1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords RADIXIN
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
4HVBA 5EDSA 3PVUA 1RRBA 5CHVC 2K2JA 5DPRA 4A3OA 2M8SA 3VTWA 3F5RA 2KCJA 4GXBA 2L00B 3KUZA 4ZRJA 2KGXB 2M17A 4AOFA 1MK9B 1H10A 1NTVA 3RZFA 1U27A 1UELA 5C23A 4MELA 2AEHA 1X86A 2GBNA 2W2XD 2AWTA 2HTHB 2LXAA 3MDBC 1JRUA 1WGYA 2DKQA 3EC8A 3U8ZA 2DLWA 3QWZB 1P9DU 1S1QB 4DBBA 3PREA 1E7UA 3QBVB 2DAFA 2ZPNA 2JT4B 2CS4A 3V62A 2Y8GA 4F1SA 2C9WB 2LXCA 2DHZA 1P98A 1I35A 3HQCA 1YIWA 5LXIB 4I6LB 4AP4C 4NNJB 1U4AA 5IAAC 4GDLB 3A9KB 1MPHA 1HB6A 1V80A 2KD0A 2CR5A 2AL6A 1AWEA 2WX1A 2VRWB 2I5FA 2ROVA 2UZRA 3WANA 1E8WA 3ZRFA 4OVVA 1AARA 5C5BB 1YD8U 2LBBA 2D11A 2N1WA 1AQCA 1WJ4A 1TZ1A 4K7SA 2DYQA 4WAAA 2C7MB 2BYFA 2Z59B 5HE0A 3H7PA 5JHHA 4FULA 1YQBA 4NPNA 1TGZB 4KAXB 4KV2A 3RCZA 1KM7A 4IWPA 1P3QU 4WSFA 3V6EB 2Y5BB 2M38A 3MHSD 5EFXA 4Z2MB 4Y94A 4KZCA 3V5WA 1WE6A 3ZDTA 3DVGX 4K2OA 2WDTB 4ANUA 2O2VB 1WH3A 4AJWA 3QK0A 2HRJA 3ZW3A 2LOZA 4RM9A 2D10A 4GOCA 4FADA 4KHBB 2DN6A 2VKIA 4W9CA 4NAWB 5CHWA 3PRZA 3QIJA 1ZGUB 1LM8B 2KNBA 2EKEC 1SE9A 2PJHA 4GDKA 2CODA 4URKA 2I1KA 2HE7A 3L17A 2K8HA 4BVUC 3HK0A 1ISNA 4BBKA 2D9VA 4GPTB 3JYUA 3HM3A 3SD5A 1WFYA 3HIZA 4A3PA 4HAYB 3VH4B 2K25A 4BKGA 4NQLB 3QC8B 2KMAA 1V5TA 1ST7A 2EMSA 2BYEA 3L13A 1C3TA 2YS3A 2ZZPB 3IFWB 3H7SA 4JL9A 5DIFB 4K81A 4DBGA 2Z0DB 3B0AA 1LFDA 3VAWA 2XK5A 1FHWA 1U29A 2YT0A 2DX5A 2DZJA 5J18A 4JQWC 4DDID 2J0MA 3VFKA 2N0YA 1UZXB 5D3YA 2ZJDA 1E8XA 2LRUA 2COPA 1PMSA 1L7YA 3S2AA 4LJOB 2BWFA 1U5GA 5D7GA 4KVGB 3APDA 4W9EA 4NJ7A 3KVFB 3KH0A 4MY6A 1TJ6A 1ACAA 4ANXA 2KFKA 4EZKA 5L83A 2OOBB 2ABDA 5JHBA 3A9JA 1V89A 1U2BA 3P2BA 2DYMA 4XWXA 2N7DA 4DK5A 4HPMB 4MSQB 2UYZB 2L0FA 2M14A 4TUUA 2K00A 1P5TA 1ZW7A 1GC6A 1E5WA 5JZEB 5E6PA 3RYTA 1MAIA 4TYZA 3BJIA 4HLEA 2DTCA 2KC2A 2JRIB 2BF8B 4WJPA 1XD3B 1XD4A 3L54A 3IVFA 1EF1A 4NQKE 2FCMA 1X1MA 1V88A 4DWFA 2M1MA 2LASA 3PLVA 4W9LA 3PRPB 4EJNA 2RVBB 4LJPB 4HAXB 4HB4B 2DZMA 5IA7A 1FXTB 3PEGA 1M7EA 3QCAA 2Z0PA 1C1YB 4MJSB 1QQGA 1V81A 4WJ7A 2C60A 2MX2A 3VOQA 4W9KA 5JH5C 3T8MA 2V4LA 2MFQA 5D27A 2ELBA 1MIZB 1XX0A 1J19A 3PVWA 4ICVA 2CB8A 3FLVA 4MGKE 3B08A 2DFKA 1Q5WB 1KLVA 1OEYJ 2A5UA 2WH5A 4FHJA 4A6KA 4IC7B 3UGBB 3GOEA 2G35A 1WGGA 1WXSA 3CSFA 3DBRI 1EVHA 2KTRA 2IZVB 3ZRCA 2N23A 1BAKA 1IP9A 5D3VA 3WIMA 3VUYA 1UPRA 4IFSA 2N1VA 3IHPC 4PYUA 1ZSQA 2LUEA 4JIOU 2GCJA 1V5UA 3GZNI 3UIPB 1UEFA 4PNKA 3QHTA 3ONSA 2YVCA 1X05A 3FSSA 3DVGY 3VUWA 1Z2MA 3DXEA 3ZLZA 4E74A 2KJHB 5J3YA 1U5FA 4HDQA 3GYOA 3ZTCA 2L05A 2DHJA 4MEMA 3K9PB 5CTRC 4WJOA 1V5MA 3OJ4B 2PEAA 4PS3A 3M62B 3ODXA 4DHJD 2Z0QA 3NZUA 2GS0A 2I5CA 3EPYA 1B55A 4TQ1A 1YJ1A 2IFSA 3UQBA 2K2UA 2LGXA 2KDEB 1LXDA 2C7HA 2JRHA 1X1FA 5KHOA 3CXBB 2MBBB 1TTNA 2KXJA 3A4SC 2MSED 2KHWB 4WVFB 3PP2A 4WWPA 3D8DA 1BTKA 3APFA 3UINB 1UNRA 2LVQA 3LJUX 2CHXA 2QHOA 4ANVA 3L10B 1FGZA 2PZ1A 4LDTD 2RGNB 2KN5A 4DHZB 2ZNVB 1K8RB 2KFJA 4W9HA 3CMMB 2LVPA 4HAWB 4I6PA 4MGZE 1ZKHA 5GOWB 2JP2A 1PLSA 1NTIA 2MWSB 1MIXA 1XQQA 3NY5A 3RUIB 1KZGA 4WWOA 5JHGA 4M8NA 3OLMD 2MWNB 1OEYA 3PRMB 3RZWC 2MBQA 2ASQA 3I3TB 3CF6E 3TIXA 3A33B 1UBIA 2PE6B 2UVMA 1W1DA 2PE9A 2MBEA 3ENEA 1NTYA 2MP2A 4W9IA 2K6DB 3SNHA 3O96A 2FAZA 1WIAA 2KJRA 2O6VA 3EHVA 5LONB 1V2YA 2R2QA 3KW5B 3ZDMC 2KDBA 1WX7A 3TJPA 2XQNM 2OTXA 2KLCA 3ECIA 3H7PB 1OGWA 4JLCA 3M95A 4K7UA 1IRSA 3Q3FA 4FJVB 4M0WB 1UNQA 2XBBC 2ZCCA 2FCQA 3FEHA 4IWQA 4EOYA 1SIFA 5AZHA 3PV1A 3TVVA 1U5EA 1DROA 5AZGA 2KLGA 4N9F4 2ADZA 1HBKA 2WYQA 3TL5A 3QJZA 1N3HA 2K8CA 3D8EA 4FLHA 1DYNA 2KZRA 5AEKB 4CHJA 3DXDA 2YLMA 5IJMA 3P6AA 2DYNA 2BPSA 3R66C 4HDOA 1J8CA 2KX3A 4MGIE 2JWZA 3LJ3A 2K1FA 2NBWB 4F7HA 5LOPB 3ALBA 3ML9A 2IO0B 4GN1A 1FOEA 3SUZA 4GDKB 4ASWC 1LW3A 2MA9B 1LB1A 2FCNA 1RAXA 2N9EB 2FJ9A 5FI1A 4GDLA 3H6NA 5C79A 2COFA 4WJNA 1W1GA 4HB0B 4W9GA 1UD7A 2LKOA 2DHIA 5HE1A 5KCVA 4ANWA 4MDKE 2L8JA 1EF5A 4PQ0A 3HHMA 1UPQA 2KDIA 4P7IA 2XK5B 4BBNF 2HJ8A 1OTRB 4IUMB 1Q1OA 4A5KA 2D4QA 3N30A 1EO6A 2N7EA 3W1YA 3ZKJC 3K9OB 2ZNVC 5GMVA 2D9XA 1WMHA 2ZCBA 2LRWA 4HAZB 2D07B 4WWNA 1WF9A 3JSVA 2KFKB 5G2NA 3A4RA 1KJTA 5LLIA 4BBNC 3BINA 1WYWB 4FJYA 2JVCA 1WX8A 2RNRB 3NZSA 3A9JB 3SHQA 5DCNA 3M3JA 1GJZA 2ROZB 5DPTA 3UF8A 2O2VA 2JPHA 4BOZB 3MTNB 2VRRB 2RSGA 2JXXA 1NDDA 3TO1A 1BTNA 4CYEA 1E8ZA 5J17A 4GIVA 2O6VD 3DDCB 2CHZA 1P3RA 4H8SA 4HJKA 1FHXA 1QC6A 3IBEA 3VTVA 5TR5A 3VXWA 3SU8X 2FDQA 2DA0A 1WY8A 3VH3B 2RLOA 4HAUB 2LGDA 3PLUA 3ZUNA 2IO3B 2FIDA 4II2B 1EAZA 2RPQA 5L81A 3W1SA 5G55A 3ODWA 3A8QA 5BO4B 3HW2B 3L16A 4C0AA 1MKEA 4AJYB 3A1QB 3H9DA 2COCA 3VTUA 2M0XA 3D8FA 4YONA 4NY0A 1FAOA 1Y5OA 4IM3A 4TQ0A 5LXHA 2IY1B 4FJZA 1E7VA 1KI1B 4CO7A 3WA0A 1TQZA 2BKFA 5CX3A 1WG7A 2R09A 3R7QA 5E6OA 3DPDA 4MM3A 3ZNID 3M1IB 3RCPA 2NR2A 1J0GA 3RULA 2KTRB 1V5OA 1Y19B 1ZC3B 4IAPA 1E8YA 4JGHB 4BKTA 3QQ8B 1SHCA 2L0TA 5AZFA 2G45B 2KQ7A 4II3B 5DPWA 3HM6X 2EJ8A 2KVRA 4EZLA 4F7GA 2DYOA 1FGYA 3APCA 4A20A 2IO1B 2P0DA 4L6EA 1K5GB 2M4NA 2LULA 1U5DA 1MG8A 3QAQA 3AI5A 1NU2A 1NVLA 4EUTA 4M8MA 2BCJA 1FHOA 3C0RB 3WAOA 3CSTA 5D94A 2MCNB 1R4MI 4A6FA 4CHKA 2IBIB 3KRXA 3WALA 3M63B 2V1YA 2D9YA 2WX0A 2RD0A 3KRWA 2Q13A 1WXMA 3KUCB 1WZ0A 2NPTA 3VDZA 2GBKA 2KMCA 3ODOA 5JLJB 1OY2A 4MJSA 5DH9B 3GYPA 5HE2A 3T9LA 2YSZA 3WAPA 2KUPA 4BKSD 2Y8FA 4ZRKA 2MKRA 3AU5A 3SDLC 2H7DA 3VQIA 2MDXA 3N32A 5C16A 3PHWB 1T0YA 1ZC4B 3DOWA 3X0WA 1V9JA 1GNUA 2L1CA 4WJQA 1XR0B 4KHAA 2DZIA 2OQBA 2NBVB 3SYXA 1GC7A 3PPAA 3UZTA 3PT2B 3U7DA 1FB8A 5JP4A 2H7EA 4KIKB 4AUQC 3QWMA 5HE3A 4WQOB 3A8PA 4XZ4A 1YX6B 1WGQA 4EEWA 2KJ6A 3R3MA 3X23A 5D6JB 4MSMB 3DBHI 3B1LX 4RMAA 2YRYA 3O65B 3PG7A 2C5LC 4MH0E 1XODA 2K39A 4W9JA 1WXVA 2N9XA 3VIAA 2REXA 2BWES 1DDWA 2MP2B 4MT7A 2W2XC 2X18A 2NZ8B 1IYFA 2MBHA 3OJ3A 2CY5A 4I6NB 4HHVA 3V60A 2YS1A 1X11A 1I7AA 4HCNB 2R2OA 3V61A 4NJ6A 1QZEA 1WGRA 4DX8A 3IG3A 3SV1A 2P0HA 4B9KA 4A6HA 2QKMA 3PVLA 3ULCA 3F0WA 2GJYA 1PFJA 4HWIB 1TBEA 5CLQB 1WJ6A 2DAJA 1Y8RC 2FCSA 4HXDA 2MQJA 1ZVRA 2DZKA 4E71A 2W9NA 4TV3A 4GSWA 2ZVNA 2LOXA 3ML8A 4K7WA 2LG1A 3DBSA 2NMBA 3KZ1A 1BT0A 2J0JA 3PGEA 3TMPB 2R0DA 2B3AA 2G4DB 1UBQA 3AXCA 2IYBA 1WRDB 2AYOB 4XX5A 3DQVA 4X57B 1CMXB 3PS6A 3FM8C 2KK8A 3NHEB 4G0NB 2BGFA 3P7ZA 1IPGA 4E3CA 4LCDE 4W9FA 4HK2A 5D3WA 4FHKA 1EUVB 2LD9A 4HPLB 2MLBA 4G11A 4GZUA 4IM2A 4ICUA 2CQUA 2VSZA 3NS8A 2E2XA 2GMIC 3QX1A 2LWPA 4K1RB 2HTHA 2JZ3B 4K17A 4G3XB 3ZNGC 4F7UP 2MRPA 4HATB 4NSWA 4FA6A 2RQ1A 5D3XA 2GBJA 1V6EA 2COAA 2QKLA 5J3QA 4BOSC 2D2QA 1WJNA 2NS5A 2XEWA 4IW0A 3L0WB 4ZRIA 3TW1A 3QARA 3VUXA 1WMHB 2JUOA 2ELAA 2WWZA 3EECA 1R4NI 3A9KA 1XT9B 2I1JA 5D2MB 5KQ4A 3ULBA 3VHTC 3G9WA 2Z0OA 3DXCA 3ZNHB 3JSVB 2K6QA 3TBLD 1LQBA 1M7RA 4GMXB 2L3ZA 2UWQA 3PTFC 4OVUA 3N7CA 4B6HA 4CHMA 5C5BA 1OQYA 3TCAA 2DX5B 4PS8A 3MJWA 1K5DB 4DHJB 3KSYA 2CU1A 1KOTA 1TXDA 2L7RA 1Z87A 3DVNV 2LI5A 2GBMA 2GOWA 5E6NA 4HCPB 4EFOA 1P6SA 1WM3A 3U30A 3TFMA 1DBHA 5FI0A 3ZVRA 4KZ0A 5KQ1A 2RR9A 2DENB 2NBUA 1NI2A 2L76A 4Z2NA 3JVZX 3T06A 4BKSA 1H4RA 1RLFA 2FJLA 5C6RA 1VCBA 3MPXA 1GUAB 5J2RA 1WI1A 1EGXA 4IWOA 2ZPYA 2LGYA 2KO3A 1Q0WB 4PYZA 2FNJB 4EKUA 1V49A 2MW5A 4LDTB 4DHZE 4KSLC 1V61A 1OMWA 2YS5A 4HB3B 3NOBA 4F7ZA 1WJUA 1WJMA 3WYFB 5C1ZA 1XCGA 4NAWA 2KANA 1DDMA 4GU2A 3ZTDA 1A5RA 1UH6A 2BYVE 1RFAA 4MK0A 4DX90 2DYBA 4YL8A 3FP5A 2CRFA 2YT1A 3DCGA 1V5PA 4BFRA 2N9PC 1HB8A 2LZ6A 1BWNA 4GMVA 1WM2A 3CIKA 3OANA 1H8CA 1WVHA 3AU4A 1V86A 4B95A 2ZVOA 4W9DA 3ZIMA 2GBRA 2NCNA 4ZYNA 2EMTA 2FUHB 1UGMA 2CHWA 3V6CB 2D3GA 1WR1A 4TKNA 2JF5A 3KYDD 1YX5B 3ZVVA 4EZJA 1ZM0A 2BKRB 2L2IA 1G6JA 1L2NA 1NBFC 3DBLI 4A6FB 3LDZE 2C7NB 3D32A 1UNPA 3RT3B 5KHQA 3SO6A 2A4ZA 5HKHA 5DI9B 1HE8A 1WGDA 3UQAA 3PSEB 2IO2B 5CLLB 1D3ZA 4FN2A 1X1GA 3DVNU 1WGUA 1DDVA 2NPTB 2RSUA 4KSKC 4ZDVA 3JW0X 2J0KA 2W2WA 4AWJA 4KHOA 2K8BA 1OQNA 3BY4B 2LJ5A 2LYDA 1SGHA 2DHKA 3ZO5B 1XKEA 1I2HA 3A1QA 1VD2A 2HD5B 4MGYE 3AJ4A 1WGHA 4XC2A 3VVWB 2UZSA 3KUDB 3AULA 2IY0B 2D9ZA 2J59M 3H1UA 3Q3JA 1Q67A 3WAMA 3OAWA 3NSUA 2NVUI 4D0NB 2FIFA 4FBJB 3KY9A 2KTFA 1PQSA 1WE7A 5DPSA 3ML4A 1RRPB 1RJ2A 2KC1A 2CY4A 1MK7B 3W1SC 2RGFA 4HB2B 2CKHB 5FR6A 3PHXB 2KWCA 3PSCA 2OJRA 2Y7BA 2DX1A 5DHAB 1GG3A 2LVOA 4IM0A 1P0RA 3R7RA 3EFUA 3PZDA 1WR6E 4HAVB 2G3QB 2KX0A 3RD2A 2ZEQA 1W1HA 1WZ3A 4IOYX 2KKCA 2KDFB 1WI0A 2P0FA 2YF0A 2CAYA 5DHFB 3QA8A 3ZNZB 2KQSA 2V76A 3UIOB 3L08A 1M94A 1F9JA 2D9WA 1J0WA 4DXAB 3KYCD 2KWVB 2V3SA 2IYDB 4GB9A 1KZ7A 4F8CB 2N4FA 3N3KB 4GGQA 4IG7B 2P8VA 2J7QB 1WXAA 2Z0EB 5J3TA 1Z5SB 4G50A 2RUKB 4DDGD 2AL3A 1E90A 5JHAA 2O6VB 4EMOA 1P1AA 2MBOA 4KDLB 2PPHA 2DKPA 4RM8A 2KOXA 2G4SA 1WX9A 2JZZA 4J6IA 2JY6A 1S3SG 5CHFA 4PS7A 2GCLA 5L95C 4B6WA 4K2PA 2KWUB 1WJ1A 2EC1A 4KIKA 3A98B 1I42A 4KDIC
chains in the Genus database with same CATH superfamily
2WDVB 4HVBA 5EDSA 4GOUA 3GZNB 3PVUA 1RRBA 1MHHE 2K2JA 5CHVC 5DPRA 4A3OA 3U12A 2M8SA 5G5HA 4GXBA 2KCJA 3F5RA 1JWUD 2L00B 3VTWA 3KUZA 4ZRJA 1L5PA 2KGXB 2M17A 4AOFA 1MK9B 1WWTA 4WQMA 1H10A 4WAFA 1NTVA 2FJUB 2PVOD 1FO4A 3RZFA 1U27A 1MVKA 4XDDA 3P63A 5BYQA 1HEZE 1UELA 4PK1A 5C23A 4MELA 2AEHA 2IPKD 1X86A 4HEA1 2GBNA 2W2XD 2AWTA 3P4SB 2HTHB 5LG4B 3AH7A 1UWXA 2LXAA 4P16A 3AE5B 5GXGB 3MDBC 1JRUA 2WDQB 1WGYA 2DKQA 1JCKB 3EC8A 3U8ZA 2DLWA 2PTLA 1P9DU 3QWZB 1S1QB 2NTSA 3AE8B 1V1PA 4DBBA 3PREA 1E7UA 3QBVB 4WIPA 2DAFA 2ZPNA 2JT4B 2CS4A 3V62A 1QOGA 2TSSA 2Y8GA 4F1SA 4LNIA 2JX5A 2C9WB 2LXCA 3LXFA 2DHZA 1P98A 1I35A 3HQCA 2BS3B 1YIWA 5LXIB 3BVGA 4I6LB 2JYTA 4AP4C 4NNJB 1KC7A 1U4AA 5IAAC 1TS2A 4GDLB 3A9KB 1RM6C 3NUHB 1MPHA 1HB6A 3DBHB 1V80A 2KD0A 4HSIA 2CR5A 2AL6A 3RMKC 1AWEA 3EGRA 2WX1A 2VRWB 2I5FA 2ROVA 2UZRA 3WANA 1ZUD2 1E8WA 3ZRFA 4OVVA 2M19A 1AARA 1NVID 1NI3A 5C5BB 1YD8U 2LBBA 2D11A 2N1WA 1AQCA 1WJ4A 1TZ1A 4K7SA 2KUQA 2KAJA 2DYQA 4WAAA 2C7MB 2BYFA 2Z59B 3URYA 3A58A 5HE0A 3H7PA 2GLSA 5JHHA 4FULA 3AB5A 1YQBA 2LEKA 4NPNA 1TGZB 1HA5A 2AQ2B 3BVMA 1QQRA 3TEZA 4KAXB 4DXFA 4KV2A 3RCZA 1KM7A 4IWPA 1VZ8A 4M0WA 1P3QU 2GI9A 2AQ3B 4WSFA 3V6EB 4QJ3B 5JXVA 1XLNA 4A9AA 1TT5B 2Y5BB 3EA6A 2M38A 3MHSD 5EFXA 4Z2MB 4Y94A 4O1NA 4XE0A 4KZCA 3V5WA 2KWDA 1VR9A 1WE6A 5HG2A 1SJHD 3ZDTA 3DVGX 4K2OA 2CJOA 4JE3B 2WGSA 1HZ6A 2WDTB 1D6EC 4RNAA 1YQ4B 3IT6B 4ANUA 1F77A 2O2VB 1WH3A 4AJWA 3QK0A 2HRJA 3ZW3A 2QJLA 2LOZA 4RM9A 2KVZA 2D10A 4GOCA 1FCCC 4FADA 4KHBB 2DN6A 2VKIA 1KRHA 4JKCA 3NW8A 2K49A 4W9CA 1ZYIA 2N7JA 4NAWB 5CHWA 3PRZA 1FXAA 3MC0B 2KMMA 3QIJA 1ZGUB 3SR6A 2K22A 2M56B 1LM8B 2KNBA 2EKEC 2BQQA 2PKOA 1SE9A 2PJHA 1PDXA 2CODA 4GDKA 2I1KA 4URKA 2HE7A 3L17A 2GRIA 2K8HA 4BVUC 4KKIA 3HK0A 1ISNA 4BBKA 1N62A 3LB8C 2XNAC 2D9VA 4GPTB 1CK1A 3JYUA 3HM3A 3Q3NC 5IN7A 3SD5A 3T3OA 2RRFA 1WFYA 3HIZA 4A3PA 4HAYB 3VH4B 2K25A 4BKGA 4NQLB 3QC8B 1SSNA 2KMAA 1V5TA 4UDUC 1ST7A 2EMSA 2BYEA 1WGKA 3L13A 1C3TA 2YS3A 3P42A 2ZZPB 5FR3A 3IFWB 3H7SA 2BB6A 4JL9A 5DIFB 4K81A 4DBGA 1SE2A 2Z0DB 4AQ7A 3B0AA 1LFDA 3VAWA 3V05A 4USAA 2XK5A 1FHWA 1U29A 2YT0A 2DX5A 3RNAC 2DZJA 4RCOA 4JQWC 5J18A 4DDID 2J0MA 3VFKA 2N0YA 2V3PA 1UZXB 5D3YA 2ZJDA 1E8XA 4ZHOA 2LRUA 2COPA 2K8EA 1PMSA 3CIRB 4PT5A 1L7YA 3S2AA 3B2GA 4LJOB 2BWFA 1U5GA 1KLUD 5D7GA 4KVGB 1T3QA 1VZ7A 2FUG1 3APDA 4W9EA 4NJ7A 3KVFB 4Q2JA 3KH0A 4MY6A 1TJ6A 1ACAA 4ANXA 2X38A 1C4AA 4KGTA 2KFKA 4TMAB 4EZKA 5L83A 1FFUA 2ABDA 2OOBB 5JHBA 4XWWA 3A9JA 1VDVA 1V89A 3KQ4A 1U2BA 1QILA 4LNFA 3NRZA 1WXQA 3P2BA 2DYMA 4IKGA 4XWXA 3NZ3A 2N7DA 4DK5A 1QF6A 2WQYB 4HPMB 4MSQB 3FVCA 2UYZB 1ET6A 2L0FA 2M14A 1I4PA 4TUUA 3U2SC 2K00A 5EE3A 1P5TA 1ZW7A 1GC6A 2YEPF 4RH6A 1L6UA 2LGIA 1FNVA 2N9LA 1LGRA 1P7FA 4HKQA 1E5WA 5JZEB 2K0PA 5E6PA 1MAIA 3RYTA 2V3NA 3L4PA 4YXDB 1AYFA 4TYZA 3Q8EA 3BJIA 1WSPA 4HLEA 2DTCA 2WXJA 4ILGB 2KC2A 2JRIB 2BF8B 2J53A 4OZCA 4WJPA 1XD3B 1XD4A 2BW2A 3ENBA 3B77A 2QILA 4B0EA 3L54A 3IVFA 3N1XC 1EF1A 2JSVX 2FBWB 4NQKE 2FCMA 1X1MA 1V88A 4DWFA 2M1MA 2LASA 3Q2AC 2KACA 3MFGA 3PLVA 2H88B 4W9LA 3PRPB 4EJNA 5BYSA 2JZPA 3Q8AA 2RVBB 4LJPB 4HAXB 4HB4B 3ABVB 4MT5A 2DZMA 5IA7A 1FXTB 3PEGA 1M7EA 3QCAA 2Z0PA 1C1YB 4MJSB 3LYYA 1QQGA 1V81A 4WJ7A 2DNFA 1Y56A 2C60A 2MX2A 4A55A 3VOQA 4W9KA 3U7ZA 5JH5C 3T8MA 4C80A 2V4LA 2MFQA 2RPVA 5D27A 2ELBA 2K9XA 3BYYB 1MIZB 1XX0A 1VRAB 1J19A 3PVWA 1TY0A 1V1OA 1ZDVA 1DIKA 4ICVA 2CB8A 3SBGA 3AEDB 3FLVA 1UGJA 4MGKE 3B08A 2DFKA 1Q5WB 1KLVA 2IJ0A 1OEYJ 1D4BA 3GP7A 5T8IA 1RYJA 2WH5A 2A5UA 4FHJA 1DOYA 4A6KA 4IC7B 3UGBB 3MP9A 3GOEA 2G35A 1WGGA 1TZOA 1GOZA 1WXSA 1PGXA 3CSFA 3DBRI 1I4HA 2BYTA 3TSSA 4WURA 1SB3C 1EVHA 2ZKMX 3KWLA 2KTRA 2IZVB 3ZRCA 1CJEA 2N23A 2WXIA 1BAKA 1IP9A 5D3VA 1L0XB 3WIMA 3VUYA 3SBTA 1GB1A 3SFDB 1KH0A 1UPRA 4IFSA 3PZ8A 2N1VA 3IHPC 4PYUA 1ZSQA 2LUEA 4JIOU 2GCJA 4CQNA 1V5UA 3GZNI 3AE2B 3UIPB 3AEAB 1UEFA 4PNKA 3QHTA 3ONSA 2YVCA 1JRPA 1X05A 3DHGC 1F52A 3FSSA 5G5GA 3TEXA 1IBXA 3DVGY 1FCLA 3VUWA 3V3XA 1Z2MA 3DXEA 1K50A 2OHFA 2WXKA 3ZLZA 4E74A 2KJHB 2LUMA 5J3YA 4L23A 1U5FA 4ACFA 4HDQA 5IRSA 1T6BX 1V8CA 3GYOA 1CQVA 3ZTCA 2WP9B 2L05A 2JYEA 2BTEA 4JKDA 2DHJA 4MEMA 3K9PB 2W55A 5CTRC 4WJOA 3AM9A 2B76B 1V5MA 3OJ4B 2QSDA 2PEAA 1I4XA 4PS3A 3M62B 3ODXA 4DHJD 3E9PA 2Z0QA 4OW0A 3NZUA 1GGOA 2GS0A 2I5CA 3EPYA 1B55A 4TQ1A 1YJ1A 2IFSA 1E6EB 3UQBA 1E10A 2K2UA 2J42A 2LGXA 3TEWA 5I2SA 2W82A 2KDEB 1LXDA 1K51A 2C7HA 2JRHA 1X1FA 1KF6B 5KHOA 3CXBB 2MBBB 1TTNA 2KXJA 1K52A 3A4SC 2MSED 2KHWB 1YN4A 2ICIA 1C4CA 4WVFB 1BMLC 3PP2A 4RGNA 4WWPA 3D8DA 4LTUA 2R61A 4EE2A 1BTKA 3H8HA 3APFA 3UINB 2LGSA 1UNRA 2LVQA 4P1BC 3RFZB 3LJUX 2CHXA 3OWEB 2QHOA 4ANVA 3L10B 1FGZA 3FKYA 2PZ1A 1A70A 1R4MB 4LDTD 4REZA 3DCXA 2RGNB 2KN5A 3DHIC 4DHZB 2ZW0A 2QMTA 2ZNVB 1K8RB 2KFJA 4N59A 4W9HA 1AW7A 3CMMB 2LVPA 4HAWB 4I6PA 4MGZE 1SEBD 1ZKHA 5GOWB 3Q6BA 2JP2A 1PLSA 1NTIA 2MWSB 1MIXA 1L0VB 1XQQA 3NY5A 3RUIB 1KZGA 2GUMA 4WWOA 5JHGA 1B1ZA 2V0GA 4XWTA 2CU3A 4M8NA 3OLMD 2MWNB 1OEYA 1JDEA 3PRMB 3RZWC 1WRIA 4LNNA 4JKBA 2MBQA 2ASQA 3TUOA 2DIKA 4C7YA 3I3TB 3CF6E 1EU3A 3TIXA 5BMIA 3A33B 1FM0D 1TS5A 1UBIA 2PE6B 2UVMA 1W1DA 2BS4B 2PE9A 2Z13A 2MBEA 2PW9A 3ENEA 1NTYA 3EUB2 2MP2A 4W9IA 2K6DB 3SNHA 3O96A 4ZOHC 2FAZA 2DWQA 1WIAA 2KJRA 2O6VA 2QCZA 3EHVA 1J7CA 5LONB 3I63C 1C78A 2WXRA 4S0RA 4JWUC 4S17A 1V2YA 2R2QA 3KW5B 3ZDMC 2KDBA 1WX7A 4LK0M 3TJPA 2XQNM 2OTXA 2KLCA 3ECIA 4JKHA 4XYCA 1MG4A 3H7PB 1OGWA 4RF1A 3FILA 3RN9C 4JLCA 2WXHA 3M95A 1IRSA 3Q3FA 4K7UA 5H92C 3BZDB 1ZOYB 4FJVB 1HXYD 4M0WB 4C56C 1NEKB 1UNQA 2XBBC 1YOVB 2MEKA 4A8XC 2KN4A 4C00A 2ZCCA 2FCQA 1ROEA 1B9RA 3ZYYX 3FEHA 2MJDA 4IWQA 4EOYA 1SIFA 5AZHA 2JXTA 3PV1A 3TVVA 1U5EA 4L2YA 3SEBA 1DROA 5AZGA 2KLGA 4N9F4 1YJIA 2ADZA 3KWVA 3HUIA 1HBKA 2WYQA 3TL5A 3ZJVA 3QJZA 1N3HA 3DWGC 2K8CA 3D8EA 1EM7A 3P4PB 1I4RA 1N5XA 4FLHA 4RGOS 1JW9D 1DYNA 2KZRA 5AEKB 4CHJA 3DXDA 2YLMA 5IJMA 1FNWA 2D3BA 1FIQA 3P6AA 2BT6A 2DYNA 2BPSA 3R66C 4HDOA 1FXIA 3Q3OC 3J9CA 2AX5A 4YT0B 1FNUA 2KX3A 4MGIE 1J8CA 2JWZA 1FRDA 1MHXA 2YEPB 2V4IB 2K1FA 3LJ3A 2NBWB 1L4DB 1TYGB 4F7HA 5LOPB 5I2MA 3ALBA 3ML9A 2IO0B 4GN1A 4TSSA 1FOEA 3SUZA 4GDKB 4ASWC 1LW3A 2MA9B 4JKAA 1LB1A 2FCNA 1RAXA 5BYRA 2N9EB 2FJ9A 5FI1A 2VZKB 2GB1A 4GDLA 3H6NA 5C79A 1N5WA 1XO3A 2COFA 3R2IA 3RPFC 2BB5A 4WJNA 1W1GA 1C4PA 3AEFB 3OG5A 4HB0B 3ZJUA 4W9GA 2G9HD 1UD7A 2LKOA 2DHIA 5HE1A 5KCVA 4ANWA 4MDKE 2INPE 2L8JA 4P1CC 1PFDA 2H89B 1EF5A 2EKIA 1JWMD 4PQ0A 5EE1A 3HHMA 1UPQA 2KDIA 1SBBB 4P7IA 2NMQA 2XK5B 4BBNF 2HJ8A 1OTRB 2INCC 1YN5A 3VR9B 3AEEB 4IUMB 1Q1OA 4A5KA 2D4QA 3VR8B 3N30A 1EO6A 1GB4A 2N7EA 3RNGC 3W1YA 3ZKJC 4IOIE 4KX6B 3K9OB 4ARCA 1VZ6A 2ZNVC 1E0ZA 5GMVA 4K3CA 2D9XA 2IGHA 1WMHA 4YWGG 2ZCBA 2LRWA 4HAZB 2D07B 1UWMA 4WWNA 1WF9A 3P4QB 2I38A 3JSVA 1T0SC 2KFKB 3BWUD 5G2NA 3A4RA 1YQ3B 1KJTA 5LLIA 4BBNC 3BINA 1WYWB 4FJYA 2JVCA 1SXTA 1WX8A 2RNRB 3NZSA 3A9JB 3SHQA 2J4XA 5DCNA 2X0SA 4HKZE 1XEEA 3M3JA 1GJZA 2ROZB 1AWDA 1XLOA 5DPTA 3UF8A 2O2VA 3IAM1 2JPHA 4BOZB 3MTNB 1MI0A 1C79A 2VRRB 2RSGA 2D3CA 2JXXA 1NDDA 3TO1A 1BTNA 2ON8A 4CYEA 1E8ZA 4KHBA 2UU7A 1PGAA 5J17A 4GIVA 2IGDA 2O6VD 3DDCB 2CHZA 1P3RA 1YNTE 4YTPB 4H8SA 1HQRD 4HJKA 1FHXA 1QC6A 3IBEA 3VTVA 5TR5A 1F2RC 3VXWA 3DWMA 3SU8X 2FDQA 2DA0A 1WY8A 4WH4A 3VH3B 2RLOA 4HAUB 2LGDA 3PLUA 3ZUNA 2IO3B 2FIDA 2WLBA 4II2B 4ARIA 1EAZA 1R4NB 3FC4A 2RPQA 3GE8C 3WCQA 1P7EA 5IOIA 1C76A 5L81A 3W1SA 1SF0A 5G55A 3ODWA 3A8QA 5BO4B 2LHEA 3W9CB 1ZPSA 2WU5B 3HW2B 3L16A 1FPYA 2WU2B 4C0AA 1MKEA 4AJYB 3A1QB 3H9DA 2COCA 3VTUA 2M0XA 2E6XA 3D8FA 1NENB 3U52E 4YONA 4NY0A 4CSQA 1FAOA 1Y5OA 4IM3A 3N20C 4TQ0A 2IY1B 5LXHA 4FJZA 1E7VA 4US9A 2RDHA 1KI1B 4CO7A 4MACA 3WA0A 1TQZA 1M4VA 4OZAA 2BKFA 4N6EB 5CX3A 1WG7A 5IKCM 2R09A 3R7QA 2W54A 3AE4B 2PVGC 5E6OA 3N9YC 3DPDA 4JK9A 2QC8A 4MM3A 3ZNID 5M4YB 3M1IB 3RCPA 3NJTA 2X8XX 2NR2A 3NWFA 1J0GA 3RULA 2KTRB 1V5OA 1Y19B 1ZC3B 4IAPA 1E8YA 1YN3A 4JGHB 4BKTA 1TKEA 3QQ8B 1SHCA 4JKEA 2J52A 2L0TA 5AZFA 2G45B 2KQ7A 4II3B 4ZHPA 5DPWA 3HM6X 3PZ7A 4ZRPA 4JKGA 2EJ8A 4NJCA 3ZGZA 4XGAB 2KVRA 4EZLA 4F7GA 2KIEA 2DYOA 1FGYA 3APCA 4A20A 4KGRA 2IO1B 1FD6A 1VBGA 2P0DA 4L6EA 1K5GB 1DOIA 3B2FA 2M4NA 2LULA 1IBXB 3I9V1 1U5DA 3UI3A 4RGTA 4C4VB 1MG8A 3BK1A 3C19A 3QAQA 1GPXA 4YSXB 3TEYA 3AI5A 4DIXA 1NU2A 1NVLA 4EUTA 4M8MA 2BCJA 2WS3B 1FHOA 3C0RB 3WAOA 3CSTA 5D94A 2PIAA 2MCNB 1R4MI 1ACCA 3OHMB 4A6FA 5AUKA 3MC9A 4RFBA 4CHKA 3ZJTA 5IP4D 2ZW1A 1XLPA 5C2TB 4HJGE 2IBIB 3KRXA 3WALA 1N60A 4ITKA 3M63B 5FKAC 2V1YA 2D9YA 2WX0A 2RD0A 3KRWA 1ZP0B 2Q13A 1TS3A 1WXMA 3KUCB 1QOFA 2LJIA 2N9KA 1WZ0A 2NPTA 3VDZA 2GBKA 2KMCA 3ODOA 5JLJB 4A6QA 1OY2A 1MJDA 5HHDG 3W5UB 1XXGA 4OZBA 2QEJC 4MJSA 5DH9B 2IGGA 5BMGA 3MJ5A 3GYPA 3O13A 5HE2A 2RMMA 3T9LA 2YSZA 5EE0A 4NZLB 1STEA 3WAPA 2KUPA 4BKSD 2Y8FA 4ZRKA 2MKRA 3AU5A 1V97A 3SDLC 2H7DA 3VQIA 2MDXA 3N32A 5C16A 3PHWB 1T0YA 2OJWA 1ZC4B 3DOWA 3X0WA 1V9JA 1JMLA 1GNUA 2L1CA 4WJQA 1XR0B 4KHAA 1N6ZA 2DZIA 2OQBA 2M0AA 2NBVB 3SYXA 3W2DA 1GC7A 2JQRB 3PPAA 1UNSA 3DBLB 1TJEA 5FK9C 5E6JA 3UZTA 3PT2B 2Z8LA 3U7DA 1FB8A 5JP4A 2H7EA 4KIKB 4YSYB 4AUQC 3QWMA 1UUPA 5HE3A 1QKZA 4WQOB 3A8PA 4XZ4A 5D3IB 4K3BA 1YX6B 1WGQA 4H2AA 4EEWA 4ILHA 2KJ6A 3R3MA 3EFCA 3X23A 5D6JB 4MSMB 3DBHI 3B1LX 4RMAA 2I2YA 4OT1A 2YRYA 3O65B 3PG7A 2BBCA 2C5LC 2HDEA 4MH0E 1XODA 2K39A 3ZXRA 4W9JA 3E56A 1MPEA 4QXAB 1WXVA 2N9XA 3VIAA 2REXA 2BWES 1DDWA 4M02A 3VRAB 4J3OD 5LNK1 2MP2B 4MT7A 2E3TA 2W2XC 1L4ZB 2X18A 2NZ8B 1IYFA 2MBHA 3OJ3A 2CY5A 2WXNA 4I6NB 2KYWA 4HHVA 3V60A 3AEBB 2MH7A 2YS1A 2XN9C 1X11A 1E7PB 4IDIA 1I7AA 5EE9A 1V1PB 4HCNB 4KKJA 2R2OA 3V61A 4NJ6A 1QZEA 1WGRA 2V9HA 4DX8A 3IG3A 4ILJA 3Q8CA 3Q8FA 2Z14A 3W5VB 1Q10A 3SV1A 5TSSA 2P0HA 3FAHA 4B9KA 3NVWA 2JU6X 4A6HA 2QKMA 3PVLA 3ULCA 3F0WA 3R2TA 2GJYA 1PFJA 4HWIB 1TBEA 5CLQB 1WJ6A 3MC8A 2DAJA 1Y8RC 2WXLA 2FCSA 4HXDA 2MQJA 3HRDD 1ZVRA 1RFKA 3E66A 1PUTA 2DZKA 2RDGA 4LNKA 4E71A 4A90A 1HTOA 2W9NA 4TV3A 4GSWA 2ZVNA 2LOXA 4QJ5B 3ML8A 1TIFA 1SIJA 4ZRQA 4K7WA 1XLQA 2LG1A 3DBSA 2WXPA 4JK8A 2NMBA 3KZ1A 1BT0A 1DYQA 2HTME 3BYTB 2J0JA 3N1YC 3PGEA 3TMPB 2R0DA 2B3AA 5HI1A 2G4DB 1UBQA 3AE3B 3AXCA 2IYBA 1L0YB 2K5PA 4M01A 1WRDB 2AYOB 4XX5A 4MH8A 3DQVA 4X57B 1CMXB 3PS6A 3FM8C 2KK8A 4GNKB 1L6VA 3NHEB 4N58A 4G0NB 2BGFA 3P7ZA 1IPGA 4E3CA 4LCDE 4W9FA 3E9SA 4D6WA 4HK2A 4JK7A 4D2KA 5D3WA 4FHKA 1D5ZC 1GAQB 1EUVB 2KR0A 1OQRA 2W3RA 2LD9A 4HPLB 2MLBA 4G11A 3HSAA 4GZUA 4R3DA 4IM2A 4ICUA 2BS2B 2CQUA 2VSZA 3Q14C 1JWAD 3NS8A 2E2XA 1TKYA 2GMIC 3GB1A 3QX1A 2LWPA 4K1RB 3BIID 2MJEA 1FRRA 2HTHA 2KT7A 4L1BA 2R2YA 2JZ3B 4ZYSA 3NWAA 4K17A 4G3XB 1PGBA 3ZNGC 4F7UP 1R7SA 2MRPA 4HATB 4NSWA 4FA6A 2Y3AA 2RQ1A 5D3XA 3CWIA 2GBJA 3DHHC 1V6EA 2COAA 2QKLA 5J3QA 4BOSC 2D2QA 1WJNA 2NS5A 4BZAA 1XCQL 2XEWA 4IW0A 3L0WB 4ZRIA 3TW1A 3QARA 3VUXA 1WMHB 2JUOA 2ELAA 3HVDA 2WWZA 3EECA 1R4NI 2QIEB 3A9KA 4BAXA 1XT9B 3R8BA 2I1JA 5D2MB 5KQ4A 3ULBA 3VHTC 3G9WA 3NVVA 1VBHA 2Z0OA 3DXCA 1EWYC 2JWUA 3P1MA 3BK2A 3JSVB 2K6QA 3ZNHB 2N0SB 3TBLD 1LQBA 1M7RA 4GMXB 2L3ZA 2UWQA 1RWSA 1C9FA 3Q3MC 4OSNA 3PTFC 1QOAA 3VRBB 2ACZB 4OVUA 3N7CA 1MFWA 4YTMB 3N1ZC 3AECB 1IUEA 4B6HA 1TS4A 2WXQA 4CHMA 5C5BA 2ONQA 3ETRA 1OQYA 3TCAA 2DX5B 4PS8A 2PMVA 3HVZA 3MJWA 1K5DB 2Z59A 4GLSC 2Y5CA 4DHJB 3BVZA 2INNE 1T77A 3KSYA 1TY2A 2CU1A 1KOTA 1TXDA 2L7RA 1Z87A 3DVNV 2LI5A 4DXGA 2GBMA 1VLBA 2MJ3A 2DBYA 2INDC 2GOWA 5E6NA 4HCPB 4EFOA 1P6SA 1WM3A 3U4EG 3U30A 4YSZB 3TFMA 3AMZA 1QOBA 1DBHA 1VJKA 5FI0A 3ZVRA 4KZ0A 3ZXVA 5KQ1A 2RR9A 2DENB 2IDYA 2NBUA 1NI2A 2L76A 4Z2NA 3JVZX 3T06A 1C77A 4BKSA 1H4RA 2WXOA 3Q8BA 1RLFA 5IO9A 2KIGA 3E9LA 2FJLA 5C6RA 1VCBA 1XF5L 3GE3C 3MPXA 1GUAB 5J2RA 1WI1A 1EGXA 4IWOA 3I57A 2ZPYA 3Q69A 2LGYA 1DGJA 2KO3A 1Q0WB 4PYZA 4B0MA 4OVZA 2FNJB 4EKUA 1V49A 2MW5A 4WWMA 4LDTB 4DHZE 4KSLC 1V61A 1OMWA 4JPSA 2YS5A 4HB3B 3NOBA 1XCTL 4F7ZA 3AN1A 4M00A 1WJUA 3IAS1 1WJMA 3WYFB 2L1AA 2SAKA 2WXFA 4RGMA 5C1ZA 1XCGA 5HFYA 4NAWA 2KANA 1DDMA 1I4QA 4GU2A 5H8YE 4YTNB 3ZTDA 1A5RA 1KBLA 1UH6A 1JALA 2BYVE 1RFAA 4MK0A 2K3UA 4DX90 4XDCA 2DYBA 4MM3B 4YL8A 3FP5A 2CRFA 4KGSA 1NYRA 2R82A 1YMHE 2YT1A 3DCGA 1V5PA 1ZXHA 1BXTA 4BFRA 2N9PC 1HB8A 2LZ6A 1DOXA 4P6VF 1JWBD 1BWNA 5I4DA 1LO5D 4GMVA 1WM2A 3CIKA 4JKGB 1F0ZA 3RNFC 3OANA 1OFFA 1N61A 1H8CA 1WVHA 2MHJA 3AU4A 1V86A 4B95A 4NAMA 2ZVOA 4W9DA 4US8A 1EWCA 1JROA 3ZIMA 2GBRA 2NCNA 1KFYB 4ZYNA 2EMTA 2FUHB 1UGMA 2YT2A 1D5MC 1JWSD 3NVYA 2CHWA 3V6CB 4L1RA 2D3GA 1WR1A 4TKNA 3SFEB 2JF5A 3KYDD 1YX5B 1IGCA 4DQOC 3ZVVA 4EZJA 2AQ1B 2NTTA 4JX1C 1HZ5A 2LFIA 1N63A 1ZM0A 3NVZA 1JQ4A 2BKRB 2L2IA 4C7ZA 3NG0A 1G6JA 1L2NA 1NBFC 3DBLI 4A6FB 3LDZE 1TKGA 2C7NB 3PO0A 3D32A 3GS2A 1SJED 3I5JC 1UNPA 4LNOA 3RT3B 1SE3A 5KHQA 2L32A 3SO6A 2A4ZA 5HKHA 1KLGD 5DI9B 1HE8A 1WGDA 1E9MA 3ZQ4A 3UQAA 3PSEB 2IO2B 5CLLB 3IXSA 4LLGM 5AUIA 1J7AA 1D3ZA 4FN2A 1X1GA 3DVNU 1WGUA 1DDVA 2NPTB 2RSUA 4KSKC 4ZDVA 1D5XC 3JW0X 2J0KA 2W2WA 4AWJA 3P4RB 3IT4B 1OQQA 3AE1B 4KHOA 2K8BA 1FMAD 1OQNA 3BY4B 2LJ5A 2D3AA 1PYWD 2LYDA 1SGHA 1UF0A 4FXCA 2DHKA 3ZO5B 3RI7C 1XKEA 1I2HA 3A1QA 3AEGB 1VD2A 2HD5B 4MGYE 3AJ4A 1WGHA 2WDRB 4XC2A 2BVCA 1NYQA 1K53A 3VVWB 2UZSA 1J7BA 3KUDB 3AULA 2IY0B 2D9ZA 2J59M 3H1UA 1YJJA 1ENFA 3RNEC 3Q3JA 1Q67A 3WAMA 3OAWA 2L52A 3NSUA 2NVUI 3B9JA 4OHJA 4QAYA 4HRSA 4D0NB 2FIFA 4FBJB 3KY9A 2Y5PA 2VH1A 2KTFA 2D5GA 2LHDA 1PQSA 1WE7A 1I7HA 5BMHA 5DPSA 1QLBB 3HIEA 3RNCC 1WYGA 3ML4A 1RRPB 1RJ2A 2KC1A 2L83A 2CY4A 2G1EA 1MK7B 3W1SC 2RGFA 4HB2B 2VZKD 1FEHA 2CKHB 5FR6A 3AE6B 3PHXB 2KWCA 1ESFA 2DLBA 5JVLA 1T0RC 3PSCA 2OJRA 2Y7BA 2DX1A 2FE8A 5DHAB 1GG3A 4C4VA 2LVOA 2OEDA 1P0RA 4IM0A 3R7RA 3EFUA 3PZDA 1WR6E 4HAVB 2G3QB 2KX0A 3RD2A 2ZEQA 3MHZA 4HROA 1W1HA 1WZ3A 3RNBC 4IOYX 1SE4A 2KKCA 2KDFB 1F2RI 1WI0A 2P0FA 2YF0A 4JKFA 2CAYA 5DHFB 3QA8A 4QJ4B 3ZNZB 2KQSA 2V76A 3UIOB 3L08A 3KLSX 5MPOA 2KQ4X 1M94A 1T0QC 1CZPA 1F9JA 2D9WA 1ZE3D 1J0WA 4DXAB 5C3JB 1I4GA 2KWVB 3KYCD 2WXGA 2V3SA 1T5XD 2IYDB 4GB9A 3AV8A 1KZ7A 4F8CB 2LMCA 2N4FA 3N3KB 4GGQA 3AE7B 2PLPA 1FFVA 4IG7B 2P8VA 1AN8A 2J7QB 2WXMA 1WXAA 2QDFA 2Z0EB 3AE9B 3NWDA 4AS1A 5J3TA 1KTKA 1ZDXA 1Z5SB 1ZXIA 4HPPA 4G50A 2RUKB 1MI1A 4DDGD 1HTQA 2AL3A 2WHIA 1E90A 5JHAA 2O6VB 4EMOA 1P1AA 4RF0A 1QT9A 2MBOA 2KDMA 4KDLB 3T3NA 3NS1A 2PPHA 1IGDA 2DKPA 2Z4DA 1ET9A 4RM8A 2KOXA 2RDBC 2EELA 2G4SA 1WX9A 2JZZA 4J6IA 2CJNA 1EU4A 2SEBD 2JY6A 1S3SG 2WNMA 5D3DA 5CHFA 3FILB 3C8YA 4PS7A 2GCLA 2NBVA 3DBRB 5L95C 1F1HA 2HJ1A 2VH2A 4B6WA 3E9OA 4K2PA 2KWUB 1WJ1A 1BUIC 2Q5WD 2EC1A 4KIKA 3A98B 2W3SA 1I42A 4JWSC 4KDIC
chains in the Genus database with same CATH topology
4HVBA 5EDSA 3PVUA 1RRBA 5CHVC 2K2JA 5DPRA 4A3OA 2M8SA 3VTWA 4GXBA 2KCJA 3F5RA 2L00B 3KUZA 4ZRJA 2KGXB 2M17A 4AOFA 1MK9B 1H10A 1NTVA 3RZFA 1U27A 1UELA 5C23A 4MELA 2AEHA 1X86A 2GBNA 2W2XD 2AWTA 2HTHB 2LXAA 3MDBC 1JRUA 1WGYA 2DKQA 3EC8A 3U8ZA 2DLWA 3QWZB 1P9DU 1S1QB 4DBBA 3PREA 1E7UA 3QBVB 2DAFA 2ZPNA 2JT4B 2CS4A 3V62A 2Y8GA 4F1SA 2C9WB 2LXCA 2DHZA 1P98A 1I35A 3HQCA 1YIWA 5LXIB 4I6LB 4AP4C 4NNJB 1KC7A 1U4AA 5IAAC 4GDLB 3A9KB 1MPHA 1HB6A 1V80A 2KD0A 2CR5A 2AL6A 1AWEA 2WX1A 2VRWB 2I5FA 2ROVA 2UZRA 3WANA 1E8WA 3ZRFA 4OVVA 1AARA 5C5BB 1YD8U 2LBBA 2D11A 2N1WA 1AQCA 1WJ4A 1TZ1A 4K7SA 2DYQA 4WAAA 2C7MB 2BYFA 2Z59B 5HE0A 3H7PA 5JHHA 4FULA 1YQBA 4NPNA 1TGZB 4KAXB 4KV2A 3RCZA 1KM7A 4IWPA 1P3QU 4WSFA 3V6EB 2Y5BB 2M38A 3MHSD 5EFXA 4Z2MB 4Y94A 4KZCA 3V5WA 1WE6A 3ZDTA 3DVGX 4K2OA 2WDTB 4ANUA 2O2VB 1WH3A 4AJWA 3QK0A 2HRJA 3ZW3A 2LOZA 4RM9A 2D10A 4GOCA 4FADA 4KHBB 2DN6A 2VKIA 4JKCA 4W9CA 4NAWB 5CHWA 3PRZA 3QIJA 1ZGUB 1LM8B 2KNBA 2EKEC 1SE9A 2PJHA 4GDKA 2CODA 4URKA 2I1KA 2HE7A 3L17A 2K8HA 4BVUC 3HK0A 1ISNA 4BBKA 2D9VA 4GPTB 3JYUA 3HM3A 3SD5A 1WFYA 3HIZA 4A3PA 4HAYB 3VH4B 2K25A 4BKGA 4NQLB 3QC8B 2KMAA 1V5TA 1ST7A 2EMSA 2BYEA 3L13A 1C3TA 2YS3A 2ZZPB 3IFWB 3H7SA 4JL9A 5DIFB 4K81A 4DBGA 2Z0DB 3B0AA 1LFDA 3VAWA 2XK5A 1FHWA 1U29A 2YT0A 2DX5A 2DZJA 5J18A 4JQWC 4DDID 2J0MA 3VFKA 2N0YA 1UZXB 5D3YA 2ZJDA 1E8XA 2LRUA 2COPA 1PMSA 1L7YA 3S2AA 4LJOB 2BWFA 1U5GA 5D7GA 4KVGB 3APDA 4W9EA 4NJ7A 3KVFB 3KH0A 4MY6A 1TJ6A 1ACAA 4ANXA 2KFKA 4EZKA 5L83A 2OOBB 2ABDA 5JHBA 3A9JA 1V89A 1U2BA 3P2BA 2DYMA 4XWXA 2N7DA 4DK5A 4HPMB 4MSQB 2UYZB 2L0FA 2M14A 4TUUA 2K00A 1P5TA 1ZW7A 1GC6A 1E5WA 5JZEB 5E6PA 3RYTA 1MAIA 4TYZA 3BJIA 4HLEA 2DTCA 4ILGB 2KC2A 2JRIB 2BF8B 4WJPA 1XD3B 1XD4A 3ENBA 3L54A 3IVFA 1EF1A 4NQKE 2FCMA 1X1MA 1V88A 4DWFA 2M1MA 2LASA 3PLVA 4W9LA 3PRPB 4EJNA 2RVBB 4LJPB 4HAXB 4HB4B 2DZMA 5IA7A 1FXTB 3PEGA 1M7EA 3QCAA 2Z0PA 1C1YB 4MJSB 1QQGA 1V81A 4WJ7A 2C60A 2MX2A 3VOQA 4W9KA 5JH5C 3T8MA 2V4LA 2MFQA 5D27A 2ELBA 1MIZB 1XX0A 1J19A 3PVWA 1DIKA 4ICVA 2CB8A 3SBGA 3FLVA 4MGKE 3B08A 2DFKA 1Q5WB 1KLVA 1OEYJ 2A5UA 2WH5A 4FHJA 4A6KA 4IC7B 3UGBB 3GOEA 2G35A 1WGGA 1WXSA 3CSFA 3DBRI 1EVHA 2KTRA 2IZVB 3ZRCA 2N23A 1BAKA 1IP9A 5D3VA 3WIMA 3VUYA 3SBTA 1UPRA 4IFSA 2N1VA 3IHPC 4PYUA 1ZSQA 2LUEA 4JIOU 2GCJA 1V5UA 3GZNI 3UIPB 1UEFA 4PNKA 3QHTA 3ONSA 2YVCA 1X05A 3FSSA 3DVGY 3VUWA 1Z2MA 3DXEA 3ZLZA 4E74A 2KJHB 5J3YA 1U5FA 4HDQA 3GYOA 3ZTCA 2L05A 4JKDA 2DHJA 4MEMA 3K9PB 5CTRC 4WJOA 1V5MA 3OJ4B 2PEAA 4PS3A 3M62B 3ODXA 4DHJD 3E9PA 2Z0QA 3NZUA 1GGOA 2GS0A 2I5CA 3EPYA 1B55A 4TQ1A 1YJ1A 2IFSA 3UQBA 2K2UA 2LGXA 2KDEB 1LXDA 2C7HA 2JRHA 1X1FA 5KHOA 3CXBB 2MBBB 1TTNA 2KXJA 3A4SC 2MSED 2KHWB 4WVFB 3PP2A 4WWPA 3D8DA 1BTKA 3APFA 3UINB 1UNRA 2LVQA 3LJUX 2CHXA 2QHOA 4ANVA 3L10B 1FGZA 2PZ1A 4LDTD 2RGNB 2KN5A 4DHZB 2ZNVB 1K8RB 2KFJA 4W9HA 3CMMB 2LVPA 4HAWB 4I6PA 4MGZE 1ZKHA 5GOWB 2JP2A 1PLSA 1NTIA 2MWSB 1MIXA 1XQQA 3NY5A 3RUIB 1KZGA 4WWOA 5JHGA 4M8NA 3OLMD 2MWNB 1OEYA 1JDEA 3PRMB 3RZWC 4JKBA 2MBQA 2ASQA 2DIKA 3I3TB 3CF6E 3TIXA 3A33B 1UBIA 2PE6B 2UVMA 1W1DA 2PE9A 2MBEA 3ENEA 1NTYA 2MP2A 4W9IA 2K6DB 3SNHA 3O96A 2FAZA 1WIAA 2KJRA 2O6VA 3EHVA 5LONB 1V2YA 2R2QA 3KW5B 3ZDMC 2KDBA 1WX7A 3TJPA 2XQNM 2OTXA 2KLCA 3ECIA 4JKHA 3H7PB 1OGWA 4JLCA 3M95A 4K7UA 1IRSA 3Q3FA 4FJVB 4M0WB 1UNQA 2XBBC 2ZCCA 2FCQA 3FEHA 4IWQA 4EOYA 1SIFA 5AZHA 3PV1A 3TVVA 1U5EA 1DROA 5AZGA 2KLGA 4N9F4 2ADZA 1HBKA 2WYQA 3TL5A 3QJZA 1N3HA 2K8CA 3D8EA 4FLHA 1DYNA 2KZRA 5AEKB 4CHJA 3DXDA 2YLMA 5IJMA 3P6AA 2DYNA 2BPSA 3R66C 4HDOA 1J8CA 2KX3A 4MGIE 2JWZA 3LJ3A 2K1FA 2NBWB 4F7HA 5LOPB 3ALBA 3ML9A 2IO0B 4GN1A 1FOEA 3SUZA 4GDKB 4ASWC 1LW3A 2MA9B 4JKAA 1LB1A 2FCNA 1RAXA 2N9EB 2FJ9A 5FI1A 4GDLA 3H6NA 5C79A 2COFA 4WJNA 1W1GA 4HB0B 4W9GA 1UD7A 2LKOA 2DHIA 5HE1A 5KCVA 4ANWA 4MDKE 2L8JA 1EF5A 4PQ0A 3HHMA 1UPQA 2KDIA 4P7IA 2XK5B 4BBNF 2HJ8A 1OTRB 4IUMB 1Q1OA 4A5KA 2D4QA 3N30A 1EO6A 2N7EA 3W1YA 3ZKJC 3K9OB 2ZNVC 5GMVA 2D9XA 1WMHA 2ZCBA 2LRWA 4HAZB 2D07B 4WWNA 1WF9A 3JSVA 2KFKB 5G2NA 3A4RA 1KJTA 5LLIA 4BBNC 3BINA 1WYWB 4FJYA 2JVCA 1WX8A 2RNRB 3NZSA 3A9JB 3SHQA 5DCNA 2X0SA 3M3JA 1GJZA 2ROZB 5DPTA 3UF8A 2O2VA 2JPHA 4BOZB 3MTNB 2VRRB 2RSGA 2JXXA 1NDDA 3TO1A 1BTNA 4CYEA 1E8ZA 5J17A 4GIVA 2O6VD 3DDCB 2CHZA 1P3RA 4H8SA 4HJKA 1FHXA 1QC6A 3IBEA 3VTVA 5TR5A 3VXWA 3SU8X 2FDQA 2DA0A 1WY8A 3VH3B 2RLOA 4HAUB 2LGDA 3PLUA 3ZUNA 2IO3B 2FIDA 4II2B 1EAZA 2RPQA 5L81A 3W1SA 5G55A 3ODWA 3A8QA 5BO4B 3HW2B 3L16A 4C0AA 1MKEA 4AJYB 3A1QB 3H9DA 2COCA 3VTUA 2M0XA 3D8FA 4YONA 4NY0A 1FAOA 1Y5OA 4IM3A 4TQ0A 5LXHA 2IY1B 4FJZA 1E7VA 1KI1B 4CO7A 3WA0A 1TQZA 2BKFA 5CX3A 1WG7A 2R09A 3R7QA 5E6OA 3DPDA 4JK9A 4MM3A 3ZNID 3M1IB 3RCPA 2NR2A 1J0GA 3RULA 2KTRB 1V5OA 1Y19B 1ZC3B 4IAPA 1E8YA 4JGHB 4BKTA 3QQ8B 1SHCA 4JKEA 2L0TA 5AZFA 2G45B 2KQ7A 4II3B 5DPWA 3HM6X 4JKGA 2EJ8A 2KVRA 4EZLA 4F7GA 2DYOA 1FGYA 3APCA 4A20A 2IO1B 1VBGA 2P0DA 4L6EA 1K5GB 2M4NA 2LULA 1U5DA 1MG8A 3QAQA 3AI5A 1NU2A 1NVLA 4EUTA 4M8MA 2BCJA 1FHOA 3C0RB 3WAOA 3CSTA 5D94A 2MCNB 1R4MI 4A6FA 4CHKA 2IBIB 3KRXA 3WALA 3M63B 2V1YA 2D9YA 2WX0A 2RD0A 3KRWA 2Q13A 1WXMA 3KUCB 1WZ0A 2NPTA 3VDZA 2GBKA 2KMCA 3ODOA 5JLJB 1OY2A 4MJSA 5DH9B 3GYPA 5HE2A 3T9LA 2YSZA 3WAPA 2KUPA 4BKSD 2Y8FA 4ZRKA 2MKRA 3AU5A 3SDLC 2H7DA 3VQIA 2MDXA 3N32A 5C16A 3PHWB 1T0YA 1ZC4B 3DOWA 3X0WA 1V9JA 1GNUA 2L1CA 4WJQA 1XR0B 4KHAA 2DZIA 2OQBA 2NBVB 3SYXA 1GC7A 3PPAA 3UZTA 3PT2B 3U7DA 1FB8A 5JP4A 2H7EA 4KIKB 4AUQC 3QWMA 5HE3A 4WQOB 3A8PA 4XZ4A 1YX6B 1WGQA 4EEWA 4ILHA 2KJ6A 3R3MA 3X23A 5D6JB 4MSMB 3DBHI 3B1LX 4RMAA 2YRYA 3O65B 3PG7A 2C5LC 4MH0E 1XODA 2K39A 4W9JA 1WXVA 2N9XA 3VIAA 2REXA 2BWES 1DDWA 2MP2B 4MT7A 2W2XC 2X18A 2NZ8B 1IYFA 2MBHA 3OJ3A 2CY5A 4I6NB 4HHVA 3V60A 2YS1A 1X11A 1I7AA 4HCNB 2R2OA 3V61A 4NJ6A 1QZEA 1WGRA 4DX8A 3IG3A 4ILJA 3SV1A 2P0HA 4B9KA 4A6HA 2QKMA 3PVLA 3ULCA 3F0WA 2GJYA 1PFJA 4HWIB 1TBEA 5CLQB 1WJ6A 2DAJA 1Y8RC 2FCSA 4HXDA 2MQJA 1ZVRA 3E66A 2DZKA 4E71A 2W9NA 4TV3A 4GSWA 2ZVNA 2LOXA 3ML8A 4K7WA 2LG1A 3DBSA 4JK8A 2NMBA 3KZ1A 1BT0A 2J0JA 3PGEA 3TMPB 2R0DA 2B3AA 2G4DB 1UBQA 3AXCA 2IYBA 1WRDB 2AYOB 4XX5A 3DQVA 4X57B 1CMXB 3PS6A 3FM8C 2KK8A 3NHEB 4G0NB 2BGFA 3P7ZA 1IPGA 4E3CA 4LCDE 4W9FA 4HK2A 4JK7A 5D3WA 4FHKA 1EUVB 2LD9A 4HPLB 2MLBA 4G11A 4GZUA 4IM2A 4ICUA 2CQUA 2VSZA 3NS8A 2E2XA 2GMIC 3QX1A 2LWPA 4K1RB 2HTHA 2JZ3B 4K17A 4G3XB 3ZNGC 4F7UP 2MRPA 4HATB 4NSWA 4FA6A 2RQ1A 5D3XA 2GBJA 1V6EA 2COAA 2QKLA 5J3QA 4BOSC 2D2QA 1WJNA 2NS5A 2XEWA 4IW0A 3L0WB 4ZRIA 3TW1A 3QARA 3VUXA 1WMHB 2JUOA 2ELAA 2WWZA 3EECA 1R4NI 3A9KA 1XT9B 2I1JA 5D2MB 5KQ4A 3ULBA 3VHTC 3G9WA 1VBHA 2Z0OA 3DXCA 3ZNHB 3JSVB 2K6QA 3TBLD 1LQBA 1M7RA 4GMXB 2L3ZA 2UWQA 3PTFC 4OVUA 3N7CA 4B6HA 4CHMA 5C5BA 1OQYA 3TCAA 2DX5B 4PS8A 3MJWA 1K5DB 4DHJB 3KSYA 2CU1A 1KOTA 1TXDA 2L7RA 1Z87A 3DVNV 2LI5A 2GBMA 2GOWA 5E6NA 4HCPB 4EFOA 1P6SA 1WM3A 3U30A 3TFMA 1DBHA 5FI0A 3ZVRA 4KZ0A 5KQ1A 2RR9A 2DENB 2NBUA 1NI2A 2L76A 4Z2NA 3JVZX 3T06A 4BKSA 1H4RA 1RLFA 3E9LA 2FJLA 5C6RA 1VCBA 3MPXA 1GUAB 5J2RA 1WI1A 1EGXA 4IWOA 2ZPYA 2LGYA 2KO3A 1Q0WB 4PYZA 2FNJB 4EKUA 1V49A 2MW5A 4LDTB 4DHZE 4KSLC 1V61A 1OMWA 2YS5A 4HB3B 3NOBA 4F7ZA 1WJUA 1WJMA 3WYFB 5C1ZA 1XCGA 4NAWA 2KANA 1DDMA 4GU2A 3ZTDA 1A5RA 1KBLA 1UH6A 2BYVE 1RFAA 4MK0A 4DX90 2DYBA 4YL8A 3FP5A 2CRFA 2R82A 2YT1A 3DCGA 1V5PA 4BFRA 2N9PC 1HB8A 2LZ6A 1BWNA 4GMVA 1WM2A 3CIKA 4JKGB 3OANA 1H8CA 1WVHA 3AU4A 1V86A 4B95A 2ZVOA 4W9DA 3ZIMA 2GBRA 2NCNA 4ZYNA 2EMTA 2FUHB 1UGMA 2CHWA 3V6CB 2D3GA 1WR1A 4TKNA 2JF5A 3KYDD 1YX5B 3ZVVA 4EZJA 1ZM0A 2BKRB 2L2IA 1G6JA 1L2NA 1NBFC 3DBLI 4A6FB 3LDZE 2C7NB 3D32A 1UNPA 3RT3B 5KHQA 3SO6A 2A4ZA 5HKHA 5DI9B 1HE8A 1WGDA 3UQAA 3PSEB 2IO2B 5CLLB 1D3ZA 4FN2A 1X1GA 3DVNU 1WGUA 1DDVA 2NPTB 2RSUA 4KSKC 4ZDVA 3JW0X 2J0KA 2W2WA 4AWJA 4KHOA 2K8BA 1OQNA 3BY4B 2LJ5A 2LYDA 1SGHA 2DHKA 3ZO5B 1XKEA 1I2HA 3A1QA 1VD2A 2HD5B 4MGYE 3AJ4A 1WGHA 4XC2A 3VVWB 2UZSA 3KUDB 3AULA 2IY0B 2D9ZA 2J59M 3H1UA 3Q3JA 1Q67A 3WAMA 3OAWA 3NSUA 2NVUI 4D0NB 2FIFA 4FBJB 3KY9A 2KTFA 1PQSA 1WE7A 5DPSA 3ML4A 1RRPB 1RJ2A 2KC1A 2CY4A 1MK7B 3W1SC 2RGFA 4HB2B 2CKHB 5FR6A 3PHXB 2KWCA 5JVLA 3PSCA 2OJRA 2Y7BA 2DX1A 5DHAB 1GG3A 2LVOA 4IM0A 1P0RA 3R7RA 3EFUA 3PZDA 1WR6E 4HAVB 2G3QB 2KX0A 3RD2A 2ZEQA 1W1HA 1WZ3A 4IOYX 2KKCA 2KDFB 1WI0A 2P0FA 2YF0A 4JKFA 2CAYA 5DHFB 3QA8A 3ZNZB 2KQSA 2V76A 3UIOB 3L08A 1M94A 1F9JA 2D9WA 1J0WA 4DXAB 3KYCD 2KWVB 2V3SA 2IYDB 4GB9A 1KZ7A 4F8CB 2N4FA 3N3KB 4GGQA 4IG7B 2P8VA 2J7QB 1WXAA 2Z0EB 5J3TA 1Z5SB 4G50A 2RUKB 4DDGD 2AL3A 1E90A 5JHAA 2O6VB 4EMOA 1P1AA 2MBOA 4KDLB 2PPHA 2DKPA 4RM8A 2KOXA 2G4SA 1WX9A 2JZZA 4J6IA 2JY6A 1S3SG 5CHFA 4PS7A 2GCLA 5L95C 4B6WA 3E9OA 4K2PA 2KWUB 1WJ1A 2EC1A 4KIKA 3A98B 1I42A 4KDIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVB A;  5EDS A;  3PVU A;  1RRB A;  5CHV C;  2K2J A;  5DPR A;  4A3O A;  2M8S A;  3VTW A;  3F5R A;  2KCJ A;  4GXB A;  2L00 B;  3KUZ A;  4ZRJ A;  2KGX B;  2M17 A;  4AOF A;  1MK9 B;  1H10 A;  1NTV A;  3RZF A;  1U27 A;  1UEL A;  5C23 A;  4MEL A;  2AEH A;  1X86 A;  2GBN A;  2W2X D;  2AWT A;  2HTH B;  2LXA A;  3MDB C;  1JRU A;  1WGY A;  2DKQ A;  3EC8 A;  3U8Z A;  2DLW A;  3QWZ B;  1P9D U;  1S1Q B;  4DBB A;  3PRE A;  1E7U A;  3QBV B;  2DAF A;  2ZPN A;  2JT4 B;  2CS4 A;  3V62 A;  2Y8G A;  4F1S A;  2C9W B;  2LXC A;  2DHZ A;  1P98 A;  1I35 A;  3HQC A;  1YIW A;  5LXI B;  4I6L B;  4AP4 C;  4NNJ B;  1U4A A;  5IAA C;  4GDL B;  3A9K B;  1MPH A;  1HB6 A;  1V80 A;  2KD0 A;  2CR5 A;  2AL6 A;  1AWE A;  2WX1 A;  2VRW B;  2I5F A;  2ROV A;  2UZR A;  3WAN A;  1E8W A;  3ZRF A;  4OVV A;  1AAR A;  5C5B B;  1YD8 U;  2LBB A;  2D11 A;  2N1W A;  1AQC A;  1WJ4 A;  1TZ1 A;  4K7S A;  2DYQ A;  4WAA A;  2C7M B;  2BYF A;  2Z59 B;  5HE0 A;  3H7P A;  5JHH A;  4FUL A;  1YQB A;  4NPN A;  1TGZ B;  4KAX B;  4KV2 A;  3RCZ A;  1KM7 A;  4IWP A;  1P3Q U;  4WSF A;  3V6E B;  2Y5B B;  2M38 A;  3MHS D;  5EFX A;  4Z2M B;  4Y94 A;  4KZC A;  3V5W A;  1WE6 A;  3ZDT A;  3DVG X;  4K2O A;  2WDT B;  4ANU A;  2O2V B;  1WH3 A;  4AJW A;  3QK0 A;  2HRJ A;  3ZW3 A;  2LOZ A;  4RM9 A;  2D10 A;  4GOC A;  4FAD A;  4KHB B;  2DN6 A;  2VKI A;  4W9C A;  4NAW B;  5CHW A;  3PRZ A;  3QIJ A;  1ZGU B;  1LM8 B;  2KNB A;  2EKE C;  1SE9 A;  2PJH A;  4GDK A;  2COD A;  4URK A;  2I1K A;  2HE7 A;  3L17 A;  2K8H A;  4BVU C;  3HK0 A;  1ISN A;  4BBK A;  2D9V A;  4GPT B;  3JYU A;  3HM3 A;  3SD5 A;  1WFY A;  3HIZ A;  4A3P A;  4HAY B;  3VH4 B;  2K25 A;  4BKG A;  4NQL B;  3QC8 B;  2KMA A;  1V5T A;  1ST7 A;  2EMS A;  2BYE A;  3L13 A;  1C3T A;  2YS3 A;  2ZZP B;  3IFW B;  3H7S A;  4JL9 A;  5DIF B;  4K81 A;  4DBG A;  2Z0D B;  3B0A A;  1LFD A;  3VAW A;  2XK5 A;  1FHW A;  1U29 A;  2YT0 A;  2DX5 A;  2DZJ A;  5J18 A;  4JQW C;  4DDI D;  2J0M A;  3VFK A;  2N0Y A;  1UZX B;  5D3Y A;  2ZJD A;  1E8X A;  2LRU A;  2COP A;  1PMS A;  1L7Y A;  3S2A A;  4LJO B;  2BWF A;  1U5G A;  5D7G A;  4KVG B;  3APD A;  4W9E A;  4NJ7 A;  3KVF B;  3KH0 A;  4MY6 A;  1TJ6 A;  1ACA A;  4ANX A;  2KFK A;  4EZK A;  5L83 A;  2OOB B;  2ABD A;  5JHB A;  3A9J A;  1V89 A;  1U2B A;  3P2B A;  2DYM A;  4XWX A;  2N7D A;  4DK5 A;  4HPM B;  4MSQ B;  2UYZ B;  2L0F A;  2M14 A;  4TUU A;  2K00 A;  1P5T A;  1ZW7 A;  1GC6 A;  1E5W A;  5JZE B;  5E6P A;  3RYT A;  1MAI A;  4TYZ A;  3BJI A;  4HLE A;  2DTC A;  2KC2 A;  2JRI B;  2BF8 B;  4WJP A;  1XD3 B;  1XD4 A;  3L54 A;  3IVF A;  1EF1 A;  4NQK E;  2FCM A;  1X1M A;  1V88 A;  4DWF A;  2M1M A;  2LAS A;  3PLV A;  4W9L A;  3PRP B;  4EJN A;  2RVB B;  4LJP B;  4HAX B;  4HB4 B;  2DZM A;  5IA7 A;  1FXT B;  3PEG A;  1M7E A;  3QCA A;  2Z0P A;  1C1Y B;  4MJS B;  1QQG A;  1V81 A;  4WJ7 A;  2C60 A;  2MX2 A;  3VOQ A;  4W9K A;  5JH5 C;  3T8M A;  2V4L A;  2MFQ A;  5D27 A;  2ELB A;  1MIZ B;  1XX0 A;  1J19 A;  3PVW A;  4ICV A;  2CB8 A;  3FLV A;  4MGK E;  3B08 A;  2DFK A;  1Q5W B;  1KLV A;  1OEY J;  2A5U A;  2WH5 A;  4FHJ A;  4A6K A;  4IC7 B;  3UGB B;  3GOE A;  2G35 A;  1WGG A;  1WXS A;  3CSF A;  3DBR I;  1EVH A;  2KTR A;  2IZV B;  3ZRC A;  2N23 A;  1BAK A;  1IP9 A;  5D3V A;  3WIM A;  3VUY A;  1UPR A;  4IFS A;  2N1V A;  3IHP C;  4PYU A;  1ZSQ A;  2LUE A;  4JIO U;  2GCJ A;  1V5U A;  3GZN I;  3UIP B;  1UEF A;  4PNK A;  3QHT A;  3ONS A;  2YVC A;  1X05 A;  3FSS A;  3DVG Y;  3VUW A;  1Z2M A;  3DXE A;  3ZLZ A;  4E74 A;  2KJH B;  5J3Y A;  1U5F A;  4HDQ A;  3GYO A;  3ZTC A;  2L05 A;  2DHJ A;  4MEM A;  3K9P B;  5CTR C;  4WJO A;  1V5M A;  3OJ4 B;  2PEA A;  4PS3 A;  3M62 B;  3ODX A;  4DHJ D;  2Z0Q A;  3NZU A;  2GS0 A;  2I5C A;  3EPY A;  1B55 A;  4TQ1 A;  1YJ1 A;  2IFS A;  3UQB A;  2K2U A;  2LGX A;  2KDE B;  1LXD A;  2C7H A;  2JRH A;  1X1F A;  5KHO A;  3CXB B;  2MBB B;  1TTN A;  2KXJ A;  3A4S C;  2MSE D;  2KHW B;  4WVF B;  3PP2 A;  4WWP A;  3D8D A;  1BTK A;  3APF A;  3UIN B;  1UNR A;  2LVQ A;  3LJU X;  2CHX A;  2QHO A;  4ANV A;  3L10 B;  1FGZ A;  2PZ1 A;  4LDT D;  2RGN B;  2KN5 A;  4DHZ B;  2ZNV B;  1K8R B;  2KFJ A;  4W9H A;  3CMM B;  2LVP A;  4HAW B;  4I6P A;  4MGZ E;  1ZKH A;  5GOW B;  2JP2 A;  1PLS A;  1NTI A;  2MWS B;  1MIX A;  1XQQ A;  3NY5 A;  3RUI B;  1KZG A;  4WWO A;  5JHG A;  4M8N A;  3OLM D;  2MWN B;  1OEY A;  3PRM B;  3RZW C;  2MBQ A;  2ASQ A;  3I3T B;  3CF6 E;  3TIX A;  3A33 B;  1UBI A;  2PE6 B;  2UVM A;  1W1D A;  2PE9 A;  2MBE A;  3ENE A;  1NTY A;  2MP2 A;  4W9I A;  2K6D B;  3SNH A;  3O96 A;  2FAZ A;  1WIA A;  2KJR A;  2O6V A;  3EHV A;  5LON B;  1V2Y A;  2R2Q A;  3KW5 B;  3ZDM C;  2KDB A;  1WX7 A;  3TJP A;  2XQN M;  2OTX A;  2KLC A;  3ECI A;  3H7P B;  1OGW A;  4JLC A;  3M95 A;  4K7U A;  1IRS A;  3Q3F A;  4FJV B;  4M0W B;  1UNQ A;  2XBB C;  2ZCC A;  2FCQ A;  3FEH A;  4IWQ A;  4EOY A;  1SIF A;  5AZH A;  3PV1 A;  3TVV A;  1U5E A;  1DRO A;  5AZG A;  2KLG A;  4N9F 4;  2ADZ A;  1HBK A;  2WYQ A;  3TL5 A;  3QJZ A;  1N3H A;  2K8C A;  3D8E A;  4FLH A;  1DYN A;  2KZR A;  5AEK B;  4CHJ A;  3DXD A;  2YLM A;  5IJM A;  3P6A A;  2DYN A;  2BPS A;  3R66 C;  4HDO A;  1J8C A;  2KX3 A;  4MGI E;  2JWZ A;  3LJ3 A;  2K1F A;  2NBW B;  4F7H A;  5LOP B;  3ALB A;  3ML9 A;  2IO0 B;  4GN1 A;  1FOE A;  3SUZ A;  4GDK B;  4ASW C;  1LW3 A;  2MA9 B;  1LB1 A;  2FCN A;  1RAX A;  2N9E B;  2FJ9 A;  5FI1 A;  4GDL A;  3H6N A;  5C79 A;  2COF A;  4WJN A;  1W1G A;  4HB0 B;  4W9G A;  1UD7 A;  2LKO A;  2DHI A;  5HE1 A;  5KCV A;  4ANW A;  4MDK E;  2L8J A;  1EF5 A;  4PQ0 A;  3HHM A;  1UPQ A;  2KDI A;  4P7I A;  2XK5 B;  4BBN F;  2HJ8 A;  1OTR B;  4IUM B;  1Q1O A;  4A5K A;  2D4Q A;  3N30 A;  1EO6 A;  2N7E A;  3W1Y A;  3ZKJ C;  3K9O B;  2ZNV C;  5GMV A;  2D9X A;  1WMH A;  2ZCB A;  2LRW A;  4HAZ B;  2D07 B;  4WWN A;  1WF9 A;  3JSV A;  2KFK B;  5G2N A;  3A4R A;  1KJT A;  5LLI A;  4BBN C;  3BIN A;  1WYW B;  4FJY A;  2JVC A;  1WX8 A;  2RNR B;  3NZS A;  3A9J B;  3SHQ A;  5DCN A;  3M3J A;  1GJZ A;  2ROZ B;  5DPT A;  3UF8 A;  2O2V A;  2JPH A;  4BOZ B;  3MTN B;  2VRR B;  2RSG A;  2JXX A;  1NDD A;  3TO1 A;  1BTN A;  4CYE A;  1E8Z A;  5J17 A;  4GIV A;  2O6V D;  3DDC B;  2CHZ A;  1P3R A;  4H8S A;  4HJK A;  1FHX A;  1QC6 A;  3IBE A;  3VTV A;  5TR5 A;  3VXW A;  3SU8 X;  2FDQ A;  2DA0 A;  1WY8 A;  3VH3 B;  2RLO A;  4HAU B;  2LGD A;  3PLU A;  3ZUN A;  2IO3 B;  2FID A;  4II2 B;  1EAZ A;  2RPQ A;  5L81 A;  3W1S A;  5G55 A;  3ODW A;  3A8Q A;  5BO4 B;  3HW2 B;  3L16 A;  4C0A A;  1MKE A;  4AJY B;  3A1Q B;  3H9D A;  2COC A;  3VTU A;  2M0X A;  3D8F A;  4YON A;  4NY0 A;  1FAO A;  1Y5O A;  4IM3 A;  4TQ0 A;  5LXH A;  2IY1 B;  4FJZ A;  1E7V A;  1KI1 B;  4CO7 A;  3WA0 A;  1TQZ A;  2BKF A;  5CX3 A;  1WG7 A;  2R09 A;  3R7Q A;  5E6O A;  3DPD A;  4MM3 A;  3ZNI D;  3M1I B;  3RCP A;  2NR2 A;  1J0G A;  3RUL A;  2KTR B;  1V5O A;  1Y19 B;  1ZC3 B;  4IAP A;  1E8Y A;  4JGH B;  4BKT A;  3QQ8 B;  1SHC A;  2L0T A;  5AZF A;  2G45 B;  2KQ7 A;  4II3 B;  5DPW A;  3HM6 X;  2EJ8 A;  2KVR A;  4EZL A;  4F7G A;  2DYO A;  1FGY A;  3APC A;  4A20 A;  2IO1 B;  2P0D A;  4L6E A;  1K5G B;  2M4N A;  2LUL A;  1U5D A;  1MG8 A;  3QAQ A;  3AI5 A;  1NU2 A;  1NVL A;  4EUT A;  4M8M A;  2BCJ A;  1FHO A;  3C0R B;  3WAO A;  3CST A;  5D94 A;  2MCN B;  1R4M I;  4A6F A;  4CHK A;  2IBI B;  3KRX A;  3WAL A;  3M63 B;  2V1Y A;  2D9Y A;  2WX0 A;  2RD0 A;  3KRW A;  2Q13 A;  1WXM A;  3KUC B;  1WZ0 A;  2NPT A;  3VDZ A;  2GBK A;  2KMC A;  3ODO A;  5JLJ B;  1OY2 A;  4MJS A;  5DH9 B;  3GYP A;  5HE2 A;  3T9L A;  2YSZ A;  3WAP A;  2KUP A;  4BKS D;  2Y8F A;  4ZRK A;  2MKR A;  3AU5 A;  3SDL C;  2H7D A;  3VQI A;  2MDX A;  3N32 A;  5C16 A;  3PHW B;  1T0Y A;  1ZC4 B;  3DOW A;  3X0W A;  1V9J A;  1GNU A;  2L1C A;  4WJQ A;  1XR0 B;  4KHA A;  2DZI A;  2OQB A;  2NBV B;  3SYX A;  1GC7 A;  3PPA A;  3UZT A;  3PT2 B;  3U7D A;  1FB8 A;  5JP4 A;  2H7E A;  4KIK B;  4AUQ C;  3QWM A;  5HE3 A;  4WQO B;  3A8P A;  4XZ4 A;  1YX6 B;  1WGQ A;  4EEW A;  2KJ6 A;  3R3M A;  3X23 A;  5D6J B;  4MSM B;  3DBH I;  3B1L X;  4RMA A;  2YRY A;  3O65 B;  3PG7 A;  2C5L C;  4MH0 E;  1XOD A;  2K39 A;  4W9J A;  1WXV A;  2N9X A;  3VIA A;  2REX A;  2BWE S;  1DDW A;  2MP2 B;  4MT7 A;  2W2X C;  2X18 A;  2NZ8 B;  1IYF A;  2MBH A;  3OJ3 A;  2CY5 A;  4I6N B;  4HHV A;  3V60 A;  2YS1 A;  1X11 A;  1I7A A;  4HCN B;  2R2O A;  3V61 A;  4NJ6 A;  1QZE A;  1WGR A;  4DX8 A;  3IG3 A;  3SV1 A;  2P0H A;  4B9K A;  4A6H A;  2QKM A;  3PVL A;  3ULC A;  3F0W A;  2GJY A;  1PFJ A;  4HWI B;  1TBE A;  5CLQ B;  1WJ6 A;  2DAJ A;  1Y8R C;  2FCS A;  4HXD A;  2MQJ A;  1ZVR A;  2DZK A;  4E71 A;  2W9N A;  4TV3 A;  4GSW A;  2ZVN A;  2LOX A;  3ML8 A;  4K7W A;  2LG1 A;  3DBS A;  2NMB A;  3KZ1 A;  1BT0 A;  2J0J A;  3PGE A;  3TMP B;  2R0D A;  2B3A A;  2G4D B;  1UBQ A;  3AXC A;  2IYB A;  1WRD B;  2AYO B;  4XX5 A;  3DQV A;  4X57 B;  1CMX B;  3PS6 A;  3FM8 C;  2KK8 A;  3NHE B;  4G0N B;  2BGF A;  3P7Z A;  1IPG A;  4E3C A;  4LCD E;  4W9F A;  4HK2 A;  5D3W A;  4FHK A;  1EUV B;  2LD9 A;  4HPL B;  2MLB A;  4G11 A;  4GZU A;  4IM2 A;  4ICU A;  2CQU A;  2VSZ A;  3NS8 A;  2E2X A;  2GMI C;  3QX1 A;  2LWP A;  4K1R B;  2HTH A;  2JZ3 B;  4K17 A;  4G3X B;  3ZNG C;  4F7U P;  2MRP A;  4HAT B;  4NSW A;  4FA6 A;  2RQ1 A;  5D3X A;  2GBJ A;  1V6E A;  2COA A;  2QKL A;  5J3Q A;  4BOS C;  2D2Q A;  1WJN A;  2NS5 A;  2XEW A;  4IW0 A;  3L0W B;  4ZRI A;  3TW1 A;  3QAR A;  3VUX A;  1WMH B;  2JUO A;  2ELA A;  2WWZ A;  3EEC A;  1R4N I;  3A9K A;  1XT9 B;  2I1J A;  5D2M B;  5KQ4 A;  3ULB A;  3VHT C;  3G9W A;  2Z0O A;  3DXC A;  3ZNH B;  3JSV B;  2K6Q A;  3TBL D;  1LQB A;  1M7R A;  4GMX B;  2L3Z A;  2UWQ A;  3PTF C;  4OVU A;  3N7C A;  4B6H A;  4CHM A;  5C5B A;  1OQY A;  3TCA A;  2DX5 B;  4PS8 A;  3MJW A;  1K5D B;  4DHJ B;  3KSY A;  2CU1 A;  1KOT A;  1TXD A;  2L7R A;  1Z87 A;  3DVN V;  2LI5 A;  2GBM A;  2GOW A;  5E6N A;  4HCP B;  4EFO A;  1P6S A;  1WM3 A;  3U30 A;  3TFM A;  1DBH A;  5FI0 A;  3ZVR A;  4KZ0 A;  5KQ1 A;  2RR9 A;  2DEN B;  2NBU A;  1NI2 A;  2L76 A;  4Z2N A;  3JVZ X;  3T06 A;  4BKS A;  1H4R A;  1RLF A;  2FJL A;  5C6R A;  1VCB A;  3MPX A;  1GUA B;  5J2R A;  1WI1 A;  1EGX A;  4IWO A;  2ZPY A;  2LGY A;  2KO3 A;  1Q0W B;  4PYZ A;  2FNJ B;  4EKU A;  1V49 A;  2MW5 A;  4LDT B;  4DHZ E;  4KSL C;  1V61 A;  1OMW A;  2YS5 A;  4HB3 B;  3NOB A;  4F7Z A;  1WJU A;  1WJM A;  3WYF B;  5C1Z A;  1XCG A;  4NAW A;  2KAN A;  1DDM A;  4GU2 A;  3ZTD A;  1A5R A;  1UH6 A;  2BYV E;  1RFA A;  4MK0 A;  4DX9 0;  2DYB A;  4YL8 A;  3FP5 A;  2CRF A;  2YT1 A;  3DCG A;  1V5P A;  4BFR A;  2N9P C;  1HB8 A;  2LZ6 A;  1BWN A;  4GMV A;  1WM2 A;  3CIK A;  3OAN A;  1H8C A;  1WVH A;  3AU4 A;  1V86 A;  4B95 A;  2ZVO A;  4W9D A;  3ZIM A;  2GBR A;  2NCN A;  4ZYN A;  2EMT A;  2FUH B;  1UGM A;  2CHW A;  3V6C B;  2D3G A;  1WR1 A;  4TKN A;  2JF5 A;  3KYD D;  1YX5 B;  3ZVV A;  4EZJ A;  1ZM0 A;  2BKR B;  2L2I A;  1G6J A;  1L2N A;  1NBF C;  3DBL I;  4A6F B;  3LDZ E;  2C7N B;  3D32 A;  1UNP A;  3RT3 B;  5KHQ A;  3SO6 A;  2A4Z A;  5HKH A;  5DI9 B;  1HE8 A;  1WGD A;  3UQA A;  3PSE B;  2IO2 B;  5CLL B;  1D3Z A;  4FN2 A;  1X1G A;  3DVN U;  1WGU A;  1DDV A;  2NPT B;  2RSU A;  4KSK C;  4ZDV A;  3JW0 X;  2J0K A;  2W2W A;  4AWJ A;  4KHO A;  2K8B A;  1OQN A;  3BY4 B;  2LJ5 A;  2LYD A;  1SGH A;  2DHK A;  3ZO5 B;  1XKE A;  1I2H A;  3A1Q A;  1VD2 A;  2HD5 B;  4MGY E;  3AJ4 A;  1WGH A;  4XC2 A;  3VVW B;  2UZS A;  3KUD B;  3AUL A;  2IY0 B;  2D9Z A;  2J59 M;  3H1U A;  3Q3J A;  1Q67 A;  3WAM A;  3OAW A;  3NSU A;  2NVU I;  4D0N B;  2FIF A;  4FBJ B;  3KY9 A;  2KTF A;  1PQS A;  1WE7 A;  5DPS A;  3ML4 A;  1RRP B;  1RJ2 A;  2KC1 A;  2CY4 A;  1MK7 B;  3W1S C;  2RGF A;  4HB2 B;  2CKH B;  5FR6 A;  3PHX B;  2KWC A;  3PSC A;  2OJR A;  2Y7B A;  2DX1 A;  5DHA B;  1GG3 A;  2LVO A;  4IM0 A;  1P0R A;  3R7R A;  3EFU A;  3PZD A;  1WR6 E;  4HAV B;  2G3Q B;  2KX0 A;  3RD2 A;  2ZEQ A;  1W1H A;  1WZ3 A;  4IOY X;  2KKC A;  2KDF B;  1WI0 A;  2P0F A;  2YF0 A;  2CAY A;  5DHF B;  3QA8 A;  3ZNZ B;  2KQS A;  2V76 A;  3UIO B;  3L08 A;  1M94 A;  1F9J A;  2D9W A;  1J0W A;  4DXA B;  3KYC D;  2KWV B;  2V3S A;  2IYD B;  4GB9 A;  1KZ7 A;  4F8C B;  2N4F A;  3N3K B;  4GGQ A;  4IG7 B;  2P8V A;  2J7Q B;  1WXA A;  2Z0E B;  5J3T A;  1Z5S B;  4G50 A;  2RUK B;  4DDG D;  2AL3 A;  1E90 A;  5JHA A;  2O6V B;  4EMO A;  1P1A A;  2MBO A;  4KDL B;  2PPH A;  2DKP A;  4RM8 A;  2KOX A;  2G4S A;  1WX9 A;  2JZZ A;  4J6I A;  2JY6 A;  1S3S G;  5CHF A;  4PS7 A;  2GCL A;  5L95 C;  4B6W A;  4K2P A;  2KWU B;  1WJ1 A;  2EC1 A;  4KIK A;  3A98 B;  1I42 A;  4KDI C; 
#chains in the Genus database with same CATH topology
 2WDV B;  4HVB A;  5EDS A;  4GOU A;  3GZN B;  3PVU A;  1RRB A;  1MHH E;  2K2J A;  5CHV C;  5DPR A;  4A3O A;  3U12 A;  2M8S A;  5G5H A;  4GXB A;  2KCJ A;  3F5R A;  1JWU D;  2L00 B;  3VTW A;  3KUZ A;  4ZRJ A;  1L5P A;  2KGX B;  2M17 A;  4AOF A;  1MK9 B;  1WWT A;  4WQM A;  1H10 A;  4WAF A;  1NTV A;  2FJU B;  2PVO D;  1FO4 A;  3RZF A;  1U27 A;  1MVK A;  4XDD A;  3P63 A;  5BYQ A;  1HEZ E;  1UEL A;  4PK1 A;  5C23 A;  4MEL A;  2AEH A;  2IPK D;  1X86 A;  4HEA 1;  2GBN A;  2W2X D;  2AWT A;  3P4S B;  2HTH B;  5LG4 B;  3AH7 A;  1UWX A;  2LXA A;  4P16 A;  3AE5 B;  5GXG B;  3MDB C;  1JRU A;  2WDQ B;  1WGY A;  2DKQ A;  1JCK B;  3EC8 A;  3U8Z A;  2DLW A;  2PTL A;  1P9D U;  3QWZ B;  1S1Q B;  2NTS A;  3AE8 B;  1V1P A;  4DBB A;  3PRE A;  1E7U A;  3QBV B;  4WIP A;  2DAF A;  2ZPN A;  2JT4 B;  2CS4 A;  3V62 A;  1QOG A;  2TSS A;  2Y8G A;  4F1S A;  4LNI A;  2JX5 A;  2C9W B;  2LXC A;  3LXF A;  2DHZ A;  1P98 A;  1I35 A;  3HQC A;  2BS3 B;  1YIW A;  5LXI B;  3BVG A;  4I6L B;  2JYT A;  4AP4 C;  4NNJ B;  1KC7 A;  1U4A A;  5IAA C;  1TS2 A;  4GDL B;  3A9K B;  1RM6 C;  3NUH B;  1MPH A;  1HB6 A;  3DBH B;  1V80 A;  2KD0 A;  4HSI A;  2CR5 A;  2AL6 A;  3RMK C;  1AWE A;  3EGR A;  2WX1 A;  2VRW B;  2I5F A;  2ROV A;  2UZR A;  3WAN A;  1ZUD 2;  1E8W A;  3ZRF A;  4OVV A;  2M19 A;  1AAR A;  1NVI D;  1NI3 A;  5C5B B;  1YD8 U;  2LBB A;  2D11 A;  2N1W A;  1AQC A;  1WJ4 A;  1TZ1 A;  4K7S A;  2KUQ A;  2KAJ A;  2DYQ A;  4WAA A;  2C7M B;  2BYF A;  2Z59 B;  3URY A;  3A58 A;  5HE0 A;  3H7P A;  2GLS A;  5JHH A;  4FUL A;  3AB5 A;  1YQB A;  2LEK A;  4NPN A;  1TGZ B;  1HA5 A;  2AQ2 B;  3BVM A;  1QQR A;  3TEZ A;  4KAX B;  4DXF A;  4KV2 A;  3RCZ A;  1KM7 A;  4IWP A;  1VZ8 A;  4M0W A;  1P3Q U;  2GI9 A;  2AQ3 B;  4WSF A;  3V6E B;  4QJ3 B;  5JXV A;  1XLN A;  4A9A A;  1TT5 B;  2Y5B B;  3EA6 A;  2M38 A;  3MHS D;  5EFX A;  4Z2M B;  4Y94 A;  4O1N A;  4XE0 A;  4KZC A;  3V5W A;  2KWD A;  1VR9 A;  1WE6 A;  5HG2 A;  1SJH D;  3ZDT A;  3DVG X;  4K2O A;  2CJO A;  4JE3 B;  2WGS A;  1HZ6 A;  2WDT B;  1D6E C;  4RNA A;  1YQ4 B;  3IT6 B;  4ANU A;  1F77 A;  2O2V B;  1WH3 A;  4AJW A;  3QK0 A;  2HRJ A;  3ZW3 A;  2QJL A;  2LOZ A;  4RM9 A;  2KVZ A;  2D10 A;  4GOC A;  1FCC C;  4FAD A;  4KHB B;  2DN6 A;  2VKI A;  1KRH A;  4JKC A;  3NW8 A;  2K49 A;  4W9C A;  1ZYI A;  2N7J A;  4NAW B;  5CHW A;  3PRZ A;  1FXA A;  3MC0 B;  2KMM A;  3QIJ A;  1ZGU B;  3SR6 A;  2K22 A;  2M56 B;  1LM8 B;  2KNB A;  2EKE C;  2BQQ A;  2PKO A;  1SE9 A;  2PJH A;  1PDX A;  2COD A;  4GDK A;  2I1K A;  4URK A;  2HE7 A;  3L17 A;  2GRI A;  2K8H A;  4BVU C;  4KKI A;  3HK0 A;  1ISN A;  4BBK A;  1N62 A;  3LB8 C;  2XNA C;  2D9V A;  4GPT B;  1CK1 A;  3JYU A;  3HM3 A;  3Q3N C;  5IN7 A;  3SD5 A;  3T3O A;  2RRF A;  1WFY A;  3HIZ A;  4A3P A;  4HAY B;  3VH4 B;  2K25 A;  4BKG A;  4NQL B;  3QC8 B;  1SSN A;  2KMA A;  1V5T A;  4UDU C;  1ST7 A;  2EMS A;  2BYE A;  1WGK A;  3L13 A;  1C3T A;  2YS3 A;  3P42 A;  2ZZP B;  5FR3 A;  3IFW B;  3H7S A;  2BB6 A;  4JL9 A;  5DIF B;  4K81 A;  4DBG A;  1SE2 A;  2Z0D B;  4AQ7 A;  3B0A A;  1LFD A;  3VAW A;  3V05 A;  4USA A;  2XK5 A;  1FHW A;  1U29 A;  2YT0 A;  2DX5 A;  3RNA C;  2DZJ A;  4RCO A;  4JQW C;  5J18 A;  4DDI D;  2J0M A;  3VFK A;  2N0Y A;  2V3P A;  1UZX B;  5D3Y A;  2ZJD A;  1E8X A;  4ZHO A;  2LRU A;  2COP A;  2K8E A;  1PMS A;  3CIR B;  4PT5 A;  1L7Y A;  3S2A A;  3B2G A;  4LJO B;  2BWF A;  1U5G A;  1KLU D;  5D7G A;  4KVG B;  1T3Q A;  1VZ7 A;  2FUG 1;  3APD A;  4W9E A;  4NJ7 A;  3KVF B;  4Q2J A;  3KH0 A;  4MY6 A;  1TJ6 A;  1ACA A;  4ANX A;  2X38 A;  1C4A A;  4KGT A;  2KFK A;  4TMA B;  4EZK A;  5L83 A;  1FFU A;  2ABD A;  2OOB B;  5JHB A;  4XWW A;  3A9J A;  1VDV A;  1V89 A;  3KQ4 A;  1U2B A;  1QIL A;  4LNF A;  3NRZ A;  1WXQ A;  3P2B A;  2DYM A;  4IKG A;  4XWX A;  3NZ3 A;  2N7D A;  4DK5 A;  1QF6 A;  2WQY B;  4HPM B;  4MSQ B;  3FVC A;  2UYZ B;  1ET6 A;  2L0F A;  2M14 A;  1I4P A;  4TUU A;  3U2S C;  2K00 A;  5EE3 A;  1P5T A;  1ZW7 A;  1GC6 A;  2YEP F;  4RH6 A;  1L6U A;  2LGI A;  1FNV A;  2N9L A;  1LGR A;  1P7F A;  4HKQ A;  1E5W A;  5JZE B;  2K0P A;  5E6P A;  1MAI A;  3RYT A;  2V3N A;  3L4P A;  4YXD B;  1AYF A;  4TYZ A;  3Q8E A;  3BJI A;  1WSP A;  4HLE A;  2DTC A;  2WXJ A;  4ILG B;  2KC2 A;  2JRI B;  2BF8 B;  2J53 A;  4OZC A;  4WJP A;  1XD3 B;  1XD4 A;  2BW2 A;  3ENB A;  3B77 A;  2QIL A;  4B0E A;  3L54 A;  3IVF A;  3N1X C;  1EF1 A;  2JSV X;  2FBW B;  4NQK E;  2FCM A;  1X1M A;  1V88 A;  4DWF A;  2M1M A;  2LAS A;  3Q2A C;  2KAC A;  3MFG A;  3PLV A;  2H88 B;  4W9L A;  3PRP B;  4EJN A;  5BYS A;  2JZP A;  3Q8A A;  2RVB B;  4LJP B;  4HAX B;  4HB4 B;  3ABV B;  4MT5 A;  2DZM A;  5IA7 A;  1FXT B;  3PEG A;  1M7E A;  3QCA A;  2Z0P A;  1C1Y B;  4MJS B;  3LYY A;  1QQG A;  1V81 A;  4WJ7 A;  2DNF A;  1Y56 A;  2C60 A;  2MX2 A;  4A55 A;  3VOQ A;  4W9K A;  3U7Z A;  5JH5 C;  3T8M A;  4C80 A;  2V4L A;  2MFQ A;  2RPV A;  5D27 A;  2ELB A;  2K9X A;  3BYY B;  1MIZ B;  1XX0 A;  1VRA B;  1J19 A;  3PVW A;  1TY0 A;  1V1O A;  1ZDV A;  1DIK A;  4ICV A;  2CB8 A;  3SBG A;  3AED B;  3FLV A;  1UGJ A;  4MGK E;  3B08 A;  2DFK A;  1Q5W B;  1KLV A;  2IJ0 A;  1OEY J;  1D4B A;  3GP7 A;  5T8I A;  1RYJ A;  2WH5 A;  2A5U A;  4FHJ A;  1DOY A;  4A6K A;  4IC7 B;  3UGB B;  3MP9 A;  3GOE A;  2G35 A;  1WGG A;  1TZO A;  1GOZ A;  1WXS A;  1PGX A;  3CSF A;  3DBR I;  1I4H A;  2BYT A;  3TSS A;  4WUR A;  1SB3 C;  1EVH A;  2ZKM X;  3KWL A;  2KTR A;  2IZV B;  3ZRC A;  1CJE A;  2N23 A;  2WXI A;  1BAK A;  1IP9 A;  5D3V A;  1L0X B;  3WIM A;  3VUY A;  3SBT A;  1GB1 A;  3SFD B;  1KH0 A;  1UPR A;  4IFS A;  3PZ8 A;  2N1V A;  3IHP C;  4PYU A;  1ZSQ A;  2LUE A;  4JIO U;  2GCJ A;  4CQN A;  1V5U A;  3GZN I;  3AE2 B;  3UIP B;  3AEA B;  1UEF A;  4PNK A;  3QHT A;  3ONS A;  2YVC A;  1JRP A;  1X05 A;  3DHG C;  1F52 A;  3FSS A;  5G5G A;  3TEX A;  1IBX A;  3DVG Y;  1FCL A;  3VUW A;  3V3X A;  1Z2M A;  3DXE A;  1K50 A;  2OHF A;  2WXK A;  3ZLZ A;  4E74 A;  2KJH B;  2LUM A;  5J3Y A;  4L23 A;  1U5F A;  4ACF A;  4HDQ A;  5IRS A;  1T6B X;  1V8C A;  3GYO A;  1CQV A;  3ZTC A;  2WP9 B;  2L05 A;  2JYE A;  2BTE A;  4JKD A;  2DHJ A;  4MEM A;  3K9P B;  2W55 A;  5CTR C;  4WJO A;  3AM9 A;  2B76 B;  1V5M A;  3OJ4 B;  2QSD A;  2PEA A;  1I4X A;  4PS3 A;  3M62 B;  3ODX A;  4DHJ D;  3E9P A;  2Z0Q A;  4OW0 A;  3NZU A;  1GGO A;  2GS0 A;  2I5C A;  3EPY A;  1B55 A;  4TQ1 A;  1YJ1 A;  2IFS A;  1E6E B;  3UQB A;  1E10 A;  2K2U A;  2J42 A;  2LGX A;  3TEW A;  5I2S A;  2W82 A;  2KDE B;  1LXD A;  1K51 A;  2C7H A;  2JRH A;  1X1F A;  1KF6 B;  5KHO A;  3CXB B;  2MBB B;  1TTN A;  2KXJ A;  1K52 A;  3A4S C;  2MSE D;  2KHW B;  1YN4 A;  2ICI A;  1C4C A;  4WVF B;  1BML C;  3PP2 A;  4RGN A;  4WWP A;  3D8D A;  4LTU A;  2R61 A;  4EE2 A;  1BTK A;  3H8H A;  3APF A;  3UIN B;  2LGS A;  1UNR A;  2LVQ A;  4P1B C;  3RFZ B;  3LJU X;  2CHX A;  3OWE B;  2QHO A;  4ANV A;  3L10 B;  1FGZ A;  3FKY A;  2PZ1 A;  1A70 A;  1R4M B;  4LDT D;  4REZ A;  3DCX A;  2RGN B;  2KN5 A;  3DHI C;  4DHZ B;  2ZW0 A;  2QMT A;  2ZNV B;  1K8R B;  2KFJ A;  4N59 A;  4W9H A;  1AW7 A;  3CMM B;  2LVP A;  4HAW B;  4I6P A;  4MGZ E;  1SEB D;  1ZKH A;  5GOW B;  3Q6B A;  2JP2 A;  1PLS A;  1NTI A;  2MWS B;  1MIX A;  1L0V B;  1XQQ A;  3NY5 A;  3RUI B;  1KZG A;  2GUM A;  4WWO A;  5JHG A;  1B1Z A;  2V0G A;  4XWT A;  2CU3 A;  4M8N A;  3OLM D;  2MWN B;  1OEY A;  1JDE A;  3PRM B;  3RZW C;  1WRI A;  4LNN A;  4JKB A;  2MBQ A;  2ASQ A;  3TUO A;  2DIK A;  4C7Y A;  3I3T B;  3CF6 E;  1EU3 A;  3TIX A;  5BMI A;  3A33 B;  1FM0 D;  1TS5 A;  1UBI A;  2PE6 B;  2UVM A;  1W1D A;  2BS4 B;  2PE9 A;  2Z13 A;  2MBE A;  2PW9 A;  3ENE A;  1NTY A;  3EUB 2;  2MP2 A;  4W9I A;  2K6D B;  3SNH A;  3O96 A;  4ZOH C;  2FAZ A;  2DWQ A;  1WIA A;  2KJR A;  2O6V A;  2QCZ A;  3EHV A;  1J7C A;  5LON B;  3I63 C;  1C78 A;  2WXR A;  4S0R A;  4JWU C;  4S17 A;  1V2Y A;  2R2Q A;  3KW5 B;  3ZDM C;  2KDB A;  1WX7 A;  4LK0 M;  3TJP A;  2XQN M;  2OTX A;  2KLC A;  3ECI A;  4JKH A;  4XYC A;  1MG4 A;  3H7P B;  1OGW A;  4RF1 A;  3FIL A;  3RN9 C;  4JLC A;  2WXH A;  3M95 A;  1IRS A;  3Q3F A;  4K7U A;  5H92 C;  3BZD B;  1ZOY B;  4FJV B;  1HXY D;  4M0W B;  4C56 C;  1NEK B;  1UNQ A;  2XBB C;  1YOV B;  2MEK A;  4A8X C;  2KN4 A;  4C00 A;  2ZCC A;  2FCQ A;  1ROE A;  1B9R A;  3ZYY X;  3FEH A;  2MJD A;  4IWQ A;  4EOY A;  1SIF A;  5AZH A;  2JXT A;  3PV1 A;  3TVV A;  1U5E A;  4L2Y A;  3SEB A;  1DRO A;  5AZG A;  2KLG A;  4N9F 4;  1YJI A;  2ADZ A;  3KWV A;  3HUI A;  1HBK A;  2WYQ A;  3TL5 A;  3ZJV A;  3QJZ A;  1N3H A;  3DWG C;  2K8C A;  3D8E A;  1EM7 A;  3P4P B;  1I4R A;  1N5X A;  4FLH A;  4RGO S;  1JW9 D;  1DYN A;  2KZR A;  5AEK B;  4CHJ A;  3DXD A;  2YLM A;  5IJM A;  1FNW A;  2D3B A;  1FIQ A;  3P6A A;  2BT6 A;  2DYN A;  2BPS A;  3R66 C;  4HDO A;  1FXI A;  3Q3O C;  3J9C A;  2AX5 A;  4YT0 B;  1FNU A;  2KX3 A;  4MGI E;  1J8C A;  2JWZ A;  1FRD A;  1MHX A;  2YEP B;  2V4I B;  2K1F A;  3LJ3 A;  2NBW B;  1L4D B;  1TYG B;  4F7H A;  5LOP B;  5I2M A;  3ALB A;  3ML9 A;  2IO0 B;  4GN1 A;  4TSS A;  1FOE A;  3SUZ A;  4GDK B;  4ASW C;  1LW3 A;  2MA9 B;  4JKA A;  1LB1 A;  2FCN A;  1RAX A;  5BYR A;  2N9E B;  2FJ9 A;  5FI1 A;  2VZK B;  2GB1 A;  4GDL A;  3H6N A;  5C79 A;  1N5W A;  1XO3 A;  2COF A;  3R2I A;  3RPF C;  2BB5 A;  4WJN A;  1W1G A;  1C4P A;  3AEF B;  3OG5 A;  4HB0 B;  3ZJU A;  4W9G A;  2G9H D;  1UD7 A;  2LKO A;  2DHI A;  5HE1 A;  5KCV A;  4ANW A;  4MDK E;  2INP E;  2L8J A;  4P1C C;  1PFD A;  2H89 B;  1EF5 A;  2EKI A;  1JWM D;  4PQ0 A;  5EE1 A;  3HHM A;  1UPQ A;  2KDI A;  1SBB B;  4P7I A;  2NMQ A;  2XK5 B;  4BBN F;  2HJ8 A;  1OTR B;  2INC C;  1YN5 A;  3VR9 B;  3AEE B;  4IUM B;  1Q1O A;  4A5K A;  2D4Q A;  3VR8 B;  3N30 A;  1EO6 A;  1GB4 A;  2N7E A;  3RNG C;  3W1Y A;  3ZKJ C;  4IOI E;  4KX6 B;  3K9O B;  4ARC A;  1VZ6 A;  2ZNV C;  1E0Z A;  5GMV A;  4K3C A;  2D9X A;  2IGH A;  1WMH A;  4YWG G;  2ZCB A;  2LRW A;  4HAZ B;  2D07 B;  1UWM A;  4WWN A;  1WF9 A;  3P4Q B;  2I38 A;  3JSV A;  1T0S C;  2KFK B;  3BWU D;  5G2N A;  3A4R A;  1YQ3 B;  1KJT A;  5LLI A;  4BBN C;  3BIN A;  1WYW B;  4FJY A;  2JVC A;  1SXT A;  1WX8 A;  2RNR B;  3NZS A;  3A9J B;  3SHQ A;  2J4X A;  5DCN A;  2X0S A;  4HKZ E;  1XEE A;  3M3J A;  1GJZ A;  2ROZ B;  1AWD A;  1XLO A;  5DPT A;  3UF8 A;  2O2V A;  3IAM 1;  2JPH A;  4BOZ B;  3MTN B;  1MI0 A;  1C79 A;  2VRR B;  2RSG A;  2D3C A;  2JXX A;  1NDD A;  3TO1 A;  1BTN A;  2ON8 A;  4CYE A;  1E8Z A;  4KHB A;  2UU7 A;  1PGA A;  5J17 A;  4GIV A;  2IGD A;  2O6V D;  3DDC B;  2CHZ A;  1P3R A;  1YNT E;  4YTP B;  4H8S A;  1HQR D;  4HJK A;  1FHX A;  1QC6 A;  3IBE A;  3VTV A;  5TR5 A;  1F2R C;  3VXW A;  3DWM A;  3SU8 X;  2FDQ A;  2DA0 A;  1WY8 A;  4WH4 A;  3VH3 B;  2RLO A;  4HAU B;  2LGD A;  3PLU A;  3ZUN A;  2IO3 B;  2FID A;  2WLB A;  4II2 B;  4ARI A;  1EAZ A;  1R4N B;  3FC4 A;  2RPQ A;  3GE8 C;  3WCQ A;  1P7E A;  5IOI A;  1C76 A;  5L81 A;  3W1S A;  1SF0 A;  5G55 A;  3ODW A;  3A8Q A;  5BO4 B;  2LHE A;  3W9C B;  1ZPS A;  2WU5 B;  3HW2 B;  3L16 A;  1FPY A;  2WU2 B;  4C0A A;  1MKE A;  4AJY B;  3A1Q B;  3H9D A;  2COC A;  3VTU A;  2M0X A;  2E6X A;  3D8F A;  1NEN B;  3U52 E;  4YON A;  4NY0 A;  4CSQ A;  1FAO A;  1Y5O A;  4IM3 A;  3N20 C;  4TQ0 A;  2IY1 B;  5LXH A;  4FJZ A;  1E7V A;  4US9 A;  2RDH A;  1KI1 B;  4CO7 A;  4MAC A;  3WA0 A;  1TQZ A;  1M4V A;  4OZA A;  2BKF A;  4N6E B;  5CX3 A;  1WG7 A;  5IKC M;  2R09 A;  3R7Q A;  2W54 A;  3AE4 B;  2PVG C;  5E6O A;  3N9Y C;  3DPD A;  4JK9 A;  2QC8 A;  4MM3 A;  3ZNI D;  5M4Y B;  3M1I B;  3RCP A;  3NJT A;  2X8X X;  2NR2 A;  3NWF A;  1J0G A;  3RUL A;  2KTR B;  1V5O A;  1Y19 B;  1ZC3 B;  4IAP A;  1E8Y A;  1YN3 A;  4JGH B;  4BKT A;  1TKE A;  3QQ8 B;  1SHC A;  4JKE A;  2J52 A;  2L0T A;  5AZF A;  2G45 B;  2KQ7 A;  4II3 B;  4ZHP A;  5DPW A;  3HM6 X;  3PZ7 A;  4ZRP A;  4JKG A;  2EJ8 A;  4NJC A;  3ZGZ A;  4XGA B;  2KVR A;  4EZL A;  4F7G A;  2KIE A;  2DYO A;  1FGY A;  3APC A;  4A20 A;  4KGR A;  2IO1 B;  1FD6 A;  1VBG A;  2P0D A;  4L6E A;  1K5G B;  1DOI A;  3B2F A;  2M4N A;  2LUL A;  1IBX B;  3I9V 1;  1U5D A;  3UI3 A;  4RGT A;  4C4V B;  1MG8 A;  3BK1 A;  3C19 A;  3QAQ A;  1GPX A;  4YSX B;  3TEY A;  3AI5 A;  4DIX A;  1NU2 A;  1NVL A;  4EUT A;  4M8M A;  2BCJ A;  2WS3 B;  1FHO A;  3C0R B;  3WAO A;  3CST A;  5D94 A;  2PIA A;  2MCN B;  1R4M I;  1ACC A;  3OHM B;  4A6F A;  5AUK A;  3MC9 A;  4RFB A;  4CHK A;  3ZJT A;  5IP4 D;  2ZW1 A;  1XLP A;  5C2T B;  4HJG E;  2IBI B;  3KRX A;  3WAL A;  1N60 A;  4ITK A;  3M63 B;  5FKA C;  2V1Y A;  2D9Y A;  2WX0 A;  2RD0 A;  3KRW A;  1ZP0 B;  2Q13 A;  1TS3 A;  1WXM A;  3KUC B;  1QOF A;  2LJI A;  2N9K A;  1WZ0 A;  2NPT A;  3VDZ A;  2GBK A;  2KMC A;  3ODO A;  5JLJ B;  4A6Q A;  1OY2 A;  1MJD A;  5HHD G;  3W5U B;  1XXG A;  4OZB A;  2QEJ C;  4MJS A;  5DH9 B;  2IGG A;  5BMG A;  3MJ5 A;  3GYP A;  3O13 A;  5HE2 A;  2RMM A;  3T9L A;  2YSZ A;  5EE0 A;  4NZL B;  1STE A;  3WAP A;  2KUP A;  4BKS D;  2Y8F A;  4ZRK A;  2MKR A;  3AU5 A;  1V97 A;  3SDL C;  2H7D A;  3VQI A;  2MDX A;  3N32 A;  5C16 A;  3PHW B;  1T0Y A;  2OJW A;  1ZC4 B;  3DOW A;  3X0W A;  1V9J A;  1JML A;  1GNU A;  2L1C A;  4WJQ A;  1XR0 B;  4KHA A;  1N6Z A;  2DZI A;  2OQB A;  2M0A A;  2NBV B;  3SYX A;  3W2D A;  1GC7 A;  2JQR B;  3PPA A;  1UNS A;  3DBL B;  1TJE A;  5FK9 C;  5E6J A;  3UZT A;  3PT2 B;  2Z8L A;  3U7D A;  1FB8 A;  5JP4 A;  2H7E A;  4KIK B;  4YSY B;  4AUQ C;  3QWM A;  1UUP A;  5HE3 A;  1QKZ A;  4WQO B;  3A8P A;  4XZ4 A;  5D3I B;  4K3B A;  1YX6 B;  1WGQ A;  4H2A A;  4EEW A;  4ILH A;  2KJ6 A;  3R3M A;  3EFC A;  3X23 A;  5D6J B;  4MSM B;  3DBH I;  3B1L X;  4RMA A;  2I2Y A;  4OT1 A;  2YRY A;  3O65 B;  3PG7 A;  2BBC A;  2C5L C;  2HDE A;  4MH0 E;  1XOD A;  2K39 A;  3ZXR A;  4W9J A;  3E56 A;  1MPE A;  4QXA B;  1WXV A;  2N9X A;  3VIA A;  2REX A;  2BWE S;  1DDW A;  4M02 A;  3VRA B;  4J3O D;  5LNK 1;  2MP2 B;  4MT7 A;  2E3T A;  2W2X C;  1L4Z B;  2X18 A;  2NZ8 B;  1IYF A;  2MBH A;  3OJ3 A;  2CY5 A;  2WXN A;  4I6N B;  2KYW A;  4HHV A;  3V60 A;  3AEB B;  2MH7 A;  2YS1 A;  2XN9 C;  1X11 A;  1E7P B;  4IDI A;  1I7A A;  5EE9 A;  1V1P B;  4HCN B;  4KKJ A;  2R2O A;  3V61 A;  4NJ6 A;  1QZE A;  1WGR A;  2V9H A;  4DX8 A;  3IG3 A;  4ILJ A;  3Q8C A;  3Q8F A;  2Z14 A;  3W5V B;  1Q10 A;  3SV1 A;  5TSS A;  2P0H A;  3FAH A;  4B9K A;  3NVW A;  2JU6 X;  4A6H A;  2QKM A;  3PVL A;  3ULC A;  3F0W A;  3R2T A;  2GJY A;  1PFJ A;  4HWI B;  1TBE A;  5CLQ B;  1WJ6 A;  3MC8 A;  2DAJ A;  1Y8R C;  2WXL A;  2FCS A;  4HXD A;  2MQJ A;  3HRD D;  1ZVR A;  1RFK A;  3E66 A;  1PUT A;  2DZK A;  2RDG A;  4LNK A;  4E71 A;  4A90 A;  1HTO A;  2W9N A;  4TV3 A;  4GSW A;  2ZVN A;  2LOX A;  4QJ5 B;  3ML8 A;  1TIF A;  1SIJ A;  4ZRQ A;  4K7W A;  1XLQ A;  2LG1 A;  3DBS A;  2WXP A;  4JK8 A;  2NMB A;  3KZ1 A;  1BT0 A;  1DYQ A;  2HTM E;  3BYT B;  2J0J A;  3N1Y C;  3PGE A;  3TMP B;  2R0D A;  2B3A A;  5HI1 A;  2G4D B;  1UBQ A;  3AE3 B;  3AXC A;  2IYB A;  1L0Y B;  2K5P A;  4M01 A;  1WRD B;  2AYO B;  4XX5 A;  4MH8 A;  3DQV A;  4X57 B;  1CMX B;  3PS6 A;  3FM8 C;  2KK8 A;  4GNK B;  1L6V A;  3NHE B;  4N58 A;  4G0N B;  2BGF A;  3P7Z A;  1IPG A;  4E3C A;  4LCD E;  4W9F A;  3E9S A;  4D6W A;  4HK2 A;  4JK7 A;  4D2K A;  5D3W A;  4FHK A;  1D5Z C;  1GAQ B;  1EUV B;  2KR0 A;  1OQR A;  2W3R A;  2LD9 A;  4HPL B;  2MLB A;  4G11 A;  3HSA A;  4GZU A;  4R3D A;  4IM2 A;  4ICU A;  2BS2 B;  2CQU A;  2VSZ A;  3Q14 C;  1JWA D;  3NS8 A;  2E2X A;  1TKY A;  2GMI C;  3GB1 A;  3QX1 A;  2LWP A;  4K1R B;  3BII D;  2MJE A;  1FRR A;  2HTH A;  2KT7 A;  4L1B A;  2R2Y A;  2JZ3 B;  4ZYS A;  3NWA A;  4K17 A;  4G3X B;  1PGB A;  3ZNG C;  4F7U P;  1R7S A;  2MRP A;  4HAT B;  4NSW A;  4FA6 A;  2Y3A A;  2RQ1 A;  5D3X A;  3CWI A;  2GBJ A;  3DHH C;  1V6E A;  2COA A;  2QKL A;  5J3Q A;  4BOS C;  2D2Q A;  1WJN A;  2NS5 A;  4BZA A;  1XCQ L;  2XEW A;  4IW0 A;  3L0W B;  4ZRI A;  3TW1 A;  3QAR A;  3VUX A;  1WMH B;  2JUO A;  2ELA A;  3HVD A;  2WWZ A;  3EEC A;  1R4N I;  2QIE B;  3A9K A;  4BAX A;  1XT9 B;  3R8B A;  2I1J A;  5D2M B;  5KQ4 A;  3ULB A;  3VHT C;  3G9W A;  3NVV A;  1VBH A;  2Z0O A;  3DXC A;  1EWY C;  2JWU A;  3P1M A;  3BK2 A;  3JSV B;  2K6Q A;  3ZNH B;  2N0S B;  3TBL D;  1LQB A;  1M7R A;  4GMX B;  2L3Z A;  2UWQ A;  1RWS A;  1C9F A;  3Q3M C;  4OSN A;  3PTF C;  1QOA A;  3VRB B;  2ACZ B;  4OVU A;  3N7C A;  1MFW A;  4YTM B;  3N1Z C;  3AEC B;  1IUE A;  4B6H A;  1TS4 A;  2WXQ A;  4CHM A;  5C5B A;  2ONQ A;  3ETR A;  1OQY A;  3TCA A;  2DX5 B;  4PS8 A;  2PMV A;  3HVZ A;  3MJW A;  1K5D B;  2Z59 A;  4GLS C;  2Y5C A;  4DHJ B;  3BVZ A;  2INN E;  1T77 A;  3KSY A;  1TY2 A;  2CU1 A;  1KOT A;  1TXD A;  2L7R A;  1Z87 A;  3DVN V;  2LI5 A;  4DXG A;  2GBM A;  1VLB A;  2MJ3 A;  2DBY A;  2IND C;  2GOW A;  5E6N A;  4HCP B;  4EFO A;  1P6S A;  1WM3 A;  3U4E G;  3U30 A;  4YSZ B;  3TFM A;  3AMZ A;  1QOB A;  1DBH A;  1VJK A;  5FI0 A;  3ZVR A;  4KZ0 A;  3ZXV A;  5KQ1 A;  2RR9 A;  2DEN B;  2IDY A;  2NBU A;  1NI2 A;  2L76 A;  4Z2N A;  3JVZ X;  3T06 A;  1C77 A;  4BKS A;  1H4R A;  2WXO A;  3Q8B A;  1RLF A;  5IO9 A;  2KIG A;  3E9L A;  2FJL A;  5C6R A;  1VCB A;  1XF5 L;  3GE3 C;  3MPX A;  1GUA B;  5J2R A;  1WI1 A;  1EGX A;  4IWO A;  3I57 A;  2ZPY A;  3Q69 A;  2LGY A;  1DGJ A;  2KO3 A;  1Q0W B;  4PYZ A;  4B0M A;  4OVZ A;  2FNJ B;  4EKU A;  1V49 A;  2MW5 A;  4WWM A;  4LDT B;  4DHZ E;  4KSL C;  1V61 A;  1OMW A;  4JPS A;  2YS5 A;  4HB3 B;  3NOB A;  1XCT L;  4F7Z A;  3AN1 A;  4M00 A;  1WJU A;  3IAS 1;  1WJM A;  3WYF B;  2L1A A;  2SAK A;  2WXF A;  4RGM A;  5C1Z A;  1XCG A;  5HFY A;  4NAW A;  2KAN A;  1DDM A;  1I4Q A;  4GU2 A;  5H8Y E;  4YTN B;  3ZTD A;  1A5R A;  1KBL A;  1UH6 A;  1JAL A;  2BYV E;  1RFA A;  4MK0 A;  2K3U A;  4DX9 0;  4XDC A;  2DYB A;  4MM3 B;  4YL8 A;  3FP5 A;  2CRF A;  4KGS A;  1NYR A;  2R82 A;  1YMH E;  2YT1 A;  3DCG A;  1V5P A;  1ZXH A;  1BXT A;  4BFR A;  2N9P C;  1HB8 A;  2LZ6 A;  1DOX A;  4P6V F;  1JWB D;  1BWN A;  5I4D A;  1LO5 D;  4GMV A;  1WM2 A;  3CIK A;  4JKG B;  1F0Z A;  3RNF C;  3OAN A;  1OFF A;  1N61 A;  1H8C A;  1WVH A;  2MHJ A;  3AU4 A;  1V86 A;  4B95 A;  4NAM A;  2ZVO A;  4W9D A;  4US8 A;  1EWC A;  1JRO A;  3ZIM A;  2GBR A;  2NCN A;  1KFY B;  4ZYN A;  2EMT A;  2FUH B;  1UGM A;  2YT2 A;  1D5M C;  1JWS D;  3NVY A;  2CHW A;  3V6C B;  4L1R A;  2D3G A;  1WR1 A;  4TKN A;  3SFE B;  2JF5 A;  3KYD D;  1YX5 B;  1IGC A;  4DQO C;  3ZVV A;  4EZJ A;  2AQ1 B;  2NTT A;  4JX1 C;  1HZ5 A;  2LFI A;  1N63 A;  1ZM0 A;  3NVZ A;  1JQ4 A;  2BKR B;  2L2I A;  4C7Z A;  3NG0 A;  1G6J A;  1L2N A;  1NBF C;  3DBL I;  4A6F B;  3LDZ E;  1TKG A;  2C7N B;  3PO0 A;  3D32 A;  3GS2 A;  1SJE D;  3I5J C;  1UNP A;  4LNO A;  3RT3 B;  1SE3 A;  5KHQ A;  2L32 A;  3SO6 A;  2A4Z A;  5HKH A;  1KLG D;  5DI9 B;  1HE8 A;  1WGD A;  1E9M A;  3ZQ4 A;  3UQA A;  3PSE B;  2IO2 B;  5CLL B;  3IXS A;  4LLG M;  5AUI A;  1J7A A;  1D3Z A;  4FN2 A;  1X1G A;  3DVN U;  1WGU A;  1DDV A;  2NPT B;  2RSU A;  4KSK C;  4ZDV A;  1D5X C;  3JW0 X;  2J0K A;  2W2W A;  4AWJ A;  3P4R B;  3IT4 B;  1OQQ A;  3AE1 B;  4KHO A;  2K8B A;  1FMA D;  1OQN A;  3BY4 B;  2LJ5 A;  2D3A A;  1PYW D;  2LYD A;  1SGH A;  1UF0 A;  4FXC A;  2DHK A;  3ZO5 B;  3RI7 C;  1XKE A;  1I2H A;  3A1Q A;  3AEG B;  1VD2 A;  2HD5 B;  4MGY E;  3AJ4 A;  1WGH A;  2WDR B;  4XC2 A;  2BVC A;  1NYQ A;  1K53 A;  3VVW B;  2UZS A;  1J7B A;  3KUD B;  3AUL A;  2IY0 B;  2D9Z A;  2J59 M;  3H1U A;  1YJJ A;  1ENF A;  3RNE C;  3Q3J A;  1Q67 A;  3WAM A;  3OAW A;  2L52 A;  3NSU A;  2NVU I;  3B9J A;  4OHJ A;  4QAY A;  4HRS A;  4D0N B;  2FIF A;  4FBJ B;  3KY9 A;  2Y5P A;  2VH1 A;  2KTF A;  2D5G A;  2LHD A;  1PQS A;  1WE7 A;  1I7H A;  5BMH A;  5DPS A;  1QLB B;  3HIE A;  3RNC C;  1WYG A;  3ML4 A;  1RRP B;  1RJ2 A;  2KC1 A;  2L83 A;  2CY4 A;  2G1E A;  1MK7 B;  3W1S C;  2RGF A;  4HB2 B;  2VZK D;  1FEH A;  2CKH B;  5FR6 A;  3AE6 B;  3PHX B;  2KWC A;  1ESF A;  2DLB A;  5JVL A;  1T0R C;  3PSC A;  2OJR A;  2Y7B A;  2DX1 A;  2FE8 A;  5DHA B;  1GG3 A;  4C4V A;  2LVO A;  2OED A;  1P0R A;  4IM0 A;  3R7R A;  3EFU A;  3PZD A;  1WR6 E;  4HAV B;  2G3Q B;  2KX0 A;  3RD2 A;  2ZEQ A;  3MHZ A;  4HRO A;  1W1H A;  1WZ3 A;  3RNB C;  4IOY X;  1SE4 A;  2KKC A;  2KDF B;  1F2R I;  1WI0 A;  2P0F A;  2YF0 A;  4JKF A;  2CAY A;  5DHF B;  3QA8 A;  4QJ4 B;  3ZNZ B;  2KQS A;  2V76 A;  3UIO B;  3L08 A;  3KLS X;  5MPO A;  2KQ4 X;  1M94 A;  1T0Q C;  1CZP A;  1F9J A;  2D9W A;  1ZE3 D;  1J0W A;  4DXA B;  5C3J B;  1I4G A;  2KWV B;  3KYC D;  2WXG A;  2V3S A;  1T5X D;  2IYD B;  4GB9 A;  3AV8 A;  1KZ7 A;  4F8C B;  2LMC A;  2N4F A;  3N3K B;  4GGQ A;  3AE7 B;  2PLP A;  1FFV A;  4IG7 B;  2P8V A;  1AN8 A;  2J7Q B;  2WXM A;  1WXA A;  2QDF A;  2Z0E B;  3AE9 B;  3NWD A;  4AS1 A;  5J3T A;  1KTK A;  1ZDX A;  1Z5S B;  1ZXI A;  4HPP A;  4G50 A;  2RUK B;  1MI1 A;  4DDG D;  1HTQ A;  2AL3 A;  2WHI A;  1E90 A;  5JHA A;  2O6V B;  4EMO A;  1P1A A;  4RF0 A;  1QT9 A;  2MBO A;  2KDM A;  4KDL B;  3T3N A;  3NS1 A;  2PPH A;  1IGD A;  2DKP A;  2Z4D A;  1ET9 A;  4RM8 A;  2KOX A;  2RDB C;  2EEL A;  2G4S A;  1WX9 A;  2JZZ A;  4J6I A;  2CJN A;  1EU4 A;  2SEB D;  2JY6 A;  1S3S G;  2WNM A;  5D3D A;  5CHF A;  3FIL B;  3C8Y A;  4PS7 A;  2GCL A;  2NBV A;  3DBR B;  5L95 C;  1F1H A;  2HJ1 A;  2VH2 A;  4B6W A;  3E9O A;  4K2P A;  2KWU B;  1WJ1 A;  1BUI C;  2Q5W D;  2EC1 A;  4KIK A;  3A98 B;  2W3S A;  1I42 A;  4JWS C;  4KDI C; 
#chains in the Genus database with same CATH homology
 4HVB A;  5EDS A;  3PVU A;  1RRB A;  5CHV C;  2K2J A;  5DPR A;  4A3O A;  2M8S A;  3VTW A;  4GXB A;  2KCJ A;  3F5R A;  2L00 B;  3KUZ A;  4ZRJ A;  2KGX B;  2M17 A;  4AOF A;  1MK9 B;  1H10 A;  1NTV A;  3RZF A;  1U27 A;  1UEL A;  5C23 A;  4MEL A;  2AEH A;  1X86 A;  2GBN A;  2W2X D;  2AWT A;  2HTH B;  2LXA A;  3MDB C;  1JRU A;  1WGY A;  2DKQ A;  3EC8 A;  3U8Z A;  2DLW A;  3QWZ B;  1P9D U;  1S1Q B;  4DBB A;  3PRE A;  1E7U A;  3QBV B;  2DAF A;  2ZPN A;  2JT4 B;  2CS4 A;  3V62 A;  2Y8G A;  4F1S A;  2C9W B;  2LXC A;  2DHZ A;  1P98 A;  1I35 A;  3HQC A;  1YIW A;  5LXI B;  4I6L B;  4AP4 C;  4NNJ B;  1KC7 A;  1U4A A;  5IAA C;  4GDL B;  3A9K B;  1MPH A;  1HB6 A;  1V80 A;  2KD0 A;  2CR5 A;  2AL6 A;  1AWE A;  2WX1 A;  2VRW B;  2I5F A;  2ROV A;  2UZR A;  3WAN A;  1E8W A;  3ZRF A;  4OVV A;  1AAR A;  5C5B B;  1YD8 U;  2LBB A;  2D11 A;  2N1W A;  1AQC A;  1WJ4 A;  1TZ1 A;  4K7S A;  2DYQ A;  4WAA A;  2C7M B;  2BYF A;  2Z59 B;  5HE0 A;  3H7P A;  5JHH A;  4FUL A;  1YQB A;  4NPN A;  1TGZ B;  4KAX B;  4KV2 A;  3RCZ A;  1KM7 A;  4IWP A;  1P3Q U;  4WSF A;  3V6E B;  2Y5B B;  2M38 A;  3MHS D;  5EFX A;  4Z2M B;  4Y94 A;  4KZC A;  3V5W A;  1WE6 A;  3ZDT A;  3DVG X;  4K2O A;  2WDT B;  4ANU A;  2O2V B;  1WH3 A;  4AJW A;  3QK0 A;  2HRJ A;  3ZW3 A;  2LOZ A;  4RM9 A;  2D10 A;  4GOC A;  4FAD A;  4KHB B;  2DN6 A;  2VKI A;  4JKC A;  4W9C A;  4NAW B;  5CHW A;  3PRZ A;  3QIJ A;  1ZGU B;  1LM8 B;  2KNB A;  2EKE C;  1SE9 A;  2PJH A;  4GDK A;  2COD A;  4URK A;  2I1K A;  2HE7 A;  3L17 A;  2K8H A;  4BVU C;  3HK0 A;  1ISN A;  4BBK A;  2D9V A;  4GPT B;  3JYU A;  3HM3 A;  3SD5 A;  1WFY A;  3HIZ A;  4A3P A;  4HAY B;  3VH4 B;  2K25 A;  4BKG A;  4NQL B;  3QC8 B;  2KMA A;  1V5T A;  1ST7 A;  2EMS A;  2BYE A;  3L13 A;  1C3T A;  2YS3 A;  2ZZP B;  3IFW B;  3H7S A;  4JL9 A;  5DIF B;  4K81 A;  4DBG A;  2Z0D B;  3B0A A;  1LFD A;  3VAW A;  2XK5 A;  1FHW A;  1U29 A;  2YT0 A;  2DX5 A;  2DZJ A;  5J18 A;  4JQW C;  4DDI D;  2J0M A;  3VFK A;  2N0Y A;  1UZX B;  5D3Y A;  2ZJD A;  1E8X A;  2LRU A;  2COP A;  1PMS A;  1L7Y A;  3S2A A;  4LJO B;  2BWF A;  1U5G A;  5D7G A;  4KVG B;  3APD A;  4W9E A;  4NJ7 A;  3KVF B;  3KH0 A;  4MY6 A;  1TJ6 A;  1ACA A;  4ANX A;  2KFK A;  4EZK A;  5L83 A;  2OOB B;  2ABD A;  5JHB A;  3A9J A;  1V89 A;  1U2B A;  3P2B A;  2DYM A;  4XWX A;  2N7D A;  4DK5 A;  4HPM B;  4MSQ B;  2UYZ B;  2L0F A;  2M14 A;  4TUU A;  2K00 A;  1P5T A;  1ZW7 A;  1GC6 A;  1E5W A;  5JZE B;  5E6P A;  3RYT A;  1MAI A;  4TYZ A;  3BJI A;  4HLE A;  2DTC A;  4ILG B;  2KC2 A;  2JRI B;  2BF8 B;  4WJP A;  1XD3 B;  1XD4 A;  3ENB A;  3L54 A;  3IVF A;  1EF1 A;  4NQK E;  2FCM A;  1X1M A;  1V88 A;  4DWF A;  2M1M A;  2LAS A;  3PLV A;  4W9L A;  3PRP B;  4EJN A;  2RVB B;  4LJP B;  4HAX B;  4HB4 B;  2DZM A;  5IA7 A;  1FXT B;  3PEG A;  1M7E A;  3QCA A;  2Z0P A;  1C1Y B;  4MJS B;  1QQG A;  1V81 A;  4WJ7 A;  2C60 A;  2MX2 A;  3VOQ A;  4W9K A;  5JH5 C;  3T8M A;  2V4L A;  2MFQ A;  5D27 A;  2ELB A;  1MIZ B;  1XX0 A;  1J19 A;  3PVW A;  1DIK A;  4ICV A;  2CB8 A;  3SBG A;  3FLV A;  4MGK E;  3B08 A;  2DFK A;  1Q5W B;  1KLV A;  1OEY J;  2A5U A;  2WH5 A;  4FHJ A;  4A6K A;  4IC7 B;  3UGB B;  3GOE A;  2G35 A;  1WGG A;  1WXS A;  3CSF A;  3DBR I;  1EVH A;  2KTR A;  2IZV B;  3ZRC A;  2N23 A;  1BAK A;  1IP9 A;  5D3V A;  3WIM A;  3VUY A;  3SBT A;  1UPR A;  4IFS A;  2N1V A;  3IHP C;  4PYU A;  1ZSQ A;  2LUE A;  4JIO U;  2GCJ A;  1V5U A;  3GZN I;  3UIP B;  1UEF A;  4PNK A;  3QHT A;  3ONS A;  2YVC A;  1X05 A;  3FSS A;  3DVG Y;  3VUW A;  1Z2M A;  3DXE A;  3ZLZ A;  4E74 A;  2KJH B;  5J3Y A;  1U5F A;  4HDQ A;  3GYO A;  3ZTC A;  2L05 A;  4JKD A;  2DHJ A;  4MEM A;  3K9P B;  5CTR C;  4WJO A;  1V5M A;  3OJ4 B;  2PEA A;  4PS3 A;  3M62 B;  3ODX A;  4DHJ D;  3E9P A;  2Z0Q A;  3NZU A;  1GGO A;  2GS0 A;  2I5C A;  3EPY A;  1B55 A;  4TQ1 A;  1YJ1 A;  2IFS A;  3UQB A;  2K2U A;  2LGX A;  2KDE B;  1LXD A;  2C7H A;  2JRH A;  1X1F A;  5KHO A;  3CXB B;  2MBB B;  1TTN A;  2KXJ A;  3A4S C;  2MSE D;  2KHW B;  4WVF B;  3PP2 A;  4WWP A;  3D8D A;  1BTK A;  3APF A;  3UIN B;  1UNR A;  2LVQ A;  3LJU X;  2CHX A;  2QHO A;  4ANV A;  3L10 B;  1FGZ A;  2PZ1 A;  4LDT D;  2RGN B;  2KN5 A;  4DHZ B;  2ZNV B;  1K8R B;  2KFJ A;  4W9H A;  3CMM B;  2LVP A;  4HAW B;  4I6P A;  4MGZ E;  1ZKH A;  5GOW B;  2JP2 A;  1PLS A;  1NTI A;  2MWS B;  1MIX A;  1XQQ A;  3NY5 A;  3RUI B;  1KZG A;  4WWO A;  5JHG A;  4M8N A;  3OLM D;  2MWN B;  1OEY A;  1JDE A;  3PRM B;  3RZW C;  4JKB A;  2MBQ A;  2ASQ A;  2DIK A;  3I3T B;  3CF6 E;  3TIX A;  3A33 B;  1UBI A;  2PE6 B;  2UVM A;  1W1D A;  2PE9 A;  2MBE A;  3ENE A;  1NTY A;  2MP2 A;  4W9I A;  2K6D B;  3SNH A;  3O96 A;  2FAZ A;  1WIA A;  2KJR A;  2O6V A;  3EHV A;  5LON B;  1V2Y A;  2R2Q A;  3KW5 B;  3ZDM C;  2KDB A;  1WX7 A;  3TJP A;  2XQN M;  2OTX A;  2KLC A;  3ECI A;  4JKH A;  3H7P B;  1OGW A;  4JLC A;  3M95 A;  4K7U A;  1IRS A;  3Q3F A;  4FJV B;  4M0W B;  1UNQ A;  2XBB C;  2ZCC A;  2FCQ A;  3FEH A;  4IWQ A;  4EOY A;  1SIF A;  5AZH A;  3PV1 A;  3TVV A;  1U5E A;  1DRO A;  5AZG A;  2KLG A;  4N9F 4;  2ADZ A;  1HBK A;  2WYQ A;  3TL5 A;  3QJZ A;  1N3H A;  2K8C A;  3D8E A;  4FLH A;  1DYN A;  2KZR A;  5AEK B;  4CHJ A;  3DXD A;  2YLM A;  5IJM A;  3P6A A;  2DYN A;  2BPS A;  3R66 C;  4HDO A;  1J8C A;  2KX3 A;  4MGI E;  2JWZ A;  3LJ3 A;  2K1F A;  2NBW B;  4F7H A;  5LOP B;  3ALB A;  3ML9 A;  2IO0 B;  4GN1 A;  1FOE A;  3SUZ A;  4GDK B;  4ASW C;  1LW3 A;  2MA9 B;  4JKA A;  1LB1 A;  2FCN A;  1RAX A;  2N9E B;  2FJ9 A;  5FI1 A;  4GDL A;  3H6N A;  5C79 A;  2COF A;  4WJN A;  1W1G A;  4HB0 B;  4W9G A;  1UD7 A;  2LKO A;  2DHI A;  5HE1 A;  5KCV A;  4ANW A;  4MDK E;  2L8J A;  1EF5 A;  4PQ0 A;  3HHM A;  1UPQ A;  2KDI A;  4P7I A;  2XK5 B;  4BBN F;  2HJ8 A;  1OTR B;  4IUM B;  1Q1O A;  4A5K A;  2D4Q A;  3N30 A;  1EO6 A;  2N7E A;  3W1Y A;  3ZKJ C;  3K9O B;  2ZNV C;  5GMV A;  2D9X A;  1WMH A;  2ZCB A;  2LRW A;  4HAZ B;  2D07 B;  4WWN A;  1WF9 A;  3JSV A;  2KFK B;  5G2N A;  3A4R A;  1KJT A;  5LLI A;  4BBN C;  3BIN A;  1WYW B;  4FJY A;  2JVC A;  1WX8 A;  2RNR B;  3NZS A;  3A9J B;  3SHQ A;  5DCN A;  2X0S A;  3M3J A;  1GJZ A;  2ROZ B;  5DPT A;  3UF8 A;  2O2V A;  2JPH A;  4BOZ B;  3MTN B;  2VRR B;  2RSG A;  2JXX A;  1NDD A;  3TO1 A;  1BTN A;  4CYE A;  1E8Z A;  5J17 A;  4GIV A;  2O6V D;  3DDC B;  2CHZ A;  1P3R A;  4H8S A;  4HJK A;  1FHX A;  1QC6 A;  3IBE A;  3VTV A;  5TR5 A;  3VXW A;  3SU8 X;  2FDQ A;  2DA0 A;  1WY8 A;  3VH3 B;  2RLO A;  4HAU B;  2LGD A;  3PLU A;  3ZUN A;  2IO3 B;  2FID A;  4II2 B;  1EAZ A;  2RPQ A;  5L81 A;  3W1S A;  5G55 A;  3ODW A;  3A8Q A;  5BO4 B;  3HW2 B;  3L16 A;  4C0A A;  1MKE A;  4AJY B;  3A1Q B;  3H9D A;  2COC A;  3VTU A;  2M0X A;  3D8F A;  4YON A;  4NY0 A;  1FAO A;  1Y5O A;  4IM3 A;  4TQ0 A;  5LXH A;  2IY1 B;  4FJZ A;  1E7V A;  1KI1 B;  4CO7 A;  3WA0 A;  1TQZ A;  2BKF A;  5CX3 A;  1WG7 A;  2R09 A;  3R7Q A;  5E6O A;  3DPD A;  4JK9 A;  4MM3 A;  3ZNI D;  3M1I B;  3RCP A;  2NR2 A;  1J0G A;  3RUL A;  2KTR B;  1V5O A;  1Y19 B;  1ZC3 B;  4IAP A;  1E8Y A;  4JGH B;  4BKT A;  3QQ8 B;  1SHC A;  4JKE A;  2L0T A;  5AZF A;  2G45 B;  2KQ7 A;  4II3 B;  5DPW A;  3HM6 X;  4JKG A;  2EJ8 A;  2KVR A;  4EZL A;  4F7G A;  2DYO A;  1FGY A;  3APC A;  4A20 A;  2IO1 B;  1VBG A;  2P0D A;  4L6E A;  1K5G B;  2M4N A;  2LUL A;  1U5D A;  1MG8 A;  3QAQ A;  3AI5 A;  1NU2 A;  1NVL A;  4EUT A;  4M8M A;  2BCJ A;  1FHO A;  3C0R B;  3WAO A;  3CST A;  5D94 A;  2MCN B;  1R4M I;  4A6F A;  4CHK A;  2IBI B;  3KRX A;  3WAL A;  3M63 B;  2V1Y A;  2D9Y A;  2WX0 A;  2RD0 A;  3KRW A;  2Q13 A;  1WXM A;  3KUC B;  1WZ0 A;  2NPT A;  3VDZ A;  2GBK A;  2KMC A;  3ODO A;  5JLJ B;  1OY2 A;  4MJS A;  5DH9 B;  3GYP A;  5HE2 A;  3T9L A;  2YSZ A;  3WAP A;  2KUP A;  4BKS D;  2Y8F A;  4ZRK A;  2MKR A;  3AU5 A;  3SDL C;  2H7D A;  3VQI A;  2MDX A;  3N32 A;  5C16 A;  3PHW B;  1T0Y A;  1ZC4 B;  3DOW A;  3X0W A;  1V9J A;  1GNU A;  2L1C A;  4WJQ A;  1XR0 B;  4KHA A;  2DZI A;  2OQB A;  2NBV B;  3SYX A;  1GC7 A;  3PPA A;  3UZT A;  3PT2 B;  3U7D A;  1FB8 A;  5JP4 A;  2H7E A;  4KIK B;  4AUQ C;  3QWM A;  5HE3 A;  4WQO B;  3A8P A;  4XZ4 A;  1YX6 B;  1WGQ A;  4EEW A;  4ILH A;  2KJ6 A;  3R3M A;  3X23 A;  5D6J B;  4MSM B;  3DBH I;  3B1L X;  4RMA A;  2YRY A;  3O65 B;  3PG7 A;  2C5L C;  4MH0 E;  1XOD A;  2K39 A;  4W9J A;  1WXV A;  2N9X A;  3VIA A;  2REX A;  2BWE S;  1DDW A;  2MP2 B;  4MT7 A;  2W2X C;  2X18 A;  2NZ8 B;  1IYF A;  2MBH A;  3OJ3 A;  2CY5 A;  4I6N B;  4HHV A;  3V60 A;  2YS1 A;  1X11 A;  1I7A A;  4HCN B;  2R2O A;  3V61 A;  4NJ6 A;  1QZE A;  1WGR A;  4DX8 A;  3IG3 A;  4ILJ A;  3SV1 A;  2P0H A;  4B9K A;  4A6H A;  2QKM A;  3PVL A;  3ULC A;  3F0W A;  2GJY A;  1PFJ A;  4HWI B;  1TBE A;  5CLQ B;  1WJ6 A;  2DAJ A;  1Y8R C;  2FCS A;  4HXD A;  2MQJ A;  1ZVR A;  3E66 A;  2DZK A;  4E71 A;  2W9N A;  4TV3 A;  4GSW A;  2ZVN A;  2LOX A;  3ML8 A;  4K7W A;  2LG1 A;  3DBS A;  4JK8 A;  2NMB A;  3KZ1 A;  1BT0 A;  2J0J A;  3PGE A;  3TMP B;  2R0D A;  2B3A A;  2G4D B;  1UBQ A;  3AXC A;  2IYB A;  1WRD B;  2AYO B;  4XX5 A;  3DQV A;  4X57 B;  1CMX B;  3PS6 A;  3FM8 C;  2KK8 A;  3NHE B;  4G0N B;  2BGF A;  3P7Z A;  1IPG A;  4E3C A;  4LCD E;  4W9F A;  4HK2 A;  4JK7 A;  5D3W A;  4FHK A;  1EUV B;  2LD9 A;  4HPL B;  2MLB A;  4G11 A;  4GZU A;  4IM2 A;  4ICU A;  2CQU A;  2VSZ A;  3NS8 A;  2E2X A;  2GMI C;  3QX1 A;  2LWP A;  4K1R B;  2HTH A;  2JZ3 B;  4K17 A;  4G3X B;  3ZNG C;  4F7U P;  2MRP A;  4HAT B;  4NSW A;  4FA6 A;  2RQ1 A;  5D3X A;  2GBJ A;  1V6E A;  2COA A;  2QKL A;  5J3Q A;  4BOS C;  2D2Q A;  1WJN A;  2NS5 A;  2XEW A;  4IW0 A;  3L0W B;  4ZRI A;  3TW1 A;  3QAR A;  3VUX A;  1WMH B;  2JUO A;  2ELA A;  2WWZ A;  3EEC A;  1R4N I;  3A9K A;  1XT9 B;  2I1J A;  5D2M B;  5KQ4 A;  3ULB A;  3VHT C;  3G9W A;  1VBH A;  2Z0O A;  3DXC A;  3ZNH B;  3JSV B;  2K6Q A;  3TBL D;  1LQB A;  1M7R A;  4GMX B;  2L3Z A;  2UWQ A;  3PTF C;  4OVU A;  3N7C A;  4B6H A;  4CHM A;  5C5B A;  1OQY A;  3TCA A;  2DX5 B;  4PS8 A;  3MJW A;  1K5D B;  4DHJ B;  3KSY A;  2CU1 A;  1KOT A;  1TXD A;  2L7R A;  1Z87 A;  3DVN V;  2LI5 A;  2GBM A;  2GOW A;  5E6N A;  4HCP B;  4EFO A;  1P6S A;  1WM3 A;  3U30 A;  3TFM A;  1DBH A;  5FI0 A;  3ZVR A;  4KZ0 A;  5KQ1 A;  2RR9 A;  2DEN B;  2NBU A;  1NI2 A;  2L76 A;  4Z2N A;  3JVZ X;  3T06 A;  4BKS A;  1H4R A;  1RLF A;  3E9L A;  2FJL A;  5C6R A;  1VCB A;  3MPX A;  1GUA B;  5J2R A;  1WI1 A;  1EGX A;  4IWO A;  2ZPY A;  2LGY A;  2KO3 A;  1Q0W B;  4PYZ A;  2FNJ B;  4EKU A;  1V49 A;  2MW5 A;  4LDT B;  4DHZ E;  4KSL C;  1V61 A;  1OMW A;  2YS5 A;  4HB3 B;  3NOB A;  4F7Z A;  1WJU A;  1WJM A;  3WYF B;  5C1Z A;  1XCG A;  4NAW A;  2KAN A;  1DDM A;  4GU2 A;  3ZTD A;  1A5R A;  1KBL A;  1UH6 A;  2BYV E;  1RFA A;  4MK0 A;  4DX9 0;  2DYB A;  4YL8 A;  3FP5 A;  2CRF A;  2R82 A;  2YT1 A;  3DCG A;  1V5P A;  4BFR A;  2N9P C;  1HB8 A;  2LZ6 A;  1BWN A;  4GMV A;  1WM2 A;  3CIK A;  4JKG B;  3OAN A;  1H8C A;  1WVH A;  3AU4 A;  1V86 A;  4B95 A;  2ZVO A;  4W9D A;  3ZIM A;  2GBR A;  2NCN A;  4ZYN A;  2EMT A;  2FUH B;  1UGM A;  2CHW A;  3V6C B;  2D3G A;  1WR1 A;  4TKN A;  2JF5 A;  3KYD D;  1YX5 B;  3ZVV A;  4EZJ A;  1ZM0 A;  2BKR B;  2L2I A;  1G6J A;  1L2N A;  1NBF C;  3DBL I;  4A6F B;  3LDZ E;  2C7N B;  3D32 A;  1UNP A;  3RT3 B;  5KHQ A;  3SO6 A;  2A4Z A;  5HKH A;  5DI9 B;  1HE8 A;  1WGD A;  3UQA A;  3PSE B;  2IO2 B;  5CLL B;  1D3Z A;  4FN2 A;  1X1G A;  3DVN U;  1WGU A;  1DDV A;  2NPT B;  2RSU A;  4KSK C;  4ZDV A;  3JW0 X;  2J0K A;  2W2W A;  4AWJ A;  4KHO A;  2K8B A;  1OQN A;  3BY4 B;  2LJ5 A;  2LYD A;  1SGH A;  2DHK A;  3ZO5 B;  1XKE A;  1I2H A;  3A1Q A;  1VD2 A;  2HD5 B;  4MGY E;  3AJ4 A;  1WGH A;  4XC2 A;  3VVW B;  2UZS A;  3KUD B;  3AUL A;  2IY0 B;  2D9Z A;  2J59 M;  3H1U A;  3Q3J A;  1Q67 A;  3WAM A;  3OAW A;  3NSU A;  2NVU I;  4D0N B;  2FIF A;  4FBJ B;  3KY9 A;  2KTF A;  1PQS A;  1WE7 A;  5DPS A;  3ML4 A;  1RRP B;  1RJ2 A;  2KC1 A;  2CY4 A;  1MK7 B;  3W1S C;  2RGF A;  4HB2 B;  2CKH B;  5FR6 A;  3PHX B;  2KWC A;  5JVL A;  3PSC A;  2OJR A;  2Y7B A;  2DX1 A;  5DHA B;  1GG3 A;  2LVO A;  4IM0 A;  1P0R A;  3R7R A;  3EFU A;  3PZD A;  1WR6 E;  4HAV B;  2G3Q B;  2KX0 A;  3RD2 A;  2ZEQ A;  1W1H A;  1WZ3 A;  4IOY X;  2KKC A;  2KDF B;  1WI0 A;  2P0F A;  2YF0 A;  4JKF A;  2CAY A;  5DHF B;  3QA8 A;  3ZNZ B;  2KQS A;  2V76 A;  3UIO B;  3L08 A;  1M94 A;  1F9J A;  2D9W A;  1J0W A;  4DXA B;  3KYC D;  2KWV B;  2V3S A;  2IYD B;  4GB9 A;  1KZ7 A;  4F8C B;  2N4F A;  3N3K B;  4GGQ A;  4IG7 B;  2P8V A;  2J7Q B;  1WXA A;  2Z0E B;  5J3T A;  1Z5S B;  4G50 A;  2RUK B;  4DDG D;  2AL3 A;  1E90 A;  5JHA A;  2O6V B;  4EMO A;  1P1A A;  2MBO A;  4KDL B;  2PPH A;  2DKP A;  4RM8 A;  2KOX A;  2G4S A;  1WX9 A;  2JZZ A;  4J6I A;  2JY6 A;  1S3S G;  5CHF A;  4PS7 A;  2GCL A;  5L95 C;  4B6W A;  3E9O A;  4K2P A;  2KWU B;  1WJ1 A;  2EC1 A;  4KIK A;  3A98 B;  1I42 A;  4KDI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...