2EMTA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
313
Chain Sequence
b'MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of PSGL-1 binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 89
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emtA01
5LXIB 1WRDB 2N0YA 3IBEA 5FI1A 4IC7B 2KWCA 2FDQA 1P3RA 4DHZB 4DX90 1Q5WB 2LBBA 1UD7A 5G2NA 4AJWA 3FP5A 3U30A 2KC2A 4ASWC 4HHVA 2BF8B 1V5MA 2KMCA 2UVMA 2M17A 4BBKA 3DVGX 3GYOA 4K7SA 2ZEQA 3ODOA 1V5TA 1BT0A 2KDFB 1U29A 4DHJB 4JLCA 5DHFB 1RFAA 1R4NI 3PG7A 3I3TB 1RAXA 3QC8B 4DHJD 4F1SA 2DX5A 3OAWA 2DTCA 3O96A 1MAIA 1Z5SB 2W9NA 1TGZB 1MK7B 2ELBA 4K81A 2JZZA 4MH0E 2O2VA 5JHGA 3RUIB 4FADA 5LXHA 4ZRIA 3QK0A 2CHZA 2YS3A 4II3B 4CHMA 3NSUA 2AL3A 4MSMB 4GZUA 1U5FA 3VTWA 2DKQA 2IO2B 3P2BA 3CF6E 2Q13A 2BCJA 1UBQA 3ZDTA 2LGYA 4BOZB 2MQJA 2LZ6A 2C7NB 4KAXB 2M4NA 2ZVNA 4LJOB 3DVNU 1Q1OA 1WJNA 4WJOA 5TR5A 1SIFA 2CS4A 5AZFA 3PRMB 4B9KA 4TYZA 2COCA 3ZLZA 2D9ZA 4MGKE 3HM6X 3Q3JA 5KQ1A 3ZRFA 3H1UA 3VUWA 4A6FA 1UELA 3A1QA 5C5BA 1SHCA 4GDKB 4DBGA 3PP2A 4KHBB 4PS3A 3ZIMA 3BY4B 4GXBA 2DZMA 3OLMD 3ZNID 2BKRB 1WI1A 2D9VA 1MPHA 1R4MI 2D2QA 4A6HA 2KKCA 3JSVA 2G3QB 4DDID 1QQGA 3KVFB 3VQIA 4IM0A 2P0FA 3SU8X 2M0XA 4HAVB 4DK5A 2WWZA 2DENB 1WE7A 2LGDA 3TL5A 2CR5A 5AEKB 1FHXA 2N23A 2DX5B 2MBHA 4MGIE 3PS6A 5DPRA 3MJWA 3WIMA 2M38A 3AXCA 2O2VB 2DYOA 2MW5A 2V3SA 2HJ8A 2WYQA 2OOBB 2C7MB 3UIPB 4GMXB 3DBRI 1V6EA 2DA0A 3FEHA 1S1QB 5DHAB 3V60A 3UQBA 1WM3A 2J7QB 4KSLC 2YS5A 2QHOA 2NPTA 3PGEA 3DVNV 2KFKB 4MK0A 4W9EA 2D3GA 4WQOB 4KVGB 4NPNA 1FXTB 2AWTA 3TFMA 4H8SA 2FAZA 4MY6A 1WYWB 1GC7A 4HLEA 5L83A 3AULA 1Q0WB 2KD0A 3ZO5B 1KZGA 2NZ8B 3TIXA 3K9PB 4HDOA 2WX0A 1TTNA 2Y8FA 4CO7A 4FBJB 3ZVVA 1VD2A 1V89A 2HTHA 4ICUA 3AU5A 3A8QA 4Z2NA 2EMTA 3AI5A 3K9OB 3A1QB 3R66C 2RUKB 3IFWB 3VH4B 4TKNA 1XCGA 1ZW7A 2KDBA 5E6PA 4W9HA 2LASA 2K2JA 2K25A 2LXCA 1WJ4A 3RT3B 1Z2MA 4IM3A 4HDQA 3DBSA 4HWIB 3SDLC 5IA7A 2OTXA 5HE0A 2G4DB 2ZPYA 2GS0A 4M0WB 1WI0A 3PRPB 4I6LB 4HK2A 4CHJA 1FHOA 4HCPB 3R7RA 1L7YA 3H7PA 4E71A 5AZGA 1X1FA 3KUDB 4BKSA 2MSED 2FJ9A 2UZSA 2VRRB 3V5WA 1EUVB 3PSCA 1WGDA 1WXMA 4MJSB 2FCMA 1TZ1A 2GMIC 5DIFB 1P6SA 3UGBB 4EJNA 2MP2A 2PEAA 3UINB 2YRYA 5DPSA 2X18A 4AWJA 2KQSA 2LRWA 4IOYX 1ZGUB 5JZEB 2BYVE 2LOXA 1UZXB 4HVBA 3QBVB 3HHMA 5G55A 2R0DA 3D8DA 4PS8A 3H9DA 5JHAA 3IVFA 3VFKA 5CHWA 1X1GA 2FIFA 3JW0X 2HTHB 1ZC3B 2ZZPB 4B6HA 4MGYE 4YL8A 4EKUA 4PS7A 5J17A 4NY0A 3KUZA 3VAWA 3G9WA 3DXDA 2RVBB 4WVFB 4FLHA 3WANA 2NVUI 3R3MA 3RCPA 1EVHA 2ABDA 4BOSC 1I42A 2RD0A 5LONB 2MBQA 2ASQA 1YQBA 2J0MA 1Z87A 3PLVA 2JXXA 1HBKA 5CLQB 2DAJA 2WH5A 4M8MA 1WJMA 3L16A 3B1LX 4OVVA 4DDGD 4D0NB 1WE6A 2CODA 3H7PB 3ULBA 1BTNA 3A4RA 4XZ4A 2IYBA 1UGMA 4HB0B 2M14A 2D9XA 3L10B 4A3PA 4KIKA 1HB8A 2IFSA 3KZ1A 2FUHB 1XD3B 3X0WA 3EECA 1Y5OA 2CHXA 4IG7B 5D6JB 1GG3A 2CHWA 1E7UA 2N9EB 3PREA 2UWQA 2IY0B 3W1SC 4WSFA 3AU4A 2Z0OA 3CXBB 1TXDA 1QC6A 3CMMB 4NAWA 2NMBA 2IO0B 2L00B 3TVVA 2K8HA 1TBEA 1P1AA 3SV1A 3KSYA 2DZKA 4NNJB 1DDVA 5J3TA 3M95A 2VKIA 4RM8A 4BVUC 5HE2A 3ONSA 4DHZE 2XQNM 3GZNI 4FJVB 1V5UA 4L6EA 2N1VA 5BO4B 1WR1A 4I6NB 2BWFA 1G6JA 4KDIC 4K7WA 4HAZB 4IW0A 1UNPA 4K1RB 4GU2A 3HW2B 1Y8RC 3UZTA 2XEWA 1E8XA 2MBBB 3ML9A 1KM7A 5GOWB 2KWVB 2HE7A 3VHTC 4W9LA 5CX3A 2R2OA 2KTRB 3A8PA 3QX1A 1YX5B 3L13A 3RZWC 1UBIA 2GCJA 4EUTA 2GBJA 2K8CA 1LQBA 1UPQA 1LB1A 3EPYA 2BWES 3CIKA 4DX8A 4GIVA 5IJMA 1FHWA 4KIKB 2G35A 5KCVA 4AUQC 2MBEA 1WF9A 4PQ0A 1WGRA 4W9JA 2CKHB 4W9KA 1PMSA 3KH0A 3N30A 2KUPA 3NZSA 5DPTA 2C7HA 1C1YB 2J0JA 2WX1A 1WR6E 3MHSD 2FCNA 2JF5A 4MDKE 2LVPA 1WJ1A 1ZVRA 2FJLA 1LM8B 1AQCA 4HAUB 2R09A 4W9GA 3WAPA 1P98A 3TBLD 2O6VA 2JRIB 2P0DA 1J0WA 2N1WA 2KLCA 5C23A 2KWUB 1U5DA 1W1HA 3IG3A 2Z59B 2PPHA 1MIZB 4HB2B 5HKHA 1M7EA 1X05A 2KLGA 3V62A 2N9PC 1V5OA 3OJ4B 4MT7A 4B6WA 2KN5A 5L95C 2MWNB 1WXVA 4LDTB 2AL6A 1FB8A 3PVLA 1V81A 2DYMA 2BPSA 4GN1A 4K2OA 4LDTD 2KJ6A 3KRXA 1NTYA 3JYUA 2L8JA 3VIAA 1L2NA 1MG8A 1UPRA 4N9F4 1Q67A 1U5GA 1AWEA 2CU1A 3A9KA 3NS8A 5D3YA 4W9DA 2KK8A 2NBUA 1P3QU 1WGQA 4BBNC 2CY5A 1GNUA 3A4SC 3L0WB 3P7ZA 1WXAA 4KSKC 4IWOA 4HJKA 1VCBA 2DYQA 3APCA 5KQ4A 4K17A 4ANWA 3UIOB 2G45B 1UNQA 3TMPB 2CRFA 4BKGA 4A20A 3QA8A 1NVLA 1ZC4B 4GOCA 1WZ3A 1WFYA 1WJ6A 1H8CA 3TJPA 2LG1A 2GBNA 2RLOA 4HATB 4A5KA 3UQAA 2N7EA 3MTNB 1WX7A 2VSZA 5CHVC 3ZKJC 4XX5A 2QKMA 3M3JA 2BGFA 1NBFC 4GSWA 3ZW3A 5D2MB 1MIXA 3RYTA 1LW3A 2MKRA 2L7RA 2KTFA 3L08A 3ZVRA 2KX0A 3VVWB 1EF5A 5AZHA 3PEGA 5DI9B 1KZ7A 4IWPA 4JIOU 5DPWA 2IO3B 3ALBA 2K39A 4ANXA 3ZNZB 2I5CA 3R7QA 4A6FB 5C5BB 1HE8A 2GOWA 2A5UA 1MK9B 2CB8A 5J2RA 1D3ZA 3BINA 1S3SG 2DHKA 3A9KB 1P5TA 3SHQA 3PHXB 2L0TA 5KHQA 2KHWB 4II2B 3VDZA 1ZKHA 4WAAA 1J0GA 3D8FA 3JSVB 2NBVB 1QZEA 1X11A 4HPLB 2RNRB 3VTUA 1ISNA 1P9DU 4NJ7A 1TQZA 4AOFA 1H4RA 1XODA 3ULCA 2DYBA 2L0FA 4HB3B 4MEMA 2BYEA 3DOWA 5E6OA 1I35A 2RPQA 2RQ1A 2EMSA 2ZCCA 3PZDA 2DAFA 3OJ3A 1E8YA 2MRPA 1X1MA 3AJ4A 4GB9A 4GPTB 4NQLB 3H7SA 5FI0A 4F7UP 2NPTB 2DHIA 1Y19B 2N4FA 4MELA 1KOTA 2YF0A 2KQ7A 4Z2MB 1YX6B 3EHVA 1ST7A 1K5GB 1E5WA 4LJPB 3PVWA 4EMOA 1PFJA 5EDSA 2W2XD 4F8CB 3ODWA 3V6EB 3QIJA 3SUZA 3RULA 2Y5BB 1UNRA 2W2WA 2BKFA 4F7GA 1IRSA 3ZDMC 4F7ZA 2COFA 4OVUA 4ANUA 3PVUA 1BTKA 4MGZE 2I1KA 1F9JA 4HB4B 1DBHA 3A33B 3OANA 2JRHA 1CMXB 2DYNA 1WX8A 2H7EA 2M8SA 4NQKE 4HCNB 2MFQA 2YLMA 1FAOA 1N3HA 1UEFA 2NS5A 3ZUNA 3KRWA 5D3VA 4ANVA 4JGHB 1K5DB 3PV1A 1EO6A 3ZNHB 4KHOA 3QARA 2OJRA 1XR0B 1XKEA 4GDLA 2MBOA 3FLVA 2A4ZA 2LYDA 3APDA 2D4QA 2REXA 1UH6A 2DFKA 2COPA 4BKSD 2HRJA 2AYOB 4EZLA 3IHPC 2ADZA 2BYFA 4NSWA 1RJ2A 1DROA 1RLFA 4M8NA 2MP2B 1T0YA 2ZJDA 4WJNA 3MPXA 2KX3A 3FSSA 1KI1B 1DDWA 5J3YA 1WGYA 2KOXA 1I7AA 3V6CB 3T9LA 2YT1A 3VUXA 3M63B 4PYUA 2HD5B 2PZ1A 1SE9A 1XT9B 5IAAC 1P0RA 4C0AA 2J0KA 3ML8A 2RR9A 2MDXA 1WVHA 2H7DA 2LGXA 4DBBA 3L54A 2KMAA 1IP9A 2LVQA 2FNJB 2YS1A 2C5LC 2FCSA 2ZNVB 1WGUA 3EC8A 4BFRA 3VTVA 4E3CA 3DCGA 3C0RB 2LXAA 4K2PA 1OQNA 3W1SA 5CTRC 3QQ8B 3A98B 3WYFB 2LI5A 2CY4A 1OEYA 2KVRA 2ZPNA 3BJIA 4J6IA 1GC6A 4RMAA 3B0AA 4JQWC 2V76A 1DYNA 3GOEA 4EEWA 2KDEB 2COAA 3DQVA 2DZIA 1XQQA 1X86A 4MM3A 4TQ1A 2GJYA 2FCQA 4URKA 5J18A 4GDLB 1OY2A 3DBHI 1KLVA 2YSZA 2OQBA 4GDKA 2D10A 1WH3A 2CQUA 2ELAA 2K6QA 2MLBA 3SO6A 1V49A 3PHWB 2Z0EB 1YD8U 3ENEA 1XD4A 5JLJB 1WXSA 2DHZA 2UYZB 2EC1A 4IWQA 2CAYA 3DXEA 1U4AA 4MSQB 1SGHA 3T06A 4ZDVA 2JY6A 2NCNA 5KHOA 4NAWB 3TCAA 3RZFA 4LCDE 2J59M 2I1JA 3V61A 1WMHA 4TQ0A 2IY1B 5DCNA 2MWSB 2JWZA 3CSFA 2M1MA 5C6RA 4PYZA 2XBBC 5E6NA 2KC1A 3UF8A 1OEYJ 2DKPA 5JHHA 4WWPA 2EKEC 2LVOA 2KFKA 2L3ZA 4X57B 4EFOA 1OQYA 2JT4B 3WAOA 2KFJA 3O65B 3U8ZA 3PTFC 2PE6B 1WIAA 2I5FA 3X23A 1B55A 5C16A 3M62B 1OTRB 1K8RB 1FGYA 4G3XB 5D3WA 2LJ5A 3B08A 1WM2A 4IFSA 3QCAA 5DH9B 2GCLA 4Y94A 1WGGA 4KDLB 2Y7BA 2K2UA 2KXJA 1A5RA 1PLSA 4FHKA 3EFUA 2IZVB 2KNBA 2L76A 2KJRA 3FM8C 1JRUA 2LRUA 3MDBC 2D11A 3QAQA 2D07B 4AP4C 2RGFA 2N9XA 1OGWA 3CSTA 3DXCA 5EFXA 2LUEA 3KUCB 1E8ZA 3U7DA 2KJHB 4I6PA 1W1DA 4IM2A 3ZNGC 3KY9A 3PLUA 4ZYNA 3TO1A 3ODXA 4W9IA 4F7HA 2W2XC 3NOBA 2DLWA 4EOYA 3QHTA 1WMHB 1NI2A 2DX1A 4HAYB 2O6VB 5JP4A 2L2IA 1DDMA 1YJ1A 2O6VD 4FJYA 5C1ZA 4WWOA 5D94A 3WAMA 2LD9A 4MJSA 1V88A 3HQCA 2GBMA 2R2QA 1KJTA 2ZCBA 1OMWA 5HE3A 1WX9A 5FR6A 1W1GA 4RM9A 2DHJA 3F5RA 1V5PA 4EZKA 2Y8GA 4ZRJA 2LKOA 1TJ6A 2V1YA 1YIWA 5CLLB 1ACAA 5CHFA 3N7CA 4HXDA 3LJ3A 3S2AA 3ECIA 4EZJA 5GMVA 2DN6A 2KO3A 4KZCA 3WA0A 1M7RA 1J19A 1ZM0A 3HK0A 3APFA 1WG7A 2L05A 3LDZE 1GJZA 3VOQA 2GBRA 3TW1A 3DPDA 4IAPA 3VXWA 3VH3B 4W9CA 3NZUA 2Z0DB 1ZSQA 2L1CA 4KV2A 2MA9B 2IO1B 2XK5A 4WJQA 1RRPB 4JL9A 2D9WA 2DZJA 2KCJA 1PQSA 4W9FA 2JVCA 2KZRA 1H10A 3HIZA 1U2BA 2KANA 3QWMA 2LOZA 2NR2A 3ZTCA 2Z0QA 1V86A 4A3OA 4KZ0A 3N32A 1U5EA 3NHEB 2C60A 2AEHA 1C3TA 2NBWB 2G4SA 3RCZA 4DWFA 3VUYA 1FOEA 2ZNVC 1EGXA 2VRWB 2UZRA 3KYCD 3NY5A 1EF1A 1EAZA 2P0HA 1U27A 2K1FA 2YVCA 4A6KA 3A9JA 2JPHA 2B3AA 4KHAA 2JZ3B 4XWXA 3WALA 4YONA 3P6AA 1V2YA 4FHJA 1GUAB 3SNHA 2YT0A 2RSGA 1RRBA 2N7DA 4BKTA 3L17A 2K00A 3RD2A 2ZVOA 3KW5B 4E74A 3T8MA 3F0WA 2IBIB 4K7UA 1I2HA 3D8EA 5D7GA 1HB6A 5J3QA 3QWZB 4G11A 3DBLI 4G0NB 2D9YA 2KDIA 4B95A 1LXDA 1E7VA 2PJHA 5JHBA 4ICVA 3ZRCA 3PRZA 3ZTDA 2KTRA 4WJPA 1E8WA 4WJ7A 2Z0PA 2XK5B 1WJUA 1NTVA 5HE1A 5D27A 5L81A 4GGQA 4TV3A 3PSEB 3N3KB 4WWNA 2LULA 2WDTB 4GMVA 2JUOA 3DVGY 3DDCB 1XX0A 2LWPA 2MCNB 1IPGA 4FA6A 3SYXA 1IYFA 4XC2A 1BAKA 1WZ0A 2QKLA 4G50A 1MKEA 4IUMB 3GYPA 1NTIA 5JH5C 5LOPB 3SD5A 3QJZA 4AJYB 3JVZX 3A9JB 3HM3A 4BBNF 4PNKA 2ROVA 1WGHA 3D32A 4FN2A 2MX2A 1M94A 4CYEA 2FIDA 1WY8A 4ZRKA 1V80A 3Q3FA 2RSUA 4TUUA 4P7IA 2ROZB 1BWNA 1AARA 4CHKA 1FGZA 2JP2A 2GBKA 2EJ8A 1LFDA 3LJUX 1V9JA 1E90A 1NU2A 2K6DB 5C79A 3PPAA 3H6NA 4FJZA 2KGXB 3W1YA 3M1IB 2V4LA 3PT2B 5D3XA 4HPMB 2K8BA 2IYDB 4DXAB 2E2XA 3ML4A 4HAWB 4HAXB 1NDDA 2PE9A 3KYDD 2RGNB 2P8VA 4FULA 5LLIA 1V61A 2C9WB 4NJ6A 1J8CA
chains in the Genus database with same CATH superfamily
5LXIB 1WRDB 2N0YA 1CK1A 3IBEA 5FI1A 2M0AA 4IC7B 2KWCA 2FDQA 2L52A 3SFDB 1IBXA 1ZXIA 2W55A 2OJWA 1P3RA 4DHZB 4AS1A 4JK9A 4HROA 1NEKB 4C4VA 3NJTA 4DX90 1Q5WB 5IKCM 4L23A 2LBBA 4UDUC 1N63A 1UD7A 3MC8A 1KC7A 5G2NA 4AJWA 5IN7A 2ZKMX 4LNIA 3FP5A 3U30A 2KC2A 4DXGA 4ASWC 1ZPSA 4HHVA 2BF8B 3NS1A 2ZW1A 1V5MA 3IAS1 2KMCA 2UVMA 2M17A 4BBKA 3DVGX 3GYOA 4K7SA 2ZEQA 2PIAA 3ODOA 2RPVA 3B77A 1V5TA 1BT0A 2KDFB 1U29A 2SEBD 4DHJB 2LEKA 4JLCA 5DHFB 1RFAA 1R4NI 3Q14C 3PG7A 3I3TB 1RAXA 3QC8B 4DHJD 4F1SA 2DX5A 4WQMA 3OAWA 5EE0A 2DTCA 3O96A 1MAIA 1Z5SB 2W9NA 4RGOS 1TGZB 1MK7B 2ELBA 4K81A 2JZZA 2O2VA 4MH0E 5JHGA 3RUIB 4FADA 5LXHA 2WXJA 4ZRIA 4ILGB 3P42A 3EUB2 2GI9A 3QK0A 2MJEA 2CHZA 2YS3A 1XEEA 4II3B 4CHMA 3NSUA 3MFGA 1ROEA 1TS4A 1KLUD 4K3CA 2AL3A 4MSMB 4GZUA 3IAM1 1U5FA 3VTWA 2DKQA 2IO2B 5FK9C 1SJHD 2YEPF 3P2BA 3CF6E 4HSIA 4OVZA 5G5HA 2Q13A 2W82A 2BCJA 1UBQA 4GOUA 1TZOA 3ZDTA 2LGYA 4BOZB 2WQYB 1GOZA 2AQ2B 2MQJA 2LZ6A 2C7NB 2EKIA 4KAXB 2GB1A 2M4NA 2ZVNA 4LJOB 1ZUD2 3DVNU 2HTME 1MHXA 1Q1OA 1WJNA 2EELA 4WJOA 5TR5A 1SIFA 2CS4A 1CJEA 5AZFA 3PRMB 4B9KA 4TYZA 1KF6B 2COCA 3ZLZA 4JKDA 2D9ZA 4MGKE 1ZYIA 3HM6X 4MM3B 1L5PA 3Q3JA 1JWSD 3NVWA 5KQ1A 3O13A 3ZRFA 3H1UA 3VUWA 3DHHC 4A6FA 1UELA 3A1QA 5C5BA 1SHCA 4GDKB 4DBGA 3PP2A 4KHBB 4PS3A 3ZIMA 3BY4B 4GXBA 2DZMA 3OLMD 3ZNID 4C4VB 2BKRB 3C19A 1WI1A 3GB1A 2D9VA 1SE3A 1MPHA 2WXLA 1R4MI 2D2QA 4C00A 4A6HA 2KKCA 3AN1A 3RNCC 3A58A 3JSVA 2AQ3B 2D5GA 2G3QB 2NBVA 4DDID 1QQGA 2INDC 3KVFB 1L4DB 3NRZA 3VQIA 4IM0A 2P0FA 3SU8X 2I38A 2M0XA 4HAVB 4DK5A 2WWZA 2DENB 1WE7A 1NYQA 2LGDA 2CR5A 3TL5A 5AEKB 1FHXA 2N23A 2DX5B 1JRPA 5IP4D 1P7EA 3U7ZA 2MBHA 4MGIE 3PS6A 1N5WA 5DPRA 3MJWA 3CIRB 3H8HA 2KT7A 3WIMA 2M38A 3AXCA 2O2VB 2DYOA 2MW5A 2V3SA 2HJ8A 2WYQA 2OOBB 2C7MB 3N1XC 3UIPB 5AUIA 4GMXB 3DBRI 1V6EA 2DA0A 2BTEA 3FEHA 1S1QB 5DHAB 3BIID 3V60A 3UQBA 2OHFA 2LGSA 2INCC 1L0XB 1WM3A 2J7QB 1QOFA 4KSLC 1VLBA 1ACCA 3R2IA 2YS5A 1FCCC 1FM0D 2QHOA 2WDVB 2NPTA 3RNAC 3PGEA 4IKGA 1HZ5A 3DVNV 2KFKB 4MK0A 4W9EA 2D3GA 4M01A 4WQOB 4KVGB 1TJEA 4NPNA 1FXTB 1VZ6A 2AWTA 3TFMA 4H8SA 2FAZA 1SF0A 1NENB 4MY6A 2LMCA 4OZBA 1WYWB 1GC7A 4HLEA 2W3SA 5L83A 3LYYA 2OEDA 3NG0A 3AULA 1Q0WB 2KD0A 3ZO5B 3Q8EA 4XWWA 1KZGA 1D5ZC 2NZ8B 3TIXA 5I2SA 3K9PB 4HDOA 3URYA 3AE6B 2WX0A 1N62A 1VZ7A 1JWAD 1TTNA 2Y8FA 5BMHA 4CO7A 3SFEB 4FBJB 1MVKA 3ZVVA 1VD2A 1V89A 1FNUA 4RFBA 2HTHA 4ICUA 3AU5A 3A8QA 4Z2NA 2EMTA 3AI5A 3K9OB 1MPEA 2DLBA 3A1QB 3DBLB 4ZRPA 3R66C 2RUKB 3BWUD 3IFWB 2H88B 3VH4B 4TKNA 2WP9B 1XCGA 1ZW7A 2KDBA 5E6PA 4ITKA 2WS3B 4W9HA 1UWMA 3GE8C 3DWGC 2LASA 1B1ZA 1TYGB 2K2JA 2K25A 2LXCA 1WJ4A 3RT3B 1Z2MA 4IM3A 4HDQA 1WRIA 3FAHA 3ZYYX 3DBSA 4HWIB 3SDLC 5IA7A 3RNBC 2OTXA 1N61A 5HE0A 2N7JA 2G4DB 4WIPA 2ZPYA 2GS0A 4M0WB 1WI0A 3PRPB 1Y56A 1TS2A 4I6LB 4HK2A 4CHJA 1GGOA 3DCXA 1FHOA 4HCPB 2K3UA 3R7RA 1L7YA 3H7PA 4E71A 4JKBA 5AZGA 2DNFA 4YTPB 2VZKB 3KWVA 1X1FA 3KUDB 1SEBD 4BKSA 2MSED 2VZKD 2FJ9A 4ZHPA 2UZSA 2VRRB 4CQNA 3V5WA 1EUVB 3PSCA 1WGDA 1WXMA 2Q5WD 2QC8A 1GAQB 1SBBB 4MJSB 2FCMA 1TZ1A 2GMIC 4RGTA 5DIFB 1P6SA 2QSDA 3UGBB 4EJNA 3RI7C 2MP2A 1WXQA 2PEAA 3UINB 2WXOA 4FXCA 2HJ1A 2YRYA 4P1BC 2RRFA 5DPSA 2X18A 4AWJA 2KQSA 2LRWA 4IOYX 4KKJA 1ZGUB 5JZEB 2BYVE 2LOXA 1UZXB 3AEFB 4HVBA 3QBVB 3HHMA 5G55A 2R0DA 3D8DA 2PLPA 3IT4B 4PS8A 3H9DA 5JHAA 3IVFA 1EU4A 1V1OA 3VFKA 2K22A 5CHWA 1X1GA 1T5XD 2FIFA 2QCZA 4J3OD 3JW0X 2HTHB 1ZC3B 3FC4A 2ZZPB 2RDGA 1PDXA 4B6HA 2RMMA 3R8BA 4MGYE 4YL8A 4EKUA 1N60A 3NUHB 4PS7A 5J17A 4NY0A 3KUZA 5G5GA 5TSSA 3ZJTA 3UI3A 3VAWA 3G9WA 3DXDA 2JWUA 2CJNA 4GNKB 2RVBB 4WVFB 4FLHA 3WANA 2NVUI 3R3MA 3Q3MC 3RCPA 1JWUD 1EVHA 2KN4A 2ABDA 4BOSC 4XWTA 1I42A 2RD0A 5LONB 2MBQA 2ASQA 1YQBA 2K49A 5MPOA 4AQ7A 2J0MA 1Z87A 2KWDA 3AEGB 2JXXA 3PLVA 1DOXA 1HBKA 5CLQB 2DAJA 3RNFC 2WH5A 4M8MA 1V8CA 1WJMA 3L16A 1NI3A 3B1LX 4OVVA 4DDGD 4O1NA 1ZP0B 3RNEC 4D0NB 1WE6A 2CODA 1C79A 3H7PB 3NWDA 3ULBA 3EGRA 1BTNA 1UNSA 3A4RA 1VBHA 1TY0A 4XZ4A 1TT5B 2IYBA 1UGMA 4HB0B 1L4ZB 2M14A 2D9XA 2INPE 3L10B 4A3PA 1I4RA 1C4CA 3E9PA 2V3NA 4KIKA 1HB8A 2IFSA 3KZ1A 4XYCA 4LNNA 1C9FA 2FUHB 1J7BA 3ABVB 1XD3B 3MP9A 3X0WA 3EECA 4RF0A 1PGXA 3NZ3A 1Y5OA 4TSSA 1D5XC 3NWFA 2CHXA 2K5PA 4IG7B 5D6JB 1GG3A 1F77A 2CHWA 3R2TA 1E7UA 2N9EB 5FR3A 3PREA 1IGCA 2UWQA 2IY0B 1F2RC 3W1SC 4WSFA 3AU4A 2Z14A 2Z0OA 1FXAA 3CXBB 1TXDA 1QC6A 3CMMB 4NAWA 1I4PA 2K0PA 3BYTB 4JPSA 2NMBA 2IO0B 2ZW0A 2L00B 2WXMA 3TVVA 2K8HA 1TBEA 2FE8A 1P1AA 3SV1A 3KSYA 2DZKA 4NNJB 1DDVA 1TS3A 1KTKA 5J3TA 2ONQA 2JU6X 3M95A 1V1PA 2WLBA 2VKIA 4RM8A 4BVUC 5HE2A 3ONSA 4XE0A 4DHZE 4KKIA 2XQNM 1LGRA 3GZNI 4FJVB 1V5UA 4L6EA 2N1VA 1TY2A 5BO4B 1WR1A 4I6NB 1VR9A 2BWFA 1G6JA 1ET9A 1UGJA 4K7WA 4JKGB 4KDIC 4HAZB 4IW0A 1UNPA 4K1RB 1XLOA 4GU2A 1FO4A 2FUG1 1L0VB 1PUTA 3HW2B 1Y8RC 1EM7A 5LNK1 3UZTA 2XEWA 1E8XA 2MBBB 3ML9A 1KM7A 2WXGA 5GOWB 2KWVB 2HE7A 2R82A 2J53A 2KVZA 3VHTC 1DOYA 4W9LA 5CX3A 2R2OA 2KTRB 5EE3A 1QLBB 3NVZA 4MH8A 3A8PA 4A8XC 3QX1A 1YX5B 3L13A 3RZWC 1R4MB 1UBIA 2GCJA 4EUTA 1MI1A 2GBJA 2K8CA 1LQBA 1C77A 1UPQA 4WWMA 4JKEA 1LB1A 1EU3A 3EPYA 2BWES 3CIKA 4QXAB 4DX8A 4HPPA 4GIVA 4XGAB 1FNVA 5IJMA 2MH7A 1FHWA 4KIKB 2L83A 2G35A 5KCVA 3P1MA 4AUQC 2MBEA 1WF9A 4PQ0A 2IDYA 3BYYB 3SR6A 4JWSC 1WGRA 1KLGD 4W9JA 2JSVX 2CKHB 3DBRB 1JCKB 3GS2A 1PMSA 3KH0A 3N30A 4W9KA 2KUPA 4MT5A 3NZSA 1C4AA 5DPTA 2C7HA 4M00A 1C1YB 2J0JA 2K8EA 1QQRA 2KACA 2WX1A 1WR6E 3MHSD 2FCNA 2MEKA 3N9YC 2JF5A 4MDKE 1E10A 4GLSC 2WGSA 3T3OA 4BAXA 2LVPA 1WJ1A 1YQ3B 1ZVRA 2IPKD 2FJLA 2R2YA 2DBYA 1LM8B 1AQCA 4HAUB 4YSYB 2WU5B 2R09A 1BMLC 4OZCA 4W9GA 2VH1A 3PO0A 3Q8BA 3WAPA 1TS5A 1P98A 3TBLD 2O6VA 2JRIB 2B76B 2P0DA 3VRAB 1FNWA 1XLNA 1J0WA 4C7ZA 2N1WA 2KLCA 5C23A 2KWUB 1U5DA 1W1HA 3IG3A 1RWSA 4YXDB 1NYRA 2Z59B 2PPHA 1MIZB 3KLSX 1PGBA 4KX6B 4HB2B 1I7HA 5HKHA 1M7EA 1FRRA 2V9HA 3E9LA 1X05A 2KLGA 3V62A 2N9PC 3ZGZA 1B9RA 1V5OA 3OJ4B 4MT7A 5IRSA 2KN5A 4B6WA 4RNAA 5L95C 2MWNB 1WXVA 4LDTB 2AL6A 1FB8A 3PVLA 1V81A 1I4QA 2DYMA 5IO9A 2BPSA 4GN1A 4K2OA 3BZDB 4LDTD 3W2DA 3MJ5A 3AEAB 2KJ6A 2NTTA 1FFUA 2K9XA 3KRXA 1NTYA 1MG4A 2L8JA 3VIAA 3JYUA 1QF6A 1TKGA 3T3NA 1IBXB 4S17A 1L2NA 1MG8A 1UPRA 4N9F4 2LHEA 1P7FA 1Q67A 3I9V1 1U5GA 2V0GA 1RM6C 3CWIA 3VRBB 1AWEA 2BS3B 2CU1A 4USAA 3A9KA 1OQQA 2MJ3A 3W9CB 5BYSA 1T3QA 2W54A 2N9LA 1AW7A 1R7SA 2QJLA 3NS8A 2UU7A 5D3YA 2JXTA 3HUIA 3AEDB 4L1BA 4W9DA 5BMGA 2KK8A 4YSZB 2NBUA 3HSAA 1JALA 3GP7A 1I4HA 1P3QU 4WURA 1WGQA 4BBNC 2CY5A 5I4DA 1GNUA 3A4SC 1WYGA 4XDDA 3L0WB 3BVGA 4PT5A 3BVZA 2PVOD 3P7ZA 1HQRD 2G9HD 4RCOA 2CJOA 4ZYSA 3P4QB 4LLGM 3ZQ4A 1WXAA 4KSKC 2GRIA 4IWOA 4HJKA 1VCBA 2DYQA 3APCA 4HEA1 5KQ4A 4K17A 1GB4A 4JKCA 4ANWA 2IJ0A 3SBTA 3UIOB 2G45B 1UNQA 2V4IB 3TMPB 2CRFA 3FKYA 4BKGA 2WNMA 3U52E 2ON8A 4A20A 3I57A 3QA8A 1M4VA 2FJUB 3U12A 1NVLA 1ZC4B 4N59A 4GOCA 1WZ3A 1QKZA 1WFYA 1WJ6A 1H8CA 3TJPA 2LG1A 2GBNA 2LJIA 3Q69A 1SE4A 1QOAA 3N1YC 2RLOA 4HATB 4A5KA 3UQAA 5D3DA 2CU3A 2N7EA 3MTNB 1WX7A 1PFDA 2VSZA 5CHVC 3ZKJC 1YOVB 4XX5A 2QKMA 3SEBA 3M3JA 1ESFA 2BGFA 1HZ6A 1NBFC 4GSWA 3ZW3A 4ARIA 1Q10A 5D2MB 1MIXA 3RYTA 1LW3A 2MKRA 2L7RA 4C80A 2KTFA 3L08A 3ZVRA 2KX0A 3VVWB 1EF5A 5AZHA 3PEGA 5DI9B 3FVCA 1KZ7A 3V3XA 4MACA 4JKHA 2PMVA 2BQQA 4IWPA 4JIOU 5DPWA 2IO3B 5H92C 3ALBA 3E66A 2K39A 4M02A 4JKFA 3ZNZB 2I5CA 4ANXA 3R7QA 4A6FB 4K3BA 5C5BB 1HE8A 1L6VA 2GOWA 2A5UA 1MK9B 2CB8A 5J2RA 5E6JA 4US8A 1FMAD 4REZA 2WXPA 1D3ZA 4YTMB 3BINA 3HVDA 1KH0A 1S3SG 2J4XA 2DHKA 3A9KB 4EE2A 1P5TA 3SHQA 3B2GA 1YN4A 3PHXB 2L0TA 3V05A 5KHQA 2KHWB 4II2B 2FBWB 1SXTA 3VDZA 1ZKHA 4WAAA 1J0GA 3D8FA 1I4GA 3JSVB 1E9MA 2GUMA 2NBVB 1QZEA 1X11A 4HPLB 2RNRB 3VTUA 1ISNA 1P9DU 4NJ7A 1TQZA 4NJCA 4AOFA 1H4RA 1XODA 4KGSA 3ETRA 3ULCA 2KQ4X 3U2SC 2DYBA 2L0FA 4HB3B 1JWMD 4MEMA 1YJIA 2BYEA 3DOWA 5E6OA 1I35A 2RPQA 4S0RA 2RQ1A 4JK8A 2EMSA 2ZCCA 3PZDA 2DAFA 3OJ3A 2I2YA 3DWMA 5HFYA 1E8YA 3B2FA 5GXGB 2MRPA 1X1MA 3ZXRA 3AJ4A 4DIXA 4GB9A 4GPTB 4NQLB 3H7SA 5FI0A 4F7UP 2GLSA 1BXTA 2NPTB 2DHIA 2PW9A 4JX1C 2G1EA 1Y19B 3B9JA 2N4FA 4MELA 1KOTA 2YF0A 3PZ8A 2KQ7A 4Z2MB 1YX6B 3EHVA 1ST7A 1K5GB 1E5WA 4LJPB 3PVWA 2SAKA 3TEXA 5BYRA 4EMOA 1PFJA 5EDSA 2W2XD 4DQOC 4F8CB 3ODWA 3V6EB 1XLQA 3L4PA 2RDBC 1GB1A 3QIJA 3SUZA 3RULA 2Y5BB 5BYQA 1UNRA 2W2WA 3GZNB 5EE9A 2BKFA 1IGDA 4F7GA 1IRSA 3ZDMC 4F7ZA 2COFA 4OVUA 4ANUA 2X8XX 3PVUA 1BTKA 4MGZE 2I1KA 2JYEA 1F9JA 5D3IB 3RMKC 4HB4B 1DBHA 1JQ4A 4JK7A 3A33B 4P1CC 1XCTL 2BB6A 3Q3OC 3OANA 2JRHA 1CMXB 2DYNA 2Y5CA 1VRAB 1WX8A 2H7EA 3IT6B 2M8SA 4NQKE 4HCNB 2MFQA 2PVGC 2YLMA 1FAOA 5BMIA 3AV8A 4JWUC 3BK2A 3ZXVA 1N3HA 3E9OA 1UEFA 2NS5A 4IOIE 3ZUNA 3KRWA 4OZAA 5D3VA 3AH7A 4ANVA 4JGHB 1K5DB 2KR0A 3AE1B 3PV1A 1EO6A 2KIEA 2WXKA 3ZNHB 4KHOA 3QARA 2OJRA 1ZDXA 1TKYA 1XR0B 4NAMA 1XKEA 1NVID 3PZ7A 4GDLA 2MBOA 3P63A 3FLVA 1K52A 1RFKA 2A4ZA 2LYDA 1R4NB 2KAJA 3EA6A 3AE7B 3P4RB 3APDA 2D4QA 2REXA 2PTLA 1UH6A 1F0ZA 2DFKA 2COPA 1FEHA 4BKSD 2HRJA 2AYOB 4RH6A 3FILA 4EZLA 3IHPC 2ADZA 2BYFA 3RFZB 4NSWA 1RJ2A 1DROA 1RLFA 4M8NA 1E7PB 1SIJA 2MP2B 1T0YA 2W3RA 2ZJDA 4WJNA 2KUQA 3MPXA 2KX3A 4YTNB 2J42A 3FSSA 1KI1B 2H89B 1JROA 4C7YA 1DDWA 5J3YA 1WGYA 2KOXA 1I7AA 4QAYA 5I2MA 3V6CB 3T9LA 4WAFA 2YT1A 1DGJA 3VUXA 3M63B 3W5VB 4PYUA 2WXIA 4RF1A 2HD5B 2PZ1A 1SE9A 1XT9B 5JXVA 3NWAA 5IAAC 1P0RA 4C0AA 2J0KA 3ML8A 4JE3B 2RR9A 2MDXA 1WVHA 2H7DA 1E6EB 2LGXA 3VR8B 2Z13A 4DBBA 1XCQL 3L54A 2X38A 1HEZE 2KMAA 1IP9A 2LVQA 2FNJB 2YS1A 3ZJVA 1UF0A 2C5LC 2FCSA 5C3JB 2ZNVB 1WGUA 3EC8A 4BFRA 3VTVA 5HI1A 3VR9B 4E3CA 3AECB 1VDVA 3DCGA 2BW2A 3C0RB 2LXAA 3OWEB 4K2PA 3Q3NC 1OQNA 3W1SA 4L1RA 2WXQA 5CTRC 2KDMA 4CSQA 2JZPA 3Q8AA 3QQ8B 2IGGA 3A98B 1JW9D 3WYFB 1FRDA 2LI5A 3DHIC 2CY4A 1ENFA 3HVZA 1OEYA 4A90A 1FXIA 1T0QC 2KVRA 2Y3AA 2ZPNA 3BJIA 2E3TA 4J6IA 1T0SC 1GC6A 2AX5A 4RMAA 3B0AA 4JQWC 2V76A 1DYNA 3GOEA 4EEWA 2KDEB 2COAA 3DQVA 2QIEB 2D3CA 2DZIA 2L32A 1XQQA 1X86A 1YN5A 4MM3A 4TQ1A 2GJYA 2FCQA 2Y5PA 3U4EG 4URKA 4HJGE 2PKOA 5J18A 4GDLB 3HIEA 2R61A 1VBGA 3KWLA 3DHGC 1D5MC 1OY2A 3DBHI 1KLVA 4LNOA 2YSZA 1D6EC 2OQBA 1STEA 4GDKA 4KHBA 1V97A 2D10A 1WH3A 2CQUA 2X0SA 3FILB 2ELAA 2K6QA 2MLBA 3SO6A 1V49A 3PHWB 1YJJA 2Z0EB 1YD8U 2DIKA 1YNTE 3AB5A 3P4SB 3AM9A 3ENEA 1N5XA 5IOIA 1XD4A 5JLJB 1WXSA 2DHZA 1J7CA 4RGNA 2UYZB 4ILJA 2EC1A 1K50A 4IWQA 4HRSA 2CAYA 3DXEA 1U4AA 2IGHA 2KMMA 4MSQB 4ARCA 3OHMB 1SGHA 3T06A 1QILA 1TIFA 2QILA 4ZDVA 2JY6A 2NCNA 5KHOA 4NAWB 3TCAA 1CQVA 4ZRQA 1DIKA 3RZFA 4ILHA 4LCDE 3AE2B 1KRHA 2J59M 2I1JA 3LB8C 3V61A 2WHIA 3Q2AC 1WMHA 4TQ0A 2IY1B 5DCNA 2AQ1B 1OFFA 2MWSB 2JWZA 4LK0M 3CSFA 2M1MA 5C6RA 4PYZA 1V1PB 2XBBC 5E6NA 2KC1A 3UF8A 1OEYJ 2D3AA 2DKPA 5JHHA 4WWPA 2EKEC 2LVOA 1C76A 2KFKA 1PYWD 2L3ZA 3MC9A 4X57B 4EFOA 1OQYA 2JT4B 3GE3C 3WAOA 2KFJA 3O65B 3U8ZA 3PTFC 2PE6B 1WIAA 1PGAA 2I5FA 3X23A 1IUEA 1B55A 1E0ZA 5C16A 3M62B 1OTRB 3N1ZC 1K8RB 4ZHOA 1FGYA 4G3XB 5D3WA 2LJ5A 3B08A 4ACFA 1FPYA 1WM2A 4IFSA 2KIGA 2XNAC 3QCAA 2L1AA 5DH9B 3TEWA 2GCLA 4Y94A 1WGGA 4KDLB 2M56B 2KYWA 2Y7BA 2K2UA 2KXJA 3LXFA 1A5RA 3RNGC 1PLSA 4FHKA 3EFUA 1BUIC 2IZVB 2KNBA 1AWDA 2L76A 1VZ8A 2KJRA 3FM8C 4B0MA 2M19A 1JRUA 1SB3C 1HTOA 2LRUA 3MDBC 3TEZA 4KGRA 1L6UA 2D11A 2MHJA 3QAQA 2D07B 2QDFA 1T77A 4AP4C 2RGFA 2N9XA 1OGWA 3CSTA 3AE5B 3DXCA 5EFXA 4OSNA 2LUEA 1J7AA 3KUCB 4RGMA 1E8ZA 3U7DA 2KJHB 3EFCA 4M0WA 4I6PA 1W1DA 4PK1A 5FKAC 4IM2A 1JMLA 3ZNGC 3KY9A 1A70A 3PLUA 4ZYNA 2TSSA 2BB5A 3TO1A 2WDRB 2N9KA 3ODXA 4W9IA 3N20C 4F7HA 2W2XC 3NOBA 1ZDVA 2DLWA 1FIQA 4DXFA 2NMQA 4EOYA 3QHTA 1WMHB 4NZLB 1NI2A 2DX1A 3BK1A 4N58A 4HAYB 2O6VB 5JP4A 2L2IA 1DDMA 1YJ1A 2O6VD 4FJYA 5C1ZA 4WWOA 1XXGA 5D94A 1WSPA 3WAMA 2LD9A 4MJSA 1JWBD 1V88A 3HQCA 2GBMA 2R2QA 1KJTA 3AEEB 2ZCBA 1OMWA 3TSSA 5HE3A 1LO5D 1WX9A 4QJ4B 5FR6A 1W1GA 4RM9A 2DHJA 3F5RA 1V5PA 1F2RI 4EZKA 2Y8GA 4ZRJA 2LKOA 1TJ6A 3TUOA 2V1YA 1YIWA 1C78A 5CLLB 3MC0B 1ACAA 3AMZA 5CHFA 3N7CA 4HXDA 1F1HA 3LJ3A 3S2AA 3ECIA 4EZJA 5GMVA 2DN6A 2KO3A 4KZCA 3WA0A 4YWGG 1EWYC 1FCLA 1M7RA 1J19A 1ZM0A 3HK0A 3APFA 1N6ZA 2LGIA 1L0YB 1WG7A 2L05A 3LDZE 1GJZA 3VOQA 4US9A 2GBRA 5H8YE 3W5UB 3IXSA 3TW1A 3DPDA 1ZOYB 4YSXB 4IAPA 3VXWA 3VH3B 4W9CA 3NZUA 2Z0DB 1DOIA 1ZSQA 2L1CA 1FD6A 4KV2A 3Q8CA 2MA9B 2IO1B 3ZJUA 2LHDA 1I4XA 2XK5A 4QJ3B 1AN8A 4WJQA 1RRPB 4JL9A 4L2YA 2D9WA 2DZJA 2KCJA 1PQSA 3MHZA 4W9FA 1UUPA 2JVCA 2KZRA 1H10A 3HIZA 1U2BA 2KANA 2Z4DA 3QWMA 1JDEA 3OG5A 4OT1A 2LOZA 1YN3A 2NR2A 1SE2A 1XO3A 3SBGA 3ZTCA 4WH4A 2Z0QA 1V86A 4A3OA 3NVVA 4KZ0A 3N32A 1T6BX 2QMTA 1U5EA 1QOGA 5C2TB 3NHEB 2BT6A 2C60A 2AEHA 2LFIA 2NBWB 1C3TA 2G4SA 3HRDD 4OHJA 3AE4B 3RCZA 4DWFA 4R3DA 3VUYA 1FOEA 4BZAA 3Q6BA 2ZNVC 1EGXA 2VRWB 2UZRA 2YT2A 3KYCD 2WDQB 3NY5A 1EF1A 1SJED 1EAZA 2P0HA 1MJDA 4N6EB 1U27A 1KFYB 1SSNA 4HKZE 2K1FA 1HTQA 2YVCA 4A6KA 2V3PA 2D3BA 2N0SB 3A9JA 3TEYA 2JQRB 1EWCA 2JPHA 2B3AA 4KHAA 2DWQA 2JZ3B 4XWXA 3WALA 2Z8LA 4YT0B 4YONA 3P6AA 5AUKA 1V2YA 1MHHE 3C8YA 4FHJA 1GUAB 3SNHA 2XN9C 1OQRA 2YT0A 2RSGA 4D6WA 1RRBA 2N7DA 4BKTA 3L17A 4B0EA 2K00A 3RD2A 2ZVOA 3KW5B 4HKQA 4E74A 2QEJC 3T8MA 4LNKA 1GPXA 5JVLA 2WXFA 3F0WA 2IBIB 3NVYA 4K7UA 4JKGA 3WCQA 2JX5A 1KBLA 1K51A 1I2HA 2ICIA 4JKAA 1CZPA 3D8EA 3E9SA 5D7GA 1QT9A 1FFVA 3P4PB 1HB6A 1UWXA 4C56C 5J3QA 1WGKA 1QOBA 3QWZB 4G11A 2E6XA 2RDHA 3DBLI 3DBHB 4G0NB 2D9YA 2KDIA 3RPFC 4B95A 2INNE 1WWTA 4P16A 1LXDA 2MJDA 1E7VA 2PJHA 4OW0A 3RN9C 2JYTA 4ICVA 3ZRCA 5JHBA 3PRZA 3ZTDA 2KTRA 4WJPA 1E8WA 4WJ7A 2Z0PA 2XK5B 4Q2JA 1WJUA 1NTVA 3AE3B 1ZXHA 5HE1A 5D27A 5L81A 4GGQA 3Q8FA 4A9AA 4TV3A 3PSEB 4ZOHC 3N3KB 4WWNA 3E56A 2LULA 2WDTB 4GMVA 2JUOA 3DVGY 4TMAB 3DDCB 1XX0A 2IGDA 4P6VF 2LUMA 2LWPA 1YMHE 4LTUA 1RYJA 1TKEA 2MCNB 1MI0A 2WU2B 1IPGA 4FA6A 3SYXA 1IYFA 2NTSA 4XC2A 5HHDG 2YEPB 4A55A 1ZE3D 1BAKA 1WZ0A 2QKLA 4G50A 1MKEA 4IUMB 1K53A 2WXNA 4LNFA 1VJKA 3GYPA 1NTIA 1C4PA 5JH5C 5LOPB 1ET6A 1T0RC 3SD5A 3QJZA 1MFWA 1F52A 3KQ4A 2BS4B 3ENBA 4AJYB 3JVZX 5T8IA 3A9JB 3HM3A 4H2AA 4BBNF 1HXYD 5HG2A 3I63C 1HA5A 3NW8A 4PNKA 2ROVA 1WGHA 3D32A 4FN2A 2MX2A 1M94A 1XLPA 3AEBB 4CYEA 2FIDA 1WY8A 4ZRKA 4QJ5B 2J52A 5EE1A 1V80A 3Q3FA 5LG4B 2RSUA 4D2KA 3AE9B 4TUUA 4P7IA 2ROZB 1BWNA 2VH2A 1AARA 4IDIA 1D4BA 2WXRA 2Z59A 4CHKA 4A6QA 1FGZA 2JP2A 2GBKA 3J9CA 2EJ8A 1LFDA 3LJUX 1V9JA 2BS2B 1E90A 1DYQA 1NU2A 1AYFA 2K6DB 5C79A 3I5JC 5M4YB 3PPAA 3H6NA 4XDCA 4FJZA 4KGTA 3BVMA 2HDEA 2WXHA 1XF5L 2KGXB 3W1YA 2ACZB 3M1IB 2BBCA 2V4LA 1YQ4B 3PT2B 5D3XA 2BVCA 4HPMB 2K8BA 2IYDB 4DXAB 2E2XA 3ML4A 4HAWB 4HAXB 1NDDA 2PE9A 3AE8B 3KYDD 2RGNB 2P8VA 4FULA 5LLIA 2BYTA 1V61A 2C9WB 4NJ6A 1J8CA
chains in the Genus database with same CATH topology
5LXIB 1WRDB 2N0YA 3IBEA 5FI1A 4IC7B 2KWCA 2FDQA 1P3RA 4DHZB 4JK9A 4DX90 1Q5WB 2LBBA 1UD7A 1KC7A 5G2NA 4AJWA 3FP5A 3U30A 2KC2A 4ASWC 4HHVA 2BF8B 1V5MA 2KMCA 2UVMA 2M17A 4BBKA 3DVGX 3GYOA 4K7SA 2ZEQA 3ODOA 1V5TA 1BT0A 2KDFB 1U29A 4DHJB 4JLCA 5DHFB 1RFAA 1R4NI 3PG7A 3I3TB 1RAXA 3QC8B 4DHJD 4F1SA 2DX5A 3OAWA 2DTCA 3O96A 1MAIA 1Z5SB 2W9NA 1TGZB 1MK7B 2ELBA 4K81A 2JZZA 4MH0E 2O2VA 5JHGA 3RUIB 4FADA 5LXHA 4ZRIA 4ILGB 3QK0A 2CHZA 2YS3A 4II3B 4CHMA 3NSUA 2AL3A 4MSMB 4GZUA 1U5FA 3VTWA 2DKQA 2IO2B 3P2BA 3CF6E 2Q13A 2BCJA 1UBQA 3ZDTA 2LGYA 4BOZB 2MQJA 2LZ6A 2C7NB 4KAXB 2M4NA 2ZVNA 4LJOB 3DVNU 1Q1OA 1WJNA 4WJOA 5TR5A 1SIFA 2CS4A 5AZFA 3PRMB 4B9KA 4TYZA 2COCA 3ZLZA 4JKDA 2D9ZA 4MGKE 3HM6X 3Q3JA 5KQ1A 3ZRFA 3H1UA 3VUWA 4A6FA 1UELA 3A1QA 5C5BA 1SHCA 4GDKB 4DBGA 3PP2A 4KHBB 4PS3A 3ZIMA 3BY4B 4GXBA 2DZMA 3OLMD 3ZNID 2BKRB 1WI1A 2D9VA 1MPHA 1R4MI 2D2QA 4A6HA 2KKCA 3JSVA 2G3QB 4DDID 1QQGA 3KVFB 3VQIA 4IM0A 2P0FA 3SU8X 2M0XA 4HAVB 4DK5A 2WWZA 2DENB 1WE7A 2LGDA 3TL5A 2CR5A 5AEKB 1FHXA 2N23A 2DX5B 2MBHA 4MGIE 3PS6A 5DPRA 3MJWA 3WIMA 3AXCA 2M38A 2O2VB 2DYOA 2MW5A 2V3SA 2HJ8A 2WYQA 2OOBB 2C7MB 3UIPB 4GMXB 3DBRI 1V6EA 2DA0A 3FEHA 1S1QB 5DHAB 3V60A 3UQBA 1WM3A 2J7QB 4KSLC 2YS5A 2QHOA 2NPTA 3PGEA 3DVNV 2KFKB 4MK0A 4W9EA 2D3GA 4WQOB 4KVGB 4NPNA 1FXTB 2AWTA 3TFMA 4H8SA 2FAZA 4MY6A 1WYWB 1GC7A 4HLEA 5L83A 3AULA 1Q0WB 2KD0A 3ZO5B 1KZGA 2NZ8B 3TIXA 3K9PB 4HDOA 2WX0A 1TTNA 2Y8FA 4CO7A 4FBJB 3ZVVA 1VD2A 1V89A 2HTHA 4ICUA 3AU5A 3A8QA 4Z2NA 2EMTA 3AI5A 3K9OB 3A1QB 3R66C 2RUKB 3IFWB 3VH4B 4TKNA 1XCGA 1ZW7A 2KDBA 5E6PA 4W9HA 2LASA 2K2JA 2K25A 2LXCA 1WJ4A 3RT3B 1Z2MA 4IM3A 4HDQA 3DBSA 4HWIB 3SDLC 5IA7A 2OTXA 5HE0A 2G4DB 2ZPYA 2GS0A 4M0WB 1WI0A 3PRPB 4I6LB 4HK2A 4CHJA 1GGOA 1FHOA 4HCPB 3R7RA 1L7YA 3H7PA 4E71A 4JKBA 5AZGA 1X1FA 3KUDB 4BKSA 2MSED 2FJ9A 2UZSA 2VRRB 3V5WA 1EUVB 3PSCA 1WGDA 1WXMA 4MJSB 2FCMA 1TZ1A 2GMIC 5DIFB 1P6SA 3UGBB 4EJNA 2MP2A 2PEAA 3UINB 2YRYA 5DPSA 2X18A 4AWJA 2KQSA 2LRWA 4IOYX 1ZGUB 5JZEB 2BYVE 2LOXA 1UZXB 4HVBA 3QBVB 3HHMA 5G55A 2R0DA 3D8DA 4PS8A 3H9DA 5JHAA 3IVFA 3VFKA 5CHWA 1X1GA 2FIFA 3JW0X 2HTHB 1ZC3B 2ZZPB 4B6HA 4MGYE 4YL8A 4EKUA 4PS7A 5J17A 4NY0A 3KUZA 3VAWA 3G9WA 3DXDA 2RVBB 4WVFB 4FLHA 3WANA 2NVUI 3R3MA 3RCPA 1EVHA 2ABDA 4BOSC 1I42A 2RD0A 5LONB 2MBQA 2ASQA 1YQBA 2J0MA 1Z87A 3PLVA 2JXXA 1HBKA 5CLQB 2DAJA 2WH5A 4M8MA 1WJMA 3L16A 3B1LX 4OVVA 4DDGD 4D0NB 1WE6A 2CODA 3H7PB 3ULBA 1BTNA 3A4RA 1VBHA 4XZ4A 2IYBA 1UGMA 4HB0B 2M14A 2D9XA 3L10B 4A3PA 3E9PA 4KIKA 1HB8A 2IFSA 3KZ1A 2FUHB 1XD3B 3X0WA 3EECA 1Y5OA 2CHXA 4IG7B 5D6JB 1GG3A 2CHWA 1E7UA 2N9EB 3PREA 2UWQA 2IY0B 3W1SC 4WSFA 3AU4A 2Z0OA 3CXBB 1TXDA 1QC6A 3CMMB 4NAWA 2NMBA 2IO0B 2L00B 3TVVA 2K8HA 1TBEA 1P1AA 3SV1A 3KSYA 2DZKA 4NNJB 1DDVA 5J3TA 3M95A 2VKIA 4RM8A 4BVUC 5HE2A 3ONSA 4DHZE 2XQNM 3GZNI 4FJVB 1V5UA 4L6EA 2N1VA 5BO4B 1WR1A 4I6NB 2BWFA 1G6JA 4KDIC 4K7WA 4JKGB 4HAZB 4IW0A 1UNPA 4K1RB 4GU2A 3HW2B 1Y8RC 3UZTA 2XEWA 1E8XA 2MBBB 3ML9A 1KM7A 5GOWB 2KWVB 2HE7A 2R82A 3VHTC 4W9LA 5CX3A 2R2OA 2KTRB 3A8PA 3QX1A 1YX5B 3L13A 3RZWC 1UBIA 2GCJA 4EUTA 2GBJA 2K8CA 1LQBA 1UPQA 4JKEA 1LB1A 3EPYA 2BWES 3CIKA 4DX8A 4GIVA 5IJMA 1FHWA 4KIKB 2G35A 5KCVA 4AUQC 2MBEA 1WF9A 4PQ0A 1WGRA 4W9JA 2CKHB 4W9KA 1PMSA 3KH0A 3N30A 2KUPA 3NZSA 5DPTA 2C7HA 1C1YB 2J0JA 2WX1A 1WR6E 3MHSD 2FCNA 2JF5A 4MDKE 2LVPA 1WJ1A 1ZVRA 2FJLA 1LM8B 1AQCA 4HAUB 2R09A 4W9GA 3WAPA 1P98A 3TBLD 2O6VA 2JRIB 2P0DA 1J0WA 2N1WA 2KLCA 5C23A 2KWUB 1U5DA 1W1HA 3IG3A 2Z59B 2PPHA 1MIZB 4HB2B 5HKHA 1M7EA 3E9LA 1X05A 2KLGA 3V62A 2N9PC 1V5OA 3OJ4B 4MT7A 4B6WA 2KN5A 5L95C 2MWNB 1WXVA 4LDTB 2AL6A 1FB8A 3PVLA 1V81A 2DYMA 2BPSA 4GN1A 4K2OA 4LDTD 2KJ6A 3KRXA 1NTYA 3JYUA 2L8JA 3VIAA 1L2NA 1MG8A 1UPRA 4N9F4 1Q67A 1U5GA 1AWEA 2CU1A 3A9KA 3NS8A 5D3YA 4W9DA 2KK8A 2NBUA 1P3QU 1WGQA 4BBNC 2CY5A 1GNUA 3A4SC 3L0WB 3P7ZA 1WXAA 4KSKC 4IWOA 4HJKA 1VCBA 2DYQA 3APCA 5KQ4A 4K17A 4JKCA 4ANWA 3SBTA 3UIOB 2G45B 1UNQA 3TMPB 2CRFA 4BKGA 4A20A 3QA8A 1NVLA 1ZC4B 4GOCA 1WZ3A 1WFYA 1WJ6A 1H8CA 3TJPA 2LG1A 2GBNA 2RLOA 4HATB 4A5KA 3UQAA 2N7EA 3MTNB 1WX7A 2VSZA 5CHVC 3ZKJC 4XX5A 2QKMA 3M3JA 2BGFA 1NBFC 4GSWA 3ZW3A 5D2MB 1MIXA 3RYTA 1LW3A 2MKRA 2L7RA 2KTFA 3L08A 3ZVRA 2KX0A 3VVWB 1EF5A 5AZHA 3PEGA 5DI9B 1KZ7A 4JKHA 4IWPA 4JIOU 5DPWA 2IO3B 3ALBA 3E66A 2K39A 4JKFA 3ZNZB 2I5CA 4ANXA 3R7QA 4A6FB 5C5BB 1HE8A 2GOWA 2A5UA 1MK9B 2CB8A 5J2RA 1D3ZA 3BINA 1S3SG 2DHKA 3A9KB 1P5TA 3SHQA 3PHXB 2L0TA 5KHQA 2KHWB 4II2B 3VDZA 1ZKHA 4WAAA 1J0GA 3D8FA 3JSVB 2NBVB 1QZEA 1X11A 4HPLB 2RNRB 3VTUA 1ISNA 1P9DU 4NJ7A 1TQZA 4AOFA 1H4RA 1XODA 3ULCA 2DYBA 2L0FA 4HB3B 4MEMA 2BYEA 3DOWA 5E6OA 1I35A 2RPQA 2RQ1A 4JK8A 2EMSA 2ZCCA 3PZDA 2DAFA 3OJ3A 1E8YA 2MRPA 1X1MA 3AJ4A 4GB9A 4GPTB 4NQLB 3H7SA 5FI0A 4F7UP 2NPTB 2DHIA 1Y19B 2N4FA 4MELA 1KOTA 2YF0A 2KQ7A 4Z2MB 1YX6B 3EHVA 1ST7A 1K5GB 1E5WA 4LJPB 3PVWA 4EMOA 1PFJA 5EDSA 2W2XD 4F8CB 3ODWA 3V6EB 3QIJA 3SUZA 3RULA 2Y5BB 1UNRA 2W2WA 2BKFA 4F7GA 1IRSA 3ZDMC 4F7ZA 2COFA 4OVUA 4ANUA 3PVUA 1BTKA 4MGZE 2I1KA 1F9JA 4HB4B 1DBHA 4JK7A 3A33B 3OANA 2JRHA 1CMXB 2DYNA 1WX8A 2H7EA 2M8SA 4NQKE 4HCNB 2MFQA 2YLMA 1FAOA 1N3HA 3E9OA 1UEFA 2NS5A 3ZUNA 3KRWA 5D3VA 4ANVA 4JGHB 1K5DB 3PV1A 1EO6A 3ZNHB 4KHOA 3QARA 2OJRA 1XR0B 1XKEA 4GDLA 2MBOA 3FLVA 2A4ZA 2LYDA 3APDA 2D4QA 2REXA 1UH6A 2DFKA 2COPA 4BKSD 2HRJA 2AYOB 4EZLA 3IHPC 2ADZA 2BYFA 4NSWA 1RJ2A 1DROA 1RLFA 4M8NA 2MP2B 1T0YA 2ZJDA 4WJNA 3MPXA 2KX3A 3FSSA 1KI1B 1DDWA 5J3YA 1WGYA 2KOXA 1I7AA 3V6CB 3T9LA 2YT1A 3VUXA 3M63B 4PYUA 2HD5B 2PZ1A 1SE9A 1XT9B 5IAAC 1P0RA 4C0AA 2J0KA 3ML8A 2RR9A 2MDXA 1WVHA 2H7DA 2LGXA 4DBBA 3L54A 2KMAA 1IP9A 2LVQA 2FNJB 2YS1A 2C5LC 2FCSA 2ZNVB 1WGUA 3EC8A 4BFRA 3VTVA 4E3CA 3DCGA 3C0RB 2LXAA 4K2PA 1OQNA 3W1SA 5CTRC 3QQ8B 3A98B 3WYFB 2LI5A 2CY4A 1OEYA 2KVRA 2ZPNA 3BJIA 4J6IA 1GC6A 4RMAA 3B0AA 4JQWC 2V76A 1DYNA 3GOEA 4EEWA 2KDEB 2COAA 3DQVA 2DZIA 1XQQA 1X86A 4MM3A 4TQ1A 2GJYA 2FCQA 4URKA 5J18A 4GDLB 1VBGA 1OY2A 3DBHI 1KLVA 2YSZA 2OQBA 4GDKA 2D10A 1WH3A 2CQUA 2X0SA 2ELAA 2K6QA 2MLBA 3SO6A 1V49A 3PHWB 2Z0EB 1YD8U 2DIKA 3ENEA 1XD4A 5JLJB 1WXSA 2DHZA 2UYZB 4ILJA 2EC1A 4IWQA 2CAYA 3DXEA 1U4AA 4MSQB 1SGHA 3T06A 4ZDVA 2JY6A 2NCNA 5KHOA 4NAWB 3TCAA 1DIKA 3RZFA 4ILHA 4LCDE 2J59M 2I1JA 3V61A 1WMHA 4TQ0A 2IY1B 5DCNA 2MWSB 2JWZA 3CSFA 2M1MA 5C6RA 4PYZA 2XBBC 5E6NA 2KC1A 3UF8A 1OEYJ 2DKPA 5JHHA 4WWPA 2EKEC 2LVOA 2KFKA 2L3ZA 4X57B 4EFOA 1OQYA 2JT4B 3WAOA 2KFJA 3O65B 3U8ZA 3PTFC 2PE6B 1WIAA 2I5FA 3X23A 1B55A 5C16A 3M62B 1OTRB 1K8RB 1FGYA 4G3XB 5D3WA 2LJ5A 3B08A 1WM2A 4IFSA 3QCAA 5DH9B 2GCLA 4Y94A 1WGGA 4KDLB 2Y7BA 2K2UA 2KXJA 1A5RA 1PLSA 4FHKA 3EFUA 2IZVB 2KNBA 2L76A 2KJRA 3FM8C 1JRUA 2LRUA 3MDBC 2D11A 3QAQA 2D07B 4AP4C 2RGFA 2N9XA 1OGWA 3CSTA 3DXCA 5EFXA 2LUEA 3KUCB 1E8ZA 3U7DA 2KJHB 4I6PA 1W1DA 4IM2A 3ZNGC 3KY9A 3PLUA 4ZYNA 3TO1A 3ODXA 4W9IA 4F7HA 2W2XC 3NOBA 2DLWA 4EOYA 3QHTA 1WMHB 1NI2A 2DX1A 4HAYB 2O6VB 5JP4A 2L2IA 1DDMA 1YJ1A 2O6VD 4FJYA 5C1ZA 4WWOA 5D94A 3WAMA 2LD9A 4MJSA 1V88A 3HQCA 2GBMA 2R2QA 1KJTA 2ZCBA 1OMWA 5HE3A 1WX9A 5FR6A 1W1GA 4RM9A 2DHJA 3F5RA 1V5PA 4EZKA 2Y8GA 4ZRJA 2LKOA 1TJ6A 2V1YA 1YIWA 5CLLB 1ACAA 5CHFA 3N7CA 4HXDA 3LJ3A 3S2AA 3ECIA 4EZJA 5GMVA 2DN6A 2KO3A 4KZCA 3WA0A 1M7RA 1J19A 1ZM0A 3HK0A 3APFA 1WG7A 2L05A 3LDZE 1GJZA 3VOQA 2GBRA 3TW1A 3DPDA 4IAPA 3VXWA 3VH3B 4W9CA 3NZUA 2Z0DB 1ZSQA 2L1CA 4KV2A 2MA9B 2IO1B 2XK5A 4WJQA 1RRPB 4JL9A 2D9WA 2DZJA 2KCJA 1PQSA 4W9FA 2JVCA 2KZRA 1H10A 3HIZA 1U2BA 2KANA 3QWMA 1JDEA 2LOZA 2NR2A 3SBGA 3ZTCA 2Z0QA 1V86A 4A3OA 4KZ0A 3N32A 1U5EA 3NHEB 2C60A 2AEHA 1C3TA 2NBWB 2G4SA 3RCZA 4DWFA 3VUYA 1FOEA 2ZNVC 1EGXA 2VRWB 2UZRA 3KYCD 3NY5A 1EF1A 1EAZA 2P0HA 1U27A 2K1FA 2YVCA 4A6KA 3A9JA 2JPHA 2B3AA 4KHAA 2JZ3B 4XWXA 3WALA 4YONA 3P6AA 1V2YA 4FHJA 1GUAB 3SNHA 2YT0A 2RSGA 1RRBA 2N7DA 4BKTA 3L17A 2K00A 3RD2A 2ZVOA 3KW5B 4E74A 3T8MA 5JVLA 3F0WA 2IBIB 4K7UA 4JKGA 1KBLA 1I2HA 4JKAA 3D8EA 5D7GA 1HB6A 5J3QA 3QWZB 4G11A 3DBLI 4G0NB 2D9YA 2KDIA 4B95A 1LXDA 1E7VA 2PJHA 5JHBA 4ICVA 3ZRCA 3PRZA 3ZTDA 2KTRA 4WJPA 1E8WA 4WJ7A 2Z0PA 2XK5B 1WJUA 1NTVA 5HE1A 5D27A 5L81A 4GGQA 4TV3A 3PSEB 3N3KB 4WWNA 2LULA 2WDTB 4GMVA 2JUOA 3DVGY 3DDCB 1XX0A 2LWPA 2MCNB 1IPGA 4FA6A 3SYXA 1IYFA 4XC2A 1BAKA 1WZ0A 2QKLA 4G50A 1MKEA 4IUMB 3GYPA 1NTIA 5JH5C 5LOPB 3SD5A 3QJZA 3ENBA 4AJYB 3JVZX 3A9JB 3HM3A 4BBNF 4PNKA 2ROVA 1WGHA 3D32A 4FN2A 2MX2A 1M94A 4CYEA 2FIDA 1WY8A 4ZRKA 1V80A 3Q3FA 2RSUA 4TUUA 4P7IA 2ROZB 1BWNA 1AARA 4CHKA 1FGZA 2JP2A 2GBKA 2EJ8A 1LFDA 3LJUX 1V9JA 1E90A 1NU2A 2K6DB 5C79A 3PPAA 3H6NA 4FJZA 2KGXB 3W1YA 3M1IB 2V4LA 3PT2B 5D3XA 4HPMB 2K8BA 2IYDB 4DXAB 2E2XA 3ML4A 4HAWB 4HAXB 1NDDA 2PE9A 3KYDD 2RGNB 2P8VA 4FULA 5LLIA 1V61A 2C9WB 4NJ6A 1J8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LXI B;  1WRD B;  2N0Y A;  3IBE A;  5FI1 A;  4IC7 B;  2KWC A;  2FDQ A;  1P3R A;  4DHZ B;  4DX9 0;  1Q5W B;  2LBB A;  1UD7 A;  5G2N A;  4AJW A;  3FP5 A;  3U30 A;  2KC2 A;  4ASW C;  4HHV A;  2BF8 B;  1V5M A;  2KMC A;  2UVM A;  2M17 A;  4BBK A;  3DVG X;  3GYO A;  4K7S A;  2ZEQ A;  3ODO A;  1V5T A;  1BT0 A;  2KDF B;  1U29 A;  4DHJ B;  4JLC A;  5DHF B;  1RFA A;  1R4N I;  3PG7 A;  3I3T B;  1RAX A;  3QC8 B;  4DHJ D;  4F1S A;  2DX5 A;  3OAW A;  2DTC A;  3O96 A;  1MAI A;  1Z5S B;  2W9N A;  1TGZ B;  1MK7 B;  2ELB A;  4K81 A;  2JZZ A;  4MH0 E;  2O2V A;  5JHG A;  3RUI B;  4FAD A;  5LXH A;  4ZRI A;  3QK0 A;  2CHZ A;  2YS3 A;  4II3 B;  4CHM A;  3NSU A;  2AL3 A;  4MSM B;  4GZU A;  1U5F A;  3VTW A;  2DKQ A;  2IO2 B;  3P2B A;  3CF6 E;  2Q13 A;  2BCJ A;  1UBQ A;  3ZDT A;  2LGY A;  4BOZ B;  2MQJ A;  2LZ6 A;  2C7N B;  4KAX B;  2M4N A;  2ZVN A;  4LJO B;  3DVN U;  1Q1O A;  1WJN A;  4WJO A;  5TR5 A;  1SIF A;  2CS4 A;  5AZF A;  3PRM B;  4B9K A;  4TYZ A;  2COC A;  3ZLZ A;  2D9Z A;  4MGK E;  3HM6 X;  3Q3J A;  5KQ1 A;  3ZRF A;  3H1U A;  3VUW A;  4A6F A;  1UEL A;  3A1Q A;  5C5B A;  1SHC A;  4GDK B;  4DBG A;  3PP2 A;  4KHB B;  4PS3 A;  3ZIM A;  3BY4 B;  4GXB A;  2DZM A;  3OLM D;  3ZNI D;  2BKR B;  1WI1 A;  2D9V A;  1MPH A;  1R4M I;  2D2Q A;  4A6H A;  2KKC A;  3JSV A;  2G3Q B;  4DDI D;  1QQG A;  3KVF B;  3VQI A;  4IM0 A;  2P0F A;  3SU8 X;  2M0X A;  4HAV B;  4DK5 A;  2WWZ A;  2DEN B;  1WE7 A;  2LGD A;  3TL5 A;  2CR5 A;  5AEK B;  1FHX A;  2N23 A;  2DX5 B;  2MBH A;  4MGI E;  3PS6 A;  5DPR A;  3MJW A;  3WIM A;  2M38 A;  3AXC A;  2O2V B;  2DYO A;  2MW5 A;  2V3S A;  2HJ8 A;  2WYQ A;  2OOB B;  2C7M B;  3UIP B;  4GMX B;  3DBR I;  1V6E A;  2DA0 A;  3FEH A;  1S1Q B;  5DHA B;  3V60 A;  3UQB A;  1WM3 A;  2J7Q B;  4KSL C;  2YS5 A;  2QHO A;  2NPT A;  3PGE A;  3DVN V;  2KFK B;  4MK0 A;  4W9E A;  2D3G A;  4WQO B;  4KVG B;  4NPN A;  1FXT B;  2AWT A;  3TFM A;  4H8S A;  2FAZ A;  4MY6 A;  1WYW B;  1GC7 A;  4HLE A;  5L83 A;  3AUL A;  1Q0W B;  2KD0 A;  3ZO5 B;  1KZG A;  2NZ8 B;  3TIX A;  3K9P B;  4HDO A;  2WX0 A;  1TTN A;  2Y8F A;  4CO7 A;  4FBJ B;  3ZVV A;  1VD2 A;  1V89 A;  2HTH A;  4ICU A;  3AU5 A;  3A8Q A;  4Z2N A;  2EMT A;  3AI5 A;  3K9O B;  3A1Q B;  3R66 C;  2RUK B;  3IFW B;  3VH4 B;  4TKN A;  1XCG A;  1ZW7 A;  2KDB A;  5E6P A;  4W9H A;  2LAS A;  2K2J A;  2K25 A;  2LXC A;  1WJ4 A;  3RT3 B;  1Z2M A;  4IM3 A;  4HDQ A;  3DBS A;  4HWI B;  3SDL C;  5IA7 A;  2OTX A;  5HE0 A;  2G4D B;  2ZPY A;  2GS0 A;  4M0W B;  1WI0 A;  3PRP B;  4I6L B;  4HK2 A;  4CHJ A;  1FHO A;  4HCP B;  3R7R A;  1L7Y A;  3H7P A;  4E71 A;  5AZG A;  1X1F A;  3KUD B;  4BKS A;  2MSE D;  2FJ9 A;  2UZS A;  2VRR B;  3V5W A;  1EUV B;  3PSC A;  1WGD A;  1WXM A;  4MJS B;  2FCM A;  1TZ1 A;  2GMI C;  5DIF B;  1P6S A;  3UGB B;  4EJN A;  2MP2 A;  2PEA A;  3UIN B;  2YRY A;  5DPS A;  2X18 A;  4AWJ A;  2KQS A;  2LRW A;  4IOY X;  1ZGU B;  5JZE B;  2BYV E;  2LOX A;  1UZX B;  4HVB A;  3QBV B;  3HHM A;  5G55 A;  2R0D A;  3D8D A;  4PS8 A;  3H9D A;  5JHA A;  3IVF A;  3VFK A;  5CHW A;  1X1G A;  2FIF A;  3JW0 X;  2HTH B;  1ZC3 B;  2ZZP B;  4B6H A;  4MGY E;  4YL8 A;  4EKU A;  4PS7 A;  5J17 A;  4NY0 A;  3KUZ A;  3VAW A;  3G9W A;  3DXD A;  2RVB B;  4WVF B;  4FLH A;  3WAN A;  2NVU I;  3R3M A;  3RCP A;  1EVH A;  2ABD A;  4BOS C;  1I42 A;  2RD0 A;  5LON B;  2MBQ A;  2ASQ A;  1YQB A;  2J0M A;  1Z87 A;  3PLV A;  2JXX A;  1HBK A;  5CLQ B;  2DAJ A;  2WH5 A;  4M8M A;  1WJM A;  3L16 A;  3B1L X;  4OVV A;  4DDG D;  4D0N B;  1WE6 A;  2COD A;  3H7P B;  3ULB A;  1BTN A;  3A4R A;  4XZ4 A;  2IYB A;  1UGM A;  4HB0 B;  2M14 A;  2D9X A;  3L10 B;  4A3P A;  4KIK A;  1HB8 A;  2IFS A;  3KZ1 A;  2FUH B;  1XD3 B;  3X0W A;  3EEC A;  1Y5O A;  2CHX A;  4IG7 B;  5D6J B;  1GG3 A;  2CHW A;  1E7U A;  2N9E B;  3PRE A;  2UWQ A;  2IY0 B;  3W1S C;  4WSF A;  3AU4 A;  2Z0O A;  3CXB B;  1TXD A;  1QC6 A;  3CMM B;  4NAW A;  2NMB A;  2IO0 B;  2L00 B;  3TVV A;  2K8H A;  1TBE A;  1P1A A;  3SV1 A;  3KSY A;  2DZK A;  4NNJ B;  1DDV A;  5J3T A;  3M95 A;  2VKI A;  4RM8 A;  4BVU C;  5HE2 A;  3ONS A;  4DHZ E;  2XQN M;  3GZN I;  4FJV B;  1V5U A;  4L6E A;  2N1V A;  5BO4 B;  1WR1 A;  4I6N B;  2BWF A;  1G6J A;  4KDI C;  4K7W A;  4HAZ B;  4IW0 A;  1UNP A;  4K1R B;  4GU2 A;  3HW2 B;  1Y8R C;  3UZT A;  2XEW A;  1E8X A;  2MBB B;  3ML9 A;  1KM7 A;  5GOW B;  2KWV B;  2HE7 A;  3VHT C;  4W9L A;  5CX3 A;  2R2O A;  2KTR B;  3A8P A;  3QX1 A;  1YX5 B;  3L13 A;  3RZW C;  1UBI A;  2GCJ A;  4EUT A;  2GBJ A;  2K8C A;  1LQB A;  1UPQ A;  1LB1 A;  3EPY A;  2BWE S;  3CIK A;  4DX8 A;  4GIV A;  5IJM A;  1FHW A;  4KIK B;  2G35 A;  5KCV A;  4AUQ C;  2MBE A;  1WF9 A;  4PQ0 A;  1WGR A;  4W9J A;  2CKH B;  4W9K A;  1PMS A;  3KH0 A;  3N30 A;  2KUP A;  3NZS A;  5DPT A;  2C7H A;  1C1Y B;  2J0J A;  2WX1 A;  1WR6 E;  3MHS D;  2FCN A;  2JF5 A;  4MDK E;  2LVP A;  1WJ1 A;  1ZVR A;  2FJL A;  1LM8 B;  1AQC A;  4HAU B;  2R09 A;  4W9G A;  3WAP A;  1P98 A;  3TBL D;  2O6V A;  2JRI B;  2P0D A;  1J0W A;  2N1W A;  2KLC A;  5C23 A;  2KWU B;  1U5D A;  1W1H A;  3IG3 A;  2Z59 B;  2PPH A;  1MIZ B;  4HB2 B;  5HKH A;  1M7E A;  1X05 A;  2KLG A;  3V62 A;  2N9P C;  1V5O A;  3OJ4 B;  4MT7 A;  4B6W A;  2KN5 A;  5L95 C;  2MWN B;  1WXV A;  4LDT B;  2AL6 A;  1FB8 A;  3PVL A;  1V81 A;  2DYM A;  2BPS A;  4GN1 A;  4K2O A;  4LDT D;  2KJ6 A;  3KRX A;  1NTY A;  3JYU A;  2L8J A;  3VIA A;  1L2N A;  1MG8 A;  1UPR A;  4N9F 4;  1Q67 A;  1U5G A;  1AWE A;  2CU1 A;  3A9K A;  3NS8 A;  5D3Y A;  4W9D A;  2KK8 A;  2NBU A;  1P3Q U;  1WGQ A;  4BBN C;  2CY5 A;  1GNU A;  3A4S C;  3L0W B;  3P7Z A;  1WXA A;  4KSK C;  4IWO A;  4HJK A;  1VCB A;  2DYQ A;  3APC A;  5KQ4 A;  4K17 A;  4ANW A;  3UIO B;  2G45 B;  1UNQ A;  3TMP B;  2CRF A;  4BKG A;  4A20 A;  3QA8 A;  1NVL A;  1ZC4 B;  4GOC A;  1WZ3 A;  1WFY A;  1WJ6 A;  1H8C A;  3TJP A;  2LG1 A;  2GBN A;  2RLO A;  4HAT B;  4A5K A;  3UQA A;  2N7E A;  3MTN B;  1WX7 A;  2VSZ A;  5CHV C;  3ZKJ C;  4XX5 A;  2QKM A;  3M3J A;  2BGF A;  1NBF C;  4GSW A;  3ZW3 A;  5D2M B;  1MIX A;  3RYT A;  1LW3 A;  2MKR A;  2L7R A;  2KTF A;  3L08 A;  3ZVR A;  2KX0 A;  3VVW B;  1EF5 A;  5AZH A;  3PEG A;  5DI9 B;  1KZ7 A;  4IWP A;  4JIO U;  5DPW A;  2IO3 B;  3ALB A;  2K39 A;  4ANX A;  3ZNZ B;  2I5C A;  3R7Q A;  4A6F B;  5C5B B;  1HE8 A;  2GOW A;  2A5U A;  1MK9 B;  2CB8 A;  5J2R A;  1D3Z A;  3BIN A;  1S3S G;  2DHK A;  3A9K B;  1P5T A;  3SHQ A;  3PHX B;  2L0T A;  5KHQ A;  2KHW B;  4II2 B;  3VDZ A;  1ZKH A;  4WAA A;  1J0G A;  3D8F A;  3JSV B;  2NBV B;  1QZE A;  1X11 A;  4HPL B;  2RNR B;  3VTU A;  1ISN A;  1P9D U;  4NJ7 A;  1TQZ A;  4AOF A;  1H4R A;  1XOD A;  3ULC A;  2DYB A;  2L0F A;  4HB3 B;  4MEM A;  2BYE A;  3DOW A;  5E6O A;  1I35 A;  2RPQ A;  2RQ1 A;  2EMS A;  2ZCC A;  3PZD A;  2DAF A;  3OJ3 A;  1E8Y A;  2MRP A;  1X1M A;  3AJ4 A;  4GB9 A;  4GPT B;  4NQL B;  3H7S A;  5FI0 A;  4F7U P;  2NPT B;  2DHI A;  1Y19 B;  2N4F A;  4MEL A;  1KOT A;  2YF0 A;  2KQ7 A;  4Z2M B;  1YX6 B;  3EHV A;  1ST7 A;  1K5G B;  1E5W A;  4LJP B;  3PVW A;  4EMO A;  1PFJ A;  5EDS A;  2W2X D;  4F8C B;  3ODW A;  3V6E B;  3QIJ A;  3SUZ A;  3RUL A;  2Y5B B;  1UNR A;  2W2W A;  2BKF A;  4F7G A;  1IRS A;  3ZDM C;  4F7Z A;  2COF A;  4OVU A;  4ANU A;  3PVU A;  1BTK A;  4MGZ E;  2I1K A;  1F9J A;  4HB4 B;  1DBH A;  3A33 B;  3OAN A;  2JRH A;  1CMX B;  2DYN A;  1WX8 A;  2H7E A;  2M8S A;  4NQK E;  4HCN B;  2MFQ A;  2YLM A;  1FAO A;  1N3H A;  1UEF A;  2NS5 A;  3ZUN A;  3KRW A;  5D3V A;  4ANV A;  4JGH B;  1K5D B;  3PV1 A;  1EO6 A;  3ZNH B;  4KHO A;  3QAR A;  2OJR A;  1XR0 B;  1XKE A;  4GDL A;  2MBO A;  3FLV A;  2A4Z A;  2LYD A;  3APD A;  2D4Q A;  2REX A;  1UH6 A;  2DFK A;  2COP A;  4BKS D;  2HRJ A;  2AYO B;  4EZL A;  3IHP C;  2ADZ A;  2BYF A;  4NSW A;  1RJ2 A;  1DRO A;  1RLF A;  4M8N A;  2MP2 B;  1T0Y A;  2ZJD A;  4WJN A;  3MPX A;  2KX3 A;  3FSS A;  1KI1 B;  1DDW A;  5J3Y A;  1WGY A;  2KOX A;  1I7A A;  3V6C B;  3T9L A;  2YT1 A;  3VUX A;  3M63 B;  4PYU A;  2HD5 B;  2PZ1 A;  1SE9 A;  1XT9 B;  5IAA C;  1P0R A;  4C0A A;  2J0K A;  3ML8 A;  2RR9 A;  2MDX A;  1WVH A;  2H7D A;  2LGX A;  4DBB A;  3L54 A;  2KMA A;  1IP9 A;  2LVQ A;  2FNJ B;  2YS1 A;  2C5L C;  2FCS A;  2ZNV B;  1WGU A;  3EC8 A;  4BFR A;  3VTV A;  4E3C A;  3DCG A;  3C0R B;  2LXA A;  4K2P A;  1OQN A;  3W1S A;  5CTR C;  3QQ8 B;  3A98 B;  3WYF B;  2LI5 A;  2CY4 A;  1OEY A;  2KVR A;  2ZPN A;  3BJI A;  4J6I A;  1GC6 A;  4RMA A;  3B0A A;  4JQW C;  2V76 A;  1DYN A;  3GOE A;  4EEW A;  2KDE B;  2COA A;  3DQV A;  2DZI A;  1XQQ A;  1X86 A;  4MM3 A;  4TQ1 A;  2GJY A;  2FCQ A;  4URK A;  5J18 A;  4GDL B;  1OY2 A;  3DBH I;  1KLV A;  2YSZ A;  2OQB A;  4GDK A;  2D10 A;  1WH3 A;  2CQU A;  2ELA A;  2K6Q A;  2MLB A;  3SO6 A;  1V49 A;  3PHW B;  2Z0E B;  1YD8 U;  3ENE A;  1XD4 A;  5JLJ B;  1WXS A;  2DHZ A;  2UYZ B;  2EC1 A;  4IWQ A;  2CAY A;  3DXE A;  1U4A A;  4MSQ B;  1SGH A;  3T06 A;  4ZDV A;  2JY6 A;  2NCN A;  5KHO A;  4NAW B;  3TCA A;  3RZF A;  4LCD E;  2J59 M;  2I1J A;  3V61 A;  1WMH A;  4TQ0 A;  2IY1 B;  5DCN A;  2MWS B;  2JWZ A;  3CSF A;  2M1M A;  5C6R A;  4PYZ A;  2XBB C;  5E6N A;  2KC1 A;  3UF8 A;  1OEY J;  2DKP A;  5JHH A;  4WWP A;  2EKE C;  2LVO A;  2KFK A;  2L3Z A;  4X57 B;  4EFO A;  1OQY A;  2JT4 B;  3WAO A;  2KFJ A;  3O65 B;  3U8Z A;  3PTF C;  2PE6 B;  1WIA A;  2I5F A;  3X23 A;  1B55 A;  5C16 A;  3M62 B;  1OTR B;  1K8R B;  1FGY A;  4G3X B;  5D3W A;  2LJ5 A;  3B08 A;  1WM2 A;  4IFS A;  3QCA A;  5DH9 B;  2GCL A;  4Y94 A;  1WGG A;  4KDL B;  2Y7B A;  2K2U A;  2KXJ A;  1A5R A;  1PLS A;  4FHK A;  3EFU A;  2IZV B;  2KNB A;  2L76 A;  2KJR A;  3FM8 C;  1JRU A;  2LRU A;  3MDB C;  2D11 A;  3QAQ A;  2D07 B;  4AP4 C;  2RGF A;  2N9X A;  1OGW A;  3CST A;  3DXC A;  5EFX A;  2LUE A;  3KUC B;  1E8Z A;  3U7D A;  2KJH B;  4I6P A;  1W1D A;  4IM2 A;  3ZNG C;  3KY9 A;  3PLU A;  4ZYN A;  3TO1 A;  3ODX A;  4W9I A;  4F7H A;  2W2X C;  3NOB A;  2DLW A;  4EOY A;  3QHT A;  1WMH B;  1NI2 A;  2DX1 A;  4HAY B;  2O6V B;  5JP4 A;  2L2I A;  1DDM A;  1YJ1 A;  2O6V D;  4FJY A;  5C1Z A;  4WWO A;  5D94 A;  3WAM A;  2LD9 A;  4MJS A;  1V88 A;  3HQC A;  2GBM A;  2R2Q A;  1KJT A;  2ZCB A;  1OMW A;  5HE3 A;  1WX9 A;  5FR6 A;  1W1G A;  4RM9 A;  2DHJ A;  3F5R A;  1V5P A;  4EZK A;  2Y8G A;  4ZRJ A;  2LKO A;  1TJ6 A;  2V1Y A;  1YIW A;  5CLL B;  1ACA A;  5CHF A;  3N7C A;  4HXD A;  3LJ3 A;  3S2A A;  3ECI A;  4EZJ A;  5GMV A;  2DN6 A;  2KO3 A;  4KZC A;  3WA0 A;  1M7R A;  1J19 A;  1ZM0 A;  3HK0 A;  3APF A;  1WG7 A;  2L05 A;  3LDZ E;  1GJZ A;  3VOQ A;  2GBR A;  3TW1 A;  3DPD A;  4IAP A;  3VXW A;  3VH3 B;  4W9C A;  3NZU A;  2Z0D B;  1ZSQ A;  2L1C A;  4KV2 A;  2MA9 B;  2IO1 B;  2XK5 A;  4WJQ A;  1RRP B;  4JL9 A;  2D9W A;  2DZJ A;  2KCJ A;  1PQS A;  4W9F A;  2JVC A;  2KZR A;  1H10 A;  3HIZ A;  1U2B A;  2KAN A;  3QWM A;  2LOZ A;  2NR2 A;  3ZTC A;  2Z0Q A;  1V86 A;  4A3O A;  4KZ0 A;  3N32 A;  1U5E A;  3NHE B;  2C60 A;  2AEH A;  1C3T A;  2NBW B;  2G4S A;  3RCZ A;  4DWF A;  3VUY A;  1FOE A;  2ZNV C;  1EGX A;  2VRW B;  2UZR A;  3KYC D;  3NY5 A;  1EF1 A;  1EAZ A;  2P0H A;  1U27 A;  2K1F A;  2YVC A;  4A6K A;  3A9J A;  2JPH A;  2B3A A;  4KHA A;  2JZ3 B;  4XWX A;  3WAL A;  4YON A;  3P6A A;  1V2Y A;  4FHJ A;  1GUA B;  3SNH A;  2YT0 A;  2RSG A;  1RRB A;  2N7D A;  4BKT A;  3L17 A;  2K00 A;  3RD2 A;  2ZVO A;  3KW5 B;  4E74 A;  3T8M A;  3F0W A;  2IBI B;  4K7U A;  1I2H A;  3D8E A;  5D7G A;  1HB6 A;  5J3Q A;  3QWZ B;  4G11 A;  3DBL I;  4G0N B;  2D9Y A;  2KDI A;  4B95 A;  1LXD A;  1E7V A;  2PJH A;  5JHB A;  4ICV A;  3ZRC A;  3PRZ A;  3ZTD A;  2KTR A;  4WJP A;  1E8W A;  4WJ7 A;  2Z0P A;  2XK5 B;  1WJU A;  1NTV A;  5HE1 A;  5D27 A;  5L81 A;  4GGQ A;  4TV3 A;  3PSE B;  3N3K B;  4WWN A;  2LUL A;  2WDT B;  4GMV A;  2JUO A;  3DVG Y;  3DDC B;  1XX0 A;  2LWP A;  2MCN B;  1IPG A;  4FA6 A;  3SYX A;  1IYF A;  4XC2 A;  1BAK A;  1WZ0 A;  2QKL A;  4G50 A;  1MKE A;  4IUM B;  3GYP A;  1NTI A;  5JH5 C;  5LOP B;  3SD5 A;  3QJZ A;  4AJY B;  3JVZ X;  3A9J B;  3HM3 A;  4BBN F;  4PNK A;  2ROV A;  1WGH A;  3D32 A;  4FN2 A;  2MX2 A;  1M94 A;  4CYE A;  2FID A;  1WY8 A;  4ZRK A;  1V80 A;  3Q3F A;  2RSU A;  4TUU A;  4P7I A;  2ROZ B;  1BWN A;  1AAR A;  4CHK A;  1FGZ A;  2JP2 A;  2GBK A;  2EJ8 A;  1LFD A;  3LJU X;  1V9J A;  1E90 A;  1NU2 A;  2K6D B;  5C79 A;  3PPA A;  3H6N A;  4FJZ A;  2KGX B;  3W1Y A;  3M1I B;  2V4L A;  3PT2 B;  5D3X A;  4HPM B;  2K8B A;  2IYD B;  4DXA B;  2E2X A;  3ML4 A;  4HAW B;  4HAX B;  1NDD A;  2PE9 A;  3KYD D;  2RGN B;  2P8V A;  4FUL A;  5LLI A;  1V61 A;  2C9W B;  4NJ6 A;  1J8C A; 
#chains in the Genus database with same CATH topology
 5LXI B;  1WRD B;  2N0Y A;  1CK1 A;  3IBE A;  5FI1 A;  2M0A A;  4IC7 B;  2KWC A;  2FDQ A;  2L52 A;  3SFD B;  1IBX A;  1ZXI A;  2W55 A;  2OJW A;  1P3R A;  4DHZ B;  4AS1 A;  4JK9 A;  4HRO A;  1NEK B;  4C4V A;  3NJT A;  4DX9 0;  1Q5W B;  5IKC M;  4L23 A;  2LBB A;  4UDU C;  1N63 A;  1UD7 A;  3MC8 A;  1KC7 A;  5G2N A;  4AJW A;  5IN7 A;  2ZKM X;  4LNI A;  3FP5 A;  3U30 A;  2KC2 A;  4DXG A;  4ASW C;  1ZPS A;  4HHV A;  2BF8 B;  3NS1 A;  2ZW1 A;  1V5M A;  3IAS 1;  2KMC A;  2UVM A;  2M17 A;  4BBK A;  3DVG X;  3GYO A;  4K7S A;  2ZEQ A;  2PIA A;  3ODO A;  2RPV A;  3B77 A;  1V5T A;  1BT0 A;  2KDF B;  1U29 A;  2SEB D;  4DHJ B;  2LEK A;  4JLC A;  5DHF B;  1RFA A;  1R4N I;  3Q14 C;  3PG7 A;  3I3T B;  1RAX A;  3QC8 B;  4DHJ D;  4F1S A;  2DX5 A;  4WQM A;  3OAW A;  5EE0 A;  2DTC A;  3O96 A;  1MAI A;  1Z5S B;  2W9N A;  4RGO S;  1TGZ B;  1MK7 B;  2ELB A;  4K81 A;  2JZZ A;  2O2V A;  4MH0 E;  5JHG A;  3RUI B;  4FAD A;  5LXH A;  2WXJ A;  4ZRI A;  4ILG B;  3P42 A;  3EUB 2;  2GI9 A;  3QK0 A;  2MJE A;  2CHZ A;  2YS3 A;  1XEE A;  4II3 B;  4CHM A;  3NSU A;  3MFG A;  1ROE A;  1TS4 A;  1KLU D;  4K3C A;  2AL3 A;  4MSM B;  4GZU A;  3IAM 1;  1U5F A;  3VTW A;  2DKQ A;  2IO2 B;  5FK9 C;  1SJH D;  2YEP F;  3P2B A;  3CF6 E;  4HSI A;  4OVZ A;  5G5H A;  2Q13 A;  2W82 A;  2BCJ A;  1UBQ A;  4GOU A;  1TZO A;  3ZDT A;  2LGY A;  4BOZ B;  2WQY B;  1GOZ A;  2AQ2 B;  2MQJ A;  2LZ6 A;  2C7N B;  2EKI A;  4KAX B;  2GB1 A;  2M4N A;  2ZVN A;  4LJO B;  1ZUD 2;  3DVN U;  2HTM E;  1MHX A;  1Q1O A;  1WJN A;  2EEL A;  4WJO A;  5TR5 A;  1SIF A;  2CS4 A;  1CJE A;  5AZF A;  3PRM B;  4B9K A;  4TYZ A;  1KF6 B;  2COC A;  3ZLZ A;  4JKD A;  2D9Z A;  4MGK E;  1ZYI A;  3HM6 X;  4MM3 B;  1L5P A;  3Q3J A;  1JWS D;  3NVW A;  5KQ1 A;  3O13 A;  3ZRF A;  3H1U A;  3VUW A;  3DHH C;  4A6F A;  1UEL A;  3A1Q A;  5C5B A;  1SHC A;  4GDK B;  4DBG A;  3PP2 A;  4KHB B;  4PS3 A;  3ZIM A;  3BY4 B;  4GXB A;  2DZM A;  3OLM D;  3ZNI D;  4C4V B;  2BKR B;  3C19 A;  1WI1 A;  3GB1 A;  2D9V A;  1SE3 A;  1MPH A;  2WXL A;  1R4M I;  2D2Q A;  4C00 A;  4A6H A;  2KKC A;  3AN1 A;  3RNC C;  3A58 A;  3JSV A;  2AQ3 B;  2D5G A;  2G3Q B;  2NBV A;  4DDI D;  1QQG A;  2IND C;  3KVF B;  1L4D B;  3NRZ A;  3VQI A;  4IM0 A;  2P0F A;  3SU8 X;  2I38 A;  2M0X A;  4HAV B;  4DK5 A;  2WWZ A;  2DEN B;  1WE7 A;  1NYQ A;  2LGD A;  2CR5 A;  3TL5 A;  5AEK B;  1FHX A;  2N23 A;  2DX5 B;  1JRP A;  5IP4 D;  1P7E A;  3U7Z A;  2MBH A;  4MGI E;  3PS6 A;  1N5W A;  5DPR A;  3MJW A;  3CIR B;  3H8H A;  2KT7 A;  3WIM A;  2M38 A;  3AXC A;  2O2V B;  2DYO A;  2MW5 A;  2V3S A;  2HJ8 A;  2WYQ A;  2OOB B;  2C7M B;  3N1X C;  3UIP B;  5AUI A;  4GMX B;  3DBR I;  1V6E A;  2DA0 A;  2BTE A;  3FEH A;  1S1Q B;  5DHA B;  3BII D;  3V60 A;  3UQB A;  2OHF A;  2LGS A;  2INC C;  1L0X B;  1WM3 A;  2J7Q B;  1QOF A;  4KSL C;  1VLB A;  1ACC A;  3R2I A;  2YS5 A;  1FCC C;  1FM0 D;  2QHO A;  2WDV B;  2NPT A;  3RNA C;  3PGE A;  4IKG A;  1HZ5 A;  3DVN V;  2KFK B;  4MK0 A;  4W9E A;  2D3G A;  4M01 A;  4WQO B;  4KVG B;  1TJE A;  4NPN A;  1FXT B;  1VZ6 A;  2AWT A;  3TFM A;  4H8S A;  2FAZ A;  1SF0 A;  1NEN B;  4MY6 A;  2LMC A;  4OZB A;  1WYW B;  1GC7 A;  4HLE A;  2W3S A;  5L83 A;  3LYY A;  2OED A;  3NG0 A;  3AUL A;  1Q0W B;  2KD0 A;  3ZO5 B;  3Q8E A;  4XWW A;  1KZG A;  1D5Z C;  2NZ8 B;  3TIX A;  5I2S A;  3K9P B;  4HDO A;  3URY A;  3AE6 B;  2WX0 A;  1N62 A;  1VZ7 A;  1JWA D;  1TTN A;  2Y8F A;  5BMH A;  4CO7 A;  3SFE B;  4FBJ B;  1MVK A;  3ZVV A;  1VD2 A;  1V89 A;  1FNU A;  4RFB A;  2HTH A;  4ICU A;  3AU5 A;  3A8Q A;  4Z2N A;  2EMT A;  3AI5 A;  3K9O B;  1MPE A;  2DLB A;  3A1Q B;  3DBL B;  4ZRP A;  3R66 C;  2RUK B;  3BWU D;  3IFW B;  2H88 B;  3VH4 B;  4TKN A;  2WP9 B;  1XCG A;  1ZW7 A;  2KDB A;  5E6P A;  4ITK A;  2WS3 B;  4W9H A;  1UWM A;  3GE8 C;  3DWG C;  2LAS A;  1B1Z A;  1TYG B;  2K2J A;  2K25 A;  2LXC A;  1WJ4 A;  3RT3 B;  1Z2M A;  4IM3 A;  4HDQ A;  1WRI A;  3FAH A;  3ZYY X;  3DBS A;  4HWI B;  3SDL C;  5IA7 A;  3RNB C;  2OTX A;  1N61 A;  5HE0 A;  2N7J A;  2G4D B;  4WIP A;  2ZPY A;  2GS0 A;  4M0W B;  1WI0 A;  3PRP B;  1Y56 A;  1TS2 A;  4I6L B;  4HK2 A;  4CHJ A;  1GGO A;  3DCX A;  1FHO A;  4HCP B;  2K3U A;  3R7R A;  1L7Y A;  3H7P A;  4E71 A;  4JKB A;  5AZG A;  2DNF A;  4YTP B;  2VZK B;  3KWV A;  1X1F A;  3KUD B;  1SEB D;  4BKS A;  2MSE D;  2VZK D;  2FJ9 A;  4ZHP A;  2UZS A;  2VRR B;  4CQN A;  3V5W A;  1EUV B;  3PSC A;  1WGD A;  1WXM A;  2Q5W D;  2QC8 A;  1GAQ B;  1SBB B;  4MJS B;  2FCM A;  1TZ1 A;  2GMI C;  4RGT A;  5DIF B;  1P6S A;  2QSD A;  3UGB B;  4EJN A;  3RI7 C;  2MP2 A;  1WXQ A;  2PEA A;  3UIN B;  2WXO A;  4FXC A;  2HJ1 A;  2YRY A;  4P1B C;  2RRF A;  5DPS A;  2X18 A;  4AWJ A;  2KQS A;  2LRW A;  4IOY X;  4KKJ A;  1ZGU B;  5JZE B;  2BYV E;  2LOX A;  1UZX B;  3AEF B;  4HVB A;  3QBV B;  3HHM A;  5G55 A;  2R0D A;  3D8D A;  2PLP A;  3IT4 B;  4PS8 A;  3H9D A;  5JHA A;  3IVF A;  1EU4 A;  1V1O A;  3VFK A;  2K22 A;  5CHW A;  1X1G A;  1T5X D;  2FIF A;  2QCZ A;  4J3O D;  3JW0 X;  2HTH B;  1ZC3 B;  3FC4 A;  2ZZP B;  2RDG A;  1PDX A;  4B6H A;  2RMM A;  3R8B A;  4MGY E;  4YL8 A;  4EKU A;  1N60 A;  3NUH B;  4PS7 A;  5J17 A;  4NY0 A;  3KUZ A;  5G5G A;  5TSS A;  3ZJT A;  3UI3 A;  3VAW A;  3G9W A;  3DXD A;  2JWU A;  2CJN A;  4GNK B;  2RVB B;  4WVF B;  4FLH A;  3WAN A;  2NVU I;  3R3M A;  3Q3M C;  3RCP A;  1JWU D;  1EVH A;  2KN4 A;  2ABD A;  4BOS C;  4XWT A;  1I42 A;  2RD0 A;  5LON B;  2MBQ A;  2ASQ A;  1YQB A;  2K49 A;  5MPO A;  4AQ7 A;  2J0M A;  1Z87 A;  2KWD A;  3AEG B;  2JXX A;  3PLV A;  1DOX A;  1HBK A;  5CLQ B;  2DAJ A;  3RNF C;  2WH5 A;  4M8M A;  1V8C A;  1WJM A;  3L16 A;  1NI3 A;  3B1L X;  4OVV A;  4DDG D;  4O1N A;  1ZP0 B;  3RNE C;  4D0N B;  1WE6 A;  2COD A;  1C79 A;  3H7P B;  3NWD A;  3ULB A;  3EGR A;  1BTN A;  1UNS A;  3A4R A;  1VBH A;  1TY0 A;  4XZ4 A;  1TT5 B;  2IYB A;  1UGM A;  4HB0 B;  1L4Z B;  2M14 A;  2D9X A;  2INP E;  3L10 B;  4A3P A;  1I4R A;  1C4C A;  3E9P A;  2V3N A;  4KIK A;  1HB8 A;  2IFS A;  3KZ1 A;  4XYC A;  4LNN A;  1C9F A;  2FUH B;  1J7B A;  3ABV B;  1XD3 B;  3MP9 A;  3X0W A;  3EEC A;  4RF0 A;  1PGX A;  3NZ3 A;  1Y5O A;  4TSS A;  1D5X C;  3NWF A;  2CHX A;  2K5P A;  4IG7 B;  5D6J B;  1GG3 A;  1F77 A;  2CHW A;  3R2T A;  1E7U A;  2N9E B;  5FR3 A;  3PRE A;  1IGC A;  2UWQ A;  2IY0 B;  1F2R C;  3W1S C;  4WSF A;  3AU4 A;  2Z14 A;  2Z0O A;  1FXA A;  3CXB B;  1TXD A;  1QC6 A;  3CMM B;  4NAW A;  1I4P A;  2K0P A;  3BYT B;  4JPS A;  2NMB A;  2IO0 B;  2ZW0 A;  2L00 B;  2WXM A;  3TVV A;  2K8H A;  1TBE A;  2FE8 A;  1P1A A;  3SV1 A;  3KSY A;  2DZK A;  4NNJ B;  1DDV A;  1TS3 A;  1KTK A;  5J3T A;  2ONQ A;  2JU6 X;  3M95 A;  1V1P A;  2WLB A;  2VKI A;  4RM8 A;  4BVU C;  5HE2 A;  3ONS A;  4XE0 A;  4DHZ E;  4KKI A;  2XQN M;  1LGR A;  3GZN I;  4FJV B;  1V5U A;  4L6E A;  2N1V A;  1TY2 A;  5BO4 B;  1WR1 A;  4I6N B;  1VR9 A;  2BWF A;  1G6J A;  1ET9 A;  1UGJ A;  4K7W A;  4JKG B;  4KDI C;  4HAZ B;  4IW0 A;  1UNP A;  4K1R B;  1XLO A;  4GU2 A;  1FO4 A;  2FUG 1;  1L0V B;  1PUT A;  3HW2 B;  1Y8R C;  1EM7 A;  5LNK 1;  3UZT A;  2XEW A;  1E8X A;  2MBB B;  3ML9 A;  1KM7 A;  2WXG A;  5GOW B;  2KWV B;  2HE7 A;  2R82 A;  2J53 A;  2KVZ A;  3VHT C;  1DOY A;  4W9L A;  5CX3 A;  2R2O A;  2KTR B;  5EE3 A;  1QLB B;  3NVZ A;  4MH8 A;  3A8P A;  4A8X C;  3QX1 A;  1YX5 B;  3L13 A;  3RZW C;  1R4M B;  1UBI A;  2GCJ A;  4EUT A;  1MI1 A;  2GBJ A;  2K8C A;  1LQB A;  1C77 A;  1UPQ A;  4WWM A;  4JKE A;  1LB1 A;  1EU3 A;  3EPY A;  2BWE S;  3CIK A;  4QXA B;  4DX8 A;  4HPP A;  4GIV A;  4XGA B;  1FNV A;  5IJM A;  2MH7 A;  1FHW A;  4KIK B;  2L83 A;  2G35 A;  5KCV A;  3P1M A;  4AUQ C;  2MBE A;  1WF9 A;  4PQ0 A;  2IDY A;  3BYY B;  3SR6 A;  4JWS C;  1WGR A;  1KLG D;  4W9J A;  2JSV X;  2CKH B;  3DBR B;  1JCK B;  3GS2 A;  1PMS A;  3KH0 A;  3N30 A;  4W9K A;  2KUP A;  4MT5 A;  3NZS A;  1C4A A;  5DPT A;  2C7H A;  4M00 A;  1C1Y B;  2J0J A;  2K8E A;  1QQR A;  2KAC A;  2WX1 A;  1WR6 E;  3MHS D;  2FCN A;  2MEK A;  3N9Y C;  2JF5 A;  4MDK E;  1E10 A;  4GLS C;  2WGS A;  3T3O A;  4BAX A;  2LVP A;  1WJ1 A;  1YQ3 B;  1ZVR A;  2IPK D;  2FJL A;  2R2Y A;  2DBY A;  1LM8 B;  1AQC A;  4HAU B;  4YSY B;  2WU5 B;  2R09 A;  1BML C;  4OZC A;  4W9G A;  2VH1 A;  3PO0 A;  3Q8B A;  3WAP A;  1TS5 A;  1P98 A;  3TBL D;  2O6V A;  2JRI B;  2B76 B;  2P0D A;  3VRA B;  1FNW A;  1XLN A;  1J0W A;  4C7Z A;  2N1W A;  2KLC A;  5C23 A;  2KWU B;  1U5D A;  1W1H A;  3IG3 A;  1RWS A;  4YXD B;  1NYR A;  2Z59 B;  2PPH A;  1MIZ B;  3KLS X;  1PGB A;  4KX6 B;  4HB2 B;  1I7H A;  5HKH A;  1M7E A;  1FRR A;  2V9H A;  3E9L A;  1X05 A;  2KLG A;  3V62 A;  2N9P C;  3ZGZ A;  1B9R A;  1V5O A;  3OJ4 B;  4MT7 A;  5IRS A;  2KN5 A;  4B6W A;  4RNA A;  5L95 C;  2MWN B;  1WXV A;  4LDT B;  2AL6 A;  1FB8 A;  3PVL A;  1V81 A;  1I4Q A;  2DYM A;  5IO9 A;  2BPS A;  4GN1 A;  4K2O A;  3BZD B;  4LDT D;  3W2D A;  3MJ5 A;  3AEA B;  2KJ6 A;  2NTT A;  1FFU A;  2K9X A;  3KRX A;  1NTY A;  1MG4 A;  2L8J A;  3VIA A;  3JYU A;  1QF6 A;  1TKG A;  3T3N A;  1IBX B;  4S17 A;  1L2N A;  1MG8 A;  1UPR A;  4N9F 4;  2LHE A;  1P7F A;  1Q67 A;  3I9V 1;  1U5G A;  2V0G A;  1RM6 C;  3CWI A;  3VRB B;  1AWE A;  2BS3 B;  2CU1 A;  4USA A;  3A9K A;  1OQQ A;  2MJ3 A;  3W9C B;  5BYS A;  1T3Q A;  2W54 A;  2N9L A;  1AW7 A;  1R7S A;  2QJL A;  3NS8 A;  2UU7 A;  5D3Y A;  2JXT A;  3HUI A;  3AED B;  4L1B A;  4W9D A;  5BMG A;  2KK8 A;  4YSZ B;  2NBU A;  3HSA A;  1JAL A;  3GP7 A;  1I4H A;  1P3Q U;  4WUR A;  1WGQ A;  4BBN C;  2CY5 A;  5I4D A;  1GNU A;  3A4S C;  1WYG A;  4XDD A;  3L0W B;  3BVG A;  4PT5 A;  3BVZ A;  2PVO D;  3P7Z A;  1HQR D;  2G9H D;  4RCO A;  2CJO A;  4ZYS A;  3P4Q B;  4LLG M;  3ZQ4 A;  1WXA A;  4KSK C;  2GRI A;  4IWO A;  4HJK A;  1VCB A;  2DYQ A;  3APC A;  4HEA 1;  5KQ4 A;  4K17 A;  1GB4 A;  4JKC A;  4ANW A;  2IJ0 A;  3SBT A;  3UIO B;  2G45 B;  1UNQ A;  2V4I B;  3TMP B;  2CRF A;  3FKY A;  4BKG A;  2WNM A;  3U52 E;  2ON8 A;  4A20 A;  3I57 A;  3QA8 A;  1M4V A;  2FJU B;  3U12 A;  1NVL A;  1ZC4 B;  4N59 A;  4GOC A;  1WZ3 A;  1QKZ A;  1WFY A;  1WJ6 A;  1H8C A;  3TJP A;  2LG1 A;  2GBN A;  2LJI A;  3Q69 A;  1SE4 A;  1QOA A;  3N1Y C;  2RLO A;  4HAT B;  4A5K A;  3UQA A;  5D3D A;  2CU3 A;  2N7E A;  3MTN B;  1WX7 A;  1PFD A;  2VSZ A;  5CHV C;  3ZKJ C;  1YOV B;  4XX5 A;  2QKM A;  3SEB A;  3M3J A;  1ESF A;  2BGF A;  1HZ6 A;  1NBF C;  4GSW A;  3ZW3 A;  4ARI A;  1Q10 A;  5D2M B;  1MIX A;  3RYT A;  1LW3 A;  2MKR A;  2L7R A;  4C80 A;  2KTF A;  3L08 A;  3ZVR A;  2KX0 A;  3VVW B;  1EF5 A;  5AZH A;  3PEG A;  5DI9 B;  3FVC A;  1KZ7 A;  3V3X A;  4MAC A;  4JKH A;  2PMV A;  2BQQ A;  4IWP A;  4JIO U;  5DPW A;  2IO3 B;  5H92 C;  3ALB A;  3E66 A;  2K39 A;  4M02 A;  4JKF A;  3ZNZ B;  2I5C A;  4ANX A;  3R7Q A;  4A6F B;  4K3B A;  5C5B B;  1HE8 A;  1L6V A;  2GOW A;  2A5U A;  1MK9 B;  2CB8 A;  5J2R A;  5E6J A;  4US8 A;  1FMA D;  4REZ A;  2WXP A;  1D3Z A;  4YTM B;  3BIN A;  3HVD A;  1KH0 A;  1S3S G;  2J4X A;  2DHK A;  3A9K B;  4EE2 A;  1P5T A;  3SHQ A;  3B2G A;  1YN4 A;  3PHX B;  2L0T A;  3V05 A;  5KHQ A;  2KHW B;  4II2 B;  2FBW B;  1SXT A;  3VDZ A;  1ZKH A;  4WAA A;  1J0G A;  3D8F A;  1I4G A;  3JSV B;  1E9M A;  2GUM A;  2NBV B;  1QZE A;  1X11 A;  4HPL B;  2RNR B;  3VTU A;  1ISN A;  1P9D U;  4NJ7 A;  1TQZ A;  4NJC A;  4AOF A;  1H4R A;  1XOD A;  4KGS A;  3ETR A;  3ULC A;  2KQ4 X;  3U2S C;  2DYB A;  2L0F A;  4HB3 B;  1JWM D;  4MEM A;  1YJI A;  2BYE A;  3DOW A;  5E6O A;  1I35 A;  2RPQ A;  4S0R A;  2RQ1 A;  4JK8 A;  2EMS A;  2ZCC A;  3PZD A;  2DAF A;  3OJ3 A;  2I2Y A;  3DWM A;  5HFY A;  1E8Y A;  3B2F A;  5GXG B;  2MRP A;  1X1M A;  3ZXR A;  3AJ4 A;  4DIX A;  4GB9 A;  4GPT B;  4NQL B;  3H7S A;  5FI0 A;  4F7U P;  2GLS A;  1BXT A;  2NPT B;  2DHI A;  2PW9 A;  4JX1 C;  2G1E A;  1Y19 B;  3B9J A;  2N4F A;  4MEL A;  1KOT A;  2YF0 A;  3PZ8 A;  2KQ7 A;  4Z2M B;  1YX6 B;  3EHV A;  1ST7 A;  1K5G B;  1E5W A;  4LJP B;  3PVW A;  2SAK A;  3TEX A;  5BYR A;  4EMO A;  1PFJ A;  5EDS A;  2W2X D;  4DQO C;  4F8C B;  3ODW A;  3V6E B;  1XLQ A;  3L4P A;  2RDB C;  1GB1 A;  3QIJ A;  3SUZ A;  3RUL A;  2Y5B B;  5BYQ A;  1UNR A;  2W2W A;  3GZN B;  5EE9 A;  2BKF A;  1IGD A;  4F7G A;  1IRS A;  3ZDM C;  4F7Z A;  2COF A;  4OVU A;  4ANU A;  2X8X X;  3PVU A;  1BTK A;  4MGZ E;  2I1K A;  2JYE A;  1F9J A;  5D3I B;  3RMK C;  4HB4 B;  1DBH A;  1JQ4 A;  4JK7 A;  3A33 B;  4P1C C;  1XCT L;  2BB6 A;  3Q3O C;  3OAN A;  2JRH A;  1CMX B;  2DYN A;  2Y5C A;  1VRA B;  1WX8 A;  2H7E A;  3IT6 B;  2M8S A;  4NQK E;  4HCN B;  2MFQ A;  2PVG C;  2YLM A;  1FAO A;  5BMI A;  3AV8 A;  4JWU C;  3BK2 A;  3ZXV A;  1N3H A;  3E9O A;  1UEF A;  2NS5 A;  4IOI E;  3ZUN A;  3KRW A;  4OZA A;  5D3V A;  3AH7 A;  4ANV A;  4JGH B;  1K5D B;  2KR0 A;  3AE1 B;  3PV1 A;  1EO6 A;  2KIE A;  2WXK A;  3ZNH B;  4KHO A;  3QAR A;  2OJR A;  1ZDX A;  1TKY A;  1XR0 B;  4NAM A;  1XKE A;  1NVI D;  3PZ7 A;  4GDL A;  2MBO A;  3P63 A;  3FLV A;  1K52 A;  1RFK A;  2A4Z A;  2LYD A;  1R4N B;  2KAJ A;  3EA6 A;  3AE7 B;  3P4R B;  3APD A;  2D4Q A;  2REX A;  2PTL A;  1UH6 A;  1F0Z A;  2DFK A;  2COP A;  1FEH A;  4BKS D;  2HRJ A;  2AYO B;  4RH6 A;  3FIL A;  4EZL A;  3IHP C;  2ADZ A;  2BYF A;  3RFZ B;  4NSW A;  1RJ2 A;  1DRO A;  1RLF A;  4M8N A;  1E7P B;  1SIJ A;  2MP2 B;  1T0Y A;  2W3R A;  2ZJD A;  4WJN A;  2KUQ A;  3MPX A;  2KX3 A;  4YTN B;  2J42 A;  3FSS A;  1KI1 B;  2H89 B;  1JRO A;  4C7Y A;  1DDW A;  5J3Y A;  1WGY A;  2KOX A;  1I7A A;  4QAY A;  5I2M A;  3V6C B;  3T9L A;  4WAF A;  2YT1 A;  1DGJ A;  3VUX A;  3M63 B;  3W5V B;  4PYU A;  2WXI A;  4RF1 A;  2HD5 B;  2PZ1 A;  1SE9 A;  1XT9 B;  5JXV A;  3NWA A;  5IAA C;  1P0R A;  4C0A A;  2J0K A;  3ML8 A;  4JE3 B;  2RR9 A;  2MDX A;  1WVH A;  2H7D A;  1E6E B;  2LGX A;  3VR8 B;  2Z13 A;  4DBB A;  1XCQ L;  3L54 A;  2X38 A;  1HEZ E;  2KMA A;  1IP9 A;  2LVQ A;  2FNJ B;  2YS1 A;  3ZJV A;  1UF0 A;  2C5L C;  2FCS A;  5C3J B;  2ZNV B;  1WGU A;  3EC8 A;  4BFR A;  3VTV A;  5HI1 A;  3VR9 B;  4E3C A;  3AEC B;  1VDV A;  3DCG A;  2BW2 A;  3C0R B;  2LXA A;  3OWE B;  4K2P A;  3Q3N C;  1OQN A;  3W1S A;  4L1R A;  2WXQ A;  5CTR C;  2KDM A;  4CSQ A;  2JZP A;  3Q8A A;  3QQ8 B;  2IGG A;  3A98 B;  1JW9 D;  3WYF B;  1FRD A;  2LI5 A;  3DHI C;  2CY4 A;  1ENF A;  3HVZ A;  1OEY A;  4A90 A;  1FXI A;  1T0Q C;  2KVR A;  2Y3A A;  2ZPN A;  3BJI A;  2E3T A;  4J6I A;  1T0S C;  1GC6 A;  2AX5 A;  4RMA A;  3B0A A;  4JQW C;  2V76 A;  1DYN A;  3GOE A;  4EEW A;  2KDE B;  2COA A;  3DQV A;  2QIE B;  2D3C A;  2DZI A;  2L32 A;  1XQQ A;  1X86 A;  1YN5 A;  4MM3 A;  4TQ1 A;  2GJY A;  2FCQ A;  2Y5P A;  3U4E G;  4URK A;  4HJG E;  2PKO A;  5J18 A;  4GDL B;  3HIE A;  2R61 A;  1VBG A;  3KWL A;  3DHG C;  1D5M C;  1OY2 A;  3DBH I;  1KLV A;  4LNO A;  2YSZ A;  1D6E C;  2OQB A;  1STE A;  4GDK A;  4KHB A;  1V97 A;  2D10 A;  1WH3 A;  2CQU A;  2X0S A;  3FIL B;  2ELA A;  2K6Q A;  2MLB A;  3SO6 A;  1V49 A;  3PHW B;  1YJJ A;  2Z0E B;  1YD8 U;  2DIK A;  1YNT E;  3AB5 A;  3P4S B;  3AM9 A;  3ENE A;  1N5X A;  5IOI A;  1XD4 A;  5JLJ B;  1WXS A;  2DHZ A;  1J7C A;  4RGN A;  2UYZ B;  4ILJ A;  2EC1 A;  1K50 A;  4IWQ A;  4HRS A;  2CAY A;  3DXE A;  1U4A A;  2IGH A;  2KMM A;  4MSQ B;  4ARC A;  3OHM B;  1SGH A;  3T06 A;  1QIL A;  1TIF A;  2QIL A;  4ZDV A;  2JY6 A;  2NCN A;  5KHO A;  4NAW B;  3TCA A;  1CQV A;  4ZRQ A;  1DIK A;  3RZF A;  4ILH A;  4LCD E;  3AE2 B;  1KRH A;  2J59 M;  2I1J A;  3LB8 C;  3V61 A;  2WHI A;  3Q2A C;  1WMH A;  4TQ0 A;  2IY1 B;  5DCN A;  2AQ1 B;  1OFF A;  2MWS B;  2JWZ A;  4LK0 M;  3CSF A;  2M1M A;  5C6R A;  4PYZ A;  1V1P B;  2XBB C;  5E6N A;  2KC1 A;  3UF8 A;  1OEY J;  2D3A A;  2DKP A;  5JHH A;  4WWP A;  2EKE C;  2LVO A;  1C76 A;  2KFK A;  1PYW D;  2L3Z A;  3MC9 A;  4X57 B;  4EFO A;  1OQY A;  2JT4 B;  3GE3 C;  3WAO A;  2KFJ A;  3O65 B;  3U8Z A;  3PTF C;  2PE6 B;  1WIA A;  1PGA A;  2I5F A;  3X23 A;  1IUE A;  1B55 A;  1E0Z A;  5C16 A;  3M62 B;  1OTR B;  3N1Z C;  1K8R B;  4ZHO A;  1FGY A;  4G3X B;  5D3W A;  2LJ5 A;  3B08 A;  4ACF A;  1FPY A;  1WM2 A;  4IFS A;  2KIG A;  2XNA C;  3QCA A;  2L1A A;  5DH9 B;  3TEW A;  2GCL A;  4Y94 A;  1WGG A;  4KDL B;  2M56 B;  2KYW A;  2Y7B A;  2K2U A;  2KXJ A;  3LXF A;  1A5R A;  3RNG C;  1PLS A;  4FHK A;  3EFU A;  1BUI C;  2IZV B;  2KNB A;  1AWD A;  2L76 A;  1VZ8 A;  2KJR A;  3FM8 C;  4B0M A;  2M19 A;  1JRU A;  1SB3 C;  1HTO A;  2LRU A;  3MDB C;  3TEZ A;  4KGR A;  1L6U A;  2D11 A;  2MHJ A;  3QAQ A;  2D07 B;  2QDF A;  1T77 A;  4AP4 C;  2RGF A;  2N9X A;  1OGW A;  3CST A;  3AE5 B;  3DXC A;  5EFX A;  4OSN A;  2LUE A;  1J7A A;  3KUC B;  4RGM A;  1E8Z A;  3U7D A;  2KJH B;  3EFC A;  4M0W A;  4I6P A;  1W1D A;  4PK1 A;  5FKA C;  4IM2 A;  1JML A;  3ZNG C;  3KY9 A;  1A70 A;  3PLU A;  4ZYN A;  2TSS A;  2BB5 A;  3TO1 A;  2WDR B;  2N9K A;  3ODX A;  4W9I A;  3N20 C;  4F7H A;  2W2X C;  3NOB A;  1ZDV A;  2DLW A;  1FIQ A;  4DXF A;  2NMQ A;  4EOY A;  3QHT A;  1WMH B;  4NZL B;  1NI2 A;  2DX1 A;  3BK1 A;  4N58 A;  4HAY B;  2O6V B;  5JP4 A;  2L2I A;  1DDM A;  1YJ1 A;  2O6V D;  4FJY A;  5C1Z A;  4WWO A;  1XXG A;  5D94 A;  1WSP A;  3WAM A;  2LD9 A;  4MJS A;  1JWB D;  1V88 A;  3HQC A;  2GBM A;  2R2Q A;  1KJT A;  3AEE B;  2ZCB A;  1OMW A;  3TSS A;  5HE3 A;  1LO5 D;  1WX9 A;  4QJ4 B;  5FR6 A;  1W1G A;  4RM9 A;  2DHJ A;  3F5R A;  1V5P A;  1F2R I;  4EZK A;  2Y8G A;  4ZRJ A;  2LKO A;  1TJ6 A;  3TUO A;  2V1Y A;  1YIW A;  1C78 A;  5CLL B;  3MC0 B;  1ACA A;  3AMZ A;  5CHF A;  3N7C A;  4HXD A;  1F1H A;  3LJ3 A;  3S2A A;  3ECI A;  4EZJ A;  5GMV A;  2DN6 A;  2KO3 A;  4KZC A;  3WA0 A;  4YWG G;  1EWY C;  1FCL A;  1M7R A;  1J19 A;  1ZM0 A;  3HK0 A;  3APF A;  1N6Z A;  2LGI A;  1L0Y B;  1WG7 A;  2L05 A;  3LDZ E;  1GJZ A;  3VOQ A;  4US9 A;  2GBR A;  5H8Y E;  3W5U B;  3IXS A;  3TW1 A;  3DPD A;  1ZOY B;  4YSX B;  4IAP A;  3VXW A;  3VH3 B;  4W9C A;  3NZU A;  2Z0D B;  1DOI A;  1ZSQ A;  2L1C A;  1FD6 A;  4KV2 A;  3Q8C A;  2MA9 B;  2IO1 B;  3ZJU A;  2LHD A;  1I4X A;  2XK5 A;  4QJ3 B;  1AN8 A;  4WJQ A;  1RRP B;  4JL9 A;  4L2Y A;  2D9W A;  2DZJ A;  2KCJ A;  1PQS A;  3MHZ A;  4W9F A;  1UUP A;  2JVC A;  2KZR A;  1H10 A;  3HIZ A;  1U2B A;  2KAN A;  2Z4D A;  3QWM A;  1JDE A;  3OG5 A;  4OT1 A;  2LOZ A;  1YN3 A;  2NR2 A;  1SE2 A;  1XO3 A;  3SBG A;  3ZTC A;  4WH4 A;  2Z0Q A;  1V86 A;  4A3O A;  3NVV A;  4KZ0 A;  3N32 A;  1T6B X;  2QMT A;  1U5E A;  1QOG A;  5C2T B;  3NHE B;  2BT6 A;  2C60 A;  2AEH A;  2LFI A;  2NBW B;  1C3T A;  2G4S A;  3HRD D;  4OHJ A;  3AE4 B;  3RCZ A;  4DWF A;  4R3D A;  3VUY A;  1FOE A;  4BZA A;  3Q6B A;  2ZNV C;  1EGX A;  2VRW B;  2UZR A;  2YT2 A;  3KYC D;  2WDQ B;  3NY5 A;  1EF1 A;  1SJE D;  1EAZ A;  2P0H A;  1MJD A;  4N6E B;  1U27 A;  1KFY B;  1SSN A;  4HKZ E;  2K1F A;  1HTQ A;  2YVC A;  4A6K A;  2V3P A;  2D3B A;  2N0S B;  3A9J A;  3TEY A;  2JQR B;  1EWC A;  2JPH A;  2B3A A;  4KHA A;  2DWQ A;  2JZ3 B;  4XWX A;  3WAL A;  2Z8L A;  4YT0 B;  4YON A;  3P6A A;  5AUK A;  1V2Y A;  1MHH E;  3C8Y A;  4FHJ A;  1GUA B;  3SNH A;  2XN9 C;  1OQR A;  2YT0 A;  2RSG A;  4D6W A;  1RRB A;  2N7D A;  4BKT A;  3L17 A;  4B0E A;  2K00 A;  3RD2 A;  2ZVO A;  3KW5 B;  4HKQ A;  4E74 A;  2QEJ C;  3T8M A;  4LNK A;  1GPX A;  5JVL A;  2WXF A;  3F0W A;  2IBI B;  3NVY A;  4K7U A;  4JKG A;  3WCQ A;  2JX5 A;  1KBL A;  1K51 A;  1I2H A;  2ICI A;  4JKA A;  1CZP A;  3D8E A;  3E9S A;  5D7G A;  1QT9 A;  1FFV A;  3P4P B;  1HB6 A;  1UWX A;  4C56 C;  5J3Q A;  1WGK A;  1QOB A;  3QWZ B;  4G11 A;  2E6X A;  2RDH A;  3DBL I;  3DBH B;  4G0N B;  2D9Y A;  2KDI A;  3RPF C;  4B95 A;  2INN E;  1WWT A;  4P16 A;  1LXD A;  2MJD A;  1E7V A;  2PJH A;  4OW0 A;  3RN9 C;  2JYT A;  4ICV A;  3ZRC A;  5JHB A;  3PRZ A;  3ZTD A;  2KTR A;  4WJP A;  1E8W A;  4WJ7 A;  2Z0P A;  2XK5 B;  4Q2J A;  1WJU A;  1NTV A;  3AE3 B;  1ZXH A;  5HE1 A;  5D27 A;  5L81 A;  4GGQ A;  3Q8F A;  4A9A A;  4TV3 A;  3PSE B;  4ZOH C;  3N3K B;  4WWN A;  3E56 A;  2LUL A;  2WDT B;  4GMV A;  2JUO A;  3DVG Y;  4TMA B;  3DDC B;  1XX0 A;  2IGD A;  4P6V F;  2LUM A;  2LWP A;  1YMH E;  4LTU A;  1RYJ A;  1TKE A;  2MCN B;  1MI0 A;  2WU2 B;  1IPG A;  4FA6 A;  3SYX A;  1IYF A;  2NTS A;  4XC2 A;  5HHD G;  2YEP B;  4A55 A;  1ZE3 D;  1BAK A;  1WZ0 A;  2QKL A;  4G50 A;  1MKE A;  4IUM B;  1K53 A;  2WXN A;  4LNF A;  1VJK A;  3GYP A;  1NTI A;  1C4P A;  5JH5 C;  5LOP B;  1ET6 A;  1T0R C;  3SD5 A;  3QJZ A;  1MFW A;  1F52 A;  3KQ4 A;  2BS4 B;  3ENB A;  4AJY B;  3JVZ X;  5T8I A;  3A9J B;  3HM3 A;  4H2A A;  4BBN F;  1HXY D;  5HG2 A;  3I63 C;  1HA5 A;  3NW8 A;  4PNK A;  2ROV A;  1WGH A;  3D32 A;  4FN2 A;  2MX2 A;  1M94 A;  1XLP A;  3AEB B;  4CYE A;  2FID A;  1WY8 A;  4ZRK A;  4QJ5 B;  2J52 A;  5EE1 A;  1V80 A;  3Q3F A;  5LG4 B;  2RSU A;  4D2K A;  3AE9 B;  4TUU A;  4P7I A;  2ROZ B;  1BWN A;  2VH2 A;  1AAR A;  4IDI A;  1D4B A;  2WXR A;  2Z59 A;  4CHK A;  4A6Q A;  1FGZ A;  2JP2 A;  2GBK A;  3J9C A;  2EJ8 A;  1LFD A;  3LJU X;  1V9J A;  2BS2 B;  1E90 A;  1DYQ A;  1NU2 A;  1AYF A;  2K6D B;  5C79 A;  3I5J C;  5M4Y B;  3PPA A;  3H6N A;  4XDC A;  4FJZ A;  4KGT A;  3BVM A;  2HDE A;  2WXH A;  1XF5 L;  2KGX B;  3W1Y A;  2ACZ B;  3M1I B;  2BBC A;  2V4L A;  1YQ4 B;  3PT2 B;  5D3X A;  2BVC A;  4HPM B;  2K8B A;  2IYD B;  4DXA B;  2E2X A;  3ML4 A;  4HAW B;  4HAX B;  1NDD A;  2PE9 A;  3AE8 B;  3KYD D;  2RGN B;  2P8V A;  4FUL A;  5LLI A;  2BYT A;  1V61 A;  2C9W B;  4NJ6 A;  1J8C A; 
#chains in the Genus database with same CATH homology
 5LXI B;  1WRD B;  2N0Y A;  3IBE A;  5FI1 A;  4IC7 B;  2KWC A;  2FDQ A;  1P3R A;  4DHZ B;  4JK9 A;  4DX9 0;  1Q5W B;  2LBB A;  1UD7 A;  1KC7 A;  5G2N A;  4AJW A;  3FP5 A;  3U30 A;  2KC2 A;  4ASW C;  4HHV A;  2BF8 B;  1V5M A;  2KMC A;  2UVM A;  2M17 A;  4BBK A;  3DVG X;  3GYO A;  4K7S A;  2ZEQ A;  3ODO A;  1V5T A;  1BT0 A;  2KDF B;  1U29 A;  4DHJ B;  4JLC A;  5DHF B;  1RFA A;  1R4N I;  3PG7 A;  3I3T B;  1RAX A;  3QC8 B;  4DHJ D;  4F1S A;  2DX5 A;  3OAW A;  2DTC A;  3O96 A;  1MAI A;  1Z5S B;  2W9N A;  1TGZ B;  1MK7 B;  2ELB A;  4K81 A;  2JZZ A;  4MH0 E;  2O2V A;  5JHG A;  3RUI B;  4FAD A;  5LXH A;  4ZRI A;  4ILG B;  3QK0 A;  2CHZ A;  2YS3 A;  4II3 B;  4CHM A;  3NSU A;  2AL3 A;  4MSM B;  4GZU A;  1U5F A;  3VTW A;  2DKQ A;  2IO2 B;  3P2B A;  3CF6 E;  2Q13 A;  2BCJ A;  1UBQ A;  3ZDT A;  2LGY A;  4BOZ B;  2MQJ A;  2LZ6 A;  2C7N B;  4KAX B;  2M4N A;  2ZVN A;  4LJO B;  3DVN U;  1Q1O A;  1WJN A;  4WJO A;  5TR5 A;  1SIF A;  2CS4 A;  5AZF A;  3PRM B;  4B9K A;  4TYZ A;  2COC A;  3ZLZ A;  4JKD A;  2D9Z A;  4MGK E;  3HM6 X;  3Q3J A;  5KQ1 A;  3ZRF A;  3H1U A;  3VUW A;  4A6F A;  1UEL A;  3A1Q A;  5C5B A;  1SHC A;  4GDK B;  4DBG A;  3PP2 A;  4KHB B;  4PS3 A;  3ZIM A;  3BY4 B;  4GXB A;  2DZM A;  3OLM D;  3ZNI D;  2BKR B;  1WI1 A;  2D9V A;  1MPH A;  1R4M I;  2D2Q A;  4A6H A;  2KKC A;  3JSV A;  2G3Q B;  4DDI D;  1QQG A;  3KVF B;  3VQI A;  4IM0 A;  2P0F A;  3SU8 X;  2M0X A;  4HAV B;  4DK5 A;  2WWZ A;  2DEN B;  1WE7 A;  2LGD A;  3TL5 A;  2CR5 A;  5AEK B;  1FHX A;  2N23 A;  2DX5 B;  2MBH A;  4MGI E;  3PS6 A;  5DPR A;  3MJW A;  3WIM A;  3AXC A;  2M38 A;  2O2V B;  2DYO A;  2MW5 A;  2V3S A;  2HJ8 A;  2WYQ A;  2OOB B;  2C7M B;  3UIP B;  4GMX B;  3DBR I;  1V6E A;  2DA0 A;  3FEH A;  1S1Q B;  5DHA B;  3V60 A;  3UQB A;  1WM3 A;  2J7Q B;  4KSL C;  2YS5 A;  2QHO A;  2NPT A;  3PGE A;  3DVN V;  2KFK B;  4MK0 A;  4W9E A;  2D3G A;  4WQO B;  4KVG B;  4NPN A;  1FXT B;  2AWT A;  3TFM A;  4H8S A;  2FAZ A;  4MY6 A;  1WYW B;  1GC7 A;  4HLE A;  5L83 A;  3AUL A;  1Q0W B;  2KD0 A;  3ZO5 B;  1KZG A;  2NZ8 B;  3TIX A;  3K9P B;  4HDO A;  2WX0 A;  1TTN A;  2Y8F A;  4CO7 A;  4FBJ B;  3ZVV A;  1VD2 A;  1V89 A;  2HTH A;  4ICU A;  3AU5 A;  3A8Q A;  4Z2N A;  2EMT A;  3AI5 A;  3K9O B;  3A1Q B;  3R66 C;  2RUK B;  3IFW B;  3VH4 B;  4TKN A;  1XCG A;  1ZW7 A;  2KDB A;  5E6P A;  4W9H A;  2LAS A;  2K2J A;  2K25 A;  2LXC A;  1WJ4 A;  3RT3 B;  1Z2M A;  4IM3 A;  4HDQ A;  3DBS A;  4HWI B;  3SDL C;  5IA7 A;  2OTX A;  5HE0 A;  2G4D B;  2ZPY A;  2GS0 A;  4M0W B;  1WI0 A;  3PRP B;  4I6L B;  4HK2 A;  4CHJ A;  1GGO A;  1FHO A;  4HCP B;  3R7R A;  1L7Y A;  3H7P A;  4E71 A;  4JKB A;  5AZG A;  1X1F A;  3KUD B;  4BKS A;  2MSE D;  2FJ9 A;  2UZS A;  2VRR B;  3V5W A;  1EUV B;  3PSC A;  1WGD A;  1WXM A;  4MJS B;  2FCM A;  1TZ1 A;  2GMI C;  5DIF B;  1P6S A;  3UGB B;  4EJN A;  2MP2 A;  2PEA A;  3UIN B;  2YRY A;  5DPS A;  2X18 A;  4AWJ A;  2KQS A;  2LRW A;  4IOY X;  1ZGU B;  5JZE B;  2BYV E;  2LOX A;  1UZX B;  4HVB A;  3QBV B;  3HHM A;  5G55 A;  2R0D A;  3D8D A;  4PS8 A;  3H9D A;  5JHA A;  3IVF A;  3VFK A;  5CHW A;  1X1G A;  2FIF A;  3JW0 X;  2HTH B;  1ZC3 B;  2ZZP B;  4B6H A;  4MGY E;  4YL8 A;  4EKU A;  4PS7 A;  5J17 A;  4NY0 A;  3KUZ A;  3VAW A;  3G9W A;  3DXD A;  2RVB B;  4WVF B;  4FLH A;  3WAN A;  2NVU I;  3R3M A;  3RCP A;  1EVH A;  2ABD A;  4BOS C;  1I42 A;  2RD0 A;  5LON B;  2MBQ A;  2ASQ A;  1YQB A;  2J0M A;  1Z87 A;  3PLV A;  2JXX A;  1HBK A;  5CLQ B;  2DAJ A;  2WH5 A;  4M8M A;  1WJM A;  3L16 A;  3B1L X;  4OVV A;  4DDG D;  4D0N B;  1WE6 A;  2COD A;  3H7P B;  3ULB A;  1BTN A;  3A4R A;  1VBH A;  4XZ4 A;  2IYB A;  1UGM A;  4HB0 B;  2M14 A;  2D9X A;  3L10 B;  4A3P A;  3E9P A;  4KIK A;  1HB8 A;  2IFS A;  3KZ1 A;  2FUH B;  1XD3 B;  3X0W A;  3EEC A;  1Y5O A;  2CHX A;  4IG7 B;  5D6J B;  1GG3 A;  2CHW A;  1E7U A;  2N9E B;  3PRE A;  2UWQ A;  2IY0 B;  3W1S C;  4WSF A;  3AU4 A;  2Z0O A;  3CXB B;  1TXD A;  1QC6 A;  3CMM B;  4NAW A;  2NMB A;  2IO0 B;  2L00 B;  3TVV A;  2K8H A;  1TBE A;  1P1A A;  3SV1 A;  3KSY A;  2DZK A;  4NNJ B;  1DDV A;  5J3T A;  3M95 A;  2VKI A;  4RM8 A;  4BVU C;  5HE2 A;  3ONS A;  4DHZ E;  2XQN M;  3GZN I;  4FJV B;  1V5U A;  4L6E A;  2N1V A;  5BO4 B;  1WR1 A;  4I6N B;  2BWF A;  1G6J A;  4KDI C;  4K7W A;  4JKG B;  4HAZ B;  4IW0 A;  1UNP A;  4K1R B;  4GU2 A;  3HW2 B;  1Y8R C;  3UZT A;  2XEW A;  1E8X A;  2MBB B;  3ML9 A;  1KM7 A;  5GOW B;  2KWV B;  2HE7 A;  2R82 A;  3VHT C;  4W9L A;  5CX3 A;  2R2O A;  2KTR B;  3A8P A;  3QX1 A;  1YX5 B;  3L13 A;  3RZW C;  1UBI A;  2GCJ A;  4EUT A;  2GBJ A;  2K8C A;  1LQB A;  1UPQ A;  4JKE A;  1LB1 A;  3EPY A;  2BWE S;  3CIK A;  4DX8 A;  4GIV A;  5IJM A;  1FHW A;  4KIK B;  2G35 A;  5KCV A;  4AUQ C;  2MBE A;  1WF9 A;  4PQ0 A;  1WGR A;  4W9J A;  2CKH B;  4W9K A;  1PMS A;  3KH0 A;  3N30 A;  2KUP A;  3NZS A;  5DPT A;  2C7H A;  1C1Y B;  2J0J A;  2WX1 A;  1WR6 E;  3MHS D;  2FCN A;  2JF5 A;  4MDK E;  2LVP A;  1WJ1 A;  1ZVR A;  2FJL A;  1LM8 B;  1AQC A;  4HAU B;  2R09 A;  4W9G A;  3WAP A;  1P98 A;  3TBL D;  2O6V A;  2JRI B;  2P0D A;  1J0W A;  2N1W A;  2KLC A;  5C23 A;  2KWU B;  1U5D A;  1W1H A;  3IG3 A;  2Z59 B;  2PPH A;  1MIZ B;  4HB2 B;  5HKH A;  1M7E A;  3E9L A;  1X05 A;  2KLG A;  3V62 A;  2N9P C;  1V5O A;  3OJ4 B;  4MT7 A;  4B6W A;  2KN5 A;  5L95 C;  2MWN B;  1WXV A;  4LDT B;  2AL6 A;  1FB8 A;  3PVL A;  1V81 A;  2DYM A;  2BPS A;  4GN1 A;  4K2O A;  4LDT D;  2KJ6 A;  3KRX A;  1NTY A;  3JYU A;  2L8J A;  3VIA A;  1L2N A;  1MG8 A;  1UPR A;  4N9F 4;  1Q67 A;  1U5G A;  1AWE A;  2CU1 A;  3A9K A;  3NS8 A;  5D3Y A;  4W9D A;  2KK8 A;  2NBU A;  1P3Q U;  1WGQ A;  4BBN C;  2CY5 A;  1GNU A;  3A4S C;  3L0W B;  3P7Z A;  1WXA A;  4KSK C;  4IWO A;  4HJK A;  1VCB A;  2DYQ A;  3APC A;  5KQ4 A;  4K17 A;  4JKC A;  4ANW A;  3SBT A;  3UIO B;  2G45 B;  1UNQ A;  3TMP B;  2CRF A;  4BKG A;  4A20 A;  3QA8 A;  1NVL A;  1ZC4 B;  4GOC A;  1WZ3 A;  1WFY A;  1WJ6 A;  1H8C A;  3TJP A;  2LG1 A;  2GBN A;  2RLO A;  4HAT B;  4A5K A;  3UQA A;  2N7E A;  3MTN B;  1WX7 A;  2VSZ A;  5CHV C;  3ZKJ C;  4XX5 A;  2QKM A;  3M3J A;  2BGF A;  1NBF C;  4GSW A;  3ZW3 A;  5D2M B;  1MIX A;  3RYT A;  1LW3 A;  2MKR A;  2L7R A;  2KTF A;  3L08 A;  3ZVR A;  2KX0 A;  3VVW B;  1EF5 A;  5AZH A;  3PEG A;  5DI9 B;  1KZ7 A;  4JKH A;  4IWP A;  4JIO U;  5DPW A;  2IO3 B;  3ALB A;  3E66 A;  2K39 A;  4JKF A;  3ZNZ B;  2I5C A;  4ANX A;  3R7Q A;  4A6F B;  5C5B B;  1HE8 A;  2GOW A;  2A5U A;  1MK9 B;  2CB8 A;  5J2R A;  1D3Z A;  3BIN A;  1S3S G;  2DHK A;  3A9K B;  1P5T A;  3SHQ A;  3PHX B;  2L0T A;  5KHQ A;  2KHW B;  4II2 B;  3VDZ A;  1ZKH A;  4WAA A;  1J0G A;  3D8F A;  3JSV B;  2NBV B;  1QZE A;  1X11 A;  4HPL B;  2RNR B;  3VTU A;  1ISN A;  1P9D U;  4NJ7 A;  1TQZ A;  4AOF A;  1H4R A;  1XOD A;  3ULC A;  2DYB A;  2L0F A;  4HB3 B;  4MEM A;  2BYE A;  3DOW A;  5E6O A;  1I35 A;  2RPQ A;  2RQ1 A;  4JK8 A;  2EMS A;  2ZCC A;  3PZD A;  2DAF A;  3OJ3 A;  1E8Y A;  2MRP A;  1X1M A;  3AJ4 A;  4GB9 A;  4GPT B;  4NQL B;  3H7S A;  5FI0 A;  4F7U P;  2NPT B;  2DHI A;  1Y19 B;  2N4F A;  4MEL A;  1KOT A;  2YF0 A;  2KQ7 A;  4Z2M B;  1YX6 B;  3EHV A;  1ST7 A;  1K5G B;  1E5W A;  4LJP B;  3PVW A;  4EMO A;  1PFJ A;  5EDS A;  2W2X D;  4F8C B;  3ODW A;  3V6E B;  3QIJ A;  3SUZ A;  3RUL A;  2Y5B B;  1UNR A;  2W2W A;  2BKF A;  4F7G A;  1IRS A;  3ZDM C;  4F7Z A;  2COF A;  4OVU A;  4ANU A;  3PVU A;  1BTK A;  4MGZ E;  2I1K A;  1F9J A;  4HB4 B;  1DBH A;  4JK7 A;  3A33 B;  3OAN A;  2JRH A;  1CMX B;  2DYN A;  1WX8 A;  2H7E A;  2M8S A;  4NQK E;  4HCN B;  2MFQ A;  2YLM A;  1FAO A;  1N3H A;  3E9O A;  1UEF A;  2NS5 A;  3ZUN A;  3KRW A;  5D3V A;  4ANV A;  4JGH B;  1K5D B;  3PV1 A;  1EO6 A;  3ZNH B;  4KHO A;  3QAR A;  2OJR A;  1XR0 B;  1XKE A;  4GDL A;  2MBO A;  3FLV A;  2A4Z A;  2LYD A;  3APD A;  2D4Q A;  2REX A;  1UH6 A;  2DFK A;  2COP A;  4BKS D;  2HRJ A;  2AYO B;  4EZL A;  3IHP C;  2ADZ A;  2BYF A;  4NSW A;  1RJ2 A;  1DRO A;  1RLF A;  4M8N A;  2MP2 B;  1T0Y A;  2ZJD A;  4WJN A;  3MPX A;  2KX3 A;  3FSS A;  1KI1 B;  1DDW A;  5J3Y A;  1WGY A;  2KOX A;  1I7A A;  3V6C B;  3T9L A;  2YT1 A;  3VUX A;  3M63 B;  4PYU A;  2HD5 B;  2PZ1 A;  1SE9 A;  1XT9 B;  5IAA C;  1P0R A;  4C0A A;  2J0K A;  3ML8 A;  2RR9 A;  2MDX A;  1WVH A;  2H7D A;  2LGX A;  4DBB A;  3L54 A;  2KMA A;  1IP9 A;  2LVQ A;  2FNJ B;  2YS1 A;  2C5L C;  2FCS A;  2ZNV B;  1WGU A;  3EC8 A;  4BFR A;  3VTV A;  4E3C A;  3DCG A;  3C0R B;  2LXA A;  4K2P A;  1OQN A;  3W1S A;  5CTR C;  3QQ8 B;  3A98 B;  3WYF B;  2LI5 A;  2CY4 A;  1OEY A;  2KVR A;  2ZPN A;  3BJI A;  4J6I A;  1GC6 A;  4RMA A;  3B0A A;  4JQW C;  2V76 A;  1DYN A;  3GOE A;  4EEW A;  2KDE B;  2COA A;  3DQV A;  2DZI A;  1XQQ A;  1X86 A;  4MM3 A;  4TQ1 A;  2GJY A;  2FCQ A;  4URK A;  5J18 A;  4GDL B;  1VBG A;  1OY2 A;  3DBH I;  1KLV A;  2YSZ A;  2OQB A;  4GDK A;  2D10 A;  1WH3 A;  2CQU A;  2X0S A;  2ELA A;  2K6Q A;  2MLB A;  3SO6 A;  1V49 A;  3PHW B;  2Z0E B;  1YD8 U;  2DIK A;  3ENE A;  1XD4 A;  5JLJ B;  1WXS A;  2DHZ A;  2UYZ B;  4ILJ A;  2EC1 A;  4IWQ A;  2CAY A;  3DXE A;  1U4A A;  4MSQ B;  1SGH A;  3T06 A;  4ZDV A;  2JY6 A;  2NCN A;  5KHO A;  4NAW B;  3TCA A;  1DIK A;  3RZF A;  4ILH A;  4LCD E;  2J59 M;  2I1J A;  3V61 A;  1WMH A;  4TQ0 A;  2IY1 B;  5DCN A;  2MWS B;  2JWZ A;  3CSF A;  2M1M A;  5C6R A;  4PYZ A;  2XBB C;  5E6N A;  2KC1 A;  3UF8 A;  1OEY J;  2DKP A;  5JHH A;  4WWP A;  2EKE C;  2LVO A;  2KFK A;  2L3Z A;  4X57 B;  4EFO A;  1OQY A;  2JT4 B;  3WAO A;  2KFJ A;  3O65 B;  3U8Z A;  3PTF C;  2PE6 B;  1WIA A;  2I5F A;  3X23 A;  1B55 A;  5C16 A;  3M62 B;  1OTR B;  1K8R B;  1FGY A;  4G3X B;  5D3W A;  2LJ5 A;  3B08 A;  1WM2 A;  4IFS A;  3QCA A;  5DH9 B;  2GCL A;  4Y94 A;  1WGG A;  4KDL B;  2Y7B A;  2K2U A;  2KXJ A;  1A5R A;  1PLS A;  4FHK A;  3EFU A;  2IZV B;  2KNB A;  2L76 A;  2KJR A;  3FM8 C;  1JRU A;  2LRU A;  3MDB C;  2D11 A;  3QAQ A;  2D07 B;  4AP4 C;  2RGF A;  2N9X A;  1OGW A;  3CST A;  3DXC A;  5EFX A;  2LUE A;  3KUC B;  1E8Z A;  3U7D A;  2KJH B;  4I6P A;  1W1D A;  4IM2 A;  3ZNG C;  3KY9 A;  3PLU A;  4ZYN A;  3TO1 A;  3ODX A;  4W9I A;  4F7H A;  2W2X C;  3NOB A;  2DLW A;  4EOY A;  3QHT A;  1WMH B;  1NI2 A;  2DX1 A;  4HAY B;  2O6V B;  5JP4 A;  2L2I A;  1DDM A;  1YJ1 A;  2O6V D;  4FJY A;  5C1Z A;  4WWO A;  5D94 A;  3WAM A;  2LD9 A;  4MJS A;  1V88 A;  3HQC A;  2GBM A;  2R2Q A;  1KJT A;  2ZCB A;  1OMW A;  5HE3 A;  1WX9 A;  5FR6 A;  1W1G A;  4RM9 A;  2DHJ A;  3F5R A;  1V5P A;  4EZK A;  2Y8G A;  4ZRJ A;  2LKO A;  1TJ6 A;  2V1Y A;  1YIW A;  5CLL B;  1ACA A;  5CHF A;  3N7C A;  4HXD A;  3LJ3 A;  3S2A A;  3ECI A;  4EZJ A;  5GMV A;  2DN6 A;  2KO3 A;  4KZC A;  3WA0 A;  1M7R A;  1J19 A;  1ZM0 A;  3HK0 A;  3APF A;  1WG7 A;  2L05 A;  3LDZ E;  1GJZ A;  3VOQ A;  2GBR A;  3TW1 A;  3DPD A;  4IAP A;  3VXW A;  3VH3 B;  4W9C A;  3NZU A;  2Z0D B;  1ZSQ A;  2L1C A;  4KV2 A;  2MA9 B;  2IO1 B;  2XK5 A;  4WJQ A;  1RRP B;  4JL9 A;  2D9W A;  2DZJ A;  2KCJ A;  1PQS A;  4W9F A;  2JVC A;  2KZR A;  1H10 A;  3HIZ A;  1U2B A;  2KAN A;  3QWM A;  1JDE A;  2LOZ A;  2NR2 A;  3SBG A;  3ZTC A;  2Z0Q A;  1V86 A;  4A3O A;  4KZ0 A;  3N32 A;  1U5E A;  3NHE B;  2C60 A;  2AEH A;  1C3T A;  2NBW B;  2G4S A;  3RCZ A;  4DWF A;  3VUY A;  1FOE A;  2ZNV C;  1EGX A;  2VRW B;  2UZR A;  3KYC D;  3NY5 A;  1EF1 A;  1EAZ A;  2P0H A;  1U27 A;  2K1F A;  2YVC A;  4A6K A;  3A9J A;  2JPH A;  2B3A A;  4KHA A;  2JZ3 B;  4XWX A;  3WAL A;  4YON A;  3P6A A;  1V2Y A;  4FHJ A;  1GUA B;  3SNH A;  2YT0 A;  2RSG A;  1RRB A;  2N7D A;  4BKT A;  3L17 A;  2K00 A;  3RD2 A;  2ZVO A;  3KW5 B;  4E74 A;  3T8M A;  5JVL A;  3F0W A;  2IBI B;  4K7U A;  4JKG A;  1KBL A;  1I2H A;  4JKA A;  3D8E A;  5D7G A;  1HB6 A;  5J3Q A;  3QWZ B;  4G11 A;  3DBL I;  4G0N B;  2D9Y A;  2KDI A;  4B95 A;  1LXD A;  1E7V A;  2PJH A;  5JHB A;  4ICV A;  3ZRC A;  3PRZ A;  3ZTD A;  2KTR A;  4WJP A;  1E8W A;  4WJ7 A;  2Z0P A;  2XK5 B;  1WJU A;  1NTV A;  5HE1 A;  5D27 A;  5L81 A;  4GGQ A;  4TV3 A;  3PSE B;  3N3K B;  4WWN A;  2LUL A;  2WDT B;  4GMV A;  2JUO A;  3DVG Y;  3DDC B;  1XX0 A;  2LWP A;  2MCN B;  1IPG A;  4FA6 A;  3SYX A;  1IYF A;  4XC2 A;  1BAK A;  1WZ0 A;  2QKL A;  4G50 A;  1MKE A;  4IUM B;  3GYP A;  1NTI A;  5JH5 C;  5LOP B;  3SD5 A;  3QJZ A;  3ENB A;  4AJY B;  3JVZ X;  3A9J B;  3HM3 A;  4BBN F;  4PNK A;  2ROV A;  1WGH A;  3D32 A;  4FN2 A;  2MX2 A;  1M94 A;  4CYE A;  2FID A;  1WY8 A;  4ZRK A;  1V80 A;  3Q3F A;  2RSU A;  4TUU A;  4P7I A;  2ROZ B;  1BWN A;  1AAR A;  4CHK A;  1FGZ A;  2JP2 A;  2GBK A;  2EJ8 A;  1LFD A;  3LJU X;  1V9J A;  1E90 A;  1NU2 A;  2K6D B;  5C79 A;  3PPA A;  3H6N A;  4FJZ A;  2KGX B;  3W1Y A;  3M1I B;  2V4L A;  3PT2 B;  5D3X A;  4HPM B;  2K8B A;  2IYD B;  4DXA B;  2E2X A;  3ML4 A;  4HAW B;  4HAX B;  1NDD A;  2PE9 A;  3KYD D;  2RGN B;  2P8V A;  4FUL A;  5LLI A;  1V61 A;  2C9W B;  4NJ6 A;  1J8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...