2EMTA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
313
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Radixin
publication title Structural basis of PSGL-1 binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
total genus 89
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emtA01
4W9LA 1V86A 3CXBB 5C1ZA 1OEYA 3L54A 3L17A 2B3AA 1C3TA 3QC8B 2DLWA 1PQSA 2N4FA 1J8CA 2D2QA 2J7QB 2M1MA 1XX0A 3TMPB 1UGMA 3B0AA 1M7RA 3TO1A 3KSYA 4A3PA 4DX8A 3U8ZA 1FGYA 3DBLI 4HCNB 4WJ7A 2KWUB 3PRMB 2DZIA 3PVWA 2RUKB 3VUWA 4GMXB 3JVZX 4X57B 4HWIB 1ZKHA 5DIFB 4KDIC 3PEGA 1WXVA 2V76A 3RYTA 3PP2A 3HQCA 4KHOA 3V5WA 3QAQA 1WXMA 2KOXA 2MX2A 4BBNF 1DBHA 4DBGA 3ZDTA 2O2VB 3SU8X 3A1QA 1H10A 4GPTB 2IZVB 3RCPA 1Z87A 2P0HA 1HBKA 2YF0A 1NVLA 4GDKA 2N9EB 2G4SA 1MK7B 2Z0OA 1TTNA 1RFAA 2DTCA 4A6HA 3KVFB 2IO0B 1LFDA 2KGXB 2FDQA 1OMWA 1Y5OA 2NPTA 5E6PA 3SV1A 3PTFC 3WAOA 2OJRA 4NPNA 5LXHA 1NBFC 3DVNU 1V81A 2L0FA 4WQOB 3V62A 4NQKE 3AI5A 1X11A 3ZDMC 2YLMA 4YL8A 1V5OA 2DAFA 3B1LX 5KCVA 2NBUA 1YX5B 2LRWA 1E7VA 3R3MA 1ZW7A 2KKCA 1EF1A 4I6NB 2AL6A 3N3KB 5AEKB 2ROZB 5C16A 2Q13A 4WJPA 1YIWA 1WMHA 4Y94A 2LVPA 2KWVB 4TQ0A 4TUUA 2KXJA 3UF8A 4WVFB 4HB4B 1X1MA 2I5FA 2L0TA 3QWZB 3DVGY 2ZCBA 2DENB 2BWFA 4K2PA 1MKEA 1T0YA 2Y8FA 4KZ0A 3APFA 1UEFA 3W1SA 4F8CB 3ZUNA 3MHSD 3PV1A 4LJOB 4LCDE 2OQBA 3WIMA 2V4LA 1ZSQA 1WM3A 1I7AA 3NZSA 4JGHB 4HB2B 2FIDA 2W2XD 5D94A 5HE0A 3DOWA 4TYZA 3IVFA 5GMVA 1F9JA 2L8JA 2L1CA 1P0RA 3OJ3A 2KC1A 4PS8A 2LULA 3NZUA 2BYEA 1P6SA 2N0YA 4DDGD 5KHOA 2YVCA 3ML4A 3DVGX 3BJIA 2J0KA 5TR5A 4KAXB 4KZCA 1WX9A 3APCA 3CSTA 4AUQC 3A8QA 4IM0A 1BT0A 2FAZA 3HHMA 1MG8A 2LXAA 1YJ1A 4URKA 3L08A 5FR6A 1XD4A 2FCQA 3PT2B 3VTWA 3JYUA 1TJ6A 5CX3A 4AP4C 5CLLB 4AJYB 4MJSB 3QCAA 1SGHA 4HB0B 3KW5B 3P2BA 1UELA 1WVHA 3HM6X 3JSVA 1AWEA 3L10B 1L7YA 4JL9A 2BPSA 1FXTB 2KX0A 2VSZA 1WJ4A 2KLCA 2L7RA 1DROA 2KNBA 4F7UP 5JH5C 3AJ4A 2LXCA 2RPQA 3V6EB 2ZPYA 3SYXA 3VUYA 2DYNA 4KVGB 4II2B 2IY0B 1OQYA 4GU2A 4K81A 2FCNA 1Z2MA 4PS7A 4XC2A 3ZTDA 1J0GA 2ABDA 2G3QB 2KK8A 1W1GA 4DBBA 2V3SA 1E8YA 5C5BA 2MSED 2LWPA 2QHOA 3BY4B 3VTUA 3RUIB 3ML9A 1H8CA 3T9LA 1UD7A 3UQAA 2DN6A 2DZKA 2LZ6A 4GGQA 2KFJA 2JT4B 1IRSA 4HPMB 1U4AA 3M3JA 3JSVB 3VAWA 2YRYA 1WJUA 1NDDA 1UZXB 1V89A 2JWZA 3ULCA 1XR0B 3QBVB 3QJZA 1WE7A 4D0NB 3OLMD 2X18A 4AWJA 5D3XA 2RVBB 1BWNA 3BINA 1WM2A 4DDID 3ZRFA 4EFOA 3VTVA 4HDQA 1FB8A 2BKFA 3Q3JA 3GYOA 4NJ7A 3L16A 3VXWA 1WRDB 5C5BB 2LOZA 5DPRA 3FP5A 1V2YA 3IG3A 2JPHA 5D7GA 2N9XA 5EFXA 2A4ZA 2A5UA 1UNQA 1E8ZA 2DYMA 3SO6A 2KLGA 3SUZA 1MIZB 5L81A 4NY0A 4ASWC 1NTYA 2E2XA 2ZNVB 2UYZB 2H7DA 2BWES 2CY5A 2D3GA 1ZGUB 3T8MA 2KMAA 2MBEA 2N23A 2CQUA 2QKLA 1VCBA 4GXBA 3DDCB 5DPSA 4F7ZA 1GUAB 3AU5A 4EMOA 4XZ4A 3ZW3A 2D9WA 2AEHA 1SE9A 2V1YA 3QQ8B 2G45B 3SNHA 2PJHA 1GG3A 2D07B 4NJ6A 2DAJA 3VOQA 5JHBA 3PVLA 2PZ1A 4PYZA 2MBQA 1HE8A 3GZNI 2JRHA 2IO3B 2DYOA 1VD2A 3DCGA 2DHZA 1A5RA 2YS3A 4M8MA 2ADZA 3ZKJC 2MWSB 2FJLA 2O2VA 1K5DB 4RMAA 4EKUA 2ROVA 1U29A 5DHAB 3PREA 4KHBB 1WGGA 1Q0WB 2NZ8B 2EMSA 2KD0A 2CAYA 4WWPA 3D8EA 2FJ9A 2CHWA 2NR2A 4NNJB 4BKSD 3VH4B 3H7PA 2L2IA 5CLQB 4FHKA 1WZ0A 2D4QA 3KRWA 2GJYA 2YSZA 2KDEB 1J19A 2L3ZA 3DVNV 3FM8C 3ODOA 2K2JA 3PLUA 4B6WA 3M63B 3IHPC 4GZUA 3A98B 5L95C 1XD3B 1UBIA 1QQGA 1E7UA 1U5DA 2RQ1A 3U7DA 4JQWC 1MPHA 3M1IB 2KQ7A 4CHJA 2LGYA 2IYDB 3DXEA 4L6EA 4K1RB 1OEYJ 2WH5A 3KYDD 2LVQA 4IC7B 2WYQA 2Y5BB 4H8SA 3LJUX 4HAZB 4IWOA 2ZVOA 2DYQA 3CF6E 5E6NA 1X05A 4EZJA 1P5TA 2D9XA 3MJWA 1WJNA 2Z0PA 2KANA 2JZ3B 3A4RA 2COAA 1YQBA 2LVOA 4CO7A 4I6LB 3RZFA 3MPXA 2KDBA 3U30A 3IFWB 1PLSA 2RSGA 4ANUA 4FADA 4HK2A 1V5MA 3KY9A 2J59M 1SHCA 4MY6A 3ENEA 4YONA 3H7PB 2GBNA 2BYFA 2K1FA 4BVUC 5J3TA 2GOWA 2LGDA 3CSFA 1RRPB 1Y8RC 3ODWA 1R4MI 2NBVB 2RNRB 2L05A 2KN5A 1N3HA 4K2OA 3TFMA 2GBKA 2UZRA 3WAPA 3PSCA 1U5GA 2O6VB 4WJQA 5DI9B 4HXDA 2W9NA 4FJZA 2R2OA 4A6FA 4RM9A 1MIXA 4GDLA 4K7WA 1K5GB 1WXAA 4A20A 2KO3A 1NU2A 1V9JA 3ZO5B 1EUVB 1WE6A 2H7EA 2NBWB 4LJPB 2BYVE 1P3QU 5KQ4A 2CU1A 4NAWB 4KHAA 2EJ8A 3T06A 2HE7A 4KSLC 2OTXA 3M95A 2LOXA 3WA0A 2C7NB 5FI0A 1XODA 2NVUI 4FLHA 2MCNB 2CHZA 2Z0QA 4MJSA 4A5KA 2WX0A 1U5FA 1WIAA 3SHQA 5LOPB 2LKOA 3FEHA 4WWOA 4IAPA 3GOEA 1M94A 2LYDA 2KFKA 1W1HA 4E74A 1HB6A 2M14A 4A6FB 1DDVA 4GDLB 2KDIA 2XQNM 2W2XC 2UVMA 2CB8A 2M17A 2ZVNA 4Z2NA 4MDKE 5HE3A 1Q5WB 3PVUA 1TGZB 3N32A 4W9DA 2N1VA 4HVBA 4B95A 3ECIA 4ANVA 4GN1A 2P0FA 2GBJA 4NQLB 2GBRA 1RLFA 3H1UA 4AOFA 2JF5A 2ZPNA 4BOSC 1V6EA 1XKEA 4BBNC 3H7SA 3LDZE 5JHHA 4W9GA 3QARA 2AWTA 2YS1A 3DPDA 3A33B 1WFYA 4IG7B 2HTHA 5LONB 3ML8A 4CHKA 3RT3B 3EFUA 1JRUA 3W1SC 3D8DA 4EJNA 2K6DB 1E90A 5AZGA 2CY4A 3ZVVA 3P6AA 4K17A 2G35A 1RRBA 3TL5A 4EUTA 1QC6A 2KFKB 4TV3A 1NTIA 2PE9A 2BF8B 3KRXA 4B6HA 2WDTB 4BFRA 2J0JA 1UPQA 2N7EA 4MGYE 5J17A 1J0WA 2MKRA 1UBQA 2DZMA 4C0AA 3QWMA 3AU4A 4IM2A 1IP9A 3N7CA 1G6JA 1B55A 1KZGA 3DQVA 2IY1B 4TQ1A 4IFSA 2LASA 1FAOA 3ZNZB 1BTNA 4WJNA 2K00A 4Z2MB 2GCLA 3ZIMA 4IW0A 2M4NA 2HTHB 4W9EA 1GC7A 1SIFA 1KLVA 2FUHB 2CHXA 3KUZA 1V88A 2R2QA 2LBBA 3H9DA 2DA0A 1KI1B 2I1JA 5HKHA 3UIOB 2N1WA 4WAAA 2COPA 3MDBC 3I3TB 3IBEA 2KJRA 1KM7A 3ALBA 2QKMA 2COCA 5DHFB 1WR6E 2IFSA 3K9PB 1MK9B 5D6JB 1WJ6A 3DXDA 2N9PC 3HK0A 2JP2A 3KZ1A 4MT7A 4TKNA 2K8CA 3UZTA 2KQSA 2KMCA 2DX5A 1YX6B 4GIVA 1WY8A 1FGZA 3HM3A 3WYFB 3VFKA 4PNKA 1M7EA 3M62B 1WZ3A 2LGXA 3SD5A 1GC6A 3NOBA 1EAZA 2YT1A 1P9DU 3PLVA 3EHVA 4MH0E 4FJYA 2ELBA 3VHTC 3OJ4B 3O65B 2KWCA 3L0WB 2JXXA 3NS8A 1WF9A 1OTRB 4WSFA 5DH9B 4ICUA 2LI5A 4A6KA 2KCJA 2GMIC 1GJZA 2M0XA 4EEWA 3RD2A 4ANWA 1IYFA 2FIFA 2KJHB 4BKSA 1LB1A 2D9ZA 1WJMA 3RCZA 2CODA 1FHWA 4FHJA 2G4DB 4ZDVA 2ELAA 1WGQA 1BTKA 2DX5B 2RSUA 2FNJB 1FOEA 2AL3A 4JLCA 4W9IA 3A8PA 1NI2A 4GSWA 3PSEB 3DBSA 1V49A 1L2NA 1U5EA 2MW5A 5HE2A 2LG1A 2K8BA 5L83A 1WX8A 2C60A 2FCMA 2EMTA 4HAYB 3DBRI 3WALA 2MDXA 2DFKA 5CHVC 1LW3A 4PS3A 1C1YB 4OVVA 3DXCA 3HIZA 1P3RA 1FHOA 4I6PA 3X23A 2LUEA 3A9KB 1WXSA 1AARA 2DKQA 5JHAA 1UNRA 2D9VA 5IAAC 3F0WA 5FI1A 3TCAA 1EF5A 5D3VA 5IJMA 3X0WA 1TQZA 4KV2A 3FLVA 3QHTA 4HCPB 3PZDA 3AXCA 3ZNID 3ODXA 2CRFA 4G50A 3APDA 2LRUA 3G9WA 2BCJA 1ISNA 2IO1B 4HLEA 1WGHA 4IOYX 2O6VA 2P8VA 1PFJA 3K9OB 3R66C 1X1GA 1V5UA 1WGYA 3KUDB 2EC1A 2PEAA 4DX90 1DYNA 5D27A 4GOCA 5D3WA 2M8SA 1OGWA 2R0DA 2MFQA 1P1AA 4BKTA 3QX1A 3JW0X 3PS6A 4AJWA 1WX7A 3L13A 2C5LC 2WX1A 4DWFA 3ONSA 3QIJA 2GBMA 4DK5A 5J3QA 1WI1A 2W2WA 4NAWA 5JLJB 1E5WA 2LD9A 4ZYNA 2MQJA 3UINB 4PQ0A 4WJOA 3EECA 2KC2A 1I35A 1TZ1A 1GNUA 1HB8A 2VRWB 2PE6B 3NHEB 4MGKE 1S3SG 3PPAA 4EZKA 2IO2B 3D32A 4BOZB 3WAMA 5J2RA 2O6VD 2JVCA 3V6CB 1R4NI 2IBIB 4ZRKA 1QZEA 3A4SC 4HAUB 4M0WB 4BBKA 4HJKA 4DHZE 5DPWA 1CMXB 4IM3A 3UIPB 1WGRA 3TJPA 3H6NA 2L00B 4FJVB 4LDTD 3A9JA 4G3XB 4DXAB 4LDTB 2HJ8A 3ZTCA 2C9WB 3TW1A 2GCJA 2JY6A 4BKGA 3EPYA 1WGDA 3VQIA 5JZEB 2RD0A 3OAWA 2WWZA 4KIKA 5G55A 3A1QB 3KH0A 3N30A 4PYUA 3R7RA 4W9CA 5KQ1A 1ZVRA 2I5CA 4GDKB 1EVHA 2YT0A 3B08A 2KUPA 1WR1A 2Z0DB 2R09A 3LJ3A 1H4RA 1WG7A 4MM3A 5CHWA 3ZNGC 4ZRJA 3R7QA 2CKHB 5IA7A 3UGBB 2KTRA 2PPHA 2NPTB 2DHJA 1WI0A 2ZZPB 4JIOU 2DZJA 5JHGA 2KJ6A 1XQQA 2ZCCA 5G2NA 3A9JB 1FHXA 4FULA 4CHMA 1KOTA 2MWNB 2RR9A 3PRPB 4EZLA 1U27A 2Y7BA 3PG7A 2DX1A 4W9KA 1WH3A 2AYOB 3C0RB 4KIKB 4G0NB 5D3YA 1WMHB 2DYBA 5AZFA 4IWQA 4CYEA 1TXDA 4HAWB 5DPTA 4RM8A 4ZRIA 2KHWB 2BKRB 5E6OA 4M8NA 3PGEA 1Y19B 2CR5A 4K7SA 3RULA 4OVUA 4HB3B 2KTRB 1I42A 3TIXA 3CIKA 2YS5A 1WGUA 1X1FA 1LM8B 2DKPA 3TBLD 2NCNA 2L76A 3Q3FA 4MEMA 2ZJDA 2VRRB 3D8FA 2EKEC 4WWNA 3CMMB 5CTRC 4XX5A 3P7ZA 3WANA 1DDMA 2HRJA 4E3CA 4HPLB 1LQBA 4K7UA 1UH6A 2DHIA 1KJTA 2COFA 1WYWB 2REXA 4FBJB 4IWPA 1TBEA 1V5PA 3UQBA 1LXDA 1Z5SB 3S2AA 3W1YA 1E8XA 2UWQA 1UNPA 3ZLZA 1EGXA 1V61A 1ZM0A 1RJ2A 2RGNB 2MP2A 4NSWA 5CHFA 4HHVA 4N9F4 2MBHA 5DCNA 5D2MB 3GYPA 3MTNB 2UZSA 3AULA 3PHWB 2K2UA 4DHZB 1Q67A 1YD8U 3VIAA 3VDZA 4FA6A 5C6RA 2KDFB 4IUMB 5HE1A 3VH3B 5JP4A 2K8HA 5BO4B 2C7MB 4A3OA 1EO6A 4MGZE 1DDWA 3PHXB 4MGIE 1NTVA 2K39A 5LLIA 2BGFA 2JUOA 4KSKC 4II3B 1S1QB 4P7IA 5KHQA 2C7HA 3NSUA 3VVWB 1IPGA 3OANA 5GOWB 3HW2B 2J0MA 2DHKA 4F7HA 2XK5A 4E71A 1WJ1A 2RGFA 2MA9B 4HAVB 5AZHA 1KZ7A 1U2BA 1MAIA 1D3ZA 3V61A 2MP2B 4W9HA 5EDSA 1W1DA 2ZEQA 5J3YA 3ZRCA 2LJ5A 4DHJD 4XWXA 1I2HA 4F1SA 1PMSA 1P98A 3A9KA 4MSMB 4DHJB 2MRPA 3EC8A 2ZNVC 2GS0A 1BAKA 1OY2A 3ULBA 2KZRA 5C23A 2Y8GA 4W9FA 2Z0EB 2D10A 2I1KA 3QK0A 3VUXA 4GB9A 1ACAA 1RAXA 2XEWA 2KTFA 2D9YA 2XBBC 2NS5A 4MSQB 2ASQA 2KX3A 1OQNA 2RLOA 3PRZA 2VKIA 2XK5B 2MBBB 2K6QA 3SDLC 1V5TA 4HDOA 4ICVA 2FCSA 3DBHI 3V60A 4ANXA 2NMBA 2N7DA 1K8RB 4G11A 4EOYA 3NY5A 4HATB 3ZNHB 2HD5B 1V80A 4B9KA 5C79A 3TVVA 2Z59B 4KDLB 1XT9B 4J6IA 2IYBA 2KVRA 2MLBA 3ZVRA 1ZC4B 2JRIB 1X86A 1UPRA 4MELA 3QA8A 2OOBB 2P0DA 2CS4A 3F5RA 3FSSA 2JZZA 3KYCD 4W9JA 5J18A 4MK0A 1ST7A 4HAXB 2D11A 3O96A 2M38A 1ZC3B 1Q1OA 4F7GA 1AQCA 1XCGA 2K25A 1E8WA 2MBOA 3RZWC 5LXIB 4GMVA 3KUCB 4FN2A
chains in the Genus database with same CATH superfamily
3J9CA 4W9LA 1V86A 3CXBB 5C1ZA 1OEYA 3L54A 4ITKA 3L17A 2B3AA 4D2KA 1C3TA 3QC8B 2DLWA 1PQSA 2N4FA 1J8CA 4YXDB 4M0WA 2D2QA 1PFDA 2J7QB 2M1MA 1XX0A 4JKCA 3TMPB 1UGMA 3B0AA 1TZOA 1M7RA 3EA6A 4KGRA 3TO1A 3KSYA 4A3PA 3E66A 4DX8A 3U8ZA 1XO3A 1FGYA 3DBLI 4HCNB 4WJ7A 2KWUB 3PRMB 1FXAA 2PKOA 2DZIA 3AN1A 1FRDA 3PVWA 2RUKB 3VUWA 4GMXB 3JVZX 4X57B 1DOYA 4HWIB 1ZKHA 5DIFB 4KDIC 2IJ0A 1KLUD 3PEGA 1NYRA 1WXVA 2V76A 3RYTA 3PP2A 3HQCA 4KHOA 3V5WA 2JSVX 3QAQA 1WXMA 2KOXA 1TT5B 5H92C 1XXGA 2MX2A 1DBHA 4BBNF 2KAJA 4DBGA 3ZDTA 4XWTA 2O2VB 1RWSA 3SU8X 4B0EA 3T3OA 1XF5L 3A1QA 1H10A 4GPTB 3ZQ4A 2IZVB 3RCPA 1Z87A 1MG4A 3IAS1 2P0HA 1HBKA 4L1RA 2YF0A 2E6XA 1NVLA 4REZA 4GDKA 3DCXA 2N9EB 4JKAA 2G4SA 1MK7B 3SBGA 2Z0OA 3BZDB 1TTNA 2QSDA 3A58A 1RFAA 2DTCA 4A6HA 3KVFB 2IO0B 1LFDA 2J53A 2KGXB 4L2YA 4AQ7A 2FDQA 2WXIA 1EWCA 4K3BA 1OMWA 1Y5OA 2NPTA 5E6PA 3SV1A 1NI3A 1VLBA 3PTFC 5AUIA 3U4EG 3WAOA 2OJRA 2LGSA 5G5GA 4NPNA 3NVVA 5LXHA 4S0RA 1NBFC 4A9AA 3DVNU 1V81A 2L0FA 3SFDB 4WQOB 3V62A 4NQKE 3AI5A 3I9V1 1X11A 4BAXA 1KFYB 3ZDMC 2YLMA 5JXVA 4YL8A 3GS2A 1V5OA 2DAFA 1XLOA 3B1LX 5KCVA 2RDBC 2NBUA 3IT4B 4HRSA 1ACCA 1YX5B 1N6ZA 2LRWA 1E7VA 3R3MA 3MC0B 1P7FA 1ZW7A 2D3BA 1F2RC 1FFVA 2KKCA 2WXPA 1EF1A 3U52E 5HG2A 4I6NB 2AL6A 3N3KB 5AEKB 5TSSA 2ROZB 5C16A 2Q13A 5IKCM 4WJPA 1YIWA 1WMHA 4Y94A 2LVPA 1ENFA 2KWVB 4TQ0A 4TUUA 2KXJA 1HXYD 1L6VA 1KBLA 3FKYA 4PT5A 3UF8A 4WVFB 4HB4B 1X1MA 2I5FA 4OHJA 2V0GA 3Q69A 2L0TA 3QWZB 3DVGY 3HIEA 2WXNA 2WDVB 2ZCBA 4JK8A 4NJCA 2DENB 2BWFA 3DWMA 1SEBD 4K2PA 1ZUD2 1MKEA 1T0YA 2Y8FA 4KZ0A 4ILHA 3APFA 1UEFA 3W1SA 4F8CB 3ZUNA 3MHSD 3PV1A 4XGAB 2AQ3B 1N5WA 4LJOB 1YJJA 4LCDE 2OQBA 2IGHA 3WIMA 2RMMA 3LXFA 2WS3B 2V4LA 2X0SA 5T8IA 2KUQA 2TSSA 1ZSQA 1WM3A 1I7AA 1PGXA 3NZSA 4JGHB 4HB2B 1YJIA 2FIDA 5EE3A 2W2XD 5D94A 5HE0A 5D3IB 1T3QA 3DOWA 4TYZA 3IVFA 5GMVA 1F9JA 2L8JA 3WCQA 2L1CA 1P0RA 2KACA 4JK9A 3OJ3A 2KC1A 4PS8A 3SEBA 2LULA 1D5XC 3NZUA 2BYEA 1ZP0B 1P6SA 2N0YA 4DDGD 5KHOA 2YVCA 1R7SA 3ML4A 3DVGX 3BJIA 1BMLC 2J0KA 4C7ZA 5IO9A 5TR5A 1HEZE 4KAXB 4KZCA 1WX9A 4TMAB 3APCA 3CSTA 1WXQA 1HZ6A 4AUQC 3A8QA 4IM0A 2GUMA 1BT0A 2D5GA 2FAZA 2W55A 3HHMA 1C79A 1MG8A 3SFEB 2LXAA 1YJ1A 3AE9B 3U7ZA 4URKA 4JWSC 3L08A 5FR6A 1XD4A 2FCQA 2ON8A 3PT2B 3VTWA 3JYUA 2GB1A 1TJ6A 5D3DA 2FE8A 5CX3A 4AP4C 5CLLB 4AJYB 4MJSB 3QCAA 5FR3A 4CQNA 1SGHA 4HB0B 3KW5B 4S17A 3TEYA 3P2BA 1UELA 1WVHA 3HM6X 3JSVA 1AWEA 3L10B 1L7YA 2DBYA 1YN5A 2KT7A 4JL9A 1RFKA 2BPSA 1FXTB 2KX0A 1I4HA 2VSZA 1WJ4A 5EE0A 2KLCA 2L7RA 2QC8A 3TEWA 1DROA 2KNBA 4F7UP 5JH5C 1QKZA 3AJ4A 2LXCA 4C00A 2RPQA 1ZPSA 1E9MA 4HSIA 3V6EB 3AE3B 2GRIA 2ZPYA 3SYXA 3VUYA 5MPOA 3GE8C 2DYNA 4P16A 4KVGB 4II2B 2IY0B 1OQYA 4GU2A 4K81A 2FCNA 1Z2MA 4PS7A 2LMCA 3FILA 4XC2A 3ZTDA 1J0GA 2ABDA 1SE2A 2G3QB 2KK8A 1ZDVA 1W1GA 4DBBA 2V3SA 1E8YA 5C5BA 2MSED 2LWPA 2QHOA 3KLSX 3BY4B 3VTUA 3W5VB 4A90A 1FNWA 3RUIB 3ML9A 3Q8CA 1H8CA 1TKEA 5EE1A 3LYYA 3T9LA 4QAYA 1UD7A 3UQAA 2DN6A 2DZKA 3NW8A 2LZ6A 3B2FA 2EKIA 4GGQA 2KFJA 2JT4B 1EWYC 3NWAA 1FIQA 3LB8C 2DIKA 1IRSA 1JRPA 5BYRA 4HPMB 1U4AA 3M3JA 3JSVB 3VAWA 2YRYA 1WJUA 1UNSA 3AE5B 1VJKA 3VRBB 1NDDA 2JWZA 1V89A 1UZXB 2GLSA 3ULCA 3C19A 1XR0B 2WHIA 3QBVB 3QJZA 1WE7A 3V05A 4D0NB 3SBTA 4LNIA 3OLMD 2X18A 4AWJA 5D3XA 2RVBB 1BWNA 1LGRA 2BS2B 1YNTE 2LJIA 3W5UB 1F0ZA 3BINA 3OHMB 1KH0A 2JZPA 1WM2A 3MHZA 2K8EA 4DDID 2RDGA 1JWBD 3ZRFA 4EFOA 3VTVA 1CK1A 4HDQA 1YN3A 3VR8B 1FB8A 2BKFA 3Q3JA 3GYOA 3BK2A 4GLSC 4NJ7A 2L1AA 3ZXRA 3FILB 3L16A 4CSQA 3VXWA 1WRDB 1SIJA 2JXTA 3U2SC 3TSSA 4N58A 5C5BB 4JKEA 2MH7A 2N7JA 1R4MB 2LOZA 1SBBB 4RGMA 2LGIA 5DPRA 3FP5A 3NRZA 1V2YA 3IG3A 2JPHA 3E56A 1FFUA 3AE4B 3U12A 2R82A 5D7GA 4ACFA 2N9XA 1JCKB 5EFXA 2A4ZA 2A5UA 1UNQA 1VRAB 3BWUD 1I4QA 1E8ZA 2Y5CA 2DYMA 1TIFA 3SO6A 2WP9B 2KLGA 2BT6A 3SUZA 4KX6B 1MIZB 1QLBB 5L81A 1JROA 4JKFA 4NY0A 4ASWC 1NTYA 4RGTA 2E2XA 2ZNVB 2UYZB 2H7DA 2DNFA 4KHBA 2BWES 2CY5A 2D3GA 2PLPA 3HVZA 4KKJA 1ZGUB 3T8MA 1YQ4B 2KMAA 2Y3AA 2MBEA 2N23A 2CQUA 3P4PB 1I7HA 3GE3C 2QKLA 1VCBA 4GXBA 3DDCB 5DPSA 2AX5A 4F7ZA 1GUAB 3AU5A 4EMOA 2IDYA 3W2DA 3KQ4A 4XZ4A 4HROA 4OZCA 3ZW3A 2D9WA 2AEHA 1SE9A 2V1YA 4NAMA 3Q8AA 1MFWA 3QQ8B 2G45B 3SNHA 2PJHA 1GG3A 2D07B 4NJ6A 2DAJA 3VOQA 3AB5A 4K3CA 5JHBA 4Q2JA 3PVLA 2K22A 2PZ1A 4DIXA 3H8HA 4PYZA 2MBQA 2H89B 1HE8A 5JVLA 3GZNI 2JRHA 2IO3B 2DYOA 1VD2A 3DCGA 2DHZA 1A5RA 2K49A 4RFBA 2YS3A 2BTEA 4M8MA 1C4CA 2ADZA 3ZKJC 3T3NA 2MWSB 2FJLA 2O2VA 1K5DB 4RMAA 4EKUA 2ROVA 1U29A 5DHAB 3PREA 4KHBB 1WGGA 1Q0WB 2DWQA 2NZ8B 2EMSA 2KD0A 2CAYA 4WWPA 3D8EA 2FJ9A 2CHWA 2NR2A 1HA5A 4NNJB 1HTQA 2HJ1A 4M00A 1Q10A 4BKSD 3N9YC 3VH4B 3H7PA 2M0AA 2L2IA 5CLQB 4FHKA 3RMKC 1WZ0A 3Q14C 3BK1A 1IGCA 2D4QA 3KRWA 1N5XA 1AW7A 2GJYA 2BQQA 2YSZA 1SSNA 2KDEB 1J19A 3RNCC 2L3ZA 3DVNV 3RI7C 4QJ3B 3FM8C 3ODOA 2K2JA 3PLUA 3B2GA 2XNAC 2RPVA 3M63B 4B6WA 3IHPC 1NYQA 4GZUA 3HRDD 3A98B 1FRRA 5L95C 1XD3B 1D5MC 1UBIA 1QQGA 2QCZA 3RFZB 1OQRA 1E7UA 1ZDXA 1U5DA 1E0ZA 1QILA 2RQ1A 3U7DA 4JQWC 1MPHA 3M1IB 2KQ7A 4CHJA 2LGYA 2WXLA 2IYDB 4LTUA 3DXEA 4L6EA 4K1RB 1T6BX 1OEYJ 2WH5A 2UU7A 3KYDD 2LVQA 4IC7B 2WYQA 2Y5BB 4H8SA 3LJUX 4HAZB 1TKYA 4IWOA 3ZXVA 2ZVOA 2DYQA 3CF6E 5E6NA 1X05A 4EZJA 1P5TA 1L6UA 2D9XA 3MJWA 1WGKA 1WJNA 2Z0PA 2KANA 2JZ3B 5G5HA 3A4RA 2COAA 1YQBA 2LVOA 2X38A 2PW9A 4CO7A 4I6LB 2Z4DA 3MJ5A 3RZFA 2KDBA 3MPXA 3Q6BA 3RNGC 3U30A 1PYWD 2HTME 1PLSA 2RSGA 2G9HD 2W3SA 3IFWB 4P1BC 4ANUA 4FADA 4HK2A 1V5MA 3KY9A 2J59M 1SHCA 4MY6A 3ENEA 4YONA 3H7PB 4C56C 2GBNA 2BYFA 2K1FA 4BVUC 5J3TA 2GOWA 2LGDA 3CSFA 1RRPB 1Y8RC 3ODWA 1R4MI 2WXRA 2QIEB 2LHEA 1QOAA 2NBVB 2RNRB 2L05A 2KN5A 1N3HA 4K2OA 3TFMA 1C76A 2GBKA 2UZRA 3WAPA 3R2IA 3PSCA 4JKGA 1U5GA 4YSXB 4ZOHC 2O6VB 1MVKA 4WJQA 5DI9B 4LNNA 1QQRA 4HXDA 2K5PA 4LNFA 2W9NA 4FJZA 3B77A 2R2OA 4XDCA 2BB5A 4A6FA 4RM9A 1MIXA 2INNE 4GDLA 3NG0A 4K7WA 1XCQL 1K5GB 1WXAA 4A20A 4RCOA 2KO3A 1C4AA 1SF0A 2MJDA 3AE1B 1NU2A 1V9JA 2PMVA 4MH8A 3ZO5B 1ROEA 1EUVB 1WE6A 2H7EA 2NBWB 4LJPB 2BYVE 2L83A 1P3QU 5LNK1 4C4VA 5KQ4A 2CU1A 4NAWB 4RGOS 3VRAB 3ZJVA 3OG5A 4A6QA 4JKDA 4KHAA 3MC8A 2EJ8A 3T06A 2HE7A 4KSLC 2OTXA 3M95A 2KWDA 2LOXA 3WA0A 2INDC 2C7NB 2INCC 4N59A 5FI0A 4QXAB 1JWSD 4RF1A 1XODA 2NVUI 4FLHA 2MCNB 1KLGD 2CHZA 1XCTL 2Z0QA 3KUCB 2WNMA 4OW0A 4MJSA 4A5KA 1KTKA 4RNAA 2WX0A 1U5FA 1WIAA 4RH6A 1YMHE 3SHQA 3PZ8A 1TY0A 4ILJA 5LOPB 2LKOA 4JKGB 2ZKMX 3FEHA 4US9A 1AWDA 3NVWA 2BW2A 4WWOA 2NTSA 1NEKB 4IAPA 4ILGB 2CJNA 1FMAD 3MFGA 3GOEA 1M94A 2LYDA 2KFKA 1OFFA 1W1HA 4E74A 2MHJA 1B9RA 1HB6A 2M14A 4A6FB 1DDVA 4GDLB 2ZW0A 2KDIA 2XQNM 2W2XC 2UVMA 1D5ZC 2CB8A 2M17A 2ZVNA 4Z2NA 4MDKE 5HE3A 3DWGC 1Q5WB 3PVUA 1TGZB 3N32A 2H88B 4W9DA 2N1VA 3I5JC 4HVBA 1SE3A 2B76B 4B95A 3ECIA 3E9LA 4GNKB 4ANVA 1PUTA 4GN1A 4C4VB 2P0FA 2GBJA 4NQLB 1OQQA 2GBRA 1RLFA 3H1UA 4AOFA 2JF5A 3DHIC 2ZPNA 4BOSC 4AS1A 3AE6B 1M4VA 1V6EA 1XKEA 2OHFA 2AQ2B 2KYWA 4YWGG 4BBNC 2KVZA 3H7SA 3LDZE 5JHHA 3P1MA 4W9GA 3QARA 2AWTA 2YS1A 3DPDA 3A33B 1RM6C 5IRSA 2JQRB 1WFYA 4IG7B 3V3XA 1V1PB 2HTHA 2OJWA 5LONB 3ML8A 4CHKA 3RT3B 3EFUA 1JRUA 3W1SC 3D8DA 4EJNA 2K6DB 2D3AA 1E90A 2BB6A 5AZGA 2CY4A 3ZVVA 3P6AA 1YQ3B 4K17A 1FNVA 1HTOA 2WXOA 3GZNB 3IXSA 2G35A 1RRBA 2LHDA 3TL5A 4EUTA 1QC6A 5BMGA 3DBRB 2KFKB 3BYTB 5I4DA 4TV3A 1NTIA 1HZ5A 2V3NA 2WLBA 2PE9A 2BF8B 1KRHA 1UGJA 2XN9C 3KRXA 4L1BA 1C77A 4B6HA 1SXTA 1TJEA 3N1ZC 2JYTA 5AUKA 2I38A 1TS2A 2WDTB 4BFRA 2J0JA 1FNUA 4YSZB 1FD6A 1UPQA 2N7EA 4MGYE 1K51A 1JW9D 5BYSA 5J17A 1J0WA 2MKRA 1UBQA 2DZMA 3E9OA 4C0AA 3QWMA 3AU4A 3P4SB 4IM2A 2PVOD 1IP9A 3N7CA 4OSNA 1G6JA 1B55A 1KZGA 3DQVA 2RRFA 1E6EB 2IY1B 4TQ1A 4IFSA 2V3PA 2LASA 3Q3MC 1FAOA 1WSPA 3ZNZB 5I2SA 3GB1A 1DOXA 1BTNA 1SE4A 4WJNA 1GGOA 2K00A 4Z2MB 2GCLA 3ZIMA 4ZHPA 4IW0A 1UWMA 2M4NA 2HTHB 4W9EA 4XDDA 1GC7A 1SIFA 1VZ7A 1KLVA 3NS1A 2FUHB 2CHXA 3KUZA 1GPXA 1V88A 2R2QA 2LBBA 3H9DA 2DA0A 1KI1B 2I1JA 5HKHA 3UIOB 3DHGC 3AE7B 3ZJTA 2N1WA 3NZ3A 4WAAA 4N6EB 3RPFC 1JWMD 4MT5A 2COPA 1D6EC 4HJGE 3MDBC 3EGRA 3I3TB 2JU6X 3UI3A 3IBEA 2KJRA 2SAKA 1KM7A 3P4RB 3ALBA 3RNEC 2QKMA 2COCA 4YSYB 4R3DA 1I4PA 1HQRD 4GOUA 1GB1A 2HDEA 1JALA 1F2RI 2QILA 4HEA1 5DHFB 2WXQA 4BZAA 1WR6E 2SEBD 2Z14A 4D6WA 2IFSA 3K9PB 1MK9B 1TKGA 2IPKD 3ENBA 1MI0A 5D6JB 2KMMA 1WJ6A 3DXDA 2N9PC 3HK0A 2JP2A 3KZ1A 4MT7A 4TKNA 1MJDA 3UZTA 1J7CA 2K8CA 2KQSA 2KMCA 4WURA 2DX5A 4WAFA 1EM7A 1YX6B 4GIVA 1WY8A 3KWVA 1FGZA 3RNBC 3HM3A 3WYFB 3VFKA 4PNKA 1M7EA 3M62B 4YTPB 2AQ1B 1WZ3A 2LGXA 3SD5A 1UF0A 1GC6A 3NOBA 1EAZA 2WDQB 2YT1A 1P9DU 3PLVA 1K52A 3EHVA 1R4NB 3Q8EA 4MH0E 4FJYA 2ELBA 3VHTC 3OJ4B 3O65B 2KWCA 4XYCA 3HUIA 3L0WB 2JXXA 3NS8A 4A8XC 1SJHD 1WF9A 1OTRB 2W82A 4WSFA 1N60A 5DH9B 1IGDA 4ICUA 1JMLA 2LI5A 3CWIA 4JWUC 4A6KA 2KCJA 2GMIC 1FCLA 1GJZA 2M0XA 4EEWA 5BYQA 3RD2A 4LLGM 4B0MA 1ET9A 4ANWA 4ARIA 1IYFA 2FIFA 2KJHB 4BKSA 4ZRPA 1LB1A 2D9ZA 1GOZA 3MC9A 4YTMB 1WJMA 3RCZA 2CODA 1QOGA 2DLBA 1FHWA 4JK7A 3BYYB 2OEDA 4FHJA 2G4DB 1MHHE 4H2AA 4ZDVA 2ELAA 5HI1A 1WGQA 1BTKA 2DX5B 2RSUA 2FNJB 3PZ7A 1FOEA 2AL3A 4JLCA 4W9IA 3Q3NC 3A8PA 1NI2A 2YEPB 4GSWA 4IDIA 3PSEB 3DBSA 1T77A 1V49A 1L2NA 1U5EA 2MW5A 1TY2A 5HE2A 4IOIE 2LG1A 2K8BA 5L83A 3HSAA 1WX8A 2C60A 4QJ5B 2FCMA 2EMTA 4HAYB 3N1YC 3DBRI 2WXHA 3Q2AC 3WALA 5HHDG 2MDXA 4DXGA 2QEJC 2DFKA 2Y5PA 5CHVC 3KWLA 1LW3A 4PS3A 1C1YB 5IN7A 4USAA 4OVVA 2QJLA 5H8YE 2WU2B 1D4BA 3DXCA 3HIZA 3TUOA 1P3RA 1FHOA 4I6PA 2LUEA 3X23A 2X8XX 1A70A 1ZXHA 3A9KB 1WXSA 5GXGB 1AARA 1CZPA 2DKQA 5JHAA 1UNRA 2D9VA 2WGSA 1WRIA 1EU4A 5IAAC 3F0WA 1F77A 5FI1A 1C9FA 3TCAA 1EF5A 5D3VA 1JQ4A 1CJEA 5IJMA 1FXIA 1C4PA 3X0WA 1TQZA 4KV2A 3MP9A 4PK1A 3FLVA 3QHTA 4HCPB 3PZDA 3AXCA 3ZNID 3ODXA 4M01A 2CRFA 4G50A 2PIAA 3APDA 2LRUA 2NBVA 1YOVB 3I57A 3G9WA 1VR9A 2FBWB 2BCJA 1ISNA 1J7BA 3B9JA 1FEHA 2IO1B 4HLEA 1WGHA 3BIID 2YT2A 2WXMA 3AEEB 1L0YB 1FCCC 4IOYX 2O6VA 2P8VA 4FXCA 1PFJA 1IBXA 3E9SA 1XLQA 3K9OB 3R66C 1X1GA 2LUMA 1V5UA 1WGYA 1L0VB 3KUDB 2EC1A 2J4XA 2PEAA 2BS4B 4DX90 4KKIA 1JWAD 4KGSA 1DYNA 5D27A 1XEEA 4GOCA 4LNOA 5D3WA 5HFYA 3P4QB 2M8SA 1SB3C 1OGWA 3AECB 2R0DA 1L4DB 5IP4D 2MFQA 1P1AA 3ZYYX 3QX1A 4BKTA 3I63C 3JW0X 3PS6A 4AJWA 1WX7A 3L13A 2C5LC 2WX1A 2ICIA 4DWFA 3ONSA 3QIJA 2GBMA 4DK5A 4HKZE 5J3QA 1WI1A 2W2WA 4NAWA 5JLJB 1E5WA 4P1CC 3DHHC 1C78A 2LD9A 4ZYNA 2MQJA 3UINB 1E7PB 1IUEA 4PQ0A 4ZHOA 4WJOA 3EECA 2KC2A 1RYJA 1SJED 1I35A 1TZ1A 1I4RA 1GNUA 3BVGA 1HB8A 4OT1A 2VRWB 1VZ6A 2PE6B 3NHEB 4MGKE 1VDVA 3OWEB 1S3SG 3PPAA 4TSSA 4YTNB 4EZKA 2IO2B 3AEFB 3D32A 4BOZB 2K0PA 4NZLB 3WAMA 5J2RA 3AE2B 3ABVB 2O6VD 2JVCA 3V6CB 1GAQB 1R4NI 2IBIB 4ZRKA 1QZEA 4XE0A 3A4SC 1IBXB 1DIKA 4HAUB 4M0WB 2NMQA 4BBKA 1DGJA 4HJKA 4DHZE 5DPWA 1L5PA 1CMXB 4IM3A 3UIPB 3Q3OC 5FKAC 1WGRA 3TJPA 3H6NA 2L00B 4FJVB 3O13A 4LDTD 3A9JA 2E3TA 4G3XB 1DOIA 2KQ4X 4DXAB 4LDTB 2D3CA 1STEA 2HJ8A 3ZTCA 2C9WB 4YT0B 1VBGA 3TW1A 4OVZA 2GCJA 1V8CA 4US8A 2JY6A 2VZKD 4BKGA 3EPYA 1WGDA 3VQIA 2VZKB 5JZEB 3AM9A 3NWDA 1AYFA 2JX5A 2RD0A 3OAWA 4XWWA 2WWZA 5FK9C 4KIKA 2RDHA 2BVCA 4C80A 5G55A 1T5XD 3NVYA 4J3OD 3BVZA 3A1QB 2KDMA 2KIEA 3KH0A 4RF0A 3N30A 5E6JA 2WDRB 4PYUA 3R7RA 4W9CA 5KQ1A 1ZVRA 2I5CA 4WIPA 2WXJA 4GDKB 1EVHA 4HKQA 2YT0A 3B08A 2KUPA 2CJOA 4C7YA 1WR1A 1V1OA 2Z0DB 2R09A 1V1PA 3LJ3A 1H4RA 2N0SB 1WG7A 4MM3A 5CHWA 2R2YA 2V4IB 3AEAB 3ZNGC 1B1ZA 4ZRJA 3R7QA 2CKHB 5IA7A 1PDXA 4M02A 2MJ3A 3UGBB 2KTRA 2PPHA 2JYEA 3FAHA 2V9HA 2NPTB 2DHJA 1WI0A 2ZZPB 4JIOU 2DZJA 2K3UA 5JHGA 2KJ6A 1I4GA 1XQQA 2ZCCA 5G2NA 3A9JB 1NENB 1FHXA 4FULA 4CHMA 1AN8A 1KOTA 2MWNB 2RR9A 3PRPB 4EZLA 4ZYSA 1U27A 3P63A 2Y7BA 3R8BA 3N1XC 2VH2A 3PG7A 4JX1C 2ONQA 2DX1A 3EFCA 3W9CB 2LEKA 4JKBA 4W9KA 4HPPA 3RNFC 1WH3A 2AYOB 3C0RB 4KIKB 4G0NB 4WQMA 1JDEA 1FPYA 2N9KA 2QMTA 2WXKA 5D3YA 1K50A 1WMHB 4LNKA 1N61A 2DYBA 5AZFA 3IT6B 4CYEA 4IWQA 1TXDA 3RN9C 5EE9A 4HAWB 1V97A 5DPTA 2QDFA 4RM8A 1WWTA 5C3JB 4ZRIA 2KHWB 2BKRB 5E6OA 4M8NA 3PGEA 4MM3B 1Y19B 3NJTA 2CR5A 1LO5D 5C2TB 4K7SA 4IKGA 2LFIA 3RULA 4OVUA 4HB3B 2KTRB 3URYA 3NWFA 4WH4A 1MPEA 1I42A 2WQYB 1FO4A 1F52A 3DBHB 3TIXA 1KF6B 1N63A 4ZRQA 3CIKA 2YS5A 1WGUA 1ZOYB 1X1FA 3AMZA 1LM8B 1CQVA 2DKPA 3TBLD 1ET6A 2NCNA 2L76A 2BYTA 3Q3FA 4MEMA 2ZJDA 4L23A 2VRRB 2YEPF 4O1NA 2IGGA 3D8FA 2EKEC 3CIRB 4WWNA 5IOIA 3CMMB 3P42A 5CTRC 4XX5A 3P7ZA 4OZAA 3WANA 1DDMA 4LK0M 2HRJA 3Q8FA 3AEDB 4E3CA 4HPLB 2KN4A 1ESFA 1LQBA 4K7UA 1UH6A 1ZE3D 2W54A 3HVDA 2WXGA 2DHIA 1UUPA 1KJTA 3TEZA 2COFA 1WYWB 2REXA 4FBJB 4IWPA 1TBEA 1V5PA 1VBHA 1ZXIA 3UQBA 1LXDA 1Z5SB 3S2AA 5M4YB 3W1YA 1E8XA 2UWQA 1UNPA 3ZLZA 1EGXA 3TEXA 1T0QC 1V61A 1ZM0A 2WU5B 1RJ2A 2RGNB 2MP2A 4NSWA 5CHFA 1NVID 1L0XB 3R2TA 2EELA 4HHVA 3GP7A 4N9F4 2MBHA 5DCNA 3L4PA 5D2MB 3GYPA 1BXTA 1TYGB 3MTNB 2MEKA 2UZSA 3DBLB 4OZBA 3AULA 3AEGB 3PO0A 3PHWB 2K2UA 4DHZB 1Q67A 2J52A 1YD8U 3VIAA 3VDZA 4FA6A 3EUB2 5C6RA 2KDFB 2ZW1A 3E9PA 4IUMB 4WWMA 1I4XA 5HE1A 1T0SC 3VH3B 1TS4A 3ZJUA 5JP4A 2K8HA 3RNAC 5BO4B 2NTTA 2C7MB 4A3OA 1EO6A 1L4ZB 1QOBA 1N62A 4MGZE 1DDWA 1YN4A 4UDUC 3PHXB 3NVZA 1WYGA 4MGIE 1NTVA 2K39A 5LLIA 2BGFA 2JUOA 2JWUA 5I2MA 1GB4A 4KSKC 1S1QB 4II3B 4P7IA 5KHQA 2C7HA 3NSUA 3VVWB 1IPGA 3Q8BA 3OANA 2M19A 5GOWB 3HW2B 2J0MA 2J42A 2DHKA 3C8YA 2VH1A 2N9LA 4F7HA 2XK5A 3VR9B 4E71A 1WJ1A 2RGFA 2MA9B 1QOFA 1QT9A 1E10A 4HAVB 5AZHA 2MJEA 1KZ7A 3ETRA 3SR6A 3AE8B 1U2BA 1MAIA 1D3ZA 3AH7A 4KGTA 4ARCA 3V61A 2MP2B 2BBCA 4W9HA 1JWUD 5EDSA 1W1DA 2ZEQA 5J3YA 3ZRCA 4A55A 1VZ8A 2LJ5A 2Z59A 3N20C 3FVCA 4JE3B 4DHJD 5BMHA 2Q5WD 4XWXA 1I2HA 2PVGC 4F1SA 1PMSA 1P98A 3A9KA 4MSMB 4DHJB 2MRPA 3EC8A 2ZNVC 2GS0A 1K53A 1EU3A 1BAKA 1OY2A 3ULBA 2KZRA 2INPE 2Y8GA 2PTLA 5C23A 4W9FA 2Z0EB 2D10A 1KC7A 1BUIC 1TS3A 2WXFA 4QJ4B 5BMIA 2I1KA 2GI9A 3QK0A 3VUXA 4GB9A 1ACAA 1RAXA 3FC4A 2L32A 2BS3B 2FUG1 2XEWA 4EE2A 2KTFA 4JKHA 3NUHB 1TS5A 2D9YA 2ACZB 2XBBC 2IGDA 2NS5A 2W3RA 4MSQB 3BVMA 2Z13A 2ASQA 2KX3A 4DQOC 4P6VF 1OQNA 2RLOA 2KIGA 2G1EA 2L52A 3PRZA 2VKIA 2XK5B 2R61A 2MBBB 2K6QA 2FJUB 1FM0D 3AEBB 1DYQA 1V5TA 3SDLC 4HDOA 4ICVA 4MACA 2FCSA 2M56B 3DBHI 1QF6A 3V60A 4ANXA 2NMBA 2N7DA 1K8RB 4G11A 1PGAA 1MI1A 4EOYA 3NY5A 4HATB 3ZNHB 2HD5B 1V80A 4B9KA 5C79A 3TVVA 1Y56A 2Z59B 4KDLB 5LG4B 3AV8A 1MHXA 4JPSA 1XT9B 4J6IA 2IYBA 2KVRA 2MLBA 3ZVRA 1ZC4B 2JRIB 1X86A 1UPRA 1P7EA 4MELA 3QA8A 2OOBB 2P0DA 2CS4A 3ZGZA 2KR0A 4RGNA 3F5RA 3FSSA 2Z8LA 2JZZA 3KYCD 4W9JA 5J18A 4MK0A 1ST7A 4HAXB 2D11A 1XLPA 3O96A 2I2YA 2M38A 1ZC3B 1Q1OA 1T0RC 4F7GA 3IAM1 1AQCA 1PGBA 1XCGA 2K25A 1UWXA 4DXFA 1J7AA 1F1HA 1E8WA 2MBOA 1XLNA 2K9XA 3RZWC 5LXIB 1ZYIA 4GMVA 2CU3A 4FN2A
chains in the Genus database with same CATH topology
4W9LA 1V86A 3CXBB 5C1ZA 1OEYA 3L54A 3L17A 2B3AA 1C3TA 3QC8B 2DLWA 1PQSA 2N4FA 1J8CA 2D2QA 2J7QB 2M1MA 1XX0A 4JKCA 3TMPB 1UGMA 3B0AA 1M7RA 3TO1A 3KSYA 4A3PA 3E66A 4DX8A 3U8ZA 1FGYA 3DBLI 4HCNB 4WJ7A 2KWUB 3PRMB 2DZIA 3PVWA 2RUKB 3VUWA 4GMXB 3JVZX 4X57B 4HWIB 1ZKHA 5DIFB 4KDIC 3PEGA 1WXVA 2V76A 3RYTA 3PP2A 3HQCA 4KHOA 3V5WA 3QAQA 1WXMA 2KOXA 2MX2A 4BBNF 1DBHA 4DBGA 3ZDTA 2O2VB 3SU8X 3A1QA 1H10A 4GPTB 2IZVB 3RCPA 1Z87A 2P0HA 1HBKA 2YF0A 1NVLA 4GDKA 2N9EB 4JKAA 2G4SA 1MK7B 3SBGA 2Z0OA 1TTNA 1RFAA 2DTCA 4A6HA 3KVFB 2IO0B 1LFDA 2KGXB 2FDQA 1OMWA 1Y5OA 2NPTA 5E6PA 3SV1A 3PTFC 3WAOA 2OJRA 4NPNA 5LXHA 1NBFC 3DVNU 1V81A 2L0FA 4WQOB 3V62A 4NQKE 3AI5A 1X11A 3ZDMC 2YLMA 4YL8A 1V5OA 2DAFA 3B1LX 5KCVA 2NBUA 1YX5B 2LRWA 1E7VA 3R3MA 1ZW7A 2KKCA 1EF1A 4I6NB 2AL6A 3N3KB 5AEKB 2ROZB 5C16A 2Q13A 4WJPA 1YIWA 1WMHA 4Y94A 2LVPA 2KWVB 4TQ0A 4TUUA 2KXJA 1KBLA 3UF8A 4WVFB 4HB4B 1X1MA 2I5FA 2L0TA 3QWZB 3DVGY 2ZCBA 4JK8A 2DENB 2BWFA 4K2PA 1MKEA 1T0YA 2Y8FA 4KZ0A 4ILHA 3APFA 1UEFA 3W1SA 4F8CB 3ZUNA 3MHSD 3PV1A 4LJOB 4LCDE 2OQBA 3WIMA 2V4LA 2X0SA 1ZSQA 1WM3A 1I7AA 3NZSA 4JGHB 4HB2B 2FIDA 2W2XD 5D94A 5HE0A 3DOWA 4TYZA 3IVFA 5GMVA 1F9JA 2L8JA 2L1CA 1P0RA 3OJ3A 4JK9A 2KC1A 4PS8A 2LULA 3NZUA 2BYEA 1P6SA 2N0YA 4DDGD 5KHOA 2YVCA 3ML4A 3DVGX 3BJIA 2J0KA 5TR5A 4KAXB 4KZCA 1WX9A 3APCA 3CSTA 4AUQC 3A8QA 4IM0A 1BT0A 2FAZA 3HHMA 1MG8A 2LXAA 1YJ1A 4URKA 3L08A 5FR6A 1XD4A 2FCQA 3PT2B 3VTWA 3JYUA 1TJ6A 5CX3A 4AP4C 5CLLB 4AJYB 4MJSB 3QCAA 1SGHA 4HB0B 3KW5B 3P2BA 1UELA 1WVHA 3HM6X 3JSVA 1AWEA 3L10B 1L7YA 4JL9A 2BPSA 1FXTB 2KX0A 2VSZA 1WJ4A 2KLCA 2L7RA 1DROA 2KNBA 4F7UP 5JH5C 3AJ4A 2LXCA 2RPQA 3V6EB 2ZPYA 3SYXA 3VUYA 2DYNA 4KVGB 4II2B 2IY0B 1OQYA 4GU2A 4K81A 2FCNA 1Z2MA 4PS7A 4XC2A 3ZTDA 1J0GA 2ABDA 2G3QB 2KK8A 1W1GA 4DBBA 2V3SA 1E8YA 5C5BA 2MSED 2LWPA 2QHOA 3BY4B 3VTUA 3RUIB 3ML9A 1H8CA 3T9LA 1UD7A 3UQAA 2DN6A 2DZKA 2LZ6A 4GGQA 2KFJA 2JT4B 2DIKA 1IRSA 4HPMB 1U4AA 3M3JA 3JSVB 3VAWA 2YRYA 1WJUA 1NDDA 1UZXB 1V89A 2JWZA 3ULCA 1XR0B 3QBVB 3QJZA 1WE7A 4D0NB 3SBTA 3OLMD 2X18A 4AWJA 5D3XA 2RVBB 1BWNA 3BINA 1WM2A 4DDID 3ZRFA 4EFOA 3VTVA 4HDQA 1FB8A 2BKFA 3Q3JA 3GYOA 4NJ7A 3L16A 3VXWA 1WRDB 5C5BB 4JKEA 2LOZA 5DPRA 3FP5A 1V2YA 3IG3A 2JPHA 2R82A 5D7GA 2N9XA 5EFXA 2A4ZA 2A5UA 1UNQA 1E8ZA 2DYMA 3SO6A 2KLGA 3SUZA 1MIZB 5L81A 4JKFA 4NY0A 4ASWC 1NTYA 2E2XA 2ZNVB 2UYZB 2H7DA 2BWES 2CY5A 2D3GA 1ZGUB 3T8MA 2KMAA 2MBEA 2N23A 2CQUA 2QKLA 1VCBA 4GXBA 3DDCB 5DPSA 4F7ZA 1GUAB 3AU5A 4EMOA 4XZ4A 3ZW3A 2D9WA 2AEHA 1SE9A 2V1YA 3QQ8B 2G45B 3SNHA 2PJHA 1GG3A 2D07B 4NJ6A 2DAJA 3VOQA 5JHBA 3PVLA 2PZ1A 4PYZA 2MBQA 1HE8A 5JVLA 3GZNI 2JRHA 2IO3B 2DYOA 1VD2A 3DCGA 2DHZA 1A5RA 2YS3A 4M8MA 2ADZA 3ZKJC 2MWSB 2FJLA 2O2VA 1K5DB 4RMAA 4EKUA 2ROVA 1U29A 5DHAB 3PREA 4KHBB 1WGGA 1Q0WB 2NZ8B 2EMSA 2KD0A 2CAYA 4WWPA 3D8EA 2FJ9A 2CHWA 2NR2A 4NNJB 4BKSD 3VH4B 3H7PA 2L2IA 5CLQB 4FHKA 1WZ0A 2D4QA 3KRWA 2GJYA 2YSZA 2KDEB 1J19A 2L3ZA 3DVNV 3FM8C 3ODOA 2K2JA 3PLUA 4B6WA 3M63B 3IHPC 4GZUA 3A98B 5L95C 1XD3B 1UBIA 1QQGA 1E7UA 1U5DA 2RQ1A 3U7DA 4JQWC 1MPHA 3M1IB 2KQ7A 4CHJA 2LGYA 2IYDB 3DXEA 4L6EA 4K1RB 1OEYJ 2WH5A 3KYDD 2LVQA 4IC7B 2WYQA 2Y5BB 4H8SA 3LJUX 4HAZB 4IWOA 2ZVOA 2DYQA 3CF6E 5E6NA 1X05A 4EZJA 1P5TA 2D9XA 3MJWA 1WJNA 2Z0PA 2KANA 2JZ3B 3A4RA 2COAA 1YQBA 2LVOA 4CO7A 4I6LB 3RZFA 3MPXA 2KDBA 3U30A 3IFWB 1PLSA 2RSGA 4ANUA 4FADA 4HK2A 1V5MA 3KY9A 2J59M 1SHCA 4MY6A 3ENEA 4YONA 3H7PB 2GBNA 2BYFA 2K1FA 4BVUC 5J3TA 2GOWA 2LGDA 3CSFA 1RRPB 1Y8RC 3ODWA 1R4MI 2NBVB 2RNRB 2L05A 2KN5A 1N3HA 4K2OA 3TFMA 2GBKA 2UZRA 3WAPA 3PSCA 4JKGA 1U5GA 2O6VB 4WJQA 5DI9B 4HXDA 2W9NA 4FJZA 2R2OA 4A6FA 4RM9A 1MIXA 4GDLA 4K7WA 1K5GB 1WXAA 4A20A 2KO3A 1NU2A 1V9JA 3ZO5B 1EUVB 1WE6A 2H7EA 2NBWB 4LJPB 2BYVE 1P3QU 5KQ4A 2CU1A 4NAWB 4JKDA 4KHAA 2EJ8A 3T06A 2HE7A 4KSLC 2OTXA 3M95A 2LOXA 3WA0A 2C7NB 5FI0A 1XODA 2NVUI 4FLHA 2MCNB 2CHZA 2Z0QA 4MJSA 4A5KA 2WX0A 1U5FA 1WIAA 3SHQA 4ILJA 5LOPB 2LKOA 4JKGB 3FEHA 4WWOA 4IAPA 4ILGB 3GOEA 1M94A 2LYDA 2KFKA 1W1HA 4E74A 1HB6A 2M14A 4A6FB 1DDVA 4GDLB 2KDIA 2XQNM 2W2XC 2UVMA 2CB8A 2M17A 2ZVNA 4Z2NA 4MDKE 5HE3A 1Q5WB 3PVUA 1TGZB 3N32A 4W9DA 2N1VA 4HVBA 4B95A 3ECIA 3E9LA 4ANVA 4GN1A 2P0FA 2GBJA 4NQLB 2GBRA 1RLFA 3H1UA 4AOFA 2JF5A 2ZPNA 4BOSC 1V6EA 1XKEA 4BBNC 3H7SA 3LDZE 5JHHA 4W9GA 3QARA 2AWTA 2YS1A 3DPDA 3A33B 1WFYA 4IG7B 2HTHA 5LONB 3ML8A 4CHKA 3RT3B 3EFUA 1JRUA 3W1SC 3D8DA 4EJNA 2K6DB 1E90A 5AZGA 2CY4A 3ZVVA 3P6AA 4K17A 2G35A 1RRBA 3TL5A 4EUTA 1QC6A 2KFKB 4TV3A 1NTIA 2PE9A 2BF8B 3KRXA 4B6HA 2WDTB 4BFRA 2J0JA 1UPQA 2N7EA 4MGYE 5J17A 1J0WA 2MKRA 1UBQA 2DZMA 3E9OA 4C0AA 3QWMA 3AU4A 4IM2A 1IP9A 3N7CA 1G6JA 1B55A 1KZGA 3DQVA 2IY1B 4TQ1A 4IFSA 2LASA 1FAOA 3ZNZB 1BTNA 4WJNA 1GGOA 2K00A 4Z2MB 2GCLA 3ZIMA 4IW0A 2M4NA 2HTHB 4W9EA 1GC7A 1SIFA 1KLVA 2FUHB 2CHXA 3KUZA 1V88A 2R2QA 2LBBA 3H9DA 2DA0A 1KI1B 2I1JA 5HKHA 3UIOB 2N1WA 4WAAA 2COPA 3MDBC 3I3TB 3IBEA 2KJRA 1KM7A 3ALBA 2QKMA 2COCA 5DHFB 1WR6E 2IFSA 3K9PB 1MK9B 3ENBA 5D6JB 1WJ6A 3DXDA 2N9PC 3HK0A 2JP2A 3KZ1A 4MT7A 4TKNA 2K8CA 3UZTA 2KQSA 2KMCA 2DX5A 1YX6B 4GIVA 1WY8A 1FGZA 3HM3A 3WYFB 3VFKA 4PNKA 1M7EA 3M62B 1WZ3A 2LGXA 3SD5A 1GC6A 3NOBA 1EAZA 2YT1A 1P9DU 3PLVA 3EHVA 4MH0E 4FJYA 2ELBA 3VHTC 3OJ4B 3O65B 2KWCA 3L0WB 2JXXA 3NS8A 1WF9A 1OTRB 4WSFA 5DH9B 4ICUA 2LI5A 4A6KA 2KCJA 2GMIC 1GJZA 2M0XA 4EEWA 3RD2A 4ANWA 1IYFA 2FIFA 2KJHB 4BKSA 1LB1A 2D9ZA 1WJMA 3RCZA 2CODA 1FHWA 4JK7A 4FHJA 2G4DB 4ZDVA 2ELAA 1WGQA 1BTKA 2DX5B 2RSUA 2FNJB 1FOEA 2AL3A 4JLCA 4W9IA 3A8PA 1NI2A 4GSWA 3PSEB 3DBSA 1V49A 1L2NA 1U5EA 2MW5A 5HE2A 2LG1A 2K8BA 5L83A 1WX8A 2C60A 2FCMA 2EMTA 4HAYB 3DBRI 3WALA 2MDXA 2DFKA 5CHVC 1LW3A 4PS3A 1C1YB 4OVVA 3DXCA 3HIZA 1P3RA 1FHOA 4I6PA 3X23A 2LUEA 3A9KB 1WXSA 1AARA 2DKQA 5JHAA 1UNRA 2D9VA 5IAAC 3F0WA 5FI1A 3TCAA 1EF5A 5D3VA 5IJMA 3X0WA 1TQZA 4KV2A 3FLVA 3QHTA 4HCPB 3PZDA 3AXCA 3ZNID 3ODXA 2CRFA 4G50A 3APDA 2LRUA 3G9WA 2BCJA 1ISNA 2IO1B 4HLEA 1WGHA 4IOYX 2O6VA 2P8VA 1PFJA 3K9OB 3R66C 1X1GA 1V5UA 1WGYA 3KUDB 2EC1A 2PEAA 4DX90 1DYNA 5D27A 4GOCA 5D3WA 2M8SA 1OGWA 2R0DA 2MFQA 1P1AA 4BKTA 3QX1A 3JW0X 3PS6A 4AJWA 1WX7A 3L13A 2C5LC 2WX1A 4DWFA 3ONSA 3QIJA 2GBMA 4DK5A 5J3QA 1WI1A 2W2WA 4NAWA 5JLJB 1E5WA 2LD9A 4ZYNA 2MQJA 3UINB 4PQ0A 4WJOA 3EECA 2KC2A 1I35A 1TZ1A 1GNUA 1HB8A 2VRWB 2PE6B 3NHEB 4MGKE 1S3SG 3PPAA 4EZKA 2IO2B 3D32A 4BOZB 3WAMA 5J2RA 2O6VD 2JVCA 3V6CB 1R4NI 2IBIB 4ZRKA 1QZEA 3A4SC 1DIKA 4HAUB 4M0WB 4BBKA 4HJKA 4DHZE 5DPWA 1CMXB 4IM3A 3UIPB 1WGRA 3TJPA 3H6NA 2L00B 4FJVB 4LDTD 3A9JA 4G3XB 4DXAB 4LDTB 2HJ8A 3ZTCA 2C9WB 1VBGA 3TW1A 2GCJA 2JY6A 4BKGA 3EPYA 1WGDA 3VQIA 5JZEB 2RD0A 3OAWA 2WWZA 4KIKA 5G55A 3A1QB 3KH0A 3N30A 4PYUA 3R7RA 4W9CA 5KQ1A 1ZVRA 2I5CA 4GDKB 1EVHA 2YT0A 3B08A 2KUPA 1WR1A 2Z0DB 2R09A 3LJ3A 1H4RA 1WG7A 4MM3A 5CHWA 3ZNGC 4ZRJA 3R7QA 2CKHB 5IA7A 3UGBB 2KTRA 2PPHA 2NPTB 2DHJA 1WI0A 2ZZPB 4JIOU 2DZJA 5JHGA 2KJ6A 1XQQA 2ZCCA 5G2NA 3A9JB 1FHXA 4FULA 4CHMA 1KOTA 2MWNB 2RR9A 3PRPB 4EZLA 1U27A 2Y7BA 3PG7A 2DX1A 4JKBA 4W9KA 1WH3A 2AYOB 3C0RB 4KIKB 4G0NB 1JDEA 5D3YA 1WMHB 2DYBA 5AZFA 4IWQA 4CYEA 1TXDA 4HAWB 5DPTA 4RM8A 4ZRIA 2KHWB 2BKRB 5E6OA 4M8NA 3PGEA 1Y19B 2CR5A 4K7SA 3RULA 4OVUA 4HB3B 2KTRB 1I42A 3TIXA 3CIKA 2YS5A 1WGUA 1X1FA 1LM8B 2DKPA 3TBLD 2NCNA 2L76A 3Q3FA 4MEMA 2ZJDA 2VRRB 3D8FA 2EKEC 4WWNA 3CMMB 5CTRC 4XX5A 3P7ZA 3WANA 1DDMA 2HRJA 4E3CA 4HPLB 1LQBA 4K7UA 1UH6A 2DHIA 1KJTA 2COFA 1WYWB 2REXA 4FBJB 4IWPA 1TBEA 1V5PA 1VBHA 3UQBA 1LXDA 1Z5SB 3S2AA 3W1YA 1E8XA 2UWQA 1UNPA 3ZLZA 1EGXA 1V61A 1ZM0A 1RJ2A 2RGNB 2MP2A 4NSWA 5CHFA 4HHVA 4N9F4 2MBHA 5DCNA 5D2MB 3GYPA 3MTNB 2UZSA 3AULA 3PHWB 2K2UA 4DHZB 1Q67A 1YD8U 3VIAA 3VDZA 4FA6A 5C6RA 2KDFB 3E9PA 4IUMB 5HE1A 3VH3B 5JP4A 2K8HA 5BO4B 2C7MB 4A3OA 1EO6A 4MGZE 1DDWA 3PHXB 4MGIE 1NTVA 2K39A 5LLIA 2BGFA 2JUOA 4KSKC 4II3B 1S1QB 4P7IA 5KHQA 2C7HA 3NSUA 3VVWB 1IPGA 3OANA 5GOWB 3HW2B 2J0MA 2DHKA 4F7HA 2XK5A 4E71A 1WJ1A 2RGFA 2MA9B 4HAVB 5AZHA 1KZ7A 1U2BA 1MAIA 1D3ZA 3V61A 2MP2B 4W9HA 5EDSA 1W1DA 2ZEQA 5J3YA 3ZRCA 2LJ5A 4DHJD 4XWXA 1I2HA 4F1SA 1PMSA 1P98A 3A9KA 4MSMB 4DHJB 2MRPA 3EC8A 2ZNVC 2GS0A 1BAKA 1OY2A 3ULBA 2KZRA 5C23A 2Y8GA 4W9FA 2Z0EB 2D10A 1KC7A 2I1KA 3QK0A 3VUXA 4GB9A 1ACAA 1RAXA 2XEWA 2KTFA 4JKHA 2D9YA 2XBBC 2NS5A 4MSQB 2ASQA 2KX3A 1OQNA 2RLOA 3PRZA 2VKIA 2XK5B 2MBBB 2K6QA 3SDLC 1V5TA 4HDOA 4ICVA 2FCSA 3DBHI 3V60A 4ANXA 2NMBA 2N7DA 1K8RB 4G11A 4EOYA 3NY5A 4HATB 3ZNHB 2HD5B 1V80A 4B9KA 5C79A 3TVVA 2Z59B 4KDLB 1XT9B 4J6IA 2IYBA 2KVRA 2MLBA 3ZVRA 1ZC4B 2JRIB 1X86A 1UPRA 4MELA 3QA8A 2OOBB 2P0DA 2CS4A 3F5RA 3FSSA 2JZZA 3KYCD 4W9JA 5J18A 4MK0A 1ST7A 4HAXB 2D11A 3O96A 2M38A 1ZC3B 1Q1OA 4F7GA 1AQCA 1XCGA 2K25A 1E8WA 2MBOA 3RZWC 5LXIB 4GMVA 3KUCB 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9L A;  1V86 A;  3CXB B;  5C1Z A;  1OEY A;  3L54 A;  3L17 A;  2B3A A;  1C3T A;  3QC8 B;  2DLW A;  1PQS A;  2N4F A;  1J8C A;  2D2Q A;  2J7Q B;  2M1M A;  1XX0 A;  3TMP B;  1UGM A;  3B0A A;  1M7R A;  3TO1 A;  3KSY A;  4A3P A;  4DX8 A;  3U8Z A;  1FGY A;  3DBL I;  4HCN B;  4WJ7 A;  2KWU B;  3PRM B;  2DZI A;  3PVW A;  2RUK B;  3VUW A;  4GMX B;  3JVZ X;  4X57 B;  4HWI B;  1ZKH A;  5DIF B;  4KDI C;  3PEG A;  1WXV A;  2V76 A;  3RYT A;  3PP2 A;  3HQC A;  4KHO A;  3V5W A;  3QAQ A;  1WXM A;  2KOX A;  2MX2 A;  4BBN F;  1DBH A;  4DBG A;  3ZDT A;  2O2V B;  3SU8 X;  3A1Q A;  1H10 A;  4GPT B;  2IZV B;  3RCP A;  1Z87 A;  2P0H A;  1HBK A;  2YF0 A;  1NVL A;  4GDK A;  2N9E B;  2G4S A;  1MK7 B;  2Z0O A;  1TTN A;  1RFA A;  2DTC A;  4A6H A;  3KVF B;  2IO0 B;  1LFD A;  2KGX B;  2FDQ A;  1OMW A;  1Y5O A;  2NPT A;  5E6P A;  3SV1 A;  3PTF C;  3WAO A;  2OJR A;  4NPN A;  5LXH A;  1NBF C;  3DVN U;  1V81 A;  2L0F A;  4WQO B;  3V62 A;  4NQK E;  3AI5 A;  1X11 A;  3ZDM C;  2YLM A;  4YL8 A;  1V5O A;  2DAF A;  3B1L X;  5KCV A;  2NBU A;  1YX5 B;  2LRW A;  1E7V A;  3R3M A;  1ZW7 A;  2KKC A;  1EF1 A;  4I6N B;  2AL6 A;  3N3K B;  5AEK B;  2ROZ B;  5C16 A;  2Q13 A;  4WJP A;  1YIW A;  1WMH A;  4Y94 A;  2LVP A;  2KWV B;  4TQ0 A;  4TUU A;  2KXJ A;  3UF8 A;  4WVF B;  4HB4 B;  1X1M A;  2I5F A;  2L0T A;  3QWZ B;  3DVG Y;  2ZCB A;  2DEN B;  2BWF A;  4K2P A;  1MKE A;  1T0Y A;  2Y8F A;  4KZ0 A;  3APF A;  1UEF A;  3W1S A;  4F8C B;  3ZUN A;  3MHS D;  3PV1 A;  4LJO B;  4LCD E;  2OQB A;  3WIM A;  2V4L A;  1ZSQ A;  1WM3 A;  1I7A A;  3NZS A;  4JGH B;  4HB2 B;  2FID A;  2W2X D;  5D94 A;  5HE0 A;  3DOW A;  4TYZ A;  3IVF A;  5GMV A;  1F9J A;  2L8J A;  2L1C A;  1P0R A;  3OJ3 A;  2KC1 A;  4PS8 A;  2LUL A;  3NZU A;  2BYE A;  1P6S A;  2N0Y A;  4DDG D;  5KHO A;  2YVC A;  3ML4 A;  3DVG X;  3BJI A;  2J0K A;  5TR5 A;  4KAX B;  4KZC A;  1WX9 A;  3APC A;  3CST A;  4AUQ C;  3A8Q A;  4IM0 A;  1BT0 A;  2FAZ A;  3HHM A;  1MG8 A;  2LXA A;  1YJ1 A;  4URK A;  3L08 A;  5FR6 A;  1XD4 A;  2FCQ A;  3PT2 B;  3VTW A;  3JYU A;  1TJ6 A;  5CX3 A;  4AP4 C;  5CLL B;  4AJY B;  4MJS B;  3QCA A;  1SGH A;  4HB0 B;  3KW5 B;  3P2B A;  1UEL A;  1WVH A;  3HM6 X;  3JSV A;  1AWE A;  3L10 B;  1L7Y A;  4JL9 A;  2BPS A;  1FXT B;  2KX0 A;  2VSZ A;  1WJ4 A;  2KLC A;  2L7R A;  1DRO A;  2KNB A;  4F7U P;  5JH5 C;  3AJ4 A;  2LXC A;  2RPQ A;  3V6E B;  2ZPY A;  3SYX A;  3VUY A;  2DYN A;  4KVG B;  4II2 B;  2IY0 B;  1OQY A;  4GU2 A;  4K81 A;  2FCN A;  1Z2M A;  4PS7 A;  4XC2 A;  3ZTD A;  1J0G A;  2ABD A;  2G3Q B;  2KK8 A;  1W1G A;  4DBB A;  2V3S A;  1E8Y A;  5C5B A;  2MSE D;  2LWP A;  2QHO A;  3BY4 B;  3VTU A;  3RUI B;  3ML9 A;  1H8C A;  3T9L A;  1UD7 A;  3UQA A;  2DN6 A;  2DZK A;  2LZ6 A;  4GGQ A;  2KFJ A;  2JT4 B;  1IRS A;  4HPM B;  1U4A A;  3M3J A;  3JSV B;  3VAW A;  2YRY A;  1WJU A;  1NDD A;  1UZX B;  1V89 A;  2JWZ A;  3ULC A;  1XR0 B;  3QBV B;  3QJZ A;  1WE7 A;  4D0N B;  3OLM D;  2X18 A;  4AWJ A;  5D3X A;  2RVB B;  1BWN A;  3BIN A;  1WM2 A;  4DDI D;  3ZRF A;  4EFO A;  3VTV A;  4HDQ A;  1FB8 A;  2BKF A;  3Q3J A;  3GYO A;  4NJ7 A;  3L16 A;  3VXW A;  1WRD B;  5C5B B;  2LOZ A;  5DPR A;  3FP5 A;  1V2Y A;  3IG3 A;  2JPH A;  5D7G A;  2N9X A;  5EFX A;  2A4Z A;  2A5U A;  1UNQ A;  1E8Z A;  2DYM A;  3SO6 A;  2KLG A;  3SUZ A;  1MIZ B;  5L81 A;  4NY0 A;  4ASW C;  1NTY A;  2E2X A;  2ZNV B;  2UYZ B;  2H7D A;  2BWE S;  2CY5 A;  2D3G A;  1ZGU B;  3T8M A;  2KMA A;  2MBE A;  2N23 A;  2CQU A;  2QKL A;  1VCB A;  4GXB A;  3DDC B;  5DPS A;  4F7Z A;  1GUA B;  3AU5 A;  4EMO A;  4XZ4 A;  3ZW3 A;  2D9W A;  2AEH A;  1SE9 A;  2V1Y A;  3QQ8 B;  2G45 B;  3SNH A;  2PJH A;  1GG3 A;  2D07 B;  4NJ6 A;  2DAJ A;  3VOQ A;  5JHB A;  3PVL A;  2PZ1 A;  4PYZ A;  2MBQ A;  1HE8 A;  3GZN I;  2JRH A;  2IO3 B;  2DYO A;  1VD2 A;  3DCG A;  2DHZ A;  1A5R A;  2YS3 A;  4M8M A;  2ADZ A;  3ZKJ C;  2MWS B;  2FJL A;  2O2V A;  1K5D B;  4RMA A;  4EKU A;  2ROV A;  1U29 A;  5DHA B;  3PRE A;  4KHB B;  1WGG A;  1Q0W B;  2NZ8 B;  2EMS A;  2KD0 A;  2CAY A;  4WWP A;  3D8E A;  2FJ9 A;  2CHW A;  2NR2 A;  4NNJ B;  4BKS D;  3VH4 B;  3H7P A;  2L2I A;  5CLQ B;  4FHK A;  1WZ0 A;  2D4Q A;  3KRW A;  2GJY A;  2YSZ A;  2KDE B;  1J19 A;  2L3Z A;  3DVN V;  3FM8 C;  3ODO A;  2K2J A;  3PLU A;  4B6W A;  3M63 B;  3IHP C;  4GZU A;  3A98 B;  5L95 C;  1XD3 B;  1UBI A;  1QQG A;  1E7U A;  1U5D A;  2RQ1 A;  3U7D A;  4JQW C;  1MPH A;  3M1I B;  2KQ7 A;  4CHJ A;  2LGY A;  2IYD B;  3DXE A;  4L6E A;  4K1R B;  1OEY J;  2WH5 A;  3KYD D;  2LVQ A;  4IC7 B;  2WYQ A;  2Y5B B;  4H8S A;  3LJU X;  4HAZ B;  4IWO A;  2ZVO A;  2DYQ A;  3CF6 E;  5E6N A;  1X05 A;  4EZJ A;  1P5T A;  2D9X A;  3MJW A;  1WJN A;  2Z0P A;  2KAN A;  2JZ3 B;  3A4R A;  2COA A;  1YQB A;  2LVO A;  4CO7 A;  4I6L B;  3RZF A;  3MPX A;  2KDB A;  3U30 A;  3IFW B;  1PLS A;  2RSG A;  4ANU A;  4FAD A;  4HK2 A;  1V5M A;  3KY9 A;  2J59 M;  1SHC A;  4MY6 A;  3ENE A;  4YON A;  3H7P B;  2GBN A;  2BYF A;  2K1F A;  4BVU C;  5J3T A;  2GOW A;  2LGD A;  3CSF A;  1RRP B;  1Y8R C;  3ODW A;  1R4M I;  2NBV B;  2RNR B;  2L05 A;  2KN5 A;  1N3H A;  4K2O A;  3TFM A;  2GBK A;  2UZR A;  3WAP A;  3PSC A;  1U5G A;  2O6V B;  4WJQ A;  5DI9 B;  4HXD A;  2W9N A;  4FJZ A;  2R2O A;  4A6F A;  4RM9 A;  1MIX A;  4GDL A;  4K7W A;  1K5G B;  1WXA A;  4A20 A;  2KO3 A;  1NU2 A;  1V9J A;  3ZO5 B;  1EUV B;  1WE6 A;  2H7E A;  2NBW B;  4LJP B;  2BYV E;  1P3Q U;  5KQ4 A;  2CU1 A;  4NAW B;  4KHA A;  2EJ8 A;  3T06 A;  2HE7 A;  4KSL C;  2OTX A;  3M95 A;  2LOX A;  3WA0 A;  2C7N B;  5FI0 A;  1XOD A;  2NVU I;  4FLH A;  2MCN B;  2CHZ A;  2Z0Q A;  4MJS A;  4A5K A;  2WX0 A;  1U5F A;  1WIA A;  3SHQ A;  5LOP B;  2LKO A;  3FEH A;  4WWO A;  4IAP A;  3GOE A;  1M94 A;  2LYD A;  2KFK A;  1W1H A;  4E74 A;  1HB6 A;  2M14 A;  4A6F B;  1DDV A;  4GDL B;  2KDI A;  2XQN M;  2W2X C;  2UVM A;  2CB8 A;  2M17 A;  2ZVN A;  4Z2N A;  4MDK E;  5HE3 A;  1Q5W B;  3PVU A;  1TGZ B;  3N32 A;  4W9D A;  2N1V A;  4HVB A;  4B95 A;  3ECI A;  4ANV A;  4GN1 A;  2P0F A;  2GBJ A;  4NQL B;  2GBR A;  1RLF A;  3H1U A;  4AOF A;  2JF5 A;  2ZPN A;  4BOS C;  1V6E A;  1XKE A;  4BBN C;  3H7S A;  3LDZ E;  5JHH A;  4W9G A;  3QAR A;  2AWT A;  2YS1 A;  3DPD A;  3A33 B;  1WFY A;  4IG7 B;  2HTH A;  5LON B;  3ML8 A;  4CHK A;  3RT3 B;  3EFU A;  1JRU A;  3W1S C;  3D8D A;  4EJN A;  2K6D B;  1E90 A;  5AZG A;  2CY4 A;  3ZVV A;  3P6A A;  4K17 A;  2G35 A;  1RRB A;  3TL5 A;  4EUT A;  1QC6 A;  2KFK B;  4TV3 A;  1NTI A;  2PE9 A;  2BF8 B;  3KRX A;  4B6H A;  2WDT B;  4BFR A;  2J0J A;  1UPQ A;  2N7E A;  4MGY E;  5J17 A;  1J0W A;  2MKR A;  1UBQ A;  2DZM A;  4C0A A;  3QWM A;  3AU4 A;  4IM2 A;  1IP9 A;  3N7C A;  1G6J A;  1B55 A;  1KZG A;  3DQV A;  2IY1 B;  4TQ1 A;  4IFS A;  2LAS A;  1FAO A;  3ZNZ B;  1BTN A;  4WJN A;  2K00 A;  4Z2M B;  2GCL A;  3ZIM A;  4IW0 A;  2M4N A;  2HTH B;  4W9E A;  1GC7 A;  1SIF A;  1KLV A;  2FUH B;  2CHX A;  3KUZ A;  1V88 A;  2R2Q A;  2LBB A;  3H9D A;  2DA0 A;  1KI1 B;  2I1J A;  5HKH A;  3UIO B;  2N1W A;  4WAA A;  2COP A;  3MDB C;  3I3T B;  3IBE A;  2KJR A;  1KM7 A;  3ALB A;  2QKM A;  2COC A;  5DHF B;  1WR6 E;  2IFS A;  3K9P B;  1MK9 B;  5D6J B;  1WJ6 A;  3DXD A;  2N9P C;  3HK0 A;  2JP2 A;  3KZ1 A;  4MT7 A;  4TKN A;  2K8C A;  3UZT A;  2KQS A;  2KMC A;  2DX5 A;  1YX6 B;  4GIV A;  1WY8 A;  1FGZ A;  3HM3 A;  3WYF B;  3VFK A;  4PNK A;  1M7E A;  3M62 B;  1WZ3 A;  2LGX A;  3SD5 A;  1GC6 A;  3NOB A;  1EAZ A;  2YT1 A;  1P9D U;  3PLV A;  3EHV A;  4MH0 E;  4FJY A;  2ELB A;  3VHT C;  3OJ4 B;  3O65 B;  2KWC A;  3L0W B;  2JXX A;  3NS8 A;  1WF9 A;  1OTR B;  4WSF A;  5DH9 B;  4ICU A;  2LI5 A;  4A6K A;  2KCJ A;  2GMI C;  1GJZ A;  2M0X A;  4EEW A;  3RD2 A;  4ANW A;  1IYF A;  2FIF A;  2KJH B;  4BKS A;  1LB1 A;  2D9Z A;  1WJM A;  3RCZ A;  2COD A;  1FHW A;  4FHJ A;  2G4D B;  4ZDV A;  2ELA A;  1WGQ A;  1BTK A;  2DX5 B;  2RSU A;  2FNJ B;  1FOE A;  2AL3 A;  4JLC A;  4W9I A;  3A8P A;  1NI2 A;  4GSW A;  3PSE B;  3DBS A;  1V49 A;  1L2N A;  1U5E A;  2MW5 A;  5HE2 A;  2LG1 A;  2K8B A;  5L83 A;  1WX8 A;  2C60 A;  2FCM A;  2EMT A;  4HAY B;  3DBR I;  3WAL A;  2MDX A;  2DFK A;  5CHV C;  1LW3 A;  4PS3 A;  1C1Y B;  4OVV A;  3DXC A;  3HIZ A;  1P3R A;  1FHO A;  4I6P A;  3X23 A;  2LUE A;  3A9K B;  1WXS A;  1AAR A;  2DKQ A;  5JHA A;  1UNR A;  2D9V A;  5IAA C;  3F0W A;  5FI1 A;  3TCA A;  1EF5 A;  5D3V A;  5IJM A;  3X0W A;  1TQZ A;  4KV2 A;  3FLV A;  3QHT A;  4HCP B;  3PZD A;  3AXC A;  3ZNI D;  3ODX A;  2CRF A;  4G50 A;  3APD A;  2LRU A;  3G9W A;  2BCJ A;  1ISN A;  2IO1 B;  4HLE A;  1WGH A;  4IOY X;  2O6V A;  2P8V A;  1PFJ A;  3K9O B;  3R66 C;  1X1G A;  1V5U A;  1WGY A;  3KUD B;  2EC1 A;  2PEA A;  4DX9 0;  1DYN A;  5D27 A;  4GOC A;  5D3W A;  2M8S A;  1OGW A;  2R0D A;  2MFQ A;  1P1A A;  4BKT A;  3QX1 A;  3JW0 X;  3PS6 A;  4AJW A;  1WX7 A;  3L13 A;  2C5L C;  2WX1 A;  4DWF A;  3ONS A;  3QIJ A;  2GBM A;  4DK5 A;  5J3Q A;  1WI1 A;  2W2W A;  4NAW A;  5JLJ B;  1E5W A;  2LD9 A;  4ZYN A;  2MQJ A;  3UIN B;  4PQ0 A;  4WJO A;  3EEC A;  2KC2 A;  1I35 A;  1TZ1 A;  1GNU A;  1HB8 A;  2VRW B;  2PE6 B;  3NHE B;  4MGK E;  1S3S G;  3PPA A;  4EZK A;  2IO2 B;  3D32 A;  4BOZ B;  3WAM A;  5J2R A;  2O6V D;  2JVC A;  3V6C B;  1R4N I;  2IBI B;  4ZRK A;  1QZE A;  3A4S C;  4HAU B;  4M0W B;  4BBK A;  4HJK A;  4DHZ E;  5DPW A;  1CMX B;  4IM3 A;  3UIP B;  1WGR A;  3TJP A;  3H6N A;  2L00 B;  4FJV B;  4LDT D;  3A9J A;  4G3X B;  4DXA B;  4LDT B;  2HJ8 A;  3ZTC A;  2C9W B;  3TW1 A;  2GCJ A;  2JY6 A;  4BKG A;  3EPY A;  1WGD A;  3VQI A;  5JZE B;  2RD0 A;  3OAW A;  2WWZ A;  4KIK A;  5G55 A;  3A1Q B;  3KH0 A;  3N30 A;  4PYU A;  3R7R A;  4W9C A;  5KQ1 A;  1ZVR A;  2I5C A;  4GDK B;  1EVH A;  2YT0 A;  3B08 A;  2KUP A;  1WR1 A;  2Z0D B;  2R09 A;  3LJ3 A;  1H4R A;  1WG7 A;  4MM3 A;  5CHW A;  3ZNG C;  4ZRJ A;  3R7Q A;  2CKH B;  5IA7 A;  3UGB B;  2KTR A;  2PPH A;  2NPT B;  2DHJ A;  1WI0 A;  2ZZP B;  4JIO U;  2DZJ A;  5JHG A;  2KJ6 A;  1XQQ A;  2ZCC A;  5G2N A;  3A9J B;  1FHX A;  4FUL A;  4CHM A;  1KOT A;  2MWN B;  2RR9 A;  3PRP B;  4EZL A;  1U27 A;  2Y7B A;  3PG7 A;  2DX1 A;  4W9K A;  1WH3 A;  2AYO B;  3C0R B;  4KIK B;  4G0N B;  5D3Y A;  1WMH B;  2DYB A;  5AZF A;  4IWQ A;  4CYE A;  1TXD A;  4HAW B;  5DPT A;  4RM8 A;  4ZRI A;  2KHW B;  2BKR B;  5E6O A;  4M8N A;  3PGE A;  1Y19 B;  2CR5 A;  4K7S A;  3RUL A;  4OVU A;  4HB3 B;  2KTR B;  1I42 A;  3TIX A;  3CIK A;  2YS5 A;  1WGU A;  1X1F A;  1LM8 B;  2DKP A;  3TBL D;  2NCN A;  2L76 A;  3Q3F A;  4MEM A;  2ZJD A;  2VRR B;  3D8F A;  2EKE C;  4WWN A;  3CMM B;  5CTR C;  4XX5 A;  3P7Z A;  3WAN A;  1DDM A;  2HRJ A;  4E3C A;  4HPL B;  1LQB A;  4K7U A;  1UH6 A;  2DHI A;  1KJT A;  2COF A;  1WYW B;  2REX A;  4FBJ B;  4IWP A;  1TBE A;  1V5P A;  3UQB A;  1LXD A;  1Z5S B;  3S2A A;  3W1Y A;  1E8X A;  2UWQ A;  1UNP A;  3ZLZ A;  1EGX A;  1V61 A;  1ZM0 A;  1RJ2 A;  2RGN B;  2MP2 A;  4NSW A;  5CHF A;  4HHV A;  4N9F 4;  2MBH A;  5DCN A;  5D2M B;  3GYP A;  3MTN B;  2UZS A;  3AUL A;  3PHW B;  2K2U A;  4DHZ B;  1Q67 A;  1YD8 U;  3VIA A;  3VDZ A;  4FA6 A;  5C6R A;  2KDF B;  4IUM B;  5HE1 A;  3VH3 B;  5JP4 A;  2K8H A;  5BO4 B;  2C7M B;  4A3O A;  1EO6 A;  4MGZ E;  1DDW A;  3PHX B;  4MGI E;  1NTV A;  2K39 A;  5LLI A;  2BGF A;  2JUO A;  4KSK C;  4II3 B;  1S1Q B;  4P7I A;  5KHQ A;  2C7H A;  3NSU A;  3VVW B;  1IPG A;  3OAN A;  5GOW B;  3HW2 B;  2J0M A;  2DHK A;  4F7H A;  2XK5 A;  4E71 A;  1WJ1 A;  2RGF A;  2MA9 B;  4HAV B;  5AZH A;  1KZ7 A;  1U2B A;  1MAI A;  1D3Z A;  3V61 A;  2MP2 B;  4W9H A;  5EDS A;  1W1D A;  2ZEQ A;  5J3Y A;  3ZRC A;  2LJ5 A;  4DHJ D;  4XWX A;  1I2H A;  4F1S A;  1PMS A;  1P98 A;  3A9K A;  4MSM B;  4DHJ B;  2MRP A;  3EC8 A;  2ZNV C;  2GS0 A;  1BAK A;  1OY2 A;  3ULB A;  2KZR A;  5C23 A;  2Y8G A;  4W9F A;  2Z0E B;  2D10 A;  2I1K A;  3QK0 A;  3VUX A;  4GB9 A;  1ACA A;  1RAX A;  2XEW A;  2KTF A;  2D9Y A;  2XBB C;  2NS5 A;  4MSQ B;  2ASQ A;  2KX3 A;  1OQN A;  2RLO A;  3PRZ A;  2VKI A;  2XK5 B;  2MBB B;  2K6Q A;  3SDL C;  1V5T A;  4HDO A;  4ICV A;  2FCS A;  3DBH I;  3V60 A;  4ANX A;  2NMB A;  2N7D A;  1K8R B;  4G11 A;  4EOY A;  3NY5 A;  4HAT B;  3ZNH B;  2HD5 B;  1V80 A;  4B9K A;  5C79 A;  3TVV A;  2Z59 B;  4KDL B;  1XT9 B;  4J6I A;  2IYB A;  2KVR A;  2MLB A;  3ZVR A;  1ZC4 B;  2JRI B;  1X86 A;  1UPR A;  4MEL A;  3QA8 A;  2OOB B;  2P0D A;  2CS4 A;  3F5R A;  3FSS A;  2JZZ A;  3KYC D;  4W9J A;  5J18 A;  4MK0 A;  1ST7 A;  4HAX B;  2D11 A;  3O96 A;  2M38 A;  1ZC3 B;  1Q1O A;  4F7G A;  1AQC A;  1XCG A;  2K25 A;  1E8W A;  2MBO A;  3RZW C;  5LXI B;  4GMV A;  3KUC B;  4FN2 A; 
#chains in the Genus database with same CATH topology
 3J9C A;  4W9L A;  1V86 A;  3CXB B;  5C1Z A;  1OEY A;  3L54 A;  4ITK A;  3L17 A;  2B3A A;  4D2K A;  1C3T A;  3QC8 B;  2DLW A;  1PQS A;  2N4F A;  1J8C A;  4YXD B;  4M0W A;  2D2Q A;  1PFD A;  2J7Q B;  2M1M A;  1XX0 A;  4JKC A;  3TMP B;  1UGM A;  3B0A A;  1TZO A;  1M7R A;  3EA6 A;  4KGR A;  3TO1 A;  3KSY A;  4A3P A;  3E66 A;  4DX8 A;  3U8Z A;  1XO3 A;  1FGY A;  3DBL I;  4HCN B;  4WJ7 A;  2KWU B;  3PRM B;  1FXA A;  2PKO A;  2DZI A;  3AN1 A;  1FRD A;  3PVW A;  2RUK B;  3VUW A;  4GMX B;  3JVZ X;  4X57 B;  1DOY A;  4HWI B;  1ZKH A;  5DIF B;  4KDI C;  2IJ0 A;  1KLU D;  3PEG A;  1NYR A;  1WXV A;  2V76 A;  3RYT A;  3PP2 A;  3HQC A;  4KHO A;  3V5W A;  2JSV X;  3QAQ A;  1WXM A;  2KOX A;  1TT5 B;  5H92 C;  1XXG A;  2MX2 A;  1DBH A;  4BBN F;  2KAJ A;  4DBG A;  3ZDT A;  4XWT A;  2O2V B;  1RWS A;  3SU8 X;  4B0E A;  3T3O A;  1XF5 L;  3A1Q A;  1H10 A;  4GPT B;  3ZQ4 A;  2IZV B;  3RCP A;  1Z87 A;  1MG4 A;  3IAS 1;  2P0H A;  1HBK A;  4L1R A;  2YF0 A;  2E6X A;  1NVL A;  4REZ A;  4GDK A;  3DCX A;  2N9E B;  4JKA A;  2G4S A;  1MK7 B;  3SBG A;  2Z0O A;  3BZD B;  1TTN A;  2QSD A;  3A58 A;  1RFA A;  2DTC A;  4A6H A;  3KVF B;  2IO0 B;  1LFD A;  2J53 A;  2KGX B;  4L2Y A;  4AQ7 A;  2FDQ A;  2WXI A;  1EWC A;  4K3B A;  1OMW A;  1Y5O A;  2NPT A;  5E6P A;  3SV1 A;  1NI3 A;  1VLB A;  3PTF C;  5AUI A;  3U4E G;  3WAO A;  2OJR A;  2LGS A;  5G5G A;  4NPN A;  3NVV A;  5LXH A;  4S0R A;  1NBF C;  4A9A A;  3DVN U;  1V81 A;  2L0F A;  3SFD B;  4WQO B;  3V62 A;  4NQK E;  3AI5 A;  3I9V 1;  1X11 A;  4BAX A;  1KFY B;  3ZDM C;  2YLM A;  5JXV A;  4YL8 A;  3GS2 A;  1V5O A;  2DAF A;  1XLO A;  3B1L X;  5KCV A;  2RDB C;  2NBU A;  3IT4 B;  4HRS A;  1ACC A;  1YX5 B;  1N6Z A;  2LRW A;  1E7V A;  3R3M A;  3MC0 B;  1P7F A;  1ZW7 A;  2D3B A;  1F2R C;  1FFV A;  2KKC A;  2WXP A;  1EF1 A;  3U52 E;  5HG2 A;  4I6N B;  2AL6 A;  3N3K B;  5AEK B;  5TSS A;  2ROZ B;  5C16 A;  2Q13 A;  5IKC M;  4WJP A;  1YIW A;  1WMH A;  4Y94 A;  2LVP A;  1ENF A;  2KWV B;  4TQ0 A;  4TUU A;  2KXJ A;  1HXY D;  1L6V A;  1KBL A;  3FKY A;  4PT5 A;  3UF8 A;  4WVF B;  4HB4 B;  1X1M A;  2I5F A;  4OHJ A;  2V0G A;  3Q69 A;  2L0T A;  3QWZ B;  3DVG Y;  3HIE A;  2WXN A;  2WDV B;  2ZCB A;  4JK8 A;  4NJC A;  2DEN B;  2BWF A;  3DWM A;  1SEB D;  4K2P A;  1ZUD 2;  1MKE A;  1T0Y A;  2Y8F A;  4KZ0 A;  4ILH A;  3APF A;  1UEF A;  3W1S A;  4F8C B;  3ZUN A;  3MHS D;  3PV1 A;  4XGA B;  2AQ3 B;  1N5W A;  4LJO B;  1YJJ A;  4LCD E;  2OQB A;  2IGH A;  3WIM A;  2RMM A;  3LXF A;  2WS3 B;  2V4L A;  2X0S A;  5T8I A;  2KUQ A;  2TSS A;  1ZSQ A;  1WM3 A;  1I7A A;  1PGX A;  3NZS A;  4JGH B;  4HB2 B;  1YJI A;  2FID A;  5EE3 A;  2W2X D;  5D94 A;  5HE0 A;  5D3I B;  1T3Q A;  3DOW A;  4TYZ A;  3IVF A;  5GMV A;  1F9J A;  2L8J A;  3WCQ A;  2L1C A;  1P0R A;  2KAC A;  4JK9 A;  3OJ3 A;  2KC1 A;  4PS8 A;  3SEB A;  2LUL A;  1D5X C;  3NZU A;  2BYE A;  1ZP0 B;  1P6S A;  2N0Y A;  4DDG D;  5KHO A;  2YVC A;  1R7S A;  3ML4 A;  3DVG X;  3BJI A;  1BML C;  2J0K A;  4C7Z A;  5IO9 A;  5TR5 A;  1HEZ E;  4KAX B;  4KZC A;  1WX9 A;  4TMA B;  3APC A;  3CST A;  1WXQ A;  1HZ6 A;  4AUQ C;  3A8Q A;  4IM0 A;  2GUM A;  1BT0 A;  2D5G A;  2FAZ A;  2W55 A;  3HHM A;  1C79 A;  1MG8 A;  3SFE B;  2LXA A;  1YJ1 A;  3AE9 B;  3U7Z A;  4URK A;  4JWS C;  3L08 A;  5FR6 A;  1XD4 A;  2FCQ A;  2ON8 A;  3PT2 B;  3VTW A;  3JYU A;  2GB1 A;  1TJ6 A;  5D3D A;  2FE8 A;  5CX3 A;  4AP4 C;  5CLL B;  4AJY B;  4MJS B;  3QCA A;  5FR3 A;  4CQN A;  1SGH A;  4HB0 B;  3KW5 B;  4S17 A;  3TEY A;  3P2B A;  1UEL A;  1WVH A;  3HM6 X;  3JSV A;  1AWE A;  3L10 B;  1L7Y A;  2DBY A;  1YN5 A;  2KT7 A;  4JL9 A;  1RFK A;  2BPS A;  1FXT B;  2KX0 A;  1I4H A;  2VSZ A;  1WJ4 A;  5EE0 A;  2KLC A;  2L7R A;  2QC8 A;  3TEW A;  1DRO A;  2KNB A;  4F7U P;  5JH5 C;  1QKZ A;  3AJ4 A;  2LXC A;  4C00 A;  2RPQ A;  1ZPS A;  1E9M A;  4HSI A;  3V6E B;  3AE3 B;  2GRI A;  2ZPY A;  3SYX A;  3VUY A;  5MPO A;  3GE8 C;  2DYN A;  4P16 A;  4KVG B;  4II2 B;  2IY0 B;  1OQY A;  4GU2 A;  4K81 A;  2FCN A;  1Z2M A;  4PS7 A;  2LMC A;  3FIL A;  4XC2 A;  3ZTD A;  1J0G A;  2ABD A;  1SE2 A;  2G3Q B;  2KK8 A;  1ZDV A;  1W1G A;  4DBB A;  2V3S A;  1E8Y A;  5C5B A;  2MSE D;  2LWP A;  2QHO A;  3KLS X;  3BY4 B;  3VTU A;  3W5V B;  4A90 A;  1FNW A;  3RUI B;  3ML9 A;  3Q8C A;  1H8C A;  1TKE A;  5EE1 A;  3LYY A;  3T9L A;  4QAY A;  1UD7 A;  3UQA A;  2DN6 A;  2DZK A;  3NW8 A;  2LZ6 A;  3B2F A;  2EKI A;  4GGQ A;  2KFJ A;  2JT4 B;  1EWY C;  3NWA A;  1FIQ A;  3LB8 C;  2DIK A;  1IRS A;  1JRP A;  5BYR A;  4HPM B;  1U4A A;  3M3J A;  3JSV B;  3VAW A;  2YRY A;  1WJU A;  1UNS A;  3AE5 B;  1VJK A;  3VRB B;  1NDD A;  2JWZ A;  1V89 A;  1UZX B;  2GLS A;  3ULC A;  3C19 A;  1XR0 B;  2WHI A;  3QBV B;  3QJZ A;  1WE7 A;  3V05 A;  4D0N B;  3SBT A;  4LNI A;  3OLM D;  2X18 A;  4AWJ A;  5D3X A;  2RVB B;  1BWN A;  1LGR A;  2BS2 B;  1YNT E;  2LJI A;  3W5U B;  1F0Z A;  3BIN A;  3OHM B;  1KH0 A;  2JZP A;  1WM2 A;  3MHZ A;  2K8E A;  4DDI D;  2RDG A;  1JWB D;  3ZRF A;  4EFO A;  3VTV A;  1CK1 A;  4HDQ A;  1YN3 A;  3VR8 B;  1FB8 A;  2BKF A;  3Q3J A;  3GYO A;  3BK2 A;  4GLS C;  4NJ7 A;  2L1A A;  3ZXR A;  3FIL B;  3L16 A;  4CSQ A;  3VXW A;  1WRD B;  1SIJ A;  2JXT A;  3U2S C;  3TSS A;  4N58 A;  5C5B B;  4JKE A;  2MH7 A;  2N7J A;  1R4M B;  2LOZ A;  1SBB B;  4RGM A;  2LGI A;  5DPR A;  3FP5 A;  3NRZ A;  1V2Y A;  3IG3 A;  2JPH A;  3E56 A;  1FFU A;  3AE4 B;  3U12 A;  2R82 A;  5D7G A;  4ACF A;  2N9X A;  1JCK B;  5EFX A;  2A4Z A;  2A5U A;  1UNQ A;  1VRA B;  3BWU D;  1I4Q A;  1E8Z A;  2Y5C A;  2DYM A;  1TIF A;  3SO6 A;  2WP9 B;  2KLG A;  2BT6 A;  3SUZ A;  4KX6 B;  1MIZ B;  1QLB B;  5L81 A;  1JRO A;  4JKF A;  4NY0 A;  4ASW C;  1NTY A;  4RGT A;  2E2X A;  2ZNV B;  2UYZ B;  2H7D A;  2DNF A;  4KHB A;  2BWE S;  2CY5 A;  2D3G A;  2PLP A;  3HVZ A;  4KKJ A;  1ZGU B;  3T8M A;  1YQ4 B;  2KMA A;  2Y3A A;  2MBE A;  2N23 A;  2CQU A;  3P4P B;  1I7H A;  3GE3 C;  2QKL A;  1VCB A;  4GXB A;  3DDC B;  5DPS A;  2AX5 A;  4F7Z A;  1GUA B;  3AU5 A;  4EMO A;  2IDY A;  3W2D A;  3KQ4 A;  4XZ4 A;  4HRO A;  4OZC A;  3ZW3 A;  2D9W A;  2AEH A;  1SE9 A;  2V1Y A;  4NAM A;  3Q8A A;  1MFW A;  3QQ8 B;  2G45 B;  3SNH A;  2PJH A;  1GG3 A;  2D07 B;  4NJ6 A;  2DAJ A;  3VOQ A;  3AB5 A;  4K3C A;  5JHB A;  4Q2J A;  3PVL A;  2K22 A;  2PZ1 A;  4DIX A;  3H8H A;  4PYZ A;  2MBQ A;  2H89 B;  1HE8 A;  5JVL A;  3GZN I;  2JRH A;  2IO3 B;  2DYO A;  1VD2 A;  3DCG A;  2DHZ A;  1A5R A;  2K49 A;  4RFB A;  2YS3 A;  2BTE A;  4M8M A;  1C4C A;  2ADZ A;  3ZKJ C;  3T3N A;  2MWS B;  2FJL A;  2O2V A;  1K5D B;  4RMA A;  4EKU A;  2ROV A;  1U29 A;  5DHA B;  3PRE A;  4KHB B;  1WGG A;  1Q0W B;  2DWQ A;  2NZ8 B;  2EMS A;  2KD0 A;  2CAY A;  4WWP A;  3D8E A;  2FJ9 A;  2CHW A;  2NR2 A;  1HA5 A;  4NNJ B;  1HTQ A;  2HJ1 A;  4M00 A;  1Q10 A;  4BKS D;  3N9Y C;  3VH4 B;  3H7P A;  2M0A A;  2L2I A;  5CLQ B;  4FHK A;  3RMK C;  1WZ0 A;  3Q14 C;  3BK1 A;  1IGC A;  2D4Q A;  3KRW A;  1N5X A;  1AW7 A;  2GJY A;  2BQQ A;  2YSZ A;  1SSN A;  2KDE B;  1J19 A;  3RNC C;  2L3Z A;  3DVN V;  3RI7 C;  4QJ3 B;  3FM8 C;  3ODO A;  2K2J A;  3PLU A;  3B2G A;  2XNA C;  2RPV A;  3M63 B;  4B6W A;  3IHP C;  1NYQ A;  4GZU A;  3HRD D;  3A98 B;  1FRR A;  5L95 C;  1XD3 B;  1D5M C;  1UBI A;  1QQG A;  2QCZ A;  3RFZ B;  1OQR A;  1E7U A;  1ZDX A;  1U5D A;  1E0Z A;  1QIL A;  2RQ1 A;  3U7D A;  4JQW C;  1MPH A;  3M1I B;  2KQ7 A;  4CHJ A;  2LGY A;  2WXL A;  2IYD B;  4LTU A;  3DXE A;  4L6E A;  4K1R B;  1T6B X;  1OEY J;  2WH5 A;  2UU7 A;  3KYD D;  2LVQ A;  4IC7 B;  2WYQ A;  2Y5B B;  4H8S A;  3LJU X;  4HAZ B;  1TKY A;  4IWO A;  3ZXV A;  2ZVO A;  2DYQ A;  3CF6 E;  5E6N A;  1X05 A;  4EZJ A;  1P5T A;  1L6U A;  2D9X A;  3MJW A;  1WGK A;  1WJN A;  2Z0P A;  2KAN A;  2JZ3 B;  5G5H A;  3A4R A;  2COA A;  1YQB A;  2LVO A;  2X38 A;  2PW9 A;  4CO7 A;  4I6L B;  2Z4D A;  3MJ5 A;  3RZF A;  2KDB A;  3MPX A;  3Q6B A;  3RNG C;  3U30 A;  1PYW D;  2HTM E;  1PLS A;  2RSG A;  2G9H D;  2W3S A;  3IFW B;  4P1B C;  4ANU A;  4FAD A;  4HK2 A;  1V5M A;  3KY9 A;  2J59 M;  1SHC A;  4MY6 A;  3ENE A;  4YON A;  3H7P B;  4C56 C;  2GBN A;  2BYF A;  2K1F A;  4BVU C;  5J3T A;  2GOW A;  2LGD A;  3CSF A;  1RRP B;  1Y8R C;  3ODW A;  1R4M I;  2WXR A;  2QIE B;  2LHE A;  1QOA A;  2NBV B;  2RNR B;  2L05 A;  2KN5 A;  1N3H A;  4K2O A;  3TFM A;  1C76 A;  2GBK A;  2UZR A;  3WAP A;  3R2I A;  3PSC A;  4JKG A;  1U5G A;  4YSX B;  4ZOH C;  2O6V B;  1MVK A;  4WJQ A;  5DI9 B;  4LNN A;  1QQR A;  4HXD A;  2K5P A;  4LNF A;  2W9N A;  4FJZ A;  3B77 A;  2R2O A;  4XDC A;  2BB5 A;  4A6F A;  4RM9 A;  1MIX A;  2INN E;  4GDL A;  3NG0 A;  4K7W A;  1XCQ L;  1K5G B;  1WXA A;  4A20 A;  4RCO A;  2KO3 A;  1C4A A;  1SF0 A;  2MJD A;  3AE1 B;  1NU2 A;  1V9J A;  2PMV A;  4MH8 A;  3ZO5 B;  1ROE A;  1EUV B;  1WE6 A;  2H7E A;  2NBW B;  4LJP B;  2BYV E;  2L83 A;  1P3Q U;  5LNK 1;  4C4V A;  5KQ4 A;  2CU1 A;  4NAW B;  4RGO S;  3VRA B;  3ZJV A;  3OG5 A;  4A6Q A;  4JKD A;  4KHA A;  3MC8 A;  2EJ8 A;  3T06 A;  2HE7 A;  4KSL C;  2OTX A;  3M95 A;  2KWD A;  2LOX A;  3WA0 A;  2IND C;  2C7N B;  2INC C;  4N59 A;  5FI0 A;  4QXA B;  1JWS D;  4RF1 A;  1XOD A;  2NVU I;  4FLH A;  2MCN B;  1KLG D;  2CHZ A;  1XCT L;  2Z0Q A;  3KUC B;  2WNM A;  4OW0 A;  4MJS A;  4A5K A;  1KTK A;  4RNA A;  2WX0 A;  1U5F A;  1WIA A;  4RH6 A;  1YMH E;  3SHQ A;  3PZ8 A;  1TY0 A;  4ILJ A;  5LOP B;  2LKO A;  4JKG B;  2ZKM X;  3FEH A;  4US9 A;  1AWD A;  3NVW A;  2BW2 A;  4WWO A;  2NTS A;  1NEK B;  4IAP A;  4ILG B;  2CJN A;  1FMA D;  3MFG A;  3GOE A;  1M94 A;  2LYD A;  2KFK A;  1OFF A;  1W1H A;  4E74 A;  2MHJ A;  1B9R A;  1HB6 A;  2M14 A;  4A6F B;  1DDV A;  4GDL B;  2ZW0 A;  2KDI A;  2XQN M;  2W2X C;  2UVM A;  1D5Z C;  2CB8 A;  2M17 A;  2ZVN A;  4Z2N A;  4MDK E;  5HE3 A;  3DWG C;  1Q5W B;  3PVU A;  1TGZ B;  3N32 A;  2H88 B;  4W9D A;  2N1V A;  3I5J C;  4HVB A;  1SE3 A;  2B76 B;  4B95 A;  3ECI A;  3E9L A;  4GNK B;  4ANV A;  1PUT A;  4GN1 A;  4C4V B;  2P0F A;  2GBJ A;  4NQL B;  1OQQ A;  2GBR A;  1RLF A;  3H1U A;  4AOF A;  2JF5 A;  3DHI C;  2ZPN A;  4BOS C;  4AS1 A;  3AE6 B;  1M4V A;  1V6E A;  1XKE A;  2OHF A;  2AQ2 B;  2KYW A;  4YWG G;  4BBN C;  2KVZ A;  3H7S A;  3LDZ E;  5JHH A;  3P1M A;  4W9G A;  3QAR A;  2AWT A;  2YS1 A;  3DPD A;  3A33 B;  1RM6 C;  5IRS A;  2JQR B;  1WFY A;  4IG7 B;  3V3X A;  1V1P B;  2HTH A;  2OJW A;  5LON B;  3ML8 A;  4CHK A;  3RT3 B;  3EFU A;  1JRU A;  3W1S C;  3D8D A;  4EJN A;  2K6D B;  2D3A A;  1E90 A;  2BB6 A;  5AZG A;  2CY4 A;  3ZVV A;  3P6A A;  1YQ3 B;  4K17 A;  1FNV A;  1HTO A;  2WXO A;  3GZN B;  3IXS A;  2G35 A;  1RRB A;  2LHD A;  3TL5 A;  4EUT A;  1QC6 A;  5BMG A;  3DBR B;  2KFK B;  3BYT B;  5I4D A;  4TV3 A;  1NTI A;  1HZ5 A;  2V3N A;  2WLB A;  2PE9 A;  2BF8 B;  1KRH A;  1UGJ A;  2XN9 C;  3KRX A;  4L1B A;  1C77 A;  4B6H A;  1SXT A;  1TJE A;  3N1Z C;  2JYT A;  5AUK A;  2I38 A;  1TS2 A;  2WDT B;  4BFR A;  2J0J A;  1FNU A;  4YSZ B;  1FD6 A;  1UPQ A;  2N7E A;  4MGY E;  1K51 A;  1JW9 D;  5BYS A;  5J17 A;  1J0W A;  2MKR A;  1UBQ A;  2DZM A;  3E9O A;  4C0A A;  3QWM A;  3AU4 A;  3P4S B;  4IM2 A;  2PVO D;  1IP9 A;  3N7C A;  4OSN A;  1G6J A;  1B55 A;  1KZG A;  3DQV A;  2RRF A;  1E6E B;  2IY1 B;  4TQ1 A;  4IFS A;  2V3P A;  2LAS A;  3Q3M C;  1FAO A;  1WSP A;  3ZNZ B;  5I2S A;  3GB1 A;  1DOX A;  1BTN A;  1SE4 A;  4WJN A;  1GGO A;  2K00 A;  4Z2M B;  2GCL A;  3ZIM A;  4ZHP A;  4IW0 A;  1UWM A;  2M4N A;  2HTH B;  4W9E A;  4XDD A;  1GC7 A;  1SIF A;  1VZ7 A;  1KLV A;  3NS1 A;  2FUH B;  2CHX A;  3KUZ A;  1GPX A;  1V88 A;  2R2Q A;  2LBB A;  3H9D A;  2DA0 A;  1KI1 B;  2I1J A;  5HKH A;  3UIO B;  3DHG C;  3AE7 B;  3ZJT A;  2N1W A;  3NZ3 A;  4WAA A;  4N6E B;  3RPF C;  1JWM D;  4MT5 A;  2COP A;  1D6E C;  4HJG E;  3MDB C;  3EGR A;  3I3T B;  2JU6 X;  3UI3 A;  3IBE A;  2KJR A;  2SAK A;  1KM7 A;  3P4R B;  3ALB A;  3RNE C;  2QKM A;  2COC A;  4YSY B;  4R3D A;  1I4P A;  1HQR D;  4GOU A;  1GB1 A;  2HDE A;  1JAL A;  1F2R I;  2QIL A;  4HEA 1;  5DHF B;  2WXQ A;  4BZA A;  1WR6 E;  2SEB D;  2Z14 A;  4D6W A;  2IFS A;  3K9P B;  1MK9 B;  1TKG A;  2IPK D;  3ENB A;  1MI0 A;  5D6J B;  2KMM A;  1WJ6 A;  3DXD A;  2N9P C;  3HK0 A;  2JP2 A;  3KZ1 A;  4MT7 A;  4TKN A;  1MJD A;  3UZT A;  1J7C A;  2K8C A;  2KQS A;  2KMC A;  4WUR A;  2DX5 A;  4WAF A;  1EM7 A;  1YX6 B;  4GIV A;  1WY8 A;  3KWV A;  1FGZ A;  3RNB C;  3HM3 A;  3WYF B;  3VFK A;  4PNK A;  1M7E A;  3M62 B;  4YTP B;  2AQ1 B;  1WZ3 A;  2LGX A;  3SD5 A;  1UF0 A;  1GC6 A;  3NOB A;  1EAZ A;  2WDQ B;  2YT1 A;  1P9D U;  3PLV A;  1K52 A;  3EHV A;  1R4N B;  3Q8E A;  4MH0 E;  4FJY A;  2ELB A;  3VHT C;  3OJ4 B;  3O65 B;  2KWC A;  4XYC A;  3HUI A;  3L0W B;  2JXX A;  3NS8 A;  4A8X C;  1SJH D;  1WF9 A;  1OTR B;  2W82 A;  4WSF A;  1N60 A;  5DH9 B;  1IGD A;  4ICU A;  1JML A;  2LI5 A;  3CWI A;  4JWU C;  4A6K A;  2KCJ A;  2GMI C;  1FCL A;  1GJZ A;  2M0X A;  4EEW A;  5BYQ A;  3RD2 A;  4LLG M;  4B0M A;  1ET9 A;  4ANW A;  4ARI A;  1IYF A;  2FIF A;  2KJH B;  4BKS A;  4ZRP A;  1LB1 A;  2D9Z A;  1GOZ A;  3MC9 A;  4YTM B;  1WJM A;  3RCZ A;  2COD A;  1QOG A;  2DLB A;  1FHW A;  4JK7 A;  3BYY B;  2OED A;  4FHJ A;  2G4D B;  1MHH E;  4H2A A;  4ZDV A;  2ELA A;  5HI1 A;  1WGQ A;  1BTK A;  2DX5 B;  2RSU A;  2FNJ B;  3PZ7 A;  1FOE A;  2AL3 A;  4JLC A;  4W9I A;  3Q3N C;  3A8P A;  1NI2 A;  2YEP B;  4GSW A;  4IDI A;  3PSE B;  3DBS A;  1T77 A;  1V49 A;  1L2N A;  1U5E A;  2MW5 A;  1TY2 A;  5HE2 A;  4IOI E;  2LG1 A;  2K8B A;  5L83 A;  3HSA A;  1WX8 A;  2C60 A;  4QJ5 B;  2FCM A;  2EMT A;  4HAY B;  3N1Y C;  3DBR I;  2WXH A;  3Q2A C;  3WAL A;  5HHD G;  2MDX A;  4DXG A;  2QEJ C;  2DFK A;  2Y5P A;  5CHV C;  3KWL A;  1LW3 A;  4PS3 A;  1C1Y B;  5IN7 A;  4USA A;  4OVV A;  2QJL A;  5H8Y E;  2WU2 B;  1D4B A;  3DXC A;  3HIZ A;  3TUO A;  1P3R A;  1FHO A;  4I6P A;  2LUE A;  3X23 A;  2X8X X;  1A70 A;  1ZXH A;  3A9K B;  1WXS A;  5GXG B;  1AAR A;  1CZP A;  2DKQ A;  5JHA A;  1UNR A;  2D9V A;  2WGS A;  1WRI A;  1EU4 A;  5IAA C;  3F0W A;  1F77 A;  5FI1 A;  1C9F A;  3TCA A;  1EF5 A;  5D3V A;  1JQ4 A;  1CJE A;  5IJM A;  1FXI A;  1C4P A;  3X0W A;  1TQZ A;  4KV2 A;  3MP9 A;  4PK1 A;  3FLV A;  3QHT A;  4HCP B;  3PZD A;  3AXC A;  3ZNI D;  3ODX A;  4M01 A;  2CRF A;  4G50 A;  2PIA A;  3APD A;  2LRU A;  2NBV A;  1YOV B;  3I57 A;  3G9W A;  1VR9 A;  2FBW B;  2BCJ A;  1ISN A;  1J7B A;  3B9J A;  1FEH A;  2IO1 B;  4HLE A;  1WGH A;  3BII D;  2YT2 A;  2WXM A;  3AEE B;  1L0Y B;  1FCC C;  4IOY X;  2O6V A;  2P8V A;  4FXC A;  1PFJ A;  1IBX A;  3E9S A;  1XLQ A;  3K9O B;  3R66 C;  1X1G A;  2LUM A;  1V5U A;  1WGY A;  1L0V B;  3KUD B;  2EC1 A;  2J4X A;  2PEA A;  2BS4 B;  4DX9 0;  4KKI A;  1JWA D;  4KGS A;  1DYN A;  5D27 A;  1XEE A;  4GOC A;  4LNO A;  5D3W A;  5HFY A;  3P4Q B;  2M8S A;  1SB3 C;  1OGW A;  3AEC B;  2R0D A;  1L4D B;  5IP4 D;  2MFQ A;  1P1A A;  3ZYY X;  3QX1 A;  4BKT A;  3I63 C;  3JW0 X;  3PS6 A;  4AJW A;  1WX7 A;  3L13 A;  2C5L C;  2WX1 A;  2ICI A;  4DWF A;  3ONS A;  3QIJ A;  2GBM A;  4DK5 A;  4HKZ E;  5J3Q A;  1WI1 A;  2W2W A;  4NAW A;  5JLJ B;  1E5W A;  4P1C C;  3DHH C;  1C78 A;  2LD9 A;  4ZYN A;  2MQJ A;  3UIN B;  1E7P B;  1IUE A;  4PQ0 A;  4ZHO A;  4WJO A;  3EEC A;  2KC2 A;  1RYJ A;  1SJE D;  1I35 A;  1TZ1 A;  1I4R A;  1GNU A;  3BVG A;  1HB8 A;  4OT1 A;  2VRW B;  1VZ6 A;  2PE6 B;  3NHE B;  4MGK E;  1VDV A;  3OWE B;  1S3S G;  3PPA A;  4TSS A;  4YTN B;  4EZK A;  2IO2 B;  3AEF B;  3D32 A;  4BOZ B;  2K0P A;  4NZL B;  3WAM A;  5J2R A;  3AE2 B;  3ABV B;  2O6V D;  2JVC A;  3V6C B;  1GAQ B;  1R4N I;  2IBI B;  4ZRK A;  1QZE A;  4XE0 A;  3A4S C;  1IBX B;  1DIK A;  4HAU B;  4M0W B;  2NMQ A;  4BBK A;  1DGJ A;  4HJK A;  4DHZ E;  5DPW A;  1L5P A;  1CMX B;  4IM3 A;  3UIP B;  3Q3O C;  5FKA C;  1WGR A;  3TJP A;  3H6N A;  2L00 B;  4FJV B;  3O13 A;  4LDT D;  3A9J A;  2E3T A;  4G3X B;  1DOI A;  2KQ4 X;  4DXA B;  4LDT B;  2D3C A;  1STE A;  2HJ8 A;  3ZTC A;  2C9W B;  4YT0 B;  1VBG A;  3TW1 A;  4OVZ A;  2GCJ A;  1V8C A;  4US8 A;  2JY6 A;  2VZK D;  4BKG A;  3EPY A;  1WGD A;  3VQI A;  2VZK B;  5JZE B;  3AM9 A;  3NWD A;  1AYF A;  2JX5 A;  2RD0 A;  3OAW A;  4XWW A;  2WWZ A;  5FK9 C;  4KIK A;  2RDH A;  2BVC A;  4C80 A;  5G55 A;  1T5X D;  3NVY A;  4J3O D;  3BVZ A;  3A1Q B;  2KDM A;  2KIE A;  3KH0 A;  4RF0 A;  3N30 A;  5E6J A;  2WDR B;  4PYU A;  3R7R A;  4W9C A;  5KQ1 A;  1ZVR A;  2I5C A;  4WIP A;  2WXJ A;  4GDK B;  1EVH A;  4HKQ A;  2YT0 A;  3B08 A;  2KUP A;  2CJO A;  4C7Y A;  1WR1 A;  1V1O A;  2Z0D B;  2R09 A;  1V1P A;  3LJ3 A;  1H4R A;  2N0S B;  1WG7 A;  4MM3 A;  5CHW A;  2R2Y A;  2V4I B;  3AEA B;  3ZNG C;  1B1Z A;  4ZRJ A;  3R7Q A;  2CKH B;  5IA7 A;  1PDX A;  4M02 A;  2MJ3 A;  3UGB B;  2KTR A;  2PPH A;  2JYE A;  3FAH A;  2V9H A;  2NPT B;  2DHJ A;  1WI0 A;  2ZZP B;  4JIO U;  2DZJ A;  2K3U A;  5JHG A;  2KJ6 A;  1I4G A;  1XQQ A;  2ZCC A;  5G2N A;  3A9J B;  1NEN B;  1FHX A;  4FUL A;  4CHM A;  1AN8 A;  1KOT A;  2MWN B;  2RR9 A;  3PRP B;  4EZL A;  4ZYS A;  1U27 A;  3P63 A;  2Y7B A;  3R8B A;  3N1X C;  2VH2 A;  3PG7 A;  4JX1 C;  2ONQ A;  2DX1 A;  3EFC A;  3W9C B;  2LEK A;  4JKB A;  4W9K A;  4HPP A;  3RNF C;  1WH3 A;  2AYO B;  3C0R B;  4KIK B;  4G0N B;  4WQM A;  1JDE A;  1FPY A;  2N9K A;  2QMT A;  2WXK A;  5D3Y A;  1K50 A;  1WMH B;  4LNK A;  1N61 A;  2DYB A;  5AZF A;  3IT6 B;  4CYE A;  4IWQ A;  1TXD A;  3RN9 C;  5EE9 A;  4HAW B;  1V97 A;  5DPT A;  2QDF A;  4RM8 A;  1WWT A;  5C3J B;  4ZRI A;  2KHW B;  2BKR B;  5E6O A;  4M8N A;  3PGE A;  4MM3 B;  1Y19 B;  3NJT A;  2CR5 A;  1LO5 D;  5C2T B;  4K7S A;  4IKG A;  2LFI A;  3RUL A;  4OVU A;  4HB3 B;  2KTR B;  3URY A;  3NWF A;  4WH4 A;  1MPE A;  1I42 A;  2WQY B;  1FO4 A;  1F52 A;  3DBH B;  3TIX A;  1KF6 B;  1N63 A;  4ZRQ A;  3CIK A;  2YS5 A;  1WGU A;  1ZOY B;  1X1F A;  3AMZ A;  1LM8 B;  1CQV A;  2DKP A;  3TBL D;  1ET6 A;  2NCN A;  2L76 A;  2BYT A;  3Q3F A;  4MEM A;  2ZJD A;  4L23 A;  2VRR B;  2YEP F;  4O1N A;  2IGG A;  3D8F A;  2EKE C;  3CIR B;  4WWN A;  5IOI A;  3CMM B;  3P42 A;  5CTR C;  4XX5 A;  3P7Z A;  4OZA A;  3WAN A;  1DDM A;  4LK0 M;  2HRJ A;  3Q8F A;  3AED B;  4E3C A;  4HPL B;  2KN4 A;  1ESF A;  1LQB A;  4K7U A;  1UH6 A;  1ZE3 D;  2W54 A;  3HVD A;  2WXG A;  2DHI A;  1UUP A;  1KJT A;  3TEZ A;  2COF A;  1WYW B;  2REX A;  4FBJ B;  4IWP A;  1TBE A;  1V5P A;  1VBH A;  1ZXI A;  3UQB A;  1LXD A;  1Z5S B;  3S2A A;  5M4Y B;  3W1Y A;  1E8X A;  2UWQ A;  1UNP A;  3ZLZ A;  1EGX A;  3TEX A;  1T0Q C;  1V61 A;  1ZM0 A;  2WU5 B;  1RJ2 A;  2RGN B;  2MP2 A;  4NSW A;  5CHF A;  1NVI D;  1L0X B;  3R2T A;  2EEL A;  4HHV A;  3GP7 A;  4N9F 4;  2MBH A;  5DCN A;  3L4P A;  5D2M B;  3GYP A;  1BXT A;  1TYG B;  3MTN B;  2MEK A;  2UZS A;  3DBL B;  4OZB A;  3AUL A;  3AEG B;  3PO0 A;  3PHW B;  2K2U A;  4DHZ B;  1Q67 A;  2J52 A;  1YD8 U;  3VIA A;  3VDZ A;  4FA6 A;  3EUB 2;  5C6R A;  2KDF B;  2ZW1 A;  3E9P A;  4IUM B;  4WWM A;  1I4X A;  5HE1 A;  1T0S C;  3VH3 B;  1TS4 A;  3ZJU A;  5JP4 A;  2K8H A;  3RNA C;  5BO4 B;  2NTT A;  2C7M B;  4A3O A;  1EO6 A;  1L4Z B;  1QOB A;  1N62 A;  4MGZ E;  1DDW A;  1YN4 A;  4UDU C;  3PHX B;  3NVZ A;  1WYG A;  4MGI E;  1NTV A;  2K39 A;  5LLI A;  2BGF A;  2JUO A;  2JWU A;  5I2M A;  1GB4 A;  4KSK C;  1S1Q B;  4II3 B;  4P7I A;  5KHQ A;  2C7H A;  3NSU A;  3VVW B;  1IPG A;  3Q8B A;  3OAN A;  2M19 A;  5GOW B;  3HW2 B;  2J0M A;  2J42 A;  2DHK A;  3C8Y A;  2VH1 A;  2N9L A;  4F7H A;  2XK5 A;  3VR9 B;  4E71 A;  1WJ1 A;  2RGF A;  2MA9 B;  1QOF A;  1QT9 A;  1E10 A;  4HAV B;  5AZH A;  2MJE A;  1KZ7 A;  3ETR A;  3SR6 A;  3AE8 B;  1U2B A;  1MAI A;  1D3Z A;  3AH7 A;  4KGT A;  4ARC A;  3V61 A;  2MP2 B;  2BBC A;  4W9H A;  1JWU D;  5EDS A;  1W1D A;  2ZEQ A;  5J3Y A;  3ZRC A;  4A55 A;  1VZ8 A;  2LJ5 A;  2Z59 A;  3N20 C;  3FVC A;  4JE3 B;  4DHJ D;  5BMH A;  2Q5W D;  4XWX A;  1I2H A;  2PVG C;  4F1S A;  1PMS A;  1P98 A;  3A9K A;  4MSM B;  4DHJ B;  2MRP A;  3EC8 A;  2ZNV C;  2GS0 A;  1K53 A;  1EU3 A;  1BAK A;  1OY2 A;  3ULB A;  2KZR A;  2INP E;  2Y8G A;  2PTL A;  5C23 A;  4W9F A;  2Z0E B;  2D10 A;  1KC7 A;  1BUI C;  1TS3 A;  2WXF A;  4QJ4 B;  5BMI A;  2I1K A;  2GI9 A;  3QK0 A;  3VUX A;  4GB9 A;  1ACA A;  1RAX A;  3FC4 A;  2L32 A;  2BS3 B;  2FUG 1;  2XEW A;  4EE2 A;  2KTF A;  4JKH A;  3NUH B;  1TS5 A;  2D9Y A;  2ACZ B;  2XBB C;  2IGD A;  2NS5 A;  2W3R A;  4MSQ B;  3BVM A;  2Z13 A;  2ASQ A;  2KX3 A;  4DQO C;  4P6V F;  1OQN A;  2RLO A;  2KIG A;  2G1E A;  2L52 A;  3PRZ A;  2VKI A;  2XK5 B;  2R61 A;  2MBB B;  2K6Q A;  2FJU B;  1FM0 D;  3AEB B;  1DYQ A;  1V5T A;  3SDL C;  4HDO A;  4ICV A;  4MAC A;  2FCS A;  2M56 B;  3DBH I;  1QF6 A;  3V60 A;  4ANX A;  2NMB A;  2N7D A;  1K8R B;  4G11 A;  1PGA A;  1MI1 A;  4EOY A;  3NY5 A;  4HAT B;  3ZNH B;  2HD5 B;  1V80 A;  4B9K A;  5C79 A;  3TVV A;  1Y56 A;  2Z59 B;  4KDL B;  5LG4 B;  3AV8 A;  1MHX A;  4JPS A;  1XT9 B;  4J6I A;  2IYB A;  2KVR A;  2MLB A;  3ZVR A;  1ZC4 B;  2JRI B;  1X86 A;  1UPR A;  1P7E A;  4MEL A;  3QA8 A;  2OOB B;  2P0D A;  2CS4 A;  3ZGZ A;  2KR0 A;  4RGN A;  3F5R A;  3FSS A;  2Z8L A;  2JZZ A;  3KYC D;  4W9J A;  5J18 A;  4MK0 A;  1ST7 A;  4HAX B;  2D11 A;  1XLP A;  3O96 A;  2I2Y A;  2M38 A;  1ZC3 B;  1Q1O A;  1T0R C;  4F7G A;  3IAM 1;  1AQC A;  1PGB A;  1XCG A;  2K25 A;  1UWX A;  4DXF A;  1J7A A;  1F1H A;  1E8W A;  2MBO A;  1XLN A;  2K9X A;  3RZW C;  5LXI B;  1ZYI A;  4GMV A;  2CU3 A;  4FN2 A; 
#chains in the Genus database with same CATH homology
 4W9L A;  1V86 A;  3CXB B;  5C1Z A;  1OEY A;  3L54 A;  3L17 A;  2B3A A;  1C3T A;  3QC8 B;  2DLW A;  1PQS A;  2N4F A;  1J8C A;  2D2Q A;  2J7Q B;  2M1M A;  1XX0 A;  4JKC A;  3TMP B;  1UGM A;  3B0A A;  1M7R A;  3TO1 A;  3KSY A;  4A3P A;  3E66 A;  4DX8 A;  3U8Z A;  1FGY A;  3DBL I;  4HCN B;  4WJ7 A;  2KWU B;  3PRM B;  2DZI A;  3PVW A;  2RUK B;  3VUW A;  4GMX B;  3JVZ X;  4X57 B;  4HWI B;  1ZKH A;  5DIF B;  4KDI C;  3PEG A;  1WXV A;  2V76 A;  3RYT A;  3PP2 A;  3HQC A;  4KHO A;  3V5W A;  3QAQ A;  1WXM A;  2KOX A;  2MX2 A;  4BBN F;  1DBH A;  4DBG A;  3ZDT A;  2O2V B;  3SU8 X;  3A1Q A;  1H10 A;  4GPT B;  2IZV B;  3RCP A;  1Z87 A;  2P0H A;  1HBK A;  2YF0 A;  1NVL A;  4GDK A;  2N9E B;  4JKA A;  2G4S A;  1MK7 B;  3SBG A;  2Z0O A;  1TTN A;  1RFA A;  2DTC A;  4A6H A;  3KVF B;  2IO0 B;  1LFD A;  2KGX B;  2FDQ A;  1OMW A;  1Y5O A;  2NPT A;  5E6P A;  3SV1 A;  3PTF C;  3WAO A;  2OJR A;  4NPN A;  5LXH A;  1NBF C;  3DVN U;  1V81 A;  2L0F A;  4WQO B;  3V62 A;  4NQK E;  3AI5 A;  1X11 A;  3ZDM C;  2YLM A;  4YL8 A;  1V5O A;  2DAF A;  3B1L X;  5KCV A;  2NBU A;  1YX5 B;  2LRW A;  1E7V A;  3R3M A;  1ZW7 A;  2KKC A;  1EF1 A;  4I6N B;  2AL6 A;  3N3K B;  5AEK B;  2ROZ B;  5C16 A;  2Q13 A;  4WJP A;  1YIW A;  1WMH A;  4Y94 A;  2LVP A;  2KWV B;  4TQ0 A;  4TUU A;  2KXJ A;  1KBL A;  3UF8 A;  4WVF B;  4HB4 B;  1X1M A;  2I5F A;  2L0T A;  3QWZ B;  3DVG Y;  2ZCB A;  4JK8 A;  2DEN B;  2BWF A;  4K2P A;  1MKE A;  1T0Y A;  2Y8F A;  4KZ0 A;  4ILH A;  3APF A;  1UEF A;  3W1S A;  4F8C B;  3ZUN A;  3MHS D;  3PV1 A;  4LJO B;  4LCD E;  2OQB A;  3WIM A;  2V4L A;  2X0S A;  1ZSQ A;  1WM3 A;  1I7A A;  3NZS A;  4JGH B;  4HB2 B;  2FID A;  2W2X D;  5D94 A;  5HE0 A;  3DOW A;  4TYZ A;  3IVF A;  5GMV A;  1F9J A;  2L8J A;  2L1C A;  1P0R A;  3OJ3 A;  4JK9 A;  2KC1 A;  4PS8 A;  2LUL A;  3NZU A;  2BYE A;  1P6S A;  2N0Y A;  4DDG D;  5KHO A;  2YVC A;  3ML4 A;  3DVG X;  3BJI A;  2J0K A;  5TR5 A;  4KAX B;  4KZC A;  1WX9 A;  3APC A;  3CST A;  4AUQ C;  3A8Q A;  4IM0 A;  1BT0 A;  2FAZ A;  3HHM A;  1MG8 A;  2LXA A;  1YJ1 A;  4URK A;  3L08 A;  5FR6 A;  1XD4 A;  2FCQ A;  3PT2 B;  3VTW A;  3JYU A;  1TJ6 A;  5CX3 A;  4AP4 C;  5CLL B;  4AJY B;  4MJS B;  3QCA A;  1SGH A;  4HB0 B;  3KW5 B;  3P2B A;  1UEL A;  1WVH A;  3HM6 X;  3JSV A;  1AWE A;  3L10 B;  1L7Y A;  4JL9 A;  2BPS A;  1FXT B;  2KX0 A;  2VSZ A;  1WJ4 A;  2KLC A;  2L7R A;  1DRO A;  2KNB A;  4F7U P;  5JH5 C;  3AJ4 A;  2LXC A;  2RPQ A;  3V6E B;  2ZPY A;  3SYX A;  3VUY A;  2DYN A;  4KVG B;  4II2 B;  2IY0 B;  1OQY A;  4GU2 A;  4K81 A;  2FCN A;  1Z2M A;  4PS7 A;  4XC2 A;  3ZTD A;  1J0G A;  2ABD A;  2G3Q B;  2KK8 A;  1W1G A;  4DBB A;  2V3S A;  1E8Y A;  5C5B A;  2MSE D;  2LWP A;  2QHO A;  3BY4 B;  3VTU A;  3RUI B;  3ML9 A;  1H8C A;  3T9L A;  1UD7 A;  3UQA A;  2DN6 A;  2DZK A;  2LZ6 A;  4GGQ A;  2KFJ A;  2JT4 B;  2DIK A;  1IRS A;  4HPM B;  1U4A A;  3M3J A;  3JSV B;  3VAW A;  2YRY A;  1WJU A;  1NDD A;  1UZX B;  1V89 A;  2JWZ A;  3ULC A;  1XR0 B;  3QBV B;  3QJZ A;  1WE7 A;  4D0N B;  3SBT A;  3OLM D;  2X18 A;  4AWJ A;  5D3X A;  2RVB B;  1BWN A;  3BIN A;  1WM2 A;  4DDI D;  3ZRF A;  4EFO A;  3VTV A;  4HDQ A;  1FB8 A;  2BKF A;  3Q3J A;  3GYO A;  4NJ7 A;  3L16 A;  3VXW A;  1WRD B;  5C5B B;  4JKE A;  2LOZ A;  5DPR A;  3FP5 A;  1V2Y A;  3IG3 A;  2JPH A;  2R82 A;  5D7G A;  2N9X A;  5EFX A;  2A4Z A;  2A5U A;  1UNQ A;  1E8Z A;  2DYM A;  3SO6 A;  2KLG A;  3SUZ A;  1MIZ B;  5L81 A;  4JKF A;  4NY0 A;  4ASW C;  1NTY A;  2E2X A;  2ZNV B;  2UYZ B;  2H7D A;  2BWE S;  2CY5 A;  2D3G A;  1ZGU B;  3T8M A;  2KMA A;  2MBE A;  2N23 A;  2CQU A;  2QKL A;  1VCB A;  4GXB A;  3DDC B;  5DPS A;  4F7Z A;  1GUA B;  3AU5 A;  4EMO A;  4XZ4 A;  3ZW3 A;  2D9W A;  2AEH A;  1SE9 A;  2V1Y A;  3QQ8 B;  2G45 B;  3SNH A;  2PJH A;  1GG3 A;  2D07 B;  4NJ6 A;  2DAJ A;  3VOQ A;  5JHB A;  3PVL A;  2PZ1 A;  4PYZ A;  2MBQ A;  1HE8 A;  5JVL A;  3GZN I;  2JRH A;  2IO3 B;  2DYO A;  1VD2 A;  3DCG A;  2DHZ A;  1A5R A;  2YS3 A;  4M8M A;  2ADZ A;  3ZKJ C;  2MWS B;  2FJL A;  2O2V A;  1K5D B;  4RMA A;  4EKU A;  2ROV A;  1U29 A;  5DHA B;  3PRE A;  4KHB B;  1WGG A;  1Q0W B;  2NZ8 B;  2EMS A;  2KD0 A;  2CAY A;  4WWP A;  3D8E A;  2FJ9 A;  2CHW A;  2NR2 A;  4NNJ B;  4BKS D;  3VH4 B;  3H7P A;  2L2I A;  5CLQ B;  4FHK A;  1WZ0 A;  2D4Q A;  3KRW A;  2GJY A;  2YSZ A;  2KDE B;  1J19 A;  2L3Z A;  3DVN V;  3FM8 C;  3ODO A;  2K2J A;  3PLU A;  4B6W A;  3M63 B;  3IHP C;  4GZU A;  3A98 B;  5L95 C;  1XD3 B;  1UBI A;  1QQG A;  1E7U A;  1U5D A;  2RQ1 A;  3U7D A;  4JQW C;  1MPH A;  3M1I B;  2KQ7 A;  4CHJ A;  2LGY A;  2IYD B;  3DXE A;  4L6E A;  4K1R B;  1OEY J;  2WH5 A;  3KYD D;  2LVQ A;  4IC7 B;  2WYQ A;  2Y5B B;  4H8S A;  3LJU X;  4HAZ B;  4IWO A;  2ZVO A;  2DYQ A;  3CF6 E;  5E6N A;  1X05 A;  4EZJ A;  1P5T A;  2D9X A;  3MJW A;  1WJN A;  2Z0P A;  2KAN A;  2JZ3 B;  3A4R A;  2COA A;  1YQB A;  2LVO A;  4CO7 A;  4I6L B;  3RZF A;  3MPX A;  2KDB A;  3U30 A;  3IFW B;  1PLS A;  2RSG A;  4ANU A;  4FAD A;  4HK2 A;  1V5M A;  3KY9 A;  2J59 M;  1SHC A;  4MY6 A;  3ENE A;  4YON A;  3H7P B;  2GBN A;  2BYF A;  2K1F A;  4BVU C;  5J3T A;  2GOW A;  2LGD A;  3CSF A;  1RRP B;  1Y8R C;  3ODW A;  1R4M I;  2NBV B;  2RNR B;  2L05 A;  2KN5 A;  1N3H A;  4K2O A;  3TFM A;  2GBK A;  2UZR A;  3WAP A;  3PSC A;  4JKG A;  1U5G A;  2O6V B;  4WJQ A;  5DI9 B;  4HXD A;  2W9N A;  4FJZ A;  2R2O A;  4A6F A;  4RM9 A;  1MIX A;  4GDL A;  4K7W A;  1K5G B;  1WXA A;  4A20 A;  2KO3 A;  1NU2 A;  1V9J A;  3ZO5 B;  1EUV B;  1WE6 A;  2H7E A;  2NBW B;  4LJP B;  2BYV E;  1P3Q U;  5KQ4 A;  2CU1 A;  4NAW B;  4JKD A;  4KHA A;  2EJ8 A;  3T06 A;  2HE7 A;  4KSL C;  2OTX A;  3M95 A;  2LOX A;  3WA0 A;  2C7N B;  5FI0 A;  1XOD A;  2NVU I;  4FLH A;  2MCN B;  2CHZ A;  2Z0Q A;  4MJS A;  4A5K A;  2WX0 A;  1U5F A;  1WIA A;  3SHQ A;  4ILJ A;  5LOP B;  2LKO A;  4JKG B;  3FEH A;  4WWO A;  4IAP A;  4ILG B;  3GOE A;  1M94 A;  2LYD A;  2KFK A;  1W1H A;  4E74 A;  1HB6 A;  2M14 A;  4A6F B;  1DDV A;  4GDL B;  2KDI A;  2XQN M;  2W2X C;  2UVM A;  2CB8 A;  2M17 A;  2ZVN A;  4Z2N A;  4MDK E;  5HE3 A;  1Q5W B;  3PVU A;  1TGZ B;  3N32 A;  4W9D A;  2N1V A;  4HVB A;  4B95 A;  3ECI A;  3E9L A;  4ANV A;  4GN1 A;  2P0F A;  2GBJ A;  4NQL B;  2GBR A;  1RLF A;  3H1U A;  4AOF A;  2JF5 A;  2ZPN A;  4BOS C;  1V6E A;  1XKE A;  4BBN C;  3H7S A;  3LDZ E;  5JHH A;  4W9G A;  3QAR A;  2AWT A;  2YS1 A;  3DPD A;  3A33 B;  1WFY A;  4IG7 B;  2HTH A;  5LON B;  3ML8 A;  4CHK A;  3RT3 B;  3EFU A;  1JRU A;  3W1S C;  3D8D A;  4EJN A;  2K6D B;  1E90 A;  5AZG A;  2CY4 A;  3ZVV A;  3P6A A;  4K17 A;  2G35 A;  1RRB A;  3TL5 A;  4EUT A;  1QC6 A;  2KFK B;  4TV3 A;  1NTI A;  2PE9 A;  2BF8 B;  3KRX A;  4B6H A;  2WDT B;  4BFR A;  2J0J A;  1UPQ A;  2N7E A;  4MGY E;  5J17 A;  1J0W A;  2MKR A;  1UBQ A;  2DZM A;  3E9O A;  4C0A A;  3QWM A;  3AU4 A;  4IM2 A;  1IP9 A;  3N7C A;  1G6J A;  1B55 A;  1KZG A;  3DQV A;  2IY1 B;  4TQ1 A;  4IFS A;  2LAS A;  1FAO A;  3ZNZ B;  1BTN A;  4WJN A;  1GGO A;  2K00 A;  4Z2M B;  2GCL A;  3ZIM A;  4IW0 A;  2M4N A;  2HTH B;  4W9E A;  1GC7 A;  1SIF A;  1KLV A;  2FUH B;  2CHX A;  3KUZ A;  1V88 A;  2R2Q A;  2LBB A;  3H9D A;  2DA0 A;  1KI1 B;  2I1J A;  5HKH A;  3UIO B;  2N1W A;  4WAA A;  2COP A;  3MDB C;  3I3T B;  3IBE A;  2KJR A;  1KM7 A;  3ALB A;  2QKM A;  2COC A;  5DHF B;  1WR6 E;  2IFS A;  3K9P B;  1MK9 B;  3ENB A;  5D6J B;  1WJ6 A;  3DXD A;  2N9P C;  3HK0 A;  2JP2 A;  3KZ1 A;  4MT7 A;  4TKN A;  2K8C A;  3UZT A;  2KQS A;  2KMC A;  2DX5 A;  1YX6 B;  4GIV A;  1WY8 A;  1FGZ A;  3HM3 A;  3WYF B;  3VFK A;  4PNK A;  1M7E A;  3M62 B;  1WZ3 A;  2LGX A;  3SD5 A;  1GC6 A;  3NOB A;  1EAZ A;  2YT1 A;  1P9D U;  3PLV A;  3EHV A;  4MH0 E;  4FJY A;  2ELB A;  3VHT C;  3OJ4 B;  3O65 B;  2KWC A;  3L0W B;  2JXX A;  3NS8 A;  1WF9 A;  1OTR B;  4WSF A;  5DH9 B;  4ICU A;  2LI5 A;  4A6K A;  2KCJ A;  2GMI C;  1GJZ A;  2M0X A;  4EEW A;  3RD2 A;  4ANW A;  1IYF A;  2FIF A;  2KJH B;  4BKS A;  1LB1 A;  2D9Z A;  1WJM A;  3RCZ A;  2COD A;  1FHW A;  4JK7 A;  4FHJ A;  2G4D B;  4ZDV A;  2ELA A;  1WGQ A;  1BTK A;  2DX5 B;  2RSU A;  2FNJ B;  1FOE A;  2AL3 A;  4JLC A;  4W9I A;  3A8P A;  1NI2 A;  4GSW A;  3PSE B;  3DBS A;  1V49 A;  1L2N A;  1U5E A;  2MW5 A;  5HE2 A;  2LG1 A;  2K8B A;  5L83 A;  1WX8 A;  2C60 A;  2FCM A;  2EMT A;  4HAY B;  3DBR I;  3WAL A;  2MDX A;  2DFK A;  5CHV C;  1LW3 A;  4PS3 A;  1C1Y B;  4OVV A;  3DXC A;  3HIZ A;  1P3R A;  1FHO A;  4I6P A;  3X23 A;  2LUE A;  3A9K B;  1WXS A;  1AAR A;  2DKQ A;  5JHA A;  1UNR A;  2D9V A;  5IAA C;  3F0W A;  5FI1 A;  3TCA A;  1EF5 A;  5D3V A;  5IJM A;  3X0W A;  1TQZ A;  4KV2 A;  3FLV A;  3QHT A;  4HCP B;  3PZD A;  3AXC A;  3ZNI D;  3ODX A;  2CRF A;  4G50 A;  3APD A;  2LRU A;  3G9W A;  2BCJ A;  1ISN A;  2IO1 B;  4HLE A;  1WGH A;  4IOY X;  2O6V A;  2P8V A;  1PFJ A;  3K9O B;  3R66 C;  1X1G A;  1V5U A;  1WGY A;  3KUD B;  2EC1 A;  2PEA A;  4DX9 0;  1DYN A;  5D27 A;  4GOC A;  5D3W A;  2M8S A;  1OGW A;  2R0D A;  2MFQ A;  1P1A A;  4BKT A;  3QX1 A;  3JW0 X;  3PS6 A;  4AJW A;  1WX7 A;  3L13 A;  2C5L C;  2WX1 A;  4DWF A;  3ONS A;  3QIJ A;  2GBM A;  4DK5 A;  5J3Q A;  1WI1 A;  2W2W A;  4NAW A;  5JLJ B;  1E5W A;  2LD9 A;  4ZYN A;  2MQJ A;  3UIN B;  4PQ0 A;  4WJO A;  3EEC A;  2KC2 A;  1I35 A;  1TZ1 A;  1GNU A;  1HB8 A;  2VRW B;  2PE6 B;  3NHE B;  4MGK E;  1S3S G;  3PPA A;  4EZK A;  2IO2 B;  3D32 A;  4BOZ B;  3WAM A;  5J2R A;  2O6V D;  2JVC A;  3V6C B;  1R4N I;  2IBI B;  4ZRK A;  1QZE A;  3A4S C;  1DIK A;  4HAU B;  4M0W B;  4BBK A;  4HJK A;  4DHZ E;  5DPW A;  1CMX B;  4IM3 A;  3UIP B;  1WGR A;  3TJP A;  3H6N A;  2L00 B;  4FJV B;  4LDT D;  3A9J A;  4G3X B;  4DXA B;  4LDT B;  2HJ8 A;  3ZTC A;  2C9W B;  1VBG A;  3TW1 A;  2GCJ A;  2JY6 A;  4BKG A;  3EPY A;  1WGD A;  3VQI A;  5JZE B;  2RD0 A;  3OAW A;  2WWZ A;  4KIK A;  5G55 A;  3A1Q B;  3KH0 A;  3N30 A;  4PYU A;  3R7R A;  4W9C A;  5KQ1 A;  1ZVR A;  2I5C A;  4GDK B;  1EVH A;  2YT0 A;  3B08 A;  2KUP A;  1WR1 A;  2Z0D B;  2R09 A;  3LJ3 A;  1H4R A;  1WG7 A;  4MM3 A;  5CHW A;  3ZNG C;  4ZRJ A;  3R7Q A;  2CKH B;  5IA7 A;  3UGB B;  2KTR A;  2PPH A;  2NPT B;  2DHJ A;  1WI0 A;  2ZZP B;  4JIO U;  2DZJ A;  5JHG A;  2KJ6 A;  1XQQ A;  2ZCC A;  5G2N A;  3A9J B;  1FHX A;  4FUL A;  4CHM A;  1KOT A;  2MWN B;  2RR9 A;  3PRP B;  4EZL A;  1U27 A;  2Y7B A;  3PG7 A;  2DX1 A;  4JKB A;  4W9K A;  1WH3 A;  2AYO B;  3C0R B;  4KIK B;  4G0N B;  1JDE A;  5D3Y A;  1WMH B;  2DYB A;  5AZF A;  4IWQ A;  4CYE A;  1TXD A;  4HAW B;  5DPT A;  4RM8 A;  4ZRI A;  2KHW B;  2BKR B;  5E6O A;  4M8N A;  3PGE A;  1Y19 B;  2CR5 A;  4K7S A;  3RUL A;  4OVU A;  4HB3 B;  2KTR B;  1I42 A;  3TIX A;  3CIK A;  2YS5 A;  1WGU A;  1X1F A;  1LM8 B;  2DKP A;  3TBL D;  2NCN A;  2L76 A;  3Q3F A;  4MEM A;  2ZJD A;  2VRR B;  3D8F A;  2EKE C;  4WWN A;  3CMM B;  5CTR C;  4XX5 A;  3P7Z A;  3WAN A;  1DDM A;  2HRJ A;  4E3C A;  4HPL B;  1LQB A;  4K7U A;  1UH6 A;  2DHI A;  1KJT A;  2COF A;  1WYW B;  2REX A;  4FBJ B;  4IWP A;  1TBE A;  1V5P A;  1VBH A;  3UQB A;  1LXD A;  1Z5S B;  3S2A A;  3W1Y A;  1E8X A;  2UWQ A;  1UNP A;  3ZLZ A;  1EGX A;  1V61 A;  1ZM0 A;  1RJ2 A;  2RGN B;  2MP2 A;  4NSW A;  5CHF A;  4HHV A;  4N9F 4;  2MBH A;  5DCN A;  5D2M B;  3GYP A;  3MTN B;  2UZS A;  3AUL A;  3PHW B;  2K2U A;  4DHZ B;  1Q67 A;  1YD8 U;  3VIA A;  3VDZ A;  4FA6 A;  5C6R A;  2KDF B;  3E9P A;  4IUM B;  5HE1 A;  3VH3 B;  5JP4 A;  2K8H A;  5BO4 B;  2C7M B;  4A3O A;  1EO6 A;  4MGZ E;  1DDW A;  3PHX B;  4MGI E;  1NTV A;  2K39 A;  5LLI A;  2BGF A;  2JUO A;  4KSK C;  4II3 B;  1S1Q B;  4P7I A;  5KHQ A;  2C7H A;  3NSU A;  3VVW B;  1IPG A;  3OAN A;  5GOW B;  3HW2 B;  2J0M A;  2DHK A;  4F7H A;  2XK5 A;  4E71 A;  1WJ1 A;  2RGF A;  2MA9 B;  4HAV B;  5AZH A;  1KZ7 A;  1U2B A;  1MAI A;  1D3Z A;  3V61 A;  2MP2 B;  4W9H A;  5EDS A;  1W1D A;  2ZEQ A;  5J3Y A;  3ZRC A;  2LJ5 A;  4DHJ D;  4XWX A;  1I2H A;  4F1S A;  1PMS A;  1P98 A;  3A9K A;  4MSM B;  4DHJ B;  2MRP A;  3EC8 A;  2ZNV C;  2GS0 A;  1BAK A;  1OY2 A;  3ULB A;  2KZR A;  5C23 A;  2Y8G A;  4W9F A;  2Z0E B;  2D10 A;  1KC7 A;  2I1K A;  3QK0 A;  3VUX A;  4GB9 A;  1ACA A;  1RAX A;  2XEW A;  2KTF A;  4JKH A;  2D9Y A;  2XBB C;  2NS5 A;  4MSQ B;  2ASQ A;  2KX3 A;  1OQN A;  2RLO A;  3PRZ A;  2VKI A;  2XK5 B;  2MBB B;  2K6Q A;  3SDL C;  1V5T A;  4HDO A;  4ICV A;  2FCS A;  3DBH I;  3V60 A;  4ANX A;  2NMB A;  2N7D A;  1K8R B;  4G11 A;  4EOY A;  3NY5 A;  4HAT B;  3ZNH B;  2HD5 B;  1V80 A;  4B9K A;  5C79 A;  3TVV A;  2Z59 B;  4KDL B;  1XT9 B;  4J6I A;  2IYB A;  2KVR A;  2MLB A;  3ZVR A;  1ZC4 B;  2JRI B;  1X86 A;  1UPR A;  4MEL A;  3QA8 A;  2OOB B;  2P0D A;  2CS4 A;  3F5R A;  3FSS A;  2JZZ A;  3KYC D;  4W9J A;  5J18 A;  4MK0 A;  1ST7 A;  4HAX B;  2D11 A;  3O96 A;  2M38 A;  1ZC3 B;  1Q1O A;  4F7G A;  1AQC A;  1XCG A;  2K25 A;  1E8W A;  2MBO A;  3RZW C;  5LXI B;  4GMV A;  3KUC B;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...