1GC6A

Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
297
structure length
297
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the membrane-targeting and unmasking mechanisms of the radixin FERM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords RADIXIN
total genus 84
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1gc6A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1gc6A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1gc6A01
2LRUA 4KHAA 1RAXA 3MDBC 3M3JA 4HCNB 2DHZA 1EF1A 4ZRKA 2CB8A 2BYFA 4IAPA 3KUZA 4K2PA 4OVVA 3SU8X 3QWMA 5DPRA 4W9CA 2DHIA 2GMIC 4BKGA 2WH5A 4KZ0A 4GN1A 2L05A 2D10A 2CODA 3T06A 4GXBA 2DZKA 4NJ7A 1ZKHA 2JWZA 2LOZA 3CSFA 3V5WA 3NZUA 5L81A 3PTFC 4ANWA 2LASA 2NS5A 2KX3A 4B95A 3EHVA 3L08A 3GYOA 2DZMA 5GMVA 4PYZA 2MP2B 3ZLZA 3O65B 2COPA 3VIAA 1WRDB 4NJ6A 4NY0A 2MRPA 3R7QA 2NMBA 3N7CA 3TCAA 3H6NA 4FHJA 3OJ3A 5CHWA 4HVBA 3P7ZA 4K17A 3Q3FA 3EC8A 4KSKC 3RCPA 3HK0A 4ANXA 4FA6A 2G35A 4TQ0A 1WY8A 2FIDA 5AZFA 2UZRA 3ZUNA 1UNQA 2GBNA 4GMVA 1P1AA 5IJMA 3SO6A 4MH0E 1Z2MA 2RQ1A 4PQ0A 2I1JA 5J2RA 2Z0DB 1BWNA 1V80A 3PV1A 5FI1A 1RLFA 1UBIA 2UYZB 3N30A 4AUQC 1RFAA 1EVHA 1Z87A 1NDDA 1E7UA 1EUVB 5HE2A 3CIKA 4WWOA 2GOWA 2J59M 2L0FA 3DCGA 3PT2B 1OEYA 4WSFA 3QHTA 1WGHA 1MIZB 3QK0A 3VH4B 1U2BA 3TO1A 1E90A 4K7UA 4B6WA 2K8BA 3G9WA 4IG7B 2K1FA 1ZM0A 1YX6B 4JL9A 2M38A 4HB3B 2Q13A 5HE3A 2BWES 1BTNA 5C1ZA 1BAKA 3F0WA 2JY6A 4P7IA 2OJRA 2IYBA 2WX0A 2KQ7A 4GDKA 4EZKA 1L2NA 2KK8A 1V49A 4ASWC 5D27A 2M0XA 3VAWA 2L3ZA 1ZGUB 1W1GA 3A9JA 3ZDTA 2VSZA 2C9WB 2CU1A 1GC6A 2Z0QA 3PVLA 4HB2B 1X11A 1WX8A 2PZ1A 2ZEQA 4I6PA 3H7PB 2COFA 5DHAB 2YS5A 2KJ6A 4RMAA 3T8MA 3V6CB 4K2OA 2PEAA 1GJZA 3VH3B 3HIZA 3FP5A 2C60A 2RSGA 3AI5A 2VKIA 4WVFB 2G4SA 3DOWA 3WALA 2KC1A 3ECIA 2FJ9A 3VDZA 5D2MB 1KLVA 2CKHB 1YQBA 3A9KA 2ZPYA 3P2BA 2DA0A 4IWQA 3ZNGC 4LCDE 3HM3A 4TKNA 1WXMA 2ZJDA 2ELAA 4GU2A 1WX9A 2KJRA 3H1UA 1V81A 5D3XA 1KZGA 1V88A 2DKPA 2QKMA 3F5RA 3CMMB 2H7DA 4GMXB 4HB4B 3NS8A 1VCBA 4HPLB 4IWPA 2JRHA 3DXDA 5KHOA 2KANA 2MQJA 2GCLA 1KI1B 2CQUA 2HE7A 3BJIA 3ULBA 3EECA 4KZCA 4BKSD 4CO7A 4DHZB 2FDQA 2DTCA 2M17A 5EDSA 2CR5A 3A8QA 3PP2A 4HCPB 2D9VA 3WAPA 5D3YA 2OQBA 3DVNU 3WANA 4F1SA 3R66C 4WWNA 2K6DB 2V76A 2LXCA 4FJVB 2QKLA 4A20A 1LB1A 1R4MI 2N7DA 1OQNA 3NZSA 2D4QA 4II3B 1A5RA 2R0DA 3KY9A 3APCA 3H7SA 2KQSA 3HM6X 1XCGA 4KHBB 1WI0A 3X23A 1XODA 2CRFA 1WXAA 2W9NA 5DPWA 2GBKA 5LOPB 1G6JA 5HE1A 2IYDB 2EJ8A 2JUOA 4LJPB 4PS3A 2J0MA 2FAZA 5AZGA 1PFJA 2ELBA 5J3YA 3VOQA 1LM8B 2K6QA 3SDLC 3SHQA 2KKCA 1F9JA 4EJNA 2CHWA 2IO1B 3DBLI 2LVPA 4GDLB 4MELA 3AU5A 4GPTB 5KQ4A 4PS7A 2LJ5A 3DBHI 4RM9A 2ZVOA 5CTRC 2IO3B 3FLVA 3JSVA 3UQAA 2YRYA 4IFSA 2LGDA 2O6VB 5DHFB 2V1YA 3ODWA 4JLCA 1UD7A 3V6EB 1U29A 2MSED 1K5GB 4IM0A 5L95C 4EEWA 3RZWC 1MIXA 1WFYA 2IO0B 4EUTA 2N9PC 3AXCA 2KFKA 3ZRFA 1U5DA 2BWFA 3V60A 4JQWC 4FULA 2LKOA 1Q67A 3ML4A 3ODXA 3DQVA 1UEFA 5BO4B 4JGHB 2KDBA 1FHWA 2ZNVC 3A98B 2DX5A 3AJ4A 1IPGA 3QARA 5C79A 1W1HA 1CMXB 3PRMB 1SE9A 4KDIC 4HB0B 5G55A 3ZO5B 4IOYX 2KX0A 4WJQA 3IHPC 1PQSA 3V61A 1WJ4A 4WAAA 3ZNHB 4EZLA 1L7YA 5D3WA 1WXSA 3PSEB 1WGYA 2RR9A 2RSUA 1DBHA 2LUEA 2P0DA 1E8WA 3LJUX 4YONA 2WDTB 3ZTDA 4FBJB 2H7EA 3B0AA 1WR6E 1LW3A 4KIKB 4B9KA 2VRRB 1RRPB 2MBBB 3EPYA 1NI2A 1FOEA 5KQ1A 1FHXA 2KCJA 1P98A 1M7RA 3W1SA 2DYMA 3APDA 4IUMB 4Z2MB 2KD0A 2KNBA 2RNRB 4IWOA 3NOBA 4WQOB 5IAAC 4B6HA 3FM8C 2FCNA 4YL8A 4A6HA 3RUIB 1V86A 3VTWA 2UVMA 2KDFB 2KMAA 2P0HA 2MX2A 4TYZA 2X18A 5KCVA 4F7GA 1NU2A 2D3GA 4K7SA 4KV2A 4FHKA 2LXAA 2RD0A 2ZNVB 1V61A 3D32A 3DBSA 5HE0A 3PRPB 2N7EA 3VHTC 2ADZA 1V5TA 3JYUA 4GSWA 1C3TA 4HAWB 2MBQA 2JP2A 4BKTA 3KRXA 2DN6A 1UPQA 2GBRA 4GB9A 1FXTB 3KVFB 4W9FA 4AOFA 1BT0A 4DX90 1WJ6A 2MCNB 1I7AA 2DYOA 2L00B 2NPTB 3WYFB 2KTRB 1OGWA 4HXDA 4I6LB 1QC6A 2G4DB 4LDTB 2NBUA 2I5CA 2LD9A 1ZSQA 1OQYA 2I5FA 1WMHB 2BF8B 4M8NA 2GCJA 3GYPA 5EFXA 3PLUA 2WWZA 3A1QB 3DVNV 2FNJB 3ONSA 4MGKE 4DK5A 3M1IB 3KUDB 1ACAA 4G50A 1M94A 2IO2B 2LGYA 5CHFA 2REXA 3R7RA 3PHXB 1DYNA 1FHOA 4BBKA 2EKEC 2UWQA 3HQCA 3EFUA 1OMWA 1LXDA 2MDXA 1NVLA 4W9HA 1E7VA 1GC7A 1OY2A 2DKQA 3M95A 4MJSB 3PGEA 1E5WA 4K1RB 4WJOA 3UF8A 1TJ6A 2W2WA 2UZSA 3PVWA 4BVUC 1IYFA 4HJKA 2DX5B 4EMOA 3ZTCA 2GJYA 3P6AA 4A6KA 3A4RA 3GZNI 5C5BB 2FCMA 1I2HA 1NTVA 2DAJA 1M7EA 3SUZA 4NQLB 3RT3B 2HTHA 3PZDA 4TUUA 4XC2A 5E6NA 1RRBA 1DDWA 2D9XA 1WGDA 2KWCA 3L17A 4NPNA 3W1SC 4A3OA 2NBVB 5D94A 4IW0A 4W9EA 4AJWA 1MPHA 4CHMA 1D3ZA 5IA7A 5CLQB 2BKRB 3C0RB 2I1KA 2GS0A 3OJ4B 3VTUA 1YJ1A 3VUWA 2ZCBA 3U8ZA 3ENEA 2C7MB 2HJ8A 4W9GA 3TJPA 4NSWA 1ZC4B 2R2QA 2EMSA 2CY5A 1C1YB 1ZC3B 2KC2A 4W9LA 4Y94A 1P3RA 3QIJA 3QC8B 1UNPA 3OAWA 3TBLD 4AJYB 1WJUA 4HLEA 3L10B 4ZDVA 2CHZA 4MGYE 4W9KA 4F7UP 2D11A 1WGGA 2GBJA 3RULA 1AQCA 4KVGB 1HBKA 2LZ6A 2MFQA 5L83A 1R4NI 2A4ZA 2J0JA 2MA9B 3BY4B 2KO3A 4W9DA 3VQIA 1T0YA 2K25A 4HATB 1HE8A 4HAXB 1WM2A 2O2VA 3K9PB 4DDID 1KOTA 3I3TB 4CHJA 4J6IA 1UNRA 2YT0A 2C7HA 3VXWA 2J0KA 4BFRA 4EKUA 1KZ7A 3FEHA 4WWPA 1EO6A 5LXHA 3PSCA 5D7GA 1X86A 3QAQA 1WJ1A 1WZ3A 3VTVA 1ZW7A 3WA0A 2BCJA 3ZIMA 4EZJA 3ALBA 1Q5WB 1WGRA 3DVGY 2LBBA 3VFKA 1MG8A 1U5FA 2W2XD 1OTRB 5G2NA 2XK5A 5CLLB 4DBGA 1P6SA 3LDZE 1AARA 4ZRIA 2DAFA 2NPTA 3UQBA 3U30A 3ZVVA 2LVQA 4XWXA 2RLOA 2YS3A 2MBHA 3ZNZB 4ANVA 4L6EA 1KM7A 1UZXB 2JT4B 2PJHA 1WMHA 3TMPB 3BINA 2LULA 4KAXB 5D6JB 2NBWB 2DFKA 4IM3A 3DVGX 3L16A 2DLWA 1UH6A 2ABDA 4MGIE 2P0FA 1P0RA 2E2XA 1ST7A 1WM3A 1AWEA 2V3SA 2MWNB 2MP2A 4WJNA 5C23A 4HK2A 2L0TA 2MBOA 4FLHA 1U27A 4PNKA 4M8MA 4JIOU 2Z0PA 5CX3A 2BYVE 2JF5A 1FB8A 3CF6E 4X57B 5TR5A 1WF9A 4GDKB 3ZDMC 4NAWA 3KRWA 2YF0A 3PREA 1GUAB 1HB8A 2AEHA 5HKHA 5JHAA 2COCA 1QZEA 4M0WB 1Y19B 4HAUB 1P3QU 4ZYNA 3W1YA 4BOSC 4KDLB 3A4SC 2C5LC 1SGHA 2HRJA 2KMCA 2LWPA 2ZPNA 3L13A 3M63B 2HTHB 1V5PA 2KDEB 3D8FA 1UPRA 3PLVA 4ZRJA 3HW2B 2R09A 1TGZB 4HAVB 4GZUA 2KXJA 5CHVC 5FR6A 1KJTA 2BYEA 2L76A 3A9KB 3IBEA 1MAIA 3KH0A 4E71A 4TV3A 3ZRCA 3FSSA 2IY0B 1WE6A 4A6FA 5C16A 2MWSB 4F7ZA 1LQBA 4A5KA 1X1MA 1FGYA 2KHWB 1WG7A 1MK7B 2KWVB 3JW0X 4C0AA 4G3XB 2LGXA 2XEWA 4LDTD 3GOEA 4MSQB 1ZVRA 3IFWB 2M8SA 2ZZPB 3TW1A 1YD8U 2EMTA 1HB6A 2JZ3B 3MPXA 3ZVRA 3LJ3A 3DXEA 3PG7A 1Q0WB 1U4AA 3JVZX 4ICVA 1X05A 5GOWB 2V4LA 1XR0B 3OANA 3APFA 3B1LX 3SYXA 2O2VB 1WJMA 4GIVA 3KSYA 4WJ7A 2VRWB 2LG1A 1XKEA 5J3QA 3H7PA 4XZ4A 3SV1A 1NTYA 1XD3B 2G3QB 2BPSA 2KFJA 2KZRA 4DHJD 3H9DA 2N1WA 2DYNA 2DENB 2JPHA 1XT9B 3PVUA 2KOXA 1DDVA 1PLSA 4W9JA 5DPTA 2O6VD 4DWFA 1XQQA 1PMSA 1TQZA 1FGZA 2AWTA 2D07B 3QA8A 4IC7B 4K7WA 3X0WA 2LYDA 4E74A 1J8CA 2XK5B 1SIFA 2K8CA 2CAYA 2Y5BB 1BTKA 1GG3A 2KLGA 4MSMB 3VUXA 3ML8A 1WZ0A 2GBMA 2L8JA 3QQ8B 4GDLA 3KUCB 1IP9A 1X1FA 3R3MA 1UGMA 1YX5B 3N3KB 3JSVB 2QHOA 2O6VA 4MM3A 2ZVNA 4FJYA 5LXIB 2N23A 4NNJB 4D0NB 1K8RB 5DCNA 2DYQA 1Z5SB 3RZFA 4E3CA 1Q1OA 1E8XA 4N9F4 5J18A 1Y8RC 4LJOB 3AU4A 4DXAB 1UELA 2A5UA 2JVCA 3WIMA 1YIWA 1MK9B 1V5UA 2BGFA 1QQGA 2KGXB 1S1QB 4TQ1A 3WAOA 1V2YA 2JZZA 2MBEA 5JHGA 2WYQA 4BBNC 2DHKA 3S2AA 3DBRI 3O96A 2RPQA 3IG3A 1J19A 4CYEA 3PEGA 1DROA 4NAWB 1LFDA 1WE7A 3QX1A 1UBQA 2KLCA 4Z2NA 1XX0A 3KZ1A 4HAYB 3K9OB 4BKSA 2B3AA 2Z59B 1I35A 2P8VA 4FN2A 1WI1A 5D3VA 4MDKE 2YS1A 2LRWA 1I42A 3UIPB 4FADA 4IM2A 4OVUA 4EFOA 2YT1A 2RGNB 2YLMA 2JXXA 2IZVB 5FI0A 1U5GA 1WVHA 5J3TA 2AYOB 2PPHA 2FCSA 2Z0EB 2RVBB 2FJLA 2K2JA 2N0YA 3D8DA 2HD5B 1FAOA 4AP4C 4AWJA 5DI9B 2LOXA 3RCZA 3DXCA 1H4RA 1NTIA 4HAZB 3A33B 4A6FB 3ULCA 3QBVB 4PYUA 3ZW3A 4G11A 3PRZA 4RM8A 4MY6A 3PS6A 2KFKB 2ROZB 1JRUA 3OLMD 2OOBB 1E8ZA 4EOYA 1P5TA 4F7HA 2M1MA 2KUPA 1P9DU 3KYCD 2NR2A 3L0WB 1U5EA 3NHEB 5AEKB 2LI5A 1GNUA 2K00A 1H8CA 1VD2A 3ZKJC 1WGUA 2K2UA 5JH5C 4WJPA 1RJ2A 2Y8FA 1N3HA 2AL3A 3ML9A 3WAMA 2DZJA 4NQKE 3PHWB 2KDIA 2R2OA 5E6OA 2DYBA 5JP4A 4K81A 4A3PA 4DDGD 4URKA 5JZEB 5JHBA 3VUYA 3Q3JA 4ANUA 3ODOA 2WX1A 3PPAA 4MT7A 4KIKA 2D2QA 3KYDD 4ICUA 1J0GA 2EC1A 2LVOA 3MHSD 4BBNF 2NZ8B 1IRSA 1TTNA 3A8PA 1WIAA 4HDOA 1WYWB 2M14A 4PS8A 5DIFB 1S3SG 2KTFA 3TFMA 1V5OA 4II2B 3NSUA 4XX5A 4KHOA 3SD5A 2D9WA 3MTNB 3D8EA 2DZIA 2PE6B 1ISNA 1H10A 2L1CA 3CXBB 5DH9B 1TZ1A 3NY5A 3QJZA 2N4FA 3TL5A 4CHKA 5E6PA 1NBFC 3L54A 4DHZE 1DDMA 2Y8GA 4DBBA 1WJNA 2J7QB 2KVRA 1K5DB 1J0WA 3DDCB 2DX1A 3MJWA 4H8SA 2G45B 1WGQA 1XD4A 2XQNM 3TVVA 2W2XC 2K8HA 3B08A 2CY4A 2IY1B 4HHVA 3ZNID 1WX7A 1V6EA 5JLJB 2ZCCA 4G0NB 4DHJB 2IBIB 2N1VA 1SHCA 2D9ZA 5KHQA 4BOZB 2AL6A 3IVFA 1V9JA 2CHXA 2YSZA 3UZTA 1OEYJ 1WH3A 2N9XA 2RGFA 4KSLC 5JHHA 3RYTA 1B55A 3TIXA 2XBBC 1EAZA 2COAA 2KTRA 3AULA 4HPMB 5LONB 4FJZA 5C6RA 4GOCA 1V89A 2FIFA 4HWIB 1MKEA 1EGXA 3QWZB 3V62A 5LLIA 2IFSA 3VVWB 2RUKB 2Y7BA 3UIOB 3A1QA 4MGZE 3N32A 3U7DA 2FCQA 1X1GA 2MW5A 2JRIB 4DX8A 1TBEA 2KJHB 1WXVA 2CS4A 2K39A 2MLBA 3CSTA 4MEMA 4HDQA 3UINB 3KW5B 1WR1A 4MJSA 2KWUB 4MK0A 2YVCA 2M4NA 4I6NB 1EF5A 2OTXA 3T9LA 2PE9A 3RD2A 2L7RA 3HHMA 2Z0OA 3QCAA 5DPSA 3M62B 2FUHB 3A9JB 4GGQA 5AZHA 2BKFA 2L2IA 4F8CB 1Y5OA 2MKRA 5J17A 2KN5A 1W1DA 5C5BA 1E8YA 2N9EB 3UGBB 3DPDA 2NCNA 2C7NB 2ROVA 2DHJA 2D9YA 2NVUI 1TXDA 4W9IA 1V5MA 3SNHA 2ASQA
chains in the Genus database with same CATH superfamily
3OHMB 3SU8X 5DPRA 4BKGA 3RNCC 2Y5CA 4YSYB 2WDQB 2JWZA 3R8BA 2LASA 2NS5A 3AE2B 3GYOA 5GMVA 5C2TB 4PYZA 3ZLZA 3MC0B 2COPA 1WRDB 3P4QB 2D3AA 2MRPA 3NVYA 1ZXHA 3H6NA 2JXTA 3OJ3A 3P7ZA 4K17A 3Q3FA 3HK0A 3SR6A 1QOFA 2G35A 1RWSA 1ZP0B 1WY8A 5AZFA 1JCKB 1D6EC 1Z2MA 2I1JA 1BWNA 1V80A 2WXRA 4HEA1 2LJIA 2UYZB 3N30A 3HIEA 1EVHA 1NDDA 1YQ3B 4QJ4B 3DHIC 1N60A 3DCGA 3QK0A 1U2BA 3TSSA 3TEWA 2K8BA 1F77A 2K1FA 1YX6B 5C1ZA 5HE3A 1BTNA 3F0WA 2JY6A 4P7IA 2IYBA 2KQ7A 2KK8A 1W1GA 2C9WB 1GC6A 2PZ1A 5E6JA 3V6CB 2KJ6A 3VH3B 3HIZA 4HRSA 1L6VA 4QAYA 2FJ9A 5D2MB 1I4HA 3ZNGC 4LCDE 3HM3A 4TKNA 1YOVB 5BMGA 1WX9A 1V81A 1SE4A 2QKMA 3F5RA 3T8MA 3NS8A 4HB4B 1VCBA 4IWPA 3U12A 4KZCA 3ULBA 5EDSA 4JKGA 2ZKMX 2CR5A 4HCPB 3PP2A 5JVLA 3WANA 4F1SA 1D5ZC 4FJVB 5IRSA 3IXSA 1F0ZA 1OQNA 1TS5A 2R0DA 3KY9A 1JRPA 1ENFA 1SBBB 3NS1A 1XCGA 3FILA 4MACA 2W9NA 2IYDB 2J0MA 2E6XA 3BVGA 5LNK1 1GPXA 4RGMA 2Z4DA 4EJNA 2IO1B 4RM9A 4IFSA 4MM3B 4JLCA 4EUTA 1CK1A 2BWFA 2MJ3A 3V60A 4FULA 2GLSA 3AJ4A 1IPGA 5C79A 1CMXB 4CSQA 3AEDB 3ZNHB 2D3BA 4EZLA 3EGRA 5D3WA 1WXSA 3PSEB 1WGYA 1ZYIA 1DBHA 1L4DB 3ZTDA 3B0AA 3Q8AA 2VRRB 3EPYA 1FOEA 3B9JA 4YTNB 1P98A 2KCJA 1I4PA 1M7RA 3APDA 4IUMB 1TY2A 2KD0A 2KNBA 4WQOB 5IAAC 4B6HA 1NYRA 3FM8C 3VTWA 4ARCA 2UVMA 3E9LA 2KDFB 1KTKA 5KCVA 4F7GA 1NU2A 2D3GA 3T3NA 4FHKA 3RMKC 3VHTC 2N7EA 2OJWA 1V5TA 4GSWA 1QLBB 3C8YA 4HAWB 2MBQA 2JP2A 4BKTA 1UPQA 4GB9A 1ZOYB 4KHBA 4DX90 1MFWA 3SBTA 2L00B 2XN9C 2FBWB 2I5CA 1ZSQA 1OQYA 4JKFA 3GYPA 2WWZA 3DVNV 3RNFC 3RNBC 2LGYA 4WURA 2MJEA 3M95A 3BK2A 1E5WA 1XLNA 4IOIE 2UZSA 3PVWA 2DX5B 2GJYA 2DAJA 1WXQA 3RT3B 1YN4A 4TUUA 1RRBA 5D3DA 4A3OA 3AE4B 3BZDB 4IW0A 4CHMA 4HJGE 1D3ZA 5CLQB 3VTUA 1ZPSA 2LGIA 3U8ZA 4NSWA 1WGKA 2R61A 1LGRA 4OSNA 2VH1A 3P4PB 1C1YB 1ZC3B 1VBGA 1WJUA 4F7UP 2LZ6A 1CQVA 4J3OD 5EE1A 3BY4B 3VQIA 1T0YA 4DDID 2YT0A 2RMMA 2X8XX 3MFGA 3VXWA 2GB1A 2DBYA 4EKUA 5LXHA 2NMQA 1WZ3A 3ZIMA 4LNFA 2LBBA 4HSIA 1OTRB 4C80A 4DBGA 5IP4D 3UQBA 4JK7A 2LVQA 2YS3A 1EU3A 2LULA 4KAXB 1TS4A 5D6JB 2DFKA 3DVGX 4MGIE 2P0FA 5C23A 3VRAB 2MWNB 1I4QA 4M8MA 2MBOA 3MC9A 1U27A 2INDC 5CX3A 3ABVB 3Q14C 5JHAA 4RGOS 3A4SC 2BT6A 1SGHA 1HZ5A 3M63B 3PLVA 4AJYB 2BYEA 1NENB 3IBEA 1C4AA 3FSSA 2MWSB 4A6FA 2WQYB 1FGYA 3RN9C 1WG7A 2JZPA 3JW0X 4C0AA 4LDTD 2LGXA 2XEWA 5LG4B 3IFWB 2GI9A 2ZZPB 3W9CB 1HB6A 3LJ3A 3DXEA 1U4AA 4JKGB 1X05A 5GOWB 1FXIA 1ACCA 2X38A 1WJMA 4WJ7A 2VRWB 4OT1A 1OQRA 1XKEA 3Q69A 2KWDA 1NTYA 2KFJA 2KZRA 4S0RA 2DYNA 1XT9B 4W9JA 1DDVA 1T0SC 4H2AA 1A70A 4YTPB 5DPTA 4DWFA 1PMSA 2CJNA 2INCC 1ZXIA 1L0VB 3QA8A 1YJJA 3GE8C 2LYDA 4E74A 2XK5B 3VUXA 4MSMB 2LHDA 3R3MA 1YX5B 3N3KB 3JSVB 4RCOA 4MM3A 2ZVNA 2DYQA 1E8XA 1SF0A 1L0XB 1DOXA 2JVCA 1N61A 3WAOA 2MBEA 2JZZA 1GB4A 3P4SB 3L4PA 2DHKA 3S2AA 3DBRI 3ZQ4A 4CYEA 4NAWB 1LFDA 4US9A 5FK9C 1UNSA 2KLCA 2B3AA 1WI1A 4MDKE 1PGAA 1JMLA 1I42A 2OEDA 4IM2A 4OVUA 4EFOA 3TUOA 5FI0A 4JKBA 1IBXB 2FJLA 3RNGC 2N0YA 1K50A 5DI9B 2LOXA 4RH6A 2Y3AA 3A33B 4PYUA 3IT4B 3MC8A 3PRZA 2I38A 3NVWA 2OOBB 1E8ZA 2BQQA 2M19A 2V3PA 3GB1A 1P9DU 3AE1B 1U5EA 1GNUA 1VD2A 1HEZE 3ZKJC 5JH5C 1N6ZA 2DZJA 2V9HA 4NQKE 1P7EA 2ICIA 2W3SA 5JP4A 4DDGD 3IAM1 1V8CA 2WX1A 4ICUA 1IRSA 1WIAA 2J42A 4A55A 4XX5A 1FNWA 3AV8A 2D9WA 2WHIA 1J7BA 1RYJA 3OWEB 3NY5A 1HZ6A 1NBFC 3L54A 2J7QB 2KVRA 4H8SA 3Q8BA 2XQNM 2WXNA 4HHVA 3SBGA 3GP7A 4BOZB 2AL6A 1V9JA 2N9LA 1OEYJ 4KSLC 1K51A 1B55A 3ZXRA 3FAHA 3AULA 2LFIA 4GOCA 1V89A 3V62A 3C19A 3V05A 3N32A 3U7ZA 1WXVA 1XF5L 2D5GA 4TMAB 4MEMA 2L32A 2WXIA 2KWUB 2OTXA 3AM9A 2CJOA 1XEEA 2Z0OA 2KT7A 5H8YE 1F52A 4M00A 4RF1A 3RFZB 4XGAB 4F8CB 4DQOC 2N9EB 2VZKD 5EE9A 3AECB 1TXDA 2JWUA 3SNHA 3M3JA 4JKCA 5JXVA 3KUZA 5H92C 4OVVA 2GMIC 4KZ0A 2L05A 4GXBA 3T06A 2KVZA 3PTFC 5L81A 4M01A 1XLQA 3O65B 3VIAA 4NJ6A 1QKZA 2B76B 5G5GA 2DNFA 3R7QA 3N7CA 1TKGA 2RDHA 1N5XA 4KSKC 2JU6X 3RCPA 4ANXA 4TQ0A 2FIDA 1R4NB 4GMVA 1PFDA 2IPKD 1P1AA 5IJMA 3SO6A 1C4CA 2L1AA 2RQ1A 4PQ0A 4JWUC 1ZDVA 1UBIA 4AUQC 1L6UA 1E7UA 3H8HA 4WWOA 2GOWA 1FNUA 3QHTA 1WGHA 1MIZB 4OZCA 5HG2A 4K7UA 4B6WA 1F2RI 2Q13A 3HVZA 4ASWC 3GZNB 1QOAA 3VAWA 1ZGUB 3A9JA 2VSZA 2COFA 5DHAB 4RMAA 4K2OA 2PEAA 2INNE 4A9AA 3AI5A 2VKIA 4WVFB 2G4SA 3WALA 3VDZA 1QILA 1YQBA 3A9KA 3P2BA 4IWQA 1WXMA 2ZJDA 1V88A 4GMXB 2AQ3B 1CZPA 2JRHA 3U52E 1L5PA 2KANA 2MQJA 3E9PA 2ZW0A 4JPSA 1WWTA 4KKJA 1QF6A 2FDQA 2DTCA 2K22A 3WAPA 3KWVA 2OQBA 2QIEB 3R66C 2V76A 2WXLA 4A20A 2KMMA 1LB1A 4GNKB 3H7SA 5AUKA 3HM6X 2GBKA 1G6JA 2JUOA 5AZGA 1JALA 2FAZA 2ELBA 5J3YA 3VOQA 1LM8B 3SDLC 1JW9D 2CHWA 4HPPA 1TS2A 4GPTB 1ZE3D 2QILA 2MEKA 2LGDA 2IGHA 5HHDG 1U29A 2MSED 4IM0A 2IO0B 3SFDB 2N9PC 2WP9B 3ZRFA 3ML4A 3U4EG 2DX5A 1W1HA 3PRMB 3ZO5B 1QQRA 2H89B 3IHPC 4WAAA 2KYWA 1L7YA 2NBVA 2RSUA 4PT5A 2KR0A 2LUEA 4YONA 2WDTB 4KIKB 4B9KA 1RRPB 5KQ1A 3W1SA 2TSSA 1DIKA 4WQMA 2LMCA 2RDGA 3EUB2 3RUIB 4A6HA 4DIXA 3ZGZA 4TYZA 2WXQA 3BYYB 4GOUA 3DHHC 2UU7A 2RD0A 3DBSA 3PRPB 1B9RA 3JYUA 1QT9A 2J52A 3KRXA 1FXTB 1BT0A 2DYOA 4AQ7A 3WYFB 1OGWA 4HXDA 4I6LB 1QC6A 2WS3B 2NBUA 2M0AA 2LD9A 2GCJA 3PLUA 3TEZA 3ONSA 3M1IB 2PMVA 1ACAA 2NTSA 1M94A 3J9CA 2BB6A 2EKEC 3EFUA 1LXDA 2MDXA 1OY2A 2DKQA 4WAFA 3UF8A 4K1RB 4WIPA 4BVUC 1NYQA 4HJKA 3ZTCA 3DCXA 2FCMA 1I2HA 1NTVA 2PTLA 3I57A 3IT6B 3PZDA 4XC2A 3L17A 4NPNA 3W1SC 3C0RB 1FMAD 1YJ1A 2IDYA 2N0SB 4W9GA 2L52A 2HJ8A 5M4YB 2KC2A 1P3RA 1AWDA 3QC8B 5EE3A 1AN8A 4UDUC 3ZXVA 3T3OA 4MGYE 4W9KA 2D11A 1HBKA 2MFQA 3NG0A 5BYRA 2J0JA 2MA9B 1HE8A 4HAXB 2C7HA 2J0KA 4BFRA 1KZ7A 4WWPA 1X86A 2WXMA 1R7SA 3QAQA 3VTVA 1ZW7A 1YJIA 1I7HA 4EZJA 3ALBA 3DVGY 3CWIA 1U5FA 2W2XD 5G2NA 1P6SA 3ZVVA 1SEBD 4L6EA 2JT4B 1UZXB 2JSVX 1OQQA 1WMHA 3BINA 4WWMA 1K52A 1FCLA 2E2XA 4WJNA 1PDXA 4HK2A 2L0TA 4JIOU 1N5WA 4PK1A 1FB8A 2M56B 4X57B 2YF0A 1GGOA 4C56C 2COCA 4ZYNA 4HAUB 1P3QU 2Z13A 1KRHA 4YWGG 4ZOHC 1V5PA 2KDEB 1UPRA 3HW2B 2R09A 5CHVC 2BYTA 1KJTA 3A9KB 3KH0A 1MAIA 2IY0B 1HA5A 4F7ZA 4A5KA 1X1MA 1MK7B 1T5XD 4G3XB 4C4VA 1FFVA 2EMTA 2JZ3B 1Q0WB 4ICVA 2O2VB 1DOIA 1VZ6A 3H7PA 5J3QA 1ET9A 2BPSA 3CIRB 2KOXA 2BTEA 2O6VD 1TQZA 1FGZA 1I4XA 4K7WA 3X0WA 4NJCA 1SIFA 5BYQA 2CAYA 1BTKA 2J53A 1WZ0A 2L8JA 5I4DA 1IP9A 1UWMA 5I2SA 2QHOA 1FIQA 3KWLA 4FJYA 3RI7C 3RZFA 2E3TA 4N9F4 1ET6A 2V0GA 1Y8RC 4LJOB 3AU4A 4DXAB 2A5UA 1MK9B 2PW9A 1LO5D 1B1ZA 1V2YA 5JHGA 4BBNC 3IAS1 2Z14A 3DHGC 1V97A 3BIID 3O96A 2RPQA 3IG3A 1DROA 2N7JA 1UBQA 4Z2NA 1HTOA 3K9OB 4L23A 2P8VA 5D3VA 1XLPA 2YS1A 2LRWA 4A6QA 2YT1A 2RGNB 2JXXA 2AYOB 1U5GA 5J3TA 2PPHA 2FCSA 2Z0EB 3ZJVA 2K2JA 2HD5B 1FAOA 1JWAD 3BVZA 3EA6A 4HAZB 3QBVB 1QOGA 3ZW3A 2L83A 1MHHE 1JRUA 2GUMA 3OLMD 1P5TA 3KYCD 1JWMD 2NR2A 1PYWD 1H8CA 1WGUA 1JQ4A 2K2UA 1UF0A 3N9YC 2Y8FA 4BZAA 1N3HA 3DBRB 3ZJUA 3PHWB 2KDIA 2KQ4X 4US8A 3VUYA 3PPAA 3WCQA 4MT7A 5BYSA 3KYDD 2LVOA 3MHSD 4BBNF 1TTNA 4HDOA 2M14A 2OHFA 5DIFB 4KHOA 3AEAB 3D8EA 2DZIA 2QJLA 1H10A 3TL5A 4M02A 3NWAA 1TIFA 3P63A 2XNAC 1DDMA 1J0WA 4JKAA 1XD4A 3TVVA 2W2XC 2IY1B 2K5PA 2MHJA 3NWFA 4G0NB 4DHJB 1EU4A 1SHCA 1SE2A 5KHQA 1IGDA 3IVFA 2CHXA 3UZTA 1WH3A 2KIGA 3P1MA 3RYTA 1V1PB 2Z59A 2XBBC 1EAZA 2KTRA 4YSXB 4HPMB 2ON8A 3QWZB 3VVWB 2Y7BA 3UIOB 3A1QA 3B2FA 3U7DA 2WDVB 4DX8A 2KJHB 4OZBA 2CS4A 2MLBA 1DGJA 4HDQA 1Q10A 1NVID 4MJSA 4MK0A 3ZYYX 1EF5A 2PE9A 3RD2A 3QCAA 5AZHA 1FPYA 1SIJA 3A9JB 2BKFA 2L2IA 1MI1A 5C5BA 2C7NB 2D9YA 1KBLA 1V5MA 4LNOA 4L1BA 2LRUA 4KHAA 4HCNB 2DHZA 4ZRKA 2CB8A 2BYFA 2DHIA 4C7YA 2WH5A 3OG5A 4GN1A 2CODA 5HI1A 3E9OA 3CSFA 4ANWA 4B95A 2KX3A 4NAMA 3L08A 2DZMA 3AN1A 3AEBB 3Q3OC 4NY0A 1RFKA 3ENBA 5FKAC 3TCAA 5CHWA 4HVBA 3AMZA 3HRDD 4FA6A 1KH0A 2UZRA 2WXKA 3ZUNA 4MH0E 5J2RA 1RLFA 3MP9A 1FO4A 1Z87A 5HE2A 3CIKA 2L0FA 3PT2B 1OEYA 4WSFA 3TO1A 5IKCM 2SEBD 3G9WA 4IG7B 4JL9A 2M38A 4HB3B 1WYGA 2PVGC 2WX0A 4GDKA 1L2NA 1C79A 2RRFA 1D5MC 4KX6B 5D27A 2L3ZA 3VR9B 1L0YB 3ZDTA 4IDIA 4ARIA 1WX8A 2Z0QA 2H88B 2ZEQA 4I6PA 3H7PB 2INPE 3AEEB 3FC4A 2YS5A 1GJZA 1SB3C 3FP5A 2RSGA 2KC1A 3ECIA 1KLVA 2CKHB 2DA0A 2IGDA 2ELAA 2V3NA 3H1UA 2KJRA 1F2RC 5TSSA 1KZGA 2DKPA 4HPLB 3CMMB 4FXCA 5KHOA 2GCLA 2CQUA 4R3DA 2HE7A 1TYGB 3EECA 4DHZB 1JDEA 3A8QA 5D3YA 3R2TA 2LXCA 2QKLA 2YT2A 4S17A 1C78A 2N7DA 4II3B 1A5RA 1FNVA 5DPWA 4KHBB 1WI0A 2CRFA 1XODA 1JWUD 2LGSA 5LOPB 1SE3A 5HE1A 3NVZA 4PS3A 1PFJA 2K6QA 2KKCA 3SFEB 1F9JA 2LUMA 3AU5A 1SJED 3A58A 4PS7A 2LJ5A 2ZVOA 2IO3B 3FLVA 2YRYA 4D6WA 1ZDXA 2V1YA 3ODWA 3LXFA 4OVZA 1UD7A 3V6EB 5L95C 1K5GB 2Q5WD 1PGXA 3RZWC 4B0MA 3AE5B 2NTTA 4JQWC 2LKOA 3ODXA 3TEYA 3DQVA 4KGTA 1T77A 4P1CC 4KDIC 1SE9A 1D4BA 1E7PB 4WJQA 2W54A 3ETRA 3V61A 3ZJTA 3LB8C 2P0DA 4FBJB 1WR6E 1LW3A 2MBBB 1ZUD2 1FHXA 2DYMA 4Z2MB 3NOBA 3Q2AC 4RF0A 2FCNA 4YL8A 1FD6A 1V86A 1I4GA 2KMAA 2P0HA 2BS3B 2X18A 5IO9A 3E9SA 5FR3A 2LXAA 4JX1C 3D32A 1V61A 4RFBA 3AEGB 5HE0A 2ADZA 4A8XC 4D2KA 5IN7A 3B2GA 2GBRA 4W9FA 4LNIA 3FILB 2WNMA 4O1NA 1V1PA 2V4IB 3PZ8A 3B77A 4LDTB 3RPFC 1VZ7A 1UUPA 2BF8B 1WMHB 4M8NA 5EFXA 4Q2JA 4N58A 4DK5A 3KUDB 4BAXA 4G50A 1HTQA 5CHFA 2REXA 3R7RA 3PHXB 2KUQA 1DYNA 1FHOA 4BBKA 1MJDA 1TJEA 1GB1A 1NVLA 1E7VA 1WRIA 4WJOA 2QDFA 2W2WA 4LNKA 3N1ZC 4A6KA 1JWBD 3A4RA 3Q8EA 1CJEA 3SUZA 1DYQA 5E6NA 1DDWA 2D9XA 1WGDA 2KWCA 4ILGB 4W9EA 1NEKB 2HDEA 2BKRB 3OJ4B 3BWUD 2ZCBA 2C7MB 2R2QA 2CY5A 1N62A 4W9LA 4Y94A 3QIJA 1UNPA 3OAWA 3TBLD 4C4VB 4ZDVA 2CHZA 4CQNA 2WXPA 5EE0A 2GBJA 1WGGA 5HFYA 5L83A 4A90A 2KO3A 4W9DA 2K25A 1WM2A 2O2VA 3K9PB 1KOTA 4CHJA 1UNRA 1JROA 1EO6A 3PSCA 1ROEA 1Q5WB 1WGRA 1TS3A 1OFFA 2J4XA 1MG8A 2BBCA 4ACFA 5BMHA 2XK5A 4ZRIA 1ESFA 2DAFA 2NPTA 4JK8A 3U30A 2RLOA 3ZNZB 1KM7A 1VR9A 1XCQL 3TMPB 4NZLB 1AW7A 1EWCA 1F1HA 1UH6A 1P0RA 3DWMA 2V3SA 2MP2A 4FLHA 2BYVE 2JF5A 3CF6E 5TR5A 4GDKB 3ZDMC 4NAWA 4P6VF 5HKHA 1IGCA 2WXHA 1RM6C 1QZEA 4M0WB 2Y5PA 4OW0A 2KN4A 4KDLB 2C5LC 2KMCA 2WU5B 2HTHB 3RNEC 4K3CA 4XDDA 4QJ5B 5FR6A 4HAVB 4GZUA 3NRZA 2L76A 4DXFA 4GLSC 4E71A 4TV3A 1K53A 1WE6A 1MVKA 1LQBA 2KHWB 4RGTA 2KWVB 2GRIA 1I4RA 1UWXA 2VH2A 4JKDA 2WXOA 1YD8U 2W82A 3ZVRA 2V4LA 1XR0B 3OANA 3APFA 4AS1A 3B1LX 2RDBC 3V3XA 4XZ4A 1JWSD 2JYEA 2DENB 2JPHA 3DWGC 3NW8A 1PLSA 1C4PA 2N9KA 2D07B 2AWTA 4IC7B 1J8CA 2DIKA 2Y5BB 2K8CA 2ONQA 2KLGA 3ML8A 3Q3NC 3QQ8B 4HKZE 1UGMA 5I2MA 5LXIB 4NNJB 1K8RB 4KGRA 1Z5SB 4E3CA 3FKYA 1DOYA 2BGFA 1FRRA 2JX5A 3N20C 1QQGA 1S1QB 2WYQA 4XWWA 3PEGA 1WE7A 1D5XC 1XX0A 3KZ1A 4HAYB 3UI3A 4YTMB 1I35A 3UIPB 4FADA 2IZVB 2HTME 2WXGA 2IGGA 4ZHOA 3EFCA 4KKIA 2WXJA 1H4RA 1NTIA 4A6FB 3ULCA 1HXYD 4G11A 4RM8A 4MY6A 2MH7A 2KFKB 1C77A 3SEBA 4EOYA 3L0WB 5AEKB 2LI5A 3AE9B 2K00A 3ML9A 3WAMA 3NZ3A 5E6OA 2DYBA 5JZEB 5JHBA 4ANUA 3ODOA 3Q8FA 1WYWB 4PS8A 1EWYC 3TFMA 1V5OA 4II2B 3NSUA 3SD5A 2YEPB 3BK1A 3MTNB 1ISNA 5DH9B 1TZ1A 2IJ0A 4XWTA 5G5HA 5E6PA 3NJTA 2Y8GA 4DBBA 5MPOA 1K5DB 3DDCB 1E10A 2K0PA 1J7AA 3Q8CA 3ZNID 1WX7A 2K8EA 2MJDA 1UGJA 1BMLC 1SXTA 2N9XA 5JHHA 2RPVA 2YEPF 5LONB 4FJZA 5C6RA 4HWIB 1MKEA 1EGXA 1NI3A 5LLIA 3N1XC 2RUKB 1Y56A 4MGZE 3GS2A 2JRIB 3RNAC 4WH4A 2K9XA 3CSTA 1FXAA 1MPEA 1GOZA 4I6NB 4JKHA 3T9LA 2L7RA 3HHMA 3KQ4A 2AQ1B 2Z8LA 3M62B 2FUHB 4GGQA 5J17A 1Y5OA 2KN5A 3UGBB 3DPDA 4P1BC 4K3BA 2ROVA 2DHJA 2PLPA 2NVUI 2WU2B 2LHEA 1P7FA 4W9IA 2ASQA 1RAXA 2VZKB 3MDBC 5D3IB 1YQ4B 3AEFB 1YN5A 1EF1A 2BVCA 2ZW1A 4IAPA 2JQRB 4K2PA 3QWMA 4W9CA 4N6EB 3AE7B 4ILHA 2D10A 2DZKA 4NJ7A 1ZKHA 2LOZA 3TEXA 3V5WA 3NZUA 3EHVA 1MHXA 4TSSA 2MP2B 1WSPA 2NMBA 4FHJA 1T3QA 1BUIC 3EC8A 3AE8B 1KFYB 1UNQA 2GBNA 4OZAA 2Z0DB 2G9HD 5FI1A 3PV1A 3NVVA 1RFAA 4C7ZA 3E66A 1EUVB 2FUG1 3P4RB 2J59M 3R2IA 1VJKA 3VH4B 3PO0A 1E90A 2R82A 1ZM0A 4YXDB 4QJ3B 1C9FA 2BWES 2W3RA 1BAKA 2OJRA 4EZKA 4ZRQA 1V49A 2M0XA 3HSAA 2CU1A 4HB2B 3PVLA 3BVMA 1X11A 4JKEA 2C60A 4KGSA 5GXGB 3DOWA 2ZPYA 1FFUA 4GU2A 2FE8A 2PVOD 1E6EB 4P16A 5D3XA 3HUIA 3MJ5A 4REZA 2H7DA 3DXDA 1FM0D 3AH7A 1KI1B 2BB5A 1TKEA 1C76A 3BJIA 4BKSD 4CO7A 2M17A 2D9VA 3DVNU 4WWNA 2K6DB 1SSNA 4JWSC 1VRAB 1R4MI 1FEHA 3O13A 2D4QA 3NZSA 3NUHB 3APCA 2KQSA 3X23A 1PGBA 1WXAA 2DLBA 2KACA 2EJ8A 4LJPB 1E0ZA 2W55A 4ITKA 3SHQA 3DBLI 4GDLB 2LVPA 4C00A 4MELA 5KQ4A 5IA7A 3DBHI 5CTRC 3UQAA 3JSVA 2O6VB 5DHFB 4USAA 4EEWA 1MIXA 1VZ8A 1WFYA 3AXCA 2KFKA 1U5DA 1KC7A 1YMHE 5BO4B 1Q67A 5IOIA 1UEFA 4JGHB 2KDBA 1FHWA 2ZNVC 3A98B 3VR8B 3QARA 3PZ7A 2SAKA 4HB0B 5G55A 4IOYX 2KX0A 3I5JC 1PQSA 1WJ4A 4HKQA 2RR9A 1E8WA 3LJUX 3VRBB 2H7EA 1NI2A 1GAQB 3KLSX 1VLBA 2RNRB 4IWOA 1MG4A 2MX2A 5AUIA 4K7SA 4KV2A 3NWDA 2ZNVB 1R4MB 1XLOA 2WDRB 1C3TA 2K49A 1YNTE 4YSZB 2DN6A 2KAJA 3KVFB 4AOFA 1KLUD 1WJ6A 4EE2A 2MCNB 1I7AA 2NPTB 2KTRB 2G4DB 2WLBA 2I5FA 3FVCA 4MGKE 5C3JB 4DXGA 3A1QB 2FNJB 2IO2B 3AE3B 2D3CA 2UWQA 3HQCA 1OMWA 1EM7A 2KIEA 4W9HA 1GC7A 4MJSB 3E56A 3PGEA 3HVDA 1TJ6A 4IKGA 1IYFA 1E9MA 4EMOA 3I9V1 4M0WA 3P6AA 3GZNI 5C5BB 1M7EA 4NQLB 2HTHA 5BMIA 1BXTA 1V1OA 2NBVB 5D94A 1PUTA 4AJWA 1MPHA 2BS2B 2I1KA 2GS0A 3VUWA 3TJPA 3ENEA 1ZC4B 2EMSA 3Q6BA 3W5VB 4HLEA 2PKOA 3L10B 3RULA 1AQCA 4KVGB 1R4NI 2A4ZA 3AE6B 4HATB 4OHJA 2CU3A 3I3TB 1T6BX 3DBHB 4J6IA 1VBHA 3DBLB 3FEHA 3GE3C 2LEKA 5D7GA 1WJ1A 2QEJC 3WA0A 2BCJA 2AQ2B 4HROA 4LTUA 3VFKA 2FJUB 5CLLB 2JYTA 3LDZE 2WGSA 1AARA 4XWXA 3W2DA 2MBHA 4ANVA 4MH8A 2PJHA 2NBWB 4IM3A 3L16A 2QC8A 2DLWA 2ABDA 1TT5B 1M4VA 1ST7A 1WM3A 1AWEA 4PNKA 2Z0PA 4L1RA 4ZRPA 1WF9A 3KRWA 3PREA 1GUAB 1HB8A 2AEHA 2WXFA 1TZOA 4RGNA 1Y19B 3W1YA 1L4ZB 4BOSC 2HRJA 2LWPA 3L13A 2ZPNA 4JK9A 3D8FA 4ZRJA 1TGZB 2KXJA 4L2YA 3ZRCA 5C16A 2KDMA 3GOEA 4MSQB 1ZVRA 2M8SA 3TW1A 3MPXA 3PG7A 3JVZX 3AB5A 3SYXA 4GIVA 3KSYA 2QSDA 3URYA 2LG1A 4ILJA 3SV1A 1XD3B 2G3QB 4N59A 4DHJD 3H9DA 2N1WA 3PVUA 1XQQA 4LLGM 1J7CA 1GG3A 2GBMA 4GDLA 3KUCB 1X1FA 2O6VA 2N23A 5DCNA 4D0NB 1Q1OA 5J18A 3WIMA 1UELA 1SJHD 1YIWA 1V5UA 4RNAA 4TQ1A 2KGXB 4XYCA 1J19A 1FCCC 2EELA 2X0SA 4ZYSA 3QX1A 4YT0B 1N63A 4JE3B 2QMTA 4BKSA 2Z59B 3LYYA 4FN2A 2YLMA 1WVHA 1T0QC 1MI0A 2RVBB 3P42A 4AWJA 3D8DA 4AP4C 3RCZA 3DXCA 2DWQA 2AX5A 2EKIA 3N1YC 1KLGD 2K3UA 3PS6A 4B0EA 2ROZB 4F7HA 2M1MA 2QCZA 2KUPA 3NHEB 1KF6B 1RJ2A 4WJPA 2AL3A 2BS4B 2R2OA 4A3PA 4URKA 4K81A 3U2SC 3Q3JA 4KIKA 2D2QA 1J0GA 2EC1A 2NZ8B 3A8PA 1XXGA 1S3SG 2KTFA 1STEA 2BW2A 4XDCA 1TKYA 1TY0A 2PE6B 3MHZA 5T8IA 2L1CA 3CXBB 3QJZA 4CHKA 2N4FA 4DHZE 1WJNA 3MJWA 2DX1A 2G45B 1WGQA 1QOBA 2K8HA 3B08A 2CY4A 4MT5A 2I2YA 2HJ1A 1V6EA 5JLJB 1YN3A 2ZCCA 2IBIB 1FRDA 2N1VA 1IUEA 3I63C 2D9ZA 1HQRD 3Q3MC 2YSZA 1T0RC 2RGFA 3TIXA 2R2YA 2G1EA 2COAA 2PIAA 2FIFA 3W5UB 2IFSA 1XO3A 4ZHPA 2FCQA 1X1GA 1IBXA 2MW5A 1TBEA 4XE0A 2K39A 3UINB 3KW5B 1WR1A 1VDVA 2YVCA 1XCTL 2M4NA 4LNNA 5DPSA 2MKRA 1W1DA 1E8YA 4QXAB 2NCNA 4LK0M 3BYTB 2ACZB 1AYFA
chains in the Genus database with same CATH topology
3SU8X 5DPRA 4BKGA 2JWZA 2LASA 2NS5A 3GYOA 5GMVA 4PYZA 3ZLZA 2COPA 1WRDB 2MRPA 3H6NA 3OJ3A 3P7ZA 4K17A 3Q3FA 3HK0A 2G35A 1WY8A 5AZFA 1Z2MA 2I1JA 1BWNA 1V80A 3N30A 2UYZB 1EVHA 1NDDA 3DCGA 3QK0A 1U2BA 2K8BA 2K1FA 1YX6B 5C1ZA 5HE3A 1BTNA 3F0WA 2JY6A 4P7IA 2IYBA 2KQ7A 2KK8A 1W1GA 2C9WB 1GC6A 2PZ1A 3V6CB 2KJ6A 3VH3B 3HIZA 2FJ9A 5D2MB 3ZNGC 4LCDE 3HM3A 4TKNA 1WX9A 1V81A 3T8MA 2QKMA 3F5RA 3NS8A 4HB4B 1VCBA 4IWPA 4KZCA 3ULBA 5EDSA 4JKGA 2CR5A 4HCPB 3PP2A 5JVLA 3WANA 4F1SA 4FJVB 1OQNA 2R0DA 3KY9A 1XCGA 2W9NA 2IYDB 2J0MA 4EJNA 2IO1B 4RM9A 4IFSA 4JLCA 4EUTA 2BWFA 3V60A 4FULA 3AJ4A 1IPGA 5C79A 1CMXB 3ZNHB 4EZLA 5D3WA 1WXSA 3PSEB 1WGYA 1DBHA 3ZTDA 3B0AA 2VRRB 3EPYA 1FOEA 1P98A 2KCJA 1M7RA 3APDA 4IUMB 2KD0A 2KNBA 4WQOB 5IAAC 4B6HA 3FM8C 3VTWA 2UVMA 3E9LA 2KDFB 5KCVA 4F7GA 1NU2A 2D3GA 4FHKA 3VHTC 2N7EA 1V5TA 4GSWA 4HAWB 2MBQA 2JP2A 4BKTA 1UPQA 4GB9A 4DX90 3SBTA 2L00B 2I5CA 1ZSQA 1OQYA 4JKFA 3GYPA 2WWZA 3DVNV 2LGYA 3M95A 1E5WA 2UZSA 3PVWA 2DX5B 2GJYA 2DAJA 3RT3B 4TUUA 1RRBA 4A3OA 4IW0A 4CHMA 1D3ZA 5CLQB 3VTUA 3U8ZA 4NSWA 1C1YB 1ZC3B 1VBGA 1WJUA 4F7UP 2LZ6A 3BY4B 3VQIA 1T0YA 4DDID 2YT0A 3VXWA 4EKUA 5LXHA 1WZ3A 3ZIMA 2LBBA 1OTRB 4DBGA 3UQBA 4JK7A 2LVQA 2YS3A 2LULA 4KAXB 5D6JB 2DFKA 3DVGX 4MGIE 2P0FA 5C23A 2MWNB 4M8MA 2MBOA 1U27A 5CX3A 5JHAA 3A4SC 1SGHA 3M63B 4AJYB 3PLVA 2BYEA 3IBEA 3FSSA 2MWSB 4A6FA 1FGYA 1WG7A 3JW0X 4C0AA 4LDTD 2LGXA 2XEWA 3IFWB 2ZZPB 1HB6A 3LJ3A 3DXEA 1U4AA 4JKGB 1X05A 5GOWB 1WJMA 4WJ7A 2VRWB 1XKEA 1NTYA 2KFJA 2KZRA 2DYNA 1XT9B 4W9JA 1DDVA 5DPTA 4DWFA 1PMSA 3QA8A 4E74A 2LYDA 2XK5B 3VUXA 4MSMB 3R3MA 1YX5B 3N3KB 3JSVB 4MM3A 2ZVNA 2DYQA 1E8XA 2JVCA 3WAOA 2MBEA 2JZZA 2DHKA 3S2AA 3DBRI 4CYEA 4NAWB 1LFDA 2KLCA 2B3AA 1WI1A 4MDKE 1I42A 4IM2A 4OVUA 4EFOA 5FI0A 4JKBA 2FJLA 2N0YA 5DI9B 2LOXA 3A33B 4PYUA 3PRZA 2OOBB 1E8ZA 1P9DU 1U5EA 1GNUA 1VD2A 3ZKJC 5JH5C 2DZJA 4NQKE 5JP4A 4DDGD 2WX1A 4ICUA 1IRSA 1WIAA 4XX5A 2D9WA 3NY5A 1NBFC 3L54A 2J7QB 2KVRA 4H8SA 2XQNM 4HHVA 3SBGA 4BOZB 2AL6A 1V9JA 1OEYJ 4KSLC 1B55A 3AULA 4GOCA 1V89A 3V62A 3N32A 1WXVA 4MEMA 2KWUB 2OTXA 2Z0OA 4F8CB 2N9EB 1TXDA 3SNHA 3M3JA 4JKCA 3KUZA 4OVVA 2GMIC 4KZ0A 2L05A 4GXBA 3T06A 3PTFC 5L81A 3O65B 3VIAA 4NJ6A 3R7QA 3N7CA 4KSKC 3RCPA 4ANXA 4TQ0A 2FIDA 4GMVA 1P1AA 5IJMA 3SO6A 2RQ1A 4PQ0A 1UBIA 4AUQC 1E7UA 4WWOA 2GOWA 3QHTA 1WGHA 1MIZB 4K7UA 4B6WA 2Q13A 4ASWC 3VAWA 1ZGUB 3A9JA 2VSZA 2COFA 5DHAB 4RMAA 4K2OA 2PEAA 3AI5A 2VKIA 4WVFB 2G4SA 3WALA 3VDZA 1YQBA 3A9KA 3P2BA 4IWQA 1WXMA 2ZJDA 1V88A 4GMXB 2JRHA 2KANA 2MQJA 3E9PA 2FDQA 2DTCA 3WAPA 2OQBA 3R66C 2V76A 4A20A 1LB1A 3H7SA 3HM6X 2GBKA 1G6JA 2JUOA 5AZGA 2FAZA 2ELBA 5J3YA 3VOQA 1LM8B 3SDLC 2CHWA 4GPTB 2LGDA 1U29A 2MSED 4IM0A 2IO0B 2N9PC 3ZRFA 3ML4A 2DX5A 1W1HA 3PRMB 3ZO5B 3IHPC 4WAAA 1L7YA 2RSUA 2LUEA 4YONA 2WDTB 4KIKB 4B9KA 1RRPB 5KQ1A 3W1SA 1DIKA 3RUIB 4A6HA 4TYZA 2RD0A 3DBSA 3PRPB 3JYUA 3KRXA 1FXTB 1BT0A 2DYOA 3WYFB 1OGWA 4HXDA 4I6LB 1QC6A 2NBUA 2LD9A 2GCJA 3PLUA 3ONSA 3M1IB 1ACAA 1M94A 2EKEC 3EFUA 1LXDA 2MDXA 1OY2A 2DKQA 3UF8A 4K1RB 4BVUC 4HJKA 3ZTCA 2FCMA 1I2HA 1NTVA 3PZDA 4XC2A 3L17A 4NPNA 3W1SC 3C0RB 1YJ1A 4W9GA 2HJ8A 2KC2A 1P3RA 3QC8B 4MGYE 4W9KA 2D11A 1HBKA 2MFQA 2J0JA 2MA9B 1HE8A 4HAXB 2C7HA 2J0KA 4BFRA 1KZ7A 4WWPA 1X86A 3QAQA 3VTVA 1ZW7A 4EZJA 3ALBA 3DVGY 1U5FA 2W2XD 5G2NA 1P6SA 3ZVVA 4L6EA 1UZXB 2JT4B 1WMHA 3BINA 2E2XA 4WJNA 4HK2A 2L0TA 4JIOU 1FB8A 4X57B 2YF0A 1GGOA 2COCA 4ZYNA 4HAUB 1P3QU 1V5PA 2KDEB 1UPRA 3HW2B 2R09A 5CHVC 1KJTA 3A9KB 3KH0A 1MAIA 2IY0B 4F7ZA 4A5KA 1X1MA 1MK7B 4G3XB 2EMTA 2JZ3B 1Q0WB 4ICVA 2O2VB 3H7PA 5J3QA 2BPSA 2KOXA 2O6VD 1TQZA 1FGZA 4K7WA 3X0WA 1SIFA 2CAYA 1BTKA 1WZ0A 2L8JA 1IP9A 2QHOA 4FJYA 3RZFA 4N9F4 1Y8RC 4LJOB 3AU4A 4DXAB 2A5UA 1MK9B 1V2YA 5JHGA 4BBNC 3IG3A 3O96A 2RPQA 1DROA 1UBQA 4Z2NA 3K9OB 2P8VA 5D3VA 2YS1A 2LRWA 2YT1A 2RGNB 2JXXA 2AYOB 1U5GA 5J3TA 2PPHA 2FCSA 2Z0EB 2K2JA 2HD5B 1FAOA 4HAZB 3QBVB 3ZW3A 1JRUA 3OLMD 1P5TA 3KYCD 2NR2A 1H8CA 1WGUA 2K2UA 2Y8FA 1N3HA 3PHWB 2KDIA 3VUYA 3PPAA 4MT7A 3KYDD 2LVOA 3MHSD 4BBNF 1TTNA 4HDOA 2M14A 5DIFB 4KHOA 3D8EA 2DZIA 1H10A 3TL5A 1DDMA 1J0WA 4JKAA 1XD4A 3TVVA 2W2XC 2IY1B 4G0NB 4DHJB 1SHCA 5KHQA 3IVFA 2CHXA 3UZTA 1WH3A 3RYTA 2XBBC 1EAZA 2KTRA 4HPMB 3QWZB 3VVWB 2Y7BA 3UIOB 3A1QA 3U7DA 4DX8A 2KJHB 2CS4A 2MLBA 4HDQA 4MJSA 4MK0A 1EF5A 2PE9A 3RD2A 3QCAA 5AZHA 3A9JB 2BKFA 2L2IA 5C5BA 2C7NB 2D9YA 1KBLA 1V5MA 2LRUA 4KHAA 4HCNB 2DHZA 4ZRKA 2CB8A 2BYFA 2DHIA 2WH5A 4GN1A 2CODA 3E9OA 3CSFA 4ANWA 4B95A 2KX3A 3L08A 2DZMA 4NY0A 3ENBA 3TCAA 5CHWA 4HVBA 4FA6A 2UZRA 3ZUNA 4MH0E 5J2RA 1RLFA 1Z87A 5HE2A 3CIKA 2L0FA 3PT2B 1OEYA 4WSFA 3TO1A 3G9WA 4IG7B 4JL9A 2M38A 4HB3B 2WX0A 4GDKA 1L2NA 5D27A 2L3ZA 3ZDTA 1WX8A 2Z0QA 2ZEQA 4I6PA 3H7PB 2YS5A 1GJZA 3FP5A 2RSGA 2KC1A 3ECIA 1KLVA 2CKHB 2DA0A 2ELAA 3H1UA 2KJRA 1KZGA 2DKPA 4HPLB 3CMMB 5KHOA 2GCLA 2CQUA 2HE7A 3EECA 4DHZB 1JDEA 3A8QA 5D3YA 2LXCA 2QKLA 2N7DA 4II3B 1A5RA 5DPWA 4KHBB 1WI0A 2CRFA 1XODA 5LOPB 5HE1A 4PS3A 1PFJA 2K6QA 2KKCA 1F9JA 3AU5A 4PS7A 2LJ5A 2ZVOA 2IO3B 3FLVA 2YRYA 2V1YA 3ODWA 1UD7A 3V6EB 5L95C 1K5GB 3RZWC 4JQWC 2LKOA 3ODXA 3DQVA 4KDIC 1SE9A 4WJQA 3V61A 2P0DA 4FBJB 1WR6E 1LW3A 2MBBB 1FHXA 2DYMA 4Z2MB 3NOBA 2FCNA 4YL8A 1V86A 2KMAA 2P0HA 2X18A 2LXAA 3D32A 1V61A 5HE0A 2ADZA 2GBRA 4W9FA 4LDTB 2BF8B 4M8NA 1WMHB 5EFXA 4DK5A 3KUDB 4G50A 5CHFA 2REXA 3R7RA 3PHXB 1DYNA 1FHOA 4BBKA 1NVLA 1E7VA 4WJOA 2W2WA 4A6KA 3A4RA 3SUZA 5E6NA 1DDWA 2D9XA 1WGDA 2KWCA 4ILGB 4W9EA 2BKRB 3OJ4B 2ZCBA 2C7MB 2R2QA 2CY5A 4W9LA 4Y94A 3QIJA 1UNPA 3OAWA 3TBLD 4ZDVA 2CHZA 2GBJA 1WGGA 5L83A 2KO3A 4W9DA 2K25A 1WM2A 2O2VA 3K9PB 1KOTA 4CHJA 1UNRA 1EO6A 3PSCA 1Q5WB 1WGRA 1MG8A 2XK5A 4ZRIA 2DAFA 2NPTA 4JK8A 3U30A 2RLOA 3ZNZB 1KM7A 3TMPB 1UH6A 1P0RA 2V3SA 2MP2A 4FLHA 2BYVE 2JF5A 3CF6E 5TR5A 4GDKB 3ZDMC 4NAWA 5HKHA 1QZEA 4M0WB 4KDLB 2C5LC 2KMCA 2HTHB 5FR6A 4HAVB 4GZUA 2L76A 4E71A 4TV3A 1WE6A 1LQBA 2KHWB 2KWVB 4JKDA 1YD8U 3ZVRA 2V4LA 1XR0B 3OANA 3APFA 3B1LX 4XZ4A 2DENB 2JPHA 1PLSA 2D07B 2AWTA 4IC7B 1J8CA 2DIKA 2Y5BB 2K8CA 2KLGA 3ML8A 3QQ8B 1UGMA 5LXIB 4NNJB 1K8RB 1Z5SB 4E3CA 2BGFA 1QQGA 1S1QB 2WYQA 3PEGA 1WE7A 1XX0A 3KZ1A 4HAYB 1I35A 3UIPB 4FADA 2IZVB 1H4RA 1NTIA 4A6FB 3ULCA 4G11A 4RM8A 4MY6A 2KFKB 4EOYA 3L0WB 5AEKB 2LI5A 2K00A 3ML9A 3WAMA 5E6OA 2DYBA 5JZEB 5JHBA 4ANUA 3ODOA 1WYWB 4PS8A 3TFMA 1V5OA 4II2B 3NSUA 3SD5A 3MTNB 1ISNA 5DH9B 1TZ1A 5E6PA 2Y8GA 4DBBA 1K5DB 3DDCB 3ZNID 1WX7A 2N9XA 5JHHA 5LONB 4FJZA 5C6RA 4HWIB 1MKEA 1EGXA 5LLIA 2RUKB 4MGZE 2JRIB 3CSTA 4I6NB 4JKHA 3T9LA 2L7RA 3HHMA 3M62B 2FUHB 4GGQA 5J17A 1Y5OA 2KN5A 3UGBB 3DPDA 2ROVA 2DHJA 2NVUI 4W9IA 2ASQA 1RAXA 3MDBC 1EF1A 4IAPA 4K2PA 3QWMA 4W9CA 4ILHA 2D10A 2DZKA 4NJ7A 1ZKHA 2LOZA 3V5WA 3NZUA 3EHVA 2MP2B 2NMBA 4FHJA 3EC8A 1UNQA 2GBNA 2Z0DB 3PV1A 5FI1A 1RFAA 3E66A 1EUVB 2J59M 3VH4B 1E90A 2R82A 1ZM0A 2BWES 1BAKA 2OJRA 4EZKA 1V49A 2M0XA 2CU1A 4HB2B 3PVLA 1X11A 4JKEA 2C60A 3DOWA 2ZPYA 4GU2A 5D3XA 2H7DA 3DXDA 1KI1B 3BJIA 4BKSD 4CO7A 2M17A 2D9VA 3DVNU 4WWNA 2K6DB 1R4MI 3NZSA 2D4QA 3APCA 2KQSA 3X23A 1WXAA 2EJ8A 4LJPB 3SHQA 3DBLI 4GDLB 2LVPA 4MELA 5KQ4A 5IA7A 3DBHI 5CTRC 3UQAA 3JSVA 2O6VB 5DHFB 4EEWA 1MIXA 1WFYA 3AXCA 2KFKA 1U5DA 1KC7A 5BO4B 1Q67A 1UEFA 4JGHB 2KDBA 1FHWA 2ZNVC 3A98B 3QARA 4HB0B 5G55A 4IOYX 2KX0A 1PQSA 1WJ4A 2RR9A 1E8WA 3LJUX 2H7EA 1NI2A 2RNRB 4IWOA 2MX2A 4K7SA 4KV2A 2ZNVB 1C3TA 2DN6A 4AOFA 3KVFB 1WJ6A 2MCNB 1I7AA 2NPTB 2KTRB 2G4DB 2I5FA 4MGKE 3A1QB 2FNJB 2IO2B 2UWQA 3HQCA 1OMWA 4W9HA 1GC7A 4MJSB 3PGEA 1TJ6A 1IYFA 4EMOA 3P6AA 3GZNI 5C5BB 1M7EA 4NQLB 2HTHA 2NBVB 5D94A 4AJWA 1MPHA 2I1KA 2GS0A 3VUWA 3TJPA 3ENEA 1ZC4B 2EMSA 4HLEA 3L10B 3RULA 1AQCA 4KVGB 1R4NI 2A4ZA 4HATB 3I3TB 4J6IA 1VBHA 3FEHA 5D7GA 1WJ1A 3WA0A 2BCJA 3VFKA 5CLLB 3LDZE 1AARA 4XWXA 2MBHA 4ANVA 2PJHA 2NBWB 4IM3A 3L16A 2DLWA 2ABDA 1ST7A 1WM3A 1AWEA 4PNKA 2Z0PA 1WF9A 3KRWA 3PREA 1GUAB 1HB8A 2AEHA 1Y19B 3W1YA 4BOSC 2HRJA 2LWPA 3L13A 2ZPNA 4JK9A 3D8FA 4ZRJA 1TGZB 2KXJA 3ZRCA 5C16A 3GOEA 4MSQB 1ZVRA 2M8SA 3TW1A 3MPXA 3PG7A 3JVZX 3SYXA 4GIVA 3KSYA 2LG1A 4ILJA 3SV1A 1XD3B 2G3QB 4DHJD 3H9DA 2N1WA 3PVUA 1XQQA 1GG3A 2GBMA 4GDLA 3KUCB 1X1FA 2O6VA 2N23A 5DCNA 4D0NB 1Q1OA 5J18A 3WIMA 1UELA 1YIWA 1V5UA 4TQ1A 2KGXB 1J19A 2X0SA 3QX1A 4BKSA 2Z59B 4FN2A 2YLMA 1WVHA 2RVBB 4AWJA 3D8DA 4AP4C 3RCZA 3DXCA 3PS6A 2ROZB 4F7HA 2M1MA 2KUPA 3NHEB 4WJPA 1RJ2A 2AL3A 2R2OA 4A3PA 4URKA 4K81A 3Q3JA 4KIKA 2D2QA 1J0GA 2EC1A 2NZ8B 3A8PA 1S3SG 2KTFA 2PE6B 2L1CA 3CXBB 3QJZA 4CHKA 2N4FA 4DHZE 1WJNA 3MJWA 2DX1A 2G45B 1WGQA 2K8HA 3B08A 2CY4A 1V6EA 5JLJB 2ZCCA 2IBIB 2N1VA 2D9ZA 2YSZA 2RGFA 3TIXA 2COAA 2FIFA 2IFSA 2FCQA 1X1GA 2MW5A 1TBEA 2K39A 3UINB 3KW5B 1WR1A 2YVCA 2M4NA 5DPSA 2MKRA 1W1DA 1E8YA 2NCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRU A;  4KHA A;  1RAX A;  3MDB C;  3M3J A;  4HCN B;  2DHZ A;  1EF1 A;  4ZRK A;  2CB8 A;  2BYF A;  4IAP A;  3KUZ A;  4K2P A;  4OVV A;  3SU8 X;  3QWM A;  5DPR A;  4W9C A;  2DHI A;  2GMI C;  4BKG A;  2WH5 A;  4KZ0 A;  4GN1 A;  2L05 A;  2D10 A;  2COD A;  3T06 A;  4GXB A;  2DZK A;  4NJ7 A;  1ZKH A;  2JWZ A;  2LOZ A;  3CSF A;  3V5W A;  3NZU A;  5L81 A;  3PTF C;  4ANW A;  2LAS A;  2NS5 A;  2KX3 A;  4B95 A;  3EHV A;  3L08 A;  3GYO A;  2DZM A;  5GMV A;  4PYZ A;  2MP2 B;  3ZLZ A;  3O65 B;  2COP A;  3VIA A;  1WRD B;  4NJ6 A;  4NY0 A;  2MRP A;  3R7Q A;  2NMB A;  3N7C A;  3TCA A;  3H6N A;  4FHJ A;  3OJ3 A;  5CHW A;  4HVB A;  3P7Z A;  4K17 A;  3Q3F A;  3EC8 A;  4KSK C;  3RCP A;  3HK0 A;  4ANX A;  4FA6 A;  2G35 A;  4TQ0 A;  1WY8 A;  2FID A;  5AZF A;  2UZR A;  3ZUN A;  1UNQ A;  2GBN A;  4GMV A;  1P1A A;  5IJM A;  3SO6 A;  4MH0 E;  1Z2M A;  2RQ1 A;  4PQ0 A;  2I1J A;  5J2R A;  2Z0D B;  1BWN A;  1V80 A;  3PV1 A;  5FI1 A;  1RLF A;  1UBI A;  2UYZ B;  3N30 A;  4AUQ C;  1RFA A;  1EVH A;  1Z87 A;  1NDD A;  1E7U A;  1EUV B;  5HE2 A;  3CIK A;  4WWO A;  2GOW A;  2J59 M;  2L0F A;  3DCG A;  3PT2 B;  1OEY A;  4WSF A;  3QHT A;  1WGH A;  1MIZ B;  3QK0 A;  3VH4 B;  1U2B A;  3TO1 A;  1E90 A;  4K7U A;  4B6W A;  2K8B A;  3G9W A;  4IG7 B;  2K1F A;  1ZM0 A;  1YX6 B;  4JL9 A;  2M38 A;  4HB3 B;  2Q13 A;  5HE3 A;  2BWE S;  1BTN A;  5C1Z A;  1BAK A;  3F0W A;  2JY6 A;  4P7I A;  2OJR A;  2IYB A;  2WX0 A;  2KQ7 A;  4GDK A;  4EZK A;  1L2N A;  2KK8 A;  1V49 A;  4ASW C;  5D27 A;  2M0X A;  3VAW A;  2L3Z A;  1ZGU B;  1W1G A;  3A9J A;  3ZDT A;  2VSZ A;  2C9W B;  2CU1 A;  1GC6 A;  2Z0Q A;  3PVL A;  4HB2 B;  1X11 A;  1WX8 A;  2PZ1 A;  2ZEQ A;  4I6P A;  3H7P B;  2COF A;  5DHA B;  2YS5 A;  2KJ6 A;  4RMA A;  3T8M A;  3V6C B;  4K2O A;  2PEA A;  1GJZ A;  3VH3 B;  3HIZ A;  3FP5 A;  2C60 A;  2RSG A;  3AI5 A;  2VKI A;  4WVF B;  2G4S A;  3DOW A;  3WAL A;  2KC1 A;  3ECI A;  2FJ9 A;  3VDZ A;  5D2M B;  1KLV A;  2CKH B;  1YQB A;  3A9K A;  2ZPY A;  3P2B A;  2DA0 A;  4IWQ A;  3ZNG C;  4LCD E;  3HM3 A;  4TKN A;  1WXM A;  2ZJD A;  2ELA A;  4GU2 A;  1WX9 A;  2KJR A;  3H1U A;  1V81 A;  5D3X A;  1KZG A;  1V88 A;  2DKP A;  2QKM A;  3F5R A;  3CMM B;  2H7D A;  4GMX B;  4HB4 B;  3NS8 A;  1VCB A;  4HPL B;  4IWP A;  2JRH A;  3DXD A;  5KHO A;  2KAN A;  2MQJ A;  2GCL A;  1KI1 B;  2CQU A;  2HE7 A;  3BJI A;  3ULB A;  3EEC A;  4KZC A;  4BKS D;  4CO7 A;  4DHZ B;  2FDQ A;  2DTC A;  2M17 A;  5EDS A;  2CR5 A;  3A8Q A;  3PP2 A;  4HCP B;  2D9V A;  3WAP A;  5D3Y A;  2OQB A;  3DVN U;  3WAN A;  4F1S A;  3R66 C;  4WWN A;  2K6D B;  2V76 A;  2LXC A;  4FJV B;  2QKL A;  4A20 A;  1LB1 A;  1R4M I;  2N7D A;  1OQN A;  3NZS A;  2D4Q A;  4II3 B;  1A5R A;  2R0D A;  3KY9 A;  3APC A;  3H7S A;  2KQS A;  3HM6 X;  1XCG A;  4KHB B;  1WI0 A;  3X23 A;  1XOD A;  2CRF A;  1WXA A;  2W9N A;  5DPW A;  2GBK A;  5LOP B;  1G6J A;  5HE1 A;  2IYD B;  2EJ8 A;  2JUO A;  4LJP B;  4PS3 A;  2J0M A;  2FAZ A;  5AZG A;  1PFJ A;  2ELB A;  5J3Y A;  3VOQ A;  1LM8 B;  2K6Q A;  3SDL C;  3SHQ A;  2KKC A;  1F9J A;  4EJN A;  2CHW A;  2IO1 B;  3DBL I;  2LVP A;  4GDL B;  4MEL A;  3AU5 A;  4GPT B;  5KQ4 A;  4PS7 A;  2LJ5 A;  3DBH I;  4RM9 A;  2ZVO A;  5CTR C;  2IO3 B;  3FLV A;  3JSV A;  3UQA A;  2YRY A;  4IFS A;  2LGD A;  2O6V B;  5DHF B;  2V1Y A;  3ODW A;  4JLC A;  1UD7 A;  3V6E B;  1U29 A;  2MSE D;  1K5G B;  4IM0 A;  5L95 C;  4EEW A;  3RZW C;  1MIX A;  1WFY A;  2IO0 B;  4EUT A;  2N9P C;  3AXC A;  2KFK A;  3ZRF A;  1U5D A;  2BWF A;  3V60 A;  4JQW C;  4FUL A;  2LKO A;  1Q67 A;  3ML4 A;  3ODX A;  3DQV A;  1UEF A;  5BO4 B;  4JGH B;  2KDB A;  1FHW A;  2ZNV C;  3A98 B;  2DX5 A;  3AJ4 A;  1IPG A;  3QAR A;  5C79 A;  1W1H A;  1CMX B;  3PRM B;  1SE9 A;  4KDI C;  4HB0 B;  5G55 A;  3ZO5 B;  4IOY X;  2KX0 A;  4WJQ A;  3IHP C;  1PQS A;  3V61 A;  1WJ4 A;  4WAA A;  3ZNH B;  4EZL A;  1L7Y A;  5D3W A;  1WXS A;  3PSE B;  1WGY A;  2RR9 A;  2RSU A;  1DBH A;  2LUE A;  2P0D A;  1E8W A;  3LJU X;  4YON A;  2WDT B;  3ZTD A;  4FBJ B;  2H7E A;  3B0A A;  1WR6 E;  1LW3 A;  4KIK B;  4B9K A;  2VRR B;  1RRP B;  2MBB B;  3EPY A;  1NI2 A;  1FOE A;  5KQ1 A;  1FHX A;  2KCJ A;  1P98 A;  1M7R A;  3W1S A;  2DYM A;  3APD A;  4IUM B;  4Z2M B;  2KD0 A;  2KNB A;  2RNR B;  4IWO A;  3NOB A;  4WQO B;  5IAA C;  4B6H A;  3FM8 C;  2FCN A;  4YL8 A;  4A6H A;  3RUI B;  1V86 A;  3VTW A;  2UVM A;  2KDF B;  2KMA A;  2P0H A;  2MX2 A;  4TYZ A;  2X18 A;  5KCV A;  4F7G A;  1NU2 A;  2D3G A;  4K7S A;  4KV2 A;  4FHK A;  2LXA A;  2RD0 A;  2ZNV B;  1V61 A;  3D32 A;  3DBS A;  5HE0 A;  3PRP B;  2N7E A;  3VHT C;  2ADZ A;  1V5T A;  3JYU A;  4GSW A;  1C3T A;  4HAW B;  2MBQ A;  2JP2 A;  4BKT A;  3KRX A;  2DN6 A;  1UPQ A;  2GBR A;  4GB9 A;  1FXT B;  3KVF B;  4W9F A;  4AOF A;  1BT0 A;  4DX9 0;  1WJ6 A;  2MCN B;  1I7A A;  2DYO A;  2L00 B;  2NPT B;  3WYF B;  2KTR B;  1OGW A;  4HXD A;  4I6L B;  1QC6 A;  2G4D B;  4LDT B;  2NBU A;  2I5C A;  2LD9 A;  1ZSQ A;  1OQY A;  2I5F A;  1WMH B;  2BF8 B;  4M8N A;  2GCJ A;  3GYP A;  5EFX A;  3PLU A;  2WWZ A;  3A1Q B;  3DVN V;  2FNJ B;  3ONS A;  4MGK E;  4DK5 A;  3M1I B;  3KUD B;  1ACA A;  4G50 A;  1M94 A;  2IO2 B;  2LGY A;  5CHF A;  2REX A;  3R7R A;  3PHX B;  1DYN A;  1FHO A;  4BBK A;  2EKE C;  2UWQ A;  3HQC A;  3EFU A;  1OMW A;  1LXD A;  2MDX A;  1NVL A;  4W9H A;  1E7V A;  1GC7 A;  1OY2 A;  2DKQ A;  3M95 A;  4MJS B;  3PGE A;  1E5W A;  4K1R B;  4WJO A;  3UF8 A;  1TJ6 A;  2W2W A;  2UZS A;  3PVW A;  4BVU C;  1IYF A;  4HJK A;  2DX5 B;  4EMO A;  3ZTC A;  2GJY A;  3P6A A;  4A6K A;  3A4R A;  3GZN I;  5C5B B;  2FCM A;  1I2H A;  1NTV A;  2DAJ A;  1M7E A;  3SUZ A;  4NQL B;  3RT3 B;  2HTH A;  3PZD A;  4TUU A;  4XC2 A;  5E6N A;  1RRB A;  1DDW A;  2D9X A;  1WGD A;  2KWC A;  3L17 A;  4NPN A;  3W1S C;  4A3O A;  2NBV B;  5D94 A;  4IW0 A;  4W9E A;  4AJW A;  1MPH A;  4CHM A;  1D3Z A;  5IA7 A;  5CLQ B;  2BKR B;  3C0R B;  2I1K A;  2GS0 A;  3OJ4 B;  3VTU A;  1YJ1 A;  3VUW A;  2ZCB A;  3U8Z A;  3ENE A;  2C7M B;  2HJ8 A;  4W9G A;  3TJP A;  4NSW A;  1ZC4 B;  2R2Q A;  2EMS A;  2CY5 A;  1C1Y B;  1ZC3 B;  2KC2 A;  4W9L A;  4Y94 A;  1P3R A;  3QIJ A;  3QC8 B;  1UNP A;  3OAW A;  3TBL D;  4AJY B;  1WJU A;  4HLE A;  3L10 B;  4ZDV A;  2CHZ A;  4MGY E;  4W9K A;  4F7U P;  2D11 A;  1WGG A;  2GBJ A;  3RUL A;  1AQC A;  4KVG B;  1HBK A;  2LZ6 A;  2MFQ A;  5L83 A;  1R4N I;  2A4Z A;  2J0J A;  2MA9 B;  3BY4 B;  2KO3 A;  4W9D A;  3VQI A;  1T0Y A;  2K25 A;  4HAT B;  1HE8 A;  4HAX B;  1WM2 A;  2O2V A;  3K9P B;  4DDI D;  1KOT A;  3I3T B;  4CHJ A;  4J6I A;  1UNR A;  2YT0 A;  2C7H A;  3VXW A;  2J0K A;  4BFR A;  4EKU A;  1KZ7 A;  3FEH A;  4WWP A;  1EO6 A;  5LXH A;  3PSC A;  5D7G A;  1X86 A;  3QAQ A;  1WJ1 A;  1WZ3 A;  3VTV A;  1ZW7 A;  3WA0 A;  2BCJ A;  3ZIM A;  4EZJ A;  3ALB A;  1Q5W B;  1WGR A;  3DVG Y;  2LBB A;  3VFK A;  1MG8 A;  1U5F A;  2W2X D;  1OTR B;  5G2N A;  2XK5 A;  5CLL B;  4DBG A;  1P6S A;  3LDZ E;  1AAR A;  4ZRI A;  2DAF A;  2NPT A;  3UQB A;  3U30 A;  3ZVV A;  2LVQ A;  4XWX A;  2RLO A;  2YS3 A;  2MBH A;  3ZNZ B;  4ANV A;  4L6E A;  1KM7 A;  1UZX B;  2JT4 B;  2PJH A;  1WMH A;  3TMP B;  3BIN A;  2LUL A;  4KAX B;  5D6J B;  2NBW B;  2DFK A;  4IM3 A;  3DVG X;  3L16 A;  2DLW A;  1UH6 A;  2ABD A;  4MGI E;  2P0F A;  1P0R A;  2E2X A;  1ST7 A;  1WM3 A;  1AWE A;  2V3S A;  2MWN B;  2MP2 A;  4WJN A;  5C23 A;  4HK2 A;  2L0T A;  2MBO A;  4FLH A;  1U27 A;  4PNK A;  4M8M A;  4JIO U;  2Z0P A;  5CX3 A;  2BYV E;  2JF5 A;  1FB8 A;  3CF6 E;  4X57 B;  5TR5 A;  1WF9 A;  4GDK B;  3ZDM C;  4NAW A;  3KRW A;  2YF0 A;  3PRE A;  1GUA B;  1HB8 A;  2AEH A;  5HKH A;  5JHA A;  2COC A;  1QZE A;  4M0W B;  1Y19 B;  4HAU B;  1P3Q U;  4ZYN A;  3W1Y A;  4BOS C;  4KDL B;  3A4S C;  2C5L C;  1SGH A;  2HRJ A;  2KMC A;  2LWP A;  2ZPN A;  3L13 A;  3M63 B;  2HTH B;  1V5P A;  2KDE B;  3D8F A;  1UPR A;  3PLV A;  4ZRJ A;  3HW2 B;  2R09 A;  1TGZ B;  4HAV B;  4GZU A;  2KXJ A;  5CHV C;  5FR6 A;  1KJT A;  2BYE A;  2L76 A;  3A9K B;  3IBE A;  1MAI A;  3KH0 A;  4E71 A;  4TV3 A;  3ZRC A;  3FSS A;  2IY0 B;  1WE6 A;  4A6F A;  5C16 A;  2MWS B;  4F7Z A;  1LQB A;  4A5K A;  1X1M A;  1FGY A;  2KHW B;  1WG7 A;  1MK7 B;  2KWV B;  3JW0 X;  4C0A A;  4G3X B;  2LGX A;  2XEW A;  4LDT D;  3GOE A;  4MSQ B;  1ZVR A;  3IFW B;  2M8S A;  2ZZP B;  3TW1 A;  1YD8 U;  2EMT A;  1HB6 A;  2JZ3 B;  3MPX A;  3ZVR A;  3LJ3 A;  3DXE A;  3PG7 A;  1Q0W B;  1U4A A;  3JVZ X;  4ICV A;  1X05 A;  5GOW B;  2V4L A;  1XR0 B;  3OAN A;  3APF A;  3B1L X;  3SYX A;  2O2V B;  1WJM A;  4GIV A;  3KSY A;  4WJ7 A;  2VRW B;  2LG1 A;  1XKE A;  5J3Q A;  3H7P A;  4XZ4 A;  3SV1 A;  1NTY A;  1XD3 B;  2G3Q B;  2BPS A;  2KFJ A;  2KZR A;  4DHJ D;  3H9D A;  2N1W A;  2DYN A;  2DEN B;  2JPH A;  1XT9 B;  3PVU A;  2KOX A;  1DDV A;  1PLS A;  4W9J A;  5DPT A;  2O6V D;  4DWF A;  1XQQ A;  1PMS A;  1TQZ A;  1FGZ A;  2AWT A;  2D07 B;  3QA8 A;  4IC7 B;  4K7W A;  3X0W A;  2LYD A;  4E74 A;  1J8C A;  2XK5 B;  1SIF A;  2K8C A;  2CAY A;  2Y5B B;  1BTK A;  1GG3 A;  2KLG A;  4MSM B;  3VUX A;  3ML8 A;  1WZ0 A;  2GBM A;  2L8J A;  3QQ8 B;  4GDL A;  3KUC B;  1IP9 A;  1X1F A;  3R3M A;  1UGM A;  1YX5 B;  3N3K B;  3JSV B;  2QHO A;  2O6V A;  4MM3 A;  2ZVN A;  4FJY A;  5LXI B;  2N23 A;  4NNJ B;  4D0N B;  1K8R B;  5DCN A;  2DYQ A;  1Z5S B;  3RZF A;  4E3C A;  1Q1O A;  1E8X A;  4N9F 4;  5J18 A;  1Y8R C;  4LJO B;  3AU4 A;  4DXA B;  1UEL A;  2A5U A;  2JVC A;  3WIM A;  1YIW A;  1MK9 B;  1V5U A;  2BGF A;  1QQG A;  2KGX B;  1S1Q B;  4TQ1 A;  3WAO A;  1V2Y A;  2JZZ A;  2MBE A;  5JHG A;  2WYQ A;  4BBN C;  2DHK A;  3S2A A;  3DBR I;  3O96 A;  2RPQ A;  3IG3 A;  1J19 A;  4CYE A;  3PEG A;  1DRO A;  4NAW B;  1LFD A;  1WE7 A;  3QX1 A;  1UBQ A;  2KLC A;  4Z2N A;  1XX0 A;  3KZ1 A;  4HAY B;  3K9O B;  4BKS A;  2B3A A;  2Z59 B;  1I35 A;  2P8V A;  4FN2 A;  1WI1 A;  5D3V A;  4MDK E;  2YS1 A;  2LRW A;  1I42 A;  3UIP B;  4FAD A;  4IM2 A;  4OVU A;  4EFO A;  2YT1 A;  2RGN B;  2YLM A;  2JXX A;  2IZV B;  5FI0 A;  1U5G A;  1WVH A;  5J3T A;  2AYO B;  2PPH A;  2FCS A;  2Z0E B;  2RVB B;  2FJL A;  2K2J A;  2N0Y A;  3D8D A;  2HD5 B;  1FAO A;  4AP4 C;  4AWJ A;  5DI9 B;  2LOX A;  3RCZ A;  3DXC A;  1H4R A;  1NTI A;  4HAZ B;  3A33 B;  4A6F B;  3ULC A;  3QBV B;  4PYU A;  3ZW3 A;  4G11 A;  3PRZ A;  4RM8 A;  4MY6 A;  3PS6 A;  2KFK B;  2ROZ B;  1JRU A;  3OLM D;  2OOB B;  1E8Z A;  4EOY A;  1P5T A;  4F7H A;  2M1M A;  2KUP A;  1P9D U;  3KYC D;  2NR2 A;  3L0W B;  1U5E A;  3NHE B;  5AEK B;  2LI5 A;  1GNU A;  2K00 A;  1H8C A;  1VD2 A;  3ZKJ C;  1WGU A;  2K2U A;  5JH5 C;  4WJP A;  1RJ2 A;  2Y8F A;  1N3H A;  2AL3 A;  3ML9 A;  3WAM A;  2DZJ A;  4NQK E;  3PHW B;  2KDI A;  2R2O A;  5E6O A;  2DYB A;  5JP4 A;  4K81 A;  4A3P A;  4DDG D;  4URK A;  5JZE B;  5JHB A;  3VUY A;  3Q3J A;  4ANU A;  3ODO A;  2WX1 A;  3PPA A;  4MT7 A;  4KIK A;  2D2Q A;  3KYD D;  4ICU A;  1J0G A;  2EC1 A;  2LVO A;  3MHS D;  4BBN F;  2NZ8 B;  1IRS A;  1TTN A;  3A8P A;  1WIA A;  4HDO A;  1WYW B;  2M14 A;  4PS8 A;  5DIF B;  1S3S G;  2KTF A;  3TFM A;  1V5O A;  4II2 B;  3NSU A;  4XX5 A;  4KHO A;  3SD5 A;  2D9W A;  3MTN B;  3D8E A;  2DZI A;  2PE6 B;  1ISN A;  1H10 A;  2L1C A;  3CXB B;  5DH9 B;  1TZ1 A;  3NY5 A;  3QJZ A;  2N4F A;  3TL5 A;  4CHK A;  5E6P A;  1NBF C;  3L54 A;  4DHZ E;  1DDM A;  2Y8G A;  4DBB A;  1WJN A;  2J7Q B;  2KVR A;  1K5D B;  1J0W A;  3DDC B;  2DX1 A;  3MJW A;  4H8S A;  2G45 B;  1WGQ A;  1XD4 A;  2XQN M;  3TVV A;  2W2X C;  2K8H A;  3B08 A;  2CY4 A;  2IY1 B;  4HHV A;  3ZNI D;  1WX7 A;  1V6E A;  5JLJ B;  2ZCC A;  4G0N B;  4DHJ B;  2IBI B;  2N1V A;  1SHC A;  2D9Z A;  5KHQ A;  4BOZ B;  2AL6 A;  3IVF A;  1V9J A;  2CHX A;  2YSZ A;  3UZT A;  1OEY J;  1WH3 A;  2N9X A;  2RGF A;  4KSL C;  5JHH A;  3RYT A;  1B55 A;  3TIX A;  2XBB C;  1EAZ A;  2COA A;  2KTR A;  3AUL A;  4HPM B;  5LON B;  4FJZ A;  5C6R A;  4GOC A;  1V89 A;  2FIF A;  4HWI B;  1MKE A;  1EGX A;  3QWZ B;  3V62 A;  5LLI A;  2IFS A;  3VVW B;  2RUK B;  2Y7B A;  3UIO B;  3A1Q A;  4MGZ E;  3N32 A;  3U7D A;  2FCQ A;  1X1G A;  2MW5 A;  2JRI B;  4DX8 A;  1TBE A;  2KJH B;  1WXV A;  2CS4 A;  2K39 A;  2MLB A;  3CST A;  4MEM A;  4HDQ A;  3UIN B;  3KW5 B;  1WR1 A;  4MJS A;  2KWU B;  4MK0 A;  2YVC A;  2M4N A;  4I6N B;  1EF5 A;  2OTX A;  3T9L A;  2PE9 A;  3RD2 A;  2L7R A;  3HHM A;  2Z0O A;  3QCA A;  5DPS A;  3M62 B;  2FUH B;  3A9J B;  4GGQ A;  5AZH A;  2BKF A;  2L2I A;  4F8C B;  1Y5O A;  2MKR A;  5J17 A;  2KN5 A;  1W1D A;  5C5B A;  1E8Y A;  2N9E B;  3UGB B;  3DPD A;  2NCN A;  2C7N B;  2ROV A;  2DHJ A;  2D9Y A;  2NVU I;  1TXD A;  4W9I A;  1V5M A;  3SNH A;  2ASQ A; 
#chains in the Genus database with same CATH topology
 3OHM B;  3SU8 X;  5DPR A;  4BKG A;  3RNC C;  2Y5C A;  4YSY B;  2WDQ B;  2JWZ A;  3R8B A;  2LAS A;  2NS5 A;  3AE2 B;  3GYO A;  5GMV A;  5C2T B;  4PYZ A;  3ZLZ A;  3MC0 B;  2COP A;  1WRD B;  3P4Q B;  2D3A A;  2MRP A;  3NVY A;  1ZXH A;  3H6N A;  2JXT A;  3OJ3 A;  3P7Z A;  4K17 A;  3Q3F A;  3HK0 A;  3SR6 A;  1QOF A;  2G35 A;  1RWS A;  1ZP0 B;  1WY8 A;  5AZF A;  1JCK B;  1D6E C;  1Z2M A;  2I1J A;  1BWN A;  1V80 A;  2WXR A;  4HEA 1;  2LJI A;  2UYZ B;  3N30 A;  3HIE A;  1EVH A;  1NDD A;  1YQ3 B;  4QJ4 B;  3DHI C;  1N60 A;  3DCG A;  3QK0 A;  1U2B A;  3TSS A;  3TEW A;  2K8B A;  1F77 A;  2K1F A;  1YX6 B;  5C1Z A;  5HE3 A;  1BTN A;  3F0W A;  2JY6 A;  4P7I A;  2IYB A;  2KQ7 A;  2KK8 A;  1W1G A;  2C9W B;  1GC6 A;  2PZ1 A;  5E6J A;  3V6C B;  2KJ6 A;  3VH3 B;  3HIZ A;  4HRS A;  1L6V A;  4QAY A;  2FJ9 A;  5D2M B;  1I4H A;  3ZNG C;  4LCD E;  3HM3 A;  4TKN A;  1YOV B;  5BMG A;  1WX9 A;  1V81 A;  1SE4 A;  2QKM A;  3F5R A;  3T8M A;  3NS8 A;  4HB4 B;  1VCB A;  4IWP A;  3U12 A;  4KZC A;  3ULB A;  5EDS A;  4JKG A;  2ZKM X;  2CR5 A;  4HCP B;  3PP2 A;  5JVL A;  3WAN A;  4F1S A;  1D5Z C;  4FJV B;  5IRS A;  3IXS A;  1F0Z A;  1OQN A;  1TS5 A;  2R0D A;  3KY9 A;  1JRP A;  1ENF A;  1SBB B;  3NS1 A;  1XCG A;  3FIL A;  4MAC A;  2W9N A;  2IYD B;  2J0M A;  2E6X A;  3BVG A;  5LNK 1;  1GPX A;  4RGM A;  2Z4D A;  4EJN A;  2IO1 B;  4RM9 A;  4IFS A;  4MM3 B;  4JLC A;  4EUT A;  1CK1 A;  2BWF A;  2MJ3 A;  3V60 A;  4FUL A;  2GLS A;  3AJ4 A;  1IPG A;  5C79 A;  1CMX B;  4CSQ A;  3AED B;  3ZNH B;  2D3B A;  4EZL A;  3EGR A;  5D3W A;  1WXS A;  3PSE B;  1WGY A;  1ZYI A;  1DBH A;  1L4D B;  3ZTD A;  3B0A A;  3Q8A A;  2VRR B;  3EPY A;  1FOE A;  3B9J A;  4YTN B;  1P98 A;  2KCJ A;  1I4P A;  1M7R A;  3APD A;  4IUM B;  1TY2 A;  2KD0 A;  2KNB A;  4WQO B;  5IAA C;  4B6H A;  1NYR A;  3FM8 C;  3VTW A;  4ARC A;  2UVM A;  3E9L A;  2KDF B;  1KTK A;  5KCV A;  4F7G A;  1NU2 A;  2D3G A;  3T3N A;  4FHK A;  3RMK C;  3VHT C;  2N7E A;  2OJW A;  1V5T A;  4GSW A;  1QLB B;  3C8Y A;  4HAW B;  2MBQ A;  2JP2 A;  4BKT A;  1UPQ A;  4GB9 A;  1ZOY B;  4KHB A;  4DX9 0;  1MFW A;  3SBT A;  2L00 B;  2XN9 C;  2FBW B;  2I5C A;  1ZSQ A;  1OQY A;  4JKF A;  3GYP A;  2WWZ A;  3DVN V;  3RNF C;  3RNB C;  2LGY A;  4WUR A;  2MJE A;  3M95 A;  3BK2 A;  1E5W A;  1XLN A;  4IOI E;  2UZS A;  3PVW A;  2DX5 B;  2GJY A;  2DAJ A;  1WXQ A;  3RT3 B;  1YN4 A;  4TUU A;  1RRB A;  5D3D A;  4A3O A;  3AE4 B;  3BZD B;  4IW0 A;  4CHM A;  4HJG E;  1D3Z A;  5CLQ B;  3VTU A;  1ZPS A;  2LGI A;  3U8Z A;  4NSW A;  1WGK A;  2R61 A;  1LGR A;  4OSN A;  2VH1 A;  3P4P B;  1C1Y B;  1ZC3 B;  1VBG A;  1WJU A;  4F7U P;  2LZ6 A;  1CQV A;  4J3O D;  5EE1 A;  3BY4 B;  3VQI A;  1T0Y A;  4DDI D;  2YT0 A;  2RMM A;  2X8X X;  3MFG A;  3VXW A;  2GB1 A;  2DBY A;  4EKU A;  5LXH A;  2NMQ A;  1WZ3 A;  3ZIM A;  4LNF A;  2LBB A;  4HSI A;  1OTR B;  4C80 A;  4DBG A;  5IP4 D;  3UQB A;  4JK7 A;  2LVQ A;  2YS3 A;  1EU3 A;  2LUL A;  4KAX B;  1TS4 A;  5D6J B;  2DFK A;  3DVG X;  4MGI E;  2P0F A;  5C23 A;  3VRA B;  2MWN B;  1I4Q A;  4M8M A;  2MBO A;  3MC9 A;  1U27 A;  2IND C;  5CX3 A;  3ABV B;  3Q14 C;  5JHA A;  4RGO S;  3A4S C;  2BT6 A;  1SGH A;  1HZ5 A;  3M63 B;  3PLV A;  4AJY B;  2BYE A;  1NEN B;  3IBE A;  1C4A A;  3FSS A;  2MWS B;  4A6F A;  2WQY B;  1FGY A;  3RN9 C;  1WG7 A;  2JZP A;  3JW0 X;  4C0A A;  4LDT D;  2LGX A;  2XEW A;  5LG4 B;  3IFW B;  2GI9 A;  2ZZP B;  3W9C B;  1HB6 A;  3LJ3 A;  3DXE A;  1U4A A;  4JKG B;  1X05 A;  5GOW B;  1FXI A;  1ACC A;  2X38 A;  1WJM A;  4WJ7 A;  2VRW B;  4OT1 A;  1OQR A;  1XKE A;  3Q69 A;  2KWD A;  1NTY A;  2KFJ A;  2KZR A;  4S0R A;  2DYN A;  1XT9 B;  4W9J A;  1DDV A;  1T0S C;  4H2A A;  1A70 A;  4YTP B;  5DPT A;  4DWF A;  1PMS A;  2CJN A;  2INC C;  1ZXI A;  1L0V B;  3QA8 A;  1YJJ A;  3GE8 C;  2LYD A;  4E74 A;  2XK5 B;  3VUX A;  4MSM B;  2LHD A;  3R3M A;  1YX5 B;  3N3K B;  3JSV B;  4RCO A;  4MM3 A;  2ZVN A;  2DYQ A;  1E8X A;  1SF0 A;  1L0X B;  1DOX A;  2JVC A;  1N61 A;  3WAO A;  2MBE A;  2JZZ A;  1GB4 A;  3P4S B;  3L4P A;  2DHK A;  3S2A A;  3DBR I;  3ZQ4 A;  4CYE A;  4NAW B;  1LFD A;  4US9 A;  5FK9 C;  1UNS A;  2KLC A;  2B3A A;  1WI1 A;  4MDK E;  1PGA A;  1JML A;  1I42 A;  2OED A;  4IM2 A;  4OVU A;  4EFO A;  3TUO A;  5FI0 A;  4JKB A;  1IBX B;  2FJL A;  3RNG C;  2N0Y A;  1K50 A;  5DI9 B;  2LOX A;  4RH6 A;  2Y3A A;  3A33 B;  4PYU A;  3IT4 B;  3MC8 A;  3PRZ A;  2I38 A;  3NVW A;  2OOB B;  1E8Z A;  2BQQ A;  2M19 A;  2V3P A;  3GB1 A;  1P9D U;  3AE1 B;  1U5E A;  1GNU A;  1VD2 A;  1HEZ E;  3ZKJ C;  5JH5 C;  1N6Z A;  2DZJ A;  2V9H A;  4NQK E;  1P7E A;  2ICI A;  2W3S A;  5JP4 A;  4DDG D;  3IAM 1;  1V8C A;  2WX1 A;  4ICU A;  1IRS A;  1WIA A;  2J42 A;  4A55 A;  4XX5 A;  1FNW A;  3AV8 A;  2D9W A;  2WHI A;  1J7B A;  1RYJ A;  3OWE B;  3NY5 A;  1HZ6 A;  1NBF C;  3L54 A;  2J7Q B;  2KVR A;  4H8S A;  3Q8B A;  2XQN M;  2WXN A;  4HHV A;  3SBG A;  3GP7 A;  4BOZ B;  2AL6 A;  1V9J A;  2N9L A;  1OEY J;  4KSL C;  1K51 A;  1B55 A;  3ZXR A;  3FAH A;  3AUL A;  2LFI A;  4GOC A;  1V89 A;  3V62 A;  3C19 A;  3V05 A;  3N32 A;  3U7Z A;  1WXV A;  1XF5 L;  2D5G A;  4TMA B;  4MEM A;  2L32 A;  2WXI A;  2KWU B;  2OTX A;  3AM9 A;  2CJO A;  1XEE A;  2Z0O A;  2KT7 A;  5H8Y E;  1F52 A;  4M00 A;  4RF1 A;  3RFZ B;  4XGA B;  4F8C B;  4DQO C;  2N9E B;  2VZK D;  5EE9 A;  3AEC B;  1TXD A;  2JWU A;  3SNH A;  3M3J A;  4JKC A;  5JXV A;  3KUZ A;  5H92 C;  4OVV A;  2GMI C;  4KZ0 A;  2L05 A;  4GXB A;  3T06 A;  2KVZ A;  3PTF C;  5L81 A;  4M01 A;  1XLQ A;  3O65 B;  3VIA A;  4NJ6 A;  1QKZ A;  2B76 B;  5G5G A;  2DNF A;  3R7Q A;  3N7C A;  1TKG A;  2RDH A;  1N5X A;  4KSK C;  2JU6 X;  3RCP A;  4ANX A;  4TQ0 A;  2FID A;  1R4N B;  4GMV A;  1PFD A;  2IPK D;  1P1A A;  5IJM A;  3SO6 A;  1C4C A;  2L1A A;  2RQ1 A;  4PQ0 A;  4JWU C;  1ZDV A;  1UBI A;  4AUQ C;  1L6U A;  1E7U A;  3H8H A;  4WWO A;  2GOW A;  1FNU A;  3QHT A;  1WGH A;  1MIZ B;  4OZC A;  5HG2 A;  4K7U A;  4B6W A;  1F2R I;  2Q13 A;  3HVZ A;  4ASW C;  3GZN B;  1QOA A;  3VAW A;  1ZGU B;  3A9J A;  2VSZ A;  2COF A;  5DHA B;  4RMA A;  4K2O A;  2PEA A;  2INN E;  4A9A A;  3AI5 A;  2VKI A;  4WVF B;  2G4S A;  3WAL A;  3VDZ A;  1QIL A;  1YQB A;  3A9K A;  3P2B A;  4IWQ A;  1WXM A;  2ZJD A;  1V88 A;  4GMX B;  2AQ3 B;  1CZP A;  2JRH A;  3U52 E;  1L5P A;  2KAN A;  2MQJ A;  3E9P A;  2ZW0 A;  4JPS A;  1WWT A;  4KKJ A;  1QF6 A;  2FDQ A;  2DTC A;  2K22 A;  3WAP A;  3KWV A;  2OQB A;  2QIE B;  3R66 C;  2V76 A;  2WXL A;  4A20 A;  2KMM A;  1LB1 A;  4GNK B;  3H7S A;  5AUK A;  3HM6 X;  2GBK A;  1G6J A;  2JUO A;  5AZG A;  1JAL A;  2FAZ A;  2ELB A;  5J3Y A;  3VOQ A;  1LM8 B;  3SDL C;  1JW9 D;  2CHW A;  4HPP A;  1TS2 A;  4GPT B;  1ZE3 D;  2QIL A;  2MEK A;  2LGD A;  2IGH A;  5HHD G;  1U29 A;  2MSE D;  4IM0 A;  2IO0 B;  3SFD B;  2N9P C;  2WP9 B;  3ZRF A;  3ML4 A;  3U4E G;  2DX5 A;  1W1H A;  3PRM B;  3ZO5 B;  1QQR A;  2H89 B;  3IHP C;  4WAA A;  2KYW A;  1L7Y A;  2NBV A;  2RSU A;  4PT5 A;  2KR0 A;  2LUE A;  4YON A;  2WDT B;  4KIK B;  4B9K A;  1RRP B;  5KQ1 A;  3W1S A;  2TSS A;  1DIK A;  4WQM A;  2LMC A;  2RDG A;  3EUB 2;  3RUI B;  4A6H A;  4DIX A;  3ZGZ A;  4TYZ A;  2WXQ A;  3BYY B;  4GOU A;  3DHH C;  2UU7 A;  2RD0 A;  3DBS A;  3PRP B;  1B9R A;  3JYU A;  1QT9 A;  2J52 A;  3KRX A;  1FXT B;  1BT0 A;  2DYO A;  4AQ7 A;  3WYF B;  1OGW A;  4HXD A;  4I6L B;  1QC6 A;  2WS3 B;  2NBU A;  2M0A A;  2LD9 A;  2GCJ A;  3PLU A;  3TEZ A;  3ONS A;  3M1I B;  2PMV A;  1ACA A;  2NTS A;  1M94 A;  3J9C A;  2BB6 A;  2EKE C;  3EFU A;  1LXD A;  2MDX A;  1OY2 A;  2DKQ A;  4WAF A;  3UF8 A;  4K1R B;  4WIP A;  4BVU C;  1NYQ A;  4HJK A;  3ZTC A;  3DCX A;  2FCM A;  1I2H A;  1NTV A;  2PTL A;  3I57 A;  3IT6 B;  3PZD A;  4XC2 A;  3L17 A;  4NPN A;  3W1S C;  3C0R B;  1FMA D;  1YJ1 A;  2IDY A;  2N0S B;  4W9G A;  2L52 A;  2HJ8 A;  5M4Y B;  2KC2 A;  1P3R A;  1AWD A;  3QC8 B;  5EE3 A;  1AN8 A;  4UDU C;  3ZXV A;  3T3O A;  4MGY E;  4W9K A;  2D11 A;  1HBK A;  2MFQ A;  3NG0 A;  5BYR A;  2J0J A;  2MA9 B;  1HE8 A;  4HAX B;  2C7H A;  2J0K A;  4BFR A;  1KZ7 A;  4WWP A;  1X86 A;  2WXM A;  1R7S A;  3QAQ A;  3VTV A;  1ZW7 A;  1YJI A;  1I7H A;  4EZJ A;  3ALB A;  3DVG Y;  3CWI A;  1U5F A;  2W2X D;  5G2N A;  1P6S A;  3ZVV A;  1SEB D;  4L6E A;  2JT4 B;  1UZX B;  2JSV X;  1OQQ A;  1WMH A;  3BIN A;  4WWM A;  1K52 A;  1FCL A;  2E2X A;  4WJN A;  1PDX A;  4HK2 A;  2L0T A;  4JIO U;  1N5W A;  4PK1 A;  1FB8 A;  2M56 B;  4X57 B;  2YF0 A;  1GGO A;  4C56 C;  2COC A;  4ZYN A;  4HAU B;  1P3Q U;  2Z13 A;  1KRH A;  4YWG G;  4ZOH C;  1V5P A;  2KDE B;  1UPR A;  3HW2 B;  2R09 A;  5CHV C;  2BYT A;  1KJT A;  3A9K B;  3KH0 A;  1MAI A;  2IY0 B;  1HA5 A;  4F7Z A;  4A5K A;  1X1M A;  1MK7 B;  1T5X D;  4G3X B;  4C4V A;  1FFV A;  2EMT A;  2JZ3 B;  1Q0W B;  4ICV A;  2O2V B;  1DOI A;  1VZ6 A;  3H7P A;  5J3Q A;  1ET9 A;  2BPS A;  3CIR B;  2KOX A;  2BTE A;  2O6V D;  1TQZ A;  1FGZ A;  1I4X A;  4K7W A;  3X0W A;  4NJC A;  1SIF A;  5BYQ A;  2CAY A;  1BTK A;  2J53 A;  1WZ0 A;  2L8J A;  5I4D A;  1IP9 A;  1UWM A;  5I2S A;  2QHO A;  1FIQ A;  3KWL A;  4FJY A;  3RI7 C;  3RZF A;  2E3T A;  4N9F 4;  1ET6 A;  2V0G A;  1Y8R C;  4LJO B;  3AU4 A;  4DXA B;  2A5U A;  1MK9 B;  2PW9 A;  1LO5 D;  1B1Z A;  1V2Y A;  5JHG A;  4BBN C;  3IAS 1;  2Z14 A;  3DHG C;  1V97 A;  3BII D;  3O96 A;  2RPQ A;  3IG3 A;  1DRO A;  2N7J A;  1UBQ A;  4Z2N A;  1HTO A;  3K9O B;  4L23 A;  2P8V A;  5D3V A;  1XLP A;  2YS1 A;  2LRW A;  4A6Q A;  2YT1 A;  2RGN B;  2JXX A;  2AYO B;  1U5G A;  5J3T A;  2PPH A;  2FCS A;  2Z0E B;  3ZJV A;  2K2J A;  2HD5 B;  1FAO A;  1JWA D;  3BVZ A;  3EA6 A;  4HAZ B;  3QBV B;  1QOG A;  3ZW3 A;  2L83 A;  1MHH E;  1JRU A;  2GUM A;  3OLM D;  1P5T A;  3KYC D;  1JWM D;  2NR2 A;  1PYW D;  1H8C A;  1WGU A;  1JQ4 A;  2K2U A;  1UF0 A;  3N9Y C;  2Y8F A;  4BZA A;  1N3H A;  3DBR B;  3ZJU A;  3PHW B;  2KDI A;  2KQ4 X;  4US8 A;  3VUY A;  3PPA A;  3WCQ A;  4MT7 A;  5BYS A;  3KYD D;  2LVO A;  3MHS D;  4BBN F;  1TTN A;  4HDO A;  2M14 A;  2OHF A;  5DIF B;  4KHO A;  3AEA B;  3D8E A;  2DZI A;  2QJL A;  1H10 A;  3TL5 A;  4M02 A;  3NWA A;  1TIF A;  3P63 A;  2XNA C;  1DDM A;  1J0W A;  4JKA A;  1XD4 A;  3TVV A;  2W2X C;  2IY1 B;  2K5P A;  2MHJ A;  3NWF A;  4G0N B;  4DHJ B;  1EU4 A;  1SHC A;  1SE2 A;  5KHQ A;  1IGD A;  3IVF A;  2CHX A;  3UZT A;  1WH3 A;  2KIG A;  3P1M A;  3RYT A;  1V1P B;  2Z59 A;  2XBB C;  1EAZ A;  2KTR A;  4YSX B;  4HPM B;  2ON8 A;  3QWZ B;  3VVW B;  2Y7B A;  3UIO B;  3A1Q A;  3B2F A;  3U7D A;  2WDV B;  4DX8 A;  2KJH B;  4OZB A;  2CS4 A;  2MLB A;  1DGJ A;  4HDQ A;  1Q10 A;  1NVI D;  4MJS A;  4MK0 A;  3ZYY X;  1EF5 A;  2PE9 A;  3RD2 A;  3QCA A;  5AZH A;  1FPY A;  1SIJ A;  3A9J B;  2BKF A;  2L2I A;  1MI1 A;  5C5B A;  2C7N B;  2D9Y A;  1KBL A;  1V5M A;  4LNO A;  4L1B A;  2LRU A;  4KHA A;  4HCN B;  2DHZ A;  4ZRK A;  2CB8 A;  2BYF A;  2DHI A;  4C7Y A;  2WH5 A;  3OG5 A;  4GN1 A;  2COD A;  5HI1 A;  3E9O A;  3CSF A;  4ANW A;  4B95 A;  2KX3 A;  4NAM A;  3L08 A;  2DZM A;  3AN1 A;  3AEB B;  3Q3O C;  4NY0 A;  1RFK A;  3ENB A;  5FKA C;  3TCA A;  5CHW A;  4HVB A;  3AMZ A;  3HRD D;  4FA6 A;  1KH0 A;  2UZR A;  2WXK A;  3ZUN A;  4MH0 E;  5J2R A;  1RLF A;  3MP9 A;  1FO4 A;  1Z87 A;  5HE2 A;  3CIK A;  2L0F A;  3PT2 B;  1OEY A;  4WSF A;  3TO1 A;  5IKC M;  2SEB D;  3G9W A;  4IG7 B;  4JL9 A;  2M38 A;  4HB3 B;  1WYG A;  2PVG C;  2WX0 A;  4GDK A;  1L2N A;  1C79 A;  2RRF A;  1D5M C;  4KX6 B;  5D27 A;  2L3Z A;  3VR9 B;  1L0Y B;  3ZDT A;  4IDI A;  4ARI A;  1WX8 A;  2Z0Q A;  2H88 B;  2ZEQ A;  4I6P A;  3H7P B;  2INP E;  3AEE B;  3FC4 A;  2YS5 A;  1GJZ A;  1SB3 C;  3FP5 A;  2RSG A;  2KC1 A;  3ECI A;  1KLV A;  2CKH B;  2DA0 A;  2IGD A;  2ELA A;  2V3N A;  3H1U A;  2KJR A;  1F2R C;  5TSS A;  1KZG A;  2DKP A;  4HPL B;  3CMM B;  4FXC A;  5KHO A;  2GCL A;  2CQU A;  4R3D A;  2HE7 A;  1TYG B;  3EEC A;  4DHZ B;  1JDE A;  3A8Q A;  5D3Y A;  3R2T A;  2LXC A;  2QKL A;  2YT2 A;  4S17 A;  1C78 A;  2N7D A;  4II3 B;  1A5R A;  1FNV A;  5DPW A;  4KHB B;  1WI0 A;  2CRF A;  1XOD A;  1JWU D;  2LGS A;  5LOP B;  1SE3 A;  5HE1 A;  3NVZ A;  4PS3 A;  1PFJ A;  2K6Q A;  2KKC A;  3SFE B;  1F9J A;  2LUM A;  3AU5 A;  1SJE D;  3A58 A;  4PS7 A;  2LJ5 A;  2ZVO A;  2IO3 B;  3FLV A;  2YRY A;  4D6W A;  1ZDX A;  2V1Y A;  3ODW A;  3LXF A;  4OVZ A;  1UD7 A;  3V6E B;  5L95 C;  1K5G B;  2Q5W D;  1PGX A;  3RZW C;  4B0M A;  3AE5 B;  2NTT A;  4JQW C;  2LKO A;  3ODX A;  3TEY A;  3DQV A;  4KGT A;  1T77 A;  4P1C C;  4KDI C;  1SE9 A;  1D4B A;  1E7P B;  4WJQ A;  2W54 A;  3ETR A;  3V61 A;  3ZJT A;  3LB8 C;  2P0D A;  4FBJ B;  1WR6 E;  1LW3 A;  2MBB B;  1ZUD 2;  1FHX A;  2DYM A;  4Z2M B;  3NOB A;  3Q2A C;  4RF0 A;  2FCN A;  4YL8 A;  1FD6 A;  1V86 A;  1I4G A;  2KMA A;  2P0H A;  2BS3 B;  2X18 A;  5IO9 A;  3E9S A;  5FR3 A;  2LXA A;  4JX1 C;  3D32 A;  1V61 A;  4RFB A;  3AEG B;  5HE0 A;  2ADZ A;  4A8X C;  4D2K A;  5IN7 A;  3B2G A;  2GBR A;  4W9F A;  4LNI A;  3FIL B;  2WNM A;  4O1N A;  1V1P A;  2V4I B;  3PZ8 A;  3B77 A;  4LDT B;  3RPF C;  1VZ7 A;  1UUP A;  2BF8 B;  1WMH B;  4M8N A;  5EFX A;  4Q2J A;  4N58 A;  4DK5 A;  3KUD B;  4BAX A;  4G50 A;  1HTQ A;  5CHF A;  2REX A;  3R7R A;  3PHX B;  2KUQ A;  1DYN A;  1FHO A;  4BBK A;  1MJD A;  1TJE A;  1GB1 A;  1NVL A;  1E7V A;  1WRI A;  4WJO A;  2QDF A;  2W2W A;  4LNK A;  3N1Z C;  4A6K A;  1JWB D;  3A4R A;  3Q8E A;  1CJE A;  3SUZ A;  1DYQ A;  5E6N A;  1DDW A;  2D9X A;  1WGD A;  2KWC A;  4ILG B;  4W9E A;  1NEK B;  2HDE A;  2BKR B;  3OJ4 B;  3BWU D;  2ZCB A;  2C7M B;  2R2Q A;  2CY5 A;  1N62 A;  4W9L A;  4Y94 A;  3QIJ A;  1UNP A;  3OAW A;  3TBL D;  4C4V B;  4ZDV A;  2CHZ A;  4CQN A;  2WXP A;  5EE0 A;  2GBJ A;  1WGG A;  5HFY A;  5L83 A;  4A90 A;  2KO3 A;  4W9D A;  2K25 A;  1WM2 A;  2O2V A;  3K9P B;  1KOT A;  4CHJ A;  1UNR A;  1JRO A;  1EO6 A;  3PSC A;  1ROE A;  1Q5W B;  1WGR A;  1TS3 A;  1OFF A;  2J4X A;  1MG8 A;  2BBC A;  4ACF A;  5BMH A;  2XK5 A;  4ZRI A;  1ESF A;  2DAF A;  2NPT A;  4JK8 A;  3U30 A;  2RLO A;  3ZNZ B;  1KM7 A;  1VR9 A;  1XCQ L;  3TMP B;  4NZL B;  1AW7 A;  1EWC A;  1F1H A;  1UH6 A;  1P0R A;  3DWM A;  2V3S A;  2MP2 A;  4FLH A;  2BYV E;  2JF5 A;  3CF6 E;  5TR5 A;  4GDK B;  3ZDM C;  4NAW A;  4P6V F;  5HKH A;  1IGC A;  2WXH A;  1RM6 C;  1QZE A;  4M0W B;  2Y5P A;  4OW0 A;  2KN4 A;  4KDL B;  2C5L C;  2KMC A;  2WU5 B;  2HTH B;  3RNE C;  4K3C A;  4XDD A;  4QJ5 B;  5FR6 A;  4HAV B;  4GZU A;  3NRZ A;  2L76 A;  4DXF A;  4GLS C;  4E71 A;  4TV3 A;  1K53 A;  1WE6 A;  1MVK A;  1LQB A;  2KHW B;  4RGT A;  2KWV B;  2GRI A;  1I4R A;  1UWX A;  2VH2 A;  4JKD A;  2WXO A;  1YD8 U;  2W82 A;  3ZVR A;  2V4L A;  1XR0 B;  3OAN A;  3APF A;  4AS1 A;  3B1L X;  2RDB C;  3V3X A;  4XZ4 A;  1JWS D;  2JYE A;  2DEN B;  2JPH A;  3DWG C;  3NW8 A;  1PLS A;  1C4P A;  2N9K A;  2D07 B;  2AWT A;  4IC7 B;  1J8C A;  2DIK A;  2Y5B B;  2K8C A;  2ONQ A;  2KLG A;  3ML8 A;  3Q3N C;  3QQ8 B;  4HKZ E;  1UGM A;  5I2M A;  5LXI B;  4NNJ B;  1K8R B;  4KGR A;  1Z5S B;  4E3C A;  3FKY A;  1DOY A;  2BGF A;  1FRR A;  2JX5 A;  3N20 C;  1QQG A;  1S1Q B;  2WYQ A;  4XWW A;  3PEG A;  1WE7 A;  1D5X C;  1XX0 A;  3KZ1 A;  4HAY B;  3UI3 A;  4YTM B;  1I35 A;  3UIP B;  4FAD A;  2IZV B;  2HTM E;  2WXG A;  2IGG A;  4ZHO A;  3EFC A;  4KKI A;  2WXJ A;  1H4R A;  1NTI A;  4A6F B;  3ULC A;  1HXY D;  4G11 A;  4RM8 A;  4MY6 A;  2MH7 A;  2KFK B;  1C77 A;  3SEB A;  4EOY A;  3L0W B;  5AEK B;  2LI5 A;  3AE9 B;  2K00 A;  3ML9 A;  3WAM A;  3NZ3 A;  5E6O A;  2DYB A;  5JZE B;  5JHB A;  4ANU A;  3ODO A;  3Q8F A;  1WYW B;  4PS8 A;  1EWY C;  3TFM A;  1V5O A;  4II2 B;  3NSU A;  3SD5 A;  2YEP B;  3BK1 A;  3MTN B;  1ISN A;  5DH9 B;  1TZ1 A;  2IJ0 A;  4XWT A;  5G5H A;  5E6P A;  3NJT A;  2Y8G A;  4DBB A;  5MPO A;  1K5D B;  3DDC B;  1E10 A;  2K0P A;  1J7A A;  3Q8C A;  3ZNI D;  1WX7 A;  2K8E A;  2MJD A;  1UGJ A;  1BML C;  1SXT A;  2N9X A;  5JHH A;  2RPV A;  2YEP F;  5LON B;  4FJZ A;  5C6R A;  4HWI B;  1MKE A;  1EGX A;  1NI3 A;  5LLI A;  3N1X C;  2RUK B;  1Y56 A;  4MGZ E;  3GS2 A;  2JRI B;  3RNA C;  4WH4 A;  2K9X A;  3CST A;  1FXA A;  1MPE A;  1GOZ A;  4I6N B;  4JKH A;  3T9L A;  2L7R A;  3HHM A;  3KQ4 A;  2AQ1 B;  2Z8L A;  3M62 B;  2FUH B;  4GGQ A;  5J17 A;  1Y5O A;  2KN5 A;  3UGB B;  3DPD A;  4P1B C;  4K3B A;  2ROV A;  2DHJ A;  2PLP A;  2NVU I;  2WU2 B;  2LHE A;  1P7F A;  4W9I A;  2ASQ A;  1RAX A;  2VZK B;  3MDB C;  5D3I B;  1YQ4 B;  3AEF B;  1YN5 A;  1EF1 A;  2BVC A;  2ZW1 A;  4IAP A;  2JQR B;  4K2P A;  3QWM A;  4W9C A;  4N6E B;  3AE7 B;  4ILH A;  2D10 A;  2DZK A;  4NJ7 A;  1ZKH A;  2LOZ A;  3TEX A;  3V5W A;  3NZU A;  3EHV A;  1MHX A;  4TSS A;  2MP2 B;  1WSP A;  2NMB A;  4FHJ A;  1T3Q A;  1BUI C;  3EC8 A;  3AE8 B;  1KFY B;  1UNQ A;  2GBN A;  4OZA A;  2Z0D B;  2G9H D;  5FI1 A;  3PV1 A;  3NVV A;  1RFA A;  4C7Z A;  3E66 A;  1EUV B;  2FUG 1;  3P4R B;  2J59 M;  3R2I A;  1VJK A;  3VH4 B;  3PO0 A;  1E90 A;  2R82 A;  1ZM0 A;  4YXD B;  4QJ3 B;  1C9F A;  2BWE S;  2W3R A;  1BAK A;  2OJR A;  4EZK A;  4ZRQ A;  1V49 A;  2M0X A;  3HSA A;  2CU1 A;  4HB2 B;  3PVL A;  3BVM A;  1X11 A;  4JKE A;  2C60 A;  4KGS A;  5GXG B;  3DOW A;  2ZPY A;  1FFU A;  4GU2 A;  2FE8 A;  2PVO D;  1E6E B;  4P16 A;  5D3X A;  3HUI A;  3MJ5 A;  4REZ A;  2H7D A;  3DXD A;  1FM0 D;  3AH7 A;  1KI1 B;  2BB5 A;  1TKE A;  1C76 A;  3BJI A;  4BKS D;  4CO7 A;  2M17 A;  2D9V A;  3DVN U;  4WWN A;  2K6D B;  1SSN A;  4JWS C;  1VRA B;  1R4M I;  1FEH A;  3O13 A;  2D4Q A;  3NZS A;  3NUH B;  3APC A;  2KQS A;  3X23 A;  1PGB A;  1WXA A;  2DLB A;  2KAC A;  2EJ8 A;  4LJP B;  1E0Z A;  2W55 A;  4ITK A;  3SHQ A;  3DBL I;  4GDL B;  2LVP A;  4C00 A;  4MEL A;  5KQ4 A;  5IA7 A;  3DBH I;  5CTR C;  3UQA A;  3JSV A;  2O6V B;  5DHF B;  4USA A;  4EEW A;  1MIX A;  1VZ8 A;  1WFY A;  3AXC A;  2KFK A;  1U5D A;  1KC7 A;  1YMH E;  5BO4 B;  1Q67 A;  5IOI A;  1UEF A;  4JGH B;  2KDB A;  1FHW A;  2ZNV C;  3A98 B;  3VR8 B;  3QAR A;  3PZ7 A;  2SAK A;  4HB0 B;  5G55 A;  4IOY X;  2KX0 A;  3I5J C;  1PQS A;  1WJ4 A;  4HKQ A;  2RR9 A;  1E8W A;  3LJU X;  3VRB B;  2H7E A;  1NI2 A;  1GAQ B;  3KLS X;  1VLB A;  2RNR B;  4IWO A;  1MG4 A;  2MX2 A;  5AUI A;  4K7S A;  4KV2 A;  3NWD A;  2ZNV B;  1R4M B;  1XLO A;  2WDR B;  1C3T A;  2K49 A;  1YNT E;  4YSZ B;  2DN6 A;  2KAJ A;  3KVF B;  4AOF A;  1KLU D;  1WJ6 A;  4EE2 A;  2MCN B;  1I7A A;  2NPT B;  2KTR B;  2G4D B;  2WLB A;  2I5F A;  3FVC A;  4MGK E;  5C3J B;  4DXG A;  3A1Q B;  2FNJ B;  2IO2 B;  3AE3 B;  2D3C A;  2UWQ A;  3HQC A;  1OMW A;  1EM7 A;  2KIE A;  4W9H A;  1GC7 A;  4MJS B;  3E56 A;  3PGE A;  3HVD A;  1TJ6 A;  4IKG A;  1IYF A;  1E9M A;  4EMO A;  3I9V 1;  4M0W A;  3P6A A;  3GZN I;  5C5B B;  1M7E A;  4NQL B;  2HTH A;  5BMI A;  1BXT A;  1V1O A;  2NBV B;  5D94 A;  1PUT A;  4AJW A;  1MPH A;  2BS2 B;  2I1K A;  2GS0 A;  3VUW A;  3TJP A;  3ENE A;  1ZC4 B;  2EMS A;  3Q6B A;  3W5V B;  4HLE A;  2PKO A;  3L10 B;  3RUL A;  1AQC A;  4KVG B;  1R4N I;  2A4Z A;  3AE6 B;  4HAT B;  4OHJ A;  2CU3 A;  3I3T B;  1T6B X;  3DBH B;  4J6I A;  1VBH A;  3DBL B;  3FEH A;  3GE3 C;  2LEK A;  5D7G A;  1WJ1 A;  2QEJ C;  3WA0 A;  2BCJ A;  2AQ2 B;  4HRO A;  4LTU A;  3VFK A;  2FJU B;  5CLL B;  2JYT A;  3LDZ E;  2WGS A;  1AAR A;  4XWX A;  3W2D A;  2MBH A;  4ANV A;  4MH8 A;  2PJH A;  2NBW B;  4IM3 A;  3L16 A;  2QC8 A;  2DLW A;  2ABD A;  1TT5 B;  1M4V A;  1ST7 A;  1WM3 A;  1AWE A;  4PNK A;  2Z0P A;  4L1R A;  4ZRP A;  1WF9 A;  3KRW A;  3PRE A;  1GUA B;  1HB8 A;  2AEH A;  2WXF A;  1TZO A;  4RGN A;  1Y19 B;  3W1Y A;  1L4Z B;  4BOS C;  2HRJ A;  2LWP A;  3L13 A;  2ZPN A;  4JK9 A;  3D8F A;  4ZRJ A;  1TGZ B;  2KXJ A;  4L2Y A;  3ZRC A;  5C16 A;  2KDM A;  3GOE A;  4MSQ B;  1ZVR A;  2M8S A;  3TW1 A;  3MPX A;  3PG7 A;  3JVZ X;  3AB5 A;  3SYX A;  4GIV A;  3KSY A;  2QSD A;  3URY A;  2LG1 A;  4ILJ A;  3SV1 A;  1XD3 B;  2G3Q B;  4N59 A;  4DHJ D;  3H9D A;  2N1W A;  3PVU A;  1XQQ A;  4LLG M;  1J7C A;  1GG3 A;  2GBM A;  4GDL A;  3KUC B;  1X1F A;  2O6V A;  2N23 A;  5DCN A;  4D0N B;  1Q1O A;  5J18 A;  3WIM A;  1UEL A;  1SJH D;  1YIW A;  1V5U A;  4RNA A;  4TQ1 A;  2KGX B;  4XYC A;  1J19 A;  1FCC C;  2EEL A;  2X0S A;  4ZYS A;  3QX1 A;  4YT0 B;  1N63 A;  4JE3 B;  2QMT A;  4BKS A;  2Z59 B;  3LYY A;  4FN2 A;  2YLM A;  1WVH A;  1T0Q C;  1MI0 A;  2RVB B;  3P42 A;  4AWJ A;  3D8D A;  4AP4 C;  3RCZ A;  3DXC A;  2DWQ A;  2AX5 A;  2EKI A;  3N1Y C;  1KLG D;  2K3U A;  3PS6 A;  4B0E A;  2ROZ B;  4F7H A;  2M1M A;  2QCZ A;  2KUP A;  3NHE B;  1KF6 B;  1RJ2 A;  4WJP A;  2AL3 A;  2BS4 B;  2R2O A;  4A3P A;  4URK A;  4K81 A;  3U2S C;  3Q3J A;  4KIK A;  2D2Q A;  1J0G A;  2EC1 A;  2NZ8 B;  3A8P A;  1XXG A;  1S3S G;  2KTF A;  1STE A;  2BW2 A;  4XDC A;  1TKY A;  1TY0 A;  2PE6 B;  3MHZ A;  5T8I A;  2L1C A;  3CXB B;  3QJZ A;  4CHK A;  2N4F A;  4DHZ E;  1WJN A;  3MJW A;  2DX1 A;  2G45 B;  1WGQ A;  1QOB A;  2K8H A;  3B08 A;  2CY4 A;  4MT5 A;  2I2Y A;  2HJ1 A;  1V6E A;  5JLJ B;  1YN3 A;  2ZCC A;  2IBI B;  1FRD A;  2N1V A;  1IUE A;  3I63 C;  2D9Z A;  1HQR D;  3Q3M C;  2YSZ A;  1T0R C;  2RGF A;  3TIX A;  2R2Y A;  2G1E A;  2COA A;  2PIA A;  2FIF A;  3W5U B;  2IFS A;  1XO3 A;  4ZHP A;  2FCQ A;  1X1G A;  1IBX A;  2MW5 A;  1TBE A;  4XE0 A;  2K39 A;  3UIN B;  3KW5 B;  1WR1 A;  1VDV A;  2YVC A;  1XCT L;  2M4N A;  4LNN A;  5DPS A;  2MKR A;  1W1D A;  1E8Y A;  4QXA B;  2NCN A;  4LK0 M;  3BYT B;  2ACZ B;  1AYF A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  5DPR A;  4BKG A;  2JWZ A;  2LAS A;  2NS5 A;  3GYO A;  5GMV A;  4PYZ A;  3ZLZ A;  2COP A;  1WRD B;  2MRP A;  3H6N A;  3OJ3 A;  3P7Z A;  4K17 A;  3Q3F A;  3HK0 A;  2G35 A;  1WY8 A;  5AZF A;  1Z2M A;  2I1J A;  1BWN A;  1V80 A;  3N30 A;  2UYZ B;  1EVH A;  1NDD A;  3DCG A;  3QK0 A;  1U2B A;  2K8B A;  2K1F A;  1YX6 B;  5C1Z A;  5HE3 A;  1BTN A;  3F0W A;  2JY6 A;  4P7I A;  2IYB A;  2KQ7 A;  2KK8 A;  1W1G A;  2C9W B;  1GC6 A;  2PZ1 A;  3V6C B;  2KJ6 A;  3VH3 B;  3HIZ A;  2FJ9 A;  5D2M B;  3ZNG C;  4LCD E;  3HM3 A;  4TKN A;  1WX9 A;  1V81 A;  3T8M A;  2QKM A;  3F5R A;  3NS8 A;  4HB4 B;  1VCB A;  4IWP A;  4KZC A;  3ULB A;  5EDS A;  4JKG A;  2CR5 A;  4HCP B;  3PP2 A;  5JVL A;  3WAN A;  4F1S A;  4FJV B;  1OQN A;  2R0D A;  3KY9 A;  1XCG A;  2W9N A;  2IYD B;  2J0M A;  4EJN A;  2IO1 B;  4RM9 A;  4IFS A;  4JLC A;  4EUT A;  2BWF A;  3V60 A;  4FUL A;  3AJ4 A;  1IPG A;  5C79 A;  1CMX B;  3ZNH B;  4EZL A;  5D3W A;  1WXS A;  3PSE B;  1WGY A;  1DBH A;  3ZTD A;  3B0A A;  2VRR B;  3EPY A;  1FOE A;  1P98 A;  2KCJ A;  1M7R A;  3APD A;  4IUM B;  2KD0 A;  2KNB A;  4WQO B;  5IAA C;  4B6H A;  3FM8 C;  3VTW A;  2UVM A;  3E9L A;  2KDF B;  5KCV A;  4F7G A;  1NU2 A;  2D3G A;  4FHK A;  3VHT C;  2N7E A;  1V5T A;  4GSW A;  4HAW B;  2MBQ A;  2JP2 A;  4BKT A;  1UPQ A;  4GB9 A;  4DX9 0;  3SBT A;  2L00 B;  2I5C A;  1ZSQ A;  1OQY A;  4JKF A;  3GYP A;  2WWZ A;  3DVN V;  2LGY A;  3M95 A;  1E5W A;  2UZS A;  3PVW A;  2DX5 B;  2GJY A;  2DAJ A;  3RT3 B;  4TUU A;  1RRB A;  4A3O A;  4IW0 A;  4CHM A;  1D3Z A;  5CLQ B;  3VTU A;  3U8Z A;  4NSW A;  1C1Y B;  1ZC3 B;  1VBG A;  1WJU A;  4F7U P;  2LZ6 A;  3BY4 B;  3VQI A;  1T0Y A;  4DDI D;  2YT0 A;  3VXW A;  4EKU A;  5LXH A;  1WZ3 A;  3ZIM A;  2LBB A;  1OTR B;  4DBG A;  3UQB A;  4JK7 A;  2LVQ A;  2YS3 A;  2LUL A;  4KAX B;  5D6J B;  2DFK A;  3DVG X;  4MGI E;  2P0F A;  5C23 A;  2MWN B;  4M8M A;  2MBO A;  1U27 A;  5CX3 A;  5JHA A;  3A4S C;  1SGH A;  3M63 B;  4AJY B;  3PLV A;  2BYE A;  3IBE A;  3FSS A;  2MWS B;  4A6F A;  1FGY A;  1WG7 A;  3JW0 X;  4C0A A;  4LDT D;  2LGX A;  2XEW A;  3IFW B;  2ZZP B;  1HB6 A;  3LJ3 A;  3DXE A;  1U4A A;  4JKG B;  1X05 A;  5GOW B;  1WJM A;  4WJ7 A;  2VRW B;  1XKE A;  1NTY A;  2KFJ A;  2KZR A;  2DYN A;  1XT9 B;  4W9J A;  1DDV A;  5DPT A;  4DWF A;  1PMS A;  3QA8 A;  4E74 A;  2LYD A;  2XK5 B;  3VUX A;  4MSM B;  3R3M A;  1YX5 B;  3N3K B;  3JSV B;  4MM3 A;  2ZVN A;  2DYQ A;  1E8X A;  2JVC A;  3WAO A;  2MBE A;  2JZZ A;  2DHK A;  3S2A A;  3DBR I;  4CYE A;  4NAW B;  1LFD A;  2KLC A;  2B3A A;  1WI1 A;  4MDK E;  1I42 A;  4IM2 A;  4OVU A;  4EFO A;  5FI0 A;  4JKB A;  2FJL A;  2N0Y A;  5DI9 B;  2LOX A;  3A33 B;  4PYU A;  3PRZ A;  2OOB B;  1E8Z A;  1P9D U;  1U5E A;  1GNU A;  1VD2 A;  3ZKJ C;  5JH5 C;  2DZJ A;  4NQK E;  5JP4 A;  4DDG D;  2WX1 A;  4ICU A;  1IRS A;  1WIA A;  4XX5 A;  2D9W A;  3NY5 A;  1NBF C;  3L54 A;  2J7Q B;  2KVR A;  4H8S A;  2XQN M;  4HHV A;  3SBG A;  4BOZ B;  2AL6 A;  1V9J A;  1OEY J;  4KSL C;  1B55 A;  3AUL A;  4GOC A;  1V89 A;  3V62 A;  3N32 A;  1WXV A;  4MEM A;  2KWU B;  2OTX A;  2Z0O A;  4F8C B;  2N9E B;  1TXD A;  3SNH A;  3M3J A;  4JKC A;  3KUZ A;  4OVV A;  2GMI C;  4KZ0 A;  2L05 A;  4GXB A;  3T06 A;  3PTF C;  5L81 A;  3O65 B;  3VIA A;  4NJ6 A;  3R7Q A;  3N7C A;  4KSK C;  3RCP A;  4ANX A;  4TQ0 A;  2FID A;  4GMV A;  1P1A A;  5IJM A;  3SO6 A;  2RQ1 A;  4PQ0 A;  1UBI A;  4AUQ C;  1E7U A;  4WWO A;  2GOW A;  3QHT A;  1WGH A;  1MIZ B;  4K7U A;  4B6W A;  2Q13 A;  4ASW C;  3VAW A;  1ZGU B;  3A9J A;  2VSZ A;  2COF A;  5DHA B;  4RMA A;  4K2O A;  2PEA A;  3AI5 A;  2VKI A;  4WVF B;  2G4S A;  3WAL A;  3VDZ A;  1YQB A;  3A9K A;  3P2B A;  4IWQ A;  1WXM A;  2ZJD A;  1V88 A;  4GMX B;  2JRH A;  2KAN A;  2MQJ A;  3E9P A;  2FDQ A;  2DTC A;  3WAP A;  2OQB A;  3R66 C;  2V76 A;  4A20 A;  1LB1 A;  3H7S A;  3HM6 X;  2GBK A;  1G6J A;  2JUO A;  5AZG A;  2FAZ A;  2ELB A;  5J3Y A;  3VOQ A;  1LM8 B;  3SDL C;  2CHW A;  4GPT B;  2LGD A;  1U29 A;  2MSE D;  4IM0 A;  2IO0 B;  2N9P C;  3ZRF A;  3ML4 A;  2DX5 A;  1W1H A;  3PRM B;  3ZO5 B;  3IHP C;  4WAA A;  1L7Y A;  2RSU A;  2LUE A;  4YON A;  2WDT B;  4KIK B;  4B9K A;  1RRP B;  5KQ1 A;  3W1S A;  1DIK A;  3RUI B;  4A6H A;  4TYZ A;  2RD0 A;  3DBS A;  3PRP B;  3JYU A;  3KRX A;  1FXT B;  1BT0 A;  2DYO A;  3WYF B;  1OGW A;  4HXD A;  4I6L B;  1QC6 A;  2NBU A;  2LD9 A;  2GCJ A;  3PLU A;  3ONS A;  3M1I B;  1ACA A;  1M94 A;  2EKE C;  3EFU A;  1LXD A;  2MDX A;  1OY2 A;  2DKQ A;  3UF8 A;  4K1R B;  4BVU C;  4HJK A;  3ZTC A;  2FCM A;  1I2H A;  1NTV A;  3PZD A;  4XC2 A;  3L17 A;  4NPN A;  3W1S C;  3C0R B;  1YJ1 A;  4W9G A;  2HJ8 A;  2KC2 A;  1P3R A;  3QC8 B;  4MGY E;  4W9K A;  2D11 A;  1HBK A;  2MFQ A;  2J0J A;  2MA9 B;  1HE8 A;  4HAX B;  2C7H A;  2J0K A;  4BFR A;  1KZ7 A;  4WWP A;  1X86 A;  3QAQ A;  3VTV A;  1ZW7 A;  4EZJ A;  3ALB A;  3DVG Y;  1U5F A;  2W2X D;  5G2N A;  1P6S A;  3ZVV A;  4L6E A;  1UZX B;  2JT4 B;  1WMH A;  3BIN A;  2E2X A;  4WJN A;  4HK2 A;  2L0T A;  4JIO U;  1FB8 A;  4X57 B;  2YF0 A;  1GGO A;  2COC A;  4ZYN A;  4HAU B;  1P3Q U;  1V5P A;  2KDE B;  1UPR A;  3HW2 B;  2R09 A;  5CHV C;  1KJT A;  3A9K B;  3KH0 A;  1MAI A;  2IY0 B;  4F7Z A;  4A5K A;  1X1M A;  1MK7 B;  4G3X B;  2EMT A;  2JZ3 B;  1Q0W B;  4ICV A;  2O2V B;  3H7P A;  5J3Q A;  2BPS A;  2KOX A;  2O6V D;  1TQZ A;  1FGZ A;  4K7W A;  3X0W A;  1SIF A;  2CAY A;  1BTK A;  1WZ0 A;  2L8J A;  1IP9 A;  2QHO A;  4FJY A;  3RZF A;  4N9F 4;  1Y8R C;  4LJO B;  3AU4 A;  4DXA B;  2A5U A;  1MK9 B;  1V2Y A;  5JHG A;  4BBN C;  3IG3 A;  3O96 A;  2RPQ A;  1DRO A;  1UBQ A;  4Z2N A;  3K9O B;  2P8V A;  5D3V A;  2YS1 A;  2LRW A;  2YT1 A;  2RGN B;  2JXX A;  2AYO B;  1U5G A;  5J3T A;  2PPH A;  2FCS A;  2Z0E B;  2K2J A;  2HD5 B;  1FAO A;  4HAZ B;  3QBV B;  3ZW3 A;  1JRU A;  3OLM D;  1P5T A;  3KYC D;  2NR2 A;  1H8C A;  1WGU A;  2K2U A;  2Y8F A;  1N3H A;  3PHW B;  2KDI A;  3VUY A;  3PPA A;  4MT7 A;  3KYD D;  2LVO A;  3MHS D;  4BBN F;  1TTN A;  4HDO A;  2M14 A;  5DIF B;  4KHO A;  3D8E A;  2DZI A;  1H10 A;  3TL5 A;  1DDM A;  1J0W A;  4JKA A;  1XD4 A;  3TVV A;  2W2X C;  2IY1 B;  4G0N B;  4DHJ B;  1SHC A;  5KHQ A;  3IVF A;  2CHX A;  3UZT A;  1WH3 A;  3RYT A;  2XBB C;  1EAZ A;  2KTR A;  4HPM B;  3QWZ B;  3VVW B;  2Y7B A;  3UIO B;  3A1Q A;  3U7D A;  4DX8 A;  2KJH B;  2CS4 A;  2MLB A;  4HDQ A;  4MJS A;  4MK0 A;  1EF5 A;  2PE9 A;  3RD2 A;  3QCA A;  5AZH A;  3A9J B;  2BKF A;  2L2I A;  5C5B A;  2C7N B;  2D9Y A;  1KBL A;  1V5M A;  2LRU A;  4KHA A;  4HCN B;  2DHZ A;  4ZRK A;  2CB8 A;  2BYF A;  2DHI A;  2WH5 A;  4GN1 A;  2COD A;  3E9O A;  3CSF A;  4ANW A;  4B95 A;  2KX3 A;  3L08 A;  2DZM A;  4NY0 A;  3ENB A;  3TCA A;  5CHW A;  4HVB A;  4FA6 A;  2UZR A;  3ZUN A;  4MH0 E;  5J2R A;  1RLF A;  1Z87 A;  5HE2 A;  3CIK A;  2L0F A;  3PT2 B;  1OEY A;  4WSF A;  3TO1 A;  3G9W A;  4IG7 B;  4JL9 A;  2M38 A;  4HB3 B;  2WX0 A;  4GDK A;  1L2N A;  5D27 A;  2L3Z A;  3ZDT A;  1WX8 A;  2Z0Q A;  2ZEQ A;  4I6P A;  3H7P B;  2YS5 A;  1GJZ A;  3FP5 A;  2RSG A;  2KC1 A;  3ECI A;  1KLV A;  2CKH B;  2DA0 A;  2ELA A;  3H1U A;  2KJR A;  1KZG A;  2DKP A;  4HPL B;  3CMM B;  5KHO A;  2GCL A;  2CQU A;  2HE7 A;  3EEC A;  4DHZ B;  1JDE A;  3A8Q A;  5D3Y A;  2LXC A;  2QKL A;  2N7D A;  4II3 B;  1A5R A;  5DPW A;  4KHB B;  1WI0 A;  2CRF A;  1XOD A;  5LOP B;  5HE1 A;  4PS3 A;  1PFJ A;  2K6Q A;  2KKC A;  1F9J A;  3AU5 A;  4PS7 A;  2LJ5 A;  2ZVO A;  2IO3 B;  3FLV A;  2YRY A;  2V1Y A;  3ODW A;  1UD7 A;  3V6E B;  5L95 C;  1K5G B;  3RZW C;  4JQW C;  2LKO A;  3ODX A;  3DQV A;  4KDI C;  1SE9 A;  4WJQ A;  3V61 A;  2P0D A;  4FBJ B;  1WR6 E;  1LW3 A;  2MBB B;  1FHX A;  2DYM A;  4Z2M B;  3NOB A;  2FCN A;  4YL8 A;  1V86 A;  2KMA A;  2P0H A;  2X18 A;  2LXA A;  3D32 A;  1V61 A;  5HE0 A;  2ADZ A;  2GBR A;  4W9F A;  4LDT B;  2BF8 B;  4M8N A;  1WMH B;  5EFX A;  4DK5 A;  3KUD B;  4G50 A;  5CHF A;  2REX A;  3R7R A;  3PHX B;  1DYN A;  1FHO A;  4BBK A;  1NVL A;  1E7V A;  4WJO A;  2W2W A;  4A6K A;  3A4R A;  3SUZ A;  5E6N A;  1DDW A;  2D9X A;  1WGD A;  2KWC A;  4ILG B;  4W9E A;  2BKR B;  3OJ4 B;  2ZCB A;  2C7M B;  2R2Q A;  2CY5 A;  4W9L A;  4Y94 A;  3QIJ A;  1UNP A;  3OAW A;  3TBL D;  4ZDV A;  2CHZ A;  2GBJ A;  1WGG A;  5L83 A;  2KO3 A;  4W9D A;  2K25 A;  1WM2 A;  2O2V A;  3K9P B;  1KOT A;  4CHJ A;  1UNR A;  1EO6 A;  3PSC A;  1Q5W B;  1WGR A;  1MG8 A;  2XK5 A;  4ZRI A;  2DAF A;  2NPT A;  4JK8 A;  3U30 A;  2RLO A;  3ZNZ B;  1KM7 A;  3TMP B;  1UH6 A;  1P0R A;  2V3S A;  2MP2 A;  4FLH A;  2BYV E;  2JF5 A;  3CF6 E;  5TR5 A;  4GDK B;  3ZDM C;  4NAW A;  5HKH A;  1QZE A;  4M0W B;  4KDL B;  2C5L C;  2KMC A;  2HTH B;  5FR6 A;  4HAV B;  4GZU A;  2L76 A;  4E71 A;  4TV3 A;  1WE6 A;  1LQB A;  2KHW B;  2KWV B;  4JKD A;  1YD8 U;  3ZVR A;  2V4L A;  1XR0 B;  3OAN A;  3APF A;  3B1L X;  4XZ4 A;  2DEN B;  2JPH A;  1PLS A;  2D07 B;  2AWT A;  4IC7 B;  1J8C A;  2DIK A;  2Y5B B;  2K8C A;  2KLG A;  3ML8 A;  3QQ8 B;  1UGM A;  5LXI B;  4NNJ B;  1K8R B;  1Z5S B;  4E3C A;  2BGF A;  1QQG A;  1S1Q B;  2WYQ A;  3PEG A;  1WE7 A;  1XX0 A;  3KZ1 A;  4HAY B;  1I35 A;  3UIP B;  4FAD A;  2IZV B;  1H4R A;  1NTI A;  4A6F B;  3ULC A;  4G11 A;  4RM8 A;  4MY6 A;  2KFK B;  4EOY A;  3L0W B;  5AEK B;  2LI5 A;  2K00 A;  3ML9 A;  3WAM A;  5E6O A;  2DYB A;  5JZE B;  5JHB A;  4ANU A;  3ODO A;  1WYW B;  4PS8 A;  3TFM A;  1V5O A;  4II2 B;  3NSU A;  3SD5 A;  3MTN B;  1ISN A;  5DH9 B;  1TZ1 A;  5E6P A;  2Y8G A;  4DBB A;  1K5D B;  3DDC B;  3ZNI D;  1WX7 A;  2N9X A;  5JHH A;  5LON B;  4FJZ A;  5C6R A;  4HWI B;  1MKE A;  1EGX A;  5LLI A;  2RUK B;  4MGZ E;  2JRI B;  3CST A;  4I6N B;  4JKH A;  3T9L A;  2L7R A;  3HHM A;  3M62 B;  2FUH B;  4GGQ A;  5J17 A;  1Y5O A;  2KN5 A;  3UGB B;  3DPD A;  2ROV A;  2DHJ A;  2NVU I;  4W9I A;  2ASQ A;  1RAX A;  3MDB C;  1EF1 A;  4IAP A;  4K2P A;  3QWM A;  4W9C A;  4ILH A;  2D10 A;  2DZK A;  4NJ7 A;  1ZKH A;  2LOZ A;  3V5W A;  3NZU A;  3EHV A;  2MP2 B;  2NMB A;  4FHJ A;  3EC8 A;  1UNQ A;  2GBN A;  2Z0D B;  3PV1 A;  5FI1 A;  1RFA A;  3E66 A;  1EUV B;  2J59 M;  3VH4 B;  1E90 A;  2R82 A;  1ZM0 A;  2BWE S;  1BAK A;  2OJR A;  4EZK A;  1V49 A;  2M0X A;  2CU1 A;  4HB2 B;  3PVL A;  1X11 A;  4JKE A;  2C60 A;  3DOW A;  2ZPY A;  4GU2 A;  5D3X A;  2H7D A;  3DXD A;  1KI1 B;  3BJI A;  4BKS D;  4CO7 A;  2M17 A;  2D9V A;  3DVN U;  4WWN A;  2K6D B;  1R4M I;  3NZS A;  2D4Q A;  3APC A;  2KQS A;  3X23 A;  1WXA A;  2EJ8 A;  4LJP B;  3SHQ A;  3DBL I;  4GDL B;  2LVP A;  4MEL A;  5KQ4 A;  5IA7 A;  3DBH I;  5CTR C;  3UQA A;  3JSV A;  2O6V B;  5DHF B;  4EEW A;  1MIX A;  1WFY A;  3AXC A;  2KFK A;  1U5D A;  1KC7 A;  5BO4 B;  1Q67 A;  1UEF A;  4JGH B;  2KDB A;  1FHW A;  2ZNV C;  3A98 B;  3QAR A;  4HB0 B;  5G55 A;  4IOY X;  2KX0 A;  1PQS A;  1WJ4 A;  2RR9 A;  1E8W A;  3LJU X;  2H7E A;  1NI2 A;  2RNR B;  4IWO A;  2MX2 A;  4K7S A;  4KV2 A;  2ZNV B;  1C3T A;  2DN6 A;  4AOF A;  3KVF B;  1WJ6 A;  2MCN B;  1I7A A;  2NPT B;  2KTR B;  2G4D B;  2I5F A;  4MGK E;  3A1Q B;  2FNJ B;  2IO2 B;  2UWQ A;  3HQC A;  1OMW A;  4W9H A;  1GC7 A;  4MJS B;  3PGE A;  1TJ6 A;  1IYF A;  4EMO A;  3P6A A;  3GZN I;  5C5B B;  1M7E A;  4NQL B;  2HTH A;  2NBV B;  5D94 A;  4AJW A;  1MPH A;  2I1K A;  2GS0 A;  3VUW A;  3TJP A;  3ENE A;  1ZC4 B;  2EMS A;  4HLE A;  3L10 B;  3RUL A;  1AQC A;  4KVG B;  1R4N I;  2A4Z A;  4HAT B;  3I3T B;  4J6I A;  1VBH A;  3FEH A;  5D7G A;  1WJ1 A;  3WA0 A;  2BCJ A;  3VFK A;  5CLL B;  3LDZ E;  1AAR A;  4XWX A;  2MBH A;  4ANV A;  2PJH A;  2NBW B;  4IM3 A;  3L16 A;  2DLW A;  2ABD A;  1ST7 A;  1WM3 A;  1AWE A;  4PNK A;  2Z0P A;  1WF9 A;  3KRW A;  3PRE A;  1GUA B;  1HB8 A;  2AEH A;  1Y19 B;  3W1Y A;  4BOS C;  2HRJ A;  2LWP A;  3L13 A;  2ZPN A;  4JK9 A;  3D8F A;  4ZRJ A;  1TGZ B;  2KXJ A;  3ZRC A;  5C16 A;  3GOE A;  4MSQ B;  1ZVR A;  2M8S A;  3TW1 A;  3MPX A;  3PG7 A;  3JVZ X;  3SYX A;  4GIV A;  3KSY A;  2LG1 A;  4ILJ A;  3SV1 A;  1XD3 B;  2G3Q B;  4DHJ D;  3H9D A;  2N1W A;  3PVU A;  1XQQ A;  1GG3 A;  2GBM A;  4GDL A;  3KUC B;  1X1F A;  2O6V A;  2N23 A;  5DCN A;  4D0N B;  1Q1O A;  5J18 A;  3WIM A;  1UEL A;  1YIW A;  1V5U A;  4TQ1 A;  2KGX B;  1J19 A;  2X0S A;  3QX1 A;  4BKS A;  2Z59 B;  4FN2 A;  2YLM A;  1WVH A;  2RVB B;  4AWJ A;  3D8D A;  4AP4 C;  3RCZ A;  3DXC A;  3PS6 A;  2ROZ B;  4F7H A;  2M1M A;  2KUP A;  3NHE B;  4WJP A;  1RJ2 A;  2AL3 A;  2R2O A;  4A3P A;  4URK A;  4K81 A;  3Q3J A;  4KIK A;  2D2Q A;  1J0G A;  2EC1 A;  2NZ8 B;  3A8P A;  1S3S G;  2KTF A;  2PE6 B;  2L1C A;  3CXB B;  3QJZ A;  4CHK A;  2N4F A;  4DHZ E;  1WJN A;  3MJW A;  2DX1 A;  2G45 B;  1WGQ A;  2K8H A;  3B08 A;  2CY4 A;  1V6E A;  5JLJ B;  2ZCC A;  2IBI B;  2N1V A;  2D9Z A;  2YSZ A;  2RGF A;  3TIX A;  2COA A;  2FIF A;  2IFS A;  2FCQ A;  1X1G A;  2MW5 A;  1TBE A;  2K39 A;  3UIN B;  3KW5 B;  1WR1 A;  2YVC A;  2M4N A;  5DPS A;  2MKR A;  1W1D A;  1E8Y A;  2NCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...