1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
2GCJA 5HE0A 3PEGA 1HB6A 1FXTB 5J2RA 4WQOB 2Z0QA 3ML9A 1TJ6A 2JRHA 3NS8A 2CRFA 4KAXB 4M8MA 2M17A 3ZRFA 4NPNA 1GC6A 5IJMA 5JP4A 2M0XA 4HAWB 3WA0A 1DROA 3AU4A 2M8SA 2MBOA 3MDBC 1GUAB 4HPMB 5E6NA 3ENEA 5D3VA 4W9FA 3ZRCA 4CHJA 1WM2A 1FHWA 2V76A 2R0DA 2KANA 4DX90 2DTCA 2FJLA 3EECA 3DVNV 2DHZA 1YX5B 2HJ8A 2BYEA 4WJNA 1H8CA 3D8FA 1IRSA 4NAWB 2DAFA 2YT0A 2C5LC 1WGYA 2G4SA 2KDIA 2IFSA 1K5GB 2R2OA 2OTXA 2L00B 2UYZB 2RQ1A 3UQAA 2BYFA 1V5PA 2RLOA 1V80A 3B0AA 3SDLC 5G2NA 3IHPC 3SYXA 4BVUC 2K6QA 4B95A 1P5TA 3A4RA 2C7NB 1ZC3B 2CAYA 3PRMB 3VUWA 1ZC4B 2K8CA 3T06A 3RT3B 3KUDB 4TQ1A 2D2QA 4HK2A 3VOQA 1SE9A 4MSMB 5CHFA 3A9JA 2YT1A 1RLFA 3ECIA 2PE9A 1QQGA 3L17A 2RR9A 1P6SA 4A3OA 2W2XD 3SV1A 3KY9A 4M8NA 5C5BB 5DHFB 4BKGA 1WF9A 2J0KA 2XK5A 3TCAA 2NPTA 2JXXA 2ZPNA 2LG1A 3DVGX 5JHAA 4MY6A 2ROZB 4LDTD 3P7ZA 4BKSD 2MBHA 2MDXA 1M7EA 2WX1A 3AXCA 3MHSD 3QJZA 2KK8A 3F5RA 4MEMA 3ULCA 3ZW3A 2CY5A 2DYNA 3ZIMA 4Y94A 5C1ZA 3VFKA 4AJWA 4X57B 2JF5A 3VVWB 3W1SA 3WIMA 3TMPB 4XX5A 4WAAA 2PEAA 3RD2A 4DDID 2KQ7A 4HCNB 4NQKE 1DYNA 3QWMA 2DENB 3PHWB 4DHZB 4B6WA 3VH4B 4F7HA 4Z2NA 2K8HA 3OJ3A 2I5FA 2H7DA 2HTHA 3BINA 3DBRI 2ABDA 3DBHI 5HE3A 2HD5B 5FR6A 2KTFA 2COPA 2C7MB 2CHWA 2QKMA 4G0NB 4DBGA 4TKNA 2AL3A 4WJQA 2KDFB 2MP2A 5D6JB 2DYMA 3QHTA 3VAWA 4W9GA 4GPTB 2GJYA 1KLVA 2M14A 3KVFB 3PP2A 3UZTA 3NSUA 1E90A 2FIDA 4B6HA 1YIWA 1QC6A 2FIFA 2KWVB 3PZDA 3V5WA 2CKHB 3DXCA 2IO2B 2DX5B 1P1AA 4HAUB 1UGMA 1TXDA 1TTNA 4MGKE 4MJSB 1L2NA 5HKHA 3VUYA 3TVVA 4E3CA 3VXWA 1ISNA 1RRBA 4IM2A 4BBNF 5CLQB 3KUZA 3DXEA 3KW5B 2CB8A 4KHBB 4A6KA 2KLGA 2ZJDA 5D27A 2IZVB 1OEYA 1PFJA 1P98A 1ZM0A 2O2VB 2L0TA 2LOXA 2OOBB 2KMAA 4IM3A 1UH6A 5KHQA 4EEWA 1E7UA 5FI1A 1WGUA 1TBEA 4KHAA 3L16A 4E71A 4IUMB 3A1QA 4GN1A 3CSFA 1I7AA 1T0YA 1YD8U 4G11A 1ZW7A 2FAZA 4HAZB 2DHIA 1WJUA 4NSWA 2Y8FA 2V1YA 4DK5A 1N3HA 3CIKA 2B3AA 1NU2A 3FM8C 2G45B 2DA0A 3UINB 3NOBA 5CHVC 2DX1A 4E74A 1X05A 3Q3JA 2LUEA 2KOXA 2O6VD 1F9JA 3AI5A 5JHBA 2FUHB 4AJYB 2KFKA 2KKCA 2Z0OA 3CF6E 2KO3A 5JHHA 3VTWA 2RSGA 4GIVA 1OY2A 4FHKA 4DXAB 5LOPB 3U7DA 1BAKA 2BF8B 4G50A 3TFMA 2CODA 2KC1A 2GBRA 1W1HA 2YRYA 1UBIA 1U5GA 2MBEA 2OJRA 1WFYA 4NJ7A 3SO6A 4A6FA 1UZXB 1XX0A 4K17A 2ASQA 3N7CA 4IOYX 4ANXA 4WJ7A 2KTRA 5D3XA 1WXVA 2A5UA 2LRUA 2M1MA 5JZEB 3FSSA 5JLJB 4W9KA 3KZ1A 3W1YA 1U2BA 4HLEA 3ZLZA 4L6EA 3PTFC 2RPQA 3H7SA 1WGQA 2Z0EB 4AUQC 2I1KA 2JWZA 1BWNA 2LJ5A 1A5RA 5DPSA 2KWCA 5LXIB 3VTVA 1BTKA 2DHJA 5J3YA 1IYFA 1WJ1A 2P0HA 4PQ0A 4IG7B 2LWPA 3QWZB 3A9KB 1MG8A 2PJHA 3EFUA 1OTRB 3NY5A 3BJIA 2COAA 2VKIA 1V86A 3HM3A 1X1GA 4G3XB 1WX9A 2O6VB 1V88A 2LYDA 2FNJB 3QBVB 3AJ4A 5J3QA 1WE7A 1GJZA 1E5WA 3QC8B 2XQNM 2K6DB 4XC2A 4MDKE 5JHGA 3S2AA 4RM9A 4CYEA 2V4LA 3HW2B 3OAWA 2LXAA 2YSZA 2KQSA 1WMHA 3ZVVA 1MIXA 2JZ3B 3SU8X 5DPRA 2BWES 2RUKB 1WGRA 2GBMA 4MGYE 4FJZA 3O65B 3P6AA 3PLVA 2FCQA 3DQVA 2MSED 4KSLC 5KHOA 3PLUA 2C7HA 3CMMB 4DHZE 4IC7B 2NCNA 3PS6A 3H7PA 3IVFA 1C1YB 2LD9A 3UIOB 2C60A 4YONA 4K2PA 1WI0A 1G6JA 2LULA 1OQYA 2LGXA 2UZSA 4CO7A 2X18A 3ZNID 5L81A 1H10A 4W9HA 4FHJA 3UIPB 2YS3A 2HRJA 3LDZE 4GXBA 4JIOU 4I6NB 4W9DA 2AEHA 2IYBA 4F7GA 2KVRA 2L7RA 3ZNZB 4AP4C 1EGXA 2N9EB 3ODWA 1WGHA 5J18A 3ZKJC 2BCJA 1SGHA 2IO3B 1XODA 2YS1A 1UPQA 2BPSA 2Z59B 1V5OA 2MWNB 3PVLA 1PMSA 1V89A 4ANVA 1EAZA 4KIKA 4IAPA 2CR5A 2K8BA 3N32A 2MBQA 2XEWA 2N0YA 3SD5A 4NY0A 4FJVB 2ELBA 1XQQA 4KZ0A 1TGZB 3VQIA 3RCZA 4II2B 1U29A 2KX3A 3A9JB 1MIZB 1XCGA 2PE6B 2NZ8B 1M94A 1U4AA 2C9WB 1HB8A 4WJOA 1QZEA 3W1SC 2KHWB 2GBNA 2ZCBA 3C0RB 4EZLA 2DKPA 4K2OA 5AEKB 4LJPB 2XK5B 4JGHB 4A5KA 4HAXB 1SHCA 2LVOA 1V9JA 1P3QU 2R09A 1GG3A 4TQ0A 2UWQA 4Z2MB 1X11A 2JRIB 3WAMA 3HHMA 2G4DB 2Q13A 1U5DA 2MRPA 1Y8RC 2LZ6A 5LLIA 2D11A 2MKRA 2D9YA 2GBKA 4DWFA 3GYPA 3ONSA 2JZZA 5C5BA 3ZVRA 2LVQA 2DYOA 2KJHB 3ZNHB 4FADA 3V60A 1V5MA 1WR6E 1VD2A 3OLMD 3CSTA 1RJ2A 1KI1B 1EF1A 3PREA 3JYUA 1FOEA 1UNRA 2HTHB 3EC8A 2W2XC 4EMOA 2CHZA 1DDVA 1KOTA 3PPAA 1PLSA 2KJ6A 2YS5A 1EF5A 4KHOA 1ST7A 2L05A 4W9LA 4OVUA 2AWTA 1UNPA 2N9PC 2MP2B 3L08A 2CS4A 2CQUA 1KZ7A 3TW1A 3MJWA 3U30A 5L95C 3RULA 2VRWB 3DXDA 1I2HA 2Z0PA 5D3YA 4BBNC 2RGNB 3QIJA 1X1FA 2NS5A 3A98B 2FDQA 2ZVOA 1GC7A 3WAOA 3ZO5B 3ZDTA 3D8DA 2LGYA 4EJNA 5GOWB 2MCNB 4AWJA 3RYTA 1FGZA 1WXAA 1AARA 4PNKA 4HXDA 3VTUA 4LDTB 2L2IA 2Y8GA 2K2UA 2AYOB 3U8ZA 1UNQA 1ZVRA 4XZ4A 5G55A 4HAVB 1V2YA 5L83A 3FLVA 3ZTDA 1EVHA 4WSFA 3SHQA 5DPTA 3RZWC 4JLCA 5GMVA 2N4FA 2JP2A 1WXMA 1ACAA 3L0WB 3NZUA 4HDOA 4HB0B 3H9DA 2D9VA 2DX5A 3KRWA 3DOWA 4HDQA 3OANA 4N9F4 2N7DA 4PS7A 2YF0A 4KDIC 4FULA 3MPXA 4HCPB 4MJSA 2KD0A 2N7EA 2IO0B 3JSVB 4DBBA 1V6EA 1MK7B 5J17A 1X1MA 2I5CA 2KLCA 2K25A 3DDCB 2RVBB 1MKEA 2ZCCA 1WX8A 3PT2B 1R4MI 2KFKB 2PZ1A 4WWPA 3AU5A 2LKOA 1KZGA 2NR2A 4GDLA 4WJPA 2KFJA 2RD0A 3T8MA 2BYVE 2LI5A 2L8JA 4HB2B 3V62A 1HE8A 1Q5WB 4KSKC 2DFKA 2J59M 1V5TA 3L13A 5EDSA 4A20A 2HE7A 4TV3A 3R3MA 2FCMA 1E7VA 2VRRB 3ZDMC 1XR0B 3TJPA 5AZHA 3WANA 3IG3A 2R2QA 5CHWA 4CHKA 2KGXB 4FLHA 3QK0A 2KTRB 4GSWA 2MX2A 4JL9A 4ANWA 3IBEA 2KUPA 1WZ3A 4IW0A 4HVBA 1MPHA 3BY4B 4DDGD 5DIFB 3HK0A 4DX8A 4W9JA 3QQ8B 3V6EB 4DHJD 4ICVA 1WJ4A 3UQBA 1YQBA 4W9EA 1DDMA 3M95A 1OGWA 2DZMA 4IWOA 4BOSC 2A4ZA 2K00A 2G35A 4HWIB 4NNJB 4GMXB 2CHXA 2P0FA 1RRPB 3KYCD 4K7WA 4C0AA 1LQBA 1TQZA 3N30A 4YL8A 1YX6B 3L10B 4K7UA 4FN2A 2H7EA 4ICUA 2ZPYA 1FHOA 3ZNGC 3GYOA 3DPDA 2VSZA 4GDKA 2L3ZA 5E6OA 2JUOA 1J0GA 2NBVB 3LJ3A 4A3PA 5D94A 2D10A 3KUCB 2RGFA 3QA8A 1CMXB 2MA9B 3K9PB 2JPHA 4BOZB 1FHXA 4EZKA 2LOZA 2EJ8A 1UPRA 3WALA 5C16A 5HE1A 1SIFA 4ZDVA 2JY6A 2DAJA 2FCSA 2EKEC 2QHOA 1WRDB 1UELA 3QARA 2CU1A 4TYZA 2KDBA 1V5UA 3PGEA 3PV1A 2WWZA 1LM8B 1Q67A 5IA7A 1D3ZA 4W9IA 2EC1A 4NJ6A 1LFDA 4B9KA 1AQCA 5C79A 3ML4A 1Z87A 1WM3A 4LJOB 2DZKA 1J0WA 3H6NA 2EMTA 4PS3A 5KQ4A 1Y19B 2N23A 4F8CB 3RZFA 2Y7BA 2P8VA 4F7ZA 3PRZA 3DBSA 4MM3A 1FAOA 2D07B 3M63B 2PPHA 2QKLA 1WYWB 3ODXA 2ROVA 4EKUA 3A33B 2ADZA 1V49A 3G9WA 3QX1A 1OMWA 4F1SA 2RSUA 2DZIA 1MK9B 5E6PA 1PQSA 4HJKA 2YVCA 2WX0A 2FJ9A 4ASWC 2RNRB 2CY4A 3EPYA 1OEYJ 3KYDD 5EFXA 4P7IA 2DHKA 3H1UA 3A4SC 2BWFA 4KIKB 3PVWA 4HHVA 5KQ1A 2GBJA 1WJNA 4BKTA 5DCNA 3PHXB 1R4NI 1Z2MA 1IP9A 2MBBB 1LB1A 4K7SA 1P0RA 1WR1A 1FB8A 3LJUX 3RCPA 1NTVA 4KZCA 4GGQA 4ANUA 3ML8A 4KV2A 3PG7A 2FCNA 2LRWA 1X86A 1B55A 3X23A 1E8XA 2D9XA 2COFA 4K1RB 4NAWA 2ZVNA 2NVUI 1WXSA 2W9NA 1J8CA 1RAXA 1WI1A 4MK0A 3X0WA 1VCBA 5KCVA 3PVUA 2BGFA 1WE6A 1W1DA 4WWNA 2GCLA 1WX7A 1ZSQA 2MWSB 1RFAA 4MH0E 1P9DU 2NPTB 4FBJB 3Q3FA 2IBIB 3B1LX 1FGYA 3T9LA 4II3B 2P0DA 4M0WB 2ZNVC 2UVMA 2WH5A 4IWQA 3TO1A 1NBFC 1NDDA 3VH3B 2LGDA 2J0MA 2KJRA 4HB4B 3ZTCA 5LONB 4I6LB 4TUUA 1M7RA 2OQBA 3M3JA 5C6RA 2KZRA 2YLMA 3ALBA 4LCDE 4AOFA 3TL5A 4NQLB 1NTYA 4MGIE 4ZRIA 4W9CA 3PSCA 2DYBA 3D8EA 2EMSA 1WVHA 4HPLB 2ZNVB 2L0FA 2NBWB 3PRPB 3DVGY 1U5EA 4MT7A 5D3WA 2IY0B 1H4RA 3KH0A 1P3RA 1L7YA 4GZUA 1WIAA 2DZJA 5CLLB 3KSYA 3APDA 1ZKHA 3I3TB 5IAAC 4PS8A 2IO1B 2Z0DB 1I42A 2ELAA 4RM8A 3A8QA 1BTNA 4EFOA 1ZGUB 3K9OB 3EHVA 3OJ4B 4HAYB 1XKEA 1K8RB 2UZRA 1UEFA 1WG7A 3V6CB 4FA6A 2KNBA 1EUVB 3R66C 4WVFB 1UD7A 1WY8A 2K2JA 4GOCA 5AZFA 4EOYA 4BBKA 2WYQA 2NMBA 3M1IB 5DHAB 5HE2A 1E8ZA 2D3GA 3HQCA 4ZRKA 4GMVA 3DBLI 1WGGA 3WAPA 1DDWA 5J3TA 2MQJA 4HATB 5CX3A 1WJMA 2LXCA 3HM6X 2KCJA 2I1JA 2KX0A 3VIAA 1E8WA 3ULBA 1AWEA 2ZEQA 1S1QB 2AL6A 3ODOA 2MFQA 3NZSA 3JW0X 3A1QB 3B08A 5TR5A 1GNUA 2GMIC 2JVCA 1K5DB 4BKSA 2LBBA 2M38A 4F7UP 1J19A 3AULA 3CXBB 5C23A 2E2XA 2REXA 2L76A 1IPGA 1EO6A 2N9XA 2K39A 3L54A 3R7QA 2LVPA 2GS0A 1MAIA 2MLBA 2M4NA 2NBUA 3DCGA 4GDLB 2O2VA 1BT0A 2Y5BB 1YJ1A 1WJ6A 4BFRA 3N3KB 5DPWA 3ZUNA 5DI9B 1XD4A 2KN5A 1KJTA 2N1VA 4ZRJA 4EUTA 5FI0A 3QAQA 4D0NB 1I35A 2J0JA 5LXHA 3HIZA 1LW3A 2KC2A 3JSVA 1W1GA 4EZJA 3SUZA 3O96A 2DKQA 1WZ0A 4RMAA 4IWPA 4H8SA 4OVVA 1HBKA 3P2BA 2LASA 4PYZA 4JQWC 1DBHA 4A6FB 3F0WA 1Q1OA 2K1FA 3QCAA 3MTNB 5DH9B 3R7RA 3KRXA 5D7GA 3JVZX 2J7QB 4ZYNA 5AZGA 1NI2A 4K81A 3FEHA 2V3SA 3UGBB 2N1WA 4CHMA 1WGDA 3VUXA 3IFWB 1XT9B 3GZNI 2ZZPB 4GDKB 3VDZA 2BKFA 1LXDA 3PSEB 1WH3A 2D9WA 4A6HA 3DVNU 2KXJA 3GOEA 1C3TA 4IM0A 3VHTC 4GB9A 1U27A 1KM7A 3NHEB 4IFSA 1Y5OA 2GOWA 3WYFB 1U5FA 2XBBC 1NVLA 3TBLD 2IY1B 4MGZE 2DN6A 3SNHA 3V61A 3RUIB 5BO4B 2IYDB 2WDTB 1UBQA 1WMHB 4XWXA 4HB3B 2G3QB 3A9KA 3A8PA 3M62B 4KDLB 1E8YA 2DYQA 1Q0WB 2JT4B 2COCA 4I6PA 5JH5C 2O6VA 4FJYA 2L1CA 2KWUB 4PYUA 1V61A 2KMCA 1S3SG 4MSQB 1XD3B 3APFA 2DLWA 3FP5A 5D2MB 3UF8A 4DHJB 1OQNA 4KVGB 1JRUA 2MW5A 4URKA 3H7PB 2W2WA 1TZ1A 2KDEB 4WWOA 2D9ZA 3APCA 1Z5SB 4GU2A 3TIXA 2D4QA 1NTIA 1V81A 2BKRB 4J6IA 4MELA 3D32A 5CTRC
chains in the Genus database with same CATH superfamily
3AE4B 2GCJA 5HE0A 3PEGA 1HB6A 1FXTB 5J2RA 4WQOB 2Z0QA 3ML9A 3AE8B 1TJ6A 2JRHA 3NS8A 2CRFA 4KAXB 3VRBB 4M8MA 2M17A 3NVZA 2KN4A 3ZRFA 1JWSD 1ZDVA 1GC6A 5IJMA 1FIQA 2LHEA 4NPNA 5JP4A 2M0XA 4HAWB 3WA0A 1EU3A 1GOZA 3I5JC 3NWFA 1DROA 4HKQA 3AU4A 2M8SA 4RNAA 2MBOA 3MDBC 2K22A 1GUAB 4HPMB 2VH1A 4USAA 5E6NA 3ENEA 5D3VA 1RWSA 4W9FA 3ZRCA 4CHJA 1WM2A 1FHWA 4A90A 2V76A 1VRAB 2R0DA 4JE3B 2Z4DA 3UI3A 2PIAA 2KANA 4DX90 2DTCA 2FJLA 3EECA 3DVNV 2DHZA 4IKGA 1YX5B 2HJ8A 4PK1A 3Q69A 2BYEA 4WJNA 1LO5D 1H8CA 1E9MA 4XDCA 3D8FA 4PT5A 1IRSA 2CJNA 4NAWB 1D5XC 2DAFA 2YT0A 2W82A 2C5LC 2ACZB 3P63A 1WGYA 2G4SA 2KDMA 3AEGB 2KDIA 2VZKB 2IFSA 4JK9A 1K5GB 4H2AA 2H89B 1L4DB 2R2OA 2OTXA 2L00B 1FCLA 2UYZB 2EELA 1TT5B 4MACA 2RQ1A 3UQAA 2BYFA 1V5PA 2RLOA 1V80A 3B0AA 3SDLC 4XE0A 5G2NA 4REZA 1L5PA 2Z59A 1FRRA 3AM9A 3IHPC 3SYXA 1GAQB 4BVUC 2K6QA 4B95A 4AS1A 1P5TA 3A4RA 1C9FA 2C7NB 1ZC3B 2CAYA 2MHJA 3PRMB 3VUWA 1ZC4B 3DCXA 2K8CA 3T06A 3EFCA 3LXFA 3RT3B 3KUDB 1T6BX 4TQ1A 1GPXA 3I63C 4NJCA 2D2QA 3MC8A 4HK2A 2L1AA 3VOQA 5HFYA 1SE9A 4MSMB 5CHFA 1NENB 3A9JA 4KKJA 2QIEB 1BXTA 2YT1A 1RLFA 3ECIA 3RNCC 2BTEA 1YN3A 2BB6A 2PE9A 3AEAB 1I4GA 1QQGA 3L17A 2RR9A 1C4CA 1P6SA 2XN9C 4A3OA 2W2XD 2MEKA 1KTKA 3SV1A 2KUQA 3KY9A 4M8NA 5C5BB 4P1CC 5DHFB 4BKGA 2QDFA 1WF9A 4A8XC 2J0KA 5FKAC 2XK5A 3TCAA 2NPTA 2JXXA 2ZPNA 2LG1A 5D3DA 3DVGX 5JHAA 3NG0A 4MY6A 1KRHA 1UNSA 2ROZB 4LDTD 3P7ZA 1I4HA 1XLOA 2INCC 5TSSA 4BKSD 2WGSA 2MBHA 2MDXA 1M7EA 2ON8A 1FO4A 1HA5A 1WXQA 2WX1A 3AXCA 3MHSD 3QJZA 2KK8A 3F5RA 4MEMA 3ULCA 2JZPA 2W3SA 3ZW3A 2CY5A 2DYNA 3ZIMA 1OQQA 2E6XA 1VJKA 4Y94A 3BVZA 2H88B 5C1ZA 1KBLA 3VFKA 3HVZA 5BYQA 3T3OA 4AJWA 4X57B 5G5HA 2JF5A 3VVWB 4OVZA 3W1SA 3WIMA 3TMPB 4XX5A 4WAAA 3NW8A 1C78A 1BUIC 2PEAA 3RD2A 4DDID 1TS2A 2JWUA 2KQ7A 4HCNB 4NQKE 1DYNA 1PGAA 4A6QA 2KT7A 3QWMA 2DENB 3PHWB 4DHZB 4B6WA 1FMAD 3VH4B 4F7HA 4Z2NA 1TKYA 3RNFC 2K8HA 2BQQA 2M19A 1MFWA 2SAKA 3OJ3A 4A55A 2WU5B 1K52A 2I5FA 2H7DA 2HTHA 3C8YA 3BINA 3DBRI 4NAMA 3KLSX 2ABDA 2Y5CA 3DBHI 5HE3A 2HD5B 5FR6A 2KTFA 4YSXB 2COPA 2C7MB 2CHWA 4N59A 2QKMA 4G0NB 4DBGA 4TKNA 3DHGC 2AL3A 4WJQA 5IP4D 2KDFB 2MP2A 5D6JB 2DYMA 4QJ3B 3QHTA 3VAWA 4W9GA 2NTSA 4GPTB 2GJYA 1VR9A 3P4SB 2M14A 1KLVA 1EWYC 5LG4B 3KVFB 3PP2A 3UZTA 3NSUA 2K0PA 1E90A 2FIDA 4B6HA 1YIWA 1QC6A 1XO3A 2FIFA 2KWVB 3PZDA 3V5WA 5IOIA 2TSSA 2CKHB 3DXCA 4TSSA 2IO2B 2DX5B 3Q3OC 1WYGA 1P1AA 4HAUB 1UGMA 1TXDA 2GB1A 1B9RA 1SE2A 1TTNA 2R2YA 3B77A 4MGKE 3Q3NC 4MJSB 1L2NA 5HKHA 3VUYA 3TVVA 4E3CA 3R2IA 1ISNA 3VXWA 1RRBA 3IT4B 4HKZE 4IM2A 3Q8EA 4KGSA 4BBNF 5CLQB 1XCTL 3KUZA 3DXEA 3KW5B 2CB8A 4KHBB 3O13A 4A6KA 2KLGA 1P7EA 1AW7A 2ZJDA 3AEEB 5D27A 2IZVB 1OEYA 2X0SA 1JCKB 3Q8CA 2PW9A 4LTUA 4BAXA 1PFJA 1P98A 2BB5A 1ZM0A 2O2VB 5D3IB 2L0TA 2LOXA 3NVWA 2IGDA 3Q6BA 2OOBB 1PGXA 4FXCA 2KMAA 3ZXVA 4IM3A 1UH6A 2JU6X 2W3RA 5KHQA 5BMIA 4EEWA 1E7UA 5FI1A 3DBRB 2BBCA 2FBWB 1WGUA 1ET6A 1TBEA 4KHAA 3L16A 1JRPA 2I38A 4ZYSA 4E71A 4IUMB 4JKHA 3A1QA 1QOBA 4GN1A 1IGDA 3CSFA 5GXGB 1I7AA 1T0YA 1YD8U 5HHDG 2J53A 4G11A 1ZW7A 2FAZA 4HAZB 2DHIA 3AB5A 3KWLA 3N1YC 1WJUA 4NSWA 2Y8FA 3TEXA 2V1YA 3AN1A 4DK5A 1N3HA 3MJ5A 3CIKA 2B3AA 1NU2A 2WQYB 3NVYA 3CWIA 3FM8C 2ZW1A 4HSIA 2G45B 2WS3B 2DA0A 3UINB 3DBLB 3NOBA 4ZHOA 4WIPA 5CHVC 2DX1A 4E74A 1X05A 3Q3JA 2LUEA 2KOXA 2O6VD 1F9JA 3AI5A 5JHBA 1JMLA 5AUIA 1FNUA 3GP7A 2IGHA 2FUHB 4AJYB 2KFKA 4HEA1 3HUIA 1ENFA 2KKCA 2Z0OA 3CF6E 2KO3A 5JHHA 3VTWA 2RSGA 4GIVA 1OY2A 4FHKA 4DXAB 5LOPB 3U7DA 4QXAB 1BAKA 2RDBC 4AQ7A 2BF8B 2UU7A 4G50A 3TFMA 2YEPF 1FEHA 2CODA 2KC1A 3PZ7A 1DOIA 2GLSA 1SB3C 4D2KA 3NZ3A 4RF0A 2GBRA 1W1HA 2YRYA 3IAM1 3FILA 1UBIA 1U5GA 2MBEA 2OJRA 3SR6A 4C4VB 1WFYA 4NJ7A 3SO6A 1MI0A 4A6FA 1UZXB 1TKEA 1XX0A 4K17A 2ASQA 1KFYB 3N7CA 4IOYX 2DBYA 4YTPB 4ANXA 4WJ7A 2KTRA 5D3XA 3TEYA 1WXVA 2A5UA 2MJEA 1V1OA 2LRUA 2GRIA 2M1MA 2WXIA 5JZEB 3FSSA 2M0AA 5JLJB 4W9KA 1E10A 3KZ1A 3W1YA 4R3DA 1U2BA 4HLEA 3ZLZA 4L6EA 3PTFC 2RPQA 3H7SA 1WGQA 2Z0EB 4AUQC 2I1KA 3ZXRA 2JWZA 1BWNA 3RNBC 2LJ5A 1A5RA 5DPSA 2KWCA 3URYA 2J4XA 3HRDD 5LXIB 1F52A 3VTVA 1BTKA 2DHJA 5J3YA 1IYFA 1WJ1A 3BYTB 2P0HA 4PQ0A 4OZBA 4L1BA 4IG7B 2LWPA 3MHZA 3QWZB 3EA6A 1F2RC 3A9KB 1MG8A 2PJHA 1YJIA 1F0ZA 3EFUA 1OTRB 2JXTA 3RN9C 1QF6A 2HDEA 1YOVB 3NY5A 3BJIA 4JPSA 3VR9B 2COAA 3V3XA 3E66A 2DLBA 2VKIA 1V86A 3HM3A 1X1GA 4G3XB 1WX9A 1I7HA 2O6VB 1V88A 1N6ZA 3FVCA 1JW9D 3MC9A 2LYDA 2FNJB 3QBVB 3AJ4A 1IGCA 5J3QA 1XLPA 1WE7A 3BWUD 2NBVA 3RPFC 1GJZA 2QCZA 1E5WA 1SJED 1TYGB 2BS3B 3QC8B 2XQNM 2K6DB 4XC2A 4MDKE 5EE9A 5JHGA 3S2AA 1N62A 5BYSA 1GB1A 1YN5A 4RM9A 4CYEA 3LYYA 2V4LA 3HW2B 5T8IA 3OAWA 2LXAA 3ABVB 2YSZA 2KQSA 1WMHA 3ZVVA 4HROA 1YNTE 4MM3B 1FCCC 1MIXA 2JZ3B 3SU8X 4JK8A 5DPRA 2BWES 3AEBB 2RUKB 1WGRA 2GBMA 4MGYE 2ICIA 1IBXB 4FJZA 4ZRPA 3O65B 1FFUA 3P6AA 3Q2AC 3PLVA 5IRSA 2FCQA 2LFIA 2MSED 3DQVA 4RH6A 2BYTA 4KSLC 4DQOC 1PDXA 5KHOA 3PLUA 2PKOA 2C7HA 4Q2JA 3W2DA 1T0SC 3CMMB 4DHZE 2PVGC 1T3QA 4IC7B 2RRFA 3HIEA 2KWDA 2NCNA 2LMCA 4JKFA 3PS6A 3H7PA 1WGKA 3BK2A 1YMHE 3IVFA 3VR8B 1C1YB 1N5WA 2LD9A 3RNEC 4XWWA 4XWTA 3UIOB 2C60A 4YONA 4K2PA 1QOFA 3P42A 1WI0A 1G6JA 2LULA 1OQYA 2LGXA 2UZSA 1JALA 4CO7A 2X18A 3ZNID 5L81A 1H10A 4W9HA 4FHJA 1PGBA 3UIPB 2KR0A 1SJHD 4RGTA 2YS3A 2HRJA 3LDZE 4GXBA 4JIOU 4I6NB 4W9DA 2AEHA 1DIKA 2IYBA 2V9HA 4F7GA 2KVRA 1XF5L 2L7RA 2V0GA 3ZNZB 4AP4C 1EGXA 2N9EB 4GOUA 3ODWA 1WGHA 4YTNB 5MPOA 1HEZE 4ZOHC 5J18A 3ZKJC 2BCJA 1SGHA 1VBHA 2IO3B 1XODA 4HRSA 1MPEA 2YS1A 1UPQA 1JDEA 1DOXA 2BPSA 2Z59B 2DWQA 1V5OA 2V3NA 3AE2B 2MWNB 1YJJA 3PVLA 1PMSA 1V89A 4ANVA 1EAZA 1L0VB 1NEKB 4KIKA 4K3CA 5BMGA 4IAPA 2CR5A 2K8BA 2WXPA 3N32A 1PUTA 2MBQA 2FUG1 2ONQA 1STEA 2XEWA 2N0YA 3SD5A 4NY0A 1VDVA 1VZ8A 2Y5PA 4FJVB 2ELBA 1T0RC 1XQQA 4KZ0A 1TGZB 3VQIA 3RCZA 4XDDA 4II2B 1U29A 2KX3A 3A9JB 1I4QA 1MIZB 1XCGA 2PE6B 2NZ8B 2GI9A 1M94A 1U4AA 1ZE3D 1J7AA 2C9WB 1HB8A 4WJOA 1QZEA 3W1SC 1C79A 1OQRA 2KHWB 2E3TA 2GBNA 2WDRB 2ZCBA 1XLQA 3C0RB 4WWMA 2OEDA 3OWEB 4EZLA 2DKPA 4K2OA 1ROEA 5AEKB 4LJPB 2WP9B 2BT6A 2XK5B 3U4EG 1JQ4A 1PFDA 4JGHB 1MVKA 5I2SA 4A5KA 4HAXB 1SHCA 2LVOA 1NI3A 1DYQA 1V9JA 1P3QU 2R09A 4JWUC 1TS5A 1GG3A 4JKAA 4TQ0A 2UWQA 4Z2MB 1X11A 3ENBA 2WHIA 2JRIB 3TEZA 3WAMA 3HHMA 3VRAB 2G4DB 2WXKA 2JYEA 4KGTA 4M0WA 3Q8AA 2WXGA 2Q13A 2BS2B 1U5DA 1AN8A 2MRPA 1Y8RC 3HSAA 5BYRA 2LZ6A 2WLBA 5LLIA 2D11A 3N1ZC 1TY0A 1J7BA 2MKRA 2D9YA 4YSZB 2GBKA 4DWFA 1ET9A 3GYPA 2OHFA 1F77A 1KH0A 3ONSA 2JZZA 5C5BA 4LNOA 3ZVRA 4JKEA 5EE3A 2LVQA 2DYOA 1NYQA 2KJHB 3ZNHB 4FADA 3V60A 1V5MA 1WR6E 1VD2A 3W5VB 1NYRA 2N0SB 4JWSC 3OLMD 3CSTA 1RJ2A 1KI1B 1EF1A 3PREA 3JYUA 4YXDB 1FOEA 1UNRA 2HTHB 3EC8A 2W2XC 4EMOA 1YQ3B 2B76B 1LGRA 2CHZA 1DDVA 1KOTA 3L4PA 3PPAA 1PLSA 2KJ6A 2YS5A 1EF5A 1VLBA 4KHOA 4J3OD 1ST7A 1QILA 2L05A 4LNIA 4C7YA 3BVMA 4W9LA 4OVUA 2AWTA 2QEJC 1UNPA 2N9PC 2MP2B 2ZKMX 3L08A 2WXOA 4ILJA 2K49A 2CS4A 2CQUA 4BZAA 1KZ7A 3TW1A 3MJWA 1HZ6A 1D4BA 1K53A 1C4PA 4JKBA 4A9AA 4ARCA 1ACCA 3U30A 1HTOA 5L95C 3RULA 2VRWB 3DXDA 1QLBB 4ACFA 1I2HA 2Z0PA 5D3YA 4BBNC 4N58A 2RGNB 3QIJA 1X1FA 2NS5A 1T77A 3HVDA 3A98B 1HZ5A 2FDQA 2ZVOA 1QT9A 1EWCA 1GC7A 3BK1A 3WAOA 3ZO5B 3ZDTA 3D8DA 2LGYA 4EJNA 5GOWB 4L23A 4YWGG 5M4YB 4UDUC 2MCNB 3RYTA 1FGZA 4AWJA 1OFFA 3NWDA 1WXAA 1AARA 4PNKA 4HXDA 3VTUA 2WXHA 4LDTB 2L2IA 2Y8GA 2K2UA 1K51A 3ZJUA 3C19A 2AYOB 3U8ZA 2K8EA 1UNQA 1L4ZB 4MT5A 1N60A 5EE0A 3R8BA 1ZVRA 4XZ4A 1SEBD 2QSDA 5G55A 4HAVB 1V2YA 3N20C 5L83A 3FLVA 3ZTDA 1EVHA 4WSFA 3SHQA 5DPTA 1D6EC 3RZWC 4JLCA 5GMVA 1WWTA 2N4FA 2JP2A 1WXMA 1ACAA 3L0WB 1TJEA 1FPYA 1CJEA 1SBBB 3N9YC 3NZUA 4HDOA 1MJDA 4HB0B 3H9DA 1QKZA 3DHIC 2D9VA 4NZLB 3BIID 3NWAA 2DX5A 3H8HA 3NVVA 4C7ZA 3KRWA 3DOWA 4HDQA 3OANA 4N9F4 2N7DA 4PS7A 3WCQA 1JROA 2YF0A 4KDIC 4FULA 3MPXA 4HCPB 2X38A 4MJSA 2KD0A 2N7EA 3DBHB 1T0QC 3P4PB 2JYTA 2IO0B 3JSVB 4LLGM 4DBBA 4KHBA 1V6EA 4IOIE 1MK7B 1QOGA 5FK9C 1RFKA 5J17A 1X1MA 4P1BC 2I5CA 2KLCA 5EE1A 2K25A 1ZDXA 3DDCB 2RVBB 5C2TB 1MKEA 4GNKB 1ZOYB 2ZCCA 1WX8A 2N9LA 3PT2B 1R4MI 4RF1A 2KFKB 1A70A 2PZ1A 3AE1B 3AU5A 4WWPA 2EKIA 2LKOA 1KZGA 2NR2A 4GDLA 4WJPA 1D5ZC 2KFJA 2IDYA 2RD0A 3P4RB 3AE5B 3T8MA 3B9JA 2BYVE 2LI5A 2L8JA 4HB2B 3V62A 1HE8A 1L0XB 1Q5WB 4KSKC 2DFKA 2J59M 2Z13A 1V5TA 3GE3C 3L13A 3W5UB 5EDSA 4A20A 2HE7A 4TV3A 2INDC 3R3MA 2LUMA 2FCMA 1E7VA 3KQ4A 2VRRB 3ZDMC 1XR0B 4QAYA 3TJPA 5AZHA 3WANA 1J7CA 3ZQ4A 4LNNA 1MHHE 3MC0B 3IG3A 2R2QA 4M00A 5CHWA 3IXSA 2KQ4X 4CHKA 2KGXB 4FLHA 3QK0A 1HQRD 2KTRB 4GSWA 2MX2A 4XYCA 3NJTA 4JL9A 1CZPA 1FXIA 4ANWA 3IBEA 2I2YA 2KUPA 1WZ3A 5C3JB 4IW0A 4HVBA 1MPHA 3BY4B 4DDGD 2KACA 1GB4A 5DIFB 4RGNA 3HK0A 4DX8A 4W9JA 3QQ8B 3V6EB 4DHJD 4ICVA 4OZCA 1WJ4A 4S17A 1FRDA 3UQBA 1Y56A 5IN7A 1YQBA 4W9EA 1DDMA 3M95A 2RPVA 1OGWA 2DZMA 2V4IB 4IWOA 3ZJTA 4BOSC 3RI7C 2A4ZA 2W54A 2NMQA 2K00A 2G35A 4HWIB 1JWBD 4NNJB 2G1EA 4EE2A 4GMXB 2CHXA 2QILA 2P0FA 1E7PB 1RRPB 3KYCD 4HJGE 4K7WA 4C0AA 4JKGA 1NVID 4C4VA 3RNGC 1LQBA 1TQZA 1R4MB 2XNAC 3N30A 4YL8A 1XCQL 1YX6B 3L10B 4K7UA 1XLNA 1V1PA 2H7EA 4FN2A 4ICUA 4QJ4B 2MJ3A 2ZPYA 1FHOA 3ZNGC 3GYOA 3DPDA 3E9PA 2VSZA 4GDKA 1RYJA 2L3ZA 1WSPA 5E6OA 2JUOA 1J0GA 2JX5A 2NBVB 5HI1A 3LJ3A 4A3PA 5D94A 2D10A 1PYWD 3KUCB 3B2FA 4D6WA 2WDQB 1QQRA 2RGFA 4KGRA 3SBTA 4CSQA 3DHHC 3QA8A 1CMXB 2MA9B 3K9PB 2JPHA 4BOZB 1FHXA 4C56C 4EZKA 2LOZA 3MFGA 3Q3MC 2EJ8A 4DIXA 1UPRA 2PMVA 2GUMA 3WALA 1ESFA 5C16A 5HE1A 1SIFA 1VBGA 4ZDVA 2JY6A 1TIFA 2DAJA 2FCSA 2Z14A 2EKEC 2PVOD 2QHOA 1WRDB 1FNVA 5JXVA 2Y3AA 1UELA 3QARA 2CU1A 1UF0A 4TYZA 1L0YB 1V5UA 2KDBA 3PGEA 3PV1A 2WWZA 1LM8B 1Q67A 2LHDA 5IA7A 1D3ZA 4W9IA 2EC1A 4NJ6A 4GLSC 1LFDA 2VZKD 1AQCA 5C79A 1SSNA 4RCOA 4B9KA 3I57A 1I4PA 1JWUD 3ML4A 1Z87A 1WM3A 2LGIA 4LJOB 2DZKA 1J0WA 1F1HA 3FC4A 2KVZA 1DOYA 3H6NA 2EMTA 3AE9B 4PS3A 5KQ4A 3SFEB 2W55A 3AH7A 1Y19B 3OHMB 2N23A 4F8CB 3RZFA 2Y7BA 2P8VA 1I4RA 2D5GA 3A58A 4F7ZA 3PRZA 3DBSA 4MM3A 1FAOA 2D07B 3M63B 1BMLC 2PPHA 2QKLA 2MH7A 1WYWB 3ODXA 2ROVA 4EKUA 4C80A 3A33B 2KIEA 2ADZA 1IUEA 3R2TA 1IBXA 1V49A 2J52A 2OJWA 3G9WA 3QX1A 1E0ZA 3RMKC 1OMWA 4F1SA 3RFZB 2RSUA 2DZIA 2PLPA 5E6JA 5H8YE 1MK9B 5E6PA 1PQSA 4HJKA 1HXYD 5LNK1 2YVCA 1SXTA 2LGSA 2WX0A 2WXQA 2AX5A 1MI1A 2FJ9A 4ASWC 1UGJA 2RNRB 2AQ1B 2CY4A 3EPYA 2FE8A 1OEYJ 3KYDD 3TEWA 5EFXA 3SEBA 2M56B 4P7IA 2DHKA 2AQ2B 3H1UA 3AEFB 2QMTA 3A4SC 1C4AA 2L83A 2BWFA 4ARIA 1XEEA 4KIKB 3PVWA 4HHVA 5KQ1A 3U12A 2GBJA 1WJNA 4BKTA 3EGRA 3PHXB 1R4NI 5DCNA 1Z2MA 1IP9A 2MBBB 4JKCA 1LB1A 3IAS1 4RGMA 2L52A 1AWDA 5AUKA 4K7SA 1P0RA 3B2GA 1WRIA 1WR1A 3BVGA 2K3UA 1FB8A 3LJUX 3N1XC 3W9CB 3RCPA 1NTVA 3NRZA 4KZCA 4JX1C 5I4DA 4GGQA 2IJ0A 4ANUA 3ML8A 4KV2A 4YT0B 3Q8BA 2R82A 3PG7A 2FCNA 4WH4A 2LRWA 1X86A 1B55A 2KIGA 3X23A 1FXAA 1ZPSA 2R61A 1E8XA 2D9XA 1C76A 2DNFA 2COFA 4K1RB 4NAWA 2ZVNA 2NVUI 1WXSA 2W9NA 1YN4A 1J8CA 1RAXA 4HPPA 1WI1A 4MK0A 2J42A 1ZXHA 3PO0A 3X0WA 1VCBA 5KCVA 3PVUA 2WXFA 3SFDB 2BGFA 1WE6A 5G5GA 1W1DA 3SBGA 2WDVB 4WWNA 2GCLA 4M01A 2RDHA 1WX7A 3DWMA 1ZSQA 1B1ZA 3MP9A 4CQNA 2MWSB 1ZUD2 1RFAA 4MH0E 1P9DU 2NPTB 4FBJB 2IBIB 3Q3FA 3B1LX 1FGYA 3T9LA 1E6EB 4II3B 2P0DA 2LEKA 4M0WB 3U2SC 5IO9A 2ZNVC 2UVMA 2WH5A 4IWQA 4O1NA 2KYWA 3TO1A 1NBFC 1NDDA 3VH3B 2LGDA 2BVCA 1JWMD 3FAHA 2J0MA 2KJRA 4WURA 3U52E 4HB4B 3ZTCA 5LONB 2WXNA 4I6LB 4TUUA 1M7RA 2OQBA 2INNE 3M3JA 5C6RA 1ZP0B 4ZHPA 1R4NB 2KZRA 3GE8C 3Q8FA 5BMHA 2YLMA 4OHJA 2QJLA 3ALBA 3TUOA 4LCDE 4AOFA 3TL5A 4NQLB 1NTYA 4MGIE 1V8CA 2KMMA 4LNKA 1SE3A 2D3CA 4ZRIA 4KX6B 3U7ZA 2RMMA 4W9CA 3PSCA 2DYBA 3D8EA 3NS1A 2EMSA 2YT2A 5I2MA 1WVHA 4HPLB 2ZNVB 2L0FA 2NBWB 3PRPB 3DVGY 3AE6B 1U5EA 4MT7A 2FJUB 2ZW0A 1TS4A 3KWVA 5D3WA 1R7SA 2IY0B 2AQ3B 1H4RA 1MG4A 4RGOS 4S0RA 3KH0A 4ILHA 1L6UA 2NTTA 1P3RA 4OSNA 4GZUA 1L7YA 1KF6B 1WIAA 2DZJA 1M4VA 5CLLB 3KSYA 4M02A 3APDA 2VH2A 1ZKHA 3I3TB 5IAAC 1EU4A 4PS8A 3ZGZA 2IO1B 2Z0DB 1TS3A 3PZ8A 2N9KA 1I42A 2ELAA 4RM8A 3A8QA 1BTNA 4EFOA 3AEDB 1ZGUB 2WXLA 3K9OB 3BYYB 3EHVA 3OJ4B 4HAYB 3AMZA 4B0EA 1FD6A 1XKEA 1K8RB 2LJIA 2UZRA 2Q5WD 1KLUD 2D3BA 3DWGC 1UEFA 1WG7A 3AE7B 3V6CB 4C00A 4FA6A 2KNBA 5H92C 1EUVB 1DGJA 3R66C 4WVFB 1HTQA 1UD7A 1WY8A 4JK7A 2K2JA 3AECB 4GOCA 2HTME 5AZFA 4EOYA 4BBKA 2WYQA 3FKYA 4TMAB 1JWAD 5FR3A 2NMBA 4DXFA 3M1IB 5DHAB 5HE2A 3CIRB 1E8ZA 2D3GA 3HQCA 4ZRKA 5HG2A 4YTMB 4GMVA 3DBLI 4L1RA 1RM6C 1WGGA 3IT6B 3WAPA 4DXGA 1DDWA 5J3TA 3V05A 1ZYIA 2MQJA 1VZ6A 4HATB 2JQRB 5CX3A 1WJMA 2LXCA 3HM6X 2KCJA 2I1JA 2KX0A 3VIAA 1L6VA 1E8WA 3E9LA 3ULBA 1AWEA 2ZEQA 1S1QB 2AL6A 3ODOA 2MFQA 1V97A 3NZSA 3JW0X 3A1QB 3B08A 5TR5A 1GNUA 2GMIC 2JVCA 1K5DB 2BS4B 4BKSA 2LBBA 2M38A 4F7UP 1J19A 3AULA 3CXBB 5C23A 2E2XA 2K5PA 2REXA 2L76A 1IPGA 1EO6A 2N9XA 2K39A 3L54A 2X8XX 4P6VF 3R7QA 4L2YA 2CU3A 2LVPA 4B0MA 1EM7A 1MHXA 2GS0A 1MAIA 1UUPA 2M4NA 2MLBA 2NBUA 2HJ1A 3DCGA 4GDLB 2O2VA 3J9CA 1TZOA 3P4QB 3E9SA 4ILGB 1BT0A 2Y5BB 1ZXIA 4QJ5B 1YJ1A 1WJ6A 4BFRA 1FM0D 3N3KB 5DPWA 3ZUNA 5DI9B 1XD4A 2KN5A 1KJTA 2N1VA 4ZRJA 4EUTA 1K50A 2QC8A 5FI0A 3QAQA 4D0NB 1I35A 2J0JA 5LXHA 3GB1A 3HIZA 1LW3A 1KLGD 2KC2A 3JSVA 1W1GA 3BZDB 2KAJA 4EZJA 3SUZA 3O96A 5IKCM 2DKQA 1WZ0A 4RMAA 3E56A 2JSVX 2INPE 1CK1A 4IWPA 1UWXA 4H8SA 1AYFA 3FILB 4OVVA 1HBKA 1TY2A 2LASA 3E9OA 3P2BA 4PYZA 4JQWC 1DBHA 4A6FB 3OG5A 2IGGA 3F0WA 1SE4A 4OT1A 1Q1OA 2N7JA 4OZAA 2MJDA 3ETRA 1YQ4B 2K1FA 3QCAA 4XGAB 2L32A 4KKIA 2YEPB 3LB8C 3MTNB 4K3BA 5DH9B 3R7RA 3KRXA 5D7GA 3I9V1 4US8A 4OW0A 3JVZX 2RDGA 2J7QB 2BW2A 4ZYNA 5AZGA 1NI2A 4RFBA 2WNMA 1N5XA 3AE3B 4K81A 1KC7A 4LNFA 3FEHA 4JKGB 2V3SA 3UGBB 3EUB2 1N61A 2N1WA 4LK0M 1FFVA 4CHMA 1WGDA 1F2RI 1V1PB 1T5XD 2G9HD 2D3AA 3VUXA 3IFWB 1XT9B 3NUHB 3GZNI 2ZZPB 4GDKB 3VDZA 1P7FA 2Z8LA 2BKFA 1LXDA 3PSEB 4US9A 1WH3A 1GGOA 1I4XA 2WXJA 2DIKA 1VZ7A 2D9WA 4A6HA 3DVNU 2KXJA 3GOEA 1C3TA 3GS2A 4IM0A 3RNAC 3VHTC 1CQVA 4GB9A 1U27A 2K9XA 1KM7A 3NHEB 3P1MA 4IFSA 4P16A 1Y5OA 2GOWA 1FNWA 3Q14C 3WYFB 3ZJVA 1U5FA 4ZRQA 2WU2B 1TKGA 2XBBC 4WQMA 1QOAA 1NVLA 3TBLD 2CJOA 2IY1B 4MGZE 2DN6A 3SNHA 1SIJA 3V61A 3RUIB 5BO4B 2IYDB 2WDTB 4JKDA 1N63A 1UBQA 1WMHB 4XWXA 4HB3B 2G3QB 3A9KA 4IDIA 3A8PA 3M62B 4KDLB 1XXGA 1E8YA 2DYQA 1Q0WB 4N6EB 2JT4B 2COCA 2WXRA 4YSYB 4I6PA 5JH5C 2O6VA 4FJYA 1Q10A 2L1CA 2KWUB 4PYUA 1V61A 4MH8A 2KMCA 1S3SG 4MSQB 1SF0A 1XD3B 1D5MC 2IPKD 3APFA 2DLWA 1UWMA 3TSSA 1C77A 4WAFA 4ITKA 3FP5A 5JVLA 5D2MB 3UF8A 4DHJB 1OQNA 4KVGB 1JRUA 2SEBD 2MW5A 4URKA 3H7PB 2W2WA 1TZ1A 2KDEB 3GZNB 2PTLA 4WWOA 2V3PA 2D9ZA 3APCA 3T3NA 1Z5SB 4GU2A 3TIXA 2D4QA 1NTIA 1V81A 3ZYYX 2BKRB 3AV8A 4J6IA 2WXMA 4MELA 3D32A 5CTRC
chains in the Genus database with same CATH topology
2GCJA 5HE0A 3PEGA 1HB6A 1FXTB 5J2RA 4WQOB 2Z0QA 3ML9A 1TJ6A 2JRHA 3NS8A 2CRFA 4KAXB 4M8MA 2M17A 3ZRFA 4NPNA 1GC6A 5IJMA 5JP4A 2M0XA 4HAWB 3WA0A 1DROA 3AU4A 2M8SA 2MBOA 3MDBC 1GUAB 4HPMB 5E6NA 3ENEA 5D3VA 4W9FA 3ZRCA 4CHJA 1WM2A 1FHWA 2V76A 2R0DA 2KANA 4DX90 2DTCA 2FJLA 3EECA 3DVNV 2DHZA 1YX5B 2HJ8A 2BYEA 4WJNA 1H8CA 3D8FA 1IRSA 4NAWB 2DAFA 2YT0A 2C5LC 1WGYA 2G4SA 2KDIA 2IFSA 4JK9A 1K5GB 2R2OA 2OTXA 2L00B 2UYZB 2RQ1A 3UQAA 2BYFA 1V5PA 2RLOA 1V80A 3B0AA 3SDLC 5G2NA 3IHPC 3SYXA 4BVUC 2K6QA 4B95A 1P5TA 3A4RA 2C7NB 1ZC3B 2CAYA 3PRMB 3VUWA 1ZC4B 2K8CA 3T06A 3RT3B 3KUDB 4TQ1A 2D2QA 4HK2A 3VOQA 1SE9A 4MSMB 5CHFA 3A9JA 2YT1A 1RLFA 3ECIA 2PE9A 1QQGA 3L17A 2RR9A 1P6SA 4A3OA 2W2XD 3SV1A 3KY9A 4M8NA 5C5BB 5DHFB 4BKGA 1WF9A 2J0KA 2XK5A 3TCAA 2NPTA 2JXXA 2ZPNA 2LG1A 3DVGX 5JHAA 4MY6A 2ROZB 4LDTD 3P7ZA 4BKSD 2MBHA 2MDXA 1M7EA 2WX1A 3AXCA 3MHSD 3QJZA 2KK8A 3F5RA 4MEMA 3ULCA 3ZW3A 2CY5A 2DYNA 3ZIMA 4Y94A 5C1ZA 1KBLA 3VFKA 4AJWA 4X57B 2JF5A 3VVWB 3W1SA 3WIMA 3TMPB 4XX5A 4WAAA 2PEAA 3RD2A 4DDID 2KQ7A 4HCNB 4NQKE 1DYNA 3QWMA 2DENB 3PHWB 4DHZB 4B6WA 3VH4B 4F7HA 4Z2NA 2K8HA 3OJ3A 2I5FA 2H7DA 2HTHA 3BINA 3DBRI 2ABDA 3DBHI 5HE3A 2HD5B 5FR6A 2KTFA 2COPA 2C7MB 2CHWA 2QKMA 4G0NB 4DBGA 4TKNA 2AL3A 4WJQA 2KDFB 2MP2A 5D6JB 2DYMA 3QHTA 3VAWA 4W9GA 4GPTB 2GJYA 1KLVA 2M14A 3KVFB 3PP2A 3UZTA 3NSUA 1E90A 2FIDA 4B6HA 1YIWA 1QC6A 2FIFA 2KWVB 3PZDA 3V5WA 2CKHB 3DXCA 2IO2B 2DX5B 1P1AA 4HAUB 1UGMA 1TXDA 1TTNA 4MGKE 4MJSB 1L2NA 5HKHA 3VUYA 3TVVA 4E3CA 3VXWA 1ISNA 1RRBA 4IM2A 4BBNF 5CLQB 3KUZA 3DXEA 3KW5B 2CB8A 4KHBB 4A6KA 2KLGA 2ZJDA 5D27A 2IZVB 1OEYA 2X0SA 1PFJA 1P98A 1ZM0A 2O2VB 2L0TA 2LOXA 2OOBB 2KMAA 4IM3A 1UH6A 5KHQA 4EEWA 1E7UA 5FI1A 1WGUA 1TBEA 4KHAA 3L16A 4E71A 4IUMB 4JKHA 3A1QA 4GN1A 3CSFA 1I7AA 1T0YA 1YD8U 4G11A 1ZW7A 2FAZA 4HAZB 2DHIA 1WJUA 4NSWA 2Y8FA 2V1YA 4DK5A 1N3HA 3CIKA 2B3AA 1NU2A 3FM8C 2G45B 2DA0A 3UINB 3NOBA 5CHVC 2DX1A 4E74A 1X05A 3Q3JA 2LUEA 2KOXA 2O6VD 1F9JA 3AI5A 5JHBA 2FUHB 4AJYB 2KFKA 2KKCA 2Z0OA 3CF6E 2KO3A 5JHHA 3VTWA 2RSGA 4GIVA 1OY2A 4FHKA 4DXAB 5LOPB 3U7DA 1BAKA 2BF8B 4G50A 3TFMA 2CODA 2KC1A 2GBRA 1W1HA 2YRYA 1UBIA 1U5GA 2MBEA 2OJRA 1WFYA 4NJ7A 3SO6A 4A6FA 1UZXB 1XX0A 4K17A 2ASQA 3N7CA 4IOYX 4ANXA 4WJ7A 2KTRA 5D3XA 1WXVA 2A5UA 2LRUA 2M1MA 5JZEB 3FSSA 5JLJB 4W9KA 3KZ1A 3W1YA 1U2BA 4HLEA 3ZLZA 4L6EA 3PTFC 2RPQA 3H7SA 1WGQA 2Z0EB 4AUQC 2I1KA 2JWZA 1BWNA 2LJ5A 1A5RA 5DPSA 2KWCA 5LXIB 3VTVA 1BTKA 2DHJA 5J3YA 1IYFA 1WJ1A 2P0HA 4PQ0A 4IG7B 2LWPA 3QWZB 3A9KB 1MG8A 2PJHA 3EFUA 1OTRB 3NY5A 3BJIA 2COAA 3E66A 2VKIA 1V86A 3HM3A 1X1GA 4G3XB 1WX9A 2O6VB 1V88A 2LYDA 2FNJB 3QBVB 3AJ4A 5J3QA 1WE7A 1GJZA 1E5WA 3QC8B 2XQNM 2K6DB 4XC2A 4MDKE 5JHGA 3S2AA 4RM9A 4CYEA 2V4LA 3HW2B 3OAWA 2LXAA 2YSZA 2KQSA 1WMHA 3ZVVA 1MIXA 2JZ3B 3SU8X 4JK8A 5DPRA 2BWES 2RUKB 1WGRA 2GBMA 4MGYE 4FJZA 3O65B 3P6AA 3PLVA 2FCQA 3DQVA 2MSED 4KSLC 5KHOA 3PLUA 2C7HA 3CMMB 4DHZE 4IC7B 2NCNA 4JKFA 3PS6A 3H7PA 3IVFA 1C1YB 2LD9A 3UIOB 2C60A 4YONA 4K2PA 1WI0A 1G6JA 2LULA 1OQYA 2LGXA 2UZSA 4CO7A 2X18A 3ZNID 5L81A 1H10A 4W9HA 4FHJA 3UIPB 2YS3A 2HRJA 3LDZE 4GXBA 4JIOU 4I6NB 4W9DA 2AEHA 1DIKA 2IYBA 4F7GA 2KVRA 2L7RA 3ZNZB 4AP4C 1EGXA 2N9EB 3ODWA 1WGHA 5J18A 3ZKJC 2BCJA 1SGHA 1VBHA 2IO3B 1XODA 2YS1A 1UPQA 1JDEA 2BPSA 2Z59B 1V5OA 2MWNB 3PVLA 1PMSA 1V89A 4ANVA 1EAZA 4KIKA 4IAPA 2CR5A 2K8BA 3N32A 2MBQA 2XEWA 2N0YA 3SD5A 4NY0A 4FJVB 2ELBA 1XQQA 4KZ0A 1TGZB 3VQIA 3RCZA 4II2B 1U29A 2KX3A 3A9JB 1MIZB 1XCGA 2PE6B 2NZ8B 1M94A 1U4AA 2C9WB 1HB8A 4WJOA 1QZEA 3W1SC 2KHWB 2GBNA 2ZCBA 3C0RB 4EZLA 2DKPA 4K2OA 5AEKB 4LJPB 2XK5B 4JGHB 4A5KA 4HAXB 1SHCA 2LVOA 1V9JA 1P3QU 2R09A 1GG3A 4JKAA 4TQ0A 2UWQA 4Z2MB 1X11A 3ENBA 2JRIB 3WAMA 3HHMA 2G4DB 2Q13A 1U5DA 2MRPA 1Y8RC 2LZ6A 5LLIA 2D11A 2MKRA 2D9YA 2GBKA 4DWFA 3GYPA 3ONSA 2JZZA 5C5BA 3ZVRA 4JKEA 2LVQA 2DYOA 2KJHB 3ZNHB 4FADA 3V60A 1V5MA 1WR6E 1VD2A 3OLMD 3CSTA 1RJ2A 1KI1B 1EF1A 3PREA 3JYUA 1FOEA 1UNRA 2HTHB 3EC8A 2W2XC 4EMOA 2CHZA 1DDVA 1KOTA 3PPAA 1PLSA 2KJ6A 2YS5A 1EF5A 4KHOA 1ST7A 2L05A 4W9LA 4OVUA 2AWTA 1UNPA 2N9PC 2MP2B 3L08A 4ILJA 2CS4A 2CQUA 1KZ7A 3TW1A 3MJWA 4JKBA 3U30A 5L95C 3RULA 2VRWB 3DXDA 1I2HA 2Z0PA 5D3YA 4BBNC 2RGNB 3QIJA 1X1FA 2NS5A 3A98B 2FDQA 2ZVOA 1GC7A 3WAOA 3ZO5B 3ZDTA 3D8DA 2LGYA 4EJNA 5GOWB 2MCNB 4AWJA 3RYTA 1FGZA 1WXAA 1AARA 4PNKA 4HXDA 3VTUA 4LDTB 2L2IA 2Y8GA 2K2UA 2AYOB 3U8ZA 1UNQA 1ZVRA 4XZ4A 5G55A 4HAVB 1V2YA 5L83A 3FLVA 3ZTDA 1EVHA 4WSFA 3SHQA 5DPTA 3RZWC 4JLCA 5GMVA 2N4FA 2JP2A 1WXMA 1ACAA 3L0WB 3NZUA 4HDOA 4HB0B 3H9DA 2D9VA 2DX5A 3KRWA 3DOWA 4HDQA 3OANA 4N9F4 2N7DA 4PS7A 2YF0A 4KDIC 4FULA 3MPXA 4HCPB 4MJSA 2KD0A 2N7EA 2IO0B 3JSVB 4DBBA 1V6EA 1MK7B 5J17A 1X1MA 2I5CA 2KLCA 2K25A 3DDCB 2RVBB 1MKEA 2ZCCA 1WX8A 3PT2B 1R4MI 2KFKB 2PZ1A 4WWPA 3AU5A 2LKOA 1KZGA 2NR2A 4GDLA 4WJPA 2KFJA 2RD0A 3T8MA 2BYVE 2LI5A 2L8JA 4HB2B 3V62A 1HE8A 1Q5WB 4KSKC 2DFKA 2J59M 1V5TA 3L13A 5EDSA 4A20A 2HE7A 4TV3A 3R3MA 2FCMA 1E7VA 2VRRB 3ZDMC 1XR0B 3TJPA 5AZHA 3WANA 3IG3A 2R2QA 5CHWA 4CHKA 2KGXB 4FLHA 3QK0A 2KTRB 4GSWA 2MX2A 4JL9A 4ANWA 3IBEA 2KUPA 1WZ3A 4IW0A 4HVBA 1MPHA 3BY4B 4DDGD 5DIFB 3HK0A 4DX8A 4W9JA 3QQ8B 3V6EB 4DHJD 4ICVA 1WJ4A 3UQBA 1YQBA 4W9EA 1DDMA 3M95A 1OGWA 2DZMA 4IWOA 4BOSC 2A4ZA 2K00A 2G35A 4HWIB 4NNJB 4GMXB 2CHXA 2P0FA 1RRPB 3KYCD 4K7WA 4C0AA 4JKGA 1LQBA 1TQZA 3N30A 4YL8A 1YX6B 3L10B 4K7UA 4FN2A 2H7EA 4ICUA 2ZPYA 1FHOA 3ZNGC 3GYOA 3DPDA 3E9PA 2VSZA 4GDKA 2L3ZA 5E6OA 2JUOA 1J0GA 2NBVB 3LJ3A 4A3PA 5D94A 2D10A 3KUCB 2RGFA 3SBTA 3QA8A 1CMXB 2MA9B 3K9PB 2JPHA 4BOZB 1FHXA 4EZKA 2LOZA 2EJ8A 1UPRA 3WALA 5C16A 5HE1A 1SIFA 1VBGA 4ZDVA 2JY6A 2DAJA 2FCSA 2EKEC 2QHOA 1WRDB 1UELA 3QARA 2CU1A 4TYZA 2KDBA 1V5UA 3PGEA 3PV1A 2WWZA 1LM8B 1Q67A 5IA7A 1D3ZA 4W9IA 2EC1A 4NJ6A 1LFDA 4B9KA 1AQCA 5C79A 3ML4A 1Z87A 1WM3A 4LJOB 2DZKA 1J0WA 3H6NA 2EMTA 4PS3A 5KQ4A 1Y19B 2N23A 4F8CB 3RZFA 2Y7BA 2P8VA 4F7ZA 3PRZA 3DBSA 4MM3A 1FAOA 2D07B 3M63B 2PPHA 2QKLA 1WYWB 3ODXA 2ROVA 4EKUA 3A33B 2ADZA 1V49A 3G9WA 3QX1A 1OMWA 4F1SA 2RSUA 2DZIA 1MK9B 5E6PA 1PQSA 4HJKA 2YVCA 2WX0A 2FJ9A 4ASWC 2RNRB 2CY4A 3EPYA 1OEYJ 3KYDD 5EFXA 4P7IA 2DHKA 3H1UA 3A4SC 2BWFA 4KIKB 3PVWA 4HHVA 5KQ1A 2GBJA 1WJNA 4BKTA 5DCNA 3PHXB 1R4NI 1Z2MA 1IP9A 2MBBB 4JKCA 1LB1A 4K7SA 1P0RA 1WR1A 1FB8A 3LJUX 3RCPA 1NTVA 4KZCA 4GGQA 4ANUA 3ML8A 4KV2A 2R82A 3PG7A 2FCNA 2LRWA 1X86A 1B55A 3X23A 1E8XA 2D9XA 2COFA 4K1RB 4NAWA 2ZVNA 2NVUI 1WXSA 2W9NA 1J8CA 1RAXA 1WI1A 4MK0A 3X0WA 1VCBA 5KCVA 3PVUA 2BGFA 1WE6A 1W1DA 3SBGA 4WWNA 2GCLA 1WX7A 1ZSQA 2MWSB 1RFAA 4MH0E 1P9DU 2NPTB 4FBJB 3Q3FA 2IBIB 3B1LX 1FGYA 3T9LA 4II3B 2P0DA 4M0WB 2ZNVC 2UVMA 2WH5A 4IWQA 3TO1A 1NBFC 1NDDA 3VH3B 2LGDA 2J0MA 2KJRA 4HB4B 3ZTCA 5LONB 4I6LB 4TUUA 1M7RA 2OQBA 3M3JA 5C6RA 2KZRA 2YLMA 3ALBA 4LCDE 4AOFA 3TL5A 4NQLB 1NTYA 4MGIE 4ZRIA 4W9CA 3PSCA 2DYBA 3D8EA 2EMSA 1WVHA 4HPLB 2ZNVB 2L0FA 2NBWB 3PRPB 3DVGY 1U5EA 4MT7A 5D3WA 2IY0B 1H4RA 3KH0A 4ILHA 1P3RA 1L7YA 4GZUA 1WIAA 2DZJA 5CLLB 3KSYA 3APDA 1ZKHA 3I3TB 5IAAC 4PS8A 2IO1B 2Z0DB 1I42A 2ELAA 4RM8A 3A8QA 1BTNA 4EFOA 1ZGUB 3K9OB 3EHVA 3OJ4B 4HAYB 1XKEA 1K8RB 2UZRA 1UEFA 1WG7A 3V6CB 4FA6A 2KNBA 1EUVB 3R66C 4WVFB 1UD7A 1WY8A 4JK7A 2K2JA 4GOCA 5AZFA 4EOYA 4BBKA 2WYQA 2NMBA 3M1IB 5DHAB 5HE2A 1E8ZA 2D3GA 3HQCA 4ZRKA 4GMVA 3DBLI 1WGGA 3WAPA 1DDWA 5J3TA 2MQJA 4HATB 5CX3A 1WJMA 2LXCA 3HM6X 2KCJA 2I1JA 2KX0A 3VIAA 1E8WA 3E9LA 3ULBA 1AWEA 2ZEQA 1S1QB 2AL6A 3ODOA 2MFQA 3NZSA 3JW0X 3A1QB 3B08A 5TR5A 1GNUA 2GMIC 2JVCA 1K5DB 4BKSA 2LBBA 2M38A 4F7UP 1J19A 3AULA 3CXBB 5C23A 2E2XA 2REXA 2L76A 1IPGA 1EO6A 2N9XA 2K39A 3L54A 3R7QA 2LVPA 2GS0A 1MAIA 2MLBA 2M4NA 2NBUA 3DCGA 4GDLB 2O2VA 4ILGB 1BT0A 2Y5BB 1YJ1A 1WJ6A 4BFRA 3N3KB 5DPWA 3ZUNA 5DI9B 1XD4A 2KN5A 1KJTA 2N1VA 4ZRJA 4EUTA 5FI0A 3QAQA 4D0NB 1I35A 2J0JA 5LXHA 3HIZA 1LW3A 2KC2A 3JSVA 1W1GA 4EZJA 3SUZA 3O96A 2DKQA 1WZ0A 4RMAA 4IWPA 4H8SA 4OVVA 1HBKA 3P2BA 2LASA 3E9OA 4PYZA 4JQWC 1DBHA 4A6FB 3F0WA 1Q1OA 2K1FA 3QCAA 3MTNB 5DH9B 3R7RA 3KRXA 5D7GA 3JVZX 2J7QB 4ZYNA 5AZGA 1NI2A 4K81A 1KC7A 3FEHA 4JKGB 2V3SA 3UGBB 2N1WA 4CHMA 1WGDA 3VUXA 3IFWB 1XT9B 3GZNI 2ZZPB 4GDKB 3VDZA 2BKFA 1LXDA 3PSEB 1WH3A 1GGOA 2DIKA 2D9WA 4A6HA 3DVNU 2KXJA 3GOEA 1C3TA 4IM0A 3VHTC 4GB9A 1U27A 1KM7A 3NHEB 4IFSA 1Y5OA 2GOWA 3WYFB 1U5FA 2XBBC 1NVLA 3TBLD 2IY1B 4MGZE 2DN6A 3SNHA 3V61A 3RUIB 5BO4B 2IYDB 2WDTB 4JKDA 1UBQA 1WMHB 4XWXA 4HB3B 2G3QB 3A9KA 3A8PA 3M62B 4KDLB 1E8YA 2DYQA 1Q0WB 2JT4B 2COCA 4I6PA 5JH5C 2O6VA 4FJYA 2L1CA 2KWUB 4PYUA 1V61A 2KMCA 1S3SG 4MSQB 1XD3B 3APFA 2DLWA 3FP5A 5JVLA 5D2MB 3UF8A 4DHJB 1OQNA 4KVGB 1JRUA 2MW5A 4URKA 3H7PB 2W2WA 1TZ1A 2KDEB 4WWOA 2D9ZA 3APCA 1Z5SB 4GU2A 3TIXA 2D4QA 1NTIA 1V81A 2BKRB 4J6IA 4MELA 3D32A 5CTRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GCJ A;  5HE0 A;  3PEG A;  1HB6 A;  1FXT B;  5J2R A;  4WQO B;  2Z0Q A;  3ML9 A;  1TJ6 A;  2JRH A;  3NS8 A;  2CRF A;  4KAX B;  4M8M A;  2M17 A;  3ZRF A;  4NPN A;  1GC6 A;  5IJM A;  5JP4 A;  2M0X A;  4HAW B;  3WA0 A;  1DRO A;  3AU4 A;  2M8S A;  2MBO A;  3MDB C;  1GUA B;  4HPM B;  5E6N A;  3ENE A;  5D3V A;  4W9F A;  3ZRC A;  4CHJ A;  1WM2 A;  1FHW A;  2V76 A;  2R0D A;  2KAN A;  4DX9 0;  2DTC A;  2FJL A;  3EEC A;  3DVN V;  2DHZ A;  1YX5 B;  2HJ8 A;  2BYE A;  4WJN A;  1H8C A;  3D8F A;  1IRS A;  4NAW B;  2DAF A;  2YT0 A;  2C5L C;  1WGY A;  2G4S A;  2KDI A;  2IFS A;  1K5G B;  2R2O A;  2OTX A;  2L00 B;  2UYZ B;  2RQ1 A;  3UQA A;  2BYF A;  1V5P A;  2RLO A;  1V80 A;  3B0A A;  3SDL C;  5G2N A;  3IHP C;  3SYX A;  4BVU C;  2K6Q A;  4B95 A;  1P5T A;  3A4R A;  2C7N B;  1ZC3 B;  2CAY A;  3PRM B;  3VUW A;  1ZC4 B;  2K8C A;  3T06 A;  3RT3 B;  3KUD B;  4TQ1 A;  2D2Q A;  4HK2 A;  3VOQ A;  1SE9 A;  4MSM B;  5CHF A;  3A9J A;  2YT1 A;  1RLF A;  3ECI A;  2PE9 A;  1QQG A;  3L17 A;  2RR9 A;  1P6S A;  4A3O A;  2W2X D;  3SV1 A;  3KY9 A;  4M8N A;  5C5B B;  5DHF B;  4BKG A;  1WF9 A;  2J0K A;  2XK5 A;  3TCA A;  2NPT A;  2JXX A;  2ZPN A;  2LG1 A;  3DVG X;  5JHA A;  4MY6 A;  2ROZ B;  4LDT D;  3P7Z A;  4BKS D;  2MBH A;  2MDX A;  1M7E A;  2WX1 A;  3AXC A;  3MHS D;  3QJZ A;  2KK8 A;  3F5R A;  4MEM A;  3ULC A;  3ZW3 A;  2CY5 A;  2DYN A;  3ZIM A;  4Y94 A;  5C1Z A;  3VFK A;  4AJW A;  4X57 B;  2JF5 A;  3VVW B;  3W1S A;  3WIM A;  3TMP B;  4XX5 A;  4WAA A;  2PEA A;  3RD2 A;  4DDI D;  2KQ7 A;  4HCN B;  4NQK E;  1DYN A;  3QWM A;  2DEN B;  3PHW B;  4DHZ B;  4B6W A;  3VH4 B;  4F7H A;  4Z2N A;  2K8H A;  3OJ3 A;  2I5F A;  2H7D A;  2HTH A;  3BIN A;  3DBR I;  2ABD A;  3DBH I;  5HE3 A;  2HD5 B;  5FR6 A;  2KTF A;  2COP A;  2C7M B;  2CHW A;  2QKM A;  4G0N B;  4DBG A;  4TKN A;  2AL3 A;  4WJQ A;  2KDF B;  2MP2 A;  5D6J B;  2DYM A;  3QHT A;  3VAW A;  4W9G A;  4GPT B;  2GJY A;  1KLV A;  2M14 A;  3KVF B;  3PP2 A;  3UZT A;  3NSU A;  1E90 A;  2FID A;  4B6H A;  1YIW A;  1QC6 A;  2FIF A;  2KWV B;  3PZD A;  3V5W A;  2CKH B;  3DXC A;  2IO2 B;  2DX5 B;  1P1A A;  4HAU B;  1UGM A;  1TXD A;  1TTN A;  4MGK E;  4MJS B;  1L2N A;  5HKH A;  3VUY A;  3TVV A;  4E3C A;  3VXW A;  1ISN A;  1RRB A;  4IM2 A;  4BBN F;  5CLQ B;  3KUZ A;  3DXE A;  3KW5 B;  2CB8 A;  4KHB B;  4A6K A;  2KLG A;  2ZJD A;  5D27 A;  2IZV B;  1OEY A;  1PFJ A;  1P98 A;  1ZM0 A;  2O2V B;  2L0T A;  2LOX A;  2OOB B;  2KMA A;  4IM3 A;  1UH6 A;  5KHQ A;  4EEW A;  1E7U A;  5FI1 A;  1WGU A;  1TBE A;  4KHA A;  3L16 A;  4E71 A;  4IUM B;  3A1Q A;  4GN1 A;  3CSF A;  1I7A A;  1T0Y A;  1YD8 U;  4G11 A;  1ZW7 A;  2FAZ A;  4HAZ B;  2DHI A;  1WJU A;  4NSW A;  2Y8F A;  2V1Y A;  4DK5 A;  1N3H A;  3CIK A;  2B3A A;  1NU2 A;  3FM8 C;  2G45 B;  2DA0 A;  3UIN B;  3NOB A;  5CHV C;  2DX1 A;  4E74 A;  1X05 A;  3Q3J A;  2LUE A;  2KOX A;  2O6V D;  1F9J A;  3AI5 A;  5JHB A;  2FUH B;  4AJY B;  2KFK A;  2KKC A;  2Z0O A;  3CF6 E;  2KO3 A;  5JHH A;  3VTW A;  2RSG A;  4GIV A;  1OY2 A;  4FHK A;  4DXA B;  5LOP B;  3U7D A;  1BAK A;  2BF8 B;  4G50 A;  3TFM A;  2COD A;  2KC1 A;  2GBR A;  1W1H A;  2YRY A;  1UBI A;  1U5G A;  2MBE A;  2OJR A;  1WFY A;  4NJ7 A;  3SO6 A;  4A6F A;  1UZX B;  1XX0 A;  4K17 A;  2ASQ A;  3N7C A;  4IOY X;  4ANX A;  4WJ7 A;  2KTR A;  5D3X A;  1WXV A;  2A5U A;  2LRU A;  2M1M A;  5JZE B;  3FSS A;  5JLJ B;  4W9K A;  3KZ1 A;  3W1Y A;  1U2B A;  4HLE A;  3ZLZ A;  4L6E A;  3PTF C;  2RPQ A;  3H7S A;  1WGQ A;  2Z0E B;  4AUQ C;  2I1K A;  2JWZ A;  1BWN A;  2LJ5 A;  1A5R A;  5DPS A;  2KWC A;  5LXI B;  3VTV A;  1BTK A;  2DHJ A;  5J3Y A;  1IYF A;  1WJ1 A;  2P0H A;  4PQ0 A;  4IG7 B;  2LWP A;  3QWZ B;  3A9K B;  1MG8 A;  2PJH A;  3EFU A;  1OTR B;  3NY5 A;  3BJI A;  2COA A;  2VKI A;  1V86 A;  3HM3 A;  1X1G A;  4G3X B;  1WX9 A;  2O6V B;  1V88 A;  2LYD A;  2FNJ B;  3QBV B;  3AJ4 A;  5J3Q A;  1WE7 A;  1GJZ A;  1E5W A;  3QC8 B;  2XQN M;  2K6D B;  4XC2 A;  4MDK E;  5JHG A;  3S2A A;  4RM9 A;  4CYE A;  2V4L A;  3HW2 B;  3OAW A;  2LXA A;  2YSZ A;  2KQS A;  1WMH A;  3ZVV A;  1MIX A;  2JZ3 B;  3SU8 X;  5DPR A;  2BWE S;  2RUK B;  1WGR A;  2GBM A;  4MGY E;  4FJZ A;  3O65 B;  3P6A A;  3PLV A;  2FCQ A;  3DQV A;  2MSE D;  4KSL C;  5KHO A;  3PLU A;  2C7H A;  3CMM B;  4DHZ E;  4IC7 B;  2NCN A;  3PS6 A;  3H7P A;  3IVF A;  1C1Y B;  2LD9 A;  3UIO B;  2C60 A;  4YON A;  4K2P A;  1WI0 A;  1G6J A;  2LUL A;  1OQY A;  2LGX A;  2UZS A;  4CO7 A;  2X18 A;  3ZNI D;  5L81 A;  1H10 A;  4W9H A;  4FHJ A;  3UIP B;  2YS3 A;  2HRJ A;  3LDZ E;  4GXB A;  4JIO U;  4I6N B;  4W9D A;  2AEH A;  2IYB A;  4F7G A;  2KVR A;  2L7R A;  3ZNZ B;  4AP4 C;  1EGX A;  2N9E B;  3ODW A;  1WGH A;  5J18 A;  3ZKJ C;  2BCJ A;  1SGH A;  2IO3 B;  1XOD A;  2YS1 A;  1UPQ A;  2BPS A;  2Z59 B;  1V5O A;  2MWN B;  3PVL A;  1PMS A;  1V89 A;  4ANV A;  1EAZ A;  4KIK A;  4IAP A;  2CR5 A;  2K8B A;  3N32 A;  2MBQ A;  2XEW A;  2N0Y A;  3SD5 A;  4NY0 A;  4FJV B;  2ELB A;  1XQQ A;  4KZ0 A;  1TGZ B;  3VQI A;  3RCZ A;  4II2 B;  1U29 A;  2KX3 A;  3A9J B;  1MIZ B;  1XCG A;  2PE6 B;  2NZ8 B;  1M94 A;  1U4A A;  2C9W B;  1HB8 A;  4WJO A;  1QZE A;  3W1S C;  2KHW B;  2GBN A;  2ZCB A;  3C0R B;  4EZL A;  2DKP A;  4K2O A;  5AEK B;  4LJP B;  2XK5 B;  4JGH B;  4A5K A;  4HAX B;  1SHC A;  2LVO A;  1V9J A;  1P3Q U;  2R09 A;  1GG3 A;  4TQ0 A;  2UWQ A;  4Z2M B;  1X11 A;  2JRI B;  3WAM A;  3HHM A;  2G4D B;  2Q13 A;  1U5D A;  2MRP A;  1Y8R C;  2LZ6 A;  5LLI A;  2D11 A;  2MKR A;  2D9Y A;  2GBK A;  4DWF A;  3GYP A;  3ONS A;  2JZZ A;  5C5B A;  3ZVR A;  2LVQ A;  2DYO A;  2KJH B;  3ZNH B;  4FAD A;  3V60 A;  1V5M A;  1WR6 E;  1VD2 A;  3OLM D;  3CST A;  1RJ2 A;  1KI1 B;  1EF1 A;  3PRE A;  3JYU A;  1FOE A;  1UNR A;  2HTH B;  3EC8 A;  2W2X C;  4EMO A;  2CHZ A;  1DDV A;  1KOT A;  3PPA A;  1PLS A;  2KJ6 A;  2YS5 A;  1EF5 A;  4KHO A;  1ST7 A;  2L05 A;  4W9L A;  4OVU A;  2AWT A;  1UNP A;  2N9P C;  2MP2 B;  3L08 A;  2CS4 A;  2CQU A;  1KZ7 A;  3TW1 A;  3MJW A;  3U30 A;  5L95 C;  3RUL A;  2VRW B;  3DXD A;  1I2H A;  2Z0P A;  5D3Y A;  4BBN C;  2RGN B;  3QIJ A;  1X1F A;  2NS5 A;  3A98 B;  2FDQ A;  2ZVO A;  1GC7 A;  3WAO A;  3ZO5 B;  3ZDT A;  3D8D A;  2LGY A;  4EJN A;  5GOW B;  2MCN B;  4AWJ A;  3RYT A;  1FGZ A;  1WXA A;  1AAR A;  4PNK A;  4HXD A;  3VTU A;  4LDT B;  2L2I A;  2Y8G A;  2K2U A;  2AYO B;  3U8Z A;  1UNQ A;  1ZVR A;  4XZ4 A;  5G55 A;  4HAV B;  1V2Y A;  5L83 A;  3FLV A;  3ZTD A;  1EVH A;  4WSF A;  3SHQ A;  5DPT A;  3RZW C;  4JLC A;  5GMV A;  2N4F A;  2JP2 A;  1WXM A;  1ACA A;  3L0W B;  3NZU A;  4HDO A;  4HB0 B;  3H9D A;  2D9V A;  2DX5 A;  3KRW A;  3DOW A;  4HDQ A;  3OAN A;  4N9F 4;  2N7D A;  4PS7 A;  2YF0 A;  4KDI C;  4FUL A;  3MPX A;  4HCP B;  4MJS A;  2KD0 A;  2N7E A;  2IO0 B;  3JSV B;  4DBB A;  1V6E A;  1MK7 B;  5J17 A;  1X1M A;  2I5C A;  2KLC A;  2K25 A;  3DDC B;  2RVB B;  1MKE A;  2ZCC A;  1WX8 A;  3PT2 B;  1R4M I;  2KFK B;  2PZ1 A;  4WWP A;  3AU5 A;  2LKO A;  1KZG A;  2NR2 A;  4GDL A;  4WJP A;  2KFJ A;  2RD0 A;  3T8M A;  2BYV E;  2LI5 A;  2L8J A;  4HB2 B;  3V62 A;  1HE8 A;  1Q5W B;  4KSK C;  2DFK A;  2J59 M;  1V5T A;  3L13 A;  5EDS A;  4A20 A;  2HE7 A;  4TV3 A;  3R3M A;  2FCM A;  1E7V A;  2VRR B;  3ZDM C;  1XR0 B;  3TJP A;  5AZH A;  3WAN A;  3IG3 A;  2R2Q A;  5CHW A;  4CHK A;  2KGX B;  4FLH A;  3QK0 A;  2KTR B;  4GSW A;  2MX2 A;  4JL9 A;  4ANW A;  3IBE A;  2KUP A;  1WZ3 A;  4IW0 A;  4HVB A;  1MPH A;  3BY4 B;  4DDG D;  5DIF B;  3HK0 A;  4DX8 A;  4W9J A;  3QQ8 B;  3V6E B;  4DHJ D;  4ICV A;  1WJ4 A;  3UQB A;  1YQB A;  4W9E A;  1DDM A;  3M95 A;  1OGW A;  2DZM A;  4IWO A;  4BOS C;  2A4Z A;  2K00 A;  2G35 A;  4HWI B;  4NNJ B;  4GMX B;  2CHX A;  2P0F A;  1RRP B;  3KYC D;  4K7W A;  4C0A A;  1LQB A;  1TQZ A;  3N30 A;  4YL8 A;  1YX6 B;  3L10 B;  4K7U A;  4FN2 A;  2H7E A;  4ICU A;  2ZPY A;  1FHO A;  3ZNG C;  3GYO A;  3DPD A;  2VSZ A;  4GDK A;  2L3Z A;  5E6O A;  2JUO A;  1J0G A;  2NBV B;  3LJ3 A;  4A3P A;  5D94 A;  2D10 A;  3KUC B;  2RGF A;  3QA8 A;  1CMX B;  2MA9 B;  3K9P B;  2JPH A;  4BOZ B;  1FHX A;  4EZK A;  2LOZ A;  2EJ8 A;  1UPR A;  3WAL A;  5C16 A;  5HE1 A;  1SIF A;  4ZDV A;  2JY6 A;  2DAJ A;  2FCS A;  2EKE C;  2QHO A;  1WRD B;  1UEL A;  3QAR A;  2CU1 A;  4TYZ A;  2KDB A;  1V5U A;  3PGE A;  3PV1 A;  2WWZ A;  1LM8 B;  1Q67 A;  5IA7 A;  1D3Z A;  4W9I A;  2EC1 A;  4NJ6 A;  1LFD A;  4B9K A;  1AQC A;  5C79 A;  3ML4 A;  1Z87 A;  1WM3 A;  4LJO B;  2DZK A;  1J0W A;  3H6N A;  2EMT A;  4PS3 A;  5KQ4 A;  1Y19 B;  2N23 A;  4F8C B;  3RZF A;  2Y7B A;  2P8V A;  4F7Z A;  3PRZ A;  3DBS A;  4MM3 A;  1FAO A;  2D07 B;  3M63 B;  2PPH A;  2QKL A;  1WYW B;  3ODX A;  2ROV A;  4EKU A;  3A33 B;  2ADZ A;  1V49 A;  3G9W A;  3QX1 A;  1OMW A;  4F1S A;  2RSU A;  2DZI A;  1MK9 B;  5E6P A;  1PQS A;  4HJK A;  2YVC A;  2WX0 A;  2FJ9 A;  4ASW C;  2RNR B;  2CY4 A;  3EPY A;  1OEY J;  3KYD D;  5EFX A;  4P7I A;  2DHK A;  3H1U A;  3A4S C;  2BWF A;  4KIK B;  3PVW A;  4HHV A;  5KQ1 A;  2GBJ A;  1WJN A;  4BKT A;  5DCN A;  3PHX B;  1R4N I;  1Z2M A;  1IP9 A;  2MBB B;  1LB1 A;  4K7S A;  1P0R A;  1WR1 A;  1FB8 A;  3LJU X;  3RCP A;  1NTV A;  4KZC A;  4GGQ A;  4ANU A;  3ML8 A;  4KV2 A;  3PG7 A;  2FCN A;  2LRW A;  1X86 A;  1B55 A;  3X23 A;  1E8X A;  2D9X A;  2COF A;  4K1R B;  4NAW A;  2ZVN A;  2NVU I;  1WXS A;  2W9N A;  1J8C A;  1RAX A;  1WI1 A;  4MK0 A;  3X0W A;  1VCB A;  5KCV A;  3PVU A;  2BGF A;  1WE6 A;  1W1D A;  4WWN A;  2GCL A;  1WX7 A;  1ZSQ A;  2MWS B;  1RFA A;  4MH0 E;  1P9D U;  2NPT B;  4FBJ B;  3Q3F A;  2IBI B;  3B1L X;  1FGY A;  3T9L A;  4II3 B;  2P0D A;  4M0W B;  2ZNV C;  2UVM A;  2WH5 A;  4IWQ A;  3TO1 A;  1NBF C;  1NDD A;  3VH3 B;  2LGD A;  2J0M A;  2KJR A;  4HB4 B;  3ZTC A;  5LON B;  4I6L B;  4TUU A;  1M7R A;  2OQB A;  3M3J A;  5C6R A;  2KZR A;  2YLM A;  3ALB A;  4LCD E;  4AOF A;  3TL5 A;  4NQL B;  1NTY A;  4MGI E;  4ZRI A;  4W9C A;  3PSC A;  2DYB A;  3D8E A;  2EMS A;  1WVH A;  4HPL B;  2ZNV B;  2L0F A;  2NBW B;  3PRP B;  3DVG Y;  1U5E A;  4MT7 A;  5D3W A;  2IY0 B;  1H4R A;  3KH0 A;  1P3R A;  1L7Y A;  4GZU A;  1WIA A;  2DZJ A;  5CLL B;  3KSY A;  3APD A;  1ZKH A;  3I3T B;  5IAA C;  4PS8 A;  2IO1 B;  2Z0D B;  1I42 A;  2ELA A;  4RM8 A;  3A8Q A;  1BTN A;  4EFO A;  1ZGU B;  3K9O B;  3EHV A;  3OJ4 B;  4HAY B;  1XKE A;  1K8R B;  2UZR A;  1UEF A;  1WG7 A;  3V6C B;  4FA6 A;  2KNB A;  1EUV B;  3R66 C;  4WVF B;  1UD7 A;  1WY8 A;  2K2J A;  4GOC A;  5AZF A;  4EOY A;  4BBK A;  2WYQ A;  2NMB A;  3M1I B;  5DHA B;  5HE2 A;  1E8Z A;  2D3G A;  3HQC A;  4ZRK A;  4GMV A;  3DBL I;  1WGG A;  3WAP A;  1DDW A;  5J3T A;  2MQJ A;  4HAT B;  5CX3 A;  1WJM A;  2LXC A;  3HM6 X;  2KCJ A;  2I1J A;  2KX0 A;  3VIA A;  1E8W A;  3ULB A;  1AWE A;  2ZEQ A;  1S1Q B;  2AL6 A;  3ODO A;  2MFQ A;  3NZS A;  3JW0 X;  3A1Q B;  3B08 A;  5TR5 A;  1GNU A;  2GMI C;  2JVC A;  1K5D B;  4BKS A;  2LBB A;  2M38 A;  4F7U P;  1J19 A;  3AUL A;  3CXB B;  5C23 A;  2E2X A;  2REX A;  2L76 A;  1IPG A;  1EO6 A;  2N9X A;  2K39 A;  3L54 A;  3R7Q A;  2LVP A;  2GS0 A;  1MAI A;  2MLB A;  2M4N A;  2NBU A;  3DCG A;  4GDL B;  2O2V A;  1BT0 A;  2Y5B B;  1YJ1 A;  1WJ6 A;  4BFR A;  3N3K B;  5DPW A;  3ZUN A;  5DI9 B;  1XD4 A;  2KN5 A;  1KJT A;  2N1V A;  4ZRJ A;  4EUT A;  5FI0 A;  3QAQ A;  4D0N B;  1I35 A;  2J0J A;  5LXH A;  3HIZ A;  1LW3 A;  2KC2 A;  3JSV A;  1W1G A;  4EZJ A;  3SUZ A;  3O96 A;  2DKQ A;  1WZ0 A;  4RMA A;  4IWP A;  4H8S A;  4OVV A;  1HBK A;  3P2B A;  2LAS A;  4PYZ A;  4JQW C;  1DBH A;  4A6F B;  3F0W A;  1Q1O A;  2K1F A;  3QCA A;  3MTN B;  5DH9 B;  3R7R A;  3KRX A;  5D7G A;  3JVZ X;  2J7Q B;  4ZYN A;  5AZG A;  1NI2 A;  4K81 A;  3FEH A;  2V3S A;  3UGB B;  2N1W A;  4CHM A;  1WGD A;  3VUX A;  3IFW B;  1XT9 B;  3GZN I;  2ZZP B;  4GDK B;  3VDZ A;  2BKF A;  1LXD A;  3PSE B;  1WH3 A;  2D9W A;  4A6H A;  3DVN U;  2KXJ A;  3GOE A;  1C3T A;  4IM0 A;  3VHT C;  4GB9 A;  1U27 A;  1KM7 A;  3NHE B;  4IFS A;  1Y5O A;  2GOW A;  3WYF B;  1U5F A;  2XBB C;  1NVL A;  3TBL D;  2IY1 B;  4MGZ E;  2DN6 A;  3SNH A;  3V61 A;  3RUI B;  5BO4 B;  2IYD B;  2WDT B;  1UBQ A;  1WMH B;  4XWX A;  4HB3 B;  2G3Q B;  3A9K A;  3A8P A;  3M62 B;  4KDL B;  1E8Y A;  2DYQ A;  1Q0W B;  2JT4 B;  2COC A;  4I6P A;  5JH5 C;  2O6V A;  4FJY A;  2L1C A;  2KWU B;  4PYU A;  1V61 A;  2KMC A;  1S3S G;  4MSQ B;  1XD3 B;  3APF A;  2DLW A;  3FP5 A;  5D2M B;  3UF8 A;  4DHJ B;  1OQN A;  4KVG B;  1JRU A;  2MW5 A;  4URK A;  3H7P B;  2W2W A;  1TZ1 A;  2KDE B;  4WWO A;  2D9Z A;  3APC A;  1Z5S B;  4GU2 A;  3TIX A;  2D4Q A;  1NTI A;  1V81 A;  2BKR B;  4J6I A;  4MEL A;  3D32 A;  5CTR C; 
#chains in the Genus database with same CATH topology
 3AE4 B;  2GCJ A;  5HE0 A;  3PEG A;  1HB6 A;  1FXT B;  5J2R A;  4WQO B;  2Z0Q A;  3ML9 A;  3AE8 B;  1TJ6 A;  2JRH A;  3NS8 A;  2CRF A;  4KAX B;  3VRB B;  4M8M A;  2M17 A;  3NVZ A;  2KN4 A;  3ZRF A;  1JWS D;  1ZDV A;  1GC6 A;  5IJM A;  1FIQ A;  2LHE A;  4NPN A;  5JP4 A;  2M0X A;  4HAW B;  3WA0 A;  1EU3 A;  1GOZ A;  3I5J C;  3NWF A;  1DRO A;  4HKQ A;  3AU4 A;  2M8S A;  4RNA A;  2MBO A;  3MDB C;  2K22 A;  1GUA B;  4HPM B;  2VH1 A;  4USA A;  5E6N A;  3ENE A;  5D3V A;  1RWS A;  4W9F A;  3ZRC A;  4CHJ A;  1WM2 A;  1FHW A;  4A90 A;  2V76 A;  1VRA B;  2R0D A;  4JE3 B;  2Z4D A;  3UI3 A;  2PIA A;  2KAN A;  4DX9 0;  2DTC A;  2FJL A;  3EEC A;  3DVN V;  2DHZ A;  4IKG A;  1YX5 B;  2HJ8 A;  4PK1 A;  3Q69 A;  2BYE A;  4WJN A;  1LO5 D;  1H8C A;  1E9M A;  4XDC A;  3D8F A;  4PT5 A;  1IRS A;  2CJN A;  4NAW B;  1D5X C;  2DAF A;  2YT0 A;  2W82 A;  2C5L C;  2ACZ B;  3P63 A;  1WGY A;  2G4S A;  2KDM A;  3AEG B;  2KDI A;  2VZK B;  2IFS A;  4JK9 A;  1K5G B;  4H2A A;  2H89 B;  1L4D B;  2R2O A;  2OTX A;  2L00 B;  1FCL A;  2UYZ B;  2EEL A;  1TT5 B;  4MAC A;  2RQ1 A;  3UQA A;  2BYF A;  1V5P A;  2RLO A;  1V80 A;  3B0A A;  3SDL C;  4XE0 A;  5G2N A;  4REZ A;  1L5P A;  2Z59 A;  1FRR A;  3AM9 A;  3IHP C;  3SYX A;  1GAQ B;  4BVU C;  2K6Q A;  4B95 A;  4AS1 A;  1P5T A;  3A4R A;  1C9F A;  2C7N B;  1ZC3 B;  2CAY A;  2MHJ A;  3PRM B;  3VUW A;  1ZC4 B;  3DCX A;  2K8C A;  3T06 A;  3EFC A;  3LXF A;  3RT3 B;  3KUD B;  1T6B X;  4TQ1 A;  1GPX A;  3I63 C;  4NJC A;  2D2Q A;  3MC8 A;  4HK2 A;  2L1A A;  3VOQ A;  5HFY A;  1SE9 A;  4MSM B;  5CHF A;  1NEN B;  3A9J A;  4KKJ A;  2QIE B;  1BXT A;  2YT1 A;  1RLF A;  3ECI A;  3RNC C;  2BTE A;  1YN3 A;  2BB6 A;  2PE9 A;  3AEA B;  1I4G A;  1QQG A;  3L17 A;  2RR9 A;  1C4C A;  1P6S A;  2XN9 C;  4A3O A;  2W2X D;  2MEK A;  1KTK A;  3SV1 A;  2KUQ A;  3KY9 A;  4M8N A;  5C5B B;  4P1C C;  5DHF B;  4BKG A;  2QDF A;  1WF9 A;  4A8X C;  2J0K A;  5FKA C;  2XK5 A;  3TCA A;  2NPT A;  2JXX A;  2ZPN A;  2LG1 A;  5D3D A;  3DVG X;  5JHA A;  3NG0 A;  4MY6 A;  1KRH A;  1UNS A;  2ROZ B;  4LDT D;  3P7Z A;  1I4H A;  1XLO A;  2INC C;  5TSS A;  4BKS D;  2WGS A;  2MBH A;  2MDX A;  1M7E A;  2ON8 A;  1FO4 A;  1HA5 A;  1WXQ A;  2WX1 A;  3AXC A;  3MHS D;  3QJZ A;  2KK8 A;  3F5R A;  4MEM A;  3ULC A;  2JZP A;  2W3S A;  3ZW3 A;  2CY5 A;  2DYN A;  3ZIM A;  1OQQ A;  2E6X A;  1VJK A;  4Y94 A;  3BVZ A;  2H88 B;  5C1Z A;  1KBL A;  3VFK A;  3HVZ A;  5BYQ A;  3T3O A;  4AJW A;  4X57 B;  5G5H A;  2JF5 A;  3VVW B;  4OVZ A;  3W1S A;  3WIM A;  3TMP B;  4XX5 A;  4WAA A;  3NW8 A;  1C78 A;  1BUI C;  2PEA A;  3RD2 A;  4DDI D;  1TS2 A;  2JWU A;  2KQ7 A;  4HCN B;  4NQK E;  1DYN A;  1PGA A;  4A6Q A;  2KT7 A;  3QWM A;  2DEN B;  3PHW B;  4DHZ B;  4B6W A;  1FMA D;  3VH4 B;  4F7H A;  4Z2N A;  1TKY A;  3RNF C;  2K8H A;  2BQQ A;  2M19 A;  1MFW A;  2SAK A;  3OJ3 A;  4A55 A;  2WU5 B;  1K52 A;  2I5F A;  2H7D A;  2HTH A;  3C8Y A;  3BIN A;  3DBR I;  4NAM A;  3KLS X;  2ABD A;  2Y5C A;  3DBH I;  5HE3 A;  2HD5 B;  5FR6 A;  2KTF A;  4YSX B;  2COP A;  2C7M B;  2CHW A;  4N59 A;  2QKM A;  4G0N B;  4DBG A;  4TKN A;  3DHG C;  2AL3 A;  4WJQ A;  5IP4 D;  2KDF B;  2MP2 A;  5D6J B;  2DYM A;  4QJ3 B;  3QHT A;  3VAW A;  4W9G A;  2NTS A;  4GPT B;  2GJY A;  1VR9 A;  3P4S B;  2M14 A;  1KLV A;  1EWY C;  5LG4 B;  3KVF B;  3PP2 A;  3UZT A;  3NSU A;  2K0P A;  1E90 A;  2FID A;  4B6H A;  1YIW A;  1QC6 A;  1XO3 A;  2FIF A;  2KWV B;  3PZD A;  3V5W A;  5IOI A;  2TSS A;  2CKH B;  3DXC A;  4TSS A;  2IO2 B;  2DX5 B;  3Q3O C;  1WYG A;  1P1A A;  4HAU B;  1UGM A;  1TXD A;  2GB1 A;  1B9R A;  1SE2 A;  1TTN A;  2R2Y A;  3B77 A;  4MGK E;  3Q3N C;  4MJS B;  1L2N A;  5HKH A;  3VUY A;  3TVV A;  4E3C A;  3R2I A;  1ISN A;  3VXW A;  1RRB A;  3IT4 B;  4HKZ E;  4IM2 A;  3Q8E A;  4KGS A;  4BBN F;  5CLQ B;  1XCT L;  3KUZ A;  3DXE A;  3KW5 B;  2CB8 A;  4KHB B;  3O13 A;  4A6K A;  2KLG A;  1P7E A;  1AW7 A;  2ZJD A;  3AEE B;  5D27 A;  2IZV B;  1OEY A;  2X0S A;  1JCK B;  3Q8C A;  2PW9 A;  4LTU A;  4BAX A;  1PFJ A;  1P98 A;  2BB5 A;  1ZM0 A;  2O2V B;  5D3I B;  2L0T A;  2LOX A;  3NVW A;  2IGD A;  3Q6B A;  2OOB B;  1PGX A;  4FXC A;  2KMA A;  3ZXV A;  4IM3 A;  1UH6 A;  2JU6 X;  2W3R A;  5KHQ A;  5BMI A;  4EEW A;  1E7U A;  5FI1 A;  3DBR B;  2BBC A;  2FBW B;  1WGU A;  1ET6 A;  1TBE A;  4KHA A;  3L16 A;  1JRP A;  2I38 A;  4ZYS A;  4E71 A;  4IUM B;  4JKH A;  3A1Q A;  1QOB A;  4GN1 A;  1IGD A;  3CSF A;  5GXG B;  1I7A A;  1T0Y A;  1YD8 U;  5HHD G;  2J53 A;  4G11 A;  1ZW7 A;  2FAZ A;  4HAZ B;  2DHI A;  3AB5 A;  3KWL A;  3N1Y C;  1WJU A;  4NSW A;  2Y8F A;  3TEX A;  2V1Y A;  3AN1 A;  4DK5 A;  1N3H A;  3MJ5 A;  3CIK A;  2B3A A;  1NU2 A;  2WQY B;  3NVY A;  3CWI A;  3FM8 C;  2ZW1 A;  4HSI A;  2G45 B;  2WS3 B;  2DA0 A;  3UIN B;  3DBL B;  3NOB A;  4ZHO A;  4WIP A;  5CHV C;  2DX1 A;  4E74 A;  1X05 A;  3Q3J A;  2LUE A;  2KOX A;  2O6V D;  1F9J A;  3AI5 A;  5JHB A;  1JML A;  5AUI A;  1FNU A;  3GP7 A;  2IGH A;  2FUH B;  4AJY B;  2KFK A;  4HEA 1;  3HUI A;  1ENF A;  2KKC A;  2Z0O A;  3CF6 E;  2KO3 A;  5JHH A;  3VTW A;  2RSG A;  4GIV A;  1OY2 A;  4FHK A;  4DXA B;  5LOP B;  3U7D A;  4QXA B;  1BAK A;  2RDB C;  4AQ7 A;  2BF8 B;  2UU7 A;  4G50 A;  3TFM A;  2YEP F;  1FEH A;  2COD A;  2KC1 A;  3PZ7 A;  1DOI A;  2GLS A;  1SB3 C;  4D2K A;  3NZ3 A;  4RF0 A;  2GBR A;  1W1H A;  2YRY A;  3IAM 1;  3FIL A;  1UBI A;  1U5G A;  2MBE A;  2OJR A;  3SR6 A;  4C4V B;  1WFY A;  4NJ7 A;  3SO6 A;  1MI0 A;  4A6F A;  1UZX B;  1TKE A;  1XX0 A;  4K17 A;  2ASQ A;  1KFY B;  3N7C A;  4IOY X;  2DBY A;  4YTP B;  4ANX A;  4WJ7 A;  2KTR A;  5D3X A;  3TEY A;  1WXV A;  2A5U A;  2MJE A;  1V1O A;  2LRU A;  2GRI A;  2M1M A;  2WXI A;  5JZE B;  3FSS A;  2M0A A;  5JLJ B;  4W9K A;  1E10 A;  3KZ1 A;  3W1Y A;  4R3D A;  1U2B A;  4HLE A;  3ZLZ A;  4L6E A;  3PTF C;  2RPQ A;  3H7S A;  1WGQ A;  2Z0E B;  4AUQ C;  2I1K A;  3ZXR A;  2JWZ A;  1BWN A;  3RNB C;  2LJ5 A;  1A5R A;  5DPS A;  2KWC A;  3URY A;  2J4X A;  3HRD D;  5LXI B;  1F52 A;  3VTV A;  1BTK A;  2DHJ A;  5J3Y A;  1IYF A;  1WJ1 A;  3BYT B;  2P0H A;  4PQ0 A;  4OZB A;  4L1B A;  4IG7 B;  2LWP A;  3MHZ A;  3QWZ B;  3EA6 A;  1F2R C;  3A9K B;  1MG8 A;  2PJH A;  1YJI A;  1F0Z A;  3EFU A;  1OTR B;  2JXT A;  3RN9 C;  1QF6 A;  2HDE A;  1YOV B;  3NY5 A;  3BJI A;  4JPS A;  3VR9 B;  2COA A;  3V3X A;  3E66 A;  2DLB A;  2VKI A;  1V86 A;  3HM3 A;  1X1G A;  4G3X B;  1WX9 A;  1I7H A;  2O6V B;  1V88 A;  1N6Z A;  3FVC A;  1JW9 D;  3MC9 A;  2LYD A;  2FNJ B;  3QBV B;  3AJ4 A;  1IGC A;  5J3Q A;  1XLP A;  1WE7 A;  3BWU D;  2NBV A;  3RPF C;  1GJZ A;  2QCZ A;  1E5W A;  1SJE D;  1TYG B;  2BS3 B;  3QC8 B;  2XQN M;  2K6D B;  4XC2 A;  4MDK E;  5EE9 A;  5JHG A;  3S2A A;  1N62 A;  5BYS A;  1GB1 A;  1YN5 A;  4RM9 A;  4CYE A;  3LYY A;  2V4L A;  3HW2 B;  5T8I A;  3OAW A;  2LXA A;  3ABV B;  2YSZ A;  2KQS A;  1WMH A;  3ZVV A;  4HRO A;  1YNT E;  4MM3 B;  1FCC C;  1MIX A;  2JZ3 B;  3SU8 X;  4JK8 A;  5DPR A;  2BWE S;  3AEB B;  2RUK B;  1WGR A;  2GBM A;  4MGY E;  2ICI A;  1IBX B;  4FJZ A;  4ZRP A;  3O65 B;  1FFU A;  3P6A A;  3Q2A C;  3PLV A;  5IRS A;  2FCQ A;  2LFI A;  2MSE D;  3DQV A;  4RH6 A;  2BYT A;  4KSL C;  4DQO C;  1PDX A;  5KHO A;  3PLU A;  2PKO A;  2C7H A;  4Q2J A;  3W2D A;  1T0S C;  3CMM B;  4DHZ E;  2PVG C;  1T3Q A;  4IC7 B;  2RRF A;  3HIE A;  2KWD A;  2NCN A;  2LMC A;  4JKF A;  3PS6 A;  3H7P A;  1WGK A;  3BK2 A;  1YMH E;  3IVF A;  3VR8 B;  1C1Y B;  1N5W A;  2LD9 A;  3RNE C;  4XWW A;  4XWT A;  3UIO B;  2C60 A;  4YON A;  4K2P A;  1QOF A;  3P42 A;  1WI0 A;  1G6J A;  2LUL A;  1OQY A;  2LGX A;  2UZS A;  1JAL A;  4CO7 A;  2X18 A;  3ZNI D;  5L81 A;  1H10 A;  4W9H A;  4FHJ A;  1PGB A;  3UIP B;  2KR0 A;  1SJH D;  4RGT A;  2YS3 A;  2HRJ A;  3LDZ E;  4GXB A;  4JIO U;  4I6N B;  4W9D A;  2AEH A;  1DIK A;  2IYB A;  2V9H A;  4F7G A;  2KVR A;  1XF5 L;  2L7R A;  2V0G A;  3ZNZ B;  4AP4 C;  1EGX A;  2N9E B;  4GOU A;  3ODW A;  1WGH A;  4YTN B;  5MPO A;  1HEZ E;  4ZOH C;  5J18 A;  3ZKJ C;  2BCJ A;  1SGH A;  1VBH A;  2IO3 B;  1XOD A;  4HRS A;  1MPE A;  2YS1 A;  1UPQ A;  1JDE A;  1DOX A;  2BPS A;  2Z59 B;  2DWQ A;  1V5O A;  2V3N A;  3AE2 B;  2MWN B;  1YJJ A;  3PVL A;  1PMS A;  1V89 A;  4ANV A;  1EAZ A;  1L0V B;  1NEK B;  4KIK A;  4K3C A;  5BMG A;  4IAP A;  2CR5 A;  2K8B A;  2WXP A;  3N32 A;  1PUT A;  2MBQ A;  2FUG 1;  2ONQ A;  1STE A;  2XEW A;  2N0Y A;  3SD5 A;  4NY0 A;  1VDV A;  1VZ8 A;  2Y5P A;  4FJV B;  2ELB A;  1T0R C;  1XQQ A;  4KZ0 A;  1TGZ B;  3VQI A;  3RCZ A;  4XDD A;  4II2 B;  1U29 A;  2KX3 A;  3A9J B;  1I4Q A;  1MIZ B;  1XCG A;  2PE6 B;  2NZ8 B;  2GI9 A;  1M94 A;  1U4A A;  1ZE3 D;  1J7A A;  2C9W B;  1HB8 A;  4WJO A;  1QZE A;  3W1S C;  1C79 A;  1OQR A;  2KHW B;  2E3T A;  2GBN A;  2WDR B;  2ZCB A;  1XLQ A;  3C0R B;  4WWM A;  2OED A;  3OWE B;  4EZL A;  2DKP A;  4K2O A;  1ROE A;  5AEK B;  4LJP B;  2WP9 B;  2BT6 A;  2XK5 B;  3U4E G;  1JQ4 A;  1PFD A;  4JGH B;  1MVK A;  5I2S A;  4A5K A;  4HAX B;  1SHC A;  2LVO A;  1NI3 A;  1DYQ A;  1V9J A;  1P3Q U;  2R09 A;  4JWU C;  1TS5 A;  1GG3 A;  4JKA A;  4TQ0 A;  2UWQ A;  4Z2M B;  1X11 A;  3ENB A;  2WHI A;  2JRI B;  3TEZ A;  3WAM A;  3HHM A;  3VRA B;  2G4D B;  2WXK A;  2JYE A;  4KGT A;  4M0W A;  3Q8A A;  2WXG A;  2Q13 A;  2BS2 B;  1U5D A;  1AN8 A;  2MRP A;  1Y8R C;  3HSA A;  5BYR A;  2LZ6 A;  2WLB A;  5LLI A;  2D11 A;  3N1Z C;  1TY0 A;  1J7B A;  2MKR A;  2D9Y A;  4YSZ B;  2GBK A;  4DWF A;  1ET9 A;  3GYP A;  2OHF A;  1F77 A;  1KH0 A;  3ONS A;  2JZZ A;  5C5B A;  4LNO A;  3ZVR A;  4JKE A;  5EE3 A;  2LVQ A;  2DYO A;  1NYQ A;  2KJH B;  3ZNH B;  4FAD A;  3V60 A;  1V5M A;  1WR6 E;  1VD2 A;  3W5V B;  1NYR A;  2N0S B;  4JWS C;  3OLM D;  3CST A;  1RJ2 A;  1KI1 B;  1EF1 A;  3PRE A;  3JYU A;  4YXD B;  1FOE A;  1UNR A;  2HTH B;  3EC8 A;  2W2X C;  4EMO A;  1YQ3 B;  2B76 B;  1LGR A;  2CHZ A;  1DDV A;  1KOT A;  3L4P A;  3PPA A;  1PLS A;  2KJ6 A;  2YS5 A;  1EF5 A;  1VLB A;  4KHO A;  4J3O D;  1ST7 A;  1QIL A;  2L05 A;  4LNI A;  4C7Y A;  3BVM A;  4W9L A;  4OVU A;  2AWT A;  2QEJ C;  1UNP A;  2N9P C;  2MP2 B;  2ZKM X;  3L08 A;  2WXO A;  4ILJ A;  2K49 A;  2CS4 A;  2CQU A;  4BZA A;  1KZ7 A;  3TW1 A;  3MJW A;  1HZ6 A;  1D4B A;  1K53 A;  1C4P A;  4JKB A;  4A9A A;  4ARC A;  1ACC A;  3U30 A;  1HTO A;  5L95 C;  3RUL A;  2VRW B;  3DXD A;  1QLB B;  4ACF A;  1I2H A;  2Z0P A;  5D3Y A;  4BBN C;  4N58 A;  2RGN B;  3QIJ A;  1X1F A;  2NS5 A;  1T77 A;  3HVD A;  3A98 B;  1HZ5 A;  2FDQ A;  2ZVO A;  1QT9 A;  1EWC A;  1GC7 A;  3BK1 A;  3WAO A;  3ZO5 B;  3ZDT A;  3D8D A;  2LGY A;  4EJN A;  5GOW B;  4L23 A;  4YWG G;  5M4Y B;  4UDU C;  2MCN B;  3RYT A;  1FGZ A;  4AWJ A;  1OFF A;  3NWD A;  1WXA A;  1AAR A;  4PNK A;  4HXD A;  3VTU A;  2WXH A;  4LDT B;  2L2I A;  2Y8G A;  2K2U A;  1K51 A;  3ZJU A;  3C19 A;  2AYO B;  3U8Z A;  2K8E A;  1UNQ A;  1L4Z B;  4MT5 A;  1N60 A;  5EE0 A;  3R8B A;  1ZVR A;  4XZ4 A;  1SEB D;  2QSD A;  5G55 A;  4HAV B;  1V2Y A;  3N20 C;  5L83 A;  3FLV A;  3ZTD A;  1EVH A;  4WSF A;  3SHQ A;  5DPT A;  1D6E C;  3RZW C;  4JLC A;  5GMV A;  1WWT A;  2N4F A;  2JP2 A;  1WXM A;  1ACA A;  3L0W B;  1TJE A;  1FPY A;  1CJE A;  1SBB B;  3N9Y C;  3NZU A;  4HDO A;  1MJD A;  4HB0 B;  3H9D A;  1QKZ A;  3DHI C;  2D9V A;  4NZL B;  3BII D;  3NWA A;  2DX5 A;  3H8H A;  3NVV A;  4C7Z A;  3KRW A;  3DOW A;  4HDQ A;  3OAN A;  4N9F 4;  2N7D A;  4PS7 A;  3WCQ A;  1JRO A;  2YF0 A;  4KDI C;  4FUL A;  3MPX A;  4HCP B;  2X38 A;  4MJS A;  2KD0 A;  2N7E A;  3DBH B;  1T0Q C;  3P4P B;  2JYT A;  2IO0 B;  3JSV B;  4LLG M;  4DBB A;  4KHB A;  1V6E A;  4IOI E;  1MK7 B;  1QOG A;  5FK9 C;  1RFK A;  5J17 A;  1X1M A;  4P1B C;  2I5C A;  2KLC A;  5EE1 A;  2K25 A;  1ZDX A;  3DDC B;  2RVB B;  5C2T B;  1MKE A;  4GNK B;  1ZOY B;  2ZCC A;  1WX8 A;  2N9L A;  3PT2 B;  1R4M I;  4RF1 A;  2KFK B;  1A70 A;  2PZ1 A;  3AE1 B;  3AU5 A;  4WWP A;  2EKI A;  2LKO A;  1KZG A;  2NR2 A;  4GDL A;  4WJP A;  1D5Z C;  2KFJ A;  2IDY A;  2RD0 A;  3P4R B;  3AE5 B;  3T8M A;  3B9J A;  2BYV E;  2LI5 A;  2L8J A;  4HB2 B;  3V62 A;  1HE8 A;  1L0X B;  1Q5W B;  4KSK C;  2DFK A;  2J59 M;  2Z13 A;  1V5T A;  3GE3 C;  3L13 A;  3W5U B;  5EDS A;  4A20 A;  2HE7 A;  4TV3 A;  2IND C;  3R3M A;  2LUM A;  2FCM A;  1E7V A;  3KQ4 A;  2VRR B;  3ZDM C;  1XR0 B;  4QAY A;  3TJP A;  5AZH A;  3WAN A;  1J7C A;  3ZQ4 A;  4LNN A;  1MHH E;  3MC0 B;  3IG3 A;  2R2Q A;  4M00 A;  5CHW A;  3IXS A;  2KQ4 X;  4CHK A;  2KGX B;  4FLH A;  3QK0 A;  1HQR D;  2KTR B;  4GSW A;  2MX2 A;  4XYC A;  3NJT A;  4JL9 A;  1CZP A;  1FXI A;  4ANW A;  3IBE A;  2I2Y A;  2KUP A;  1WZ3 A;  5C3J B;  4IW0 A;  4HVB A;  1MPH A;  3BY4 B;  4DDG D;  2KAC A;  1GB4 A;  5DIF B;  4RGN A;  3HK0 A;  4DX8 A;  4W9J A;  3QQ8 B;  3V6E B;  4DHJ D;  4ICV A;  4OZC A;  1WJ4 A;  4S17 A;  1FRD A;  3UQB A;  1Y56 A;  5IN7 A;  1YQB A;  4W9E A;  1DDM A;  3M95 A;  2RPV A;  1OGW A;  2DZM A;  2V4I B;  4IWO A;  3ZJT A;  4BOS C;  3RI7 C;  2A4Z A;  2W54 A;  2NMQ A;  2K00 A;  2G35 A;  4HWI B;  1JWB D;  4NNJ B;  2G1E A;  4EE2 A;  4GMX B;  2CHX A;  2QIL A;  2P0F A;  1E7P B;  1RRP B;  3KYC D;  4HJG E;  4K7W A;  4C0A A;  4JKG A;  1NVI D;  4C4V A;  3RNG C;  1LQB A;  1TQZ A;  1R4M B;  2XNA C;  3N30 A;  4YL8 A;  1XCQ L;  1YX6 B;  3L10 B;  4K7U A;  1XLN A;  1V1P A;  2H7E A;  4FN2 A;  4ICU A;  4QJ4 B;  2MJ3 A;  2ZPY A;  1FHO A;  3ZNG C;  3GYO A;  3DPD A;  3E9P A;  2VSZ A;  4GDK A;  1RYJ A;  2L3Z A;  1WSP A;  5E6O A;  2JUO A;  1J0G A;  2JX5 A;  2NBV B;  5HI1 A;  3LJ3 A;  4A3P A;  5D94 A;  2D10 A;  1PYW D;  3KUC B;  3B2F A;  4D6W A;  2WDQ B;  1QQR A;  2RGF A;  4KGR A;  3SBT A;  4CSQ A;  3DHH C;  3QA8 A;  1CMX B;  2MA9 B;  3K9P B;  2JPH A;  4BOZ B;  1FHX A;  4C56 C;  4EZK A;  2LOZ A;  3MFG A;  3Q3M C;  2EJ8 A;  4DIX A;  1UPR A;  2PMV A;  2GUM A;  3WAL A;  1ESF A;  5C16 A;  5HE1 A;  1SIF A;  1VBG A;  4ZDV A;  2JY6 A;  1TIF A;  2DAJ A;  2FCS A;  2Z14 A;  2EKE C;  2PVO D;  2QHO A;  1WRD B;  1FNV A;  5JXV A;  2Y3A A;  1UEL A;  3QAR A;  2CU1 A;  1UF0 A;  4TYZ A;  1L0Y B;  1V5U A;  2KDB A;  3PGE A;  3PV1 A;  2WWZ A;  1LM8 B;  1Q67 A;  2LHD A;  5IA7 A;  1D3Z A;  4W9I A;  2EC1 A;  4NJ6 A;  4GLS C;  1LFD A;  2VZK D;  1AQC A;  5C79 A;  1SSN A;  4RCO A;  4B9K A;  3I57 A;  1I4P A;  1JWU D;  3ML4 A;  1Z87 A;  1WM3 A;  2LGI A;  4LJO B;  2DZK A;  1J0W A;  1F1H A;  3FC4 A;  2KVZ A;  1DOY A;  3H6N A;  2EMT A;  3AE9 B;  4PS3 A;  5KQ4 A;  3SFE B;  2W55 A;  3AH7 A;  1Y19 B;  3OHM B;  2N23 A;  4F8C B;  3RZF A;  2Y7B A;  2P8V A;  1I4R A;  2D5G A;  3A58 A;  4F7Z A;  3PRZ A;  3DBS A;  4MM3 A;  1FAO A;  2D07 B;  3M63 B;  1BML C;  2PPH A;  2QKL A;  2MH7 A;  1WYW B;  3ODX A;  2ROV A;  4EKU A;  4C80 A;  3A33 B;  2KIE A;  2ADZ A;  1IUE A;  3R2T A;  1IBX A;  1V49 A;  2J52 A;  2OJW A;  3G9W A;  3QX1 A;  1E0Z A;  3RMK C;  1OMW A;  4F1S A;  3RFZ B;  2RSU A;  2DZI A;  2PLP A;  5E6J A;  5H8Y E;  1MK9 B;  5E6P A;  1PQS A;  4HJK A;  1HXY D;  5LNK 1;  2YVC A;  1SXT A;  2LGS A;  2WX0 A;  2WXQ A;  2AX5 A;  1MI1 A;  2FJ9 A;  4ASW C;  1UGJ A;  2RNR B;  2AQ1 B;  2CY4 A;  3EPY A;  2FE8 A;  1OEY J;  3KYD D;  3TEW A;  5EFX A;  3SEB A;  2M56 B;  4P7I A;  2DHK A;  2AQ2 B;  3H1U A;  3AEF B;  2QMT A;  3A4S C;  1C4A A;  2L83 A;  2BWF A;  4ARI A;  1XEE A;  4KIK B;  3PVW A;  4HHV A;  5KQ1 A;  3U12 A;  2GBJ A;  1WJN A;  4BKT A;  3EGR A;  3PHX B;  1R4N I;  5DCN A;  1Z2M A;  1IP9 A;  2MBB B;  4JKC A;  1LB1 A;  3IAS 1;  4RGM A;  2L52 A;  1AWD A;  5AUK A;  4K7S A;  1P0R A;  3B2G A;  1WRI A;  1WR1 A;  3BVG A;  2K3U A;  1FB8 A;  3LJU X;  3N1X C;  3W9C B;  3RCP A;  1NTV A;  3NRZ A;  4KZC A;  4JX1 C;  5I4D A;  4GGQ A;  2IJ0 A;  4ANU A;  3ML8 A;  4KV2 A;  4YT0 B;  3Q8B A;  2R82 A;  3PG7 A;  2FCN A;  4WH4 A;  2LRW A;  1X86 A;  1B55 A;  2KIG A;  3X23 A;  1FXA A;  1ZPS A;  2R61 A;  1E8X A;  2D9X A;  1C76 A;  2DNF A;  2COF A;  4K1R B;  4NAW A;  2ZVN A;  2NVU I;  1WXS A;  2W9N A;  1YN4 A;  1J8C A;  1RAX A;  4HPP A;  1WI1 A;  4MK0 A;  2J42 A;  1ZXH A;  3PO0 A;  3X0W A;  1VCB A;  5KCV A;  3PVU A;  2WXF A;  3SFD B;  2BGF A;  1WE6 A;  5G5G A;  1W1D A;  3SBG A;  2WDV B;  4WWN A;  2GCL A;  4M01 A;  2RDH A;  1WX7 A;  3DWM A;  1ZSQ A;  1B1Z A;  3MP9 A;  4CQN A;  2MWS B;  1ZUD 2;  1RFA A;  4MH0 E;  1P9D U;  2NPT B;  4FBJ B;  2IBI B;  3Q3F A;  3B1L X;  1FGY A;  3T9L A;  1E6E B;  4II3 B;  2P0D A;  2LEK A;  4M0W B;  3U2S C;  5IO9 A;  2ZNV C;  2UVM A;  2WH5 A;  4IWQ A;  4O1N A;  2KYW A;  3TO1 A;  1NBF C;  1NDD A;  3VH3 B;  2LGD A;  2BVC A;  1JWM D;  3FAH A;  2J0M A;  2KJR A;  4WUR A;  3U52 E;  4HB4 B;  3ZTC A;  5LON B;  2WXN A;  4I6L B;  4TUU A;  1M7R A;  2OQB A;  2INN E;  3M3J A;  5C6R A;  1ZP0 B;  4ZHP A;  1R4N B;  2KZR A;  3GE8 C;  3Q8F A;  5BMH A;  2YLM A;  4OHJ A;  2QJL A;  3ALB A;  3TUO A;  4LCD E;  4AOF A;  3TL5 A;  4NQL B;  1NTY A;  4MGI E;  1V8C A;  2KMM A;  4LNK A;  1SE3 A;  2D3C A;  4ZRI A;  4KX6 B;  3U7Z A;  2RMM A;  4W9C A;  3PSC A;  2DYB A;  3D8E A;  3NS1 A;  2EMS A;  2YT2 A;  5I2M A;  1WVH A;  4HPL B;  2ZNV B;  2L0F A;  2NBW B;  3PRP B;  3DVG Y;  3AE6 B;  1U5E A;  4MT7 A;  2FJU B;  2ZW0 A;  1TS4 A;  3KWV A;  5D3W A;  1R7S A;  2IY0 B;  2AQ3 B;  1H4R A;  1MG4 A;  4RGO S;  4S0R A;  3KH0 A;  4ILH A;  1L6U A;  2NTT A;  1P3R A;  4OSN A;  4GZU A;  1L7Y A;  1KF6 B;  1WIA A;  2DZJ A;  1M4V A;  5CLL B;  3KSY A;  4M02 A;  3APD A;  2VH2 A;  1ZKH A;  3I3T B;  5IAA C;  1EU4 A;  4PS8 A;  3ZGZ A;  2IO1 B;  2Z0D B;  1TS3 A;  3PZ8 A;  2N9K A;  1I42 A;  2ELA A;  4RM8 A;  3A8Q A;  1BTN A;  4EFO A;  3AED B;  1ZGU B;  2WXL A;  3K9O B;  3BYY B;  3EHV A;  3OJ4 B;  4HAY B;  3AMZ A;  4B0E A;  1FD6 A;  1XKE A;  1K8R B;  2LJI A;  2UZR A;  2Q5W D;  1KLU D;  2D3B A;  3DWG C;  1UEF A;  1WG7 A;  3AE7 B;  3V6C B;  4C00 A;  4FA6 A;  2KNB A;  5H92 C;  1EUV B;  1DGJ A;  3R66 C;  4WVF B;  1HTQ A;  1UD7 A;  1WY8 A;  4JK7 A;  2K2J A;  3AEC B;  4GOC A;  2HTM E;  5AZF A;  4EOY A;  4BBK A;  2WYQ A;  3FKY A;  4TMA B;  1JWA D;  5FR3 A;  2NMB A;  4DXF A;  3M1I B;  5DHA B;  5HE2 A;  3CIR B;  1E8Z A;  2D3G A;  3HQC A;  4ZRK A;  5HG2 A;  4YTM B;  4GMV A;  3DBL I;  4L1R A;  1RM6 C;  1WGG A;  3IT6 B;  3WAP A;  4DXG A;  1DDW A;  5J3T A;  3V05 A;  1ZYI A;  2MQJ A;  1VZ6 A;  4HAT B;  2JQR B;  5CX3 A;  1WJM A;  2LXC A;  3HM6 X;  2KCJ A;  2I1J A;  2KX0 A;  3VIA A;  1L6V A;  1E8W A;  3E9L A;  3ULB A;  1AWE A;  2ZEQ A;  1S1Q B;  2AL6 A;  3ODO A;  2MFQ A;  1V97 A;  3NZS A;  3JW0 X;  3A1Q B;  3B08 A;  5TR5 A;  1GNU A;  2GMI C;  2JVC A;  1K5D B;  2BS4 B;  4BKS A;  2LBB A;  2M38 A;  4F7U P;  1J19 A;  3AUL A;  3CXB B;  5C23 A;  2E2X A;  2K5P A;  2REX A;  2L76 A;  1IPG A;  1EO6 A;  2N9X A;  2K39 A;  3L54 A;  2X8X X;  4P6V F;  3R7Q A;  4L2Y A;  2CU3 A;  2LVP A;  4B0M A;  1EM7 A;  1MHX A;  2GS0 A;  1MAI A;  1UUP A;  2M4N A;  2MLB A;  2NBU A;  2HJ1 A;  3DCG A;  4GDL B;  2O2V A;  3J9C A;  1TZO A;  3P4Q B;  3E9S A;  4ILG B;  1BT0 A;  2Y5B B;  1ZXI A;  4QJ5 B;  1YJ1 A;  1WJ6 A;  4BFR A;  1FM0 D;  3N3K B;  5DPW A;  3ZUN A;  5DI9 B;  1XD4 A;  2KN5 A;  1KJT A;  2N1V A;  4ZRJ A;  4EUT A;  1K50 A;  2QC8 A;  5FI0 A;  3QAQ A;  4D0N B;  1I35 A;  2J0J A;  5LXH A;  3GB1 A;  3HIZ A;  1LW3 A;  1KLG D;  2KC2 A;  3JSV A;  1W1G A;  3BZD B;  2KAJ A;  4EZJ A;  3SUZ A;  3O96 A;  5IKC M;  2DKQ A;  1WZ0 A;  4RMA A;  3E56 A;  2JSV X;  2INP E;  1CK1 A;  4IWP A;  1UWX A;  4H8S A;  1AYF A;  3FIL B;  4OVV A;  1HBK A;  1TY2 A;  2LAS A;  3E9O A;  3P2B A;  4PYZ A;  4JQW C;  1DBH A;  4A6F B;  3OG5 A;  2IGG A;  3F0W A;  1SE4 A;  4OT1 A;  1Q1O A;  2N7J A;  4OZA A;  2MJD A;  3ETR A;  1YQ4 B;  2K1F A;  3QCA A;  4XGA B;  2L32 A;  4KKI A;  2YEP B;  3LB8 C;  3MTN B;  4K3B A;  5DH9 B;  3R7R A;  3KRX A;  5D7G A;  3I9V 1;  4US8 A;  4OW0 A;  3JVZ X;  2RDG A;  2J7Q B;  2BW2 A;  4ZYN A;  5AZG A;  1NI2 A;  4RFB A;  2WNM A;  1N5X A;  3AE3 B;  4K81 A;  1KC7 A;  4LNF A;  3FEH A;  4JKG B;  2V3S A;  3UGB B;  3EUB 2;  1N61 A;  2N1W A;  4LK0 M;  1FFV A;  4CHM A;  1WGD A;  1F2R I;  1V1P B;  1T5X D;  2G9H D;  2D3A A;  3VUX A;  3IFW B;  1XT9 B;  3NUH B;  3GZN I;  2ZZP B;  4GDK B;  3VDZ A;  1P7F A;  2Z8L A;  2BKF A;  1LXD A;  3PSE B;  4US9 A;  1WH3 A;  1GGO A;  1I4X A;  2WXJ A;  2DIK A;  1VZ7 A;  2D9W A;  4A6H A;  3DVN U;  2KXJ A;  3GOE A;  1C3T A;  3GS2 A;  4IM0 A;  3RNA C;  3VHT C;  1CQV A;  4GB9 A;  1U27 A;  2K9X A;  1KM7 A;  3NHE B;  3P1M A;  4IFS A;  4P16 A;  1Y5O A;  2GOW A;  1FNW A;  3Q14 C;  3WYF B;  3ZJV A;  1U5F A;  4ZRQ A;  2WU2 B;  1TKG A;  2XBB C;  4WQM A;  1QOA A;  1NVL A;  3TBL D;  2CJO A;  2IY1 B;  4MGZ E;  2DN6 A;  3SNH A;  1SIJ A;  3V61 A;  3RUI B;  5BO4 B;  2IYD B;  2WDT B;  4JKD A;  1N63 A;  1UBQ A;  1WMH B;  4XWX A;  4HB3 B;  2G3Q B;  3A9K A;  4IDI A;  3A8P A;  3M62 B;  4KDL B;  1XXG A;  1E8Y A;  2DYQ A;  1Q0W B;  4N6E B;  2JT4 B;  2COC A;  2WXR A;  4YSY B;  4I6P A;  5JH5 C;  2O6V A;  4FJY A;  1Q10 A;  2L1C A;  2KWU B;  4PYU A;  1V61 A;  4MH8 A;  2KMC A;  1S3S G;  4MSQ B;  1SF0 A;  1XD3 B;  1D5M C;  2IPK D;  3APF A;  2DLW A;  1UWM A;  3TSS A;  1C77 A;  4WAF A;  4ITK A;  3FP5 A;  5JVL A;  5D2M B;  3UF8 A;  4DHJ B;  1OQN A;  4KVG B;  1JRU A;  2SEB D;  2MW5 A;  4URK A;  3H7P B;  2W2W A;  1TZ1 A;  2KDE B;  3GZN B;  2PTL A;  4WWO A;  2V3P A;  2D9Z A;  3APC A;  3T3N A;  1Z5S B;  4GU2 A;  3TIX A;  2D4Q A;  1NTI A;  1V81 A;  3ZYY X;  2BKR B;  3AV8 A;  4J6I A;  2WXM A;  4MEL A;  3D32 A;  5CTR C; 
#chains in the Genus database with same CATH homology
 2GCJ A;  5HE0 A;  3PEG A;  1HB6 A;  1FXT B;  5J2R A;  4WQO B;  2Z0Q A;  3ML9 A;  1TJ6 A;  2JRH A;  3NS8 A;  2CRF A;  4KAX B;  4M8M A;  2M17 A;  3ZRF A;  4NPN A;  1GC6 A;  5IJM A;  5JP4 A;  2M0X A;  4HAW B;  3WA0 A;  1DRO A;  3AU4 A;  2M8S A;  2MBO A;  3MDB C;  1GUA B;  4HPM B;  5E6N A;  3ENE A;  5D3V A;  4W9F A;  3ZRC A;  4CHJ A;  1WM2 A;  1FHW A;  2V76 A;  2R0D A;  2KAN A;  4DX9 0;  2DTC A;  2FJL A;  3EEC A;  3DVN V;  2DHZ A;  1YX5 B;  2HJ8 A;  2BYE A;  4WJN A;  1H8C A;  3D8F A;  1IRS A;  4NAW B;  2DAF A;  2YT0 A;  2C5L C;  1WGY A;  2G4S A;  2KDI A;  2IFS A;  4JK9 A;  1K5G B;  2R2O A;  2OTX A;  2L00 B;  2UYZ B;  2RQ1 A;  3UQA A;  2BYF A;  1V5P A;  2RLO A;  1V80 A;  3B0A A;  3SDL C;  5G2N A;  3IHP C;  3SYX A;  4BVU C;  2K6Q A;  4B95 A;  1P5T A;  3A4R A;  2C7N B;  1ZC3 B;  2CAY A;  3PRM B;  3VUW A;  1ZC4 B;  2K8C A;  3T06 A;  3RT3 B;  3KUD B;  4TQ1 A;  2D2Q A;  4HK2 A;  3VOQ A;  1SE9 A;  4MSM B;  5CHF A;  3A9J A;  2YT1 A;  1RLF A;  3ECI A;  2PE9 A;  1QQG A;  3L17 A;  2RR9 A;  1P6S A;  4A3O A;  2W2X D;  3SV1 A;  3KY9 A;  4M8N A;  5C5B B;  5DHF B;  4BKG A;  1WF9 A;  2J0K A;  2XK5 A;  3TCA A;  2NPT A;  2JXX A;  2ZPN A;  2LG1 A;  3DVG X;  5JHA A;  4MY6 A;  2ROZ B;  4LDT D;  3P7Z A;  4BKS D;  2MBH A;  2MDX A;  1M7E A;  2WX1 A;  3AXC A;  3MHS D;  3QJZ A;  2KK8 A;  3F5R A;  4MEM A;  3ULC A;  3ZW3 A;  2CY5 A;  2DYN A;  3ZIM A;  4Y94 A;  5C1Z A;  1KBL A;  3VFK A;  4AJW A;  4X57 B;  2JF5 A;  3VVW B;  3W1S A;  3WIM A;  3TMP B;  4XX5 A;  4WAA A;  2PEA A;  3RD2 A;  4DDI D;  2KQ7 A;  4HCN B;  4NQK E;  1DYN A;  3QWM A;  2DEN B;  3PHW B;  4DHZ B;  4B6W A;  3VH4 B;  4F7H A;  4Z2N A;  2K8H A;  3OJ3 A;  2I5F A;  2H7D A;  2HTH A;  3BIN A;  3DBR I;  2ABD A;  3DBH I;  5HE3 A;  2HD5 B;  5FR6 A;  2KTF A;  2COP A;  2C7M B;  2CHW A;  2QKM A;  4G0N B;  4DBG A;  4TKN A;  2AL3 A;  4WJQ A;  2KDF B;  2MP2 A;  5D6J B;  2DYM A;  3QHT A;  3VAW A;  4W9G A;  4GPT B;  2GJY A;  1KLV A;  2M14 A;  3KVF B;  3PP2 A;  3UZT A;  3NSU A;  1E90 A;  2FID A;  4B6H A;  1YIW A;  1QC6 A;  2FIF A;  2KWV B;  3PZD A;  3V5W A;  2CKH B;  3DXC A;  2IO2 B;  2DX5 B;  1P1A A;  4HAU B;  1UGM A;  1TXD A;  1TTN A;  4MGK E;  4MJS B;  1L2N A;  5HKH A;  3VUY A;  3TVV A;  4E3C A;  3VXW A;  1ISN A;  1RRB A;  4IM2 A;  4BBN F;  5CLQ B;  3KUZ A;  3DXE A;  3KW5 B;  2CB8 A;  4KHB B;  4A6K A;  2KLG A;  2ZJD A;  5D27 A;  2IZV B;  1OEY A;  2X0S A;  1PFJ A;  1P98 A;  1ZM0 A;  2O2V B;  2L0T A;  2LOX A;  2OOB B;  2KMA A;  4IM3 A;  1UH6 A;  5KHQ A;  4EEW A;  1E7U A;  5FI1 A;  1WGU A;  1TBE A;  4KHA A;  3L16 A;  4E71 A;  4IUM B;  4JKH A;  3A1Q A;  4GN1 A;  3CSF A;  1I7A A;  1T0Y A;  1YD8 U;  4G11 A;  1ZW7 A;  2FAZ A;  4HAZ B;  2DHI A;  1WJU A;  4NSW A;  2Y8F A;  2V1Y A;  4DK5 A;  1N3H A;  3CIK A;  2B3A A;  1NU2 A;  3FM8 C;  2G45 B;  2DA0 A;  3UIN B;  3NOB A;  5CHV C;  2DX1 A;  4E74 A;  1X05 A;  3Q3J A;  2LUE A;  2KOX A;  2O6V D;  1F9J A;  3AI5 A;  5JHB A;  2FUH B;  4AJY B;  2KFK A;  2KKC A;  2Z0O A;  3CF6 E;  2KO3 A;  5JHH A;  3VTW A;  2RSG A;  4GIV A;  1OY2 A;  4FHK A;  4DXA B;  5LOP B;  3U7D A;  1BAK A;  2BF8 B;  4G50 A;  3TFM A;  2COD A;  2KC1 A;  2GBR A;  1W1H A;  2YRY A;  1UBI A;  1U5G A;  2MBE A;  2OJR A;  1WFY A;  4NJ7 A;  3SO6 A;  4A6F A;  1UZX B;  1XX0 A;  4K17 A;  2ASQ A;  3N7C A;  4IOY X;  4ANX A;  4WJ7 A;  2KTR A;  5D3X A;  1WXV A;  2A5U A;  2LRU A;  2M1M A;  5JZE B;  3FSS A;  5JLJ B;  4W9K A;  3KZ1 A;  3W1Y A;  1U2B A;  4HLE A;  3ZLZ A;  4L6E A;  3PTF C;  2RPQ A;  3H7S A;  1WGQ A;  2Z0E B;  4AUQ C;  2I1K A;  2JWZ A;  1BWN A;  2LJ5 A;  1A5R A;  5DPS A;  2KWC A;  5LXI B;  3VTV A;  1BTK A;  2DHJ A;  5J3Y A;  1IYF A;  1WJ1 A;  2P0H A;  4PQ0 A;  4IG7 B;  2LWP A;  3QWZ B;  3A9K B;  1MG8 A;  2PJH A;  3EFU A;  1OTR B;  3NY5 A;  3BJI A;  2COA A;  3E66 A;  2VKI A;  1V86 A;  3HM3 A;  1X1G A;  4G3X B;  1WX9 A;  2O6V B;  1V88 A;  2LYD A;  2FNJ B;  3QBV B;  3AJ4 A;  5J3Q A;  1WE7 A;  1GJZ A;  1E5W A;  3QC8 B;  2XQN M;  2K6D B;  4XC2 A;  4MDK E;  5JHG A;  3S2A A;  4RM9 A;  4CYE A;  2V4L A;  3HW2 B;  3OAW A;  2LXA A;  2YSZ A;  2KQS A;  1WMH A;  3ZVV A;  1MIX A;  2JZ3 B;  3SU8 X;  4JK8 A;  5DPR A;  2BWE S;  2RUK B;  1WGR A;  2GBM A;  4MGY E;  4FJZ A;  3O65 B;  3P6A A;  3PLV A;  2FCQ A;  3DQV A;  2MSE D;  4KSL C;  5KHO A;  3PLU A;  2C7H A;  3CMM B;  4DHZ E;  4IC7 B;  2NCN A;  4JKF A;  3PS6 A;  3H7P A;  3IVF A;  1C1Y B;  2LD9 A;  3UIO B;  2C60 A;  4YON A;  4K2P A;  1WI0 A;  1G6J A;  2LUL A;  1OQY A;  2LGX A;  2UZS A;  4CO7 A;  2X18 A;  3ZNI D;  5L81 A;  1H10 A;  4W9H A;  4FHJ A;  3UIP B;  2YS3 A;  2HRJ A;  3LDZ E;  4GXB A;  4JIO U;  4I6N B;  4W9D A;  2AEH A;  1DIK A;  2IYB A;  4F7G A;  2KVR A;  2L7R A;  3ZNZ B;  4AP4 C;  1EGX A;  2N9E B;  3ODW A;  1WGH A;  5J18 A;  3ZKJ C;  2BCJ A;  1SGH A;  1VBH A;  2IO3 B;  1XOD A;  2YS1 A;  1UPQ A;  1JDE A;  2BPS A;  2Z59 B;  1V5O A;  2MWN B;  3PVL A;  1PMS A;  1V89 A;  4ANV A;  1EAZ A;  4KIK A;  4IAP A;  2CR5 A;  2K8B A;  3N32 A;  2MBQ A;  2XEW A;  2N0Y A;  3SD5 A;  4NY0 A;  4FJV B;  2ELB A;  1XQQ A;  4KZ0 A;  1TGZ B;  3VQI A;  3RCZ A;  4II2 B;  1U29 A;  2KX3 A;  3A9J B;  1MIZ B;  1XCG A;  2PE6 B;  2NZ8 B;  1M94 A;  1U4A A;  2C9W B;  1HB8 A;  4WJO A;  1QZE A;  3W1S C;  2KHW B;  2GBN A;  2ZCB A;  3C0R B;  4EZL A;  2DKP A;  4K2O A;  5AEK B;  4LJP B;  2XK5 B;  4JGH B;  4A5K A;  4HAX B;  1SHC A;  2LVO A;  1V9J A;  1P3Q U;  2R09 A;  1GG3 A;  4JKA A;  4TQ0 A;  2UWQ A;  4Z2M B;  1X11 A;  3ENB A;  2JRI B;  3WAM A;  3HHM A;  2G4D B;  2Q13 A;  1U5D A;  2MRP A;  1Y8R C;  2LZ6 A;  5LLI A;  2D11 A;  2MKR A;  2D9Y A;  2GBK A;  4DWF A;  3GYP A;  3ONS A;  2JZZ A;  5C5B A;  3ZVR A;  4JKE A;  2LVQ A;  2DYO A;  2KJH B;  3ZNH B;  4FAD A;  3V60 A;  1V5M A;  1WR6 E;  1VD2 A;  3OLM D;  3CST A;  1RJ2 A;  1KI1 B;  1EF1 A;  3PRE A;  3JYU A;  1FOE A;  1UNR A;  2HTH B;  3EC8 A;  2W2X C;  4EMO A;  2CHZ A;  1DDV A;  1KOT A;  3PPA A;  1PLS A;  2KJ6 A;  2YS5 A;  1EF5 A;  4KHO A;  1ST7 A;  2L05 A;  4W9L A;  4OVU A;  2AWT A;  1UNP A;  2N9P C;  2MP2 B;  3L08 A;  4ILJ A;  2CS4 A;  2CQU A;  1KZ7 A;  3TW1 A;  3MJW A;  4JKB A;  3U30 A;  5L95 C;  3RUL A;  2VRW B;  3DXD A;  1I2H A;  2Z0P A;  5D3Y A;  4BBN C;  2RGN B;  3QIJ A;  1X1F A;  2NS5 A;  3A98 B;  2FDQ A;  2ZVO A;  1GC7 A;  3WAO A;  3ZO5 B;  3ZDT A;  3D8D A;  2LGY A;  4EJN A;  5GOW B;  2MCN B;  4AWJ A;  3RYT A;  1FGZ A;  1WXA A;  1AAR A;  4PNK A;  4HXD A;  3VTU A;  4LDT B;  2L2I A;  2Y8G A;  2K2U A;  2AYO B;  3U8Z A;  1UNQ A;  1ZVR A;  4XZ4 A;  5G55 A;  4HAV B;  1V2Y A;  5L83 A;  3FLV A;  3ZTD A;  1EVH A;  4WSF A;  3SHQ A;  5DPT A;  3RZW C;  4JLC A;  5GMV A;  2N4F A;  2JP2 A;  1WXM A;  1ACA A;  3L0W B;  3NZU A;  4HDO A;  4HB0 B;  3H9D A;  2D9V A;  2DX5 A;  3KRW A;  3DOW A;  4HDQ A;  3OAN A;  4N9F 4;  2N7D A;  4PS7 A;  2YF0 A;  4KDI C;  4FUL A;  3MPX A;  4HCP B;  4MJS A;  2KD0 A;  2N7E A;  2IO0 B;  3JSV B;  4DBB A;  1V6E A;  1MK7 B;  5J17 A;  1X1M A;  2I5C A;  2KLC A;  2K25 A;  3DDC B;  2RVB B;  1MKE A;  2ZCC A;  1WX8 A;  3PT2 B;  1R4M I;  2KFK B;  2PZ1 A;  4WWP A;  3AU5 A;  2LKO A;  1KZG A;  2NR2 A;  4GDL A;  4WJP A;  2KFJ A;  2RD0 A;  3T8M A;  2BYV E;  2LI5 A;  2L8J A;  4HB2 B;  3V62 A;  1HE8 A;  1Q5W B;  4KSK C;  2DFK A;  2J59 M;  1V5T A;  3L13 A;  5EDS A;  4A20 A;  2HE7 A;  4TV3 A;  3R3M A;  2FCM A;  1E7V A;  2VRR B;  3ZDM C;  1XR0 B;  3TJP A;  5AZH A;  3WAN A;  3IG3 A;  2R2Q A;  5CHW A;  4CHK A;  2KGX B;  4FLH A;  3QK0 A;  2KTR B;  4GSW A;  2MX2 A;  4JL9 A;  4ANW A;  3IBE A;  2KUP A;  1WZ3 A;  4IW0 A;  4HVB A;  1MPH A;  3BY4 B;  4DDG D;  5DIF B;  3HK0 A;  4DX8 A;  4W9J A;  3QQ8 B;  3V6E B;  4DHJ D;  4ICV A;  1WJ4 A;  3UQB A;  1YQB A;  4W9E A;  1DDM A;  3M95 A;  1OGW A;  2DZM A;  4IWO A;  4BOS C;  2A4Z A;  2K00 A;  2G35 A;  4HWI B;  4NNJ B;  4GMX B;  2CHX A;  2P0F A;  1RRP B;  3KYC D;  4K7W A;  4C0A A;  4JKG A;  1LQB A;  1TQZ A;  3N30 A;  4YL8 A;  1YX6 B;  3L10 B;  4K7U A;  4FN2 A;  2H7E A;  4ICU A;  2ZPY A;  1FHO A;  3ZNG C;  3GYO A;  3DPD A;  3E9P A;  2VSZ A;  4GDK A;  2L3Z A;  5E6O A;  2JUO A;  1J0G A;  2NBV B;  3LJ3 A;  4A3P A;  5D94 A;  2D10 A;  3KUC B;  2RGF A;  3SBT A;  3QA8 A;  1CMX B;  2MA9 B;  3K9P B;  2JPH A;  4BOZ B;  1FHX A;  4EZK A;  2LOZ A;  2EJ8 A;  1UPR A;  3WAL A;  5C16 A;  5HE1 A;  1SIF A;  1VBG A;  4ZDV A;  2JY6 A;  2DAJ A;  2FCS A;  2EKE C;  2QHO A;  1WRD B;  1UEL A;  3QAR A;  2CU1 A;  4TYZ A;  2KDB A;  1V5U A;  3PGE A;  3PV1 A;  2WWZ A;  1LM8 B;  1Q67 A;  5IA7 A;  1D3Z A;  4W9I A;  2EC1 A;  4NJ6 A;  1LFD A;  4B9K A;  1AQC A;  5C79 A;  3ML4 A;  1Z87 A;  1WM3 A;  4LJO B;  2DZK A;  1J0W A;  3H6N A;  2EMT A;  4PS3 A;  5KQ4 A;  1Y19 B;  2N23 A;  4F8C B;  3RZF A;  2Y7B A;  2P8V A;  4F7Z A;  3PRZ A;  3DBS A;  4MM3 A;  1FAO A;  2D07 B;  3M63 B;  2PPH A;  2QKL A;  1WYW B;  3ODX A;  2ROV A;  4EKU A;  3A33 B;  2ADZ A;  1V49 A;  3G9W A;  3QX1 A;  1OMW A;  4F1S A;  2RSU A;  2DZI A;  1MK9 B;  5E6P A;  1PQS A;  4HJK A;  2YVC A;  2WX0 A;  2FJ9 A;  4ASW C;  2RNR B;  2CY4 A;  3EPY A;  1OEY J;  3KYD D;  5EFX A;  4P7I A;  2DHK A;  3H1U A;  3A4S C;  2BWF A;  4KIK B;  3PVW A;  4HHV A;  5KQ1 A;  2GBJ A;  1WJN A;  4BKT A;  5DCN A;  3PHX B;  1R4N I;  1Z2M A;  1IP9 A;  2MBB B;  4JKC A;  1LB1 A;  4K7S A;  1P0R A;  1WR1 A;  1FB8 A;  3LJU X;  3RCP A;  1NTV A;  4KZC A;  4GGQ A;  4ANU A;  3ML8 A;  4KV2 A;  2R82 A;  3PG7 A;  2FCN A;  2LRW A;  1X86 A;  1B55 A;  3X23 A;  1E8X A;  2D9X A;  2COF A;  4K1R B;  4NAW A;  2ZVN A;  2NVU I;  1WXS A;  2W9N A;  1J8C A;  1RAX A;  1WI1 A;  4MK0 A;  3X0W A;  1VCB A;  5KCV A;  3PVU A;  2BGF A;  1WE6 A;  1W1D A;  3SBG A;  4WWN A;  2GCL A;  1WX7 A;  1ZSQ A;  2MWS B;  1RFA A;  4MH0 E;  1P9D U;  2NPT B;  4FBJ B;  3Q3F A;  2IBI B;  3B1L X;  1FGY A;  3T9L A;  4II3 B;  2P0D A;  4M0W B;  2ZNV C;  2UVM A;  2WH5 A;  4IWQ A;  3TO1 A;  1NBF C;  1NDD A;  3VH3 B;  2LGD A;  2J0M A;  2KJR A;  4HB4 B;  3ZTC A;  5LON B;  4I6L B;  4TUU A;  1M7R A;  2OQB A;  3M3J A;  5C6R A;  2KZR A;  2YLM A;  3ALB A;  4LCD E;  4AOF A;  3TL5 A;  4NQL B;  1NTY A;  4MGI E;  4ZRI A;  4W9C A;  3PSC A;  2DYB A;  3D8E A;  2EMS A;  1WVH A;  4HPL B;  2ZNV B;  2L0F A;  2NBW B;  3PRP B;  3DVG Y;  1U5E A;  4MT7 A;  5D3W A;  2IY0 B;  1H4R A;  3KH0 A;  4ILH A;  1P3R A;  1L7Y A;  4GZU A;  1WIA A;  2DZJ A;  5CLL B;  3KSY A;  3APD A;  1ZKH A;  3I3T B;  5IAA C;  4PS8 A;  2IO1 B;  2Z0D B;  1I42 A;  2ELA A;  4RM8 A;  3A8Q A;  1BTN A;  4EFO A;  1ZGU B;  3K9O B;  3EHV A;  3OJ4 B;  4HAY B;  1XKE A;  1K8R B;  2UZR A;  1UEF A;  1WG7 A;  3V6C B;  4FA6 A;  2KNB A;  1EUV B;  3R66 C;  4WVF B;  1UD7 A;  1WY8 A;  4JK7 A;  2K2J A;  4GOC A;  5AZF A;  4EOY A;  4BBK A;  2WYQ A;  2NMB A;  3M1I B;  5DHA B;  5HE2 A;  1E8Z A;  2D3G A;  3HQC A;  4ZRK A;  4GMV A;  3DBL I;  1WGG A;  3WAP A;  1DDW A;  5J3T A;  2MQJ A;  4HAT B;  5CX3 A;  1WJM A;  2LXC A;  3HM6 X;  2KCJ A;  2I1J A;  2KX0 A;  3VIA A;  1E8W A;  3E9L A;  3ULB A;  1AWE A;  2ZEQ A;  1S1Q B;  2AL6 A;  3ODO A;  2MFQ A;  3NZS A;  3JW0 X;  3A1Q B;  3B08 A;  5TR5 A;  1GNU A;  2GMI C;  2JVC A;  1K5D B;  4BKS A;  2LBB A;  2M38 A;  4F7U P;  1J19 A;  3AUL A;  3CXB B;  5C23 A;  2E2X A;  2REX A;  2L76 A;  1IPG A;  1EO6 A;  2N9X A;  2K39 A;  3L54 A;  3R7Q A;  2LVP A;  2GS0 A;  1MAI A;  2MLB A;  2M4N A;  2NBU A;  3DCG A;  4GDL B;  2O2V A;  4ILG B;  1BT0 A;  2Y5B B;  1YJ1 A;  1WJ6 A;  4BFR A;  3N3K B;  5DPW A;  3ZUN A;  5DI9 B;  1XD4 A;  2KN5 A;  1KJT A;  2N1V A;  4ZRJ A;  4EUT A;  5FI0 A;  3QAQ A;  4D0N B;  1I35 A;  2J0J A;  5LXH A;  3HIZ A;  1LW3 A;  2KC2 A;  3JSV A;  1W1G A;  4EZJ A;  3SUZ A;  3O96 A;  2DKQ A;  1WZ0 A;  4RMA A;  4IWP A;  4H8S A;  4OVV A;  1HBK A;  3P2B A;  2LAS A;  3E9O A;  4PYZ A;  4JQW C;  1DBH A;  4A6F B;  3F0W A;  1Q1O A;  2K1F A;  3QCA A;  3MTN B;  5DH9 B;  3R7R A;  3KRX A;  5D7G A;  3JVZ X;  2J7Q B;  4ZYN A;  5AZG A;  1NI2 A;  4K81 A;  1KC7 A;  3FEH A;  4JKG B;  2V3S A;  3UGB B;  2N1W A;  4CHM A;  1WGD A;  3VUX A;  3IFW B;  1XT9 B;  3GZN I;  2ZZP B;  4GDK B;  3VDZ A;  2BKF A;  1LXD A;  3PSE B;  1WH3 A;  1GGO A;  2DIK A;  2D9W A;  4A6H A;  3DVN U;  2KXJ A;  3GOE A;  1C3T A;  4IM0 A;  3VHT C;  4GB9 A;  1U27 A;  1KM7 A;  3NHE B;  4IFS A;  1Y5O A;  2GOW A;  3WYF B;  1U5F A;  2XBB C;  1NVL A;  3TBL D;  2IY1 B;  4MGZ E;  2DN6 A;  3SNH A;  3V61 A;  3RUI B;  5BO4 B;  2IYD B;  2WDT B;  4JKD A;  1UBQ A;  1WMH B;  4XWX A;  4HB3 B;  2G3Q B;  3A9K A;  3A8P A;  3M62 B;  4KDL B;  1E8Y A;  2DYQ A;  1Q0W B;  2JT4 B;  2COC A;  4I6P A;  5JH5 C;  2O6V A;  4FJY A;  2L1C A;  2KWU B;  4PYU A;  1V61 A;  2KMC A;  1S3S G;  4MSQ B;  1XD3 B;  3APF A;  2DLW A;  3FP5 A;  5JVL A;  5D2M B;  3UF8 A;  4DHJ B;  1OQN A;  4KVG B;  1JRU A;  2MW5 A;  4URK A;  3H7P B;  2W2W A;  1TZ1 A;  2KDE B;  4WWO A;  2D9Z A;  3APC A;  1Z5S B;  4GU2 A;  3TIX A;  2D4Q A;  1NTI A;  1V81 A;  2BKR B;  4J6I A;  4MEL A;  3D32 A;  5CTR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...