2EMTA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
313
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of PSGL-1 binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 89
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emtA01
3ULCA 1EO6A 1XD4A 3F0WA 4WSFA 2DX5B 1NVLA 3ZIMA 3VQIA 1W1DA 5AEKB 4DHJD 3QX1A 2B3AA 1V5MA 2D9WA 5HKHA 4ICUA 4P7IA 3HQCA 1XD3B 3N7CA 3EPYA 2BYEA 2KFJA 2H7EA 2O6VD 2H7DA 4DX90 3KVFB 3TVVA 3L0WB 2AL3A 4WWOA 3JYUA 4BBNF 2KJ6A 1WGGA 4D0NB 1W1HA 3FLVA 5DPSA 2KQ7A 3ZVRA 4ZRKA 3WAPA 4F7GA 1NTYA 1YX5B 5HE0A 2K25A 4K7UA 4F7UP 4DXAB 3SYXA 5TR5A 2RD0A 3LDZE 1ZVRA 4MT7A 1XX0A 3PPAA 4BKGA 2P8VA 1L7YA 3W1SA 5KHOA 3W1SC 2NCNA 3D8DA 2DN6A 2DTCA 1KLVA 4NPNA 1Y5OA 4FA6A 1GUAB 1BT0A 2CHZA 3APFA 3UGBB 1M94A 2X18A 3ZDMC 4BBNC 2ZVOA 1UBIA 1I7AA 1WM3A 1UEFA 1GC6A 2M8SA 2W2XC 2RPQA 3VOQA 2REXA 1Z5SB 2WDTB 2D4QA 2DA0A 4EKUA 4I6PA 3IG3A 2M1MA 3PRPB 2EKEC 2LXCA 3TO1A 4BKTA 4HXDA 3TJPA 4CHMA 1BAKA 3DDCB 3P6AA 1HB8A 1V5TA 1PLSA 2KC1A 3RZFA 3OANA 4GXBA 4WAAA 4GIVA 2RUKB 1DDMA 4NAWA 2MFQA 3WYFB 4JIOU 3QQ8B 4FHKA 3RYTA 3ZUNA 1OEYJ 3ZVVA 3DVGX 4M0WB 4KSKC 1Q67A 4ICVA 4MEMA 1U5EA 5JHAA 3SDLC 3VAWA 4IUMB 2KFKB 5D2MB 5LXHA 1ACAA 3H7PB 2JXXA 2CHXA 2D3GA 1F9JA 1OEYA 3DVNU 3G9WA 1PQSA 2K00A 1V6EA 4W9FA 5AZHA 2RVBB 3ONSA 4JLCA 5JH5C 3V5WA 1X86A 2C9WB 3UIOB 2N9EB 3JSVB 3TCAA 5J3YA 2Z0EB 4IWQA 2DYBA 1E8YA 2DZIA 2HJ8A 2O2VA 2KVRA 3A9KB 2R2QA 3U8ZA 1UBQA 3ENEA 1GJZA 4MGYE 5EDSA 4KHBB 4E71A 2JRIB 3A1QB 4GSWA 2ELAA 1EF5A 1ST7A 3QK0A 4JL9A 2AL6A 2LGDA 1ZM0A 2NS5A 5DPRA 4AWJA 2LWPA 2WWZA 3DCGA 2IY1B 2MP2A 3KW5B 4K2PA 2YF0A 3A8QA 1WY8A 3NSUA 2DYMA 3H7SA 1FHWA 5JP4A 3RUIB 1OQNA 3ODXA 3SO6A 4G50A 4HAXB 3H9DA 4II2B 2R09A 1LM8B 2KZRA 1YQBA 3L10B 1XQQA 3SV1A 3MJWA 3KY9A 2KWVB 5D3YA 2G4SA 2IO2B 4HLEA 2MWNB 2NVUI 1G6JA 3AJ4A 5FI0A 2DLWA 4FADA 2K8CA 3IVFA 4DBGA 2N9XA 2MRPA 3PP2A 3L13A 2PEAA 3HM3A 1X05A 2XK5B 1UGMA 4HPLB 3ZW3A 1X1MA 1UNRA 1NTIA 2ADZA 4AJYB 2KXJA 4XWXA 3MHSD 1Q0WB 5J3QA 3X0WA 2KDFB 3V6EB 3SU8X 2ZNVC 3GYPA 3ML4A 4IFSA 3HIZA 4EFOA 2G3QB 4K81A 3M62B 5C5BB 2MDXA 3PHXB 4IG7B 4CHKA 4EMOA 3GOEA 2MWSB 1PMSA 3MTNB 5JHBA 1ZGUB 4HB0B 4PYUA 4PS3A 2XQNM 2LVPA 1WMHA 2KK8A 3TW1A 4FN2A 2BPSA 4DHZE 4E74A 2WX1A 1ZW7A 2MBQA 1RLFA 3RD2A 1S1QB 4I6NB 2MLBA 5C79A 2L7RA 3VHTC 2CRFA 3UF8A 2IZVB 1LXDA 2GS0A 2HTHB 2V4LA 1HB6A 2R2OA 4OVVA 3TL5A 4A3PA 5AZFA 3QIJA 5HE3A 1Z2MA 2NPTB 3ALBA 3BJIA 2IO1B 3OLMD 2ELBA 1U29A 2COPA 2DHKA 4W9EA 4GMVA 5EFXA 3D8EA 4L6EA 4A5KA 4WJQA 3R3MA 3ECIA 1KZGA 4DHJB 1TTNA 4K17A 5CX3A 1MIZB 4WWNA 1V5PA 3ODOA 3CSTA 1AARA 5L81A 1YD8U 4HJKA 2O6VB 4MJSB 4W9LA 4HAUB 5JLJB 1AWEA 3PSEB 2D9YA 2KGXB 2MA9B 1NBFC 4RM8A 3ZTCA 1RRPB 1I2HA 1FGZA 3SD5A 2K8BA 2KTRA 2KDEB 3PLVA 2LASA 4Y94A 3NHEB 1WZ3A 4BOZB 2J7QB 4TUUA 4A6HA 3A98B 2YT0A 4KSLC 2BCJA 4ANUA 2NR2A 1V5OA 3KYDD 2YLMA 1KI1B 3AXCA 3I3TB 2YRYA 3SNHA 2N4FA 2YS5A 5D3WA 4GOCA 5KCVA 1RFAA 2BF8B 2FCMA 2CHWA 2JY6A 4NQKE 4GDKA 2COCA 3HM6X 4NNJB 4HB3B 5AZGA 1HBKA 2R0DA 3KZ1A 4CYEA 3RZWC 1M7RA 3U30A 1AQCA 4DK5A 1KM7A 2LZ6A 3PG7A 1SHCA 5J17A 4YONA 4FJYA 5IAAC 4FULA 2ZPYA 2K8HA 2ZCBA 1BTNA 2LBBA 2DX1A 2K2JA 2DAJA 5D94A 4WWPA 2IBIB 1LQBA 3JVZX 2FAZA 2KD0A 2VRWB 1H8CA 1P3QU 2RGFA 4KIKA 2C7NB 3DPDA 2MCNB 2P0HA 1V9JA 3VDZA 3ZKJC 3FSSA 4Z2NA 1E90A 5E6OA 4G3XB 4JQWC 4B6WA 1WM2A 2BYVE 1V89A 3QJZA 3FP5A 1NU2A 5LXIB 1X11A 2OTXA 4MGZE 2KC2A 3OJ3A 3TIXA 1UNQA 4TQ0A 4DHZB 3ZO5B 4ASWC 1RAXA 4J6IA 2Y8FA 2DYQA 2JPHA 4KV2A 1K8RB 1MG8A 2KX3A 2L3ZA 3UZTA 2ZZPB 1XKEA 4MSMB 2AWTA 1E7VA 3DVNV 2KDIA 4HATB 4DX8A 3DOWA 3WAOA 3DBRI 2KANA 5BO4B 2M14A 3KUZA 4HWIB 1WGQA 5C23A 4A6FB 3PV1A 2W2XD 2Z0QA 2KJHB 1SE9A 1Y19B 2CODA 3A9JB 1WJNA 3S2AA 4EJNA 2JF5A 4GB9A 1YIWA 3NZSA 4TV3A 1NI2A 1RRBA 2COFA 2DKQA 2VSZA 3K9OB 2LKOA 5D3XA 2DX5A 4G0NB 1FB8A 3FM8C 3VUYA 4XZ4A 2K6DB 1VCBA 4MY6A 2UZSA 4K1RB 1IPGA 2J0JA 4HDQA 2MP2B 2LRWA 3B1LX 3VFKA 1OY2A 4NQLB 2LUEA 5DPWA 3EHVA 2OQBA 1V2YA 1WRDB 4TYZA 3RCZA 2JVCA 1N3HA 2AYOB 2DHZA 1E7UA 2ZPNA 3H1UA 4H8SA 5KQ1A 4RMAA 1IYFA 1V5UA 2KX0A 3ZNID 2N0YA 2K1FA 3QA8A 2C7MB 2MW5A 1MPHA 2UYZB 2I5CA 3PVLA 1X1GA 2RNRB 5HE2A 4KAXB 4N9F4 5CHWA 2RLOA 3MPXA 1WG7A 1QC6A 2LULA 2K39A 4HCPB 4HB4B 5DIFB 2MBOA 4ANWA 1EF1A 5LONB 2NBVB 1U4AA 3L54A 1P5TA 3CMMB 4HK2A 1UELA 1E8ZA 2LXAA 2D9XA 3R7QA 4IWOA 2KJRA 2JWZA 1P0RA 1NTVA 1U5DA 2FJLA 3L16A 2CAYA 2DKPA 2JUOA 4IC7B 2YVCA 3QC8B 1GNUA 3KRXA 3SHQA 1DDWA 2P0DA 5DH9B 4BBKA 3PLUA 3KRWA 4LDTD 1LFDA 2Y8GA 2KWCA 1WGYA 2RGNB 4BKSA 3TMPB 4C0AA 2LYDA 3VUXA 3LJUX 4BKSD 1SIFA 4K2OA 5GOWB 1ZKHA 4HCNB 3ZNZB 4NJ7A 4IM0A 3RULA 3H7PA 4WJNA 4ZRIA 4GZUA 2KLGA 3ZLZA 5JHGA 2XEWA 4FBJB 4ANVA 3MDBC 4IWPA 4MDKE 1EGXA 2JP2A 1RJ2A 3QHTA 2XBBC 2CS4A 3JSVA 4MH0E 3VH3B 2EC1A 2HRJA 1D3ZA 4EOYA 3A9KA 3AU4A 4NSWA 2WX0A 4B9KA 4TQ1A 2N9PC 3QCAA 1U5FA 2GMIC 2DENB 2W9NA 4HAVB 2EMTA 5D27A 2JZZA 4EZLA 2Q13A 3K9PB 3N32A 1H4RA 2G45B 1TXDA 3A1QA 3QARA 2D11A 3FEHA 2C60A 1XT9B 4JGHB 1LB1A 2NZ8B 1C1YB 3VXWA 1Y8RC 2FCSA 4LCDE 2LG1A 1Q1OA 2JZ3B 4WJ7A 1QQGA 2PPHA 1OMWA 4KVGB 1UPQA 1OTRB 4A20A 2Z0OA 4MSQB 4GDLB 4M8NA 1XCGA 4F8CB 1A5RA 4HHVA 2OJRA 5FR6A 2IO0B 1KOTA 2I1JA 3HK0A 2KUPA 1Q5WB 1WJMA 3BY4B 2KNBA 3UINB 1WFYA 2L76A 4HB2B 2KO3A 4AUQC 4BOSC 5J18A 2Z0PA 2MQJA 2XK5A 3M3JA 3VIAA 4I6LB 3DQVA 5GMVA 4NY0A 2IYBA 2ROVA 3CXBB 5HE1A 4EEWA 1YJ1A 1U5GA 2I1KA 4KHOA 3AULA 4GN1A 4DBBA 1WIAA 5CHFA 4MGIE 4MGKE 2IYDB 3WAMA 4KDLB 2M0XA 5C5BA 2UWQA 4A3OA 1IP9A 1T0YA 2EMSA 3ZDTA 1MKEA 1GG3A 1WR1A 2E2XA 2PJHA 5KHQA 5CTRC 2YS1A 1V88A 2MKRA 1V61A 1TJ6A 4PS7A 2DYOA 3RCPA 1WGUA 3JW0X 1XODA 3HW2B 2DHJA 3QWMA 3PRZA 2LD9A 1OQYA 1DROA 3PS6A 4KZCA 1R4MI 4WJOA 1K5GB 2CY5A 1WX9A 3BINA 3U7DA 1WX7A 2HTHA 1J19A 1WJ1A 3KUDB 2CQUA 1WGRA 1C3TA 2KLCA 2N1VA 2LI5A 3A4SC 3PTFC 1NDDA 3NZUA 4IM3A 4M8MA 5C6RA 2Z59B 2LJ5A 2A5UA 5E6NA 2M4NA 2J59M 2NPTA 3APCA 3PSCA 2OOBB 3KUCB 2JT4B 4XC2A 2GBJA 1P1AA 2IFSA 1V86A 2ROZB 3IBEA 2M38A 1WZ0A 3PHWB 1HE8A 5J3TA 3TBLD 2N23A 5L83A 4DDID 1ZC4B 5DI9B 1X1FA 2LVQA 2V3SA 2MSED 2GBNA 3ML8A 5L95C 1V80A 2L00B 3L08A 1BTKA 4W9GA 1YX6B 2O6VA 4MJSA 3DBSA 3ODWA 3L17A 4CO7A 4NAWB 2GOWA 4NJ6A 3R7RA 2D07B 5C1ZA 4AJWA 2RSGA 3O96A 2UVMA 2BKRB 3M95A 4LJOB 4CHJA 1U27A 1WJ4A 3HHMA 4GGQA 3AU5A 1WI1A 3DXDA 2Y7BA 3DXCA 3R66C 2C7HA 3PVUA 1K5DB 1WYWB 5E6PA 3QWZB 4MELA 1IRSA 2N7DA 3WALA 3ULBA 4W9JA 5D6JB 2L0FA 4PS8A 3IHPC 4WJPA 2VKIA 2WYQA 5JZEB 3EECA 3OJ4B 2D9ZA 2QKMA 4IOYX 4B6HA 2EJ8A 2O2VB 1DDVA 3A8PA 1J8CA 4A6KA 3UQAA 1CMXB 1UNPA 1M7EA 1R4NI 3UIPB 3D8FA 3D32A 4HPMB 2BGFA 4LJPB 1TZ1A 3VUWA 4E3CA 5D3VA 5DCNA 4DWFA 3DBLI 3O65B 3APDA 4MK0A 2MBBB 1Z87A 2YT1A 4PQ0A 3T8MA 2COAA 3NS8A 3CSFA 1ZC3B 3ZTDA 1WH3A 1P6SA 5DHFB 1KJTA 1P9DU 3V60A 3PGEA 2LOZA 3KH0A 1PFJA 3B08A 5DHAB 4LDTB 3B0AA 1MIXA 1QZEA 3LJ3A 2IY0B 1EVHA 4BVUC 3NOBA 1WGDA 2D2QA 2QKLA 2KN5A 2GJYA 3M63B 2DYNA 3TFMA 3EFUA 3NY5A 2L8JA 1FHXA 3W1YA 2RSUA 2FCNA 1H10A 1P3RA 2Z0DB 4FHJA 2KCJA 5FI1A 3EC8A 3M1IB 4FJVB 3OAWA 4A6FA 2YSZA 2ZNVB 3QAQA 5G55A 4F7ZA 3A4RA 2ZVNA 4ZDVA 3A9JA 2LOXA 5DPTA 2KTFA 2CY4A 2ASQA 3ZNHB 4HVBA 1I42A 4W9HA 1UZXB 2BKFA 2WH5A 1MK7B 1E8XA 1WMHB 1ZSQA 4IM2A 2KOXA 2K2UA 2GBMA 3H6NA 1WI0A 5IA7A 4B95A 1DYNA 3A33B 4HAYB 2UZRA 5CLLB 2BWES 2MBHA 4HDOA 4W9CA 2JRHA 1WXAA 4HAZB 2Y5BB 2YS3A 2V1YA 2RQ1A 3VVWB 2P0FA 3VTWA 2KQSA 2A4ZA 3T9LA 5JHHA 2CB8A 4BFRA 2AEHA 1FXTB 2V76A 2DZKA 2KFKA 4GU2A 4X57B 5C16A 1WGHA 3GYOA 4TKNA 4EZKA 5D7GA 2LGYA 4W9IA 2M17A 2FCQA 2BWFA 3AI5A 4F1SA 2G4DB 3PREA 3GZNI 2NMBA 2ZEQA 2D9VA 2DFKA 1KZ7A 4IW0A 2RR9A 1FHOA 4KZ0A 1JRUA 2GCLA 1WE6A 5LOPB 4ANXA 1TQZA 1WX8A 4ZYNA 1FGYA 1E5WA 1WF9A 1GC7A 2CKHB 3P2BA 2N1WA 2FIDA 3VTVA 1E8WA 4GMXB 2J0MA 1WE7A 1WXSA 4AOFA 3V61A 3Q3JA 2KTRB 2FDQA 2KHWB 2MX2A 1V81A 2FNJB 3F5RA 2PZ1A 2W2WA 4GPTB 3SUZA 3T06A 1TBEA 4XX5A 3DXEA 4URKA 2LRUA 3PEGA 4W9KA 3P7ZA 3PRMB 1WXMA 3V6CB 1OGWA 2FJ9A 1WR6E 4KHAA 1I35A 2CU1A 4IAPA 4ZRJA 2NBWB 4FLHA 2L1CA 4OVUA 4GDKB 1SGHA 3WA0A 2HE7A 2K6QA 3CIKA 4WQOB 4HAWB 2PE9A 2PE6B 2D10A 4G11A 5IJMA 1MK9B 1XR0B 2ZJDA 1BWNA 2DZJA 2L05A 3UQBA 4K7SA 2KMAA 2KWUB 5J2RA 1W1GA 2DAFA 1UH6A 2FIFA 3ZRFA 1TGZB 1B55A 4YL8A 2GBKA 1UPRA 2HD5B 3IFWB 3X23A 2DHIA 2CR5A 1VD2A 4K7WA 4W9DA 1WJ6A 2KDBA 3VH4B 1FOEA 4F7HA 3DVGY 2N7EA 2I5FA 2FUHB 1J0GA 1EAZA 3KSYA 2MBEA 2DZMA 4KIKB 3ZNGC 1WVHA 1ISNA 2G35A 2J0KA 2BYFA 5CLQB 4EZJA 1WJUA 4II3B 4PYZA 3PVWA 4KDIC 2GCJA 2L2IA 2GBRA 2QHOA 4EUTA 1P98A 3VTUA 2LVOA 2IO3B 3KYCD 1V49A 1DBHA 3N30A 2L0TA 2VRRB 4WVFB 2ABDA 3V62A 1S3SG 2NBUA 1LW3A 2KKCA 3CF6E 4FJZA 3ZRCA 2KMCA 4RM9A 4PNKA 4AP4C 3WANA 3WIMA 3C0RB 3Q3FA 1FAOA 3ML9A 1U2BA 3QBVB 3N3KB 4MM3A 4Z2MB 2LGXA 1L2NA 5LLIA 5KQ4A 1WXVA 4GDLA 3PT2B 2ZCCA 5CHVC 3DBHI 3PZDA 1UD7A 3RT3B 1EUVB 1MAIA 1J0WA 5G2NA 2C5LC 4DDGD
chains in the Genus database with same CATH superfamily
3ULCA 1GB4A 1EO6A 2NTTA 1XD4A 2LHEA 5I2SA 3F0WA 4WSFA 1VLBA 2DX5B 1NVLA 3ZIMA 3VQIA 2JQRB 1W1DA 5AEKB 4DHJD 3QX1A 1LGRA 2B3AA 1V5MA 2D9WA 5HKHA 4ICUA 5C3JB 1NENB 4P7IA 3HQCA 3R8BA 2NMQA 4PK1A 1UWMA 1XD3B 3N7CA 3EPYA 1E0ZA 1KBLA 2BYEA 2KFJA 2H7EA 1TS3A 2H7DA 2O6VD 4DX90 3KVFB 3TVVA 3L0WB 2AL3A 3GS2A 4WWOA 2WXJA 4US8A 1JWUD 3JYUA 4BBNF 4DXFA 2KJ6A 1WGGA 4IKGA 4D0NB 1W1HA 3E9OA 1JWAD 3FLVA 5DPSA 2KQ7A 3ZVRA 4ZRKA 3WAPA 2BB5A 4F7GA 1NTYA 1YX5B 2WQYB 1F1HA 5HE0A 3PZ8A 2K25A 4K7UA 2KQ4X 4F7UP 4DXAB 2QCZA 3SYXA 5TR5A 3E56A 2RD0A 1GOZA 3LDZE 2HTME 2W82A 1ZVRA 1TKEA 3U4EG 4MT7A 4ITKA 1XX0A 3PPAA 4BKGA 1DOYA 1GPXA 2P8VA 1B9RA 1L7YA 3NVWA 3W1SA 5KHOA 3W1SC 2NCNA 3D8DA 1KF6B 2DN6A 2DTCA 3E9SA 2V9HA 1KLVA 4NPNA 1Y5OA 2JU6X 2MH7A 1GUAB 4FA6A 1BT0A 2CHZA 3APFA 3UGBB 1I4RA 1M94A 2X18A 3ZDMC 1M4VA 2WXOA 2H88B 4BBNC 2ZVOA 5C2TB 1UBIA 1I7AA 1WM3A 1K53A 3AEBB 1FNWA 1XEEA 1UEFA 1GC6A 1L0XB 2M8SA 2W2XC 2K49A 2RPQA 3VOQA 2REXA 1Z5SB 2N9KA 2WDTB 2D4QA 2Z4DA 4KKJA 2DA0A 4EKUA 1XO3A 4I6PA 3IG3A 4XDDA 1ZUD2 2M1MA 3PRPB 2EKEC 2LXCA 4RGTA 3TO1A 4BKTA 3ZJTA 2WXIA 4P16A 2L1AA 4HXDA 4JKAA 3NVYA 3TJPA 4CHMA 1BAKA 2DBYA 3DDCB 4ZRPA 3P6AA 2K22A 5IN7A 5H8YE 1HB8A 1V5TA 1JROA 1I4XA 3ABVB 1PLSA 1VZ7A 2KC1A 1JW9D 2IGGA 3RZFA 3OANA 4GXBA 3DBHB 4WAAA 4GIVA 2RUKB 1DDMA 1TIFA 4B0EA 3AE9B 4NAWA 2MFQA 4RF1A 3WYFB 4JIOU 3QQ8B 4FHKA 3RYTA 1XCQL 3ZUNA 5E6JA 3AE2B 4WWMA 1FPYA 1OEYJ 3ZVVA 3DVGX 1YJIA 1T77A 4M0WB 4KSKC 1FCCC 3U52E 1Q67A 4ICVA 4MEMA 1U5EA 5JHAA 4QXAB 3Q8EA 3SDLC 3VAWA 4IUMB 2KFKB 1UF0A 3SR6A 5D2MB 1FNUA 2L32A 5LXHA 1ACAA 1YMHE 3H7PB 4CQNA 2JXXA 4ZYSA 2CHXA 1F52A 2D3GA 1F9JA 2RDGA 2D3CA 1OEYA 3DVNU 3G9WA 1PQSA 2K00A 1V6EA 4W9FA 5AZHA 3AB5A 3C8YA 2DWQA 3N20C 2RVBB 3ONSA 4JLCA 5JH5C 3EFCA 3T3OA 2Y5PA 3V5WA 1X86A 2OHFA 4HROA 3W2DA 1SJED 2C9WB 2BQQA 4H2AA 3UIOB 4A6QA 1TKGA 2WXFA 1UWXA 2N9EB 3JSVB 3TCAA 1I4GA 5J3YA 2EKIA 2Z0EB 3IT6B 4IWQA 3AM9A 2DYBA 1E8YA 2DZIA 1WWTA 2HJ8A 2O2VA 1N60A 2KVRA 3A9KB 3SFDB 1P7FA 2R2QA 3U8ZA 4MT5A 1UBQA 3ENEA 4JWSC 1GJZA 3RFZB 2MEKA 5BYRA 4MGYE 4KX6B 4ZOHC 5EDSA 3B77A 2G9HD 4HPPA 4KHBB 1QOFA 1SB3C 4E71A 2JRIB 3A1QB 4GSWA 2ELAA 1EF5A 1ST7A 3SBGA 3QK0A 3BWUD 1QF6A 3IT4B 4JL9A 3B9JA 2AL6A 3C19A 4C4VB 2LGDA 1ZM0A 2NS5A 5DPRA 4AWJA 1ZOYB 1FRDA 2LWPA 3DBRB 1NVID 2WWZA 2JX5A 3DCGA 2IY1B 2MP2A 3KW5B 1F0ZA 4K2PA 2VZKB 2YF0A 1K50A 3A8QA 1WY8A 3NSUA 2DYMA 3H7SA 1FHWA 5JP4A 3MC0B 2AQ3B 1MFWA 3RUIB 1OQNA 2KDMA 3ODXA 2XN9C 3SO6A 4G50A 4HAXB 3H9DA 4II2B 3CIRB 2R09A 1LM8B 3PZ7A 2KZRA 1YQBA 3L10B 1XQQA 3SV1A 3MJWA 3KY9A 2KWVB 2YEPB 5D3YA 2G4SA 2IO2B 4HLEA 3MJ5A 2V0GA 2MJ3A 2MWNB 2NVUI 2PTLA 3L4PA 4RH6A 1G6JA 3AJ4A 5FI0A 2DLWA 4FADA 4M02A 1QILA 1SE3A 2MJEA 2K8CA 3RNFC 3IVFA 2LUMA 4DBGA 2N9XA 3O13A 2MRPA 3PP2A 3L13A 2PEAA 3HM3A 1X05A 2XK5B 1UGMA 4HPLB 4JK7A 3ZW3A 1X1MA 1UNRA 1NTIA 1YQ3B 2ADZA 4AJYB 1E6EB 2KXJA 1GAQB 4XWXA 4LNNA 3MHSD 1Q0WB 4XWWA 5J3QA 3X0WA 3P1MA 3AE8B 2KDFB 5FKAC 2QILA 1N5WA 1V1PB 4MH8A 1QQRA 2K3UA 2WP9B 3V6EB 3SU8X 2ZNVC 2K9XA 3GYPA 3ML4A 2QSDA 1T6BX 4IFSA 2X0SA 1C4CA 2W3SA 2JYTA 3HIZA 3ZXVA 4EFOA 2B76B 3DHIC 2G3QB 4K81A 3DWMA 3M62B 5C5BB 2MDXA 3PHXB 3SEBA 4IG7B 4RGNA 4CHKA 3DHHC 4EMOA 3GOEA 2MWSB 1PMSA 2W3RA 3MTNB 5JHBA 1ZGUB 4HB0B 4PYUA 1ET9A 1YQ4B 4S17A 2WDQB 4PS3A 2XQNM 2LVPA 1WMHA 2KK8A 2FUG1 3TW1A 3IAS1 4FN2A 2BPSA 4DHZE 2D5GA 2Z14A 4E74A 2WX1A 1AYFA 1ZW7A 1NYQA 2MBQA 1RLFA 4R3DA 3RD2A 1S1QB 3DHGC 4I6NB 2MLBA 5C79A 2L7RA 5BYQA 3VHTC 2CRFA 3UF8A 2IZVB 1LXDA 2GS0A 2HTHB 2V4LA 2ON8A 2G1EA 1HB6A 1I4QA 2R2OA 4OVVA 2PKOA 3Q3OC 2WXRA 3TL5A 4A3PA 5AZFA 1C9FA 3QIJA 4AQ7A 5HE3A 1Z2MA 4MM3B 3P42A 1D5MC 3B2FA 3KWVA 2NPTB 3NJTA 4JKFA 5BYSA 3ALBA 1DIKA 3BJIA 1XCTL 2IO1B 3OLMD 2ELBA 3SFEB 1U29A 2COPA 2KR0A 2DHKA 1YN4A 2X38A 1YN5A 1KFYB 4W9EA 4GMVA 5EFXA 3D8EA 4L6EA 4A5KA 4WJQA 1FMAD 4KGRA 3R3MA 3ECIA 3N9YC 1KZGA 1C4AA 4DHJB 1FM0D 3BYTB 1TTNA 4K17A 5CX3A 1MIZB 4WWNA 1V5PA 3ODOA 1IBXA 3TEWA 3CSTA 1D4BA 1AARA 5L81A 1YD8U 1VDVA 1DOIA 3HUIA 4HJKA 2O6VB 4MJSB 4YSXB 4W9LA 4HAUB 4LNOA 5JLJB 1AWEA 2IJ0A 4HKZE 3AEGB 3PSEB 1TJEA 2D9YA 2KGXB 2MA9B 1NBFC 4RM8A 3ZTCA 1RRPB 1I2HA 1FGZA 4GLSC 3SD5A 1UUPA 1F77A 2K8BA 3E9LA 2KTRA 4ILGB 2KDEB 3PLVA 2LASA 4Y94A 3NHEB 1WZ3A 2AQ1B 4BOZB 1ZE3D 2PMVA 2J7QB 4TUUA 1F2RC 2V4IB 3RNCC 2MJDA 4N58A 4A6HA 3A98B 2YT0A 4HEA1 2R82A 4KSLC 2BCJA 4ANUA 2NR2A 4US9A 2V3NA 1V5OA 3KYDD 2YLMA 3SBTA 4QJ5B 1KI1B 3AXCA 3I3TB 2YRYA 3SNHA 1J7CA 1MVKA 2N4FA 2YS5A 2KAJA 1QOBA 5D3WA 4GOCA 5KCVA 1RFAA 2BF8B 2FCMA 4Q2JA 2CHWA 2JY6A 4NQKE 2WDRB 4GDKA 4A90A 2COCA 3HM6X 4NNJB 4HB3B 1L0YB 3Q8AA 5AZGA 1HBKA 2R0DA 1FCLA 2XNAC 1EU3A 4OVZA 2WXHA 3KZ1A 4CYEA 3RZWC 1M7RA 3ENBA 3BYYB 1FEHA 5T8IA 2JXTA 3U30A 1AQCA 4DK5A 1PYWD 1KM7A 2LZ6A 5HI1A 3AEAB 3PG7A 4RGMA 1SHCA 5J17A 2WXNA 3KWLA 4YONA 4FJYA 5IAAC 4FULA 2ZPYA 2EELA 2K8HA 4L1BA 2ZCBA 1BTNA 4C00A 2LBBA 2Q5WD 1TYGB 2DX1A 1RM6C 2K2JA 1JMLA 2DAJA 5D94A 2QIEB 4WWPA 1TZOA 2IBIB 1LQBA 2CJOA 4FXCA 4J3OD 3JVZX 1WSPA 2FAZA 2KD0A 2VRWB 1H8CA 1P3QU 2RGFA 4KIKA 2C7NB 2CU3A 3DPDA 2MCNB 2BTEA 2P0HA 1V9JA 1HXYD 3VDZA 1ENFA 3ZKJC 3FSSA 4A8XC 4Z2NA 1ZDXA 1E90A 1QLBB 5E6OA 4JKHA 1RYJA 3CWIA 4G3XB 5IKCM 4JQWC 4B6WA 1WM2A 2BYVE 1V89A 3QJZA 3FP5A 2BT6A 1NU2A 5LXIB 1X11A 2OTXA 4MGZE 2KC2A 2MHJA 3OJ3A 3TIXA 1UNQA 4TQ0A 2HJ1A 4DHZB 1EWCA 3ZO5B 4ASWC 1RAXA 4J6IA 3VR9B 2Y8FA 2DYQA 5H92C 2JPHA 4KV2A 2N0SB 1K8RB 1MG8A 2KX3A 1I4HA 2L3ZA 3UZTA 2ZZPB 4N6EB 2LJIA 1JDEA 1C76A 4XGAB 2KACA 1XKEA 4MSMB 2AWTA 2BW2A 1E7VA 3DVNV 2KDIA 1PDXA 1SF0A 4HATB 4DX8A 2SEBD 3DOWA 3WAOA 3NW8A 3ZJVA 4P1CC 3DBRI 2KANA 5BO4B 2M14A 3KUZA 4JKCA 4HWIB 1WGQA 2Z59A 1FFVA 5C23A 4A6FB 3PV1A 3N1XC 2W2XD 4JKDA 2Z0QA 2RDBC 2KJHB 1SE9A 1Y19B 2CODA 3A9JB 1PUTA 1WJNA 2BYTA 3S2AA 3BVGA 2PLPA 2JWUA 4EJNA 2JF5A 4GB9A 1YIWA 2QDFA 4P1BC 3NZSA 3MC8A 4TV3A 1NI2A 2AQ2B 1RRBA 2COFA 1QOAA 2DKQA 2VSZA 3K9OB 2LKOA 2K8EA 5GXGB 5D3XA 2DX5A 4G0NB 1FB8A 2Y3AA 3FM8C 3VUYA 2GI9A 2KUQA 4XZ4A 2K6DB 1VCBA 4XE0A 4MY6A 2UZSA 3Q69A 1AN8A 1UGJA 4K1RB 1IPGA 2J0JA 4HDQA 1AWDA 4DXGA 1OQRA 2MP2B 3I63C 2LRWA 3B1LX 3UI3A 3EGRA 3VFKA 1OY2A 5I2MA 3U12A 4NQLB 2LUEA 5DPWA 3EHVA 3HRDD 2OQBA 1V2YA 1WRDB 5IP4D 4TYZA 3RCZA 3RNEC 2JVCA 1N3HA 3RI7C 3BVMA 4HKQA 2AYOB 2DHZA 1E7UA 1YN3A 4GNKB 2ZPNA 3H1UA 2J52A 4H8SA 5KQ1A 2J4XA 4RMAA 2WU5B 1IGDA 1IYFA 2AX5A 4YXDB 1V5UA 4JKGB 2KX0A 3ZNID 1VR9A 2ONQA 3GE8C 2N0YA 2R2YA 1L5PA 2K1FA 3QA8A 2C7MB 2IGDA 4WAFA 4WURA 1D5XC 2MW5A 2L83A 1MPHA 2GLSA 2UYZB 2I5CA 3PVLA 1X1GA 3GP7A 1XLNA 4OZAA 2RNRB 5HE2A 4C56C 5HFYA 4KAXB 4N9F4 1NI3A 4C7ZA 5CHWA 4YSYB 2RLOA 3MPXA 3AE7B 1WG7A 1C79A 1QC6A 1FNVA 2LULA 4L1RA 2K39A 4HCPB 4HB4B 3BK2A 1WXQA 5DIFB 2MBOA 4ANWA 1EF1A 5LONB 2NBVB 3N1YC 3NVVA 1U4AA 4NZLB 3L54A 1P5TA 3CMMB 4HK2A 1UELA 3HIEA 1E8ZA 2LXAA 1A70A 2D9XA 3R7QA 2ZW0A 2WU2B 2KJRA 4IWOA 2JWZA 3RNBC 3Q8CA 3TEXA 4OSNA 3R2IA 1P0RA 1NTVA 4K3CA 5AUKA 1B1ZA 3DWGC 1U5DA 2FJLA 1RWSA 3L16A 2CAYA 2DKPA 4IDIA 2JUOA 4IC7B 2OEDA 2YVCA 1SSNA 3QC8B 1CQVA 1GNUA 4LLGM 3RPFC 3KRXA 3SHQA 3TEYA 1DDWA 3AH7A 2INCC 2RMMA 1D6EC 2P0DA 1TS2A 1R4NB 2ZKMX 1E9MA 5DH9B 5G5HA 3FILA 4BBKA 3PLUA 3KRWA 4M0WA 4LDTD 2BB6A 1LFDA 2Y8GA 2KWCA 1WGYA 2RGNB 4BKSA 3TMPB 4C0AA 2LYDA 3VUXA 1PGBA 3P4PB 2ZW1A 3LJUX 2QMTA 4BKSD 1SIFA 4LK0M 4K2OA 1RFKA 1FO4A 3NUHB 5GOWB 2LHDA 1KLUD 1ZKHA 4HCNB 3LXFA 2KIGA 4UDUC 2WXLA 4NJ7A 3ZNZB 4DQOC 4IM0A 3RULA 3DBLB 3H7PA 4WJNA 1GGOA 5EE0A 3AE3B 4ZRIA 4GZUA 2KLGA 3ZLZA 1PGAA 2PW9A 5JHGA 2XEWA 1QOGA 4FBJB 4ANVA 1MG4A 2VH2A 3MDBC 4B0MA 1T0SC 4IWPA 4MDKE 1EGXA 2JP2A 1RJ2A 1KTKA 2XBBC 3QHTA 4NAMA 4GOUA 2CS4A 2IPKD 2PIAA 3EA6A 2QC8A 3JSVA 4MH0E 3VH3B 2KYWA 2EC1A 2HRJA 3W5VB 4OZCA 1D3ZA 1HZ5A 4EOYA 1Y56A 3A9KA 3AU4A 4NSWA 2WLBA 2WX0A 4B9KA 3ZJUA 4TQ1A 2N9PC 3QCAA 1U5FA 2GMIC 4K3BA 2DENB 2W9NA 2ACZB 4HAVB 2EMTA 3NWDA 1NYRA 2M19A 1N6ZA 5D27A 2J42A 2JZZA 4HSIA 3IAM1 4EZLA 2Q13A 3K9PB 2LMCA 1H4RA 3N32A 2G45B 4ILJA 1TXDA 3A1QA 3Q3MC 3ZYYX 3P4QB 3QARA 2D11A 3FEHA 1ESFA 2C60A 1XT9B 4JGHB 4C4VA 2NTSA 1LB1A 1WGKA 2NZ8B 3Q3NC 3LB8C 1C1YB 3Q8FA 3VXWA 1Y8RC 2FCSA 4LCDE 2LG1A 1Q1OA 2WXPA 2JZ3B 1ZP0B 2BS2B 3TUOA 4WJ7A 1QQGA 2PPHA 1OMWA 1C4PA 1SE2A 4YTPB 3RNGC 4KVGB 1UPQA 1OTRB 4A20A 1VZ8A 2Z0OA 3I9V1 4MSQB 4GDLB 4M8NA 4NJCA 3U7ZA 1XCGA 4F8CB 1A5RA 4HHVA 2OJRA 5FR6A 2IO0B 1KOTA 2K5PA 2I1JA 4N59A 3HK0A 2KUPA 1PGXA 1CZPA 1Q5WB 2YT2A 1WJMA 3BY4B 2KNBA 3UINB 2FE8A 1WFYA 2L76A 2M0AA 3DCXA 4HB2B 2KO3A 4AUQC 3J9CA 3MC9A 4BOSC 2W54A 1MJDA 1ET6A 5J18A 2Z0PA 2BVCA 2MQJA 2XK5A 3M3JA 3VIAA 4I6LB 3DQVA 5GMVA 4NY0A 2IYBA 2ROVA 3CXBB 4RF0A 5HE1A 1XLOA 4EEWA 1YJ1A 1U5GA 2I1KA 4XWTA 3AEFB 4KHOA 2PVGC 3AULA 4ARIA 4GN1A 4DBBA 1V1PA 1WIAA 5CHFA 4MGIE 1EWYC 2QJLA 4MGKE 2IYDB 1JWSD 4TSSA 3WAMA 1KRHA 4KDLB 2M0XA 5C5BA 1IUEA 4CSQA 2UWQA 4A3OA 1IP9A 1T0YA 2EMSA 3ZDTA 1MKEA 3FAHA 1GG3A 1QKZA 1WR1A 2E2XA 2PJHA 4OW0A 5KHQA 2N9LA 3I57A 3W5UB 3AEDB 5CTRC 3GZNB 2YS1A 1V88A 2MKRA 1V61A 2WDVB 1TJ6A 4PS7A 4MACA 3KQ4A 4USAA 3GB1A 2DYOA 3RCPA 1WGUA 3JW0X 1XODA 1TS5A 3HW2B 2DHJA 2WS3B 4LTUA 3QWMA 4S0RA 1MHHE 3PRZA 2X8XX 2LD9A 1OQYA 1DROA 1P7EA 3PS6A 4KZCA 1R4MI 4WJOA 1K5GB 2CY5A 1WX9A 3E9PA 3BINA 1YJJA 3U7DA 1WX7A 2HTHA 1J19A 2Y5CA 1WJ1A 1R7SA 3KUDB 3MP9A 2CQUA 1WGRA 2OJWA 1C3TA 2KLCA 2N1VA 2LI5A 3A4SC 3PTFC 1NDDA 3NZUA 4IM3A 4M8MA 1T3QA 1N62A 2LGIA 5C6RA 3BK1A 1L4DB 2Z59B 2LJ5A 2A5UA 5E6NA 4ZRQA 2M4NA 2J59M 2NPTA 3APCA 3PSCA 2OOBB 3KUCB 2JT4B 4XC2A 4YSZB 2GBJA 1P1AA 2IFSA 1V86A 2ROZB 5IO9A 3IBEA 5G5GA 2M38A 1WZ0A 3PHWB 3PO0A 1HE8A 4JWUC 2IDYA 1L6UA 5J3TA 3HSAA 3TBLD 3A58A 4RCOA 4ILHA 2N23A 5L83A 4DDID 1ZC4B 4RNAA 2ICIA 1C77A 5DI9B 1X1FA 2LVQA 4RGOS 1MI1A 1KLGD 1ZPSA 2V3SA 2MSED 3N1ZC 1JQ4A 1K52A 2GBNA 3ML8A 5L95C 1VZ6A 1V80A 2Z8LA 1OFFA 2L00B 3L08A 1BTKA 1D5ZC 4W9GA 1YX6B 4D6WA 2O6VA 4MJSA 3DBSA 3ODWA 3L17A 4CO7A 4NAWB 1HQRD 2GOWA 1BUIC 4NJ6A 3R7RA 2D07B 5C1ZA 3Q6BA 3GE3C 4AJWA 2RSGA 5AUIA 3O96A 1J7AA 2UVMA 2BKRB 2LEKA 3OHMB 2WXKA 3M95A 4CHJA 4LJOB 1U27A 3MHZA 1N5XA 1WJ4A 3HHMA 4GGQA 4XYCA 3AU5A 1WI1A 3DXDA 2Y7BA 3DXCA 2FBWB 1V97A 3R66C 2C7HA 3PVUA 1L4ZB 2WHIA 1K5DB 1WYWB 5E6PA 3Q8BA 3P63A 2GUMA 4M00A 3QWZB 3AE1B 4MELA 4JPSA 1DOXA 1XLQA 4IOIE 1IRSA 3OG5A 2RPVA 3NWFA 2N7DA 3WALA 3ULBA 2KN4A 2W55A 4W9JA 5D6JB 3RN9C 1N63A 5JVLA 2KWDA 1TY2A 1Q10A 1STEA 2L0FA 4PS8A 1N61A 3IHPC 4WJPA 2VKIA 1DGJA 2HDEA 1HTQA 2WYQA 5JZEB 3EECA 3OJ4B 5FR3A 2D9ZA 1CK1A 2QKMA 4IOYX 2D3AA 4B6HA 2EJ8A 2O2VB 4C7YA 2N7JA 1DDVA 3A8PA 1J8CA 4RFBA 2DIKA 4A6KA 3UQAA 1CMXB 1SIJA 4JK8A 1UNPA 4XDCA 2KIEA 1M7EA 1R4NI 2TSSA 3UIPB 5I4DA 2KMMA 1PFDA 3D8FA 3D32A 4HPMB 1UNSA 3RMKC 2BGFA 4TMAB 1R4MB 1NEKB 4LJPB 1TZ1A 3MFGA 3VUWA 4E3CA 3AN1A 5D3VA 5DCNA 4DWFA 3DBLI 3O65B 1L6VA 1XLPA 3APDA 4MK0A 2MBBB 1Z87A 2YT1A 4PQ0A 3ZGZA 5BMIA 2RDHA 3T8MA 1OQQA 4HRSA 2COAA 3NS8A 3BVZA 3NWAA 3CSFA 1ZC3B 3ZTDA 1V8CA 3H8HA 2M56B 1WH3A 2WXGA 1P6SA 5DHFB 1KJTA 1P9DU 2GRIA 1T5XD 2INNE 3V60A 3PGEA 4WIPA 2LOZA 3KH0A 3ZXRA 5HG2A 1PFJA 3B08A 5DHAB 3BIID 1EM7A 4LDTB 2KT7A 3B0AA 3FILB 5BMGA 1MIXA 1CJEA 1FXAA 1QZEA 4D2KA 3KLSX 3LJ3A 2IY0B 1EVHA 4BVUC 3NOBA 3VRBB 1WGDA 2D2QA 2QKLA 2KN5A 3BZDB 3EUB2 1GB1A 2GJYA 3M63B 1HZ6A 2BBCA 5FK9C 1LO5D 1F2RI 2DYNA 3TFMA 1JALA 1QT9A 3EFUA 1JWBD 4WQMA 1EU4A 3URYA 3NY5A 1VJKA 1FHXA 2L8JA 3W1YA 3T3NA 2RSUA 2FCNA 2R61A 1H10A 3AMZA 1P3RA 2Z0DB 4FHJA 4L2YA 2KCJA 1MI0A 1WYGA 3VR8B 4PT5A 5FI1A 5EE1A 3RNAC 3EC8A 3M1IB 4FJVB 3OAWA 3WCQA 4A6FA 2YSZA 2ZNVB 3QAQA 1KC7A 5G55A 4F7ZA 3A4RA 2ZVNA 4ZDVA 4KGSA 2SAKA 3FKYA 1ZXHA 3U2SC 3A9JA 4M01A 2LOXA 5DPTA 1SBBB 2KTFA 2CY4A 2BS3B 2ASQA 5LG4B 4OHJA 1SEBD 1TT5B 3ZNHB 1HEZE 4HVBA 1J7BA 1I42A 4W9HA 1UZXB 2BKFA 2WH5A 1MK7B 1FFUA 1E8XA 1WMHB 4LNIA 5TSSA 1ZSQA 4IM2A 2KOXA 3W9CB 2I2YA 5D3IB 3HVDA 3AEEB 1AW7A 2K2UA 2GBMA 3H6NA 1WI0A 5IA7A 4B95A 5IOIA 1DYNA 2WNMA 3A33B 4HAYB 2UZRA 5CLLB 2BWES 2MBHA 4QAYA 1KH0A 4HDOA 1IGCA 4W9CA 5D3DA 2JRHA 4ZHOA 4AS1A 4LNKA 1WXAA 4HAZB 2Y5BB 2YS3A 4OZBA 4A9AA 2V1YA 3AE5B 1E10A 2K0PA 2RQ1A 3VVWB 2P0FA 3VTWA 2KQSA 2A4ZA 3Q14C 3T9LA 2RRFA 5JHHA 1BMLC 2CB8A 1XXGA 2AEHA 4BFRA 1FXTB 2V76A 2V3PA 5IRSA 3TSSA 2DZKA 4WH4A 2KFKA 4GU2A 4X57B 5C16A 2WGSA 1WGHA 5JXVA 3GYOA 3LYYA 4TKNA 1I4PA 1E7PB 4EZKA 2BS4B 5D7GA 2LGYA 3R2TA 4W9IA 2M17A 2FCQA 3AE6B 2BWFA 1MHXA 3AI5A 4F1SA 2G4DB 3PREA 3GZNI 2NMBA 4QJ4B 2ZEQA 4JKGA 2D9VA 4JKBA 2DFKA 1KZ7A 2UU7A 1HA5A 4IW0A 2RR9A 5EE3A 4L23A 1FHOA 4KZ0A 2H89B 1JRUA 2GCLA 1WE6A 5LOPB 1IBXB 3B2GA 4ANXA 2JZPA 1TQZA 1WX8A 4ZYNA 1FGYA 4OT1A 1E5WA 1WF9A 1GC7A 2CKHB 3P2BA 2N1WA 2FIDA 3VTVA 1ROEA 4O1NA 4ZHPA 1E8WA 1ZXIA 4GMXB 2J0MA 1TS4A 1WE7A 1WXSA 4AOFA 3FC4A 3V61A 2JSVX 2YEPF 3AV8A 4REZA 3Q3JA 2KTRB 2FDQA 2KHWB 2MX2A 1V81A 2FNJB 3F5RA 1VBHA 2PZ1A 2Z13A 2DLBA 2NBVA 3NRZA 2W2WA 4KGTA 4GPTB 4KHBA 3SUZA 3T06A 1TBEA 1JCKB 4BZAA 4XX5A 3DXEA 4URKA 2PVOD 1HTOA 2LRUA 4KKIA 3PEGA 4W9KA 3P7ZA 3PRMB 1C78A 1WXMA 3V6CB 1OGWA 2FJ9A 1WR6E 4KHAA 1L0VB 1I35A 2J53A 2LFIA 2CU1A 3I5JC 3IXSA 4IAPA 4ZRJA 1DYQA 2NBWB 2VZKD 3NZ3A 4FLHA 1I7HA 2L1CA 4OVUA 4GDKB 5LNK1 1SGHA 1VBGA 3WA0A 2HE7A 2K6QA 4C80A 3CIKA 4WQOB 4HAWB 2PE9A 2PE6B 2D10A 5BMHA 1VRAB 4G11A 2L52A 2CJNA 3HVZA 5IJMA 1MPEA 1V1OA 1JRPA 1MK9B 3AECB 1XR0B 2ZJDA 4DIXA 1BWNA 2DZJA 1JWMD 2L05A 3AE4B 3V3XA 3UQBA 4K7SA 2KMAA 3TEZA 3V05A 2KWUB 5J2RA 3FVCA 1W1GA 2DAFA 5EE9A 3VRAB 1UH6A 2FIFA 3ZRFA 1TGZB 1ACCA 4YTMB 1B55A 4YL8A 3Q2AC 4EE2A 2GBKA 1UPRA 2HD5B 3IFWB 4LNFA 3E66A 3X23A 2DHIA 2CR5A 1VD2A 1FXIA 2WXQA 3OWEB 4K7WA 4QJ3B 1WJ6A 2KDBA 4W9DA 3VH4B 1FOEA 4F7HA 4JE3B 4BAXA 1WRIA 3DVGY 2N7EA 2I5FA 2FUHB 1J0GA 1EAZA 2I38A 3KSYA 2MBEA 4YWGG 2DZMA 4JKEA 4KIKB 2INDC 1FRRA 3ZNGC 1WVHA 1ISNA 2DNFA 2G35A 2J0KA 2BYFA 1ZDVA 5MPOA 4P6VF 5CLQB 1TY0A 4EZJA 1WJUA 1FIQA 4II3B 4PYZA 1BXTA 3ETRA 2GB1A 1K51A 1TKYA 3PVWA 4KDIC 2IGHA 2KVZA 2E6XA 2GCJA 2L2IA 2GBRA 2QHOA 4EUTA 3ZQ4A 1P98A 3VTUA 3P4RB 2QEJC 1FD6A 4YT0B 4ACFA 2LVOA 1SJHD 2IO3B 3KYCD 1V49A 1DBHA 3N30A 2L0TA 2VRRB 1T0RC 1XF5L 2LGSA 4WVFB 4ARCA 2WXMA 2ABDA 5M4YB 3V62A 3NVZA 3P4SB 1S3SG 3NS1A 2E3TA 2NBUA 4JX1C 1LW3A 2KKCA 3CF6E 4FJZA 2FJUB 1T0QC 3ZRCA 1ZYIA 2KMCA 4RM9A 5HHDG 4PNKA 4AP4C 3WANA 1YOVB 3WIMA 3NG0A 3C0RB 3Q3FA 2VH1A 2D3BA 4HJGE 1FAOA 1SE4A 3ML9A 1U2BA 3QBVB 3N3KB 4JK9A 4MM3A 4Z2MB 2LGXA 1L2NA 5LLIA 4YTNB 5KQ4A 1WXVA 4GDLA 4A55A 3PT2B 2ZCCA 5CHVC 2INPE 3DBHI 1YNTE 3PZDA 1UD7A 3RT3B 1EUVB 2JYEA 1MAIA 1SXTA 1J0WA 5G2NA 2C5LC 4DDGD
chains in the Genus database with same CATH topology
3ULCA 1EO6A 1XD4A 3F0WA 4WSFA 2DX5B 1NVLA 3ZIMA 3VQIA 1W1DA 5AEKB 4DHJD 3QX1A 2B3AA 1V5MA 2D9WA 5HKHA 4ICUA 4P7IA 3HQCA 1XD3B 3N7CA 3EPYA 1KBLA 2BYEA 2KFJA 2H7EA 2O6VD 2H7DA 4DX90 3KVFB 3TVVA 3L0WB 2AL3A 4WWOA 3JYUA 4BBNF 2KJ6A 1WGGA 4D0NB 1W1HA 3E9OA 3FLVA 5DPSA 2KQ7A 3ZVRA 4ZRKA 3WAPA 4F7GA 1NTYA 1YX5B 5HE0A 2K25A 4K7UA 4F7UP 4DXAB 3SYXA 5TR5A 2RD0A 3LDZE 1ZVRA 4MT7A 1XX0A 3PPAA 4BKGA 2P8VA 1L7YA 3W1SA 5KHOA 3W1SC 2NCNA 3D8DA 2DN6A 2DTCA 1KLVA 4NPNA 1Y5OA 4FA6A 1GUAB 1BT0A 2CHZA 3APFA 3UGBB 1M94A 2X18A 3ZDMC 4BBNC 2ZVOA 1UBIA 1I7AA 1WM3A 1UEFA 1GC6A 2M8SA 2W2XC 2RPQA 3VOQA 2REXA 1Z5SB 2WDTB 2D4QA 2DA0A 4EKUA 4I6PA 3IG3A 2M1MA 3PRPB 2EKEC 2LXCA 3TO1A 4BKTA 4HXDA 4JKAA 3TJPA 4CHMA 1BAKA 3DDCB 3P6AA 1HB8A 1V5TA 1PLSA 2KC1A 3RZFA 3OANA 4GXBA 4WAAA 4GIVA 2RUKB 1DDMA 4NAWA 2MFQA 3WYFB 4JIOU 3QQ8B 4FHKA 3RYTA 3ZUNA 1OEYJ 3ZVVA 3DVGX 4M0WB 4KSKC 1Q67A 4ICVA 4MEMA 1U5EA 5JHAA 3SDLC 3VAWA 4IUMB 2KFKB 5D2MB 5LXHA 1ACAA 3H7PB 2JXXA 2CHXA 2D3GA 1F9JA 1OEYA 3DVNU 3G9WA 1PQSA 2K00A 1V6EA 4W9FA 5AZHA 2RVBB 3ONSA 4JLCA 5JH5C 3V5WA 1X86A 2C9WB 3UIOB 2N9EB 3JSVB 3TCAA 5J3YA 2Z0EB 4IWQA 2DYBA 1E8YA 2DZIA 2HJ8A 2O2VA 2KVRA 3A9KB 2R2QA 3U8ZA 1UBQA 3ENEA 1GJZA 4MGYE 5EDSA 4KHBB 4E71A 2JRIB 3A1QB 4GSWA 2ELAA 1EF5A 1ST7A 3SBGA 3QK0A 4JL9A 2AL6A 2LGDA 1ZM0A 2NS5A 5DPRA 4AWJA 2LWPA 2WWZA 3DCGA 2IY1B 2MP2A 3KW5B 4K2PA 2YF0A 3A8QA 1WY8A 3NSUA 2DYMA 3H7SA 1FHWA 5JP4A 3RUIB 1OQNA 3ODXA 3SO6A 4G50A 4HAXB 3H9DA 4II2B 2R09A 1LM8B 2KZRA 1YQBA 3L10B 1XQQA 3SV1A 3MJWA 3KY9A 2KWVB 5D3YA 2G4SA 2IO2B 4HLEA 2MWNB 2NVUI 1G6JA 3AJ4A 5FI0A 2DLWA 4FADA 2K8CA 3IVFA 4DBGA 2N9XA 2MRPA 3PP2A 3L13A 2PEAA 3HM3A 1X05A 2XK5B 1UGMA 4HPLB 4JK7A 3ZW3A 1X1MA 1UNRA 1NTIA 2ADZA 4AJYB 2KXJA 4XWXA 3MHSD 1Q0WB 5J3QA 3X0WA 2KDFB 3V6EB 3SU8X 2ZNVC 3GYPA 3ML4A 4IFSA 2X0SA 3HIZA 4EFOA 2G3QB 4K81A 3M62B 5C5BB 2MDXA 3PHXB 4IG7B 4CHKA 4EMOA 3GOEA 2MWSB 1PMSA 3MTNB 5JHBA 1ZGUB 4HB0B 4PYUA 4PS3A 2XQNM 2LVPA 1WMHA 2KK8A 3TW1A 4FN2A 2BPSA 4DHZE 4E74A 2WX1A 1ZW7A 2MBQA 1RLFA 3RD2A 1S1QB 4I6NB 2MLBA 5C79A 2L7RA 3VHTC 2CRFA 3UF8A 2IZVB 1LXDA 2GS0A 2HTHB 2V4LA 1HB6A 2R2OA 4OVVA 3TL5A 4A3PA 5AZFA 3QIJA 5HE3A 1Z2MA 2NPTB 4JKFA 3ALBA 1DIKA 3BJIA 2IO1B 3OLMD 2ELBA 1U29A 2COPA 2DHKA 4W9EA 4GMVA 5EFXA 3D8EA 4L6EA 4A5KA 4WJQA 3R3MA 3ECIA 1KZGA 4DHJB 1TTNA 4K17A 5CX3A 1MIZB 4WWNA 1V5PA 3ODOA 3CSTA 1AARA 5L81A 1YD8U 4HJKA 2O6VB 4MJSB 4W9LA 4HAUB 5JLJB 1AWEA 3PSEB 2D9YA 2KGXB 2MA9B 1NBFC 4RM8A 3ZTCA 1RRPB 1I2HA 1FGZA 3SD5A 2K8BA 3E9LA 2KTRA 4ILGB 2KDEB 3PLVA 2LASA 4Y94A 3NHEB 1WZ3A 4BOZB 2J7QB 4TUUA 4A6HA 3A98B 2YT0A 2R82A 4KSLC 2BCJA 4ANUA 2NR2A 1V5OA 3KYDD 2YLMA 3SBTA 1KI1B 3AXCA 3I3TB 2YRYA 3SNHA 2N4FA 2YS5A 5D3WA 4GOCA 5KCVA 1RFAA 2BF8B 2FCMA 2CHWA 2JY6A 4NQKE 4GDKA 2COCA 3HM6X 4NNJB 4HB3B 5AZGA 1HBKA 2R0DA 3KZ1A 4CYEA 3RZWC 1M7RA 3ENBA 3U30A 1AQCA 4DK5A 1KM7A 2LZ6A 3PG7A 1SHCA 5J17A 4YONA 4FJYA 5IAAC 4FULA 2ZPYA 2K8HA 2ZCBA 1BTNA 2LBBA 2DX1A 2K2JA 2DAJA 5D94A 4WWPA 2IBIB 1LQBA 3JVZX 2FAZA 2KD0A 2VRWB 1H8CA 1P3QU 2RGFA 4KIKA 2C7NB 3DPDA 2MCNB 2P0HA 1V9JA 3VDZA 3ZKJC 3FSSA 4Z2NA 1E90A 5E6OA 4JKHA 4G3XB 4JQWC 4B6WA 1WM2A 2BYVE 1V89A 3QJZA 3FP5A 1NU2A 5LXIB 1X11A 2OTXA 4MGZE 2KC2A 3OJ3A 3TIXA 1UNQA 4TQ0A 4DHZB 3ZO5B 4ASWC 1RAXA 4J6IA 2Y8FA 2DYQA 2JPHA 4KV2A 1K8RB 1MG8A 2KX3A 2L3ZA 3UZTA 2ZZPB 1JDEA 1XKEA 4MSMB 2AWTA 1E7VA 3DVNV 2KDIA 4HATB 4DX8A 3DOWA 3WAOA 3DBRI 5BO4B 2KANA 2M14A 3KUZA 4JKCA 4HWIB 1WGQA 5C23A 4A6FB 3PV1A 2W2XD 4JKDA 2Z0QA 2KJHB 1SE9A 1Y19B 2CODA 3A9JB 1WJNA 3S2AA 4EJNA 2JF5A 4GB9A 1YIWA 3NZSA 4TV3A 1NI2A 1RRBA 2COFA 2DKQA 2VSZA 3K9OB 2LKOA 5D3XA 2DX5A 4G0NB 1FB8A 3FM8C 3VUYA 4XZ4A 2K6DB 1VCBA 4MY6A 2UZSA 4K1RB 1IPGA 2J0JA 4HDQA 2MP2B 2LRWA 3B1LX 3VFKA 1OY2A 4NQLB 2LUEA 5DPWA 3EHVA 2OQBA 1V2YA 1WRDB 4TYZA 3RCZA 2JVCA 1N3HA 2AYOB 2DHZA 1E7UA 2ZPNA 3H1UA 4H8SA 5KQ1A 4RMAA 1IYFA 1V5UA 4JKGB 2KX0A 3ZNID 2N0YA 2K1FA 3QA8A 2C7MB 2MW5A 1MPHA 2UYZB 2I5CA 3PVLA 1X1GA 2RNRB 5HE2A 4KAXB 4N9F4 5CHWA 2RLOA 3MPXA 1WG7A 1QC6A 2LULA 2K39A 4HCPB 4HB4B 5DIFB 2MBOA 4ANWA 1EF1A 5LONB 2NBVB 1U4AA 3L54A 1P5TA 3CMMB 4HK2A 1UELA 1E8ZA 2LXAA 2D9XA 3R7QA 4IWOA 2KJRA 2JWZA 1P0RA 1NTVA 1U5DA 2FJLA 3L16A 2CAYA 2DKPA 2JUOA 4IC7B 2YVCA 3QC8B 1GNUA 3KRXA 3SHQA 1DDWA 2P0DA 5DH9B 4BBKA 3PLUA 3KRWA 4LDTD 1LFDA 2Y8GA 2KWCA 1WGYA 2RGNB 4BKSA 3TMPB 4C0AA 2LYDA 3VUXA 3LJUX 4BKSD 1SIFA 4K2OA 5GOWB 1ZKHA 4HCNB 3ZNZB 4NJ7A 4IM0A 3RULA 3H7PA 4WJNA 1GGOA 4ZRIA 4GZUA 2KLGA 3ZLZA 5JHGA 2XEWA 4FBJB 4ANVA 3MDBC 4IWPA 4MDKE 1EGXA 2JP2A 1RJ2A 3QHTA 2XBBC 2CS4A 3JSVA 4MH0E 3VH3B 2EC1A 2HRJA 1D3ZA 4EOYA 3A9KA 3AU4A 4NSWA 2WX0A 4B9KA 4TQ1A 2N9PC 3QCAA 1U5FA 2GMIC 2DENB 2W9NA 4HAVB 2EMTA 5D27A 2JZZA 4EZLA 2Q13A 3K9PB 3N32A 1H4RA 2G45B 4ILJA 1TXDA 3A1QA 3QARA 2D11A 3FEHA 2C60A 1XT9B 4JGHB 1LB1A 2NZ8B 1C1YB 3VXWA 1Y8RC 2FCSA 4LCDE 2LG1A 1Q1OA 2JZ3B 4WJ7A 1QQGA 2PPHA 1OMWA 4KVGB 1UPQA 1OTRB 4A20A 2Z0OA 4MSQB 4GDLB 4M8NA 1XCGA 4F8CB 1A5RA 4HHVA 2OJRA 5FR6A 2IO0B 1KOTA 2I1JA 3HK0A 2KUPA 1Q5WB 1WJMA 3BY4B 2KNBA 3UINB 1WFYA 2L76A 4HB2B 2KO3A 4AUQC 4BOSC 5J18A 2Z0PA 2MQJA 2XK5A 3M3JA 3VIAA 4I6LB 3DQVA 5GMVA 4NY0A 2IYBA 2ROVA 3CXBB 5HE1A 4EEWA 1YJ1A 1U5GA 2I1KA 4KHOA 3AULA 4GN1A 4DBBA 1WIAA 5CHFA 4MGIE 4MGKE 2IYDB 3WAMA 4KDLB 2M0XA 5C5BA 2UWQA 4A3OA 1IP9A 1T0YA 2EMSA 3ZDTA 1MKEA 1GG3A 1WR1A 2E2XA 2PJHA 5KHQA 5CTRC 2YS1A 1V88A 2MKRA 1V61A 1TJ6A 4PS7A 2DYOA 3RCPA 1WGUA 3JW0X 1XODA 3HW2B 2DHJA 3QWMA 3PRZA 2LD9A 1OQYA 1DROA 3PS6A 4KZCA 1R4MI 4WJOA 1K5GB 2CY5A 1WX9A 3E9PA 3BINA 3U7DA 1WX7A 2HTHA 1J19A 1WJ1A 3KUDB 2CQUA 1WGRA 1C3TA 2KLCA 2N1VA 2LI5A 3A4SC 3PTFC 1NDDA 3NZUA 4IM3A 4M8MA 5C6RA 2Z59B 2LJ5A 2A5UA 5E6NA 2M4NA 2J59M 2NPTA 3APCA 3PSCA 2OOBB 3KUCB 2JT4B 4XC2A 2GBJA 1P1AA 2IFSA 1V86A 2ROZB 3IBEA 2M38A 1WZ0A 3PHWB 1HE8A 5J3TA 3TBLD 4ILHA 2N23A 5L83A 4DDID 1ZC4B 5DI9B 1X1FA 2LVQA 2V3SA 2MSED 2GBNA 3ML8A 5L95C 1V80A 2L00B 3L08A 1BTKA 4W9GA 1YX6B 4MJSA 2O6VA 3DBSA 3ODWA 3L17A 4CO7A 4NAWB 2GOWA 4NJ6A 3R7RA 2D07B 5C1ZA 4AJWA 2RSGA 3O96A 2UVMA 2BKRB 3M95A 4LJOB 4CHJA 1U27A 1WJ4A 3HHMA 4GGQA 3AU5A 1WI1A 3DXDA 2Y7BA 3DXCA 3R66C 2C7HA 3PVUA 1K5DB 1WYWB 5E6PA 3QWZB 4MELA 1IRSA 2N7DA 3WALA 3ULBA 4W9JA 5D6JB 5JVLA 2L0FA 4PS8A 3IHPC 4WJPA 2VKIA 2WYQA 5JZEB 3EECA 3OJ4B 2D9ZA 2QKMA 4IOYX 4B6HA 2EJ8A 2O2VB 1DDVA 3A8PA 1J8CA 2DIKA 4A6KA 3UQAA 1CMXB 4JK8A 1UNPA 1M7EA 1R4NI 3UIPB 3D8FA 3D32A 4HPMB 2BGFA 4LJPB 1TZ1A 3VUWA 4E3CA 5D3VA 5DCNA 4DWFA 3DBLI 3O65B 3APDA 4MK0A 2MBBB 1Z87A 2YT1A 4PQ0A 3T8MA 2COAA 3NS8A 3CSFA 1ZC3B 3ZTDA 1WH3A 1P6SA 5DHFB 1KJTA 1P9DU 3V60A 3PGEA 2LOZA 3KH0A 1PFJA 3B08A 5DHAB 4LDTB 3B0AA 1MIXA 1QZEA 3LJ3A 2IY0B 1EVHA 4BVUC 3NOBA 1WGDA 2D2QA 2QKLA 2KN5A 2GJYA 3M63B 2DYNA 3TFMA 3EFUA 3NY5A 2L8JA 1FHXA 3W1YA 2RSUA 2FCNA 1H10A 1P3RA 2Z0DB 4FHJA 2KCJA 5FI1A 3EC8A 3M1IB 4FJVB 3OAWA 4A6FA 2YSZA 2ZNVB 3QAQA 1KC7A 5G55A 4F7ZA 3A4RA 2ZVNA 4ZDVA 3A9JA 2LOXA 5DPTA 2KTFA 2CY4A 2ASQA 3ZNHB 4HVBA 1I42A 4W9HA 1UZXB 2BKFA 2WH5A 1MK7B 1E8XA 1WMHB 1ZSQA 4IM2A 2KOXA 2K2UA 2GBMA 3H6NA 1WI0A 5IA7A 4B95A 1DYNA 3A33B 4HAYB 2UZRA 5CLLB 2BWES 2MBHA 4HDOA 4W9CA 2JRHA 1WXAA 4HAZB 2Y5BB 2YS3A 2V1YA 2RQ1A 3VVWB 2P0FA 3VTWA 2KQSA 2A4ZA 3T9LA 5JHHA 2CB8A 4BFRA 2AEHA 1FXTB 2V76A 2DZKA 2KFKA 4GU2A 4X57B 5C16A 1WGHA 3GYOA 4TKNA 4EZKA 5D7GA 2LGYA 4W9IA 2M17A 2FCQA 2BWFA 3AI5A 4F1SA 2G4DB 3PREA 3GZNI 2NMBA 2ZEQA 4JKGA 2D9VA 4JKBA 2DFKA 1KZ7A 4IW0A 2RR9A 1FHOA 4KZ0A 1JRUA 2GCLA 1WE6A 5LOPB 4ANXA 1TQZA 1WX8A 4ZYNA 1FGYA 1E5WA 1WF9A 1GC7A 2CKHB 3P2BA 2N1WA 2FIDA 3VTVA 1E8WA 4GMXB 2J0MA 1WE7A 1WXSA 4AOFA 3V61A 3Q3JA 2KTRB 2FDQA 2KHWB 2MX2A 1V81A 2FNJB 3F5RA 1VBHA 2PZ1A 2W2WA 4GPTB 3SUZA 3T06A 1TBEA 4XX5A 3DXEA 4URKA 2LRUA 3PEGA 4W9KA 3P7ZA 3PRMB 1WXMA 3V6CB 1OGWA 2FJ9A 1WR6E 4KHAA 1I35A 2CU1A 4IAPA 4ZRJA 2NBWB 4FLHA 2L1CA 4OVUA 4GDKB 1SGHA 1VBGA 3WA0A 2HE7A 2K6QA 3CIKA 4WQOB 4HAWB 2PE9A 2PE6B 2D10A 4G11A 5IJMA 1MK9B 1XR0B 2ZJDA 1BWNA 2DZJA 2L05A 3UQBA 4K7SA 2KMAA 2KWUB 5J2RA 1W1GA 2DAFA 1UH6A 2FIFA 3ZRFA 1TGZB 1B55A 4YL8A 2GBKA 1UPRA 2HD5B 3IFWB 3E66A 3X23A 2DHIA 2CR5A 1VD2A 4K7WA 4W9DA 1WJ6A 2KDBA 3VH4B 1FOEA 4F7HA 3DVGY 2N7EA 2I5FA 2FUHB 1J0GA 1EAZA 3KSYA 2MBEA 2DZMA 4JKEA 4KIKB 3ZNGC 1WVHA 1ISNA 2G35A 2J0KA 2BYFA 5CLQB 4EZJA 1WJUA 4II3B 4PYZA 3PVWA 4KDIC 2GCJA 2L2IA 2GBRA 2QHOA 4EUTA 1P98A 3VTUA 2LVOA 2IO3B 3KYCD 1V49A 1DBHA 3N30A 2L0TA 2VRRB 4WVFB 2ABDA 3V62A 1S3SG 2NBUA 1LW3A 2KKCA 3CF6E 4FJZA 3ZRCA 2KMCA 4RM9A 4PNKA 4AP4C 3WANA 3WIMA 3C0RB 3Q3FA 1FAOA 3ML9A 1U2BA 3QBVB 3N3KB 4JK9A 4MM3A 4Z2MB 2LGXA 1L2NA 5LLIA 5KQ4A 1WXVA 4GDLA 3PT2B 2ZCCA 5CHVC 3DBHI 3PZDA 1UD7A 3RT3B 1EUVB 1MAIA 1J0WA 5G2NA 2C5LC 4DDGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULC A;  1EO6 A;  1XD4 A;  3F0W A;  4WSF A;  2DX5 B;  1NVL A;  3ZIM A;  3VQI A;  1W1D A;  5AEK B;  4DHJ D;  3QX1 A;  2B3A A;  1V5M A;  2D9W A;  5HKH A;  4ICU A;  4P7I A;  3HQC A;  1XD3 B;  3N7C A;  3EPY A;  2BYE A;  2KFJ A;  2H7E A;  2O6V D;  2H7D A;  4DX9 0;  3KVF B;  3TVV A;  3L0W B;  2AL3 A;  4WWO A;  3JYU A;  4BBN F;  2KJ6 A;  1WGG A;  4D0N B;  1W1H A;  3FLV A;  5DPS A;  2KQ7 A;  3ZVR A;  4ZRK A;  3WAP A;  4F7G A;  1NTY A;  1YX5 B;  5HE0 A;  2K25 A;  4K7U A;  4F7U P;  4DXA B;  3SYX A;  5TR5 A;  2RD0 A;  3LDZ E;  1ZVR A;  4MT7 A;  1XX0 A;  3PPA A;  4BKG A;  2P8V A;  1L7Y A;  3W1S A;  5KHO A;  3W1S C;  2NCN A;  3D8D A;  2DN6 A;  2DTC A;  1KLV A;  4NPN A;  1Y5O A;  4FA6 A;  1GUA B;  1BT0 A;  2CHZ A;  3APF A;  3UGB B;  1M94 A;  2X18 A;  3ZDM C;  4BBN C;  2ZVO A;  1UBI A;  1I7A A;  1WM3 A;  1UEF A;  1GC6 A;  2M8S A;  2W2X C;  2RPQ A;  3VOQ A;  2REX A;  1Z5S B;  2WDT B;  2D4Q A;  2DA0 A;  4EKU A;  4I6P A;  3IG3 A;  2M1M A;  3PRP B;  2EKE C;  2LXC A;  3TO1 A;  4BKT A;  4HXD A;  3TJP A;  4CHM A;  1BAK A;  3DDC B;  3P6A A;  1HB8 A;  1V5T A;  1PLS A;  2KC1 A;  3RZF A;  3OAN A;  4GXB A;  4WAA A;  4GIV A;  2RUK B;  1DDM A;  4NAW A;  2MFQ A;  3WYF B;  4JIO U;  3QQ8 B;  4FHK A;  3RYT A;  3ZUN A;  1OEY J;  3ZVV A;  3DVG X;  4M0W B;  4KSK C;  1Q67 A;  4ICV A;  4MEM A;  1U5E A;  5JHA A;  3SDL C;  3VAW A;  4IUM B;  2KFK B;  5D2M B;  5LXH A;  1ACA A;  3H7P B;  2JXX A;  2CHX A;  2D3G A;  1F9J A;  1OEY A;  3DVN U;  3G9W A;  1PQS A;  2K00 A;  1V6E A;  4W9F A;  5AZH A;  2RVB B;  3ONS A;  4JLC A;  5JH5 C;  3V5W A;  1X86 A;  2C9W B;  3UIO B;  2N9E B;  3JSV B;  3TCA A;  5J3Y A;  2Z0E B;  4IWQ A;  2DYB A;  1E8Y A;  2DZI A;  2HJ8 A;  2O2V A;  2KVR A;  3A9K B;  2R2Q A;  3U8Z A;  1UBQ A;  3ENE A;  1GJZ A;  4MGY E;  5EDS A;  4KHB B;  4E71 A;  2JRI B;  3A1Q B;  4GSW A;  2ELA A;  1EF5 A;  1ST7 A;  3QK0 A;  4JL9 A;  2AL6 A;  2LGD A;  1ZM0 A;  2NS5 A;  5DPR A;  4AWJ A;  2LWP A;  2WWZ A;  3DCG A;  2IY1 B;  2MP2 A;  3KW5 B;  4K2P A;  2YF0 A;  3A8Q A;  1WY8 A;  3NSU A;  2DYM A;  3H7S A;  1FHW A;  5JP4 A;  3RUI B;  1OQN A;  3ODX A;  3SO6 A;  4G50 A;  4HAX B;  3H9D A;  4II2 B;  2R09 A;  1LM8 B;  2KZR A;  1YQB A;  3L10 B;  1XQQ A;  3SV1 A;  3MJW A;  3KY9 A;  2KWV B;  5D3Y A;  2G4S A;  2IO2 B;  4HLE A;  2MWN B;  2NVU I;  1G6J A;  3AJ4 A;  5FI0 A;  2DLW A;  4FAD A;  2K8C A;  3IVF A;  4DBG A;  2N9X A;  2MRP A;  3PP2 A;  3L13 A;  2PEA A;  3HM3 A;  1X05 A;  2XK5 B;  1UGM A;  4HPL B;  3ZW3 A;  1X1M A;  1UNR A;  1NTI A;  2ADZ A;  4AJY B;  2KXJ A;  4XWX A;  3MHS D;  1Q0W B;  5J3Q A;  3X0W A;  2KDF B;  3V6E B;  3SU8 X;  2ZNV C;  3GYP A;  3ML4 A;  4IFS A;  3HIZ A;  4EFO A;  2G3Q B;  4K81 A;  3M62 B;  5C5B B;  2MDX A;  3PHX B;  4IG7 B;  4CHK A;  4EMO A;  3GOE A;  2MWS B;  1PMS A;  3MTN B;  5JHB A;  1ZGU B;  4HB0 B;  4PYU A;  4PS3 A;  2XQN M;  2LVP A;  1WMH A;  2KK8 A;  3TW1 A;  4FN2 A;  2BPS A;  4DHZ E;  4E74 A;  2WX1 A;  1ZW7 A;  2MBQ A;  1RLF A;  3RD2 A;  1S1Q B;  4I6N B;  2MLB A;  5C79 A;  2L7R A;  3VHT C;  2CRF A;  3UF8 A;  2IZV B;  1LXD A;  2GS0 A;  2HTH B;  2V4L A;  1HB6 A;  2R2O A;  4OVV A;  3TL5 A;  4A3P A;  5AZF A;  3QIJ A;  5HE3 A;  1Z2M A;  2NPT B;  3ALB A;  3BJI A;  2IO1 B;  3OLM D;  2ELB A;  1U29 A;  2COP A;  2DHK A;  4W9E A;  4GMV A;  5EFX A;  3D8E A;  4L6E A;  4A5K A;  4WJQ A;  3R3M A;  3ECI A;  1KZG A;  4DHJ B;  1TTN A;  4K17 A;  5CX3 A;  1MIZ B;  4WWN A;  1V5P A;  3ODO A;  3CST A;  1AAR A;  5L81 A;  1YD8 U;  4HJK A;  2O6V B;  4MJS B;  4W9L A;  4HAU B;  5JLJ B;  1AWE A;  3PSE B;  2D9Y A;  2KGX B;  2MA9 B;  1NBF C;  4RM8 A;  3ZTC A;  1RRP B;  1I2H A;  1FGZ A;  3SD5 A;  2K8B A;  2KTR A;  2KDE B;  3PLV A;  2LAS A;  4Y94 A;  3NHE B;  1WZ3 A;  4BOZ B;  2J7Q B;  4TUU A;  4A6H A;  3A98 B;  2YT0 A;  4KSL C;  2BCJ A;  4ANU A;  2NR2 A;  1V5O A;  3KYD D;  2YLM A;  1KI1 B;  3AXC A;  3I3T B;  2YRY A;  3SNH A;  2N4F A;  2YS5 A;  5D3W A;  4GOC A;  5KCV A;  1RFA A;  2BF8 B;  2FCM A;  2CHW A;  2JY6 A;  4NQK E;  4GDK A;  2COC A;  3HM6 X;  4NNJ B;  4HB3 B;  5AZG A;  1HBK A;  2R0D A;  3KZ1 A;  4CYE A;  3RZW C;  1M7R A;  3U30 A;  1AQC A;  4DK5 A;  1KM7 A;  2LZ6 A;  3PG7 A;  1SHC A;  5J17 A;  4YON A;  4FJY A;  5IAA C;  4FUL A;  2ZPY A;  2K8H A;  2ZCB A;  1BTN A;  2LBB A;  2DX1 A;  2K2J A;  2DAJ A;  5D94 A;  4WWP A;  2IBI B;  1LQB A;  3JVZ X;  2FAZ A;  2KD0 A;  2VRW B;  1H8C A;  1P3Q U;  2RGF A;  4KIK A;  2C7N B;  3DPD A;  2MCN B;  2P0H A;  1V9J A;  3VDZ A;  3ZKJ C;  3FSS A;  4Z2N A;  1E90 A;  5E6O A;  4G3X B;  4JQW C;  4B6W A;  1WM2 A;  2BYV E;  1V89 A;  3QJZ A;  3FP5 A;  1NU2 A;  5LXI B;  1X11 A;  2OTX A;  4MGZ E;  2KC2 A;  3OJ3 A;  3TIX A;  1UNQ A;  4TQ0 A;  4DHZ B;  3ZO5 B;  4ASW C;  1RAX A;  4J6I A;  2Y8F A;  2DYQ A;  2JPH A;  4KV2 A;  1K8R B;  1MG8 A;  2KX3 A;  2L3Z A;  3UZT A;  2ZZP B;  1XKE A;  4MSM B;  2AWT A;  1E7V A;  3DVN V;  2KDI A;  4HAT B;  4DX8 A;  3DOW A;  3WAO A;  3DBR I;  2KAN A;  5BO4 B;  2M14 A;  3KUZ A;  4HWI B;  1WGQ A;  5C23 A;  4A6F B;  3PV1 A;  2W2X D;  2Z0Q A;  2KJH B;  1SE9 A;  1Y19 B;  2COD A;  3A9J B;  1WJN A;  3S2A A;  4EJN A;  2JF5 A;  4GB9 A;  1YIW A;  3NZS A;  4TV3 A;  1NI2 A;  1RRB A;  2COF A;  2DKQ A;  2VSZ A;  3K9O B;  2LKO A;  5D3X A;  2DX5 A;  4G0N B;  1FB8 A;  3FM8 C;  3VUY A;  4XZ4 A;  2K6D B;  1VCB A;  4MY6 A;  2UZS A;  4K1R B;  1IPG A;  2J0J A;  4HDQ A;  2MP2 B;  2LRW A;  3B1L X;  3VFK A;  1OY2 A;  4NQL B;  2LUE A;  5DPW A;  3EHV A;  2OQB A;  1V2Y A;  1WRD B;  4TYZ A;  3RCZ A;  2JVC A;  1N3H A;  2AYO B;  2DHZ A;  1E7U A;  2ZPN A;  3H1U A;  4H8S A;  5KQ1 A;  4RMA A;  1IYF A;  1V5U A;  2KX0 A;  3ZNI D;  2N0Y A;  2K1F A;  3QA8 A;  2C7M B;  2MW5 A;  1MPH A;  2UYZ B;  2I5C A;  3PVL A;  1X1G A;  2RNR B;  5HE2 A;  4KAX B;  4N9F 4;  5CHW A;  2RLO A;  3MPX A;  1WG7 A;  1QC6 A;  2LUL A;  2K39 A;  4HCP B;  4HB4 B;  5DIF B;  2MBO A;  4ANW A;  1EF1 A;  5LON B;  2NBV B;  1U4A A;  3L54 A;  1P5T A;  3CMM B;  4HK2 A;  1UEL A;  1E8Z A;  2LXA A;  2D9X A;  3R7Q A;  4IWO A;  2KJR A;  2JWZ A;  1P0R A;  1NTV A;  1U5D A;  2FJL A;  3L16 A;  2CAY A;  2DKP A;  2JUO A;  4IC7 B;  2YVC A;  3QC8 B;  1GNU A;  3KRX A;  3SHQ A;  1DDW A;  2P0D A;  5DH9 B;  4BBK A;  3PLU A;  3KRW A;  4LDT D;  1LFD A;  2Y8G A;  2KWC A;  1WGY A;  2RGN B;  4BKS A;  3TMP B;  4C0A A;  2LYD A;  3VUX A;  3LJU X;  4BKS D;  1SIF A;  4K2O A;  5GOW B;  1ZKH A;  4HCN B;  3ZNZ B;  4NJ7 A;  4IM0 A;  3RUL A;  3H7P A;  4WJN A;  4ZRI A;  4GZU A;  2KLG A;  3ZLZ A;  5JHG A;  2XEW A;  4FBJ B;  4ANV A;  3MDB C;  4IWP A;  4MDK E;  1EGX A;  2JP2 A;  1RJ2 A;  3QHT A;  2XBB C;  2CS4 A;  3JSV A;  4MH0 E;  3VH3 B;  2EC1 A;  2HRJ A;  1D3Z A;  4EOY A;  3A9K A;  3AU4 A;  4NSW A;  2WX0 A;  4B9K A;  4TQ1 A;  2N9P C;  3QCA A;  1U5F A;  2GMI C;  2DEN B;  2W9N A;  4HAV B;  2EMT A;  5D27 A;  2JZZ A;  4EZL A;  2Q13 A;  3K9P B;  3N32 A;  1H4R A;  2G45 B;  1TXD A;  3A1Q A;  3QAR A;  2D11 A;  3FEH A;  2C60 A;  1XT9 B;  4JGH B;  1LB1 A;  2NZ8 B;  1C1Y B;  3VXW A;  1Y8R C;  2FCS A;  4LCD E;  2LG1 A;  1Q1O A;  2JZ3 B;  4WJ7 A;  1QQG A;  2PPH A;  1OMW A;  4KVG B;  1UPQ A;  1OTR B;  4A20 A;  2Z0O A;  4MSQ B;  4GDL B;  4M8N A;  1XCG A;  4F8C B;  1A5R A;  4HHV A;  2OJR A;  5FR6 A;  2IO0 B;  1KOT A;  2I1J A;  3HK0 A;  2KUP A;  1Q5W B;  1WJM A;  3BY4 B;  2KNB A;  3UIN B;  1WFY A;  2L76 A;  4HB2 B;  2KO3 A;  4AUQ C;  4BOS C;  5J18 A;  2Z0P A;  2MQJ A;  2XK5 A;  3M3J A;  3VIA A;  4I6L B;  3DQV A;  5GMV A;  4NY0 A;  2IYB A;  2ROV A;  3CXB B;  5HE1 A;  4EEW A;  1YJ1 A;  1U5G A;  2I1K A;  4KHO A;  3AUL A;  4GN1 A;  4DBB A;  1WIA A;  5CHF A;  4MGI E;  4MGK E;  2IYD B;  3WAM A;  4KDL B;  2M0X A;  5C5B A;  2UWQ A;  4A3O A;  1IP9 A;  1T0Y A;  2EMS A;  3ZDT A;  1MKE A;  1GG3 A;  1WR1 A;  2E2X A;  2PJH A;  5KHQ A;  5CTR C;  2YS1 A;  1V88 A;  2MKR A;  1V61 A;  1TJ6 A;  4PS7 A;  2DYO A;  3RCP A;  1WGU A;  3JW0 X;  1XOD A;  3HW2 B;  2DHJ A;  3QWM A;  3PRZ A;  2LD9 A;  1OQY A;  1DRO A;  3PS6 A;  4KZC A;  1R4M I;  4WJO A;  1K5G B;  2CY5 A;  1WX9 A;  3BIN A;  3U7D A;  1WX7 A;  2HTH A;  1J19 A;  1WJ1 A;  3KUD B;  2CQU A;  1WGR A;  1C3T A;  2KLC A;  2N1V A;  2LI5 A;  3A4S C;  3PTF C;  1NDD A;  3NZU A;  4IM3 A;  4M8M A;  5C6R A;  2Z59 B;  2LJ5 A;  2A5U A;  5E6N A;  2M4N A;  2J59 M;  2NPT A;  3APC A;  3PSC A;  2OOB B;  3KUC B;  2JT4 B;  4XC2 A;  2GBJ A;  1P1A A;  2IFS A;  1V86 A;  2ROZ B;  3IBE A;  2M38 A;  1WZ0 A;  3PHW B;  1HE8 A;  5J3T A;  3TBL D;  2N23 A;  5L83 A;  4DDI D;  1ZC4 B;  5DI9 B;  1X1F A;  2LVQ A;  2V3S A;  2MSE D;  2GBN A;  3ML8 A;  5L95 C;  1V80 A;  2L00 B;  3L08 A;  1BTK A;  4W9G A;  1YX6 B;  2O6V A;  4MJS A;  3DBS A;  3ODW A;  3L17 A;  4CO7 A;  4NAW B;  2GOW A;  4NJ6 A;  3R7R A;  2D07 B;  5C1Z A;  4AJW A;  2RSG A;  3O96 A;  2UVM A;  2BKR B;  3M95 A;  4LJO B;  4CHJ A;  1U27 A;  1WJ4 A;  3HHM A;  4GGQ A;  3AU5 A;  1WI1 A;  3DXD A;  2Y7B A;  3DXC A;  3R66 C;  2C7H A;  3PVU A;  1K5D B;  1WYW B;  5E6P A;  3QWZ B;  4MEL A;  1IRS A;  2N7D A;  3WAL A;  3ULB A;  4W9J A;  5D6J B;  2L0F A;  4PS8 A;  3IHP C;  4WJP A;  2VKI A;  2WYQ A;  5JZE B;  3EEC A;  3OJ4 B;  2D9Z A;  2QKM A;  4IOY X;  4B6H A;  2EJ8 A;  2O2V B;  1DDV A;  3A8P A;  1J8C A;  4A6K A;  3UQA A;  1CMX B;  1UNP A;  1M7E A;  1R4N I;  3UIP B;  3D8F A;  3D32 A;  4HPM B;  2BGF A;  4LJP B;  1TZ1 A;  3VUW A;  4E3C A;  5D3V A;  5DCN A;  4DWF A;  3DBL I;  3O65 B;  3APD A;  4MK0 A;  2MBB B;  1Z87 A;  2YT1 A;  4PQ0 A;  3T8M A;  2COA A;  3NS8 A;  3CSF A;  1ZC3 B;  3ZTD A;  1WH3 A;  1P6S A;  5DHF B;  1KJT A;  1P9D U;  3V60 A;  3PGE A;  2LOZ A;  3KH0 A;  1PFJ A;  3B08 A;  5DHA B;  4LDT B;  3B0A A;  1MIX A;  1QZE A;  3LJ3 A;  2IY0 B;  1EVH A;  4BVU C;  3NOB A;  1WGD A;  2D2Q A;  2QKL A;  2KN5 A;  2GJY A;  3M63 B;  2DYN A;  3TFM A;  3EFU A;  3NY5 A;  2L8J A;  1FHX A;  3W1Y A;  2RSU A;  2FCN A;  1H10 A;  1P3R A;  2Z0D B;  4FHJ A;  2KCJ A;  5FI1 A;  3EC8 A;  3M1I B;  4FJV B;  3OAW A;  4A6F A;  2YSZ A;  2ZNV B;  3QAQ A;  5G55 A;  4F7Z A;  3A4R A;  2ZVN A;  4ZDV A;  3A9J A;  2LOX A;  5DPT A;  2KTF A;  2CY4 A;  2ASQ A;  3ZNH B;  4HVB A;  1I42 A;  4W9H A;  1UZX B;  2BKF A;  2WH5 A;  1MK7 B;  1E8X A;  1WMH B;  1ZSQ A;  4IM2 A;  2KOX A;  2K2U A;  2GBM A;  3H6N A;  1WI0 A;  5IA7 A;  4B95 A;  1DYN A;  3A33 B;  4HAY B;  2UZR A;  5CLL B;  2BWE S;  2MBH A;  4HDO A;  4W9C A;  2JRH A;  1WXA A;  4HAZ B;  2Y5B B;  2YS3 A;  2V1Y A;  2RQ1 A;  3VVW B;  2P0F A;  3VTW A;  2KQS A;  2A4Z A;  3T9L A;  5JHH A;  2CB8 A;  4BFR A;  2AEH A;  1FXT B;  2V76 A;  2DZK A;  2KFK A;  4GU2 A;  4X57 B;  5C16 A;  1WGH A;  3GYO A;  4TKN A;  4EZK A;  5D7G A;  2LGY A;  4W9I A;  2M17 A;  2FCQ A;  2BWF A;  3AI5 A;  4F1S A;  2G4D B;  3PRE A;  3GZN I;  2NMB A;  2ZEQ A;  2D9V A;  2DFK A;  1KZ7 A;  4IW0 A;  2RR9 A;  1FHO A;  4KZ0 A;  1JRU A;  2GCL A;  1WE6 A;  5LOP B;  4ANX A;  1TQZ A;  1WX8 A;  4ZYN A;  1FGY A;  1E5W A;  1WF9 A;  1GC7 A;  2CKH B;  3P2B A;  2N1W A;  2FID A;  3VTV A;  1E8W A;  4GMX B;  2J0M A;  1WE7 A;  1WXS A;  4AOF A;  3V61 A;  3Q3J A;  2KTR B;  2FDQ A;  2KHW B;  2MX2 A;  1V81 A;  2FNJ B;  3F5R A;  2PZ1 A;  2W2W A;  4GPT B;  3SUZ A;  3T06 A;  1TBE A;  4XX5 A;  3DXE A;  4URK A;  2LRU A;  3PEG A;  4W9K A;  3P7Z A;  3PRM B;  1WXM A;  3V6C B;  1OGW A;  2FJ9 A;  1WR6 E;  4KHA A;  1I35 A;  2CU1 A;  4IAP A;  4ZRJ A;  2NBW B;  4FLH A;  2L1C A;  4OVU A;  4GDK B;  1SGH A;  3WA0 A;  2HE7 A;  2K6Q A;  3CIK A;  4WQO B;  4HAW B;  2PE9 A;  2PE6 B;  2D10 A;  4G11 A;  5IJM A;  1MK9 B;  1XR0 B;  2ZJD A;  1BWN A;  2DZJ A;  2L05 A;  3UQB A;  4K7S A;  2KMA A;  2KWU B;  5J2R A;  1W1G A;  2DAF A;  1UH6 A;  2FIF A;  3ZRF A;  1TGZ B;  1B55 A;  4YL8 A;  2GBK A;  1UPR A;  2HD5 B;  3IFW B;  3X23 A;  2DHI A;  2CR5 A;  1VD2 A;  4K7W A;  4W9D A;  1WJ6 A;  2KDB A;  3VH4 B;  1FOE A;  4F7H A;  3DVG Y;  2N7E A;  2I5F A;  2FUH B;  1J0G A;  1EAZ A;  3KSY A;  2MBE A;  2DZM A;  4KIK B;  3ZNG C;  1WVH A;  1ISN A;  2G35 A;  2J0K A;  2BYF A;  5CLQ B;  4EZJ A;  1WJU A;  4II3 B;  4PYZ A;  3PVW A;  4KDI C;  2GCJ A;  2L2I A;  2GBR A;  2QHO A;  4EUT A;  1P98 A;  3VTU A;  2LVO A;  2IO3 B;  3KYC D;  1V49 A;  1DBH A;  3N30 A;  2L0T A;  2VRR B;  4WVF B;  2ABD A;  3V62 A;  1S3S G;  2NBU A;  1LW3 A;  2KKC A;  3CF6 E;  4FJZ A;  3ZRC A;  2KMC A;  4RM9 A;  4PNK A;  4AP4 C;  3WAN A;  3WIM A;  3C0R B;  3Q3F A;  1FAO A;  3ML9 A;  1U2B A;  3QBV B;  3N3K B;  4MM3 A;  4Z2M B;  2LGX A;  1L2N A;  5LLI A;  5KQ4 A;  1WXV A;  4GDL A;  3PT2 B;  2ZCC A;  5CHV C;  3DBH I;  3PZD A;  1UD7 A;  3RT3 B;  1EUV B;  1MAI A;  1J0W A;  5G2N A;  2C5L C;  4DDG D; 
#chains in the Genus database with same CATH topology
 3ULC A;  1GB4 A;  1EO6 A;  2NTT A;  1XD4 A;  2LHE A;  5I2S A;  3F0W A;  4WSF A;  1VLB A;  2DX5 B;  1NVL A;  3ZIM A;  3VQI A;  2JQR B;  1W1D A;  5AEK B;  4DHJ D;  3QX1 A;  1LGR A;  2B3A A;  1V5M A;  2D9W A;  5HKH A;  4ICU A;  5C3J B;  1NEN B;  4P7I A;  3HQC A;  3R8B A;  2NMQ A;  4PK1 A;  1UWM A;  1XD3 B;  3N7C A;  3EPY A;  1E0Z A;  1KBL A;  2BYE A;  2KFJ A;  2H7E A;  1TS3 A;  2H7D A;  2O6V D;  4DX9 0;  3KVF B;  3TVV A;  3L0W B;  2AL3 A;  3GS2 A;  4WWO A;  2WXJ A;  4US8 A;  1JWU D;  3JYU A;  4BBN F;  4DXF A;  2KJ6 A;  1WGG A;  4IKG A;  4D0N B;  1W1H A;  3E9O A;  1JWA D;  3FLV A;  5DPS A;  2KQ7 A;  3ZVR A;  4ZRK A;  3WAP A;  2BB5 A;  4F7G A;  1NTY A;  1YX5 B;  2WQY B;  1F1H A;  5HE0 A;  3PZ8 A;  2K25 A;  4K7U A;  2KQ4 X;  4F7U P;  4DXA B;  2QCZ A;  3SYX A;  5TR5 A;  3E56 A;  2RD0 A;  1GOZ A;  3LDZ E;  2HTM E;  2W82 A;  1ZVR A;  1TKE A;  3U4E G;  4MT7 A;  4ITK A;  1XX0 A;  3PPA A;  4BKG A;  1DOY A;  1GPX A;  2P8V A;  1B9R A;  1L7Y A;  3NVW A;  3W1S A;  5KHO A;  3W1S C;  2NCN A;  3D8D A;  1KF6 B;  2DN6 A;  2DTC A;  3E9S A;  2V9H A;  1KLV A;  4NPN A;  1Y5O A;  2JU6 X;  2MH7 A;  1GUA B;  4FA6 A;  1BT0 A;  2CHZ A;  3APF A;  3UGB B;  1I4R A;  1M94 A;  2X18 A;  3ZDM C;  1M4V A;  2WXO A;  2H88 B;  4BBN C;  2ZVO A;  5C2T B;  1UBI A;  1I7A A;  1WM3 A;  1K53 A;  3AEB B;  1FNW A;  1XEE A;  1UEF A;  1GC6 A;  1L0X B;  2M8S A;  2W2X C;  2K49 A;  2RPQ A;  3VOQ A;  2REX A;  1Z5S B;  2N9K A;  2WDT B;  2D4Q A;  2Z4D A;  4KKJ A;  2DA0 A;  4EKU A;  1XO3 A;  4I6P A;  3IG3 A;  4XDD A;  1ZUD 2;  2M1M A;  3PRP B;  2EKE C;  2LXC A;  4RGT A;  3TO1 A;  4BKT A;  3ZJT A;  2WXI A;  4P16 A;  2L1A A;  4HXD A;  4JKA A;  3NVY A;  3TJP A;  4CHM A;  1BAK A;  2DBY A;  3DDC B;  4ZRP A;  3P6A A;  2K22 A;  5IN7 A;  5H8Y E;  1HB8 A;  1V5T A;  1JRO A;  1I4X A;  3ABV B;  1PLS A;  1VZ7 A;  2KC1 A;  1JW9 D;  2IGG A;  3RZF A;  3OAN A;  4GXB A;  3DBH B;  4WAA A;  4GIV A;  2RUK B;  1DDM A;  1TIF A;  4B0E A;  3AE9 B;  4NAW A;  2MFQ A;  4RF1 A;  3WYF B;  4JIO U;  3QQ8 B;  4FHK A;  3RYT A;  1XCQ L;  3ZUN A;  5E6J A;  3AE2 B;  4WWM A;  1FPY A;  1OEY J;  3ZVV A;  3DVG X;  1YJI A;  1T77 A;  4M0W B;  4KSK C;  1FCC C;  3U52 E;  1Q67 A;  4ICV A;  4MEM A;  1U5E A;  5JHA A;  4QXA B;  3Q8E A;  3SDL C;  3VAW A;  4IUM B;  2KFK B;  1UF0 A;  3SR6 A;  5D2M B;  1FNU A;  2L32 A;  5LXH A;  1ACA A;  1YMH E;  3H7P B;  4CQN A;  2JXX A;  4ZYS A;  2CHX A;  1F52 A;  2D3G A;  1F9J A;  2RDG A;  2D3C A;  1OEY A;  3DVN U;  3G9W A;  1PQS A;  2K00 A;  1V6E A;  4W9F A;  5AZH A;  3AB5 A;  3C8Y A;  2DWQ A;  3N20 C;  2RVB B;  3ONS A;  4JLC A;  5JH5 C;  3EFC A;  3T3O A;  2Y5P A;  3V5W A;  1X86 A;  2OHF A;  4HRO A;  3W2D A;  1SJE D;  2C9W B;  2BQQ A;  4H2A A;  3UIO B;  4A6Q A;  1TKG A;  2WXF A;  1UWX A;  2N9E B;  3JSV B;  3TCA A;  1I4G A;  5J3Y A;  2EKI A;  2Z0E B;  3IT6 B;  4IWQ A;  3AM9 A;  2DYB A;  1E8Y A;  2DZI A;  1WWT A;  2HJ8 A;  2O2V A;  1N60 A;  2KVR A;  3A9K B;  3SFD B;  1P7F A;  2R2Q A;  3U8Z A;  4MT5 A;  1UBQ A;  3ENE A;  4JWS C;  1GJZ A;  3RFZ B;  2MEK A;  5BYR A;  4MGY E;  4KX6 B;  4ZOH C;  5EDS A;  3B77 A;  2G9H D;  4HPP A;  4KHB B;  1QOF A;  1SB3 C;  4E71 A;  2JRI B;  3A1Q B;  4GSW A;  2ELA A;  1EF5 A;  1ST7 A;  3SBG A;  3QK0 A;  3BWU D;  1QF6 A;  3IT4 B;  4JL9 A;  3B9J A;  2AL6 A;  3C19 A;  4C4V B;  2LGD A;  1ZM0 A;  2NS5 A;  5DPR A;  4AWJ A;  1ZOY B;  1FRD A;  2LWP A;  3DBR B;  1NVI D;  2WWZ A;  2JX5 A;  3DCG A;  2IY1 B;  2MP2 A;  3KW5 B;  1F0Z A;  4K2P A;  2VZK B;  2YF0 A;  1K50 A;  3A8Q A;  1WY8 A;  3NSU A;  2DYM A;  3H7S A;  1FHW A;  5JP4 A;  3MC0 B;  2AQ3 B;  1MFW A;  3RUI B;  1OQN A;  2KDM A;  3ODX A;  2XN9 C;  3SO6 A;  4G50 A;  4HAX B;  3H9D A;  4II2 B;  3CIR B;  2R09 A;  1LM8 B;  3PZ7 A;  2KZR A;  1YQB A;  3L10 B;  1XQQ A;  3SV1 A;  3MJW A;  3KY9 A;  2KWV B;  2YEP B;  5D3Y A;  2G4S A;  2IO2 B;  4HLE A;  3MJ5 A;  2V0G A;  2MJ3 A;  2MWN B;  2NVU I;  2PTL A;  3L4P A;  4RH6 A;  1G6J A;  3AJ4 A;  5FI0 A;  2DLW A;  4FAD A;  4M02 A;  1QIL A;  1SE3 A;  2MJE A;  2K8C A;  3RNF C;  3IVF A;  2LUM A;  4DBG A;  2N9X A;  3O13 A;  2MRP A;  3PP2 A;  3L13 A;  2PEA A;  3HM3 A;  1X05 A;  2XK5 B;  1UGM A;  4HPL B;  4JK7 A;  3ZW3 A;  1X1M A;  1UNR A;  1NTI A;  1YQ3 B;  2ADZ A;  4AJY B;  1E6E B;  2KXJ A;  1GAQ B;  4XWX A;  4LNN A;  3MHS D;  1Q0W B;  4XWW A;  5J3Q A;  3X0W A;  3P1M A;  3AE8 B;  2KDF B;  5FKA C;  2QIL A;  1N5W A;  1V1P B;  4MH8 A;  1QQR A;  2K3U A;  2WP9 B;  3V6E B;  3SU8 X;  2ZNV C;  2K9X A;  3GYP A;  3ML4 A;  2QSD A;  1T6B X;  4IFS A;  2X0S A;  1C4C A;  2W3S A;  2JYT A;  3HIZ A;  3ZXV A;  4EFO A;  2B76 B;  3DHI C;  2G3Q B;  4K81 A;  3DWM A;  3M62 B;  5C5B B;  2MDX A;  3PHX B;  3SEB A;  4IG7 B;  4RGN A;  4CHK A;  3DHH C;  4EMO A;  3GOE A;  2MWS B;  1PMS A;  2W3R A;  3MTN B;  5JHB A;  1ZGU B;  4HB0 B;  4PYU A;  1ET9 A;  1YQ4 B;  4S17 A;  2WDQ B;  4PS3 A;  2XQN M;  2LVP A;  1WMH A;  2KK8 A;  2FUG 1;  3TW1 A;  3IAS 1;  4FN2 A;  2BPS A;  4DHZ E;  2D5G A;  2Z14 A;  4E74 A;  2WX1 A;  1AYF A;  1ZW7 A;  1NYQ A;  2MBQ A;  1RLF A;  4R3D A;  3RD2 A;  1S1Q B;  3DHG C;  4I6N B;  2MLB A;  5C79 A;  2L7R A;  5BYQ A;  3VHT C;  2CRF A;  3UF8 A;  2IZV B;  1LXD A;  2GS0 A;  2HTH B;  2V4L A;  2ON8 A;  2G1E A;  1HB6 A;  1I4Q A;  2R2O A;  4OVV A;  2PKO A;  3Q3O C;  2WXR A;  3TL5 A;  4A3P A;  5AZF A;  1C9F A;  3QIJ A;  4AQ7 A;  5HE3 A;  1Z2M A;  4MM3 B;  3P42 A;  1D5M C;  3B2F A;  3KWV A;  2NPT B;  3NJT A;  4JKF A;  5BYS A;  3ALB A;  1DIK A;  3BJI A;  1XCT L;  2IO1 B;  3OLM D;  2ELB A;  3SFE B;  1U29 A;  2COP A;  2KR0 A;  2DHK A;  1YN4 A;  2X38 A;  1YN5 A;  1KFY B;  4W9E A;  4GMV A;  5EFX A;  3D8E A;  4L6E A;  4A5K A;  4WJQ A;  1FMA D;  4KGR A;  3R3M A;  3ECI A;  3N9Y C;  1KZG A;  1C4A A;  4DHJ B;  1FM0 D;  3BYT B;  1TTN A;  4K17 A;  5CX3 A;  1MIZ B;  4WWN A;  1V5P A;  3ODO A;  1IBX A;  3TEW A;  3CST A;  1D4B A;  1AAR A;  5L81 A;  1YD8 U;  1VDV A;  1DOI A;  3HUI A;  4HJK A;  2O6V B;  4MJS B;  4YSX B;  4W9L A;  4HAU B;  4LNO A;  5JLJ B;  1AWE A;  2IJ0 A;  4HKZ E;  3AEG B;  3PSE B;  1TJE A;  2D9Y A;  2KGX B;  2MA9 B;  1NBF C;  4RM8 A;  3ZTC A;  1RRP B;  1I2H A;  1FGZ A;  4GLS C;  3SD5 A;  1UUP A;  1F77 A;  2K8B A;  3E9L A;  2KTR A;  4ILG B;  2KDE B;  3PLV A;  2LAS A;  4Y94 A;  3NHE B;  1WZ3 A;  2AQ1 B;  4BOZ B;  1ZE3 D;  2PMV A;  2J7Q B;  4TUU A;  1F2R C;  2V4I B;  3RNC C;  2MJD A;  4N58 A;  4A6H A;  3A98 B;  2YT0 A;  4HEA 1;  2R82 A;  4KSL C;  2BCJ A;  4ANU A;  2NR2 A;  4US9 A;  2V3N A;  1V5O A;  3KYD D;  2YLM A;  3SBT A;  4QJ5 B;  1KI1 B;  3AXC A;  3I3T B;  2YRY A;  3SNH A;  1J7C A;  1MVK A;  2N4F A;  2YS5 A;  2KAJ A;  1QOB A;  5D3W A;  4GOC A;  5KCV A;  1RFA A;  2BF8 B;  2FCM A;  4Q2J A;  2CHW A;  2JY6 A;  4NQK E;  2WDR B;  4GDK A;  4A90 A;  2COC A;  3HM6 X;  4NNJ B;  4HB3 B;  1L0Y B;  3Q8A A;  5AZG A;  1HBK A;  2R0D A;  1FCL A;  2XNA C;  1EU3 A;  4OVZ A;  2WXH A;  3KZ1 A;  4CYE A;  3RZW C;  1M7R A;  3ENB A;  3BYY B;  1FEH A;  5T8I A;  2JXT A;  3U30 A;  1AQC A;  4DK5 A;  1PYW D;  1KM7 A;  2LZ6 A;  5HI1 A;  3AEA B;  3PG7 A;  4RGM A;  1SHC A;  5J17 A;  2WXN A;  3KWL A;  4YON A;  4FJY A;  5IAA C;  4FUL A;  2ZPY A;  2EEL A;  2K8H A;  4L1B A;  2ZCB A;  1BTN A;  4C00 A;  2LBB A;  2Q5W D;  1TYG B;  2DX1 A;  1RM6 C;  2K2J A;  1JML A;  2DAJ A;  5D94 A;  2QIE B;  4WWP A;  1TZO A;  2IBI B;  1LQB A;  2CJO A;  4FXC A;  4J3O D;  3JVZ X;  1WSP A;  2FAZ A;  2KD0 A;  2VRW B;  1H8C A;  1P3Q U;  2RGF A;  4KIK A;  2C7N B;  2CU3 A;  3DPD A;  2MCN B;  2BTE A;  2P0H A;  1V9J A;  1HXY D;  3VDZ A;  1ENF A;  3ZKJ C;  3FSS A;  4A8X C;  4Z2N A;  1ZDX A;  1E90 A;  1QLB B;  5E6O A;  4JKH A;  1RYJ A;  3CWI A;  4G3X B;  5IKC M;  4JQW C;  4B6W A;  1WM2 A;  2BYV E;  1V89 A;  3QJZ A;  3FP5 A;  2BT6 A;  1NU2 A;  5LXI B;  1X11 A;  2OTX A;  4MGZ E;  2KC2 A;  2MHJ A;  3OJ3 A;  3TIX A;  1UNQ A;  4TQ0 A;  2HJ1 A;  4DHZ B;  1EWC A;  3ZO5 B;  4ASW C;  1RAX A;  4J6I A;  3VR9 B;  2Y8F A;  2DYQ A;  5H92 C;  2JPH A;  4KV2 A;  2N0S B;  1K8R B;  1MG8 A;  2KX3 A;  1I4H A;  2L3Z A;  3UZT A;  2ZZP B;  4N6E B;  2LJI A;  1JDE A;  1C76 A;  4XGA B;  2KAC A;  1XKE A;  4MSM B;  2AWT A;  2BW2 A;  1E7V A;  3DVN V;  2KDI A;  1PDX A;  1SF0 A;  4HAT B;  4DX8 A;  2SEB D;  3DOW A;  3WAO A;  3NW8 A;  3ZJV A;  4P1C C;  3DBR I;  2KAN A;  5BO4 B;  2M14 A;  3KUZ A;  4JKC A;  4HWI B;  1WGQ A;  2Z59 A;  1FFV A;  5C23 A;  4A6F B;  3PV1 A;  3N1X C;  2W2X D;  4JKD A;  2Z0Q A;  2RDB C;  2KJH B;  1SE9 A;  1Y19 B;  2COD A;  3A9J B;  1PUT A;  1WJN A;  2BYT A;  3S2A A;  3BVG A;  2PLP A;  2JWU A;  4EJN A;  2JF5 A;  4GB9 A;  1YIW A;  2QDF A;  4P1B C;  3NZS A;  3MC8 A;  4TV3 A;  1NI2 A;  2AQ2 B;  1RRB A;  2COF A;  1QOA A;  2DKQ A;  2VSZ A;  3K9O B;  2LKO A;  2K8E A;  5GXG B;  5D3X A;  2DX5 A;  4G0N B;  1FB8 A;  2Y3A A;  3FM8 C;  3VUY A;  2GI9 A;  2KUQ A;  4XZ4 A;  2K6D B;  1VCB A;  4XE0 A;  4MY6 A;  2UZS A;  3Q69 A;  1AN8 A;  1UGJ A;  4K1R B;  1IPG A;  2J0J A;  4HDQ A;  1AWD A;  4DXG A;  1OQR A;  2MP2 B;  3I63 C;  2LRW A;  3B1L X;  3UI3 A;  3EGR A;  3VFK A;  1OY2 A;  5I2M A;  3U12 A;  4NQL B;  2LUE A;  5DPW A;  3EHV A;  3HRD D;  2OQB A;  1V2Y A;  1WRD B;  5IP4 D;  4TYZ A;  3RCZ A;  3RNE C;  2JVC A;  1N3H A;  3RI7 C;  3BVM A;  4HKQ A;  2AYO B;  2DHZ A;  1E7U A;  1YN3 A;  4GNK B;  2ZPN A;  3H1U A;  2J52 A;  4H8S A;  5KQ1 A;  2J4X A;  4RMA A;  2WU5 B;  1IGD A;  1IYF A;  2AX5 A;  4YXD B;  1V5U A;  4JKG B;  2KX0 A;  3ZNI D;  1VR9 A;  2ONQ A;  3GE8 C;  2N0Y A;  2R2Y A;  1L5P A;  2K1F A;  3QA8 A;  2C7M B;  2IGD A;  4WAF A;  4WUR A;  1D5X C;  2MW5 A;  2L83 A;  1MPH A;  2GLS A;  2UYZ B;  2I5C A;  3PVL A;  1X1G A;  3GP7 A;  1XLN A;  4OZA A;  2RNR B;  5HE2 A;  4C56 C;  5HFY A;  4KAX B;  4N9F 4;  1NI3 A;  4C7Z A;  5CHW A;  4YSY B;  2RLO A;  3MPX A;  3AE7 B;  1WG7 A;  1C79 A;  1QC6 A;  1FNV A;  2LUL A;  4L1R A;  2K39 A;  4HCP B;  4HB4 B;  3BK2 A;  1WXQ A;  5DIF B;  2MBO A;  4ANW A;  1EF1 A;  5LON B;  2NBV B;  3N1Y C;  3NVV A;  1U4A A;  4NZL B;  3L54 A;  1P5T A;  3CMM B;  4HK2 A;  1UEL A;  3HIE A;  1E8Z A;  2LXA A;  1A70 A;  2D9X A;  3R7Q A;  2ZW0 A;  2WU2 B;  2KJR A;  4IWO A;  2JWZ A;  3RNB C;  3Q8C A;  3TEX A;  4OSN A;  3R2I A;  1P0R A;  1NTV A;  4K3C A;  5AUK A;  1B1Z A;  3DWG C;  1U5D A;  2FJL A;  1RWS A;  3L16 A;  2CAY A;  2DKP A;  4IDI A;  2JUO A;  4IC7 B;  2OED A;  2YVC A;  1SSN A;  3QC8 B;  1CQV A;  1GNU A;  4LLG M;  3RPF C;  3KRX A;  3SHQ A;  3TEY A;  1DDW A;  3AH7 A;  2INC C;  2RMM A;  1D6E C;  2P0D A;  1TS2 A;  1R4N B;  2ZKM X;  1E9M A;  5DH9 B;  5G5H A;  3FIL A;  4BBK A;  3PLU A;  3KRW A;  4M0W A;  4LDT D;  2BB6 A;  1LFD A;  2Y8G A;  2KWC A;  1WGY A;  2RGN B;  4BKS A;  3TMP B;  4C0A A;  2LYD A;  3VUX A;  1PGB A;  3P4P B;  2ZW1 A;  3LJU X;  2QMT A;  4BKS D;  1SIF A;  4LK0 M;  4K2O A;  1RFK A;  1FO4 A;  3NUH B;  5GOW B;  2LHD A;  1KLU D;  1ZKH A;  4HCN B;  3LXF A;  2KIG A;  4UDU C;  2WXL A;  4NJ7 A;  3ZNZ B;  4DQO C;  4IM0 A;  3RUL A;  3DBL B;  3H7P A;  4WJN A;  1GGO A;  5EE0 A;  3AE3 B;  4ZRI A;  4GZU A;  2KLG A;  3ZLZ A;  1PGA A;  2PW9 A;  5JHG A;  2XEW A;  1QOG A;  4FBJ B;  4ANV A;  1MG4 A;  2VH2 A;  3MDB C;  4B0M A;  1T0S C;  4IWP A;  4MDK E;  1EGX A;  2JP2 A;  1RJ2 A;  1KTK A;  2XBB C;  3QHT A;  4NAM A;  4GOU A;  2CS4 A;  2IPK D;  2PIA A;  3EA6 A;  2QC8 A;  3JSV A;  4MH0 E;  3VH3 B;  2KYW A;  2EC1 A;  2HRJ A;  3W5V B;  4OZC A;  1D3Z A;  1HZ5 A;  4EOY A;  1Y56 A;  3A9K A;  3AU4 A;  4NSW A;  2WLB A;  2WX0 A;  4B9K A;  3ZJU A;  4TQ1 A;  2N9P C;  3QCA A;  1U5F A;  2GMI C;  4K3B A;  2DEN B;  2W9N A;  2ACZ B;  4HAV B;  2EMT A;  3NWD A;  1NYR A;  2M19 A;  1N6Z A;  5D27 A;  2J42 A;  2JZZ A;  4HSI A;  3IAM 1;  4EZL A;  2Q13 A;  3K9P B;  2LMC A;  1H4R A;  3N32 A;  2G45 B;  4ILJ A;  1TXD A;  3A1Q A;  3Q3M C;  3ZYY X;  3P4Q B;  3QAR A;  2D11 A;  3FEH A;  1ESF A;  2C60 A;  1XT9 B;  4JGH B;  4C4V A;  2NTS A;  1LB1 A;  1WGK A;  2NZ8 B;  3Q3N C;  3LB8 C;  1C1Y B;  3Q8F A;  3VXW A;  1Y8R C;  2FCS A;  4LCD E;  2LG1 A;  1Q1O A;  2WXP A;  2JZ3 B;  1ZP0 B;  2BS2 B;  3TUO A;  4WJ7 A;  1QQG A;  2PPH A;  1OMW A;  1C4P A;  1SE2 A;  4YTP B;  3RNG C;  4KVG B;  1UPQ A;  1OTR B;  4A20 A;  1VZ8 A;  2Z0O A;  3I9V 1;  4MSQ B;  4GDL B;  4M8N A;  4NJC A;  3U7Z A;  1XCG A;  4F8C B;  1A5R A;  4HHV A;  2OJR A;  5FR6 A;  2IO0 B;  1KOT A;  2K5P A;  2I1J A;  4N59 A;  3HK0 A;  2KUP A;  1PGX A;  1CZP A;  1Q5W B;  2YT2 A;  1WJM A;  3BY4 B;  2KNB A;  3UIN B;  2FE8 A;  1WFY A;  2L76 A;  2M0A A;  3DCX A;  4HB2 B;  2KO3 A;  4AUQ C;  3J9C A;  3MC9 A;  4BOS C;  2W54 A;  1MJD A;  1ET6 A;  5J18 A;  2Z0P A;  2BVC A;  2MQJ A;  2XK5 A;  3M3J A;  3VIA A;  4I6L B;  3DQV A;  5GMV A;  4NY0 A;  2IYB A;  2ROV A;  3CXB B;  4RF0 A;  5HE1 A;  1XLO A;  4EEW A;  1YJ1 A;  1U5G A;  2I1K A;  4XWT A;  3AEF B;  4KHO A;  2PVG C;  3AUL A;  4ARI A;  4GN1 A;  4DBB A;  1V1P A;  1WIA A;  5CHF A;  4MGI E;  1EWY C;  2QJL A;  4MGK E;  2IYD B;  1JWS D;  4TSS A;  3WAM A;  1KRH A;  4KDL B;  2M0X A;  5C5B A;  1IUE A;  4CSQ A;  2UWQ A;  4A3O A;  1IP9 A;  1T0Y A;  2EMS A;  3ZDT A;  1MKE A;  3FAH A;  1GG3 A;  1QKZ A;  1WR1 A;  2E2X A;  2PJH A;  4OW0 A;  5KHQ A;  2N9L A;  3I57 A;  3W5U B;  3AED B;  5CTR C;  3GZN B;  2YS1 A;  1V88 A;  2MKR A;  1V61 A;  2WDV B;  1TJ6 A;  4PS7 A;  4MAC A;  3KQ4 A;  4USA A;  3GB1 A;  2DYO A;  3RCP A;  1WGU A;  3JW0 X;  1XOD A;  1TS5 A;  3HW2 B;  2DHJ A;  2WS3 B;  4LTU A;  3QWM A;  4S0R A;  1MHH E;  3PRZ A;  2X8X X;  2LD9 A;  1OQY A;  1DRO A;  1P7E A;  3PS6 A;  4KZC A;  1R4M I;  4WJO A;  1K5G B;  2CY5 A;  1WX9 A;  3E9P A;  3BIN A;  1YJJ A;  3U7D A;  1WX7 A;  2HTH A;  1J19 A;  2Y5C A;  1WJ1 A;  1R7S A;  3KUD B;  3MP9 A;  2CQU A;  1WGR A;  2OJW A;  1C3T A;  2KLC A;  2N1V A;  2LI5 A;  3A4S C;  3PTF C;  1NDD A;  3NZU A;  4IM3 A;  4M8M A;  1T3Q A;  1N62 A;  2LGI A;  5C6R A;  3BK1 A;  1L4D B;  2Z59 B;  2LJ5 A;  2A5U A;  5E6N A;  4ZRQ A;  2M4N A;  2J59 M;  2NPT A;  3APC A;  3PSC A;  2OOB B;  3KUC B;  2JT4 B;  4XC2 A;  4YSZ B;  2GBJ A;  1P1A A;  2IFS A;  1V86 A;  2ROZ B;  5IO9 A;  3IBE A;  5G5G A;  2M38 A;  1WZ0 A;  3PHW B;  3PO0 A;  1HE8 A;  4JWU C;  2IDY A;  1L6U A;  5J3T A;  3HSA A;  3TBL D;  3A58 A;  4RCO A;  4ILH A;  2N23 A;  5L83 A;  4DDI D;  1ZC4 B;  4RNA A;  2ICI A;  1C77 A;  5DI9 B;  1X1F A;  2LVQ A;  4RGO S;  1MI1 A;  1KLG D;  1ZPS A;  2V3S A;  2MSE D;  3N1Z C;  1JQ4 A;  1K52 A;  2GBN A;  3ML8 A;  5L95 C;  1VZ6 A;  1V80 A;  2Z8L A;  1OFF A;  2L00 B;  3L08 A;  1BTK A;  1D5Z C;  4W9G A;  1YX6 B;  4D6W A;  2O6V A;  4MJS A;  3DBS A;  3ODW A;  3L17 A;  4CO7 A;  4NAW B;  1HQR D;  2GOW A;  1BUI C;  4NJ6 A;  3R7R A;  2D07 B;  5C1Z A;  3Q6B A;  3GE3 C;  4AJW A;  2RSG A;  5AUI A;  3O96 A;  1J7A A;  2UVM A;  2BKR B;  2LEK A;  3OHM B;  2WXK A;  3M95 A;  4CHJ A;  4LJO B;  1U27 A;  3MHZ A;  1N5X A;  1WJ4 A;  3HHM A;  4GGQ A;  4XYC A;  3AU5 A;  1WI1 A;  3DXD A;  2Y7B A;  3DXC A;  2FBW B;  1V97 A;  3R66 C;  2C7H A;  3PVU A;  1L4Z B;  2WHI A;  1K5D B;  1WYW B;  5E6P A;  3Q8B A;  3P63 A;  2GUM A;  4M00 A;  3QWZ B;  3AE1 B;  4MEL A;  4JPS A;  1DOX A;  1XLQ A;  4IOI E;  1IRS A;  3OG5 A;  2RPV A;  3NWF A;  2N7D A;  3WAL A;  3ULB A;  2KN4 A;  2W55 A;  4W9J A;  5D6J B;  3RN9 C;  1N63 A;  5JVL A;  2KWD A;  1TY2 A;  1Q10 A;  1STE A;  2L0F A;  4PS8 A;  1N61 A;  3IHP C;  4WJP A;  2VKI A;  1DGJ A;  2HDE A;  1HTQ A;  2WYQ A;  5JZE B;  3EEC A;  3OJ4 B;  5FR3 A;  2D9Z A;  1CK1 A;  2QKM A;  4IOY X;  2D3A A;  4B6H A;  2EJ8 A;  2O2V B;  4C7Y A;  2N7J A;  1DDV A;  3A8P A;  1J8C A;  4RFB A;  2DIK A;  4A6K A;  3UQA A;  1CMX B;  1SIJ A;  4JK8 A;  1UNP A;  4XDC A;  2KIE A;  1M7E A;  1R4N I;  2TSS A;  3UIP B;  5I4D A;  2KMM A;  1PFD A;  3D8F A;  3D32 A;  4HPM B;  1UNS A;  3RMK C;  2BGF A;  4TMA B;  1R4M B;  1NEK B;  4LJP B;  1TZ1 A;  3MFG A;  3VUW A;  4E3C A;  3AN1 A;  5D3V A;  5DCN A;  4DWF A;  3DBL I;  3O65 B;  1L6V A;  1XLP A;  3APD A;  4MK0 A;  2MBB B;  1Z87 A;  2YT1 A;  4PQ0 A;  3ZGZ A;  5BMI A;  2RDH A;  3T8M A;  1OQQ A;  4HRS A;  2COA A;  3NS8 A;  3BVZ A;  3NWA A;  3CSF A;  1ZC3 B;  3ZTD A;  1V8C A;  3H8H A;  2M56 B;  1WH3 A;  2WXG A;  1P6S A;  5DHF B;  1KJT A;  1P9D U;  2GRI A;  1T5X D;  2INN E;  3V60 A;  3PGE A;  4WIP A;  2LOZ A;  3KH0 A;  3ZXR A;  5HG2 A;  1PFJ A;  3B08 A;  5DHA B;  3BII D;  1EM7 A;  4LDT B;  2KT7 A;  3B0A A;  3FIL B;  5BMG A;  1MIX A;  1CJE A;  1FXA A;  1QZE A;  4D2K A;  3KLS X;  3LJ3 A;  2IY0 B;  1EVH A;  4BVU C;  3NOB A;  3VRB B;  1WGD A;  2D2Q A;  2QKL A;  2KN5 A;  3BZD B;  3EUB 2;  1GB1 A;  2GJY A;  3M63 B;  1HZ6 A;  2BBC A;  5FK9 C;  1LO5 D;  1F2R I;  2DYN A;  3TFM A;  1JAL A;  1QT9 A;  3EFU A;  1JWB D;  4WQM A;  1EU4 A;  3URY A;  3NY5 A;  1VJK A;  1FHX A;  2L8J A;  3W1Y A;  3T3N A;  2RSU A;  2FCN A;  2R61 A;  1H10 A;  3AMZ A;  1P3R A;  2Z0D B;  4FHJ A;  4L2Y A;  2KCJ A;  1MI0 A;  1WYG A;  3VR8 B;  4PT5 A;  5FI1 A;  5EE1 A;  3RNA C;  3EC8 A;  3M1I B;  4FJV B;  3OAW A;  3WCQ A;  4A6F A;  2YSZ A;  2ZNV B;  3QAQ A;  1KC7 A;  5G55 A;  4F7Z A;  3A4R A;  2ZVN A;  4ZDV A;  4KGS A;  2SAK A;  3FKY A;  1ZXH A;  3U2S C;  3A9J A;  4M01 A;  2LOX A;  5DPT A;  1SBB B;  2KTF A;  2CY4 A;  2BS3 B;  2ASQ A;  5LG4 B;  4OHJ A;  1SEB D;  1TT5 B;  3ZNH B;  1HEZ E;  4HVB A;  1J7B A;  1I42 A;  4W9H A;  1UZX B;  2BKF A;  2WH5 A;  1MK7 B;  1FFU A;  1E8X A;  1WMH B;  4LNI A;  5TSS A;  1ZSQ A;  4IM2 A;  2KOX A;  3W9C B;  2I2Y A;  5D3I B;  3HVD A;  3AEE B;  1AW7 A;  2K2U A;  2GBM A;  3H6N A;  1WI0 A;  5IA7 A;  4B95 A;  5IOI A;  1DYN A;  2WNM A;  3A33 B;  4HAY B;  2UZR A;  5CLL B;  2BWE S;  2MBH A;  4QAY A;  1KH0 A;  4HDO A;  1IGC A;  4W9C A;  5D3D A;  2JRH A;  4ZHO A;  4AS1 A;  4LNK A;  1WXA A;  4HAZ B;  2Y5B B;  2YS3 A;  4OZB A;  4A9A A;  2V1Y A;  3AE5 B;  1E10 A;  2K0P A;  2RQ1 A;  3VVW B;  2P0F A;  3VTW A;  2KQS A;  2A4Z A;  3Q14 C;  3T9L A;  2RRF A;  5JHH A;  1BML C;  2CB8 A;  1XXG A;  2AEH A;  4BFR A;  1FXT B;  2V76 A;  2V3P A;  5IRS A;  3TSS A;  2DZK A;  4WH4 A;  2KFK A;  4GU2 A;  4X57 B;  5C16 A;  2WGS A;  1WGH A;  5JXV A;  3GYO A;  3LYY A;  4TKN A;  1I4P A;  1E7P B;  4EZK A;  2BS4 B;  5D7G A;  2LGY A;  3R2T A;  4W9I A;  2M17 A;  2FCQ A;  3AE6 B;  2BWF A;  1MHX A;  3AI5 A;  4F1S A;  2G4D B;  3PRE A;  3GZN I;  2NMB A;  4QJ4 B;  2ZEQ A;  4JKG A;  2D9V A;  4JKB A;  2DFK A;  1KZ7 A;  2UU7 A;  1HA5 A;  4IW0 A;  2RR9 A;  5EE3 A;  4L23 A;  1FHO A;  4KZ0 A;  2H89 B;  1JRU A;  2GCL A;  1WE6 A;  5LOP B;  1IBX B;  3B2G A;  4ANX A;  2JZP A;  1TQZ A;  1WX8 A;  4ZYN A;  1FGY A;  4OT1 A;  1E5W A;  1WF9 A;  1GC7 A;  2CKH B;  3P2B A;  2N1W A;  2FID A;  3VTV A;  1ROE A;  4O1N A;  4ZHP A;  1E8W A;  1ZXI A;  4GMX B;  2J0M A;  1TS4 A;  1WE7 A;  1WXS A;  4AOF A;  3FC4 A;  3V61 A;  2JSV X;  2YEP F;  3AV8 A;  4REZ A;  3Q3J A;  2KTR B;  2FDQ A;  2KHW B;  2MX2 A;  1V81 A;  2FNJ B;  3F5R A;  1VBH A;  2PZ1 A;  2Z13 A;  2DLB A;  2NBV A;  3NRZ A;  2W2W A;  4KGT A;  4GPT B;  4KHB A;  3SUZ A;  3T06 A;  1TBE A;  1JCK B;  4BZA A;  4XX5 A;  3DXE A;  4URK A;  2PVO D;  1HTO A;  2LRU A;  4KKI A;  3PEG A;  4W9K A;  3P7Z A;  3PRM B;  1C78 A;  1WXM A;  3V6C B;  1OGW A;  2FJ9 A;  1WR6 E;  4KHA A;  1L0V B;  1I35 A;  2J53 A;  2LFI A;  2CU1 A;  3I5J C;  3IXS A;  4IAP A;  4ZRJ A;  1DYQ A;  2NBW B;  2VZK D;  3NZ3 A;  4FLH A;  1I7H A;  2L1C A;  4OVU A;  4GDK B;  5LNK 1;  1SGH A;  1VBG A;  3WA0 A;  2HE7 A;  2K6Q A;  4C80 A;  3CIK A;  4WQO B;  4HAW B;  2PE9 A;  2PE6 B;  2D10 A;  5BMH A;  1VRA B;  4G11 A;  2L52 A;  2CJN A;  3HVZ A;  5IJM A;  1MPE A;  1V1O A;  1JRP A;  1MK9 B;  3AEC B;  1XR0 B;  2ZJD A;  4DIX A;  1BWN A;  2DZJ A;  1JWM D;  2L05 A;  3AE4 B;  3V3X A;  3UQB A;  4K7S A;  2KMA A;  3TEZ A;  3V05 A;  2KWU B;  5J2R A;  3FVC A;  1W1G A;  2DAF A;  5EE9 A;  3VRA B;  1UH6 A;  2FIF A;  3ZRF A;  1TGZ B;  1ACC A;  4YTM B;  1B55 A;  4YL8 A;  3Q2A C;  4EE2 A;  2GBK A;  1UPR A;  2HD5 B;  3IFW B;  4LNF A;  3E66 A;  3X23 A;  2DHI A;  2CR5 A;  1VD2 A;  1FXI A;  2WXQ A;  3OWE B;  4K7W A;  4QJ3 B;  1WJ6 A;  2KDB A;  4W9D A;  3VH4 B;  1FOE A;  4F7H A;  4JE3 B;  4BAX A;  1WRI A;  3DVG Y;  2N7E A;  2I5F A;  2FUH B;  1J0G A;  1EAZ A;  2I38 A;  3KSY A;  2MBE A;  4YWG G;  2DZM A;  4JKE A;  4KIK B;  2IND C;  1FRR A;  3ZNG C;  1WVH A;  1ISN A;  2DNF A;  2G35 A;  2J0K A;  2BYF A;  1ZDV A;  5MPO A;  4P6V F;  5CLQ B;  1TY0 A;  4EZJ A;  1WJU A;  1FIQ A;  4II3 B;  4PYZ A;  1BXT A;  3ETR A;  2GB1 A;  1K51 A;  1TKY A;  3PVW A;  4KDI C;  2IGH A;  2KVZ A;  2E6X A;  2GCJ A;  2L2I A;  2GBR A;  2QHO A;  4EUT A;  3ZQ4 A;  1P98 A;  3VTU A;  3P4R B;  2QEJ C;  1FD6 A;  4YT0 B;  4ACF A;  2LVO A;  1SJH D;  2IO3 B;  3KYC D;  1V49 A;  1DBH A;  3N30 A;  2L0T A;  2VRR B;  1T0R C;  1XF5 L;  2LGS A;  4WVF B;  4ARC A;  2WXM A;  2ABD A;  5M4Y B;  3V62 A;  3NVZ A;  3P4S B;  1S3S G;  3NS1 A;  2E3T A;  2NBU A;  4JX1 C;  1LW3 A;  2KKC A;  3CF6 E;  4FJZ A;  2FJU B;  1T0Q C;  3ZRC A;  1ZYI A;  2KMC A;  4RM9 A;  5HHD G;  4PNK A;  4AP4 C;  3WAN A;  1YOV B;  3WIM A;  3NG0 A;  3C0R B;  3Q3F A;  2VH1 A;  2D3B A;  4HJG E;  1FAO A;  1SE4 A;  3ML9 A;  1U2B A;  3QBV B;  3N3K B;  4JK9 A;  4MM3 A;  4Z2M B;  2LGX A;  1L2N A;  5LLI A;  4YTN B;  5KQ4 A;  1WXV A;  4GDL A;  4A55 A;  3PT2 B;  2ZCC A;  5CHV C;  2INP E;  3DBH I;  1YNT E;  3PZD A;  1UD7 A;  3RT3 B;  1EUV B;  2JYE A;  1MAI A;  1SXT A;  1J0W A;  5G2N A;  2C5L C;  4DDG D; 
#chains in the Genus database with same CATH homology
 3ULC A;  1EO6 A;  1XD4 A;  3F0W A;  4WSF A;  2DX5 B;  1NVL A;  3ZIM A;  3VQI A;  1W1D A;  5AEK B;  4DHJ D;  3QX1 A;  2B3A A;  1V5M A;  2D9W A;  5HKH A;  4ICU A;  4P7I A;  3HQC A;  1XD3 B;  3N7C A;  3EPY A;  1KBL A;  2BYE A;  2KFJ A;  2H7E A;  2O6V D;  2H7D A;  4DX9 0;  3KVF B;  3TVV A;  3L0W B;  2AL3 A;  4WWO A;  3JYU A;  4BBN F;  2KJ6 A;  1WGG A;  4D0N B;  1W1H A;  3E9O A;  3FLV A;  5DPS A;  2KQ7 A;  3ZVR A;  4ZRK A;  3WAP A;  4F7G A;  1NTY A;  1YX5 B;  5HE0 A;  2K25 A;  4K7U A;  4F7U P;  4DXA B;  3SYX A;  5TR5 A;  2RD0 A;  3LDZ E;  1ZVR A;  4MT7 A;  1XX0 A;  3PPA A;  4BKG A;  2P8V A;  1L7Y A;  3W1S A;  5KHO A;  3W1S C;  2NCN A;  3D8D A;  2DN6 A;  2DTC A;  1KLV A;  4NPN A;  1Y5O A;  4FA6 A;  1GUA B;  1BT0 A;  2CHZ A;  3APF A;  3UGB B;  1M94 A;  2X18 A;  3ZDM C;  4BBN C;  2ZVO A;  1UBI A;  1I7A A;  1WM3 A;  1UEF A;  1GC6 A;  2M8S A;  2W2X C;  2RPQ A;  3VOQ A;  2REX A;  1Z5S B;  2WDT B;  2D4Q A;  2DA0 A;  4EKU A;  4I6P A;  3IG3 A;  2M1M A;  3PRP B;  2EKE C;  2LXC A;  3TO1 A;  4BKT A;  4HXD A;  4JKA A;  3TJP A;  4CHM A;  1BAK A;  3DDC B;  3P6A A;  1HB8 A;  1V5T A;  1PLS A;  2KC1 A;  3RZF A;  3OAN A;  4GXB A;  4WAA A;  4GIV A;  2RUK B;  1DDM A;  4NAW A;  2MFQ A;  3WYF B;  4JIO U;  3QQ8 B;  4FHK A;  3RYT A;  3ZUN A;  1OEY J;  3ZVV A;  3DVG X;  4M0W B;  4KSK C;  1Q67 A;  4ICV A;  4MEM A;  1U5E A;  5JHA A;  3SDL C;  3VAW A;  4IUM B;  2KFK B;  5D2M B;  5LXH A;  1ACA A;  3H7P B;  2JXX A;  2CHX A;  2D3G A;  1F9J A;  1OEY A;  3DVN U;  3G9W A;  1PQS A;  2K00 A;  1V6E A;  4W9F A;  5AZH A;  2RVB B;  3ONS A;  4JLC A;  5JH5 C;  3V5W A;  1X86 A;  2C9W B;  3UIO B;  2N9E B;  3JSV B;  3TCA A;  5J3Y A;  2Z0E B;  4IWQ A;  2DYB A;  1E8Y A;  2DZI A;  2HJ8 A;  2O2V A;  2KVR A;  3A9K B;  2R2Q A;  3U8Z A;  1UBQ A;  3ENE A;  1GJZ A;  4MGY E;  5EDS A;  4KHB B;  4E71 A;  2JRI B;  3A1Q B;  4GSW A;  2ELA A;  1EF5 A;  1ST7 A;  3SBG A;  3QK0 A;  4JL9 A;  2AL6 A;  2LGD A;  1ZM0 A;  2NS5 A;  5DPR A;  4AWJ A;  2LWP A;  2WWZ A;  3DCG A;  2IY1 B;  2MP2 A;  3KW5 B;  4K2P A;  2YF0 A;  3A8Q A;  1WY8 A;  3NSU A;  2DYM A;  3H7S A;  1FHW A;  5JP4 A;  3RUI B;  1OQN A;  3ODX A;  3SO6 A;  4G50 A;  4HAX B;  3H9D A;  4II2 B;  2R09 A;  1LM8 B;  2KZR A;  1YQB A;  3L10 B;  1XQQ A;  3SV1 A;  3MJW A;  3KY9 A;  2KWV B;  5D3Y A;  2G4S A;  2IO2 B;  4HLE A;  2MWN B;  2NVU I;  1G6J A;  3AJ4 A;  5FI0 A;  2DLW A;  4FAD A;  2K8C A;  3IVF A;  4DBG A;  2N9X A;  2MRP A;  3PP2 A;  3L13 A;  2PEA A;  3HM3 A;  1X05 A;  2XK5 B;  1UGM A;  4HPL B;  4JK7 A;  3ZW3 A;  1X1M A;  1UNR A;  1NTI A;  2ADZ A;  4AJY B;  2KXJ A;  4XWX A;  3MHS D;  1Q0W B;  5J3Q A;  3X0W A;  2KDF B;  3V6E B;  3SU8 X;  2ZNV C;  3GYP A;  3ML4 A;  4IFS A;  2X0S A;  3HIZ A;  4EFO A;  2G3Q B;  4K81 A;  3M62 B;  5C5B B;  2MDX A;  3PHX B;  4IG7 B;  4CHK A;  4EMO A;  3GOE A;  2MWS B;  1PMS A;  3MTN B;  5JHB A;  1ZGU B;  4HB0 B;  4PYU A;  4PS3 A;  2XQN M;  2LVP A;  1WMH A;  2KK8 A;  3TW1 A;  4FN2 A;  2BPS A;  4DHZ E;  4E74 A;  2WX1 A;  1ZW7 A;  2MBQ A;  1RLF A;  3RD2 A;  1S1Q B;  4I6N B;  2MLB A;  5C79 A;  2L7R A;  3VHT C;  2CRF A;  3UF8 A;  2IZV B;  1LXD A;  2GS0 A;  2HTH B;  2V4L A;  1HB6 A;  2R2O A;  4OVV A;  3TL5 A;  4A3P A;  5AZF A;  3QIJ A;  5HE3 A;  1Z2M A;  2NPT B;  4JKF A;  3ALB A;  1DIK A;  3BJI A;  2IO1 B;  3OLM D;  2ELB A;  1U29 A;  2COP A;  2DHK A;  4W9E A;  4GMV A;  5EFX A;  3D8E A;  4L6E A;  4A5K A;  4WJQ A;  3R3M A;  3ECI A;  1KZG A;  4DHJ B;  1TTN A;  4K17 A;  5CX3 A;  1MIZ B;  4WWN A;  1V5P A;  3ODO A;  3CST A;  1AAR A;  5L81 A;  1YD8 U;  4HJK A;  2O6V B;  4MJS B;  4W9L A;  4HAU B;  5JLJ B;  1AWE A;  3PSE B;  2D9Y A;  2KGX B;  2MA9 B;  1NBF C;  4RM8 A;  3ZTC A;  1RRP B;  1I2H A;  1FGZ A;  3SD5 A;  2K8B A;  3E9L A;  2KTR A;  4ILG B;  2KDE B;  3PLV A;  2LAS A;  4Y94 A;  3NHE B;  1WZ3 A;  4BOZ B;  2J7Q B;  4TUU A;  4A6H A;  3A98 B;  2YT0 A;  2R82 A;  4KSL C;  2BCJ A;  4ANU A;  2NR2 A;  1V5O A;  3KYD D;  2YLM A;  3SBT A;  1KI1 B;  3AXC A;  3I3T B;  2YRY A;  3SNH A;  2N4F A;  2YS5 A;  5D3W A;  4GOC A;  5KCV A;  1RFA A;  2BF8 B;  2FCM A;  2CHW A;  2JY6 A;  4NQK E;  4GDK A;  2COC A;  3HM6 X;  4NNJ B;  4HB3 B;  5AZG A;  1HBK A;  2R0D A;  3KZ1 A;  4CYE A;  3RZW C;  1M7R A;  3ENB A;  3U30 A;  1AQC A;  4DK5 A;  1KM7 A;  2LZ6 A;  3PG7 A;  1SHC A;  5J17 A;  4YON A;  4FJY A;  5IAA C;  4FUL A;  2ZPY A;  2K8H A;  2ZCB A;  1BTN A;  2LBB A;  2DX1 A;  2K2J A;  2DAJ A;  5D94 A;  4WWP A;  2IBI B;  1LQB A;  3JVZ X;  2FAZ A;  2KD0 A;  2VRW B;  1H8C A;  1P3Q U;  2RGF A;  4KIK A;  2C7N B;  3DPD A;  2MCN B;  2P0H A;  1V9J A;  3VDZ A;  3ZKJ C;  3FSS A;  4Z2N A;  1E90 A;  5E6O A;  4JKH A;  4G3X B;  4JQW C;  4B6W A;  1WM2 A;  2BYV E;  1V89 A;  3QJZ A;  3FP5 A;  1NU2 A;  5LXI B;  1X11 A;  2OTX A;  4MGZ E;  2KC2 A;  3OJ3 A;  3TIX A;  1UNQ A;  4TQ0 A;  4DHZ B;  3ZO5 B;  4ASW C;  1RAX A;  4J6I A;  2Y8F A;  2DYQ A;  2JPH A;  4KV2 A;  1K8R B;  1MG8 A;  2KX3 A;  2L3Z A;  3UZT A;  2ZZP B;  1JDE A;  1XKE A;  4MSM B;  2AWT A;  1E7V A;  3DVN V;  2KDI A;  4HAT B;  4DX8 A;  3DOW A;  3WAO A;  3DBR I;  5BO4 B;  2KAN A;  2M14 A;  3KUZ A;  4JKC A;  4HWI B;  1WGQ A;  5C23 A;  4A6F B;  3PV1 A;  2W2X D;  4JKD A;  2Z0Q A;  2KJH B;  1SE9 A;  1Y19 B;  2COD A;  3A9J B;  1WJN A;  3S2A A;  4EJN A;  2JF5 A;  4GB9 A;  1YIW A;  3NZS A;  4TV3 A;  1NI2 A;  1RRB A;  2COF A;  2DKQ A;  2VSZ A;  3K9O B;  2LKO A;  5D3X A;  2DX5 A;  4G0N B;  1FB8 A;  3FM8 C;  3VUY A;  4XZ4 A;  2K6D B;  1VCB A;  4MY6 A;  2UZS A;  4K1R B;  1IPG A;  2J0J A;  4HDQ A;  2MP2 B;  2LRW A;  3B1L X;  3VFK A;  1OY2 A;  4NQL B;  2LUE A;  5DPW A;  3EHV A;  2OQB A;  1V2Y A;  1WRD B;  4TYZ A;  3RCZ A;  2JVC A;  1N3H A;  2AYO B;  2DHZ A;  1E7U A;  2ZPN A;  3H1U A;  4H8S A;  5KQ1 A;  4RMA A;  1IYF A;  1V5U A;  4JKG B;  2KX0 A;  3ZNI D;  2N0Y A;  2K1F A;  3QA8 A;  2C7M B;  2MW5 A;  1MPH A;  2UYZ B;  2I5C A;  3PVL A;  1X1G A;  2RNR B;  5HE2 A;  4KAX B;  4N9F 4;  5CHW A;  2RLO A;  3MPX A;  1WG7 A;  1QC6 A;  2LUL A;  2K39 A;  4HCP B;  4HB4 B;  5DIF B;  2MBO A;  4ANW A;  1EF1 A;  5LON B;  2NBV B;  1U4A A;  3L54 A;  1P5T A;  3CMM B;  4HK2 A;  1UEL A;  1E8Z A;  2LXA A;  2D9X A;  3R7Q A;  4IWO A;  2KJR A;  2JWZ A;  1P0R A;  1NTV A;  1U5D A;  2FJL A;  3L16 A;  2CAY A;  2DKP A;  2JUO A;  4IC7 B;  2YVC A;  3QC8 B;  1GNU A;  3KRX A;  3SHQ A;  1DDW A;  2P0D A;  5DH9 B;  4BBK A;  3PLU A;  3KRW A;  4LDT D;  1LFD A;  2Y8G A;  2KWC A;  1WGY A;  2RGN B;  4BKS A;  3TMP B;  4C0A A;  2LYD A;  3VUX A;  3LJU X;  4BKS D;  1SIF A;  4K2O A;  5GOW B;  1ZKH A;  4HCN B;  3ZNZ B;  4NJ7 A;  4IM0 A;  3RUL A;  3H7P A;  4WJN A;  1GGO A;  4ZRI A;  4GZU A;  2KLG A;  3ZLZ A;  5JHG A;  2XEW A;  4FBJ B;  4ANV A;  3MDB C;  4IWP A;  4MDK E;  1EGX A;  2JP2 A;  1RJ2 A;  3QHT A;  2XBB C;  2CS4 A;  3JSV A;  4MH0 E;  3VH3 B;  2EC1 A;  2HRJ A;  1D3Z A;  4EOY A;  3A9K A;  3AU4 A;  4NSW A;  2WX0 A;  4B9K A;  4TQ1 A;  2N9P C;  3QCA A;  1U5F A;  2GMI C;  2DEN B;  2W9N A;  4HAV B;  2EMT A;  5D27 A;  2JZZ A;  4EZL A;  2Q13 A;  3K9P B;  3N32 A;  1H4R A;  2G45 B;  4ILJ A;  1TXD A;  3A1Q A;  3QAR A;  2D11 A;  3FEH A;  2C60 A;  1XT9 B;  4JGH B;  1LB1 A;  2NZ8 B;  1C1Y B;  3VXW A;  1Y8R C;  2FCS A;  4LCD E;  2LG1 A;  1Q1O A;  2JZ3 B;  4WJ7 A;  1QQG A;  2PPH A;  1OMW A;  4KVG B;  1UPQ A;  1OTR B;  4A20 A;  2Z0O A;  4MSQ B;  4GDL B;  4M8N A;  1XCG A;  4F8C B;  1A5R A;  4HHV A;  2OJR A;  5FR6 A;  2IO0 B;  1KOT A;  2I1J A;  3HK0 A;  2KUP A;  1Q5W B;  1WJM A;  3BY4 B;  2KNB A;  3UIN B;  1WFY A;  2L76 A;  4HB2 B;  2KO3 A;  4AUQ C;  4BOS C;  5J18 A;  2Z0P A;  2MQJ A;  2XK5 A;  3M3J A;  3VIA A;  4I6L B;  3DQV A;  5GMV A;  4NY0 A;  2IYB A;  2ROV A;  3CXB B;  5HE1 A;  4EEW A;  1YJ1 A;  1U5G A;  2I1K A;  4KHO A;  3AUL A;  4GN1 A;  4DBB A;  1WIA A;  5CHF A;  4MGI E;  4MGK E;  2IYD B;  3WAM A;  4KDL B;  2M0X A;  5C5B A;  2UWQ A;  4A3O A;  1IP9 A;  1T0Y A;  2EMS A;  3ZDT A;  1MKE A;  1GG3 A;  1WR1 A;  2E2X A;  2PJH A;  5KHQ A;  5CTR C;  2YS1 A;  1V88 A;  2MKR A;  1V61 A;  1TJ6 A;  4PS7 A;  2DYO A;  3RCP A;  1WGU A;  3JW0 X;  1XOD A;  3HW2 B;  2DHJ A;  3QWM A;  3PRZ A;  2LD9 A;  1OQY A;  1DRO A;  3PS6 A;  4KZC A;  1R4M I;  4WJO A;  1K5G B;  2CY5 A;  1WX9 A;  3E9P A;  3BIN A;  3U7D A;  1WX7 A;  2HTH A;  1J19 A;  1WJ1 A;  3KUD B;  2CQU A;  1WGR A;  1C3T A;  2KLC A;  2N1V A;  2LI5 A;  3A4S C;  3PTF C;  1NDD A;  3NZU A;  4IM3 A;  4M8M A;  5C6R A;  2Z59 B;  2LJ5 A;  2A5U A;  5E6N A;  2M4N A;  2J59 M;  2NPT A;  3APC A;  3PSC A;  2OOB B;  3KUC B;  2JT4 B;  4XC2 A;  2GBJ A;  1P1A A;  2IFS A;  1V86 A;  2ROZ B;  3IBE A;  2M38 A;  1WZ0 A;  3PHW B;  1HE8 A;  5J3T A;  3TBL D;  4ILH A;  2N23 A;  5L83 A;  4DDI D;  1ZC4 B;  5DI9 B;  1X1F A;  2LVQ A;  2V3S A;  2MSE D;  2GBN A;  3ML8 A;  5L95 C;  1V80 A;  2L00 B;  3L08 A;  1BTK A;  4W9G A;  1YX6 B;  4MJS A;  2O6V A;  3DBS A;  3ODW A;  3L17 A;  4CO7 A;  4NAW B;  2GOW A;  4NJ6 A;  3R7R A;  2D07 B;  5C1Z A;  4AJW A;  2RSG A;  3O96 A;  2UVM A;  2BKR B;  3M95 A;  4LJO B;  4CHJ A;  1U27 A;  1WJ4 A;  3HHM A;  4GGQ A;  3AU5 A;  1WI1 A;  3DXD A;  2Y7B A;  3DXC A;  3R66 C;  2C7H A;  3PVU A;  1K5D B;  1WYW B;  5E6P A;  3QWZ B;  4MEL A;  1IRS A;  2N7D A;  3WAL A;  3ULB A;  4W9J A;  5D6J B;  5JVL A;  2L0F A;  4PS8 A;  3IHP C;  4WJP A;  2VKI A;  2WYQ A;  5JZE B;  3EEC A;  3OJ4 B;  2D9Z A;  2QKM A;  4IOY X;  4B6H A;  2EJ8 A;  2O2V B;  1DDV A;  3A8P A;  1J8C A;  2DIK A;  4A6K A;  3UQA A;  1CMX B;  4JK8 A;  1UNP A;  1M7E A;  1R4N I;  3UIP B;  3D8F A;  3D32 A;  4HPM B;  2BGF A;  4LJP B;  1TZ1 A;  3VUW A;  4E3C A;  5D3V A;  5DCN A;  4DWF A;  3DBL I;  3O65 B;  3APD A;  4MK0 A;  2MBB B;  1Z87 A;  2YT1 A;  4PQ0 A;  3T8M A;  2COA A;  3NS8 A;  3CSF A;  1ZC3 B;  3ZTD A;  1WH3 A;  1P6S A;  5DHF B;  1KJT A;  1P9D U;  3V60 A;  3PGE A;  2LOZ A;  3KH0 A;  1PFJ A;  3B08 A;  5DHA B;  4LDT B;  3B0A A;  1MIX A;  1QZE A;  3LJ3 A;  2IY0 B;  1EVH A;  4BVU C;  3NOB A;  1WGD A;  2D2Q A;  2QKL A;  2KN5 A;  2GJY A;  3M63 B;  2DYN A;  3TFM A;  3EFU A;  3NY5 A;  2L8J A;  1FHX A;  3W1Y A;  2RSU A;  2FCN A;  1H10 A;  1P3R A;  2Z0D B;  4FHJ A;  2KCJ A;  5FI1 A;  3EC8 A;  3M1I B;  4FJV B;  3OAW A;  4A6F A;  2YSZ A;  2ZNV B;  3QAQ A;  1KC7 A;  5G55 A;  4F7Z A;  3A4R A;  2ZVN A;  4ZDV A;  3A9J A;  2LOX A;  5DPT A;  2KTF A;  2CY4 A;  2ASQ A;  3ZNH B;  4HVB A;  1I42 A;  4W9H A;  1UZX B;  2BKF A;  2WH5 A;  1MK7 B;  1E8X A;  1WMH B;  1ZSQ A;  4IM2 A;  2KOX A;  2K2U A;  2GBM A;  3H6N A;  1WI0 A;  5IA7 A;  4B95 A;  1DYN A;  3A33 B;  4HAY B;  2UZR A;  5CLL B;  2BWE S;  2MBH A;  4HDO A;  4W9C A;  2JRH A;  1WXA A;  4HAZ B;  2Y5B B;  2YS3 A;  2V1Y A;  2RQ1 A;  3VVW B;  2P0F A;  3VTW A;  2KQS A;  2A4Z A;  3T9L A;  5JHH A;  2CB8 A;  4BFR A;  2AEH A;  1FXT B;  2V76 A;  2DZK A;  2KFK A;  4GU2 A;  4X57 B;  5C16 A;  1WGH A;  3GYO A;  4TKN A;  4EZK A;  5D7G A;  2LGY A;  4W9I A;  2M17 A;  2FCQ A;  2BWF A;  3AI5 A;  4F1S A;  2G4D B;  3PRE A;  3GZN I;  2NMB A;  2ZEQ A;  4JKG A;  2D9V A;  4JKB A;  2DFK A;  1KZ7 A;  4IW0 A;  2RR9 A;  1FHO A;  4KZ0 A;  1JRU A;  2GCL A;  1WE6 A;  5LOP B;  4ANX A;  1TQZ A;  1WX8 A;  4ZYN A;  1FGY A;  1E5W A;  1WF9 A;  1GC7 A;  2CKH B;  3P2B A;  2N1W A;  2FID A;  3VTV A;  1E8W A;  4GMX B;  2J0M A;  1WE7 A;  1WXS A;  4AOF A;  3V61 A;  3Q3J A;  2KTR B;  2FDQ A;  2KHW B;  2MX2 A;  1V81 A;  2FNJ B;  3F5R A;  1VBH A;  2PZ1 A;  2W2W A;  4GPT B;  3SUZ A;  3T06 A;  1TBE A;  4XX5 A;  3DXE A;  4URK A;  2LRU A;  3PEG A;  4W9K A;  3P7Z A;  3PRM B;  1WXM A;  3V6C B;  1OGW A;  2FJ9 A;  1WR6 E;  4KHA A;  1I35 A;  2CU1 A;  4IAP A;  4ZRJ A;  2NBW B;  4FLH A;  2L1C A;  4OVU A;  4GDK B;  1SGH A;  1VBG A;  3WA0 A;  2HE7 A;  2K6Q A;  3CIK A;  4WQO B;  4HAW B;  2PE9 A;  2PE6 B;  2D10 A;  4G11 A;  5IJM A;  1MK9 B;  1XR0 B;  2ZJD A;  1BWN A;  2DZJ A;  2L05 A;  3UQB A;  4K7S A;  2KMA A;  2KWU B;  5J2R A;  1W1G A;  2DAF A;  1UH6 A;  2FIF A;  3ZRF A;  1TGZ B;  1B55 A;  4YL8 A;  2GBK A;  1UPR A;  2HD5 B;  3IFW B;  3E66 A;  3X23 A;  2DHI A;  2CR5 A;  1VD2 A;  4K7W A;  4W9D A;  1WJ6 A;  2KDB A;  3VH4 B;  1FOE A;  4F7H A;  3DVG Y;  2N7E A;  2I5F A;  2FUH B;  1J0G A;  1EAZ A;  3KSY A;  2MBE A;  2DZM A;  4JKE A;  4KIK B;  3ZNG C;  1WVH A;  1ISN A;  2G35 A;  2J0K A;  2BYF A;  5CLQ B;  4EZJ A;  1WJU A;  4II3 B;  4PYZ A;  3PVW A;  4KDI C;  2GCJ A;  2L2I A;  2GBR A;  2QHO A;  4EUT A;  1P98 A;  3VTU A;  2LVO A;  2IO3 B;  3KYC D;  1V49 A;  1DBH A;  3N30 A;  2L0T A;  2VRR B;  4WVF B;  2ABD A;  3V62 A;  1S3S G;  2NBU A;  1LW3 A;  2KKC A;  3CF6 E;  4FJZ A;  3ZRC A;  2KMC A;  4RM9 A;  4PNK A;  4AP4 C;  3WAN A;  3WIM A;  3C0R B;  3Q3F A;  1FAO A;  3ML9 A;  1U2B A;  3QBV B;  3N3K B;  4JK9 A;  4MM3 A;  4Z2M B;  2LGX A;  1L2N A;  5LLI A;  5KQ4 A;  1WXV A;  4GDL A;  3PT2 B;  2ZCC A;  5CHV C;  3DBH I;  3PZD A;  1UD7 A;  3RT3 B;  1EUV B;  1MAI A;  1J0W A;  5G2N A;  2C5L C;  4DDG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...