1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords RADIXIN
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
1TZ1A 4MELA 2NCNA 3H1UA 1XR0B 5JZEB 2KDBA 4X57B 2K8CA 2L8JA 4GZUA 3DVNU 1V5TA 4EFOA 3W1SC 2C5LC 4G3XB 5G2NA 2EJ8A 1T0YA 2JZZA 1W1DA 2ZCCA 1NI2A 4I6NB 2YS1A 4HCPB 3V61A 4JQWC 4IOYX 4MEMA 1V9JA 4OVUA 4W9KA 2P8VA 2N0YA 2XEWA 1GNUA 2ROZB 3HM6X 3VOQA 3ZRCA 4HAVB 1HB8A 2COPA 2YVCA 1MAIA 3ODWA 3SV1A 1ZW7A 3PHWB 3UQAA 1YD8U 2D9YA 2Z0DB 4M8MA 1S3SG 4W9HA 1I35A 2DX1A 1LM8B 2WH5A 1TBEA 2CY4A 2YLMA 4KAXB 3V5WA 2CKHB 2QKMA 2Y8FA 2ZJDA 3TCAA 4GGQA 5JHHA 2LGDA 3C0RB 3ODOA 3A8QA 2BCJA 2FCQA 4HPMB 3FP5A 2XQNM 2W2WA 3PEGA 1V5PA 1E8XA 1P0RA 1U5FA 1X1GA 1ST7A 2ZPYA 1DDMA 4NQLB 5AZGA 1WGUA 1ZC3B 5DIFB 3TW1A 2RLOA 3JVZX 4DX8A 1PFJA 4K7UA 3AU5A 4A20A 4HB2B 2LRUA 1R4NI 3DXCA 4K81A 4A6KA 2FIFA 4MJSB 1NBFC 4TUUA 3ZNID 1ZVRA 2IYBA 1RRPB 2VRWB 5C6RA 4ICUA 5C16A 4KSLC 2V3SA 1W1GA 4TKNA 2MCNB 4ANXA 2I1JA 4W9GA 2ZNVC 3PRMB 2L2IA 2FAZA 2KJRA 1WF9A 1M7EA 2O2VA 3V6CB 2KN5A 2IZVB 3PPAA 1HB6A 1H10A 4GIVA 2RUKB 2NVUI 3CIKA 3WYFB 3UZTA 4L6EA 1OY2A 2KJ6A 3PV1A 3ZVVA 4LCDE 4M0WB 2CB8A 2DYQA 1OQYA 2IO2B 4E71A 1OTRB 3UQBA 3JW0X 3QA8A 1E7VA 1ZSQA 3A8PA 4WSFA 4EUTA 1ZKHA 4TQ0A 1U4AA 2LGYA 2A4ZA 3F0WA 2P0FA 3T06A 5D3VA 2KQ7A 2ZEQA 1WM3A 3VUYA 2VSZA 2DYMA 2ZPNA 1V49A 2E2XA 2KTFA 2ZNVB 3PLVA 1V5MA 1XCGA 3GZNI 5C79A 3VTVA 4FJYA 4BFRA 2MKRA 4GDKA 1EVHA 3R7QA 4RMAA 4F1SA 2DAFA 1E8YA 2BF8B 1AQCA 2K6DB 3DVGY 2HRJA 1KM7A 2UZRA 3DBSA 3L16A 3OAWA 5FR6A 3HQCA 4ICVA 3VVWB 5HKHA 4H8SA 4GDLA 4GSWA 2ASQA 3PLUA 4HK2A 3SD5A 3UF8A 2LULA 1EAZA 4MK0A 1OEYA 1X1FA 2P0DA 3IVFA 1UH6A 3DVNV 3HHMA 3APDA 3MPXA 5J3TA 1FGZA 1WJ1A 1K5GB 1UBQA 3KYDD 3N7CA 1FHXA 2IO1B 3KUCB 3ZKJC 3DCGA 4A6FA 3M3JA 3RCPA 1WGDA 1LW3A 1UBIA 3RCZA 4DDGD 4PS8A 5KHOA 1J0GA 4KIKB 1MKEA 4WJOA 3AXCA 3MJWA 4MM3A 2IYDB 4FBJB 3R3MA 4NJ6A 4F7ZA 4FA6A 3QX1A 4IM0A 1WH3A 5IJMA 1BTKA 2L0FA 2KDFB 4GMVA 3VUXA 3U7DA 1YIWA 2DZMA 2L00B 4GU2A 3W1YA 1GC6A 1WGYA 2FCSA 3UGBB 4BKSD 3WA0A 1MPHA 4BKTA 1V81A 2BWFA 4HB0B 1JRUA 2Y7BA 2M1MA 3KSYA 3QK0A 2I5CA 2JWZA 2O6VB 5D3YA 4A5KA 2WDTB 1FHOA 3KVFB 1KLVA 4P7IA 3O96A 1PQSA 2IY0B 2LXAA 1I2HA 4GPTB 2L0TA 2LVQA 2MWSB 3WIMA 1IPGA 3AU4A 4YONA 3KW5B 4HATB 2JY6A 1WXAA 1U2BA 1ISNA 3AJ4A 2MBQA 1WMHB 3N30A 2DKPA 1V6EA 5LOPB 2KMAA 2O6VA 4IG7B 2R2QA 4KHBB 2CS4A 3NZUA 3PRPB 3D8DA 3IHPC 1WIAA 5DI9B 1P5TA 3PGEA 4I6PA 1WE7A 1D3ZA 3APFA 1J0WA 4TV3A 1V89A 2DX5A 3SHQA 2GBRA 4DHZE 1WMHA 4XWXA 2FDQA 3QIJA 2G45B 1BT0A 2L05A 1BWNA 2RR9A 4PS3A 3SO6A 5AEKB 2D9VA 4KZCA 4IAPA 1XX0A 2N9EB 5C5BA 5D2MB 3ZDMC 2XK5B 4WJNA 1P3RA 2Z0PA 5LXHA 1DYNA 2KWCA 1AWEA 3FM8C 3PRZA 3KY9A 1E7UA 1CMXB 3ZDTA 2R09A 3IFWB 3JSVB 3OLMD 4DDID 1V5OA 2K8HA 4WWPA 1QQGA 2K2JA 3TMPB 3TFMA 4DHJB 4ZRIA 4GN1A 4Z2NA 3WANA 4DK5A 4DHZB 3WAOA 1SGHA 1V2YA 3TBLD 1YJ1A 1WXMA 3LJUX 4G50A 4DXAB 2M14A 4NAWA 4JGHB 2NZ8B 1WR6E 3VXWA 2Q13A 5CLLB 1WX9A 1XQQA 3VQIA 2OOBB 1WX7A 4F7HA 1ZC4B 4AOFA 5C1ZA 1K5DB 2BGFA 1KZ7A 1UNQA 4KHAA 2MWNB 2FCNA 3A1QA 2G3QB 3JSVA 2ADZA 1KZGA 4W9FA 3EPYA 3V6EB 4KVGB 2NBWB 5BO4B 3WAMA 1BAKA 3ZLZA 1R4MI 2RD0A 4AWJA 1KOTA 5D27A 2MW5A 3ODXA 3QWZB 2KDEB 1PLSA 3TIXA 2CR5A 3A4SC 4WVFB 1V80A 3JYUA 2LOXA 1X86A 2Z0EB 3L13A 3VHTC 5DH9B 4DBBA 4HXDA 4A3PA 3VAWA 2HD5B 2GBMA 3L10B 2RSGA 4GOCA 4MGYE 2KUPA 4K2PA 3KRXA 1KJTA 2KO3A 2RPQA 3QJZA 4KSKC 4KIKA 4PYZA 4W9CA 5LLIA 3Q3JA 2Z0QA 4BBKA 4AP4C 2D07B 2MP2A 4WWNA 1OQNA 2ZCBA 4KV2A 3R7RA 4EZKA 3SYXA 4K17A 3Q3FA 2I5FA 1SIFA 2DYBA 5E6NA 2DZKA 1U5EA 2PE9A 1SE9A 2AYOB 2GMIC 3PTFC 5D6JB 4B6WA 4B9KA 2NMBA 2KZRA 5DPSA 3DBHI 2ELAA 3PP2A 1OEYJ 3ZO5B 1W1HA 2RGFA 2DKQA 4FADA 2MX2A 1M94A 1YQBA 2KWVB 3UIPB 4Z2MB 1FXTB 4RM8A 2CODA 3DDCB 3AI5A 2DZIA 1EGXA 2OQBA 2JUOA 4B6HA 3L17A 1XT9B 3ZRFA 4CYEA 1WE6A 4I6LB 4K2OA 2OJRA 5JHBA 2MBBB 1LXDA 2LUEA 4HJKA 5L83A 2GS0A 2YRYA 2M8SA 3PREA 3QAQA 2NPTB 4BVUC 2NR2A 1B55A 2JT4B 3ALBA 5EDSA 3L0WB 4MGZE 4B95A 2X18A 1FHWA 2R0DA 4MH0E 2LYDA 3OJ4B 2Z0OA 1SHCA 5TR5A 1N3HA 3NSUA 4W9EA 1E8WA 1XKEA 5KHQA 1IRSA 4Y94A 1XODA 2W2XD 5EFXA 3EC8A 2CHZA 3F5RA 5CHWA 3K9PB 2W9NA 1H8CA 1WZ0A 3T8MA 1WI0A 2IY1B 1E90A 2JRHA 2CY5A 2L7RA 3QC8B 4XZ4A 5AZHA 4DX90 3H6NA 2ZZPB 2QHOA 2CQUA 1MIZB 3D8FA 2C7MB 2M4NA 1GUAB 3QHTA 4GDLB 1KI1B 4HCNB 4M8NA 2YS3A 4HAZB 1L2NA 2OTXA 2KMCA 1X05A 5JP4A 2ABDA 2KGXB 3GYOA 1U5GA 3P7ZA 3PVUA 1RAXA 1EUVB 2J7QB 3A9JB 3MHSD 3VFKA 2FJ9A 2MBEA 4KZ0A 2JXXA 2DHJA 3KRWA 3HW2B 1NU2A 2VRRB 2ZVNA 4F7UP 4NAWB 2D9ZA 1MK9B 2Y8GA 1L7YA 3B1LX 2CHXA 4XX5A 3N32A 2JP2A 4MY6A 2M0XA 3V60A 1G6JA 2KKCA 3VH4B 1Y8RC 4WQOB 1U27A 5CTRC 3L54A 1C1YB 2RQ1A 1FAOA 1NTVA 1TXDA 5HE1A 1P98A 1WJ6A 2NBUA 3M62B 3NHEB 4FN2A 4PYUA 3QQ8B 2PE6B 1ACAA 2FNJB 3HK0A 2KX3A 1NTYA 3ONSA 3DXDA 3V62A 2KNBA 1V5UA 2DYNA 4GXBA 1IP9A 1Q0WB 1IYFA 4W9LA 2W2XC 4TYZA 3BY4B 1FOEA 3VDZA 2KDIA 2RNRB 4LDTB 2LOZA 1Q5WB 4WJQA 3PSEB 4KDIC 1WJUA 2DYOA 2WYQA 4K7SA 1Z2MA 3RYTA 2KCJA 4BKGA 4ANUA 2I1KA 3QCAA 4NQKE 5CHVC 3LDZE 1HBKA 2N4FA 2RSUA 4HWIB 4IM2A 4IWOA 5J3YA 2GJYA 2IO0B 4IWPA 5JH5C 3P2BA 2J0KA 5C23A 1WM2A 2N7EA 4HPLB 3CSTA 2K25A 4MGIE 3RZFA 5LXIB 2K6QA 3MDBC 2KTRB 3TO1A 2MDXA 2C7HA 3BINA 2K00A 5DHAB 3DBRI 1OGWA 3NS8A 2MBHA 2JPHA 4NNJB 3PG7A 2J0MA 1WJ4A 2H7DA 2IFSA 1K8RB 3P6AA 2LVPA 2PJHA 4IUMB 4J6IA 1LQBA 3EECA 3SU8X 2HJ8A 4CHKA 4ZDVA 2MSED 2LG1A 2D11A 2GBJA 1WYWB 3DVGX 2COAA 1WGHA 2K39A 1DDVA 2BYVE 2KJHB 3ZNZB 2HTHB 3ZIMA 1X11A 2LASA 4HAWB 5DPWA 4EEWA 2L76A 2UYZB 1V61A 2EMSA 1WG7A 5HE2A 3X0WA 5JLJB 4FJZA 2CRFA 3DXEA 5HE0A 2BWES 4PNKA 3CF6E 4GB9A 3SUZA 3R66C 2KTRA 4JL9A 3D32A 2K2UA 5J3QA 2AL3A 2WWZA 1WX8A 2KFJA 2KK8A 2LJ5A 3VIAA 4DWFA 1F9JA 1C3TA 2ZVOA 4ANVA 2H7EA 4EZJA 3X23A 4NY0A 2DTCA 1Y19B 4ZRJA 4HHVA 1XD3B 3KUZA 3FEHA 5CLQB 2FCMA 3M95A 3VH3B 3ZTDA 3ZNHB 1UEFA 3D8EA 1YX5B 3EHVA 4II2B 2KQSA 4II3B 3ML4A 4GMXB 1TTNA 1J8CA 4WAAA 2B3AA 2JRIB 2EMTA 2KOXA 1M7RA 2J0JA 1WXSA 5GOWB 2JF5A 4XC2A 2JZ3B 5DPRA 4IM3A 2KXJA 3KZ1A 3A9JA 4ZYNA 3H7PA 4D0NB 1AARA 4FHKA 1UD7A 2GBKA 2M38A 2KD0A 2NS5A 5L81A 4LDTD 2LVOA 1U5DA 2YF0A 4EMOA 2AEHA 5JHGA 1RLFA 4FHJA 4GDKB 3DPDA 3BJIA 1NTIA 1HE8A 1DDWA 4G11A 4EKUA 2GOWA 4JLCA 1LB1A 3KYCD 2DHKA 2D3GA 2IBIB 1E8ZA 4K7WA 2MA9B 4W9DA 3ULBA 5DPTA 4BOZB 1PMSA 5J18A 4W9IA 1DROA 2KC2A 2WX1A 3H9DA 2UVMA 2NBVB 5D7GA 5E6PA 2YT1A 4CHJA 3UIOB 4LJPB 4MSMB 3KUDB 3RULA 4HB3B 3ENEA 3ECIA 3WALA 2XK5A 4E74A 1RJ2A 3T9LA 4BBNF 2LD9A 3B0AA 3QARA 3PZDA 4IFSA 2FIDA 5KQ4A 1NDDA 1RFAA 2GBNA 1ZGUB 1FB8A 4NJ7A 2D2QA 3PT2B 3H7PB 3PHXB 3OANA 2V76A 2DENB 2P0HA 4A6FB 4G0NB 4ZRKA 2DA0A 5LONB 4HVBA 4BOSC 1OMWA 2MLBA 5D3XA 4MDKE 2LBBA 3FSSA 1WRDB 1WZ3A 5AZFA 1BTNA 3ZUNA 3ZVRA 4URKA 4A6HA 3IG3A 4FULA 2G4SA 2AWTA 2DN6A 2BYEA 3LJ3A 3SDLC 3M1IB 2YSZA 2N1VA 3PVLA 2PPHA 3RUIB 5G55A 4IWQA 5DHFB 2KWUB 4EZLA 1UGMA 3FLVA 1WJMA 1ZM0A 3GYPA 5FI0A 1WFYA 4IC7B 4KDLB 5GMVA 1WY8A 4EJNA 3I3TB 2MQJA 4WJPA 1Z5SB 3ML9A 2LI5A 2WX0A 3RT3B 3H7SA 4K1RB 2UWQA 2BKFA 4NSWA 2L1CA 4PQ0A 3M63B 1S1QB 1UZXB 2KX0A 3EFUA 1I7AA 1I42A 3K9OB 2IO3B 5J2RA 2HTHA 4FJVB 2CAYA 1J19A 2ROVA 5D3WA 1TQZA 1WI1A 2PEAA 3O65B 4PS7A 2BKRB 5DCNA 3ML8A 4TQ1A 4HLEA 2N23A 1Q67A 2CU1A 4HDOA 3ZTCA 4AJYB 1WXVA 1VCBA 3PVWA 2DZJA 1XD4A 1P9DU 1VD2A 2BPSA 1TGZB 5D94A 3ZNGC 3CXBB 2O6VD 2AL6A 2FJLA 4IW0A 1NVLA 1P3QU 1P6SA 2L3ZA 2N9XA 4F7GA 3A98B 1EO6A 1UPRA 3VUWA 3QBVB 4NPNA 1MK7B 2BYFA 1EF1A 2JVCA 1E5WA 5C5BB 3PS6A 3VTWA 3W1SA 2YS5A 4YL8A 2COCA 2K8BA 3L08A 5CHFA 2ELBA 2LZ6A 2KANA 1GJZA 3OJ3A 3DOWA 1Y5OA 2DFKA 4HAXB 1UELA 2KHWB 4ANWA 4OVVA 2D9XA 2HE7A 1X1MA 4HB4B 2DX5B 1TJ6A 2VKIA 3N3KB 2YT0A 1LFDA 3GOEA 3A4RA 3TJPA 2KLCA 2REXA 2LKOA 2CHWA 2DHZA 2EC1A 2N7DA 2PZ1A 4CO7A 2N1WA 4JIOU 2C7NB 4AUQC 5JHAA 4KHOA 2MRPA 2O2VB 3U8ZA 2LXCA 2FUHB 2R2OA 2NPTA 2XBBC 1QC6A 3APCA 1UPQA 1WR1A 4MJSA 2KFKA 3CSFA 2GCJA 1Q1OA 2V4LA 4C0AA 3A1QB 4F8CB 4ASWC 3SNHA 4AJWA 1EF5A 2V1YA 1UNPA 1WJNA 2A5UA 1FGYA 3PSCA 3G9WA 2EKEC 2G4DB 3DBLI 3KH0A 3WAPA 1WGQA 2C9WB 2KLGA 4DHJD 2G35A 5FI1A 2C60A 1A5RA 4LJOB 1MIXA 2Y5BB 2KC1A 2KVRA 2N9PC 5J17A 3A33B 5E6OA 2MFQA 4W9JA 4EOYA 5L95C 3U30A 5HE3A 1U29A 4WJ7A 3TVVA 2UZSA 2J59M 2QKLA 1MG8A 5KCVA 2KFKB 4HAYB 3A9KA 3NZSA 2LRWA 3MTNB 3AULA 1WGGA 3S2AA 2RVBB 4DBGA 2RGNB 4MGKE 4HAUB 1GG3A 2COFA 4FLHA 4MSQB 4N9F4 4RM9A 3NOBA 3VTUA 4CHMA 3NY5A 3RZWC 2LWPA 3HM3A 3CMMB 5IAAC 2DLWA 1QZEA 1WVHA 2LGXA 4WWOA 2D9WA 1Z87A 3UINB 3QWMA 3TL5A 2DAJA 1GC7A 3ULCA 3DQVA 4BBNC 2D4QA 4E3CA 2M17A 3HIZA 3RD2A 1H4RA 5KQ1A 1RRBA 1UNRA 1YX6B 2D10A 2DHIA 1DBHA 1V86A 2Z59B 3IBEA 2K1FA 3B08A 1P1AA 3A9KB 4HDQA 4BKSA 4MT7A 2GCLA 2MBOA 4A3OA 5CX3A 3ZW3A 2MP2B 5IA7A 1V88A 1WGRA
chains in the Genus database with same CATH superfamily
1ZE3D 1TS4A 2K8CA 2IGGA 3DVNU 4GZUA 2WDVB 2C5LC 2JZZA 3PZ7A 2MH7A 2N9KA 2JYEA 2XEWA 1GNUA 2ROZB 1EM7A 4HAVB 2YVCA 1MPEA 3DHGC 3HVDA 1YD8U 4W9HA 2KACA 5C2TB 1TBEA 1QOBA 2YLMA 3V5WA 2Y8FA 3PEGA 1E8XA 1U5FA 4NQLB 3AEGB 5AZGA 1WGUA 5DIFB 4A9AA 2W3RA 2QJLA 3AU5A 4HB2B 2LRUA 4MJSB 1XF5L 4TUUA 1VZ8A 2VRWB 1RRPB 4LNIA 2V3SA 1ZP0B 2I1JA 2L2IA 2O2VA 2KN5A 1UUPA 4GIVA 2NVUI 3CIKA 2KJ6A 3DHIC 1ZDXA 4LCDE 4M0WB 2CB8A 1OQYA 2IO2B 1OTRB 3LB8C 4TQ0A 1E7VA 4WSFA 1N61A 2ZEQA 5EE1A 3VUYA 2ZPNA 1JROA 1FNWA 2E2XA 1V49A 2KTFA 3PLVA 1V5MA 3BWUD 3VTVA 4ZHPA 4FJYA 4GDKA 1YQ3B 4F1SA 4HCPB 2IPKD 4H8SA 3UF8A 3PLUA 4LNKA 1XCQL 1VBHA 1EAZA 1MFWA 3IVFA 3DVNV 5J3TA 1J7BA 4ACFA 3KYDD 3N7CA 1D6EC 3ZKJC 3DCGA 4PS8A 1DOIA 1NI3A 1RFKA 4NZLB 1E9MA 4LK0M 4HKQA 2K5PA 2BS4B 4BAXA 2MJ3A 2V0GA 2KAJA 4ZRPA 2PW9A 2RRFA 2DZMA 4GU2A 2FCSA 5FK9C 3WA0A 1B1ZA 4HB0B 1I4HA 3KVFB 1P7FA 4P7IA 2MWSB 2WXNA 3KW5B 4HATB 1WXAA 1U2BA 3AJ4A 3N30A 4IG7B 3E9PA 1F52A 1CJEA 1K52A 3IHPC 3HVZA 2DX5A 2L05A 1BWNA 2LGIA 3SO6A 5AEKB 1DYQA 1XX0A 2YEPB 2N9EB 5C5BA 2NMQA 2Z0PA 3PRZA 5G5HA 4YSXB 2W82A 4WWPA 4RFBA 4DK5A 1WXMA 4JWUC 2OOBB 5AUIA 2G3QB 3RI7C 4W9FA 3ZLZA 4JKCA 5D27A 2GI9A 3QWZB 3TIXA 2CR5A 2IGHA 2LOXA 4XDDA 3KLSX 1I4XA 3VAWA 2GBMA 3L10B 2RSGA 1PUTA 3WANA 2KUPA 2KO3A 2QMTA 2TSSA 1HXYD 4WWNA 2D3CA 4OVZA 1FXAA 1YN4A 4B9KA 4WURA 2WXMA 1M94A 3UIPB 2K0PA 1FXTB 2DZIA 1EGXA 1WWTA 4JKAA 2OQBA 2JUOA 4B6HA 2MHJA 4CYEA 4I6LB 4M01A 2LUEA 2BQQA 4HKZE 2GS0A 4WWMA 1TKGA 3PREA 3QAQA 2NPTB 4B95A 1FHWA 2LYDA 1C4CA 1AWDA 1SHCA 5TR5A 3NSUA 1D5ZC 1IRSA 4Y94A 1XODA 3U4EG 2CHZA 3F5RA 2W9NA 1H8CA 3T8MA 2W54A 1E90A 5AZHA 4C00A 1KI1B 3Q3MC 3AE8B 2ABDA 4WQMA 2MBEA 3HW2B 2YEPF 3NS1A 4NAWB 3E9LA 2R82A 1UF0A 1U27A 2JX5A 5HE1A 4PYUA 3Q3OC 3V62A 3GZNB 1KLGD 2KNBA 1IYFA 1BUIC 2KDIA 4EE2A 1WJUA 3IAM1 2KCJA 4ANUA 2I1KA 2V3NA 3KQ4A 4IWOA 5J3YA 2GJYA 4C56C 3P2BA 5C23A 2ZKMX 2K6QA 3MC8A 3U52E 2K00A 3EA6A 3PG7A 3DCXA 1KOTA 2H88B 1LQBA 2INDC 4US9A 4ZDVA 2LG1A 2RDHA 2UU7A 2K39A 1WGHA 1DDVA 2KJHB 1L6VA 1STEA 5DPWA 4EEWA 1VJKA 1V61A 1WG7A 1YJJA 3I9V1 2BWES 1JWMD 4YT0B 2W3SA 2KK8A 1HZ5A 2H7EA 3X23A 4HHVA 3ZNHB 5CLQB 3M95A 3ZTDA 3D8EA 4II2B 4II3B 4WAAA 1QT9A 2B3AA 2AX5A 4RGNA 1C4AA 2J0JA 2JF5A 5IN7A 1JWSD 2JZ3B 4IM3A 2KXJA 2J52A 3A9JA 4ZYNA 1AARA 2GBKA 2M38A 2KD0A 2NS5A 5L81A 3N20C 4LDTD 5BYRA 1U5DA 2H89B 4FHJA 3DPDA 2J53A 3BJIA 4G11A 5BYQA 4PK1A 1LB1A 2B76B 2IBIB 1E8ZA 2WXLA 2MA9B 5J18A 1E10A 5DPTA 4BOZB 1FFVA 4OZAA 2WX1A 5IOIA 2HTME 4YTMB 2YT1A 4CHJA 3KUDB 2XK5A 1RJ2A 3AH7A 2LD9A 1ZDVA 4NJ7A 2D2QA 3OANA 2WXOA 2V76A 4HVBA 1MHXA 1QILA 2LBBA 1WZ3A 1WRDB 3ZUNA 4URKA 1DOXA 3ZVRA 4A6HA 1SF0A 4FULA 2WXGA 1SEBD 3LJ3A 4P1CC 3M1IB 2YSZA 1IGDA 3RUIB 1J7CA 1WFYA 1ZM0A 3P4QB 4AS1A 4IC7B 3R8BA 4EJNA 1F77A 2BKFA 4NSWA 4PQ0A 3M63B 1S1QB 2KX0A 2HDEA 3BVMA 4FJVB 3DWMA 5D3WA 4J3OD 4K3CA 2GLSA 2BKRB 4TQ1A 1Q67A 2CU1A 3DBHB 4RGOS 4TMAB 1WXVA 2XN9C 1ZUD2 3CIRB 4L23A 4RGMA 1TGZB 1NVLA 1L4DB 3A98B 3VUWA 3QBVB 1MK7B 2JVCA 3W1SA 3PS6A 2K8BA 3OG5A 3VRBB 2KANA 1FCLA 4HAXB 1UELA 4OVVA 2D9XA 1X1MA 2VKIA 3SBTA 3GOEA 1FRDA 4IOIE 2N7DA 4KHOA 5AUKA 3W9CB 2FUHB 2IJ0A 4K3BA 3TSSA 2XBBC 3RNFC 1WR1A 2GCJA 2NTSA 1QKZA 4AJWA 2V1YA 5JH5C 2EKEC 3WAPA 3PSCA 1WGQA 2G35A 1MIXA 2N9PC 4B0MA 5HFYA 2BYTA 2MFQA 4N59A 1U29A 1F0ZA 2J59M 2QKLA 2Z14A 3A9KA 4DBGA 3AULA 1FM0D 1GG3A 4N9F4 2D3BA 2EKIA 3VTUA 4CHMA 2LWPA 2INNE 1QZEA 2LGXA 2D9WA 1Z87A 1GC7A 3N1ZC 4BBNC 2WXRA 3VR8B 1RRBA 3IBEA 1P1AA 3VRAB 2ONQA 4HDQA 3B77A 3DWGC 5CX3A 3ZW3A 1WGRA 1TZ1A 2VZKB 2NCNA 5JZEB 2KDBA 4X57B 2WXHA 3Q8CA 1MJDA 2PIAA 4L1RA 2EJ8A 1W1DA 4WIPA 3V61A 1KRHA 4MEMA 2N0YA 2Z13A 3HM6X 1SB3C 3SV1A 1HB8A 1MAIA 1R4MB 5IP4D 1ZW7A 2GUMA 3UQAA 2D9YA 1LM8B 2QKMA 3NVVA 4JWSC 2LGDA 3FP5A 1K51A 1X1GA 1ST7A 3B2GA 3IT6B 1PFJA 4K7UA 1R4NI 5T8IA 4K81A 5H92C 2FIFA 3ZNID 5C6RA 3TEWA 4ANXA 4ICUA 4TKNA 3PRMB 2K3UA 2KJRA 4N6EB 1ZXHA 3ZQ4A 1HB6A 3WYFB 3PV1A 1PGXA 3U2SC 3AN1A 3QA8A 3A8PA 2LGYA 1TZOA 4S0RA 3F0WA 3T06A 1WM3A 3KWLA 3B2FA 3BYYB 5D3DA 4NJCA 5C79A 1JQ4A 4BFRA 2WXPA 2MKRA 1EVHA 1RYJA 3L16A 1AQCA 2K6DB 3P1MA 2HRJA 3DBSA 1AYFA 3OAWA 3HQCA 3VVWB 4GDLA 4HK2A 3AE2B 2LULA 1X1FA 1WYGA 1V1PA 1FHXA 1FCCC 4A6FA 1D4BA 1UBIA 2WU2B 4ILJA 1J0GA 4WJOA 3MJWA 4FBJB 4D6WA 2Z4DA 5IJMA 4GMVA 3U7DA 1YIWA 3W1YA 2L00B 5E6JA 1GAQB 3UGBB 1MPHA 5I2MA 4BZAA 1JRUA 2M1MA 3QK0A 2I5CA 1XLPA 2O6VB 4A5KA 1FHOA 3O96A 1PQSA 2LVQA 3WIMA 3AU4A 2KYWA 1WMHB 2LHEA 1V6EA 5LOPB 5IKCM 4KHBB 3NZUA 3PRPB 1WRIA 2KWDA 3I57A 1WIAA 5DI9B 4I6PA 3SHQA 2GBRA 5GXGB 1BT0A 1TKYA 2RR9A 3GP7A 1DIKA 4IAPA 1XLOA 1EU4A 5D2MB 5JVLA 2K22A 2MJEA 2XK5B 4JK8A 5LXHA 3FM8C 1C77A 2R09A 3JSVB 2N7JA 1V5OA 2K8HA 3TMPB 1QQGA 1D5MC 4ZRIA 4DHZB 1V2YA 4NAWA 4DXAB 4QJ5B 1KBLA 1K5DB 4KHAA 2FCNA 3A1QA 3FAHA 4KVGB 1QOGA 3WAMA 1BAKA 4XGAB 2CJOA 4DXFA 3ODXA 3TUOA 4LLGM 3JYUA 3L13A 1X86A 4A3PA 2HD5B 2EELA 3KRXA 4JKGB 1NYQA 2RPQA 4KIKA 3EGRA 5LLIA 1L0YB 1HA5A 2MP2A 1OQNA 2BB6A 2GMIC 1V97A 1FFUA 1OEYJ 3PP2A 1W1HA 3MHZA 2MX2A 2KWVB 4Z2MB 2CODA 1SSNA 2WXKA 3ABVB 4K2OA 1LXDA 2VH2A 1C76A 2YRYA 2M8SA 4BVUC 1JWUD 2JT4B 3L0WB 4MGZE 2INPE 1XCTL 4MH0E 3DBRB 3OJ4B 3T3OA 1HTOA 1XKEA 5EE9A 3EC8A 1N62A 2WNMA 3K9PB 3P4PB 1MVKA 1R4NB 1KLUD 1TS3A 3QC8B 2CQUA 3D8FA 2KDMA 4HAZB 4XWWA 2KMCA 5JP4A 2KGXB 3SEBA 3A9JB 4D2KA 3V3XA 3KRWA 5HG2A 2ZVNA 2D9ZA 1MK9B 2Y8GA 1L7YA 4XX5A 3V60A 2JP2A 1SJHD 1Y8RC 4WQOB 1C1YB 1FAOA 1NTVA 4FN2A 1ROEA 4LNOA 1KC7A 3QQ8B 2MJDA 1V5UA 1Q0WB 2W2XC 4TYZA 1FOEA 3VDZA 2RNRB 2LOZA 4WJQA 1SIJA 2WYQA 4K7SA 1JW9D 1E7PB 2BS3B 4NQKE 4A6QA 4GOUA 1BXTA 2QC8A 3CSTA 5LXIB 2KTRB 3TO1A 5DHAB 3DBRI 2MBHA 2LVPA 3Q14C 2PJHA 2H7DA 2IFSA 3SU8X 3URYA 4CHKA 2HJ8A 2GBJA 1WYWB 3DVGX 2COAA 3ZIMA 4DQOC 4HAWB 2UYZB 3X0WA 1FIQA 3DXEA 4PNKA 1FO4A 4GB9A 3SUZA 3R66C 2KTRA 3D32A 2K2UA 5J3QA 2WWZA 3BK2A 2LJ5A 4DWFA 3GB1A 4ANVA 4EZJA 4NY0A 1Y19B 4ZRJA 3KUZA 1QLBB 1UEFA 3EHVA 2KQSA 4PT5A 2JRIB 2EMTA 4H2AA 2PLPA 3MC0B 1PGAA 3H7PA 3E66A 2LEKA 2LVOA 3LYYA 2YF0A 4EMOA 1RLFA 4JX1C 1I4QA 1T0QC 2L83A 1HE8A 4JLCA 2D3AA 2GOWA 2JWUA 3KYCD 2D3GA 1C79A 3ULBA 3TEZA 2MEKA 1DROA 3H9DA 3UIOB 1F2RC 5I4DA 3T9LA 4BBNF 3QARA 3B0AA 4L2YA 2FIDA 1NDDA 1WXQA 4Q2JA 1MI0A 1AN8A 3PT2B 3H7PB 3PHXB 4XYCA 3I63C 2DENB 4ZRKA 2DA0A 5LONB 4YTPB 3RNAC 5D3XA 4MDKE 1FD6A 3IG3A 2AWTA 2DN6A 2BYEA 5DHFB 4EZLA 1UGMA 3FLVA 4KDLB 3BYTB 1WY8A 4JKHA 3RT3B 4K1RB 2UWQA 3LXFA 3W5VB 3FILA 2PKOA 3NUHB 1I7AA 4XE0A 2CAYA 4A90A 1D3ZA 2PEAA 3O65B 4PS7A 4HLEA 3J9CA 1T3QA 3W2DA 5D94A 3CXBB 1P3QU 2L3ZA 1P6SA 4F7GA 2NTTA 2BYFA 4REZA 3MP9A 2COCA 2LZ6A 1Y5OA 2DFKA 1XEEA 5EE0A 2DX5B 2YT0A 2CHWA 1CQVA 4JIOU 1HEZE 2MRPA 4YXDB 3U8ZA 2LXCA 4OSNA 1QC6A 2KFKA 1Q1OA 4C0AA 1I4GA 3A1QB 4ASWC 1IGCA 1EF5A 2G4DB 1WJNA 3KH0A 1FGYA 3DBLI 2C9WB 2OHFA 1JRPA 2C60A 2KC1A 5BMHA 4QAYA 5L95C 3TVVA 1SBBB 4ZRQA 1MG8A 5KCVA 3S2AA 4DHJD 1C9FA 5C1ZA 2BT6A 4ILHA 4HAUB 2COFA 4FLHA 3NOBA 3CMMB 2FJUB 3E9OA 2DLWA 1WVHA 4WWOA 4E3CA 2DAJA 2M17A 3HIZA 5IO9A 1QF6A 5KQ1A 1UNRA 1DGJA 1YX6B 3ETRA 1DBHA 2Z59B 3B08A 1SJED 3GE3C 4BKSA 1TJEA 2GCLA 4A3OA 2MP2B 1V1PB 3A58A 1V88A 2G9HD 5C3JB 4MELA 4JK7A 1NYRA 1XR0B 2L8JA 4MACA 5G2NA 2ZCCA 4YWGG 2YS1A 3R2TA 3B9JA 4IOYX 1V9JA 1FEHA 1NENB 3C8YA 1A70A 3VOQA 1QOAA 4GLSC 2COPA 3PHWB 2WU5B 4QXAB 1I35A 2CY4A 2R61A 2I38A 3IT4B 4KAXB 2ZW1A 3C0RB 2FCQA 3AB5A 2XQNM 1L5PA 1V5PA 1P0RA 2ZPYA 1DDMA 3TW1A 3JVZX 2RLOA 4DX8A 3RPFC 3TEYA 4A20A 1D5XC 3DXCA 4E74A 1NBFC 1GGOA 5C16A 2R2YA 2D5GA 2FAZA 1WF9A 3OWEB 2IZVB 3UI3A 5I2SA 4L6EA 1OY2A 1MHHE 1YJIA 2QDFA 3ZVVA 2DYQA 5FKAC 2LFIA 3UQBA 3JW0X 1ZSQA 4LTUA 1U4AA 2A4ZA 2P0FA 2KQ7A 2ZNVB 2QCZA 1OQQA 3R7QA 2BF8B 2MCNB 3DVGY 1IBXB 1YQ4B 1OEYA 1UH6A 1QOFA 3W5UB 2KIEA 3MPXA 1FGZA 2JXTA 5D3IB 3AEEB 3AV8A 1WGDA 1LW3A 1YNTE 2JQRB 4KIKB 3AXCA 4MM3A 2IYDB 4NJ6A 4F7ZA 5IRSA 3RFZB 1UGJA 1CZPA 2L0FA 2KDFB 1ZPSA 2W55A 3ZJTA 4BKSD 1WGYA 1UWXA 3NVWA 1JALA 1V81A 3FKYA 2Y7BA 3KSYA 3NVYA 2JWZA 3FILB 4JKDA 1KLVA 2IY0B 1I2HA 2L0TA 3BVGA 2CU3A 4YONA 4ARCA 1ISNA 3BK1A 2MBQA 1TY0A 4UDUC 4A55A 2R2QA 2CS4A 2WXQA 3HIEA 3TEXA 4KGRA 1P5TA 3MJ5A 1WE7A 1ZOYB 3APFA 1J0WA 1V89A 4DHZE 2FDQA 2G45B 1GPXA 2DIKA 4PS3A 2D9VA 4KZCA 1L6UA 3H8HA 3ZDMC 4WJNA 1MG4A 1P3RA 4JKEA 1E7UA 3OLMD 2K2JA 3TFMA 4KHBA 4GN1A 3WAOA 1SGHA 4FXCA 3NZ3A 1ET9A 2M14A 4JGHB 3VXWA 1WX9A 5CLLB 1XQQA 2KVZA 3VQIA 4AOFA 1ZC4B 2BGFA 1UNQA 2MWNB 2L52A 2RMMA 2ADZA 1KZGA 3V6EB 2NBWB 5BO4B 2RD0A 4AWJA 2MW5A 4M00A 2Z0EB 3VHTC 5DH9B 4DBBA 3FVCA 4HXDA 4MGYE 4BOSC 4GOCA 3QJZA 3EUB2 3Q3JA 4BBKA 4AP4C 3OHMB 2D07B 1V1OA 2ZCBA 3SYXA 4K17A 2BVCA 1SIFA 5E6NA 2WQYB 1SE9A 2AYOB 5G5GA 4B6WA 5D6JB 2ELAA 3AE5B 2RGFA 1YQBA 4RM8A 3L17A 3ZRFA 1WE6A 2OJRA 3NWFA 2Z8LA 1OFFA 2K9XA 1L0VB 3ALBA 3R2IA 5EDSA 2X18A 2R0DA 2IDYA 2Z0OA 2K8EA 5KHQA 4W9EA 1E8WA 3N1YC 2W2XD 5EFXA 1XO3A 1WSPA 2JRHA 2CY5A 2L7RA 4O1NA 4XZ4A 2ZZPB 2QHOA 5LG4B 1MIZB 2M4NA 3QHTA 4R3DA 1GUAB 1FMAD 2YS3A 1L2NA 2OTXA 4HRSA 1RAXA 3GYOA 3P7ZA 1U5GA 3MHSD 3VFKA 2FJ9A 4JPSA 4KZ0A 2JXXA 2DHJA 4F7UP 3ZJVA 3B1LX 3U7ZA 2CHXA 2KKCA 5CTRC 4QJ4B 3L54A 2RQ1A 1TXDA 1WJ6A 3NHEB 2NBUA 1ACAA 1XLQA 2FNJB 2KX3A 3ONSA 4US8A 4GXBA 3E56A 2FUG1 4W9LA 1K50A 2WS3B 4LDTB 3ENBA 1Q5WB 4XDCA 1VZ7A 4KDIC 4N58A 5BMGA 4OT1A 4NAMA 4HSIA 1TKEA 5CHVC 2BB5A 2N4FA 4IM2A 2J0KA 2QILA 3N1XC 2N7EA 4HPLB 4MGIE 2K25A 2X38A 3MDBC 2WXFA 1HQRD 2C7HA 3BZDB 4NNJB 1WJ4A 2J0MA 4IUMB 4J6IA 1KF6B 1E6EB 2MSED 4WAFA 2BYVE 1IUEA 3ZNZB 2LASA 1UNSA 2LHDA 3MC9A 2L76A 4FJZA 1N63A 2CRFA 5HE0A 3WCQA 3GE8C 1T77A 4OZBA 4ZHOA 2KFJA 1YMHE 2PMVA 3E9SA 1F9JA 2ZVOA 2KT7A 1ESFA 1XD3B 3VH3B 1I42A 2FCMA 1J8CA 4P16A 3ML4A 1TS2A 3BVZA 2V9HA 4M0WA 1M7RA 1WXSA 4XC2A 5GOWB 5DPRA 2CJNA 1UD7A 4C4VA 3AEBB 1EU3A 1DDWA 4EKUA 4RH6A 4IDIA 4K7WA 3AECB 4W9DA 2RDGA 4W9IA 1V8CA 5D7GA 2KC2A 2UVMA 2NBVB 3CWIA 4MSMB 3ECIA 4RF1A 1WGKA 4IFSA 1ENFA 2FE8A 5KQ4A 1RFAA 5JXVA 2SAKA 1ZGUB 4G0NB 4A6FB 1R7SA 1OMWA 2MLBA 1HZ6A 3FSSA 1BTNA 2KQ4X 2G4SA 1PGBA 3SDLC 2N1VA 3PVLA 3AE7B 1VZ6A 2PPHA 5G55A 2KWUB 1LGRA 4JK9A 1WJMA 2MQJA 2WDRB 1Z5SB 4WJPA 1K53A 1C78A 1UZXB 3EFUA 4MH8A 5J2RA 3Q8AA 4ZOHC 2ROVA 1TQZA 3ML8A 1F2RI 1IBXA 4AJYB 4ZYSA 1L0XB 2AL6A 2FJLA 4IW0A 2YT2A 2DLBA 4USAA 2WXJA 1EF1A 3VTWA 2YS5A 4YL8A 3L08A 5CHFA 2ELBA 1QQRA 1GJZA 2PVOD 4ANWA 4DIXA 2SEBD 4HB4B 1J7AA 1LFDA 2KLCA 2REXA 3IAS1 4CO7A 2EC1A 2PZ1A 3NRZA 4AUQC 1B9RA 1N5WA 2O2VB 3P4RB 3RN9C 5BYSA 3APCA 4MJSA 2V4LA 3SNHA 1UNPA 2A5UA 4IWQA 4XWTA 3G9WA 2QIEB 2KLGA 5FI1A 3NG0A 5J17A 5E6OA 4W9JA 4ARIA 2HJ1A 2DBYA 3AM9A 2LJIA 1GOZA 4KKJA 3NZSA 4HAYB 2RPVA 1KH0A 2LRWA 3MTNB 1VBGA 3AE6B 3DBLB 3RZWC 4YSZB 4JKBA 3HM3A 5IAAC 4GNKB 2AQ1B 3DQVA 3ULCA 2JZPA 2D4QA 4JE3B 2WGSA 1TY2A 1H4RA 3RD2A 5FR3A 2D10A 2DHIA 2AQ2B 1GB1A 3A9KB 4CSQA 1I4RA 4MT7A 2MBOA 5IA7A 3H1UA 3Q69A 3P4SB 1V5TA 1ET6A 1MI1A 2LMCA 4EFOA 1HTQA 2K49A 1SE2A 4G3XB 1T0YA 1NI2A 4I6NB 1RWSA 4JQWC 4OVUA 4W9KA 2P8VA 4DXGA 2GB1A 3ZRCA 2WXIA 1JDEA 3ODWA 1ZYIA 2Z0DB 4M8MA 1S3SG 3SR6A 2DX1A 1N5XA 2WH5A 2CKHB 2ZJDA 3TCAA 4GGQA 5JHHA 4HPMB 3ODOA 3A8QA 2BCJA 2J4XA 2W2WA 3AMZA 2LGSA 2M56B 4KKIA 3KWVA 2VZKD 1ZC3B 2FBWB 4A6KA 5TSSA 5HHDG 1ZVRA 2IYBA 4KSLC 5HKHA 1Q10A 1W1GA 4W9GA 2ZNVC 1M7EA 3V6CB 3Q6BA 3GS2A 3PPAA 1H10A 2RUKB 3UZTA 4ITKA 5MPOA 3AE4B 4E71A 1JMLA 4OHJA 4EUTA 1ZKHA 2X0SA 5D3VA 2GRIA 2E6XA 2VSZA 2DYMA 5H8YE 1XCGA 3GZNI 3HSAA 1ZXIA 3V05A 1Y56A 4RMAA 2DAFA 3Q8EA 1E8YA 5FR6A 1KM7A 2UZRA 2E3TA 2DWQA 4ICVA 4GSWA 3SD5A 2ASQA 2NBVA 4MK0A 3RNCC 2P0DA 3HHMA 3APDA 1WJ1A 1UBQA 1K5GB 1T5XD 2IO1B 3KUCB 3M3JA 3RCPA 3U12A 3RCZA 4DDGD 3O13A 5KHOA 1KFYB 1DOYA 1MKEA 3ZYYX 2JYTA 3Q8BA 4FA6A 1ACCA 3R3MA 3FC4A 1I7HA 3QX1A 4IM0A 1WH3A 1BTKA 3VUXA 1GC6A 2Y3AA 4BKTA 2BWFA 2INCC 3DHHC 5EE3A 5D3YA 2WDTB 2LXAA 4GPTB 4ILGB 1IPGA 2JU6X 3AEDB 2JY6A 3L4PA 2AQ3B 2DKPA 1T0SC 2KMAA 2O6VA 2I2YA 2RDBC 2WP9B 1YOVB 2QEJC 4HJGE 3D8DA 3ZJUA 3PGEA 3PZ8A 4TV3A 1WMHA 4XWXA 3QIJA 2BS2B 3ZGZA 3AEFB 3RNBC 1FNUA 1T0RC 4A8XC 3MFGA 1DYNA 2KWCA 1AWEA 3KY9A 1CMXB 3ZDTA 3IFWB 4DDID 4DHJB 1AW7A 4Z2NA 3TBLD 1YJ1A 3LJUX 4G50A 2NZ8B 1WR6E 2Q13A 1WX7A 4F7HA 1KZ7A 3JSVA 3EPYA 1N60A 1R4MI 1SE4A 2V3PA 2KDEB 1PLSA 1I4PA 3A4SC 4WVFB 1V80A 2X8XX 1VLBA 4K2PA 1KJTA 4MM3B 2OEDA 4KSKC 4OW0A 4PYZA 4W9CA 2Z0QA 4C7ZA 1T6BX 1SE3A 4KV2A 3R7RA 4EZKA 3Q3FA 2I5FA 5M4YB 1KTKA 2DYBA 2DZKA 1U5EA 2PE9A 3PTFC 4P6VF 2BTEA 2NMBA 2KZRA 5DPSA 3DBHI 1VRAB 1EWYC 3ZO5B 4TSSA 2DKQA 4FADA 3DDCB 3AI5A 1XT9B 3HUIA 4B0EA 5JHBA 2MBBB 4HJKA 3IXSA 3NJTA 1TT5B 5L83A 2KIGA 3SFEB 1LO5D 3BIID 2NR2A 1B55A 1TS5A 4KGTA 2Q5WD 2N0SB 4RGTA 1N3HA 5CHWA 5BMIA 1WZ0A 1WI0A 2IY1B 1VR9A 4DX90 1JWBD 3H6NA 4RF0A 4GDLB 2C7MB 4HCNB 4M8NA 2VH1A 2OJWA 1X05A 4C4VB 3PVUA 2J7QB 1EUVB 2KUQA 1E0ZA 1NU2A 4IKGA 2VRRB 1G6JA 3N32A 4MY6A 2M0XA 2DNFA 2QSDA 3VH4B 2ICIA 1P98A 1OQRA 3M62B 3T3NA 2PE6B 3HK0A 2LUMA 1JCKB 1NTYA 3DXDA 4WH4A 2DYNA 1IP9A 3SBGA 3BY4B 1CK1A 5LNK1 3PSEB 2DYOA 1Z2MA 3RYTA 4BKGA 3QCAA 3LDZE 1HBKA 2RSUA 4HWIB 2M19A 4IWPA 2IO0B 1WM2A 3RZFA 4JKGA 4AQ7A 2MDXA 3BINA 3NS8A 1OGWA 2JPHA 1K8RB 4C80A 3P6AA 3EECA 3AE3B 1FXIA 2D11A 1F1HA 3VR9B 1FPYA 1L4ZB 2HTHB 1X11A 1SXTA 2N9LA 1RM6C 2KN4A 2EMSA 1N6ZA 5HE2A 5JLJB 2PTLA 1YN5A 1TYGB 1PDXA 3CF6E 4JL9A 1XXGA 2AL3A 2XNAC 1WX8A 3VIAA 1C3TA 2DTCA 3FEHA 3NWDA 1NVID 1YX5B 4HROA 4GMXB 2L1AA 1TTNA 4JKFA 2KOXA 3SFDB 3KZ1A 3AE9B 4FHKA 4D0NB 3P42A 5JHGA 2AEHA 4GDKB 4C7YA 1NTIA 4YSYB 2DHKA 5HI1A 1XLNA 1PMSA 5E6PA 4LJPB 3RULA 4LNNA 4HB3B 3ENEA 3WALA 2L32A 1GB4A 3PZDA 1PYWD 2GBNA 4MT5A 1FB8A 2IGDA 2M0AA 2PVGC 2P0HA 1M4VA 2ON8A 2BW2A 4HEA1 5AZFA 3NW8A 2ACZB 3Q8FA 4LNFA 3C19A 2WHIA 3Q3NC 3Q2AC 3HRDD 2KR0A 3GYPA 5FI0A 1EWCA 5GMVA 4QJ3B 3I3TB 1VDVA 3I5JC 3ML9A 2LI5A 2WX0A 4YTNB 3H7SA 2L1CA 3K9OB 2IO3B 2HTHA 1J19A 1YN3A 5DCNA 1WI1A 3P63A 3AEAB 2ZW0A 2N23A 3ZXVA 4HDOA 3RMKC 2BBCA 3ZTCA 1BMLC 1VCBA 3PVWA 2WLBA 3EFCA 2DZJA 1XD4A 1P9DU 1VD2A 2BPSA 3ZNGC 2O6VD 4M02A 2N9XA 1EO6A 3NVZA 1UPRA 4NPNA 1FRRA 1E5WA 5C5BB 2Y5CA 3OJ3A 3DOWA 2KHWB 4KGSA 2HE7A 3N3KB 1TJ6A 3NWAA 4P1BC 3TJPA 2V4IB 3A4RA 4CQNA 2LKOA 2DHZA 4KX6B 2N1WA 1C4PA 2C7NB 2Y5PA 4RCOA 5JHAA 4HPPA 2R2OA 2NPTA 4OZCA 1UPQA 3CSFA 4F8CB 2KMMA 4S17A 3ZXRA 3AE1B 1A5RA 4LJOB 1P7EA 2Y5BB 2KVRA 3PO0A 3A33B 2G1EA 2J42A 4EOYA 3U30A 5HE3A 4WJ7A 2UZSA 2KFKB 4L1BA 1FNVA 4RNAA 1WGGA 1UWMA 2RVBB 2RGNB 4MGKE 3W1SC 2Z59A 4MSQB 4RM9A 3NY5A 1NEKB 3RNEC 2JSVX 2WDQB 1PFDA 3UINB 3QWMA 3TL5A 3RNGC 1TIFA 3N9YC 1V86A 2K1FA 1JWAD
chains in the Genus database with same CATH topology
2K8CA 3DVNU 4GZUA 2C5LC 2JZZA 2XEWA 1GNUA 2ROZB 4HAVB 2YVCA 1YD8U 4W9HA 1TBEA 2YLMA 3V5WA 2Y8FA 3PEGA 1E8XA 1U5FA 4NQLB 5AZGA 1WGUA 5DIFB 3AU5A 4HB2B 2LRUA 4MJSB 4TUUA 2VRWB 1RRPB 2V3SA 2I1JA 2L2IA 2O2VA 2KN5A 4GIVA 2NVUI 3CIKA 2KJ6A 4LCDE 4M0WB 2CB8A 1OQYA 2IO2B 1OTRB 4TQ0A 1E7VA 4WSFA 2ZEQA 3VUYA 2ZPNA 1V49A 2E2XA 2KTFA 3PLVA 1V5MA 3VTVA 4FJYA 4GDKA 4F1SA 4HCPB 4H8SA 3UF8A 3PLUA 1VBHA 1EAZA 3IVFA 3DVNV 5J3TA 3KYDD 3N7CA 3ZKJC 3DCGA 4PS8A 2DZMA 4GU2A 2FCSA 3WA0A 4HB0B 3KVFB 4P7IA 2MWSB 3KW5B 4HATB 1WXAA 1U2BA 3AJ4A 3N30A 4IG7B 3E9PA 3IHPC 2DX5A 2L05A 1BWNA 3SO6A 5AEKB 1XX0A 2N9EB 5C5BA 2Z0PA 3PRZA 4WWPA 4DK5A 1WXMA 2OOBB 2G3QB 4W9FA 3ZLZA 4JKCA 5D27A 3QWZB 3TIXA 2CR5A 2LOXA 3VAWA 2GBMA 3L10B 2RSGA 3WANA 2KUPA 2KO3A 4WWNA 4B9KA 1M94A 3UIPB 1FXTB 2DZIA 1EGXA 4JKAA 2OQBA 2JUOA 4B6HA 4CYEA 4I6LB 2LUEA 2GS0A 3PREA 3QAQA 2NPTB 4B95A 1FHWA 2LYDA 1SHCA 5TR5A 3NSUA 1IRSA 4Y94A 1XODA 2CHZA 3F5RA 2W9NA 1H8CA 3T8MA 1E90A 5AZHA 1KI1B 2ABDA 2MBEA 3HW2B 4NAWB 3E9LA 2R82A 1U27A 5HE1A 4PYUA 3V62A 2KNBA 1IYFA 2KDIA 1WJUA 2KCJA 4ANUA 2I1KA 4IWOA 5J3YA 2GJYA 3P2BA 5C23A 2K6QA 2K00A 3PG7A 1KOTA 1LQBA 4ZDVA 2LG1A 2K39A 1WGHA 1DDVA 2KJHB 5DPWA 4EEWA 1V61A 1WG7A 2BWES 2KK8A 2H7EA 3X23A 4HHVA 3ZNHB 5CLQB 3M95A 3ZTDA 3D8EA 4II2B 4II3B 4WAAA 2B3AA 2J0JA 2JF5A 2JZ3B 4IM3A 2KXJA 3A9JA 4ZYNA 1AARA 2GBKA 2M38A 2KD0A 2NS5A 5L81A 4LDTD 1U5DA 4FHJA 3DPDA 3BJIA 4G11A 1LB1A 2IBIB 1E8ZA 2MA9B 5J18A 5DPTA 4BOZB 2WX1A 2YT1A 4CHJA 3KUDB 2XK5A 1RJ2A 2LD9A 4NJ7A 2D2QA 3OANA 2V76A 4HVBA 2LBBA 1WZ3A 1WRDB 3ZUNA 4URKA 3ZVRA 4A6HA 4FULA 3LJ3A 3M1IB 2YSZA 3RUIB 1WFYA 1ZM0A 4IC7B 4EJNA 2BKFA 4NSWA 4PQ0A 3M63B 1S1QB 2KX0A 4FJVB 5D3WA 2BKRB 4TQ1A 1Q67A 2CU1A 1WXVA 1TGZB 1NVLA 3A98B 3VUWA 3QBVB 1MK7B 2JVCA 3W1SA 3PS6A 2K8BA 2KANA 4HAXB 1UELA 4OVVA 2D9XA 1X1MA 2VKIA 3SBTA 3GOEA 2N7DA 4KHOA 2FUHB 2XBBC 1WR1A 2GCJA 4AJWA 5JH5C 2V1YA 2EKEC 3WAPA 3PSCA 1WGQA 2G35A 1MIXA 2N9PC 2MFQA 1U29A 2J59M 2QKLA 4DBGA 3A9KA 3AULA 1GG3A 4N9F4 3VTUA 4CHMA 2LWPA 1QZEA 2LGXA 2D9WA 1Z87A 1GC7A 4BBNC 1RRBA 3IBEA 1P1AA 4HDQA 5CX3A 3ZW3A 1WGRA 1TZ1A 2NCNA 5JZEB 2KDBA 4X57B 2EJ8A 1W1DA 3V61A 4MEMA 2N0YA 3HM6X 3SV1A 1HB8A 1MAIA 1ZW7A 3UQAA 2D9YA 1LM8B 2QKMA 2LGDA 3FP5A 1X1GA 1ST7A 1PFJA 4K7UA 1R4NI 4K81A 2FIFA 3ZNID 5C6RA 4ANXA 4ICUA 4TKNA 3PRMB 2KJRA 1HB6A 3WYFB 3PV1A 3QA8A 3A8PA 2LGYA 3F0WA 3T06A 1WM3A 5C79A 4BFRA 2MKRA 1EVHA 3L16A 1AQCA 2K6DB 2HRJA 3DBSA 3OAWA 3HQCA 3VVWB 4GDLA 4HK2A 2LULA 1X1FA 1FHXA 4A6FA 1UBIA 4ILJA 1J0GA 4WJOA 3MJWA 4FBJB 5IJMA 4GMVA 3U7DA 1YIWA 3W1YA 2L00B 3UGBB 1MPHA 1JRUA 2M1MA 3QK0A 2I5CA 2O6VB 4A5KA 1FHOA 3O96A 1PQSA 2LVQA 3WIMA 3AU4A 1WMHB 1V6EA 5LOPB 4KHBB 3NZUA 3PRPB 1WIAA 5DI9B 4I6PA 3SHQA 2GBRA 1BT0A 2RR9A 1DIKA 4IAPA 5D2MB 5JVLA 2XK5B 4JK8A 5LXHA 3FM8C 2R09A 3JSVB 1V5OA 2K8HA 3TMPB 1QQGA 4ZRIA 4DHZB 1V2YA 4NAWA 4DXAB 1KBLA 1K5DB 4KHAA 2FCNA 3A1QA 4KVGB 3WAMA 1BAKA 3ODXA 3JYUA 3L13A 1X86A 4A3PA 2HD5B 3KRXA 4JKGB 2RPQA 4KIKA 5LLIA 2MP2A 1OQNA 2GMIC 1OEYJ 3PP2A 1W1HA 2MX2A 2KWVB 4Z2MB 2CODA 4K2OA 1LXDA 2YRYA 2M8SA 4BVUC 2JT4B 3L0WB 4MGZE 4MH0E 3OJ4B 1XKEA 3EC8A 3K9PB 3QC8B 2CQUA 3D8FA 4HAZB 2KMCA 5JP4A 2KGXB 3A9JB 3KRWA 2ZVNA 2D9ZA 1MK9B 4XX5A 2Y8GA 1L7YA 3V60A 2JP2A 1Y8RC 4WQOB 1C1YB 1FAOA 1NTVA 4FN2A 1KC7A 3QQ8B 1V5UA 1Q0WB 2W2XC 4TYZA 1FOEA 3VDZA 2RNRB 2LOZA 4WJQA 2WYQA 4K7SA 4NQKE 3CSTA 5LXIB 2KTRB 3TO1A 5DHAB 3DBRI 2MBHA 2LVPA 2H7DA 2IFSA 2PJHA 3SU8X 4CHKA 2HJ8A 2GBJA 1WYWB 3DVGX 2COAA 3ZIMA 4HAWB 2UYZB 3X0WA 3DXEA 4PNKA 4GB9A 3SUZA 3R66C 2KTRA 3D32A 2K2UA 5J3QA 2WWZA 2LJ5A 4DWFA 4ANVA 4EZJA 4NY0A 1Y19B 4ZRJA 3KUZA 1UEFA 3EHVA 2KQSA 2JRIB 2EMTA 3H7PA 3E66A 2LVOA 2YF0A 4EMOA 1RLFA 1HE8A 4JLCA 2GOWA 3KYCD 2D3GA 3ULBA 1DROA 3H9DA 3UIOB 3T9LA 4BBNF 3QARA 3B0AA 2FIDA 1NDDA 3PT2B 3H7PB 3PHXB 2DENB 4ZRKA 2DA0A 5LONB 5D3XA 4MDKE 3IG3A 2AWTA 2DN6A 2BYEA 5DHFB 4EZLA 1UGMA 3FLVA 4KDLB 1WY8A 4JKHA 3RT3B 4K1RB 2UWQA 1I7AA 2CAYA 1D3ZA 2PEAA 3O65B 4PS7A 4HLEA 5D94A 3CXBB 1P3QU 2L3ZA 1P6SA 4F7GA 2BYFA 2COCA 2LZ6A 1Y5OA 2DFKA 2DX5B 2YT0A 2CHWA 4JIOU 2MRPA 3U8ZA 2LXCA 1QC6A 2KFKA 1Q1OA 4C0AA 3A1QB 4ASWC 1EF5A 2G4DB 1WJNA 3KH0A 1FGYA 3DBLI 2C9WB 2C60A 2KC1A 5L95C 3TVVA 1MG8A 5KCVA 4DHJD 3S2AA 5C1ZA 4ILHA 4HAUB 2COFA 4FLHA 3NOBA 3CMMB 3E9OA 2DLWA 1WVHA 4WWOA 4E3CA 2DAJA 2M17A 3HIZA 5KQ1A 1UNRA 1YX6B 1DBHA 2Z59B 3B08A 4BKSA 2GCLA 4A3OA 2MP2B 1V88A 4MELA 4JK7A 1XR0B 2L8JA 5G2NA 2ZCCA 2YS1A 4IOYX 1V9JA 3VOQA 2COPA 3PHWB 1I35A 2CY4A 4KAXB 3C0RB 2FCQA 2XQNM 1V5PA 1P0RA 2ZPYA 1DDMA 3TW1A 3JVZX 2RLOA 4DX8A 4A20A 3DXCA 4E74A 1NBFC 1GGOA 5C16A 2FAZA 1WF9A 2IZVB 4L6EA 1OY2A 3ZVVA 2DYQA 3UQBA 3JW0X 1ZSQA 1U4AA 2A4ZA 2P0FA 2KQ7A 2ZNVB 3R7QA 2BF8B 2MCNB 3DVGY 1OEYA 1UH6A 3MPXA 1FGZA 1WGDA 1LW3A 4KIKB 3AXCA 4MM3A 2IYDB 4NJ6A 4F7ZA 2L0FA 2KDFB 4BKSD 1WGYA 1V81A 2Y7BA 3KSYA 2JWZA 4JKDA 1KLVA 2IY0B 1I2HA 2L0TA 4YONA 1ISNA 2MBQA 2R2QA 2CS4A 1P5TA 1WE7A 3APFA 1J0WA 1V89A 4DHZE 2FDQA 2G45B 2DIKA 4PS3A 2D9VA 4KZCA 3ZDMC 4WJNA 1P3RA 4JKEA 1E7UA 3OLMD 2K2JA 3TFMA 4GN1A 3WAOA 1SGHA 2M14A 4JGHB 3VXWA 1WX9A 5CLLB 1XQQA 3VQIA 4AOFA 1ZC4B 2BGFA 1UNQA 2MWNB 2ADZA 1KZGA 3V6EB 2NBWB 5BO4B 2RD0A 4AWJA 2MW5A 2Z0EB 3VHTC 5DH9B 4DBBA 4HXDA 4MGYE 4BOSC 4GOCA 3QJZA 3Q3JA 4BBKA 4AP4C 2D07B 2ZCBA 3SYXA 4K17A 1SIFA 5E6NA 1SE9A 2AYOB 4B6WA 5D6JB 2ELAA 2RGFA 1YQBA 4RM8A 3L17A 3ZRFA 1WE6A 2OJRA 3ALBA 5EDSA 2X18A 2R0DA 2Z0OA 5KHQA 4W9EA 1E8WA 2W2XD 5EFXA 2JRHA 2CY5A 2L7RA 4XZ4A 2ZZPB 2QHOA 2M4NA 1MIZB 3QHTA 1GUAB 2YS3A 1L2NA 2OTXA 1RAXA 3GYOA 3P7ZA 1U5GA 3MHSD 3VFKA 2FJ9A 4KZ0A 2JXXA 2DHJA 4F7UP 3B1LX 2CHXA 2KKCA 5CTRC 3L54A 2RQ1A 1TXDA 1WJ6A 3NHEB 2NBUA 1ACAA 2FNJB 2KX3A 3ONSA 4GXBA 4W9LA 4LDTB 3ENBA 1Q5WB 4KDIC 5CHVC 2N4FA 4IM2A 2J0KA 2N7EA 4HPLB 4MGIE 2K25A 3MDBC 2C7HA 4NNJB 1WJ4A 2J0MA 4IUMB 4J6IA 2MSED 2BYVE 3ZNZB 2LASA 2L76A 4FJZA 2CRFA 5HE0A 2KFJA 1F9JA 2ZVOA 1XD3B 3VH3B 1I42A 2FCMA 1J8CA 3ML4A 1M7RA 1WXSA 4XC2A 5GOWB 5DPRA 1UD7A 1DDWA 4EKUA 4K7WA 4W9DA 4W9IA 5D7GA 2KC2A 2UVMA 2NBVB 4MSMB 3ECIA 4IFSA 5KQ4A 1RFAA 1ZGUB 4G0NB 4A6FB 1OMWA 2MLBA 3FSSA 1BTNA 2G4SA 3SDLC 2N1VA 3PVLA 2PPHA 5G55A 2KWUB 4JK9A 1WJMA 2MQJA 4WJPA 1Z5SB 1UZXB 3EFUA 5J2RA 2ROVA 1TQZA 3ML8A 4AJYB 2AL6A 2FJLA 4IW0A 1EF1A 3VTWA 2YS5A 4YL8A 3L08A 5CHFA 2ELBA 1GJZA 4ANWA 4HB4B 1LFDA 2KLCA 2REXA 4CO7A 2EC1A 2PZ1A 4AUQC 2O2VB 3APCA 4MJSA 2V4LA 3SNHA 4IWQA 1UNPA 2A5UA 3G9WA 2KLGA 5FI1A 5J17A 5E6OA 4W9JA 3NZSA 4HAYB 2LRWA 3MTNB 1VBGA 3RZWC 4JKBA 3HM3A 5IAAC 3DQVA 3ULCA 2D4QA 3RD2A 1H4RA 2D10A 2DHIA 3A9KB 4MT7A 2MBOA 5IA7A 3H1UA 4EFOA 1V5TA 4G3XB 1T0YA 1NI2A 4I6NB 4JQWC 4OVUA 4W9KA 2P8VA 3ZRCA 1JDEA 3ODWA 2Z0DB 4M8MA 1S3SG 2DX1A 2WH5A 2CKHB 2ZJDA 3TCAA 4GGQA 5JHHA 4HPMB 3ODOA 3A8QA 2BCJA 2W2WA 1ZC3B 4A6KA 1ZVRA 2IYBA 5HKHA 4KSLC 1W1GA 4W9GA 2ZNVC 1M7EA 3V6CB 3PPAA 1H10A 2RUKB 3UZTA 4E71A 4EUTA 1ZKHA 2X0SA 5D3VA 2VSZA 2DYMA 1XCGA 3GZNI 4RMAA 2DAFA 1E8YA 5FR6A 1KM7A 2UZRA 4ICVA 4GSWA 3SD5A 2ASQA 4MK0A 2P0DA 3HHMA 3APDA 1WJ1A 1UBQA 1K5GB 2IO1B 3KUCB 3M3JA 3RCPA 3RCZA 4DDGD 5KHOA 1MKEA 4FA6A 3R3MA 3QX1A 4IM0A 1WH3A 1BTKA 3VUXA 1GC6A 4BKTA 2BWFA 5D3YA 2WDTB 2LXAA 4GPTB 4ILGB 1IPGA 2JY6A 2DKPA 2KMAA 2O6VA 3D8DA 3PGEA 4TV3A 1WMHA 4XWXA 3QIJA 1DYNA 2KWCA 1AWEA 3KY9A 1CMXB 3ZDTA 3IFWB 4DDID 4DHJB 4Z2NA 3TBLD 1YJ1A 3LJUX 4G50A 2NZ8B 1WR6E 2Q13A 1WX7A 4F7HA 1KZ7A 3JSVA 3EPYA 1R4MI 2KDEB 1PLSA 3A4SC 4WVFB 1V80A 4K2PA 1KJTA 4KSKC 4PYZA 4W9CA 2Z0QA 4KV2A 3R7RA 4EZKA 3Q3FA 2I5FA 2DYBA 2DZKA 1U5EA 2PE9A 3PTFC 2NMBA 2KZRA 5DPSA 3DBHI 3ZO5B 2DKQA 4FADA 3DDCB 3AI5A 1XT9B 5JHBA 2MBBB 4HJKA 5L83A 2NR2A 1B55A 1N3HA 5CHWA 1WZ0A 1WI0A 2IY1B 4DX90 3H6NA 4GDLB 2C7MB 4HCNB 4M8NA 1X05A 3PVUA 2J7QB 1EUVB 1NU2A 2VRRB 1G6JA 3N32A 4MY6A 2M0XA 3VH4B 1P98A 3M62B 2PE6B 3HK0A 1NTYA 3DXDA 2DYNA 1IP9A 3SBGA 3BY4B 3PSEB 2DYOA 1Z2MA 3RYTA 4BKGA 3QCAA 3LDZE 1HBKA 2RSUA 4HWIB 4IWPA 2IO0B 1WM2A 3RZFA 4JKGA 2MDXA 3BINA 3NS8A 1OGWA 2JPHA 1K8RB 3P6AA 3EECA 2D11A 2HTHB 1X11A 2EMSA 5HE2A 5JLJB 3CF6E 4JL9A 2AL3A 1WX8A 3VIAA 1C3TA 2DTCA 3FEHA 1YX5B 4GMXB 1TTNA 4JKFA 2KOXA 3KZ1A 4FHKA 4D0NB 5JHGA 2AEHA 4GDKB 1NTIA 2DHKA 1PMSA 5E6PA 4LJPB 3RULA 4HB3B 3ENEA 3WALA 3PZDA 2GBNA 1FB8A 2P0HA 5AZFA 3GYPA 5FI0A 5GMVA 3I3TB 3ML9A 2LI5A 2WX0A 3H7SA 2L1CA 3K9OB 2IO3B 2HTHA 1J19A 5DCNA 1WI1A 2N23A 4HDOA 3ZTCA 1VCBA 3PVWA 2DZJA 1XD4A 1P9DU 1VD2A 2BPSA 3ZNGC 2O6VD 2N9XA 1EO6A 1UPRA 4NPNA 1E5WA 5C5BB 3OJ3A 3DOWA 2KHWB 2HE7A 3N3KB 1TJ6A 3TJPA 3A4RA 2LKOA 2DHZA 2N1WA 2C7NB 5JHAA 2R2OA 2NPTA 1UPQA 3CSFA 4F8CB 1A5RA 4LJOB 2Y5BB 2KVRA 3A33B 4EOYA 3U30A 5HE3A 4WJ7A 2UZSA 2KFKB 1WGGA 2RVBB 3W1SC 2RGNB 4MGKE 4MSQB 4RM9A 3NY5A 3UINB 3QWMA 3TL5A 1V86A 2K1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZ1 A;  4MEL A;  2NCN A;  3H1U A;  1XR0 B;  5JZE B;  2KDB A;  4X57 B;  2K8C A;  2L8J A;  4GZU A;  3DVN U;  1V5T A;  4EFO A;  3W1S C;  2C5L C;  4G3X B;  5G2N A;  2EJ8 A;  1T0Y A;  2JZZ A;  1W1D A;  2ZCC A;  1NI2 A;  4I6N B;  2YS1 A;  4HCP B;  3V61 A;  4JQW C;  4IOY X;  4MEM A;  1V9J A;  4OVU A;  4W9K A;  2P8V A;  2N0Y A;  2XEW A;  1GNU A;  2ROZ B;  3HM6 X;  3VOQ A;  3ZRC A;  4HAV B;  1HB8 A;  2COP A;  2YVC A;  1MAI A;  3ODW A;  3SV1 A;  1ZW7 A;  3PHW B;  3UQA A;  1YD8 U;  2D9Y A;  2Z0D B;  4M8M A;  1S3S G;  4W9H A;  1I35 A;  2DX1 A;  1LM8 B;  2WH5 A;  1TBE A;  2CY4 A;  2YLM A;  4KAX B;  3V5W A;  2CKH B;  2QKM A;  2Y8F A;  2ZJD A;  3TCA A;  4GGQ A;  5JHH A;  2LGD A;  3C0R B;  3ODO A;  3A8Q A;  2BCJ A;  2FCQ A;  4HPM B;  3FP5 A;  2XQN M;  2W2W A;  3PEG A;  1V5P A;  1E8X A;  1P0R A;  1U5F A;  1X1G A;  1ST7 A;  2ZPY A;  1DDM A;  4NQL B;  5AZG A;  1WGU A;  1ZC3 B;  5DIF B;  3TW1 A;  2RLO A;  3JVZ X;  4DX8 A;  1PFJ A;  4K7U A;  3AU5 A;  4A20 A;  4HB2 B;  2LRU A;  1R4N I;  3DXC A;  4K81 A;  4A6K A;  2FIF A;  4MJS B;  1NBF C;  4TUU A;  3ZNI D;  1ZVR A;  2IYB A;  1RRP B;  2VRW B;  5C6R A;  4ICU A;  5C16 A;  4KSL C;  2V3S A;  1W1G A;  4TKN A;  2MCN B;  4ANX A;  2I1J A;  4W9G A;  2ZNV C;  3PRM B;  2L2I A;  2FAZ A;  2KJR A;  1WF9 A;  1M7E A;  2O2V A;  3V6C B;  2KN5 A;  2IZV B;  3PPA A;  1HB6 A;  1H10 A;  4GIV A;  2RUK B;  2NVU I;  3CIK A;  3WYF B;  3UZT A;  4L6E A;  1OY2 A;  2KJ6 A;  3PV1 A;  3ZVV A;  4LCD E;  4M0W B;  2CB8 A;  2DYQ A;  1OQY A;  2IO2 B;  4E71 A;  1OTR B;  3UQB A;  3JW0 X;  3QA8 A;  1E7V A;  1ZSQ A;  3A8P A;  4WSF A;  4EUT A;  1ZKH A;  4TQ0 A;  1U4A A;  2LGY A;  2A4Z A;  3F0W A;  2P0F A;  3T06 A;  5D3V A;  2KQ7 A;  2ZEQ A;  1WM3 A;  3VUY A;  2VSZ A;  2DYM A;  2ZPN A;  1V49 A;  2E2X A;  2KTF A;  2ZNV B;  3PLV A;  1V5M A;  1XCG A;  3GZN I;  5C79 A;  3VTV A;  4FJY A;  4BFR A;  2MKR A;  4GDK A;  1EVH A;  3R7Q A;  4RMA A;  4F1S A;  2DAF A;  1E8Y A;  2BF8 B;  1AQC A;  2K6D B;  3DVG Y;  2HRJ A;  1KM7 A;  2UZR A;  3DBS A;  3L16 A;  3OAW A;  5FR6 A;  3HQC A;  4ICV A;  3VVW B;  5HKH A;  4H8S A;  4GDL A;  4GSW A;  2ASQ A;  3PLU A;  4HK2 A;  3SD5 A;  3UF8 A;  2LUL A;  1EAZ A;  4MK0 A;  1OEY A;  1X1F A;  2P0D A;  3IVF A;  1UH6 A;  3DVN V;  3HHM A;  3APD A;  3MPX A;  5J3T A;  1FGZ A;  1WJ1 A;  1K5G B;  1UBQ A;  3KYD D;  3N7C A;  1FHX A;  2IO1 B;  3KUC B;  3ZKJ C;  3DCG A;  4A6F A;  3M3J A;  3RCP A;  1WGD A;  1LW3 A;  1UBI A;  3RCZ A;  4DDG D;  4PS8 A;  5KHO A;  1J0G A;  4KIK B;  1MKE A;  4WJO A;  3AXC A;  3MJW A;  4MM3 A;  2IYD B;  4FBJ B;  3R3M A;  4NJ6 A;  4F7Z A;  4FA6 A;  3QX1 A;  4IM0 A;  1WH3 A;  5IJM A;  1BTK A;  2L0F A;  2KDF B;  4GMV A;  3VUX A;  3U7D A;  1YIW A;  2DZM A;  2L00 B;  4GU2 A;  3W1Y A;  1GC6 A;  1WGY A;  2FCS A;  3UGB B;  4BKS D;  3WA0 A;  1MPH A;  4BKT A;  1V81 A;  2BWF A;  4HB0 B;  1JRU A;  2Y7B A;  2M1M A;  3KSY A;  3QK0 A;  2I5C A;  2JWZ A;  2O6V B;  5D3Y A;  4A5K A;  2WDT B;  1FHO A;  3KVF B;  1KLV A;  4P7I A;  3O96 A;  1PQS A;  2IY0 B;  2LXA A;  1I2H A;  4GPT B;  2L0T A;  2LVQ A;  2MWS B;  3WIM A;  1IPG A;  3AU4 A;  4YON A;  3KW5 B;  4HAT B;  2JY6 A;  1WXA A;  1U2B A;  1ISN A;  3AJ4 A;  2MBQ A;  1WMH B;  3N30 A;  2DKP A;  1V6E A;  5LOP B;  2KMA A;  2O6V A;  4IG7 B;  2R2Q A;  4KHB B;  2CS4 A;  3NZU A;  3PRP B;  3D8D A;  3IHP C;  1WIA A;  5DI9 B;  1P5T A;  3PGE A;  4I6P A;  1WE7 A;  1D3Z A;  3APF A;  1J0W A;  4TV3 A;  1V89 A;  2DX5 A;  3SHQ A;  2GBR A;  4DHZ E;  1WMH A;  4XWX A;  2FDQ A;  3QIJ A;  2G45 B;  1BT0 A;  2L05 A;  1BWN A;  2RR9 A;  4PS3 A;  3SO6 A;  5AEK B;  2D9V A;  4KZC A;  4IAP A;  1XX0 A;  2N9E B;  5C5B A;  5D2M B;  3ZDM C;  2XK5 B;  4WJN A;  1P3R A;  2Z0P A;  5LXH A;  1DYN A;  2KWC A;  1AWE A;  3FM8 C;  3PRZ A;  3KY9 A;  1E7U A;  1CMX B;  3ZDT A;  2R09 A;  3IFW B;  3JSV B;  3OLM D;  4DDI D;  1V5O A;  2K8H A;  4WWP A;  1QQG A;  2K2J A;  3TMP B;  3TFM A;  4DHJ B;  4ZRI A;  4GN1 A;  4Z2N A;  3WAN A;  4DK5 A;  4DHZ B;  3WAO A;  1SGH A;  1V2Y A;  3TBL D;  1YJ1 A;  1WXM A;  3LJU X;  4G50 A;  4DXA B;  2M14 A;  4NAW A;  4JGH B;  2NZ8 B;  1WR6 E;  3VXW A;  2Q13 A;  5CLL B;  1WX9 A;  1XQQ A;  3VQI A;  2OOB B;  1WX7 A;  4F7H A;  1ZC4 B;  4AOF A;  5C1Z A;  1K5D B;  2BGF A;  1KZ7 A;  1UNQ A;  4KHA A;  2MWN B;  2FCN A;  3A1Q A;  2G3Q B;  3JSV A;  2ADZ A;  1KZG A;  4W9F A;  3EPY A;  3V6E B;  4KVG B;  2NBW B;  5BO4 B;  3WAM A;  1BAK A;  3ZLZ A;  1R4M I;  2RD0 A;  4AWJ A;  1KOT A;  5D27 A;  2MW5 A;  3ODX A;  3QWZ B;  2KDE B;  1PLS A;  3TIX A;  2CR5 A;  3A4S C;  4WVF B;  1V80 A;  3JYU A;  2LOX A;  1X86 A;  2Z0E B;  3L13 A;  3VHT C;  5DH9 B;  4DBB A;  4HXD A;  4A3P A;  3VAW A;  2HD5 B;  2GBM A;  3L10 B;  2RSG A;  4GOC A;  4MGY E;  2KUP A;  4K2P A;  3KRX A;  1KJT A;  2KO3 A;  2RPQ A;  3QJZ A;  4KSK C;  4KIK A;  4PYZ A;  4W9C A;  5LLI A;  3Q3J A;  2Z0Q A;  4BBK A;  4AP4 C;  2D07 B;  2MP2 A;  4WWN A;  1OQN A;  2ZCB A;  4KV2 A;  3R7R A;  4EZK A;  3SYX A;  4K17 A;  3Q3F A;  2I5F A;  1SIF A;  2DYB A;  5E6N A;  2DZK A;  1U5E A;  2PE9 A;  1SE9 A;  2AYO B;  2GMI C;  3PTF C;  5D6J B;  4B6W A;  4B9K A;  2NMB A;  2KZR A;  5DPS A;  3DBH I;  2ELA A;  3PP2 A;  1OEY J;  3ZO5 B;  1W1H A;  2RGF A;  2DKQ A;  4FAD A;  2MX2 A;  1M94 A;  1YQB A;  2KWV B;  3UIP B;  4Z2M B;  1FXT B;  4RM8 A;  2COD A;  3DDC B;  3AI5 A;  2DZI A;  1EGX A;  2OQB A;  2JUO A;  4B6H A;  3L17 A;  1XT9 B;  3ZRF A;  4CYE A;  1WE6 A;  4I6L B;  4K2O A;  2OJR A;  5JHB A;  2MBB B;  1LXD A;  2LUE A;  4HJK A;  5L83 A;  2GS0 A;  2YRY A;  2M8S A;  3PRE A;  3QAQ A;  2NPT B;  4BVU C;  2NR2 A;  1B55 A;  2JT4 B;  3ALB A;  5EDS A;  3L0W B;  4MGZ E;  4B95 A;  2X18 A;  1FHW A;  2R0D A;  4MH0 E;  2LYD A;  3OJ4 B;  2Z0O A;  1SHC A;  5TR5 A;  1N3H A;  3NSU A;  4W9E A;  1E8W A;  1XKE A;  5KHQ A;  1IRS A;  4Y94 A;  1XOD A;  2W2X D;  5EFX A;  3EC8 A;  2CHZ A;  3F5R A;  5CHW A;  3K9P B;  2W9N A;  1H8C A;  1WZ0 A;  3T8M A;  1WI0 A;  2IY1 B;  1E90 A;  2JRH A;  2CY5 A;  2L7R A;  3QC8 B;  4XZ4 A;  5AZH A;  4DX9 0;  3H6N A;  2ZZP B;  2QHO A;  2CQU A;  1MIZ B;  3D8F A;  2C7M B;  2M4N A;  1GUA B;  3QHT A;  4GDL B;  1KI1 B;  4HCN B;  4M8N A;  2YS3 A;  4HAZ B;  1L2N A;  2OTX A;  2KMC A;  1X05 A;  5JP4 A;  2ABD A;  2KGX B;  3GYO A;  1U5G A;  3P7Z A;  3PVU A;  1RAX A;  1EUV B;  2J7Q B;  3A9J B;  3MHS D;  3VFK A;  2FJ9 A;  2MBE A;  4KZ0 A;  2JXX A;  2DHJ A;  3KRW A;  3HW2 B;  1NU2 A;  2VRR B;  2ZVN A;  4F7U P;  4NAW B;  2D9Z A;  1MK9 B;  2Y8G A;  1L7Y A;  3B1L X;  2CHX A;  4XX5 A;  3N32 A;  2JP2 A;  4MY6 A;  2M0X A;  3V60 A;  1G6J A;  2KKC A;  3VH4 B;  1Y8R C;  4WQO B;  1U27 A;  5CTR C;  3L54 A;  1C1Y B;  2RQ1 A;  1FAO A;  1NTV A;  1TXD A;  5HE1 A;  1P98 A;  1WJ6 A;  2NBU A;  3M62 B;  3NHE B;  4FN2 A;  4PYU A;  3QQ8 B;  2PE6 B;  1ACA A;  2FNJ B;  3HK0 A;  2KX3 A;  1NTY A;  3ONS A;  3DXD A;  3V62 A;  2KNB A;  1V5U A;  2DYN A;  4GXB A;  1IP9 A;  1Q0W B;  1IYF A;  4W9L A;  2W2X C;  4TYZ A;  3BY4 B;  1FOE A;  3VDZ A;  2KDI A;  2RNR B;  4LDT B;  2LOZ A;  1Q5W B;  4WJQ A;  3PSE B;  4KDI C;  1WJU A;  2DYO A;  2WYQ A;  4K7S A;  1Z2M A;  3RYT A;  2KCJ A;  4BKG A;  4ANU A;  2I1K A;  3QCA A;  4NQK E;  5CHV C;  3LDZ E;  1HBK A;  2N4F A;  2RSU A;  4HWI B;  4IM2 A;  4IWO A;  5J3Y A;  2GJY A;  2IO0 B;  4IWP A;  5JH5 C;  3P2B A;  2J0K A;  5C23 A;  1WM2 A;  2N7E A;  4HPL B;  3CST A;  2K25 A;  4MGI E;  3RZF A;  5LXI B;  2K6Q A;  3MDB C;  2KTR B;  3TO1 A;  2MDX A;  2C7H A;  3BIN A;  2K00 A;  5DHA B;  3DBR I;  1OGW A;  3NS8 A;  2MBH A;  2JPH A;  4NNJ B;  3PG7 A;  2J0M A;  1WJ4 A;  2H7D A;  2IFS A;  1K8R B;  3P6A A;  2LVP A;  2PJH A;  4IUM B;  4J6I A;  1LQB A;  3EEC A;  3SU8 X;  2HJ8 A;  4CHK A;  4ZDV A;  2MSE D;  2LG1 A;  2D11 A;  2GBJ A;  1WYW B;  3DVG X;  2COA A;  1WGH A;  2K39 A;  1DDV A;  2BYV E;  2KJH B;  3ZNZ B;  2HTH B;  3ZIM A;  1X11 A;  2LAS A;  4HAW B;  5DPW A;  4EEW A;  2L76 A;  2UYZ B;  1V61 A;  2EMS A;  1WG7 A;  5HE2 A;  3X0W A;  5JLJ B;  4FJZ A;  2CRF A;  3DXE A;  5HE0 A;  2BWE S;  4PNK A;  3CF6 E;  4GB9 A;  3SUZ A;  3R66 C;  2KTR A;  4JL9 A;  3D32 A;  2K2U A;  5J3Q A;  2AL3 A;  2WWZ A;  1WX8 A;  2KFJ A;  2KK8 A;  2LJ5 A;  3VIA A;  4DWF A;  1F9J A;  1C3T A;  2ZVO A;  4ANV A;  2H7E A;  4EZJ A;  3X23 A;  4NY0 A;  2DTC A;  1Y19 B;  4ZRJ A;  4HHV A;  1XD3 B;  3KUZ A;  3FEH A;  5CLQ B;  2FCM A;  3M95 A;  3VH3 B;  3ZTD A;  3ZNH B;  1UEF A;  3D8E A;  1YX5 B;  3EHV A;  4II2 B;  2KQS A;  4II3 B;  3ML4 A;  4GMX B;  1TTN A;  1J8C A;  4WAA A;  2B3A A;  2JRI B;  2EMT A;  2KOX A;  1M7R A;  2J0J A;  1WXS A;  5GOW B;  2JF5 A;  4XC2 A;  2JZ3 B;  5DPR A;  4IM3 A;  2KXJ A;  3KZ1 A;  3A9J A;  4ZYN A;  3H7P A;  4D0N B;  1AAR A;  4FHK A;  1UD7 A;  2GBK A;  2M38 A;  2KD0 A;  2NS5 A;  5L81 A;  4LDT D;  2LVO A;  1U5D A;  2YF0 A;  4EMO A;  2AEH A;  5JHG A;  1RLF A;  4FHJ A;  4GDK B;  3DPD A;  3BJI A;  1NTI A;  1HE8 A;  1DDW A;  4G11 A;  4EKU A;  2GOW A;  4JLC A;  1LB1 A;  3KYC D;  2DHK A;  2D3G A;  2IBI B;  1E8Z A;  4K7W A;  2MA9 B;  4W9D A;  3ULB A;  5DPT A;  4BOZ B;  1PMS A;  5J18 A;  4W9I A;  1DRO A;  2KC2 A;  2WX1 A;  3H9D A;  2UVM A;  2NBV B;  5D7G A;  5E6P A;  2YT1 A;  4CHJ A;  3UIO B;  4LJP B;  4MSM B;  3KUD B;  3RUL A;  4HB3 B;  3ENE A;  3ECI A;  3WAL A;  2XK5 A;  4E74 A;  1RJ2 A;  3T9L A;  4BBN F;  2LD9 A;  3B0A A;  3QAR A;  3PZD A;  4IFS A;  2FID A;  5KQ4 A;  1NDD A;  1RFA A;  2GBN A;  1ZGU B;  1FB8 A;  4NJ7 A;  2D2Q A;  3PT2 B;  3H7P B;  3PHX B;  3OAN A;  2V76 A;  2DEN B;  2P0H A;  4A6F B;  4G0N B;  4ZRK A;  2DA0 A;  5LON B;  4HVB A;  4BOS C;  1OMW A;  2MLB A;  5D3X A;  4MDK E;  2LBB A;  3FSS A;  1WRD B;  1WZ3 A;  5AZF A;  1BTN A;  3ZUN A;  3ZVR A;  4URK A;  4A6H A;  3IG3 A;  4FUL A;  2G4S A;  2AWT A;  2DN6 A;  2BYE A;  3LJ3 A;  3SDL C;  3M1I B;  2YSZ A;  2N1V A;  3PVL A;  2PPH A;  3RUI B;  5G55 A;  4IWQ A;  5DHF B;  2KWU B;  4EZL A;  1UGM A;  3FLV A;  1WJM A;  1ZM0 A;  3GYP A;  5FI0 A;  1WFY A;  4IC7 B;  4KDL B;  5GMV A;  1WY8 A;  4EJN A;  3I3T B;  2MQJ A;  4WJP A;  1Z5S B;  3ML9 A;  2LI5 A;  2WX0 A;  3RT3 B;  3H7S A;  4K1R B;  2UWQ A;  2BKF A;  4NSW A;  2L1C A;  4PQ0 A;  3M63 B;  1S1Q B;  1UZX B;  2KX0 A;  3EFU A;  1I7A A;  1I42 A;  3K9O B;  2IO3 B;  5J2R A;  2HTH A;  4FJV B;  2CAY A;  1J19 A;  2ROV A;  5D3W A;  1TQZ A;  1WI1 A;  2PEA A;  3O65 B;  4PS7 A;  2BKR B;  5DCN A;  3ML8 A;  4TQ1 A;  4HLE A;  2N23 A;  1Q67 A;  2CU1 A;  4HDO A;  3ZTC A;  4AJY B;  1WXV A;  1VCB A;  3PVW A;  2DZJ A;  1XD4 A;  1P9D U;  1VD2 A;  2BPS A;  1TGZ B;  5D94 A;  3ZNG C;  3CXB B;  2O6V D;  2AL6 A;  2FJL A;  4IW0 A;  1NVL A;  1P3Q U;  1P6S A;  2L3Z A;  2N9X A;  4F7G A;  3A98 B;  1EO6 A;  1UPR A;  3VUW A;  3QBV B;  4NPN A;  1MK7 B;  2BYF A;  1EF1 A;  2JVC A;  1E5W A;  5C5B B;  3PS6 A;  3VTW A;  3W1S A;  2YS5 A;  4YL8 A;  2COC A;  2K8B A;  3L08 A;  5CHF A;  2ELB A;  2LZ6 A;  2KAN A;  1GJZ A;  3OJ3 A;  3DOW A;  1Y5O A;  2DFK A;  4HAX B;  1UEL A;  2KHW B;  4ANW A;  4OVV A;  2D9X A;  2HE7 A;  1X1M A;  4HB4 B;  2DX5 B;  1TJ6 A;  2VKI A;  3N3K B;  2YT0 A;  1LFD A;  3GOE A;  3A4R A;  3TJP A;  2KLC A;  2REX A;  2LKO A;  2CHW A;  2DHZ A;  2EC1 A;  2N7D A;  2PZ1 A;  4CO7 A;  2N1W A;  4JIO U;  2C7N B;  4AUQ C;  5JHA A;  4KHO A;  2MRP A;  2O2V B;  3U8Z A;  2LXC A;  2FUH B;  2R2O A;  2NPT A;  2XBB C;  1QC6 A;  3APC A;  1UPQ A;  1WR1 A;  4MJS A;  2KFK A;  3CSF A;  2GCJ A;  1Q1O A;  2V4L A;  4C0A A;  3A1Q B;  4F8C B;  4ASW C;  3SNH A;  4AJW A;  1EF5 A;  2V1Y A;  1UNP A;  1WJN A;  2A5U A;  1FGY A;  3PSC A;  3G9W A;  2EKE C;  2G4D B;  3DBL I;  3KH0 A;  3WAP A;  1WGQ A;  2C9W B;  2KLG A;  4DHJ D;  2G35 A;  5FI1 A;  2C60 A;  1A5R A;  4LJO B;  1MIX A;  2Y5B B;  2KC1 A;  2KVR A;  2N9P C;  5J17 A;  3A33 B;  5E6O A;  2MFQ A;  4W9J A;  4EOY A;  5L95 C;  3U30 A;  5HE3 A;  1U29 A;  4WJ7 A;  3TVV A;  2UZS A;  2J59 M;  2QKL A;  1MG8 A;  5KCV A;  2KFK B;  4HAY B;  3A9K A;  3NZS A;  2LRW A;  3MTN B;  3AUL A;  1WGG A;  3S2A A;  2RVB B;  4DBG A;  2RGN B;  4MGK E;  4HAU B;  1GG3 A;  2COF A;  4FLH A;  4MSQ B;  4N9F 4;  4RM9 A;  3NOB A;  3VTU A;  4CHM A;  3NY5 A;  3RZW C;  2LWP A;  3HM3 A;  3CMM B;  5IAA C;  2DLW A;  1QZE A;  1WVH A;  2LGX A;  4WWO A;  2D9W A;  1Z87 A;  3UIN B;  3QWM A;  3TL5 A;  2DAJ A;  1GC7 A;  3ULC A;  3DQV A;  4BBN C;  2D4Q A;  4E3C A;  2M17 A;  3HIZ A;  3RD2 A;  1H4R A;  5KQ1 A;  1RRB A;  1UNR A;  1YX6 B;  2D10 A;  2DHI A;  1DBH A;  1V86 A;  2Z59 B;  3IBE A;  2K1F A;  3B08 A;  1P1A A;  3A9K B;  4HDQ A;  4BKS A;  4MT7 A;  2GCL A;  2MBO A;  4A3O A;  5CX3 A;  3ZW3 A;  2MP2 B;  5IA7 A;  1V88 A;  1WGR A; 
#chains in the Genus database with same CATH topology
 1ZE3 D;  1TS4 A;  2K8C A;  2IGG A;  3DVN U;  4GZU A;  2WDV B;  2C5L C;  2JZZ A;  3PZ7 A;  2MH7 A;  2N9K A;  2JYE A;  2XEW A;  1GNU A;  2ROZ B;  1EM7 A;  4HAV B;  2YVC A;  1MPE A;  3DHG C;  3HVD A;  1YD8 U;  4W9H A;  2KAC A;  5C2T B;  1TBE A;  1QOB A;  2YLM A;  3V5W A;  2Y8F A;  3PEG A;  1E8X A;  1U5F A;  4NQL B;  3AEG B;  5AZG A;  1WGU A;  5DIF B;  4A9A A;  2W3R A;  2QJL A;  3AU5 A;  4HB2 B;  2LRU A;  4MJS B;  1XF5 L;  4TUU A;  1VZ8 A;  2VRW B;  1RRP B;  4LNI A;  2V3S A;  1ZP0 B;  2I1J A;  2L2I A;  2O2V A;  2KN5 A;  1UUP A;  4GIV A;  2NVU I;  3CIK A;  2KJ6 A;  3DHI C;  1ZDX A;  4LCD E;  4M0W B;  2CB8 A;  1OQY A;  2IO2 B;  1OTR B;  3LB8 C;  4TQ0 A;  1E7V A;  4WSF A;  1N61 A;  2ZEQ A;  5EE1 A;  3VUY A;  2ZPN A;  1JRO A;  1FNW A;  2E2X A;  1V49 A;  2KTF A;  3PLV A;  1V5M A;  3BWU D;  3VTV A;  4ZHP A;  4FJY A;  4GDK A;  1YQ3 B;  4F1S A;  4HCP B;  2IPK D;  4H8S A;  3UF8 A;  3PLU A;  4LNK A;  1XCQ L;  1VBH A;  1EAZ A;  1MFW A;  3IVF A;  3DVN V;  5J3T A;  1J7B A;  4ACF A;  3KYD D;  3N7C A;  1D6E C;  3ZKJ C;  3DCG A;  4PS8 A;  1DOI A;  1NI3 A;  1RFK A;  4NZL B;  1E9M A;  4LK0 M;  4HKQ A;  2K5P A;  2BS4 B;  4BAX A;  2MJ3 A;  2V0G A;  2KAJ A;  4ZRP A;  2PW9 A;  2RRF A;  2DZM A;  4GU2 A;  2FCS A;  5FK9 C;  3WA0 A;  1B1Z A;  4HB0 B;  1I4H A;  3KVF B;  1P7F A;  4P7I A;  2MWS B;  2WXN A;  3KW5 B;  4HAT B;  1WXA A;  1U2B A;  3AJ4 A;  3N30 A;  4IG7 B;  3E9P A;  1F52 A;  1CJE A;  1K52 A;  3IHP C;  3HVZ A;  2DX5 A;  2L05 A;  1BWN A;  2LGI A;  3SO6 A;  5AEK B;  1DYQ A;  1XX0 A;  2YEP B;  2N9E B;  5C5B A;  2NMQ A;  2Z0P A;  3PRZ A;  5G5H A;  4YSX B;  2W82 A;  4WWP A;  4RFB A;  4DK5 A;  1WXM A;  4JWU C;  2OOB B;  5AUI A;  2G3Q B;  3RI7 C;  4W9F A;  3ZLZ A;  4JKC A;  5D27 A;  2GI9 A;  3QWZ B;  3TIX A;  2CR5 A;  2IGH A;  2LOX A;  4XDD A;  3KLS X;  1I4X A;  3VAW A;  2GBM A;  3L10 B;  2RSG A;  1PUT A;  3WAN A;  2KUP A;  2KO3 A;  2QMT A;  2TSS A;  1HXY D;  4WWN A;  2D3C A;  4OVZ A;  1FXA A;  1YN4 A;  4B9K A;  4WUR A;  2WXM A;  1M94 A;  3UIP B;  2K0P A;  1FXT B;  2DZI A;  1EGX A;  1WWT A;  4JKA A;  2OQB A;  2JUO A;  4B6H A;  2MHJ A;  4CYE A;  4I6L B;  4M01 A;  2LUE A;  2BQQ A;  4HKZ E;  2GS0 A;  4WWM A;  1TKG A;  3PRE A;  3QAQ A;  2NPT B;  4B95 A;  1FHW A;  2LYD A;  1C4C A;  1AWD A;  1SHC A;  5TR5 A;  3NSU A;  1D5Z C;  1IRS A;  4Y94 A;  1XOD A;  3U4E G;  2CHZ A;  3F5R A;  2W9N A;  1H8C A;  3T8M A;  2W54 A;  1E90 A;  5AZH A;  4C00 A;  1KI1 B;  3Q3M C;  3AE8 B;  2ABD A;  4WQM A;  2MBE A;  3HW2 B;  2YEP F;  3NS1 A;  4NAW B;  3E9L A;  2R82 A;  1UF0 A;  1U27 A;  2JX5 A;  5HE1 A;  4PYU A;  3Q3O C;  3V62 A;  3GZN B;  1KLG D;  2KNB A;  1IYF A;  1BUI C;  2KDI A;  4EE2 A;  1WJU A;  3IAM 1;  2KCJ A;  4ANU A;  2I1K A;  2V3N A;  3KQ4 A;  4IWO A;  5J3Y A;  2GJY A;  4C56 C;  3P2B A;  5C23 A;  2ZKM X;  2K6Q A;  3MC8 A;  3U52 E;  2K00 A;  3EA6 A;  3PG7 A;  3DCX A;  1KOT A;  2H88 B;  1LQB A;  2IND C;  4US9 A;  4ZDV A;  2LG1 A;  2RDH A;  2UU7 A;  2K39 A;  1WGH A;  1DDV A;  2KJH B;  1L6V A;  1STE A;  5DPW A;  4EEW A;  1VJK A;  1V61 A;  1WG7 A;  1YJJ A;  3I9V 1;  2BWE S;  1JWM D;  4YT0 B;  2W3S A;  2KK8 A;  1HZ5 A;  2H7E A;  3X23 A;  4HHV A;  3ZNH B;  5CLQ B;  3M95 A;  3ZTD A;  3D8E A;  4II2 B;  4II3 B;  4WAA A;  1QT9 A;  2B3A A;  2AX5 A;  4RGN A;  1C4A A;  2J0J A;  2JF5 A;  5IN7 A;  1JWS D;  2JZ3 B;  4IM3 A;  2KXJ A;  2J52 A;  3A9J A;  4ZYN A;  1AAR A;  2GBK A;  2M38 A;  2KD0 A;  2NS5 A;  5L81 A;  3N20 C;  4LDT D;  5BYR A;  1U5D A;  2H89 B;  4FHJ A;  3DPD A;  2J53 A;  3BJI A;  4G11 A;  5BYQ A;  4PK1 A;  1LB1 A;  2B76 B;  2IBI B;  1E8Z A;  2WXL A;  2MA9 B;  5J18 A;  1E10 A;  5DPT A;  4BOZ B;  1FFV A;  4OZA A;  2WX1 A;  5IOI A;  2HTM E;  4YTM B;  2YT1 A;  4CHJ A;  3KUD B;  2XK5 A;  1RJ2 A;  3AH7 A;  2LD9 A;  1ZDV A;  4NJ7 A;  2D2Q A;  3OAN A;  2WXO A;  2V76 A;  4HVB A;  1MHX A;  1QIL A;  2LBB A;  1WZ3 A;  1WRD B;  3ZUN A;  4URK A;  1DOX A;  3ZVR A;  4A6H A;  1SF0 A;  4FUL A;  2WXG A;  1SEB D;  3LJ3 A;  4P1C C;  3M1I B;  2YSZ A;  1IGD A;  3RUI B;  1J7C A;  1WFY A;  1ZM0 A;  3P4Q B;  4AS1 A;  4IC7 B;  3R8B A;  4EJN A;  1F77 A;  2BKF A;  4NSW A;  4PQ0 A;  3M63 B;  1S1Q B;  2KX0 A;  2HDE A;  3BVM A;  4FJV B;  3DWM A;  5D3W A;  4J3O D;  4K3C A;  2GLS A;  2BKR B;  4TQ1 A;  1Q67 A;  2CU1 A;  3DBH B;  4RGO S;  4TMA B;  1WXV A;  2XN9 C;  1ZUD 2;  3CIR B;  4L23 A;  4RGM A;  1TGZ B;  1NVL A;  1L4D B;  3A98 B;  3VUW A;  3QBV B;  1MK7 B;  2JVC A;  3W1S A;  3PS6 A;  2K8B A;  3OG5 A;  3VRB B;  2KAN A;  1FCL A;  4HAX B;  1UEL A;  4OVV A;  2D9X A;  1X1M A;  2VKI A;  3SBT A;  3GOE A;  1FRD A;  4IOI E;  2N7D A;  4KHO A;  5AUK A;  3W9C B;  2FUH B;  2IJ0 A;  4K3B A;  3TSS A;  2XBB C;  3RNF C;  1WR1 A;  2GCJ A;  2NTS A;  1QKZ A;  4AJW A;  2V1Y A;  5JH5 C;  2EKE C;  3WAP A;  3PSC A;  1WGQ A;  2G35 A;  1MIX A;  2N9P C;  4B0M A;  5HFY A;  2BYT A;  2MFQ A;  4N59 A;  1U29 A;  1F0Z A;  2J59 M;  2QKL A;  2Z14 A;  3A9K A;  4DBG A;  3AUL A;  1FM0 D;  1GG3 A;  4N9F 4;  2D3B A;  2EKI A;  3VTU A;  4CHM A;  2LWP A;  2INN E;  1QZE A;  2LGX A;  2D9W A;  1Z87 A;  1GC7 A;  3N1Z C;  4BBN C;  2WXR A;  3VR8 B;  1RRB A;  3IBE A;  1P1A A;  3VRA B;  2ONQ A;  4HDQ A;  3B77 A;  3DWG C;  5CX3 A;  3ZW3 A;  1WGR A;  1TZ1 A;  2VZK B;  2NCN A;  5JZE B;  2KDB A;  4X57 B;  2WXH A;  3Q8C A;  1MJD A;  2PIA A;  4L1R A;  2EJ8 A;  1W1D A;  4WIP A;  3V61 A;  1KRH A;  4MEM A;  2N0Y A;  2Z13 A;  3HM6 X;  1SB3 C;  3SV1 A;  1HB8 A;  1MAI A;  1R4M B;  5IP4 D;  1ZW7 A;  2GUM A;  3UQA A;  2D9Y A;  1LM8 B;  2QKM A;  3NVV A;  4JWS C;  2LGD A;  3FP5 A;  1K51 A;  1X1G A;  1ST7 A;  3B2G A;  3IT6 B;  1PFJ A;  4K7U A;  1R4N I;  5T8I A;  4K81 A;  5H92 C;  2FIF A;  3ZNI D;  5C6R A;  3TEW A;  4ANX A;  4ICU A;  4TKN A;  3PRM B;  2K3U A;  2KJR A;  4N6E B;  1ZXH A;  3ZQ4 A;  1HB6 A;  3WYF B;  3PV1 A;  1PGX A;  3U2S C;  3AN1 A;  3QA8 A;  3A8P A;  2LGY A;  1TZO A;  4S0R A;  3F0W A;  3T06 A;  1WM3 A;  3KWL A;  3B2F A;  3BYY B;  5D3D A;  4NJC A;  5C79 A;  1JQ4 A;  4BFR A;  2WXP A;  2MKR A;  1EVH A;  1RYJ A;  3L16 A;  1AQC A;  2K6D B;  3P1M A;  2HRJ A;  3DBS A;  1AYF A;  3OAW A;  3HQC A;  3VVW B;  4GDL A;  4HK2 A;  3AE2 B;  2LUL A;  1X1F A;  1WYG A;  1V1P A;  1FHX A;  1FCC C;  4A6F A;  1D4B A;  1UBI A;  2WU2 B;  4ILJ A;  1J0G A;  4WJO A;  3MJW A;  4FBJ B;  4D6W A;  2Z4D A;  5IJM A;  4GMV A;  3U7D A;  1YIW A;  3W1Y A;  2L00 B;  5E6J A;  1GAQ B;  3UGB B;  1MPH A;  5I2M A;  4BZA A;  1JRU A;  2M1M A;  3QK0 A;  2I5C A;  1XLP A;  2O6V B;  4A5K A;  1FHO A;  3O96 A;  1PQS A;  2LVQ A;  3WIM A;  3AU4 A;  2KYW A;  1WMH B;  2LHE A;  1V6E A;  5LOP B;  5IKC M;  4KHB B;  3NZU A;  3PRP B;  1WRI A;  2KWD A;  3I57 A;  1WIA A;  5DI9 B;  4I6P A;  3SHQ A;  2GBR A;  5GXG B;  1BT0 A;  1TKY A;  2RR9 A;  3GP7 A;  1DIK A;  4IAP A;  1XLO A;  1EU4 A;  5D2M B;  5JVL A;  2K22 A;  2MJE A;  2XK5 B;  4JK8 A;  5LXH A;  3FM8 C;  1C77 A;  2R09 A;  3JSV B;  2N7J A;  1V5O A;  2K8H A;  3TMP B;  1QQG A;  1D5M C;  4ZRI A;  4DHZ B;  1V2Y A;  4NAW A;  4DXA B;  4QJ5 B;  1KBL A;  1K5D B;  4KHA A;  2FCN A;  3A1Q A;  3FAH A;  4KVG B;  1QOG A;  3WAM A;  1BAK A;  4XGA B;  2CJO A;  4DXF A;  3ODX A;  3TUO A;  4LLG M;  3JYU A;  3L13 A;  1X86 A;  4A3P A;  2HD5 B;  2EEL A;  3KRX A;  4JKG B;  1NYQ A;  2RPQ A;  4KIK A;  3EGR A;  5LLI A;  1L0Y B;  1HA5 A;  2MP2 A;  1OQN A;  2BB6 A;  2GMI C;  1V97 A;  1FFU A;  1OEY J;  3PP2 A;  1W1H A;  3MHZ A;  2MX2 A;  2KWV B;  4Z2M B;  2COD A;  1SSN A;  2WXK A;  3ABV B;  4K2O A;  1LXD A;  2VH2 A;  1C76 A;  2YRY A;  2M8S A;  4BVU C;  1JWU D;  2JT4 B;  3L0W B;  4MGZ E;  2INP E;  1XCT L;  4MH0 E;  3DBR B;  3OJ4 B;  3T3O A;  1HTO A;  1XKE A;  5EE9 A;  3EC8 A;  1N62 A;  2WNM A;  3K9P B;  3P4P B;  1MVK A;  1R4N B;  1KLU D;  1TS3 A;  3QC8 B;  2CQU A;  3D8F A;  2KDM A;  4HAZ B;  4XWW A;  2KMC A;  5JP4 A;  2KGX B;  3SEB A;  3A9J B;  4D2K A;  3V3X A;  3KRW A;  5HG2 A;  2ZVN A;  2D9Z A;  1MK9 B;  2Y8G A;  1L7Y A;  4XX5 A;  3V60 A;  2JP2 A;  1SJH D;  1Y8R C;  4WQO B;  1C1Y B;  1FAO A;  1NTV A;  4FN2 A;  1ROE A;  4LNO A;  1KC7 A;  3QQ8 B;  2MJD A;  1V5U A;  1Q0W B;  2W2X C;  4TYZ A;  1FOE A;  3VDZ A;  2RNR B;  2LOZ A;  4WJQ A;  1SIJ A;  2WYQ A;  4K7S A;  1JW9 D;  1E7P B;  2BS3 B;  4NQK E;  4A6Q A;  4GOU A;  1BXT A;  2QC8 A;  3CST A;  5LXI B;  2KTR B;  3TO1 A;  5DHA B;  3DBR I;  2MBH A;  2LVP A;  3Q14 C;  2PJH A;  2H7D A;  2IFS A;  3SU8 X;  3URY A;  4CHK A;  2HJ8 A;  2GBJ A;  1WYW B;  3DVG X;  2COA A;  3ZIM A;  4DQO C;  4HAW B;  2UYZ B;  3X0W A;  1FIQ A;  3DXE A;  4PNK A;  1FO4 A;  4GB9 A;  3SUZ A;  3R66 C;  2KTR A;  3D32 A;  2K2U A;  5J3Q A;  2WWZ A;  3BK2 A;  2LJ5 A;  4DWF A;  3GB1 A;  4ANV A;  4EZJ A;  4NY0 A;  1Y19 B;  4ZRJ A;  3KUZ A;  1QLB B;  1UEF A;  3EHV A;  2KQS A;  4PT5 A;  2JRI B;  2EMT A;  4H2A A;  2PLP A;  3MC0 B;  1PGA A;  3H7P A;  3E66 A;  2LEK A;  2LVO A;  3LYY A;  2YF0 A;  4EMO A;  1RLF A;  4JX1 C;  1I4Q A;  1T0Q C;  2L83 A;  1HE8 A;  4JLC A;  2D3A A;  2GOW A;  2JWU A;  3KYC D;  2D3G A;  1C79 A;  3ULB A;  3TEZ A;  2MEK A;  1DRO A;  3H9D A;  3UIO B;  1F2R C;  5I4D A;  3T9L A;  4BBN F;  3QAR A;  3B0A A;  4L2Y A;  2FID A;  1NDD A;  1WXQ A;  4Q2J A;  1MI0 A;  1AN8 A;  3PT2 B;  3H7P B;  3PHX B;  4XYC A;  3I63 C;  2DEN B;  4ZRK A;  2DA0 A;  5LON B;  4YTP B;  3RNA C;  5D3X A;  4MDK E;  1FD6 A;  3IG3 A;  2AWT A;  2DN6 A;  2BYE A;  5DHF B;  4EZL A;  1UGM A;  3FLV A;  4KDL B;  3BYT B;  1WY8 A;  4JKH A;  3RT3 B;  4K1R B;  2UWQ A;  3LXF A;  3W5V B;  3FIL A;  2PKO A;  3NUH B;  1I7A A;  4XE0 A;  2CAY A;  4A90 A;  1D3Z A;  2PEA A;  3O65 B;  4PS7 A;  4HLE A;  3J9C A;  1T3Q A;  3W2D A;  5D94 A;  3CXB B;  1P3Q U;  2L3Z A;  1P6S A;  4F7G A;  2NTT A;  2BYF A;  4REZ A;  3MP9 A;  2COC A;  2LZ6 A;  1Y5O A;  2DFK A;  1XEE A;  5EE0 A;  2DX5 B;  2YT0 A;  2CHW A;  1CQV A;  4JIO U;  1HEZ E;  2MRP A;  4YXD B;  3U8Z A;  2LXC A;  4OSN A;  1QC6 A;  2KFK A;  1Q1O A;  4C0A A;  1I4G A;  3A1Q B;  4ASW C;  1IGC A;  1EF5 A;  2G4D B;  1WJN A;  3KH0 A;  1FGY A;  3DBL I;  2C9W B;  2OHF A;  1JRP A;  2C60 A;  2KC1 A;  5BMH A;  4QAY A;  5L95 C;  3TVV A;  1SBB B;  4ZRQ A;  1MG8 A;  5KCV A;  3S2A A;  4DHJ D;  1C9F A;  5C1Z A;  2BT6 A;  4ILH A;  4HAU B;  2COF A;  4FLH A;  3NOB A;  3CMM B;  2FJU B;  3E9O A;  2DLW A;  1WVH A;  4WWO A;  4E3C A;  2DAJ A;  2M17 A;  3HIZ A;  5IO9 A;  1QF6 A;  5KQ1 A;  1UNR A;  1DGJ A;  1YX6 B;  3ETR A;  1DBH A;  2Z59 B;  3B08 A;  1SJE D;  3GE3 C;  4BKS A;  1TJE A;  2GCL A;  4A3O A;  2MP2 B;  1V1P B;  3A58 A;  1V88 A;  2G9H D;  5C3J B;  4MEL A;  4JK7 A;  1NYR A;  1XR0 B;  2L8J A;  4MAC A;  5G2N A;  2ZCC A;  4YWG G;  2YS1 A;  3R2T A;  3B9J A;  4IOY X;  1V9J A;  1FEH A;  1NEN B;  3C8Y A;  1A70 A;  3VOQ A;  1QOA A;  4GLS C;  2COP A;  3PHW B;  2WU5 B;  4QXA B;  1I35 A;  2CY4 A;  2R61 A;  2I38 A;  3IT4 B;  4KAX B;  2ZW1 A;  3C0R B;  2FCQ A;  3AB5 A;  2XQN M;  1L5P A;  1V5P A;  1P0R A;  2ZPY A;  1DDM A;  3TW1 A;  3JVZ X;  2RLO A;  4DX8 A;  3RPF C;  3TEY A;  4A20 A;  1D5X C;  3DXC A;  4E74 A;  1NBF C;  1GGO A;  5C16 A;  2R2Y A;  2D5G A;  2FAZ A;  1WF9 A;  3OWE B;  2IZV B;  3UI3 A;  5I2S A;  4L6E A;  1OY2 A;  1MHH E;  1YJI A;  2QDF A;  3ZVV A;  2DYQ A;  5FKA C;  2LFI A;  3UQB A;  3JW0 X;  1ZSQ A;  4LTU A;  1U4A A;  2A4Z A;  2P0F A;  2KQ7 A;  2ZNV B;  2QCZ A;  1OQQ A;  3R7Q A;  2BF8 B;  2MCN B;  3DVG Y;  1IBX B;  1YQ4 B;  1OEY A;  1UH6 A;  1QOF A;  3W5U B;  2KIE A;  3MPX A;  1FGZ A;  2JXT A;  5D3I B;  3AEE B;  3AV8 A;  1WGD A;  1LW3 A;  1YNT E;  2JQR B;  4KIK B;  3AXC A;  4MM3 A;  2IYD B;  4NJ6 A;  4F7Z A;  5IRS A;  3RFZ B;  1UGJ A;  1CZP A;  2L0F A;  2KDF B;  1ZPS A;  2W55 A;  3ZJT A;  4BKS D;  1WGY A;  1UWX A;  3NVW A;  1JAL A;  1V81 A;  3FKY A;  2Y7B A;  3KSY A;  3NVY A;  2JWZ A;  3FIL B;  4JKD A;  1KLV A;  2IY0 B;  1I2H A;  2L0T A;  3BVG A;  2CU3 A;  4YON A;  4ARC A;  1ISN A;  3BK1 A;  2MBQ A;  1TY0 A;  4UDU C;  4A55 A;  2R2Q A;  2CS4 A;  2WXQ A;  3HIE A;  3TEX A;  4KGR A;  1P5T A;  3MJ5 A;  1WE7 A;  1ZOY B;  3APF A;  1J0W A;  1V89 A;  4DHZ E;  2FDQ A;  2G45 B;  1GPX A;  2DIK A;  4PS3 A;  2D9V A;  4KZC A;  1L6U A;  3H8H A;  3ZDM C;  4WJN A;  1MG4 A;  1P3R A;  4JKE A;  1E7U A;  3OLM D;  2K2J A;  3TFM A;  4KHB A;  4GN1 A;  3WAO A;  1SGH A;  4FXC A;  3NZ3 A;  1ET9 A;  2M14 A;  4JGH B;  3VXW A;  1WX9 A;  5CLL B;  1XQQ A;  2KVZ A;  3VQI A;  4AOF A;  1ZC4 B;  2BGF A;  1UNQ A;  2MWN B;  2L52 A;  2RMM A;  2ADZ A;  1KZG A;  3V6E B;  2NBW B;  5BO4 B;  2RD0 A;  4AWJ A;  2MW5 A;  4M00 A;  2Z0E B;  3VHT C;  5DH9 B;  4DBB A;  3FVC A;  4HXD A;  4MGY E;  4BOS C;  4GOC A;  3QJZ A;  3EUB 2;  3Q3J A;  4BBK A;  4AP4 C;  3OHM B;  2D07 B;  1V1O A;  2ZCB A;  3SYX A;  4K17 A;  2BVC A;  1SIF A;  5E6N A;  2WQY B;  1SE9 A;  2AYO B;  5G5G A;  4B6W A;  5D6J B;  2ELA A;  3AE5 B;  2RGF A;  1YQB A;  4RM8 A;  3L17 A;  3ZRF A;  1WE6 A;  2OJR A;  3NWF A;  2Z8L A;  1OFF A;  2K9X A;  1L0V B;  3ALB A;  3R2I A;  5EDS A;  2X18 A;  2R0D A;  2IDY A;  2Z0O A;  2K8E A;  5KHQ A;  4W9E A;  1E8W A;  3N1Y C;  2W2X D;  5EFX A;  1XO3 A;  1WSP A;  2JRH A;  2CY5 A;  2L7R A;  4O1N A;  4XZ4 A;  2ZZP B;  2QHO A;  5LG4 B;  1MIZ B;  2M4N A;  3QHT A;  4R3D A;  1GUA B;  1FMA D;  2YS3 A;  1L2N A;  2OTX A;  4HRS A;  1RAX A;  3GYO A;  3P7Z A;  1U5G A;  3MHS D;  3VFK A;  2FJ9 A;  4JPS A;  4KZ0 A;  2JXX A;  2DHJ A;  4F7U P;  3ZJV A;  3B1L X;  3U7Z A;  2CHX A;  2KKC A;  5CTR C;  4QJ4 B;  3L54 A;  2RQ1 A;  1TXD A;  1WJ6 A;  3NHE B;  2NBU A;  1ACA A;  1XLQ A;  2FNJ B;  2KX3 A;  3ONS A;  4US8 A;  4GXB A;  3E56 A;  2FUG 1;  4W9L A;  1K50 A;  2WS3 B;  4LDT B;  3ENB A;  1Q5W B;  4XDC A;  1VZ7 A;  4KDI C;  4N58 A;  5BMG A;  4OT1 A;  4NAM A;  4HSI A;  1TKE A;  5CHV C;  2BB5 A;  2N4F A;  4IM2 A;  2J0K A;  2QIL A;  3N1X C;  2N7E A;  4HPL B;  4MGI E;  2K25 A;  2X38 A;  3MDB C;  2WXF A;  1HQR D;  2C7H A;  3BZD B;  4NNJ B;  1WJ4 A;  2J0M A;  4IUM B;  4J6I A;  1KF6 B;  1E6E B;  2MSE D;  4WAF A;  2BYV E;  1IUE A;  3ZNZ B;  2LAS A;  1UNS A;  2LHD A;  3MC9 A;  2L76 A;  4FJZ A;  1N63 A;  2CRF A;  5HE0 A;  3WCQ A;  3GE8 C;  1T77 A;  4OZB A;  4ZHO A;  2KFJ A;  1YMH E;  2PMV A;  3E9S A;  1F9J A;  2ZVO A;  2KT7 A;  1ESF A;  1XD3 B;  3VH3 B;  1I42 A;  2FCM A;  1J8C A;  4P16 A;  3ML4 A;  1TS2 A;  3BVZ A;  2V9H A;  4M0W A;  1M7R A;  1WXS A;  4XC2 A;  5GOW B;  5DPR A;  2CJN A;  1UD7 A;  4C4V A;  3AEB B;  1EU3 A;  1DDW A;  4EKU A;  4RH6 A;  4IDI A;  4K7W A;  3AEC B;  4W9D A;  2RDG A;  4W9I A;  1V8C A;  5D7G A;  2KC2 A;  2UVM A;  2NBV B;  3CWI A;  4MSM B;  3ECI A;  4RF1 A;  1WGK A;  4IFS A;  1ENF A;  2FE8 A;  5KQ4 A;  1RFA A;  5JXV A;  2SAK A;  1ZGU B;  4G0N B;  4A6F B;  1R7S A;  1OMW A;  2MLB A;  1HZ6 A;  3FSS A;  1BTN A;  2KQ4 X;  2G4S A;  1PGB A;  3SDL C;  2N1V A;  3PVL A;  3AE7 B;  1VZ6 A;  2PPH A;  5G55 A;  2KWU B;  1LGR A;  4JK9 A;  1WJM A;  2MQJ A;  2WDR B;  1Z5S B;  4WJP A;  1K53 A;  1C78 A;  1UZX B;  3EFU A;  4MH8 A;  5J2R A;  3Q8A A;  4ZOH C;  2ROV A;  1TQZ A;  3ML8 A;  1F2R I;  1IBX A;  4AJY B;  4ZYS A;  1L0X B;  2AL6 A;  2FJL A;  4IW0 A;  2YT2 A;  2DLB A;  4USA A;  2WXJ A;  1EF1 A;  3VTW A;  2YS5 A;  4YL8 A;  3L08 A;  5CHF A;  2ELB A;  1QQR A;  1GJZ A;  2PVO D;  4ANW A;  4DIX A;  2SEB D;  4HB4 B;  1J7A A;  1LFD A;  2KLC A;  2REX A;  3IAS 1;  4CO7 A;  2EC1 A;  2PZ1 A;  3NRZ A;  4AUQ C;  1B9R A;  1N5W A;  2O2V B;  3P4R B;  3RN9 C;  5BYS A;  3APC A;  4MJS A;  2V4L A;  3SNH A;  1UNP A;  2A5U A;  4IWQ A;  4XWT A;  3G9W A;  2QIE B;  2KLG A;  5FI1 A;  3NG0 A;  5J17 A;  5E6O A;  4W9J A;  4ARI A;  2HJ1 A;  2DBY A;  3AM9 A;  2LJI A;  1GOZ A;  4KKJ A;  3NZS A;  4HAY B;  2RPV A;  1KH0 A;  2LRW A;  3MTN B;  1VBG A;  3AE6 B;  3DBL B;  3RZW C;  4YSZ B;  4JKB A;  3HM3 A;  5IAA C;  4GNK B;  2AQ1 B;  3DQV A;  3ULC A;  2JZP A;  2D4Q A;  4JE3 B;  2WGS A;  1TY2 A;  1H4R A;  3RD2 A;  5FR3 A;  2D10 A;  2DHI A;  2AQ2 B;  1GB1 A;  3A9K B;  4CSQ A;  1I4R A;  4MT7 A;  2MBO A;  5IA7 A;  3H1U A;  3Q69 A;  3P4S B;  1V5T A;  1ET6 A;  1MI1 A;  2LMC A;  4EFO A;  1HTQ A;  2K49 A;  1SE2 A;  4G3X B;  1T0Y A;  1NI2 A;  4I6N B;  1RWS A;  4JQW C;  4OVU A;  4W9K A;  2P8V A;  4DXG A;  2GB1 A;  3ZRC A;  2WXI A;  1JDE A;  3ODW A;  1ZYI A;  2Z0D B;  4M8M A;  1S3S G;  3SR6 A;  2DX1 A;  1N5X A;  2WH5 A;  2CKH B;  2ZJD A;  3TCA A;  4GGQ A;  5JHH A;  4HPM B;  3ODO A;  3A8Q A;  2BCJ A;  2J4X A;  2W2W A;  3AMZ A;  2LGS A;  2M56 B;  4KKI A;  3KWV A;  2VZK D;  1ZC3 B;  2FBW B;  4A6K A;  5TSS A;  5HHD G;  1ZVR A;  2IYB A;  4KSL C;  5HKH A;  1Q10 A;  1W1G A;  4W9G A;  2ZNV C;  1M7E A;  3V6C B;  3Q6B A;  3GS2 A;  3PPA A;  1H10 A;  2RUK B;  3UZT A;  4ITK A;  5MPO A;  3AE4 B;  4E71 A;  1JML A;  4OHJ A;  4EUT A;  1ZKH A;  2X0S A;  5D3V A;  2GRI A;  2E6X A;  2VSZ A;  2DYM A;  5H8Y E;  1XCG A;  3GZN I;  3HSA A;  1ZXI A;  3V05 A;  1Y56 A;  4RMA A;  2DAF A;  3Q8E A;  1E8Y A;  5FR6 A;  1KM7 A;  2UZR A;  2E3T A;  2DWQ A;  4ICV A;  4GSW A;  3SD5 A;  2ASQ A;  2NBV A;  4MK0 A;  3RNC C;  2P0D A;  3HHM A;  3APD A;  1WJ1 A;  1UBQ A;  1K5G B;  1T5X D;  2IO1 B;  3KUC B;  3M3J A;  3RCP A;  3U12 A;  3RCZ A;  4DDG D;  3O13 A;  5KHO A;  1KFY B;  1DOY A;  1MKE A;  3ZYY X;  2JYT A;  3Q8B A;  4FA6 A;  1ACC A;  3R3M A;  3FC4 A;  1I7H A;  3QX1 A;  4IM0 A;  1WH3 A;  1BTK A;  3VUX A;  1GC6 A;  2Y3A A;  4BKT A;  2BWF A;  2INC C;  3DHH C;  5EE3 A;  5D3Y A;  2WDT B;  2LXA A;  4GPT B;  4ILG B;  1IPG A;  2JU6 X;  3AED B;  2JY6 A;  3L4P A;  2AQ3 B;  2DKP A;  1T0S C;  2KMA A;  2O6V A;  2I2Y A;  2RDB C;  2WP9 B;  1YOV B;  2QEJ C;  4HJG E;  3D8D A;  3ZJU A;  3PGE A;  3PZ8 A;  4TV3 A;  1WMH A;  4XWX A;  3QIJ A;  2BS2 B;  3ZGZ A;  3AEF B;  3RNB C;  1FNU A;  1T0R C;  4A8X C;  3MFG A;  1DYN A;  2KWC A;  1AWE A;  3KY9 A;  1CMX B;  3ZDT A;  3IFW B;  4DDI D;  4DHJ B;  1AW7 A;  4Z2N A;  3TBL D;  1YJ1 A;  3LJU X;  4G50 A;  2NZ8 B;  1WR6 E;  2Q13 A;  1WX7 A;  4F7H A;  1KZ7 A;  3JSV A;  3EPY A;  1N60 A;  1R4M I;  1SE4 A;  2V3P A;  2KDE B;  1PLS A;  1I4P A;  3A4S C;  4WVF B;  1V80 A;  2X8X X;  1VLB A;  4K2P A;  1KJT A;  4MM3 B;  2OED A;  4KSK C;  4OW0 A;  4PYZ A;  4W9C A;  2Z0Q A;  4C7Z A;  1T6B X;  1SE3 A;  4KV2 A;  3R7R A;  4EZK A;  3Q3F A;  2I5F A;  5M4Y B;  1KTK A;  2DYB A;  2DZK A;  1U5E A;  2PE9 A;  3PTF C;  4P6V F;  2BTE A;  2NMB A;  2KZR A;  5DPS A;  3DBH I;  1VRA B;  1EWY C;  3ZO5 B;  4TSS A;  2DKQ A;  4FAD A;  3DDC B;  3AI5 A;  1XT9 B;  3HUI A;  4B0E A;  5JHB A;  2MBB B;  4HJK A;  3IXS A;  3NJT A;  1TT5 B;  5L83 A;  2KIG A;  3SFE B;  1LO5 D;  3BII D;  2NR2 A;  1B55 A;  1TS5 A;  4KGT A;  2Q5W D;  2N0S B;  4RGT A;  1N3H A;  5CHW A;  5BMI A;  1WZ0 A;  1WI0 A;  2IY1 B;  1VR9 A;  4DX9 0;  1JWB D;  3H6N A;  4RF0 A;  4GDL B;  2C7M B;  4HCN B;  4M8N A;  2VH1 A;  2OJW A;  1X05 A;  4C4V B;  3PVU A;  2J7Q B;  1EUV B;  2KUQ A;  1E0Z A;  1NU2 A;  4IKG A;  2VRR B;  1G6J A;  3N32 A;  4MY6 A;  2M0X A;  2DNF A;  2QSD A;  3VH4 B;  2ICI A;  1P98 A;  1OQR A;  3M62 B;  3T3N A;  2PE6 B;  3HK0 A;  2LUM A;  1JCK B;  1NTY A;  3DXD A;  4WH4 A;  2DYN A;  1IP9 A;  3SBG A;  3BY4 B;  1CK1 A;  5LNK 1;  3PSE B;  2DYO A;  1Z2M A;  3RYT A;  4BKG A;  3QCA A;  3LDZ E;  1HBK A;  2RSU A;  4HWI B;  2M19 A;  4IWP A;  2IO0 B;  1WM2 A;  3RZF A;  4JKG A;  4AQ7 A;  2MDX A;  3BIN A;  3NS8 A;  1OGW A;  2JPH A;  1K8R B;  4C80 A;  3P6A A;  3EEC A;  3AE3 B;  1FXI A;  2D11 A;  1F1H A;  3VR9 B;  1FPY A;  1L4Z B;  2HTH B;  1X11 A;  1SXT A;  2N9L A;  1RM6 C;  2KN4 A;  2EMS A;  1N6Z A;  5HE2 A;  5JLJ B;  2PTL A;  1YN5 A;  1TYG B;  1PDX A;  3CF6 E;  4JL9 A;  1XXG A;  2AL3 A;  2XNA C;  1WX8 A;  3VIA A;  1C3T A;  2DTC A;  3FEH A;  3NWD A;  1NVI D;  1YX5 B;  4HRO A;  4GMX B;  2L1A A;  1TTN A;  4JKF A;  2KOX A;  3SFD B;  3KZ1 A;  3AE9 B;  4FHK A;  4D0N B;  3P42 A;  5JHG A;  2AEH A;  4GDK B;  4C7Y A;  1NTI A;  4YSY B;  2DHK A;  5HI1 A;  1XLN A;  1PMS A;  5E6P A;  4LJP B;  3RUL A;  4LNN A;  4HB3 B;  3ENE A;  3WAL A;  2L32 A;  1GB4 A;  3PZD A;  1PYW D;  2GBN A;  4MT5 A;  1FB8 A;  2IGD A;  2M0A A;  2PVG C;  2P0H A;  1M4V A;  2ON8 A;  2BW2 A;  4HEA 1;  5AZF A;  3NW8 A;  2ACZ B;  3Q8F A;  4LNF A;  3C19 A;  2WHI A;  3Q3N C;  3Q2A C;  3HRD D;  2KR0 A;  3GYP A;  5FI0 A;  1EWC A;  5GMV A;  4QJ3 B;  3I3T B;  1VDV A;  3I5J C;  3ML9 A;  2LI5 A;  2WX0 A;  4YTN B;  3H7S A;  2L1C A;  3K9O B;  2IO3 B;  2HTH A;  1J19 A;  1YN3 A;  5DCN A;  1WI1 A;  3P63 A;  3AEA B;  2ZW0 A;  2N23 A;  3ZXV A;  4HDO A;  3RMK C;  2BBC A;  3ZTC A;  1BML C;  1VCB A;  3PVW A;  2WLB A;  3EFC A;  2DZJ A;  1XD4 A;  1P9D U;  1VD2 A;  2BPS A;  3ZNG C;  2O6V D;  4M02 A;  2N9X A;  1EO6 A;  3NVZ A;  1UPR A;  4NPN A;  1FRR A;  1E5W A;  5C5B B;  2Y5C A;  3OJ3 A;  3DOW A;  2KHW B;  4KGS A;  2HE7 A;  3N3K B;  1TJ6 A;  3NWA A;  4P1B C;  3TJP A;  2V4I B;  3A4R A;  4CQN A;  2LKO A;  2DHZ A;  4KX6 B;  2N1W A;  1C4P A;  2C7N B;  2Y5P A;  4RCO A;  5JHA A;  4HPP A;  2R2O A;  2NPT A;  4OZC A;  1UPQ A;  3CSF A;  4F8C B;  2KMM A;  4S17 A;  3ZXR A;  3AE1 B;  1A5R A;  4LJO B;  1P7E A;  2Y5B B;  2KVR A;  3PO0 A;  3A33 B;  2G1E A;  2J42 A;  4EOY A;  3U30 A;  5HE3 A;  4WJ7 A;  2UZS A;  2KFK B;  4L1B A;  1FNV A;  4RNA A;  1WGG A;  1UWM A;  2RVB B;  2RGN B;  4MGK E;  3W1S C;  2Z59 A;  4MSQ B;  4RM9 A;  3NY5 A;  1NEK B;  3RNE C;  2JSV X;  2WDQ B;  1PFD A;  3UIN B;  3QWM A;  3TL5 A;  3RNG C;  1TIF A;  3N9Y C;  1V86 A;  2K1F A;  1JWA D; 
#chains in the Genus database with same CATH homology
 2K8C A;  3DVN U;  4GZU A;  2C5L C;  2JZZ A;  2XEW A;  1GNU A;  2ROZ B;  4HAV B;  2YVC A;  1YD8 U;  4W9H A;  1TBE A;  2YLM A;  3V5W A;  2Y8F A;  3PEG A;  1E8X A;  1U5F A;  4NQL B;  5AZG A;  1WGU A;  5DIF B;  3AU5 A;  4HB2 B;  2LRU A;  4MJS B;  4TUU A;  2VRW B;  1RRP B;  2V3S A;  2I1J A;  2L2I A;  2O2V A;  2KN5 A;  4GIV A;  2NVU I;  3CIK A;  2KJ6 A;  4LCD E;  4M0W B;  2CB8 A;  1OQY A;  2IO2 B;  1OTR B;  4TQ0 A;  1E7V A;  4WSF A;  2ZEQ A;  3VUY A;  2ZPN A;  1V49 A;  2E2X A;  2KTF A;  3PLV A;  1V5M A;  3VTV A;  4FJY A;  4GDK A;  4F1S A;  4HCP B;  4H8S A;  3UF8 A;  3PLU A;  1VBH A;  1EAZ A;  3IVF A;  3DVN V;  5J3T A;  3KYD D;  3N7C A;  3ZKJ C;  3DCG A;  4PS8 A;  2DZM A;  4GU2 A;  2FCS A;  3WA0 A;  4HB0 B;  3KVF B;  4P7I A;  2MWS B;  3KW5 B;  4HAT B;  1WXA A;  1U2B A;  3AJ4 A;  3N30 A;  4IG7 B;  3E9P A;  3IHP C;  2DX5 A;  2L05 A;  1BWN A;  3SO6 A;  5AEK B;  1XX0 A;  2N9E B;  5C5B A;  2Z0P A;  3PRZ A;  4WWP A;  4DK5 A;  1WXM A;  2OOB B;  2G3Q B;  4W9F A;  3ZLZ A;  4JKC A;  5D27 A;  3QWZ B;  3TIX A;  2CR5 A;  2LOX A;  3VAW A;  2GBM A;  3L10 B;  2RSG A;  3WAN A;  2KUP A;  2KO3 A;  4WWN A;  4B9K A;  1M94 A;  3UIP B;  1FXT B;  2DZI A;  1EGX A;  4JKA A;  2OQB A;  2JUO A;  4B6H A;  4CYE A;  4I6L B;  2LUE A;  2GS0 A;  3PRE A;  3QAQ A;  2NPT B;  4B95 A;  1FHW A;  2LYD A;  1SHC A;  5TR5 A;  3NSU A;  1IRS A;  4Y94 A;  1XOD A;  2CHZ A;  3F5R A;  2W9N A;  1H8C A;  3T8M A;  1E90 A;  5AZH A;  1KI1 B;  2ABD A;  2MBE A;  3HW2 B;  4NAW B;  3E9L A;  2R82 A;  1U27 A;  5HE1 A;  4PYU A;  3V62 A;  2KNB A;  1IYF A;  2KDI A;  1WJU A;  2KCJ A;  4ANU A;  2I1K A;  4IWO A;  5J3Y A;  2GJY A;  3P2B A;  5C23 A;  2K6Q A;  2K00 A;  3PG7 A;  1KOT A;  1LQB A;  4ZDV A;  2LG1 A;  2K39 A;  1WGH A;  1DDV A;  2KJH B;  5DPW A;  4EEW A;  1V61 A;  1WG7 A;  2BWE S;  2KK8 A;  2H7E A;  3X23 A;  4HHV A;  3ZNH B;  5CLQ B;  3M95 A;  3ZTD A;  3D8E A;  4II2 B;  4II3 B;  4WAA A;  2B3A A;  2J0J A;  2JF5 A;  2JZ3 B;  4IM3 A;  2KXJ A;  3A9J A;  4ZYN A;  1AAR A;  2GBK A;  2M38 A;  2KD0 A;  2NS5 A;  5L81 A;  4LDT D;  1U5D A;  4FHJ A;  3DPD A;  3BJI A;  4G11 A;  1LB1 A;  2IBI B;  1E8Z A;  2MA9 B;  5J18 A;  5DPT A;  4BOZ B;  2WX1 A;  2YT1 A;  4CHJ A;  3KUD B;  2XK5 A;  1RJ2 A;  2LD9 A;  4NJ7 A;  2D2Q A;  3OAN A;  2V76 A;  4HVB A;  2LBB A;  1WZ3 A;  1WRD B;  3ZUN A;  4URK A;  3ZVR A;  4A6H A;  4FUL A;  3LJ3 A;  3M1I B;  2YSZ A;  3RUI B;  1WFY A;  1ZM0 A;  4IC7 B;  4EJN A;  2BKF A;  4NSW A;  4PQ0 A;  3M63 B;  1S1Q B;  2KX0 A;  4FJV B;  5D3W A;  2BKR B;  4TQ1 A;  1Q67 A;  2CU1 A;  1WXV A;  1TGZ B;  1NVL A;  3A98 B;  3VUW A;  3QBV B;  1MK7 B;  2JVC A;  3W1S A;  3PS6 A;  2K8B A;  2KAN A;  4HAX B;  1UEL A;  4OVV A;  2D9X A;  1X1M A;  2VKI A;  3SBT A;  3GOE A;  2N7D A;  4KHO A;  2FUH B;  2XBB C;  1WR1 A;  2GCJ A;  4AJW A;  5JH5 C;  2V1Y A;  2EKE C;  3WAP A;  3PSC A;  1WGQ A;  2G35 A;  1MIX A;  2N9P C;  2MFQ A;  1U29 A;  2J59 M;  2QKL A;  4DBG A;  3A9K A;  3AUL A;  1GG3 A;  4N9F 4;  3VTU A;  4CHM A;  2LWP A;  1QZE A;  2LGX A;  2D9W A;  1Z87 A;  1GC7 A;  4BBN C;  1RRB A;  3IBE A;  1P1A A;  4HDQ A;  5CX3 A;  3ZW3 A;  1WGR A;  1TZ1 A;  2NCN A;  5JZE B;  2KDB A;  4X57 B;  2EJ8 A;  1W1D A;  3V61 A;  4MEM A;  2N0Y A;  3HM6 X;  3SV1 A;  1HB8 A;  1MAI A;  1ZW7 A;  3UQA A;  2D9Y A;  1LM8 B;  2QKM A;  2LGD A;  3FP5 A;  1X1G A;  1ST7 A;  1PFJ A;  4K7U A;  1R4N I;  4K81 A;  2FIF A;  3ZNI D;  5C6R A;  4ANX A;  4ICU A;  4TKN A;  3PRM B;  2KJR A;  1HB6 A;  3WYF B;  3PV1 A;  3QA8 A;  3A8P A;  2LGY A;  3F0W A;  3T06 A;  1WM3 A;  5C79 A;  4BFR A;  2MKR A;  1EVH A;  3L16 A;  1AQC A;  2K6D B;  2HRJ A;  3DBS A;  3OAW A;  3HQC A;  3VVW B;  4GDL A;  4HK2 A;  2LUL A;  1X1F A;  1FHX A;  4A6F A;  1UBI A;  4ILJ A;  1J0G A;  4WJO A;  3MJW A;  4FBJ B;  5IJM A;  4GMV A;  3U7D A;  1YIW A;  3W1Y A;  2L00 B;  3UGB B;  1MPH A;  1JRU A;  2M1M A;  3QK0 A;  2I5C A;  2O6V B;  4A5K A;  1FHO A;  3O96 A;  1PQS A;  2LVQ A;  3WIM A;  3AU4 A;  1WMH B;  1V6E A;  5LOP B;  4KHB B;  3NZU A;  3PRP B;  1WIA A;  5DI9 B;  4I6P A;  3SHQ A;  2GBR A;  1BT0 A;  2RR9 A;  1DIK A;  4IAP A;  5D2M B;  5JVL A;  2XK5 B;  4JK8 A;  5LXH A;  3FM8 C;  2R09 A;  3JSV B;  1V5O A;  2K8H A;  3TMP B;  1QQG A;  4ZRI A;  4DHZ B;  1V2Y A;  4NAW A;  4DXA B;  1KBL A;  1K5D B;  4KHA A;  2FCN A;  3A1Q A;  4KVG B;  3WAM A;  1BAK A;  3ODX A;  3JYU A;  3L13 A;  1X86 A;  4A3P A;  2HD5 B;  3KRX A;  4JKG B;  2RPQ A;  4KIK A;  5LLI A;  2MP2 A;  1OQN A;  2GMI C;  1OEY J;  3PP2 A;  1W1H A;  2MX2 A;  2KWV B;  4Z2M B;  2COD A;  4K2O A;  1LXD A;  2YRY A;  2M8S A;  4BVU C;  2JT4 B;  3L0W B;  4MGZ E;  4MH0 E;  3OJ4 B;  1XKE A;  3EC8 A;  3K9P B;  3QC8 B;  2CQU A;  3D8F A;  4HAZ B;  2KMC A;  5JP4 A;  2KGX B;  3A9J B;  3KRW A;  2ZVN A;  2D9Z A;  1MK9 B;  4XX5 A;  2Y8G A;  1L7Y A;  3V60 A;  2JP2 A;  1Y8R C;  4WQO B;  1C1Y B;  1FAO A;  1NTV A;  4FN2 A;  1KC7 A;  3QQ8 B;  1V5U A;  1Q0W B;  2W2X C;  4TYZ A;  1FOE A;  3VDZ A;  2RNR B;  2LOZ A;  4WJQ A;  2WYQ A;  4K7S A;  4NQK E;  3CST A;  5LXI B;  2KTR B;  3TO1 A;  5DHA B;  3DBR I;  2MBH A;  2LVP A;  2H7D A;  2IFS A;  2PJH A;  3SU8 X;  4CHK A;  2HJ8 A;  2GBJ A;  1WYW B;  3DVG X;  2COA A;  3ZIM A;  4HAW B;  2UYZ B;  3X0W A;  3DXE A;  4PNK A;  4GB9 A;  3SUZ A;  3R66 C;  2KTR A;  3D32 A;  2K2U A;  5J3Q A;  2WWZ A;  2LJ5 A;  4DWF A;  4ANV A;  4EZJ A;  4NY0 A;  1Y19 B;  4ZRJ A;  3KUZ A;  1UEF A;  3EHV A;  2KQS A;  2JRI B;  2EMT A;  3H7P A;  3E66 A;  2LVO A;  2YF0 A;  4EMO A;  1RLF A;  1HE8 A;  4JLC A;  2GOW A;  3KYC D;  2D3G A;  3ULB A;  1DRO A;  3H9D A;  3UIO B;  3T9L A;  4BBN F;  3QAR A;  3B0A A;  2FID A;  1NDD A;  3PT2 B;  3H7P B;  3PHX B;  2DEN B;  4ZRK A;  2DA0 A;  5LON B;  5D3X A;  4MDK E;  3IG3 A;  2AWT A;  2DN6 A;  2BYE A;  5DHF B;  4EZL A;  1UGM A;  3FLV A;  4KDL B;  1WY8 A;  4JKH A;  3RT3 B;  4K1R B;  2UWQ A;  1I7A A;  2CAY A;  1D3Z A;  2PEA A;  3O65 B;  4PS7 A;  4HLE A;  5D94 A;  3CXB B;  1P3Q U;  2L3Z A;  1P6S A;  4F7G A;  2BYF A;  2COC A;  2LZ6 A;  1Y5O A;  2DFK A;  2DX5 B;  2YT0 A;  2CHW A;  4JIO U;  2MRP A;  3U8Z A;  2LXC A;  1QC6 A;  2KFK A;  1Q1O A;  4C0A A;  3A1Q B;  4ASW C;  1EF5 A;  2G4D B;  1WJN A;  3KH0 A;  1FGY A;  3DBL I;  2C9W B;  2C60 A;  2KC1 A;  5L95 C;  3TVV A;  1MG8 A;  5KCV A;  4DHJ D;  3S2A A;  5C1Z A;  4ILH A;  4HAU B;  2COF A;  4FLH A;  3NOB A;  3CMM B;  3E9O A;  2DLW A;  1WVH A;  4WWO A;  4E3C A;  2DAJ A;  2M17 A;  3HIZ A;  5KQ1 A;  1UNR A;  1YX6 B;  1DBH A;  2Z59 B;  3B08 A;  4BKS A;  2GCL A;  4A3O A;  2MP2 B;  1V88 A;  4MEL A;  4JK7 A;  1XR0 B;  2L8J A;  5G2N A;  2ZCC A;  2YS1 A;  4IOY X;  1V9J A;  3VOQ A;  2COP A;  3PHW B;  1I35 A;  2CY4 A;  4KAX B;  3C0R B;  2FCQ A;  2XQN M;  1V5P A;  1P0R A;  2ZPY A;  1DDM A;  3TW1 A;  3JVZ X;  2RLO A;  4DX8 A;  4A20 A;  3DXC A;  4E74 A;  1NBF C;  1GGO A;  5C16 A;  2FAZ A;  1WF9 A;  2IZV B;  4L6E A;  1OY2 A;  3ZVV A;  2DYQ A;  3UQB A;  3JW0 X;  1ZSQ A;  1U4A A;  2A4Z A;  2P0F A;  2KQ7 A;  2ZNV B;  3R7Q A;  2BF8 B;  2MCN B;  3DVG Y;  1OEY A;  1UH6 A;  3MPX A;  1FGZ A;  1WGD A;  1LW3 A;  4KIK B;  3AXC A;  4MM3 A;  2IYD B;  4NJ6 A;  4F7Z A;  2L0F A;  2KDF B;  4BKS D;  1WGY A;  1V81 A;  2Y7B A;  3KSY A;  2JWZ A;  4JKD A;  1KLV A;  2IY0 B;  1I2H A;  2L0T A;  4YON A;  1ISN A;  2MBQ A;  2R2Q A;  2CS4 A;  1P5T A;  1WE7 A;  3APF A;  1J0W A;  1V89 A;  4DHZ E;  2FDQ A;  2G45 B;  2DIK A;  4PS3 A;  2D9V A;  4KZC A;  3ZDM C;  4WJN A;  1P3R A;  4JKE A;  1E7U A;  3OLM D;  2K2J A;  3TFM A;  4GN1 A;  3WAO A;  1SGH A;  2M14 A;  4JGH B;  3VXW A;  1WX9 A;  5CLL B;  1XQQ A;  3VQI A;  4AOF A;  1ZC4 B;  2BGF A;  1UNQ A;  2MWN B;  2ADZ A;  1KZG A;  3V6E B;  2NBW B;  5BO4 B;  2RD0 A;  4AWJ A;  2MW5 A;  2Z0E B;  3VHT C;  5DH9 B;  4DBB A;  4HXD A;  4MGY E;  4BOS C;  4GOC A;  3QJZ A;  3Q3J A;  4BBK A;  4AP4 C;  2D07 B;  2ZCB A;  3SYX A;  4K17 A;  1SIF A;  5E6N A;  1SE9 A;  2AYO B;  4B6W A;  5D6J B;  2ELA A;  2RGF A;  1YQB A;  4RM8 A;  3L17 A;  3ZRF A;  1WE6 A;  2OJR A;  3ALB A;  5EDS A;  2X18 A;  2R0D A;  2Z0O A;  5KHQ A;  4W9E A;  1E8W A;  2W2X D;  5EFX A;  2JRH A;  2CY5 A;  2L7R A;  4XZ4 A;  2ZZP B;  2QHO A;  2M4N A;  1MIZ B;  3QHT A;  1GUA B;  2YS3 A;  1L2N A;  2OTX A;  1RAX A;  3GYO A;  3P7Z A;  1U5G A;  3MHS D;  3VFK A;  2FJ9 A;  4KZ0 A;  2JXX A;  2DHJ A;  4F7U P;  3B1L X;  2CHX A;  2KKC A;  5CTR C;  3L54 A;  2RQ1 A;  1TXD A;  1WJ6 A;  3NHE B;  2NBU A;  1ACA A;  2FNJ B;  2KX3 A;  3ONS A;  4GXB A;  4W9L A;  4LDT B;  3ENB A;  1Q5W B;  4KDI C;  5CHV C;  2N4F A;  4IM2 A;  2J0K A;  2N7E A;  4HPL B;  4MGI E;  2K25 A;  3MDB C;  2C7H A;  4NNJ B;  1WJ4 A;  2J0M A;  4IUM B;  4J6I A;  2MSE D;  2BYV E;  3ZNZ B;  2LAS A;  2L76 A;  4FJZ A;  2CRF A;  5HE0 A;  2KFJ A;  1F9J A;  2ZVO A;  1XD3 B;  3VH3 B;  1I42 A;  2FCM A;  1J8C A;  3ML4 A;  1M7R A;  1WXS A;  4XC2 A;  5GOW B;  5DPR A;  1UD7 A;  1DDW A;  4EKU A;  4K7W A;  4W9D A;  4W9I A;  5D7G A;  2KC2 A;  2UVM A;  2NBV B;  4MSM B;  3ECI A;  4IFS A;  5KQ4 A;  1RFA A;  1ZGU B;  4G0N B;  4A6F B;  1OMW A;  2MLB A;  3FSS A;  1BTN A;  2G4S A;  3SDL C;  2N1V A;  3PVL A;  2PPH A;  5G55 A;  2KWU B;  4JK9 A;  1WJM A;  2MQJ A;  4WJP A;  1Z5S B;  1UZX B;  3EFU A;  5J2R A;  2ROV A;  1TQZ A;  3ML8 A;  4AJY B;  2AL6 A;  2FJL A;  4IW0 A;  1EF1 A;  3VTW A;  2YS5 A;  4YL8 A;  3L08 A;  5CHF A;  2ELB A;  1GJZ A;  4ANW A;  4HB4 B;  1LFD A;  2KLC A;  2REX A;  4CO7 A;  2EC1 A;  2PZ1 A;  4AUQ C;  2O2V B;  3APC A;  4MJS A;  2V4L A;  3SNH A;  4IWQ A;  1UNP A;  2A5U A;  3G9W A;  2KLG A;  5FI1 A;  5J17 A;  5E6O A;  4W9J A;  3NZS A;  4HAY B;  2LRW A;  3MTN B;  1VBG A;  3RZW C;  4JKB A;  3HM3 A;  5IAA C;  3DQV A;  3ULC A;  2D4Q A;  3RD2 A;  1H4R A;  2D10 A;  2DHI A;  3A9K B;  4MT7 A;  2MBO A;  5IA7 A;  3H1U A;  4EFO A;  1V5T A;  4G3X B;  1T0Y A;  1NI2 A;  4I6N B;  4JQW C;  4OVU A;  4W9K A;  2P8V A;  3ZRC A;  1JDE A;  3ODW A;  2Z0D B;  4M8M A;  1S3S G;  2DX1 A;  2WH5 A;  2CKH B;  2ZJD A;  3TCA A;  4GGQ A;  5JHH A;  4HPM B;  3ODO A;  3A8Q A;  2BCJ A;  2W2W A;  1ZC3 B;  4A6K A;  1ZVR A;  2IYB A;  5HKH A;  4KSL C;  1W1G A;  4W9G A;  2ZNV C;  1M7E A;  3V6C B;  3PPA A;  1H10 A;  2RUK B;  3UZT A;  4E71 A;  4EUT A;  1ZKH A;  2X0S A;  5D3V A;  2VSZ A;  2DYM A;  1XCG A;  3GZN I;  4RMA A;  2DAF A;  1E8Y A;  5FR6 A;  1KM7 A;  2UZR A;  4ICV A;  4GSW A;  3SD5 A;  2ASQ A;  4MK0 A;  2P0D A;  3HHM A;  3APD A;  1WJ1 A;  1UBQ A;  1K5G B;  2IO1 B;  3KUC B;  3M3J A;  3RCP A;  3RCZ A;  4DDG D;  5KHO A;  1MKE A;  4FA6 A;  3R3M A;  3QX1 A;  4IM0 A;  1WH3 A;  1BTK A;  3VUX A;  1GC6 A;  4BKT A;  2BWF A;  5D3Y A;  2WDT B;  2LXA A;  4GPT B;  4ILG B;  1IPG A;  2JY6 A;  2DKP A;  2KMA A;  2O6V A;  3D8D A;  3PGE A;  4TV3 A;  1WMH A;  4XWX A;  3QIJ A;  1DYN A;  2KWC A;  1AWE A;  3KY9 A;  1CMX B;  3ZDT A;  3IFW B;  4DDI D;  4DHJ B;  4Z2N A;  3TBL D;  1YJ1 A;  3LJU X;  4G50 A;  2NZ8 B;  1WR6 E;  2Q13 A;  1WX7 A;  4F7H A;  1KZ7 A;  3JSV A;  3EPY A;  1R4M I;  2KDE B;  1PLS A;  3A4S C;  4WVF B;  1V80 A;  4K2P A;  1KJT A;  4KSK C;  4PYZ A;  4W9C A;  2Z0Q A;  4KV2 A;  3R7R A;  4EZK A;  3Q3F A;  2I5F A;  2DYB A;  2DZK A;  1U5E A;  2PE9 A;  3PTF C;  2NMB A;  2KZR A;  5DPS A;  3DBH I;  3ZO5 B;  2DKQ A;  4FAD A;  3DDC B;  3AI5 A;  1XT9 B;  5JHB A;  2MBB B;  4HJK A;  5L83 A;  2NR2 A;  1B55 A;  1N3H A;  5CHW A;  1WZ0 A;  1WI0 A;  2IY1 B;  4DX9 0;  3H6N A;  4GDL B;  2C7M B;  4HCN B;  4M8N A;  1X05 A;  3PVU A;  2J7Q B;  1EUV B;  1NU2 A;  2VRR B;  1G6J A;  3N32 A;  4MY6 A;  2M0X A;  3VH4 B;  1P98 A;  3M62 B;  2PE6 B;  3HK0 A;  1NTY A;  3DXD A;  2DYN A;  1IP9 A;  3SBG A;  3BY4 B;  3PSE B;  2DYO A;  1Z2M A;  3RYT A;  4BKG A;  3QCA A;  3LDZ E;  1HBK A;  2RSU A;  4HWI B;  4IWP A;  2IO0 B;  1WM2 A;  3RZF A;  4JKG A;  2MDX A;  3BIN A;  3NS8 A;  1OGW A;  2JPH A;  1K8R B;  3P6A A;  3EEC A;  2D11 A;  2HTH B;  1X11 A;  2EMS A;  5HE2 A;  5JLJ B;  3CF6 E;  4JL9 A;  2AL3 A;  1WX8 A;  3VIA A;  1C3T A;  2DTC A;  3FEH A;  1YX5 B;  4GMX B;  1TTN A;  4JKF A;  2KOX A;  3KZ1 A;  4FHK A;  4D0N B;  5JHG A;  2AEH A;  4GDK B;  1NTI A;  2DHK A;  1PMS A;  5E6P A;  4LJP B;  3RUL A;  4HB3 B;  3ENE A;  3WAL A;  3PZD A;  2GBN A;  1FB8 A;  2P0H A;  5AZF A;  3GYP A;  5FI0 A;  5GMV A;  3I3T B;  3ML9 A;  2LI5 A;  2WX0 A;  3H7S A;  2L1C A;  3K9O B;  2IO3 B;  2HTH A;  1J19 A;  5DCN A;  1WI1 A;  2N23 A;  4HDO A;  3ZTC A;  1VCB A;  3PVW A;  2DZJ A;  1XD4 A;  1P9D U;  1VD2 A;  2BPS A;  3ZNG C;  2O6V D;  2N9X A;  1EO6 A;  1UPR A;  4NPN A;  1E5W A;  5C5B B;  3OJ3 A;  3DOW A;  2KHW B;  2HE7 A;  3N3K B;  1TJ6 A;  3TJP A;  3A4R A;  2LKO A;  2DHZ A;  2N1W A;  2C7N B;  5JHA A;  2R2O A;  2NPT A;  1UPQ A;  3CSF A;  4F8C B;  1A5R A;  4LJO B;  2Y5B B;  2KVR A;  3A33 B;  4EOY A;  3U30 A;  5HE3 A;  4WJ7 A;  2UZS A;  2KFK B;  1WGG A;  2RVB B;  3W1S C;  2RGN B;  4MGK E;  4MSQ B;  4RM9 A;  3NY5 A;  3UIN B;  3QWM A;  3TL5 A;  1V86 A;  2K1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...