2NBV B;  2GUM A;  4DXG A;  3A8Q A;  2QKM A;  2KN4 A;  2BKR B;  3AN1 A;  2Y8G A;  1FO4 A;  4EZL A;  4TSS A;  4JE3 B;  3DVG X;  2LRW A;  2QIE B;  3B0A A;  1PGX A;  3S2A A;  4HEA 1;  4RH6 A;  1OEY A;  2A4Z A;  4HKZ E;  2UYZ B;  2JU6 X;  2WNM A;  2M0X A;  5DI9 B;  3FVC A;  5FR3 A;  1NTI A;  1VJK A;  3Q3N C;  5D3X A;  1ZUD 2;  1WRI A;  1ZVR A;  1T5X D;  1E0Z A;  2Z4D A;  4L6E A;  4EKU A;  4FJY A;  2PEA A;  3PRZ A;  2LUE A;  3SBG A;  3ECI A;  1VRA B;  4L1B A;  2L3Z A;  2GCL A;  2N9X A;  2FIF A;  3HSA A;  1F9J A;  2K49 A;  2R2O A;  2RD0 A;  5TR5 A;  4XWW A;  1WYG A;  3NHE B;  3KYD D;  5TSS A;  2I38 A;  4D0N B;  1K8R B;  1VDV A;  5HFY A;  1U4A A;  5BO4 B;  1K53 A;  2HTH B;  4A8X C;  5CHV C;  2K8H A;  2X38 A;  4NJC A;  1W1G A;  1DOI A;  4DXF A;  3TBL D;  3EPY A;  3PZD A;  1HZ6 A;  4P1C C;  5LNK 1;  5C79 A;  5C6R A;  2EJ8 A;  3AED B;  4LNN A;  2NMQ A;  3QQ8 B;  1I4H A;  2WXI A;  3R2T A;  2N1V A;  4M01 A;  4A6K A;  1WGG A;  4JKF A;  2PE9 A;  1BAK A;  4HJG E;  1ACA A;  2BPS A;  2CU1 A;  3DBL I;  3ULC A;  2DTC A;  4MH0 E;  4RGO S;  2L0T A;  1WZ3 A;  4LJP B;  4MJS A;  3RYT A;  1FB8 A;  4MDK E;  4NJ6 A;  4MSM B;  1EGX A;  2BW2 A;  2ZNV B;  2PZ1 A;  1GPX A;  2BYE A;  5EE1 A;  1WXM A;  3ETR A;  3U2S C;  3IT6 B;  4WAA A;  2MBQ A;  3DXD A;  2R2Y A;  3IT4 B;  4II2 B;  2L2I A;  2JXX A;  2NCN A;  2WGS A;  1ST7 A;  1ZXI A;  4W9E A;  2AEH A;  5BMG A;  2BGF A;  2M38 A;  1YIW A;  2AQ2 B;  1GC7 A;  2FCS A;  2TSS A;  2FNJ B;  4ILJ A;  1NVL A;  1V5P A;  2N9K A;  2Z0D B;  5L81 A;  1EU4 A;  1I4P A;  5DCN A;  1WJ6 A;  2J4X A;  2JWZ A;  4YSX B;  1C4C A;  5JHH A;  4DBG A;  2D4Q A;  2LUL A;  3QIJ A;  4CSQ A;  5IO9 A;  4M0W B;  4LDT B;  4OVZ A;  2J0J A;  1QC6 A;  1P0R A;  5C5B A;  4J6I A;  4NPN A;  4HB0 B;  4YL8 A;  2KTF A;  2ELB A;  2QIL A;  2M19 A;  3URY A;  1NBF C;  2IND C;  1E8Y A;  3UGB B;  4AOF A;  3SO6 A;  1L0Y B;  4WH4 A;  1V8C A;  3DCG A;  1D6E C;  1P6S A;  1MG4 A;  3DDC B;  2LJI A;  4KZ0 A;  4US9 A;  3GP7 A;  3IHP C;  3D8F A;  1U29 A;  4QXA B;  4E71 A;  1T6B X;  1CQV A;  2G4S A;  2YT2 A;  4FA6 A;  1MK9 B;  3BII D;  4C7Y A;  3QK0 A;  1TJ6 A;  4PQ0 A;  2IJ0 A;  1UBQ A;  1JRP A;  1NYR A;  2KC1 A;  4C4V A;  2DYQ A;  1JDE A;  1TQZ A;  3SBT A;  4OHJ A;  4W9F A;  3GE3 C;  4LK0 M;  3V6E B;  3NVZ A;  2IYD B;  1V5U A;  3N1X C;  1JRU A;  1XO3 A;  2MBO A;  1TZ1 A;  3ZXV A;  4M8M A;  1YJJ A;  1T3Q A;  4C00 A;  4KGS A;  4KSL C;  1E7P B;  2RGN B;  4TV3 A;  4HPL B;  2PIA A;  1P9D U;  4FHK A;  4IDI A;  2V3P A;  3Q8F A;  5G2N A;  3AJ4 A;  2B76 B;  1L4D B;  2R82 A;  1R4M B;  4MM3 B;  4N9F 4;  1I4R A;  4YSY B;  3TVV A;  1JWU D;  3UI3 A;  4ZRI A;  5C2T B;  2COF A;  1M7R A;  3PEG A;  3VIA A;  2D3B A;  3P1M A;  4HRS A;  1UGJ A;  3FIL A;  2IO0 B;  3ODO A;  1XD3 B;  4HXD A;  4HAU B;  2JT4 B;  3AI5 A;  2M14 A;  2WXG A;  1JW9 D;  4B0M A;  5EE9 A;  1SGH A;  2PJH A;  4JKG B;  1F77 A;  1XQQ A;  3B1L X;  1PUT A;  2W9N A;  3CST A;  4IAP A;  3RZW C;  1QLB B;  3A4R A;  1K5G B;  3EEC A;  1WJ1 A;  4JQW C;  3L08 A;  1E9M A;  2KVZ A;  4M00 A;  4KZC A;  3PLV A;  2EKI A;  1C1Y B;  1Q5W B;  2JZ3 B;  5IOI A;  1K52 A;  3V3X A;  3PRE A;  1Q10 A;  1X1G A;  1TS4 A;  4YWG G;  4GOU A;  1HQR D;  2YVC A;  4HDO A;  1F1H A;  3HVZ A;  2JP2 A;  3RFZ B;  1RFK A;  4CYE A;  2FBW B;  5L83 A;  3RT3 B;  2FJ9 A;  2C5L C;  2P0F A;  3KSY A;  1WX9 A;  2COC A;  1WGD A;  4XE0 A;  1OQQ A;  1WVH A;  3DBH B;  1HB6 A;  3ZO5 B;  3FEH A;  1T0R C;  4C4V B;  4C56 C;  3HIZ A;  4GXB A;  3GZN B;  1EWC A;  2WLB A;  2LRU A;  3N1Y C;  2Z8L A;  3AV8 A;  1CMX B;  3ALB A;  3VFK A;  1TZO A;  2BVC A;  2M17 A;  3PRP B;  3NVY A;  3SDL C;  2DYO A;  3DHH C;  4IC7 B;  2ZCB A;  3PHX B;  3VRA B;  1ZE3 D;  5HE0 A;  3VAW A;  1C4A A;  1KZ7 A;  1E90 A;  1WFY A;  3O13 A;  2VZK D;  3PSE B;  1L0V B;  3AEB B;  1D5X C;  5H92 C;  1KH0 A;  4HAT B;  3M1I B;  3ZRF A;  1X1M A;  3AEG B;  3AEA B;  5HG2 A;  1GGO A;  3CIK A;  5D94 A;  1W1D A;  2IDY A;  3QJZ A;  1XLQ A;  1PGA A;  2GJY A;  3Q3F A;  3V62 A;  4QJ5 B;  3VH4 B;  4ANV A;  1FD6 A;  3NZ3 A;  4F7H A;  4EMO A;  2QC8 A;  2CJO A;  2QKL A;  3SUZ A;  1LW3 A;  4A6H A;  3E9L A;  4F1S A;  4WJ7 A;  2D2Q A;  1NI3 A;  3DBS A;  4WWP A;  5FK9 C;  2P0H A;  3SR6 A;  2DKQ A;  1FXA A;  2H7D A;  1MK7 B;  1JQ4 A;  2YSZ A;  2JRH A;  3KUD B;  3DXE A;  4GU2 A;  1I42 A;  4WQM A;  4GDL B;  2LVQ A;  3TL5 A;  3TW1 A;  1UH6 A;  3ZRC A;  1QOG A;  1EM7 A;  3UIO B;  1ZC4 B;  2WU2 B;  1TS2 A;  2REX A;  3W5V B;  1TY2 A;  1WXV A;  3T8M A;  1ROE A;  3HW2 B;  1C4P A;  3DXC A;  1WYW B;  5JXV A;  4I6L B;  1BT0 A;  4CHK A;  1TYG B;  1QT9 A;  4RMA A;  4ZHO A;  2KT7 A;  3HRD D;  3RNE C;  3QWZ B;  3LXF A;  2FCQ A;  1B9R A;  3N20 C;  3TSS A;  1KLG D;  3VUW A;  1GG3 A;  1UEF A;  1W1H A;  2NTT A;  2D9W A;  1DIK A;  3RUI B;  1UPR A;  2ZW0 A;  1EUV B;  1D5Z C;  1SE9 A;  1OY2 A;  5JH5 C;  1SE4 A;  1NDD A;  3W9C B;  1MHX A;  1V1O A;  3L16 A;  2VZK B;  1Q0W B;  4HCN B;  1J7B A;  3OJ3 A;  2R0D A;  3M62 B;  4TMA B;  2O2V B;  4PNK A;  2SEB D;  2IPK D;  4A6F B;  1YX6 B;  4Z2N A;  3NW8 A;  5M4Y B;  2WXK A;  2Z0E B;  4HK2 A;  5D3D A;  2MH7 A;  4IKG A;  4II3 B;  1WF9 A;  2OJR A;  2EC1 A;  2Z14 A;  4H8S A;  3NZU A;  1NU2 A;  1GAQ B;  4RF0 A;  3N3K B;  5HKH A;  2D3C A;  4X57 B;  2LGX A;  4EUT A;  1NI2 A;  4MGK E;  3RNC C;  4OZC A;  1ZP0 B;  1WIA A;  5D3I B;  3CWI A;  2KYW A;  4TUU A;  5DPS A;  1C78 A;  2KCJ A;  3QWM A;  4C0A A;  1J7A A;  1A70 A;  4B6H A;  3APC A;  2RUK B;  3MDB C;  2RSU A;  1V5O A;  2A5U A;  2O6V D;  2ZW1 A;  2LGD A;  2R61 A;  4XC2 A;  3E9O A;  3MJ5 A;  1WRD B;  4ZYN A;  4ILH A;  2I5F A;  1WMH A;  5GOW B;  1YN4 A;  4LNI A;  4XWT A;  3VDZ A;  2MJE A;  2YLM A;  1PFJ A;  3NWD A;  4WWN A;  3MPX A;  2KC2 A;  5AUK A;  5G55 A;  1L5P A;  3ZUN A;  4FBJ B;  1GOZ A;  5IKC M;  1WM2 A;  3Q14 C;  3AE9 B;  3AEE B;  1EAZ A;  1IUE A;  3BY4 B;  3GYP A;  2V1Y A;  2KIG A;  4TYZ A;  4FN2 A;  1GB4 A;  4US8 A;  4MGZ E;  2PE6 B;  3NWF A;  2FJL A;  2BS2 B;  1WXA A;  5D2M B;  1Z2M A;  1V81 A;  4FUL A;  2KWU B;  1JWS D;  4BBN C;  2LVP A;  2MWS B;  1YQ3 B;  2V9H A;  5LXI B;  1SE2 A;  2WWZ A;  1V86 A;  3DBH I;  2WXJ A;  3PGE A;  1V88 A;  4KVG B;  3Q8B A;  3E66 A;  4HKQ A;  1NTV A;  2PKO A;  1TKE A;  3I3T B;  1KLV A;  4EZJ A;  5EDS A;  1RJ2 A;  3RNF C;  1D5M C;  1T0Q C;  5CTR C;  1XLO A;  4HAY B;  1OTR B;  1HTO A;  4NQL B;  4EFO A;  5KQ4 A;  5E6N A;  3M63 B;  3VUY A;  4A9A A;  2MEK A;  3WAL A;  1ZXH A;  2X18 A;  4GOC A;  1PMS A;  2W55 A;  2CS4 A;  4HAV B;  4HDQ A;  4DX8 A;  5CHW A;  3PPA A;  5BYQ A;  4WWO A;  2MJ3 A;  1I7A A;  4A3P A;  1RWS A;  4MAC A;  3B77 A;  5I2S A;  3SNH A;  4M02 A;  3VTV A;  4Z2M B;  1CK1 A;  2WU5 B;  3WAM A;  4DXA B;  1EF5 A;  1HZ5 A;  4NJ7 A;  2N23 A;  2O6V B;  4ZHP A;  5J3T A;  1L0X B;  2W3R A;  4YTM B;  3NUH B;  2JX5 A;  2WX1 A;  4O1N A;  5IRS A;  2K8C A;  1OQR A;  5C1Z A;  4MH8 A;  2KJ6 A;  4L23 A;  4NAM A;  2ON8 A;  3KUC B;  1WJ4 A;  1QOA A;  2RPV A;  3M95 A;  3DHG C;  2LOX A;  1V80 A;  4P1B C;  1Z5S B;  1OGW A;  4ARC A;  3QA8 A;  1U2B A;  4KSK C;  1OQN A;  1AWE A;  3ZTC A;  3L4P A;  3ZGZ A;  1WMH B;  3EC8 A;  4HJK A;  1E7U A;  1WGH A;  2AL6 A;  3W1Y A;  4M0W A;  4N59 A;  4B9K A;  3V05 A;  2RVB B;  3I5J C;  2HJ8 A;  1QIL A;  4TQ0 A;  4KHO A;  1EVH A;  2V3S A;  1VZ7 A;  1IYF A;  2KFJ A;  5LXH A;  4KX6 B;  2JQR B;  3KLS X;  1CJE A;  1IP9 A;  4HB2 B;  3D8E A;  3P7Z A;  4Y94 A;  1U5G A;  1HEZ E;  3C19 A;  1SEB D;  2YS3 A;  4KHB A;  2L00 B;  4ACF A;  3TEX A;  2FCN A;  3SFD B;  4A3O A;  1PGB A;  2RNR B;  2KWV B;  2MQJ A;  3N1Z C;  5AUI A;  2KDB A;  4OT1 A;  4MGI E;  3FP5 A;  2WS3 B;  5E6O A;  3W1S A;  2ZEQ A;  4OZA A;  3DPD A;  4J3O D;  1GJZ A;  2PVG C;  2KMM A;  4M8N A;  3RI7 C;  1TT5 B;  2KWC A;  4HCP B;  5BMI A;  2SAK A;  3NWA A;  2WXN A;  3AE1 B;  2D9X A;  1FRR A;  5E6P A;  1UNP A;  2BYV E;  2ELA A;  4ARI A;  3L10 B;  4OVV A;  1SBB B;  3B08 A;  1T0S C;  1YX5 B;  1TJE A;  1MI0 A;  1TY0 A;  1U5F A;  3B2G A;  5LOP B;  2AYO B;  3NRZ A;  1AAR A;  2YF0 A;  2Y5P A;  2WXQ A;  4HLE A;  3T3O A;  3D32 A;  4FHJ A;  2Y3A A;  1TTN A;  1MG8 A;  1MVK A;  2Z0O A;  3ABV B;  2EMS A;  3KW5 B;  2ROZ B;  4WWM A;  2GMI C;  2J59 M;  1KFY B;  2KR0 A;  4MM3 A;  4FAD A;  2LKO A;  1KM7 A;  3DBR B;  4RGN A;  5D7G A;  3PVL A;  2K2J A;  1VD2 A;  2YS5 A;  3ENE A;  4W9J A;  2Z13 A;  2ZZP B;  1UNS A;  3NS1 A;  1UWM A;  3AUL A;  1XCT L;  3EGR A;  3NOB A;  4K7U A;  1Q67 A;  1AN8 A;  2UZR A;  2C7M B;  4HAW B;  2WXL A;  5DPW A;  2HDE A;  3H7S A;  1XXG A;  3ZKJ C;  2I1J A;  5DHF B;  2MP2 B;  2RMM A;  5AZH A;  3W2D A;  1I7H A;  4F7G A;  2COP A;  2DX1 A;  5BYS A;  3Q3J A;  2NBU A;  1V5T A;  1E6E B;  3SD5 A;  4IFS A;  2DLW A;  4JKG A;  2Y7B A;  1ZC3 B;  3H7P A;  4F7U P;  3WYF B;  3SFE B;  2HJ1 A;  3FSS A;  3DVG Y;  2LG1 A;  3VR8 B;  1NYQ A;  2LGI A;  2ASQ A;  2AWT A;  4B0E A;  1WXS A;  1E7V A;  5D3Y A;  3PVW A;  1BWN A;  1SJE D;  4P16 A;  3MC0 B;  1HTQ A;  2IO2 B;  2MJD A;  4XDD A;  4KHB B;  1V61 A;  3KWL A;  3KY9 A;  2NVU I;  4DHJ D;  5JP4 A;  2L0F A;  3VR9 B;  2WDQ B;  3KVF B;  1YJI A;  5KQ1 A;  2CHX A;  2OOB B;  3Q8C A;  5KHO A;  5H8Y E;  2M8S A;  1H10 A;  1WJU A;  3N30 A;  5C23 A;  4JLC A;  2K8E A;  3ZXR A;  4IM2 A;  3IAM 1;  3KWV A;  2N0S B;  1Y56 A;  1WI0 A;  3R2I A;  2DAJ A;  2ZVO A;  4IWQ A;  4TQ1 A;  3U7Z A;  3QCA A;  4FJZ A;  5IJM A;  3IVF A;  3F0W A;  4WQO B;  4JKD A;  3T06 A;  5HE2 A;  4W9K A;  3MC8 A;  1TIF A;  3BYY B;  3Q8A A;  2KNB A;  5KCV A;  4WJP A;  2W2X C;  3RNA C;  3TMP B;  1KC7 A;  1RFA A;  1UUP A;  4A55 A;  2KAC A;  2W54 A;  4GZU A;  3H6N A;  2G4D B;  2WX0 A;  2LGY A;  3A4S C;  1TBE A;  4KHA A;  5I2M A;  2DN6 A;  1UBI A;  1IGC A;  3EFU A;  1MAI A;  1MPE A;  2DZM A;  3GS2 A;  1QOF A;  2DWQ A;  1BTK A;  1SHC A;  2G3Q B;  2RLO A;  2H7E A;  1U5E A;  3PSC A;  2QDF A;  4DIX A;  3DWM A;  4HWI B;  1VBH A;  1XF5 L;  1I35 A;  2JVC A;  2M0A A;  3HM6 X;  1JWM D;  1DRO A;  1V6E A;  4P7I A;  2BWE S;  4K1R B;  3KRW A;  4PYZ A;  5KHQ A;  1J19 A;  2ZPN A;  4KIK B;  1WXQ A;  4REZ A;  1IRS A;  4WSF A;  3N9Y C;  3AB5 A;  1YD8 U;  3AH7 A;  1ZKH A;  3LJ3 A;  3H7P B;  4DHJ B;  2YEP F;  2MW5 A;  2V76 A;  3ZIM A;  4JIO U;  1X11 A;  3UQB A;  1WJN A;  1OFF A;  4GDL A;  1ET6 A;  1JRO A;  2BKF A;  2LHE A;  3NG0 A;  2KTR B;  3MTN B;  2KHW B;  2M56 B;  1EWY C;  1KZG A;  1H8C A;  2YEP B;  3RPF C;  3O65 B;  2DA0 A;  1D3Z A;  2FE8 A;  1JWA D;  2OTX A;  4S0R A;  2MHJ A;  2PMV A;  4XZ4 A;  2K3U A;  2NBW B;  1X05 A;  1TS5 A;  1X1F A;  5C3J B;  2BS4 B;  2C7H A;  1X86 A;  1EU3 A;  1SXT A;  2DYN A;  1FXT B;  3PT2 B;  2AQ1 B;  5IP4 D;  2XK5 A;  1V9J A;  1U27 A;  2KJR A;  3EA6 A;  3RNG C;  1AQC A;  2IO3 B;  1N60 A;  1JCK B;  1PLS A;  1WZ0 A;  4HB4 B;  2J42 A;  4G11 A;  1VZ8 A;  4AJY B;  4NAW B;  2DHJ A;  1FXI A;  4XGA B;  2AX5 A;  3ENB A;  1LO5 D;  3APD A;  4PK1 A;  4WUR A;  4RGM A;  3ZQ4 A;  5G5G A;  1GC6 A;  3PZ7 A;  2XBB C;  4PS8 A;  2LAS A;  1E8X A;  2O2V A;  4RFB A;  3ZNH B;  2GS0 A;  4A6F A;  2C60 A;  4URK A;  2KDM A;  5MPO A;  2MBB B;  1UNR A;  2KQ4 X;  4I6N B;  2WH5 A;  1R7S A;  5LON B;  3NVW A;  3RZF A;  1DOY A;  5HHD G;  2W2W A;  1DOX A;  2RSG A;  2HE7 A;  3DBR I;  2IYB A;  4MEM A;  2BWF A;  1EF1 A;  1A5R A;  1ZSQ A;  1FFV A;  1SSN A;  2JXT A;  1F0Z A;  3RN9 C;  3MJW A;  3IG3 A;  1V97 A;  4A20 A;  3ZNI D;  1FNU A;  2LYD A;  1P3Q U;  2MLB A;  1PQS A;  2FDQ A;  2GRI A;  2JZP A;  1XCQ L;  2KLG A;  2XEW A;  4W9C A;  1BTN A;  2KVR A;  2G45 B;  2DAF A;  2JZZ A;  1IGD A;  1R4N B;  2VH2 A;  4MSQ B;  2KUP A;  2N7E A;  1T77 A;  2OQB A;  3A8P A;  4K7W A;  2L8J A;  2JRI B;  4D2K A;  1ZGU B;  2DZK A;  1YQB A;  4YSZ B;  3B9J A;  2FJU B;  1WWT A;  2JUO A;  2KQS A;  3A33 B;  1WH3 A;  3X0W A;  2IZV B;  3RNB C;  1TXD A;  2CY5 A;  2NS5 A;  3W1S C;  2UU7 A;  4HHV A;  3AE4 B;  2Z0P A;  2LI5 A;  2D9V A;  4JWS C;  1YOV B;  3PTF C;  1SB3 C;  1DGJ A;  1YQ4 B;  4N6E B;  2QCZ A;  1RRP B;  2KKC A;  2CQU A;  1K51 A;  3ZDM C;  1UD7 A;  4BKS A;  5CX3 A;  2XK5 B;  3MHZ A;  3UF8 A;  2KXJ A;  4XYC A;  4AJW A;  1V89 A;  2QHO A;  3KQ4 A;  2K0P A;  3ODX A;  4D6W A;  4R3D A;  3AE8 B;  2G9H D;  2WDR B;  1PFD A;  5JLJ B;  1T0Y A;  3QC8 B;  4IG7 B;  2OED A;  2N1W A;  4WIP A;  1LGR A;  4DDI D;  2MWN B;  4C7Z A;  4C80 A;  2UVM A;  1NEN B;  1WR6 E;  3IBE A;  3WCQ A;  2V0G A;  2CHW A;  4FLH A;  2UZS A;  2YRY A;  1DDM A;  1R4M I;  2O6V A;  2DKP A;  4KGR A;  4I6P A;  3ZJU A;  1ENF A;  2LD9 A;  3BK1 A;  3PLU A;  3SV1 A;  1WGU A;  3CMM B;  3DVN U;  3BWU D;  2IY0 B;  4KGT A;  2CY4 A;  3ZYY X;  2WXM A;  2KOX A;  4A90 A;  3NVV A;  1I4X A;  1VLB A;  1RYJ A;  5E6J A;  2E2X A;  2IY1 B;  2BB6 A;  3UIP B;  4FXC A;  4JK7 A;  3CXB B;  3UZT A;  3VXW A;  1DYN A;  2MBE A;  2GCJ A;  3DHI C;  3OJ4 B;  4MEL A;  4IWO A;  3ZJT A;  3MP9 A;  4B95 A;  2K2U A;  2Y8F A;  3JW0 X;  3K9O B;  4LNO A;  4PYU A;  3VRB B;  2Z59 B;  1WGK A;  4IUM B;  3AU5 A;  3AE6 B;  3ML9 A;  3K9P B;  2FUH B;  3TUO A;  5IN7 A;  3W5U B;  1F2R C;  1FCC C;  2OHF A;  2OJW A;  4L2Y A;  2AL3 A;  2IBI B;  3KRX A;  4YXD B;  1QQR A;  2M4N A;  2LEK A;  1QKZ A;  2IGD A;  3VTU A;  1FGZ A;  2MSE D;  1F2R I;  1HXY D;  3FM8 C;  1WR1 A;  2VH1 A;  4WJO A;  2K39 A;  1S1Q B;  3NJT A;  2ADZ A;  1NTY A;  5DIF B;  5HE3 A;  3L17 A;  2DEN B;  2INN E;  4YT0 B;  1IPG A;  2KMA A;  2K9X A;  4JKE A;  2FCM A;  2N9P C;  2NTS A;  3GOE A;  3TEY A;  5DH9 B;  2K5P A;  2ZVN A;  4K7S A;  2MX2 A;  3TEZ A;  3JYU A;  1E5W A;  1PDX A;  4NNJ B;  3BJI A;  3GZN I;  2ACZ B;  3N32 A;  2ZJD A;  4K3C A;  1DYQ A;  2WP9 B;  2KWD A;  4KDL B;  3EFC A;  5FKA C;  1S3S G;  2KDI A;  1V1P B;  4ANX A;  3BK2 A;  2L1A A;  2LXC A;  5J17 A;  5HI1 A;  2FID A;  1FNV A;  1MPH A;  2N7J A;  4DHZ B;  2RR9 A;  2LUM A;  5J3Q A;  2CKH B;  3Q8E A;  2KO3 A;  1V2Y A;  4GDK A;  1UEL A;  1M4V A;  3GB1 A;  3X23 A;  4A5K A;  1YMH E;  2J7Q B;  3L0W B;  1MKE A;  1ZDV A;  3APF A;  3TIX A;  2L76 A;  2DZJ A;  1MJD A;  5GXG B;  2RDB C;  2MCN B;  3OAN A;  2C7N B;  1YNT E;  2JPH A;  2H88 B;  2YT1 A;  2K6D B;  2E6X A;  3CF6 E;  1HBK A;  1AW7 A;  2D3G A;  2WDV B;  3ZDT A;  1IBX B;  4WJQ A;  2XQN M;  2D5G A;  3GYO A;  5FI1 A;  4EEW A;  4EJN A;  4MY6 A;  2GB1 A;  2JF5 A;  1OMW A;  3KZ1 A;  3BVZ A;  1ESF A;  4EOY A;  5FR6 A;  4RM8 A;  3ZLZ A;  2MP2 A;  3F5R A;  2V3N A;  3A1Q B;  5HE1 A;  4JKA A;  1L6U A;  2YS1 A;  1WM3 A;  3FKY A;  2WXF A;  1FHW A;  4GIV A;  4WVF B;  1L2N A;  3R3M A;  1WGR A;  3A9K B;  4IM0 A;  1ZDX A;  3FAH A;  2FUG 1;  2KN5 A;  2L32 A;  3IAS 1;  4K17 A;  5D3W A;  4Q2J A;  3KYC D;  4F7Z A;  1XOD A;  2WYQ A;  4ICV A;  2EMT A;  2DFK A;  4AP4 C;  3P4Q B;  3BVG A;  2KMC A;  2KDF B;  4IM3 A;  5DPT A;  1ZW7 A;  1C76 A;  1FM0 D;  5JHG A;  3L13 A;  1YN5 A;  2QMT A;  4HPP A;  3WA0 A;  1WI1 A;  1MFW A;  4GPT B;  3DVN V;  3HK0 A;  4LNK A;  1XEE A;  1CZP A;  4W9H A;  1FPY A;  2JYE A;  1F52 A;  2P0D A;  4K2P A;  1NVI D;  3JSV A;  1PYW D;  4LDT D;  1WX7 A;  1QF6 A;  1SF0 A;  4DBB A;  2DYM A;  2JSV X;  1N5X A;  4GNK B;  3VTW A;  4KKI A;  3PZ8 A;  4HPM B;  3SYX A;  1WGQ A;  1RRB A;  2AQ3 B;  3WAO A;  4E3C A;  3AE5 B;  1TKG A;  3VVW B;  5J2R A;  3VOQ A;  1I4Q A;  1N62 A;  4KKJ A;  3I63 C;  3P4S B;  4NZL B;  2L7R A;  1N3H A;  4NSW A;  3RD2 A;  3LYY A;  3P6A A;  4QAY A;  2P8V A;  4GDK B;  5BYR A;  3PS6 A;  3P4P B;  5D3V A;  2R2Q A;  3LB8 C;  3CIR B;  2K22 A;  1UNQ A;  2KX0 A;  2VSZ A;  2NPT B;  2N9L A;  3FC4 A;  1HE8 A;  2IGH A;  3H8H A;  3E9S A;  3PVU A;  2D9Y A;  2D07 B;  4IWP A;  2MA9 B;  1P1A A;  4HVB A;  4S17 A;  2GI9 A;  4RCO A;  2DNF A;  1LFD A;  4KAX B;  1WGY A;  2BF8 B;  4QJ4 B;  2KQ7 A;  3A9J B;  1WG7 A;  2DX5 B;  4XX5 A;  4JX1 C;  4ANW A;  1C9F A;  2K1F A;  1VZ6 A;  2B3A A;  3Q3M C;  4KIK A;  3A58 A;  1XT9 B;  2BB5 A;  2DYB A;  3ZVV A;  1E8Z A;  1U5D A;  4OVU A;  4G50 A;  1P7E A;  4K81 A;  5C16 A;  2LZ6 A;  2I1K A;  4MT5 A;  1Y5O A;  2KTR A;  3TFM A;  3TJP A;  3QBV B;  3EHV A;  3MC9 A;  1UF0 A;  3R7Q A;  3ODW A;  2CU3 A; 
#chains in the Genus database with same CATH homology
 4GMV A;  1DDW A;  4XWX A;  2N4F A;  1V5M A;  4NQK E;  3UQA A;  4K2O A;  1KBL A;  4E74 A;  2K6Q A;  1Y19 B;  1L7Y A;  5JHA A;  2NZ8 B;  1Z87 A;  3DOW A;  3HHM A;  3JSV B;  4NAW A;  3M3J A;  4BFR A;  2KD0 A;  4ASW C;  4F8C B;  5J3Y A;  3WAN A;  1FHX A;  3TO1 A;  2GBR A;  5LLI A;  2IO1 B;  2CB8 A;  4DHZ E;  2C9W B;  3UIN B;  2RGF A;  4ILG B;  2L1C A;  1RAX A;  3H9D A;  2ZCC A;  1OEY J;  3ZNG C;  2LJ5 A;  3RCZ A;  2X0S A;  5JVL A;  4W9D A;  2PPH A;  4MJS B;  3LJU X;  1WJM A;  2KZR A;  1G6J A;  3U7D A;  2BYF A;  3U30 A;  3TCA A;  3CSF A;  3H1U A;  4JK8 A;  2M1M A;  2ROV A;  2DHZ A;  5CHF A;  3V61 A;  4JL9 A;  2LWP A;  3NY5 A;  4DX9 0;  2K00 A;  4YON A;  4PS7 A;  1E8W A;  1Y8R C;  2FAZ A;  2N0Y A;  4KV2 A;  3BIN A;  3QAQ A;  2V4L A;  2G35 A;  4ICU A;  5IAA C;  3E9P A;  5D27 A;  1XD4 A;  3SHQ A;  1LB1 A;  4W9L A;  5C5B B;  3V6C B;  5AEK B;  5EFX A;  1EO6 A;  2MDX A;  2D11 A;  1VCB A;  2CRF A;  3N7C A;  2DHK A;  2Q13 A;  2CHZ A;  3AU4 A;  1H4R A;  3U8Z A;  4GMX B;  2HD5 B;  1UGM A;  2MRP A;  2LXA A;  1C3T A;  4EZK A;  5IA7 A;  1GUA B;  2LVO A;  4BBN F;  2ZNV C;  2RPQ A;  2Y5B B;  5DHA B;  1FGY A;  3R66 C;  1HB8 A;  2UWQ A;  3JVZ X;  4CHJ A;  3PG7 A;  1FHO A;  4GGQ A;  3ULB A;  4IOY X;  1B55 A;  2N7D A;  2J0K A;  1SIF A;  1YJ1 A;  3VH3 B;  4CO7 A;  4LJO B;  2RQ1 A;  5JZE B;  3QHT A;  3OLM D;  2CAY A;  3KH0 A;  1M7E A;  4BVU C;  1KOT A;  1Q1O A;  1KI1 B;  1XCG A;  1RLF A;  2HRJ A;  1LXD A;  4IW0 A;  3ZVR A;  3FLV A;  3NS8 A;  1TGZ B;  2BCJ A;  4CHM A;  3V60 A;  4G3X B;  4JGH B;  3A98 B;  2KLC A;  3HQC A;  4HAZ B;  3HM3 A;  4ZRJ A;  1WX8 A;  1I2H A;  3R7R A;  4B6W A;  4JK9 A;  3ZW3 A;  2K25 A;  1FAO A;  3VHT C;  2GOW A;  1MIZ B;  1MIX A;  1P5T A;  1LQB A;  2R09 A;  1LM8 B;  2VRW B;  4BKT A;  3O96 A;  3ZTD A;  3V5W A;  3ML8 A;  3PP2 A;  4G0N B;  2KFK A;  3KUZ A;  4WJN A;  3L54 A;  2KGX B;  1KJT A;  3RCP A;  3C0R B;  2VKI A;  3NSU A;  1XX0 A;  2N9E B;  3PRM B;  3D8D A;  2ABD A;  2KJH B;  2J0M A;  2I5C A;  1WY8 A;  2VRR B;  1GNU A;  2DHI A;  2IFS A;  4AUQ C;  2MBH A;  4DK5 A;  4BKG A;  3ONS A;  1ISN A;  3WIM A;  5JHB A;  2DZI A;  4BKS D;  3PV1 A;  3G9W A;  1DBH A;  3P2B A;  2KK8 A;  3VUX A;  2JY6 A;  3ZNZ B;  2GBK A;  2D9Z A;  1ZM0 A;  1P98 A;  4JKH A;  2GBM A;  1FOE A;  3A1Q A;  4ZRK A;  1VBG A;  4GN1 A;  3IFW B;  5FI0 A;  4KDI C;  2NMB A;  3A9K A;  2ZPY A;  2MKR A;  3RUL A;  2KAN A;  4MGY E;  2COD A;  1QQG A;  3AXC A;  4DWF A;  5J18 A;  2WDT B;  2Z0Q A;  1OQY A;  2KX3 A;  1XKE A;  1M94 A;  4ANU A;  4BOS C;  2W2X D;  2EKE C;  4TKN A;  1DDV A;  3DQV A;  4DDG D;  2GBN A;  2NR2 A;  4MT7 A;  1UPQ A;  2LBB A;  2GBJ A;  2DIK A;  5GMV A;  3LDZ E;  1P3R A;  4RM9 A;  5DPR A;  2CR5 A;  2HTH A;  1WE6 A;  3PHW B;  3ML4 A;  2KFK B;  4GSW A;  2YT0 A;  1QZE A;  1J8C A;  4ZDV A;  4BBK A;  5CLQ B;  5CLL B;  3MHS D;  2L05 A;  2K8B A;  2LOZ A;  5L95 C;  4JKC A;  1WE7 A;  4W9G A;  3OAW A;  4LCD E;  3QX1 A;  2D10 A;  3QAR A;  4MK0 A;  1J0G A;  4HB3 B;  3NZS A;  4AWJ A;  4BOZ B;  3SU8 X;  5D6J B;  3T9L A;  1J0W A;  2NPT A;  4W9I A;  2MFQ A;  5AZF A;  4JKB A;  2COA A;  2KDE B;  1V49 A;  1R4N I;  1K5D B;  5AZG A;  3A9J A;  2DX5 A;  4HAX B;  4GB9 A;  1UZX B;  3VQI A;  4FJV B;  4NY0 A;  3WAP A;  1XR0 B;  4PS3 A;  2NBV B;  3A8Q A;  2QKM A;  2BKR B;  2Y8G A;  4EZL A;  3DVG X;  2LRW A;  3B0A A;  3S2A A;  1OEY A;  2A4Z A;  2UYZ B;  2M0X A;  5DI9 B;  1NTI A;  5D3X A;  1ZVR A;  4L6E A;  4EKU A;  4FJY A;  2PEA A;  3PRZ A;  2LUE A;  3SBG A;  3ECI A;  2L3Z A;  2GCL A;  2N9X A;  2FIF A;  1F9J A;  2R2O A;  2RD0 A;  5TR5 A;  3NHE B;  3KYD D;  4D0N B;  1K8R B;  1U4A A;  5BO4 B;  2HTH B;  5CHV C;  2K8H A;  1W1G A;  3TBL D;  3EPY A;  3PZD A;  5C79 A;  5C6R A;  2EJ8 A;  3QQ8 B;  2N1V A;  4A6K A;  1WGG A;  4JKF A;  2PE9 A;  1BAK A;  1ACA A;  2BPS A;  2CU1 A;  3DBL I;  3ULC A;  2DTC A;  4MH0 E;  2L0T A;  1WZ3 A;  4LJP B;  4MJS A;  3RYT A;  1FB8 A;  4MDK E;  4NJ6 A;  4MSM B;  1EGX A;  2ZNV B;  2PZ1 A;  2BYE A;  1WXM A;  4WAA A;  2MBQ A;  3DXD A;  4II2 B;  2L2I A;  2JXX A;  2NCN A;  1ST7 A;  4W9E A;  2AEH A;  2BGF A;  2M38 A;  1YIW A;  2FCS A;  1GC7 A;  2FNJ B;  4ILJ A;  1NVL A;  1V5P A;  2Z0D B;  5L81 A;  5DCN A;  1WJ6 A;  2JWZ A;  5JHH A;  4DBG A;  2D4Q A;  2LUL A;  3QIJ A;  4M0W B;  4LDT B;  2J0J A;  1QC6 A;  1P0R A;  5C5B A;  4J6I A;  4NPN A;  4HB0 B;  4YL8 A;  2KTF A;  2ELB A;  1NBF C;  3UGB B;  1E8Y A;  4AOF A;  3SO6 A;  3DCG A;  1P6S A;  3DDC B;  4KZ0 A;  3IHP C;  3D8F A;  1U29 A;  4E71 A;  2G4S A;  4FA6 A;  1MK9 B;  3QK0 A;  1TJ6 A;  4PQ0 A;  1UBQ A;  2KC1 A;  2DYQ A;  1JDE A;  1TQZ A;  3SBT A;  4W9F A;  3V6E B;  2IYD B;  1V5U A;  1JRU A;  2MBO A;  1TZ1 A;  4M8M A;  4KSL C;  2RGN B;  4TV3 A;  4HPL B;  1P9D U;  4FHK A;  5G2N A;  3AJ4 A;  2R82 A;  4N9F 4;  3TVV A;  4ZRI A;  2COF A;  1M7R A;  3PEG A;  3VIA A;  2IO0 B;  3ODO A;  1XD3 B;  4HXD A;  4HAU B;  2JT4 B;  3AI5 A;  2M14 A;  1SGH A;  2PJH A;  4JKG B;  1XQQ A;  3B1L X;  2W9N A;  3CST A;  4IAP A;  3RZW C;  3A4R A;  1K5G B;  3EEC A;  1WJ1 A;  4JQW C;  3L08 A;  4KZC A;  3PLV A;  1C1Y B;  1Q5W B;  2JZ3 B;  3PRE A;  1X1G A;  2YVC A;  4HDO A;  2JP2 A;  5L83 A;  4CYE A;  3RT3 B;  2FJ9 A;  2C5L C;  2P0F A;  3KSY A;  1WX9 A;  2COC A;  1WGD A;  1WVH A;  1HB6 A;  3ZO5 B;  3FEH A;  3HIZ A;  4GXB A;  2LRU A;  1CMX B;  3ALB A;  3VFK A;  2M17 A;  3PRP B;  3SDL C;  2DYO A;  4IC7 B;  2ZCB A;  3PHX B;  5HE0 A;  3VAW A;  1KZ7 A;  1E90 A;  1WFY A;  3PSE B;  4HAT B;  3M1I B;  3ZRF A;  1X1M A;  1GGO A;  3CIK A;  5D94 A;  1W1D A;  3QJZ A;  2GJY A;  3Q3F A;  3V62 A;  3VH4 B;  4ANV A;  4F7H A;  4EMO A;  2QKL A;  3SUZ A;  1LW3 A;  4A6H A;  3E9L A;  4F1S A;  4WJ7 A;  2D2Q A;  3DBS A;  4WWP A;  2P0H A;  2DKQ A;  2H7D A;  1MK7 B;  2YSZ A;  2JRH A;  3KUD B;  3DXE A;  4GU2 A;  1I42 A;  4GDL B;  2LVQ A;  3TL5 A;  3TW1 A;  1UH6 A;  3ZRC A;  3UIO B;  1ZC4 B;  2REX A;  1WXV A;  3T8M A;  3HW2 B;  3DXC A;  1WYW B;  4I6L B;  1BT0 A;  4CHK A;  4RMA A;  3QWZ B;  2FCQ A;  3VUW A;  1GG3 A;  1UEF A;  1W1H A;  2D9W A;  1DIK A;  3RUI B;  1UPR A;  1EUV B;  1SE9 A;  1OY2 A;  5JH5 C;  1NDD A;  3L16 A;  1Q0W B;  4HCN B;  3OJ3 A;  2R0D A;  3M62 B;  2O2V B;  4PNK A;  4A6F B;  1YX6 B;  4Z2N A;  2Z0E B;  4HK2 A;  4II3 B;  1WF9 A;  2OJR A;  2EC1 A;  4H8S A;  3NZU A;  1NU2 A;  3N3K B;  5HKH A;  4X57 B;  2LGX A;  4EUT A;  1NI2 A;  4MGK E;  1WIA A;  4TUU A;  5DPS A;  2KCJ A;  3QWM A;  4C0A A;  4B6H A;  3APC A;  2RUK B;  3MDB C;  2RSU A;  1V5O A;  2A5U A;  2O6V D;  2LGD A;  4XC2 A;  3E9O A;  1WRD B;  4ZYN A;  4ILH A;  2I5F A;  1WMH A;  5GOW B;  3VDZ A;  2YLM A;  1PFJ A;  4WWN A;  3MPX A;  2KC2 A;  5G55 A;  3ZUN A;  4FBJ B;  1WM2 A;  1EAZ A;  3BY4 B;  3GYP A;  2V1Y A;  4TYZ A;  4FN2 A;  4MGZ E;  2PE6 B;  2FJL A;  1WXA A;  5D2M B;  1Z2M A;  1V81 A;  4FUL A;  2KWU B;  4BBN C;  2LVP A;  2MWS B;  5LXI B;  2WWZ A;  1V86 A;  3DBH I;  3PGE A;  1V88 A;  4KVG B;  3E66 A;  1NTV A;  3I3T B;  1KLV A;  4EZJ A;  5EDS A;  1RJ2 A;  5CTR C;  4HAY B;  1OTR B;  4EFO A;  4NQL B;  5KQ4 A;  5E6N A;  3M63 B;  3VUY A;  3WAL A;  2X18 A;  4GOC A;  1PMS A;  2CS4 A;  4HAV B;  4HDQ A;  4DX8 A;  5CHW A;  3PPA A;  4WWO A;  1I7A A;  4A3P A;  3SNH A;  3VTV A;  4Z2M B;  3WAM A;  4DXA B;  1EF5 A;  4NJ7 A;  2N23 A;  2O6V B;  5J3T A;  2WX1 A;  2K8C A;  5C1Z A;  2KJ6 A;  3KUC B;  1WJ4 A;  3M95 A;  2LOX A;  1V80 A;  1Z5S B;  1OGW A;  3QA8 A;  1U2B A;  4KSK C;  1OQN A;  1AWE A;  3ZTC A;  1WMH B;  3EC8 A;  4HJK A;  1E7U A;  1WGH A;  2AL6 A;  3W1Y A;  4B9K A;  2RVB B;  2HJ8 A;  4TQ0 A;  4KHO A;  1EVH A;  2V3S A;  1IYF A;  2KFJ A;  5LXH A;  1IP9 A;  4HB2 B;  3D8E A;  3P7Z A;  4Y94 A;  1U5G A;  2YS3 A;  2L00 B;  2FCN A;  4A3O A;  2RNR B;  2KWV B;  2MQJ A;  2KDB A;  4MGI E;  3FP5 A;  5E6O A;  3W1S A;  2ZEQ A;  3DPD A;  1GJZ A;  4M8N A;  2KWC A;  4HCP B;  2D9X A;  5E6P A;  1UNP A;  2BYV E;  2ELA A;  3L10 B;  4OVV A;  3B08 A;  1YX5 B;  1U5F A;  5LOP B;  2AYO B;  1AAR A;  2YF0 A;  4HLE A;  3D32 A;  4FHJ A;  1TTN A;  1MG8 A;  2Z0O A;  2EMS A;  3KW5 B;  2ROZ B;  2GMI C;  2J59 M;  4MM3 A;  4FAD A;  2LKO A;  1KM7 A;  5D7G A;  3PVL A;  2K2J A;  1VD2 A;  2YS5 A;  3ENE A;  4W9J A;  2ZZP B;  3AUL A;  3NOB A;  4K7U A;  1Q67 A;  2UZR A;  2C7M B;  4HAW B;  5DPW A;  3H7S A;  3ZKJ C;  2I1J A;  5DHF B;  2MP2 B;  5AZH A;  4F7G A;  2COP A;  2DX1 A;  3Q3J A;  2NBU A;  1V5T A;  3SD5 A;  4IFS A;  2DLW A;  4JKG A;  2Y7B A;  1ZC3 B;  3H7P A;  4F7U P;  3WYF B;  3FSS A;  3DVG Y;  2LG1 A;  2ASQ A;  2AWT A;  1WXS A;  1E7V A;  5D3Y A;  3PVW A;  1BWN A;  2IO2 B;  4KHB B;  1V61 A;  3KY9 A;  2NVU I;  4DHJ D;  5JP4 A;  2L0F A;  3KVF B;  5KQ1 A;  2CHX A;  2OOB B;  5KHO A;  2M8S A;  1H10 A;  1WJU A;  3N30 A;  5C23 A;  4JLC A;  4IM2 A;  1WI0 A;  2DAJ A;  2ZVO A;  4IWQ A;  4TQ1 A;  3QCA A;  4FJZ A;  5IJM A;  3IVF A;  3F0W A;  4WQO B;  4JKD A;  3T06 A;  5HE2 A;  4W9K A;  2KNB A;  5KCV A;  4WJP A;  2W2X C;  3TMP B;  1KC7 A;  1RFA A;  4GZU A;  3H6N A;  2G4D B;  2WX0 A;  2LGY A;  3A4S C;  1TBE A;  4KHA A;  2DN6 A;  1UBI A;  3EFU A;  1MAI A;  2DZM A;  1BTK A;  1SHC A;  2RLO A;  2G3Q B;  2H7E A;  1U5E A;  3PSC A;  4HWI B;  1VBH A;  1I35 A;  2JVC A;  3HM6 X;  1DRO A;  1V6E A;  4P7I A;  2BWE S;  4K1R B;  3KRW A;  4PYZ A;  5KHQ A;  1J19 A;  2ZPN A;  4KIK B;  1IRS A;  4WSF A;  1YD8 U;  1ZKH A;  3LJ3 A;  3H7P B;  4DHJ B;  2MW5 A;  2V76 A;  3ZIM A;  4JIO U;  1X11 A;  3UQB A;  1WJN A;  4GDL A;  2BKF A;  2KTR B;  3MTN B;  2KHW B;  1KZG A;  1H8C A;  3O65 B;  2DA0 A;  1D3Z A;  2OTX A;  4XZ4 A;  2NBW B;  1X05 A;  1X1F A;  2C7H A;  1X86 A;  2DYN A;  1FXT B;  3PT2 B;  2XK5 A;  1V9J A;  1U27 A;  2KJR A;  1AQC A;  2IO3 B;  1PLS A;  1WZ0 A;  4HB4 B;  4AJY B;  4G11 A;  4NAW B;  2DHJ A;  3ENB A;  3APD A;  1GC6 A;  2XBB C;  4PS8 A;  2LAS A;  1E8X A;  2O2V A;  3ZNH B;  2GS0 A;  4A6F A;  2C60 A;  4URK A;  2MBB B;  1UNR A;  4I6N B;  2WH5 A;  5LON B;  3RZF A;  2W2W A;  2RSG A;  2HE7 A;  3DBR I;  2IYB A;  4MEM A;  2BWF A;  1EF1 A;  1A5R A;  1ZSQ A;  3MJW A;  3IG3 A;  4A20 A;  3ZNI D;  2LYD A;  1P3Q U;  2MLB A;  1PQS A;  2FDQ A;  2KLG A;  2XEW A;  4W9C A;  1BTN A;  2KVR A;  2G45 B;  2DAF A;  2JZZ A;  4MSQ B;  2KUP A;  2N7E A;  2OQB A;  3A8P A;  4K7W A;  2L8J A;  2JRI B;  1ZGU B;  2DZK A;  1YQB A;  2JUO A;  2KQS A;  3A33 B;  1WH3 A;  3X0W A;  2IZV B;  1TXD A;  2CY5 A;  2NS5 A;  3W1S C;  4HHV A;  2Z0P A;  2LI5 A;  2D9V A;  3PTF C;  1RRP B;  2KKC A;  2CQU A;  3ZDM C;  1UD7 A;  4BKS A;  5CX3 A;  2XK5 B;  3UF8 A;  2KXJ A;  4AJW A;  1V89 A;  2QHO A;  3ODX A;  5JLJ B;  1T0Y A;  3QC8 B;  4IG7 B;  2N1W A;  4DDI D;  2MWN B;  2UVM A;  1WR6 E;  3IBE A;  2CHW A;  4FLH A;  2UZS A;  2YRY A;  1DDM A;  1R4M I;  2O6V A;  2DKP A;  4I6P A;  2LD9 A;  3PLU A;  3SV1 A;  1WGU A;  3CMM B;  3DVN U;  2IY0 B;  2CY4 A;  2KOX A;  2E2X A;  2IY1 B;  3UIP B;  4JK7 A;  3CXB B;  3UZT A;  3VXW A;  1DYN A;  2MBE A;  2GCJ A;  3OJ4 B;  4MEL A;  4IWO A;  4B95 A;  2K2U A;  2Y8F A;  3JW0 X;  3K9O B;  4PYU A;  2Z59 B;  4IUM B;  3AU5 A;  3ML9 A;  3K9P B;  2FUH B;  2AL3 A;  2IBI B;  3KRX A;  2M4N A;  3VTU A;  1FGZ A;  2MSE D;  3FM8 C;  1WR1 A;  4WJO A;  2K39 A;  1S1Q B;  2ADZ A;  1NTY A;  5DIF B;  5HE3 A;  3L17 A;  2DEN B;  1IPG A;  2KMA A;  4JKE A;  2FCM A;  2N9P C;  3GOE A;  5DH9 B;  2ZVN A;  4K7S A;  2MX2 A;  3JYU A;  1E5W A;  4NNJ B;  3BJI A;  3GZN I;  3N32 A;  2ZJD A;  4KDL B;  1S3S G;  2KDI A;  4ANX A;  2LXC A;  5J17 A;  2FID A;  1MPH A;  4DHZ B;  2RR9 A;  5J3Q A;  2CKH B;  2KO3 A;  1V2Y A;  4GDK A;  1UEL A;  3X23 A;  4A5K A;  3L0W B;  2J7Q B;  1MKE A;  3APF A;  3TIX A;  2L76 A;  2DZJ A;  2MCN B;  3OAN A;  2C7N B;  2JPH A;  2YT1 A;  2K6D B;  3CF6 E;  1HBK A;  2D3G A;  3ZDT A;  4WJQ A;  2XQN M;  3GYO A;  5FI1 A;  4EEW A;  4EJN A;  4MY6 A;  2JF5 A;  1OMW A;  3KZ1 A;  4EOY A;  5FR6 A;  4RM8 A;  3ZLZ A;  2MP2 A;  3F5R A;  3A1Q B;  5HE1 A;  4JKA A;  2YS1 A;  1WM3 A;  1FHW A;  4GIV A;  4WVF B;  1L2N A;  3R3M A;  1WGR A;  3A9K B;  4IM0 A;  2KN5 A;  4K17 A;  5D3W A;  3KYC D;  4F7Z A;  1XOD A;  2WYQ A;  4ICV A;  2EMT A;  2DFK A;  4AP4 C;  2KMC A;  2KDF B;  4IM3 A;  5DPT A;  1ZW7 A;  5JHG A;  3L13 A;  3WA0 A;  1WI1 A;  4GPT B;  3DVN V;  3HK0 A;  4W9H A;  2P0D A;  4K2P A;  3JSV A;  4LDT D;  1WX7 A;  4DBB A;  2DYM A;  3VTW A;  4HPM B;  3SYX A;  1WGQ A;  1RRB A;  3WAO A;  4E3C A;  3VVW B;  5J2R A;  3VOQ A;  2L7R A;  3RD2 A;  1N3H A;  4NSW A;  3P6A A;  2P8V A;  4GDK B;  3PS6 A;  2R2Q A;  5D3V A;  1UNQ A;  2KX0 A;  2VSZ A;  2NPT B;  1HE8 A;  3PVU A;  2D9Y A;  2D07 B;  4IWP A;  2MA9 B;  1P1A A;  4HVB A;  1LFD A;  4KAX B;  1WGY A;  2BF8 B;  2KQ7 A;  3A9J B;  1WG7 A;  2DX5 B;  4XX5 A;  4ANW A;  2K1F A;  2B3A A;  4KIK A;  1XT9 B;  2DYB A;  3ZVV A;  1E8Z A;  1U5D A;  4OVU A;  4G50 A;  4K81 A;  5C16 A;  2LZ6 A;  2I1K A;  1Y5O A;  2KTR A;  3TFM A;  3TJP A;  3QBV B;  3EHV A;  3R7Q A;  3ODW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...