2EMTA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
313
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis of PSGL-1 binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 89
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emtA01
3NOBA 1IYFA 3ODXA 1J8CA 1WZ3A 1RJ2A 3UIPB 1M94A 1JRUA 5LOPB 2O6VB 5CHFA 3L08A 4PS8A 1XCGA 3RCZA 4HB0B 2BYFA 4NQLB 2G35A 4BBKA 5C79A 3KW5B 2IFSA 2ZJDA 2KWUB 3PLVA 5E6PA 2V3SA 4NY0A 4I6LB 3DOWA 4F7GA 2DX5A 2DYBA 1XD3B 4IWOA 3BJIA 2HJ8A 4F7HA 4MK0A 2MRPA 2YSZA 4RMAA 2C7NB 2Z59B 3VUXA 2LG1A 3PV1A 4II2B 2FCMA 3IHPC 1W1DA 3K9OB 3MPXA 2LGYA 2OQBA 4GDKA 1D3ZA 4TQ0A 2GOWA 1WJMA 4CHKA 2Z0OA 1V2YA 1U5EA 1E7UA 2DZMA 4HB3B 2RSUA 4IWPA 4DBGA 1Q5WB 2RQ1A 1H8CA 5IJMA 2RLOA 2M0XA 4GDLB 3L54A 2CRFA 4EZKA 1V9JA 4WWPA 1UNPA 1WR6E 4MGIE 2XK5B 1FGYA 4AJWA 1V5OA 4ZDVA 1DDMA 2DA0A 5JH5C 2W2XD 3R7QA 5C23A 2DYMA 3HK0A 1WVHA 2K2JA 1WXSA 5D3YA 2YVCA 4GU2A 3HW2B 4GMVA 4TV3A 5AZGA 5CX3A 1P1AA 2RVBB 2MWSB 3TBLD 2NS5A 3PREA 4FA6A 3DXEA 2GBNA 4KV2A 3DXDA 2YT1A 4MGYE 4Z2NA 1YD8U 1XX0A 5J17A 5J3YA 3H9DA 1C1YB 1Y19B 2AYOB 1HB8A 3TO1A 2G4DB 2CKHB 4GSWA 3RT3B 2Z0PA 5JZEB 4NNJB 3AULA 3OJ4B 5C1ZA 4OVVA 1Z2MA 2IBIB 3LJ3A 2KKCA 1ZC4B 1MK9B 2D9VA 3NS8A 4CYEA 5JHGA 2MLBA 2ASQA 3FEHA 2ZEQA 4X57B 3IBEA 2CR5A 4WAAA 4EUTA 2N7DA 3KZ1A 2OJRA 5KCVA 1R4NI 2WWZA 2R2QA 1WJUA 2DYNA 1AARA 3HHMA 1OQNA 3PSEB 2DENB 3A9KB 3DBRI 2FJ9A 3PHXB 1WX9A 2UYZB 2L3ZA 4DWFA 3PGEA 2E2XA 2YS5A 2M38A 3WANA 1FHWA 2EKEC 3VH3B 1LXDA 2YS1A 2Y8FA 1WJ4A 1WE6A 2KC1A 4BKSA 2AL3A 4A6FA 2MBQA 3UIOB 4W9DA 4PYZA 2MP2A 4FBJB 3AU5A 4A6KA 2OTXA 3TIXA 3L16A 2JZ3B 3R3MA 4GPTB 1TJ6A 4B95A 3N3KB 5IAAC 1UBIA 1WXMA 4AP4C 2Q13A 1IRSA 4LJOB 2C60A 1SE9A 1GNUA 1S3SG 4HAXB 2Z0DB 4PNKA 1LW3A 1FGZA 1V5PA 2XBBC 2FNJB 4GOCA 4G11A 2VRRB 4HPMB 2V76A 3KUZA 4RM8A 3EPYA 3HIZA 1V89A 4NQKE 2NBVB 2BF8B 2M4NA 3QK0A 1I42A 4B6WA 3W1SC 1KLVA 5DPTA 4EKUA 1X86A 1YX5B 2MSED 2K00A 4MDKE 3IVFA 1MKEA 2MCNB 2RPQA 3BY4B 1QZEA 4EZLA 1KZ7A 3V60A 4L6EA 2PPHA 4HDQA 4NPNA 4LCDE 5L81A 2JWZA 2NPTA 2HE7A 5DPWA 3DDCB 3A8QA 2YRYA 3PLUA 1UH6A 5GMVA 2COFA 2Y7BA 5EDSA 3CIKA 2CHXA 3Q3JA 4TKNA 3QX1A 2DHJA 3FM8C 1P5TA 1J0WA 1ZW7A 2OOBB 3NY5A 4AUQC 4F8CB 4JQWC 5KHQA 1UBQA 2JZZA 3TL5A 1WXVA 5DPSA 2KX0A 2FJLA 1OMWA 2ROVA 2PEAA 4FHJA 4HAZB 4F1SA 2MFQA 2LVPA 1OGWA 2J0MA 1K5GB 4TYZA 3QHTA 3ODWA 1YJ1A 3X23A 3EECA 3T06A 2GBMA 3VFKA 3QQ8B 1P3QU 3GZNI 3WALA 2O6VA 2DHIA 1U5DA 1WM2A 3PHWB 3ECIA 2FIFA 1WFYA 5DI9B 1E90A 3DVGX 2KO3A 2L76A 4MJSB 4AWJA 3WIMA 1Y5OA 2KFKB 2C9WB 2DHZA 4II3B 2RNRB 1ACAA 2K25A 2HRJA 4IOYX 3PP2A 5D3VA 4MT7A 1WYWB 1RAXA 3PSCA 2ZPNA 3VOQA 3D8DA 2FUHB 3KYDD 4BKTA 3KUDB 4N9F4 3IFWB 2LI5A 3JSVB 1R4MI 4WSFA 2LASA 2RGNB 4URKA 2DKPA 5JP4A 3RD2A 2N9XA 4E74A 3ZO5B 4M8NA 1GC6A 2A5UA 3B08A 2DFKA 1RFAA 2MA9B 4MSQB 1I2HA 2MQJA 5CHVC 2FDQA 3L0WB 2GCLA 3UINB 3UZTA 2K6DB 3DVNU 1M7RA 2KDBA 4W9CA 5AEKB 2GBRA 4BVUC 1P9DU 3QJZA 2PJHA 1MPHA 2VKIA 1MAIA 2KX3A 2QHOA 1KI1B 2K8HA 3CMMB 1OQYA 2V4LA 3R66C 4GDLA 2CHZA 2PE9A 2LXCA 2MW5A 3B1LX 3DVGY 4XWXA 1Z87A 1H10A 2QKLA 2C7HA 4M8MA 5LLIA 4DX90 4HVBA 4E3CA 2G3QB 1KOTA 2KUPA 2AEHA 2WDTB 1FXTB 1P3RA 4Z2MB 2KDEB 1OEYJ 1PMSA 4K2PA 1X11A 1V5MA 3A4RA 4A3OA 3W1YA 4JGHB 1UELA 3VVWB 4ZRIA 3KRXA 3UGBB 3V61A 4IUMB 2BKFA 4MSMB 1IP9A 4WVFB 5AZFA 1ZVRA 2KN5A 4LDTD 2NZ8B 3APCA 1Z5SB 4ZRJA 4EFOA 4PS7A 3SD5A 1WXAA 1V81A 4KVGB 3SO6A 1UPQA 3T9LA 3L13A 4K2OA 4J6IA 2H7EA 2KLGA 4KSLC 2R0DA 2ROZB 2FCNA 5HE2A 5D94A 4DHJD 4D0NB 5TR5A 2QKMA 1H4RA 1FHOA 2KJRA 2MBHA 4KHBB 2KXJA 2R09A 4KHAA 4LDTB 3A9KA 4JL9A 3V62A 2C7MB 3FLVA 4W9KA 3ZDTA 1B55A 1U2BA 2G4SA 2DX5B 3VDZA 1AWEA 2ZNVC 4DX8A 3U30A 2LVOA 4K7SA 2NMBA 2FAZA 3ZVVA 2NVUI 3ENEA 4NSWA 1UPRA 5JHHA 4HXDA 1F9JA 4HJKA 2GCJA 3TFMA 5CLQB 2A4ZA 3A1QB 1FAOA 3O96A 2N4FA 3WA0A 2LVQA 4ZYNA 3OLMD 1EF1A 1CMXB 2AL6A 4DHJB 5DHAB 3NSUA 2LWPA 4WJPA 1C3TA 3V5WA 2KTRB 4GZUA 2KC2A 4F7ZA 5J3QA 4HAYB 1FHXA 2KDIA 1V80A 1WGGA 4Y94A 2JPHA 4FJVB 4NAWA 4PYUA 2KJ6A 2DKQA 2LRWA 2D10A 3FSSA 3VTVA 3TCAA 4ANXA 2L00B 4CHMA 2COPA 2KJHB 4AOFA 4MGZE 1UD7A 2N1WA 1PLSA 5KQ4A 1FOEA 3UF8A 3DXCA 4WJOA 2KFJA 2NCNA 4ICVA 3SNHA 3ML8A 2KZRA 2DAFA 3A4SC 2BKRB 3KH0A 2K6QA 2JXXA 3D8FA 3ODOA 2DYQA 2VRWB 5D3XA 2I1JA 2HTHA 3R7RA 1T0YA 2PZ1A 4GMXB 4MELA 3QWZB 2BWES 3VH4B 1DDWA 3CSFA 5DIFB 1ISNA 4FHKA 1XKEA 4F7UP 1V86A 3MDBC 1V49A 3G9WA 2J7QB 4ANWA 3OJ3A 4W9GA 4FULA 5C16A 1GG3A 1NBFC 2CODA 4WJ7A 1UEFA 5KHOA 4EOYA 1WGUA 3WYFB 2UZSA 2L8JA 1WX7A 5L95C 3OAWA 3F5RA 4BKSD 3H7PB 1MIZB 3TJPA 2JVCA 4RM9A 5G2NA 3ZNGC 3EFUA 5D2MB 4WJQA 2KOXA 4AJYB 3ZNHB 1WRDB 5C6RA 3WAMA 4TUUA 1E8XA 2WX1A 2MKRA 3ZTCA 3NZSA 3N30A 1SHCA 2NBWB 3F0WA 3NZUA 4EJNA 1V5UA 1EO6A 3NHEB 1XD4A 2D9XA 3PZDA 3L10B 4ASWC 5C5BA 3Q3FA 3PVUA 3VXWA 2DYOA 1WI0A 1I7AA 1OY2A 1WGRA 4LJPB 2KANA 4HK2A 2N0YA 4IC7B 5HE1A 5E6NA 3ML9A 1XQQA 3TMPB 1WJ1A 3U7DA 2JRHA 3H7SA 4IM0A 2KFKA 2FCQA 2COAA 3H1UA 4IG7B 1WMHB 2GJYA 3A98B 1WJNA 2ZCBA 1Q67A 1EGXA 3HM3A 4HCPB 1V61A 3TVVA 2ZZPB 3V6EB 1AQCA 1Q1OA 2H7DA 2KD0A 3QBVB 3FP5A 2UVMA 1MK7B 3JSVA 3WAOA 1ZM0A 3CXBB 4CHJA 2P0HA 4YL8A 2CY5A 1NTYA 2I5FA 2FCSA 4IAPA 3SDLC 2NR2A 4DHZB 2BGFA 2LKOA 1BTKA 5D27A 2ZCCA 1UGMA 2LXAA 2KQSA 1BAKA 2KWVB 1E5WA 2I5CA 1P98A 5D3WA 2LUEA 5FR6A 2EMSA 1U29A 4G50A 1VD2A 2L7RA 4KIKB 4GXBA 2L1CA 1LFDA 1DYNA 1E7VA 4G3XB 1RRPB 2BPSA 1WX8A 2DX1A 2IYDB 3B0AA 2ELBA 2ZVOA 2X18A 3JVZX 4K81A 2CHWA 1NVLA 1SGHA 2RGFA 4GIVA 1WR1A 3ZNID 1S1QB 3JW0X 4W9JA 4DDID 2NPTB 3EHVA 5KQ1A 4HHVA 4KZCA 1J19A 1BTNA 2O6VD 3ZDMC 4FLHA 2NBUA 3VQIA 2K8CA 4W9HA 2EC1A 4W9IA 1IPGA 1EUVB 1NI2A 2KWCA 3DBLI 1ST7A 2JF5A 3JYUA 1RLFA 3ZRFA 1V6EA 4XC2A 2DZJA 3M62B 1TQZA 1GUAB 4EZJA 3VAWA 3HM6X 2M8SA 2JT4B 2COCA 2DTCA 5G55A 2RR9A 3TW1A 5HE0A 4NJ6A 1U5GA 2N9PC 3M95A 3P2BA 2IZVB 4W9FA 5DCNA 4I6NB 4MGKE 4BBNC 2KK8A 4GB9A 2LULA 4C0AA 5GOWB 1E8YA 4JLCA 2D3GA 2W2WA 3QC8B 2KMAA 1EVHA 2XK5A 4G0NB 3PPAA 2LZ6A 4IM2A 1WIAA 1N3HA 2Y5BB 3PVLA 3VUYA 2ADZA 3V6CB 1BT0A 3KYCD 3VHTC 5DPRA 2DN6A 1SIFA 3RUIB 2M17A 3DBSA 4A3PA 2JUOA 2JRIB 2KGXB 3EC8A 5D7GA 2CQUA 1L2NA 2L0TA 3ZTDA 4A6HA 2MBEA 3DCGA 4BFRA 4DXAB 2M14A 3APDA 3ONSA 5JHAA 3QWMA 4PS3A 1WJ6A 2W2XC 3A1QA 3ALBA 1X05A 4CO7A 1G6JA 4BOSC 4DBBA 4M0WB 1OTRB 2KVRA 2N9EB 3A9JB 4KDIC 4HAWB 2ZVNA 2YLMA 3RZFA 4PQ0A 2O2VB 3SYXA 1XODA 2KTRA 4OVUA 2IO2B 5BO4B 4IWQA 3SU8X 1J0GA 3AJ4A 2R2OA 2CB8A 5D6JB 2G45B 4HAUB 3ZNZB 2GBKA 5HKHA 2VSZA 1U5FA 3ZRCA 4FADA 2PE6B 1V5TA 3KRWA 3ZKJC 3M63B 4B6HA 3VUWA 3X0WA 3LJUX 3DBHI 4HATB 2IO1B 1I35A 2J0KA 2ELAA 2XEWA 1W1GA 1HE8A 4XX5A 3PTFC 2L2IA 2LOZA 1NU2A 3AU4A 2DZKA 4KAXB 2CY4A 2DHKA 2IO0B 1U27A 5JLJB 1EAZA 2I1KA 3PRZA 3DVNV 2JP2A 4K7UA 1WY8A 1XR0B 5LXHA 4GDKB 3ZUNA 3KSYA 3OANA 3ULBA 4IFSA 3MTNB 3RZWC 2LJ5A 1NTVA 3QA8A 4HWIB 1W1HA 4EMOA 4GN1A 2Z0QA 2RD0A 1LQBA 5JHBA 1TXDA 2HD5B 3H7PA 4ANVA 5FI0A 1TTNA 4I6PA 2AWTA 2KCJA 3WAPA 4YONA 3RCPA 5AZHA 1WGHA 2UWQA 1PQSA 1WGQA 1VCBA 1TZ1A 3GYPA 2YS3A 3IG3A 2EMTA 3RYTA 2Y8GA 2RSGA 4HAVB 1E8ZA 5CTRC 1K8RB 3QARA 1L7YA 3RULA 3ZLZA 4KDLB 2RUKB 2K39A 3T8MA 1KJTA 1K5DB 5CHWA 3HQCA 4K17A 1P0RA 4BKGA 2D9ZA 2B3AA 1PFJA 3PEGA 5LXIB 3AXCA 4FN2A 4HDOA 2KTFA 4BBNF 3APFA 2IY0B 4HCNB 5E6OA 1WG7A 4DK5A 1WGYA 5HE3A 1FB8A 1MIXA 1WMHA 4FJYA 1WE7A 2UZRA 3VTWA 4KHOA 4NJ7A 1UZXB 5DHFB 2KDFB 3O65B 2ZNVB 2LGDA 3M1IB 2K2UA 2LGXA 1YQBA 1LM8B 3QCAA 3SUZA 1NTIA 3ZW3A 2LRUA 2L05A 2FIDA 5LONB 1Y8RC 2P0DA 4NAWB 2W9NA 1E8WA 3L17A 3PVWA 1WGDA 5J18A 4DDGD 3GYOA 1YIWA 3KUCB 2LBBA 2BYEA 2D11A 3MHSD 5L83A 2CAYA 1Q0WB 2DLWA 2P8VA 3P6AA 4MEMA 3PRMB 3D8EA 1UNQA 1HBKA 2D07B 1DDVA 3KVFB 1ZKHA 4KIKA 2GBJA 3DPDA 3PT2B 3PS6A 4WWNA 2D9YA 3CSTA 3KY9A 3N32A 1WI1A 2N23A 1V88A 3K9PB 1XT9B 3AI5A 2K8BA 4A20A 2HTHB 1TBEA 4JIOU 1BWNA 4MJSA 1A5RA 4MM3A 2GS0A 4KZ0A 3UQBA 4MY6A 1ZGUB 3I3TB 4A6FB 2CS4A 2J0JA 5J3TA 2EJ8A 4HB4B 1X1MA 2WX0A 2MP2B 2IO3B 3A33B 2L0FA 3W1SA 4ANUA 4BOZB 1YX6B 1NDDA 2ZPYA 1U4AA 4HB2B 1M7EA 2KHWB 1QC6A 3VIAA 2D2QA 4XZ4A 2P0FA 2REXA 5FI1A 1UNRA 2D9WA 2MX2A 2C5LC 1WM3A 3VTUA 4B9KA 2Z0EB 2IYBA 2DAJA 3GOEA 4ZRKA 4HPLB 3M3JA 3ZVRA 2N7EA 4H8SA 4IM3A 2DZIA 1DROA 4W9LA 1X1GA 3MJWA 4WWOA 1WZ0A 1ZSQA 2BCJA 2YT0A 4GGQA 1WH3A 3BINA 2J59M 3DQVA 1KZGA 2CU1A 4A5KA 4FJZA 4K1RB 5DH9B 3LDZE 4P7IA 4TQ1A 4MH0E 5IA7A 3PRPB 2MDXA 4ICUA 1GJZA 5C5BB 1LB1A 2WH5A 2YF0A 1QQGA 4DHZE 1EF5A 3ULCA 4W9EA 1TGZB 2KQ7A 2K1FA 3C0RB 4K7WA 1OEYA 2ABDA 1GC7A 1MG8A 4E71A 2LD9A 2LYDA 2GMIC 1WF9A 1X1FA 2V1YA 5CLLB 3QIJA 2KNBA 3SHQA 4EEWA 5EFXA 2MBOA 2LOXA 2IY1B 3P7ZA 3U8ZA 3QAQA 3SV1A 2XQNM 3ML4A 1DBHA 2N1VA 2JY6A 3D32A 4WJNA 1P6SA 4KSKC 2D4QA 2BWFA 2WYQA 1ZC3B 1KM7A 2KMCA 5J2RA 4WQOB 2MBBB 2BYVE 4HLEA 3PG7A 3CF6E 1RRBA 3UQAA 1HB6A 3A9JA 3ZIMA 2M1MA 3A8PA 3H6NA 3N7CA 4IW0A 2O2VA 3S2AA 2KLCA 2MWNB
chains in the Genus database with same CATH superfamily
3NOBA 1IYFA 3ODXA 1J8CA 2Z4DA 1WZ3A 1RJ2A 2OEDA 3C8YA 3UIPB 1M94A 1JRUA 2JZPA 5LOPB 2O6VB 5CHFA 3L08A 1WYGA 4PS8A 3MHZA 1XCGA 5H92C 3RCZA 4HB0B 1BUIC 4IOIE 3RN9C 2BYFA 4NQLB 4BAXA 4OVZA 3N1YC 3BYTB 2G35A 4BBKA 3AE6B 4LNKA 5C79A 2WDVB 3KW5B 2IFSA 2ZJDA 2KWUB 1C76A 3PLVA 3W9CB 5E6PA 2V3SA 4NY0A 4I6LB 3DOWA 4F7GA 1HTQA 2G9HD 2DX5A 2DYBA 3AE7B 2IGDA 1XD3B 2Z14A 3Q8AA 4IWOA 3BJIA 2HJ8A 5IOIA 4F7HA 2JX5A 4MK0A 2MRPA 2YSZA 4RMAA 3VRAB 2C7NB 2D5GA 2Z59B 1GOZA 1QLBB 3VUXA 2LG1A 2BVCA 2GRIA 3PV1A 4II2B 2FCMA 3IHPC 3SFDB 1W1DA 2PVOD 3K9OB 3MPXA 2LGYA 3AE8B 2OQBA 3NUHB 4GDKA 1D3ZA 4TQ0A 2GOWA 1WJMA 3U7ZA 4CHKA 2Z0OA 1V2YA 4D2KA 1U5EA 1E7UA 2DZMA 5T8IA 4HB3B 2RSUA 4IWPA 4DBGA 1Q5WB 2RQ1A 1H8CA 5IJMA 1TYGB 2RLOA 3MFGA 2M0XA 3FILA 2SEBD 4MACA 3NW8A 4GDLB 3L54A 2CRFA 4EZKA 1V9JA 3P42A 4WWPA 1UNPA 2X0SA 1WR6E 3DHGC 4MGIE 2XK5B 1FGYA 4AJWA 2H88B 2JXTA 4ILJA 1V5OA 1C4PA 1VLBA 2ACZB 2BS4B 4ZDVA 3W2DA 1DDMA 2DA0A 5JH5C 4JPSA 2W2XD 3R7QA 5C23A 2DYMA 3HK0A 5BYQA 1WVHA 2K2JA 1WXSA 1JQ4A 5D3YA 2YVCA 1SE4A 4GU2A 3HW2B 4GMVA 4TV3A 5AZGA 5CX3A 1V8CA 1P1AA 4ACFA 2RVBB 2MWSB 2LUMA 3R2IA 1K51A 3TBLD 2NS5A 1OQQA 3PREA 1I4HA 2INPE 4FA6A 1F2RI 3DXEA 2GBNA 4KV2A 3DXDA 2YT1A 4MGYE 2KAJA 4Z2NA 4GNKB 1QOAA 1YD8U 1XX0A 4OZCA 5J17A 5J3YA 4CSQA 3H9DA 2KYWA 1C1YB 5LNK1 1Y19B 2AYOB 1HB8A 3TO1A 2UU7A 2EELA 2G4DB 3U4EG 2RPVA 1V1OA 4QJ5B 2CKHB 2K9XA 4GSWA 1I7HA 1TS2A 1CJEA 3RT3B 2Z0PA 5JZEB 1PGBA 4ZRQA 4J3OD 2W3RA 4NNJB 2MJ3A 2WXQA 3AULA 3OJ4B 4RH6A 2V9HA 1DIKA 1V1PB 5C1ZA 4OVVA 1Z2MA 2IBIB 3LJ3A 3ZJUA 2KKCA 1ZC4B 1MK9B 3E9LA 2D9VA 3NS8A 1GB1A 4CYEA 1DOIA 1PFDA 1TS5A 5JHGA 2MLBA 2ASQA 1FD6A 3FEHA 2ZEQA 4X57B 3IBEA 4GOUA 3RNGC 1KBLA 2CR5A 1L6VA 4WAAA 4EUTA 2N7DA 3PO0A 3KZ1A 2OJRA 2WS3B 5KCVA 1R4NI 2WWZA 2R2QA 1WJUA 2DYNA 4B0EA 4ITKA 1YN3A 1AARA 4WH4A 3HHMA 3AEDB 1OQNA 2IJ0A 2V0GA 3PSEB 2DENB 3A9KB 1PGXA 3AE9B 2CJNA 3DBRI 2FJ9A 3PHXB 1WX9A 4QJ3B 2UYZB 2L3ZA 1KF6B 1FEHA 4DWFA 3PGEA 1KTKA 4H2AA 2E2XA 2QJLA 2YS5A 2M38A 4JKCA 1VZ7A 3WANA 1WRIA 2YEPF 1FHWA 2EKEC 3VH3B 1LXDA 2YS1A 4JWSC 2YT2A 2Y8FA 4NZLB 1I4RA 1WJ4A 5BYRA 1KRHA 1WE6A 4OZAA 2KC1A 4BKSA 2AL3A 4A6FA 1HQRD 2MBQA 3UIOB 4W9DA 4PYZA 1GPXA 2MP2A 4FBJB 3AU5A 2ZW1A 4A6KA 4P6VF 1L0VB 1WWTA 2OTXA 3TIXA 3L16A 1YNTE 2JZ3B 3R3MA 3RI7C 1MI1A 1PYWD 2WLBA 2FJUB 4GPTB 4YSXB 2GB1A 1TJ6A 5C3JB 4B95A 3RPFC 1K53A 3N3KB 2W54A 5IAAC 4DXFA 3Q14C 1J7CA 1JCKB 1UBIA 1WXMA 4AP4C 2Q13A 1IRSA 1XF5L 2D3CA 4LJOB 2C60A 3WCQA 1SE9A 1GNUA 1S3SG 4PT5A 4HAXB 2Z0DB 4C7YA 2IDYA 4LTUA 4PNKA 1LW3A 1FGZA 1V5PA 2AQ1B 2XBBC 1DOXA 2FNJB 4GOCA 5GXGB 4G11A 3ABVB 2VRRB 4HPMB 2V76A 2M56B 3KUZA 4RM8A 3EPYA 1XLNA 4DXGA 3HIZA 1V89A 4NQKE 2NBVB 1HXYD 2BF8B 2M4NA 3QK0A 4UDUC 1I42A 2LJIA 4B6WA 5IKCM 3W1SC 3DBLB 1KLVA 5DPTA 4L2YA 4EKUA 1NENB 1XCTL 5HFYA 1X86A 1YX5B 1UWXA 2MSED 2K00A 3GP7A 3FAHA 1FRRA 2NMQA 3OG5A 2K49A 4LNIA 4MDKE 4KKJA 3IVFA 3ETRA 1MI0A 1MKEA 2L83A 4LK0M 2V3PA 2MCNB 3ZYYX 1JWMD 4YXDB 1TKGA 2RPQA 3AEEB 3BY4B 1QZEA 4EZLA 4JE3B 1IBXB 3AECB 4JKAA 3NG0A 2J52A 1KZ7A 3V60A 4L6EA 2X8XX 1KLGD 2KIEA 2PPHA 1RFKA 4HDQA 4NPNA 4LCDE 5L81A 2WXRA 2JWZA 2NPTA 2HE7A 5DPWA 3DDCB 3A8QA 3SFEB 2YRYA 1JWUD 2INCC 2L1AA 1ZXIA 4KKIA 3PLUA 1UH6A 5GMVA 2COFA 2Y7BA 5EDSA 3CIKA 5JVLA 4HSIA 1FFUA 4P16A 1A70A 1UWMA 1FXIA 2CHXA 3Q3JA 4TKNA 1AN8A 3QX1A 2DHJA 5M4YB 3FM8C 1FIQA 2BB6A 3NVVA 3HVZA 1TIFA 1P5TA 3GE8C 3DCXA 4S17A 1J0WA 1ZW7A 2OOBB 3NY5A 4AUQC 4F8CB 4JQWC 5KHQA 1UBQA 3ZJVA 2JZZA 3TL5A 4ILGB 1YJJA 2BT6A 1WXVA 5DPSA 1VJKA 2KX0A 2FJLA 5E6JA 1OMWA 2ROVA 4RGOS 2PEAA 3IAS1 4FHJA 4HAZB 4F1SA 2MFQA 2K0PA 3NJTA 3MC8A 4HKZE 1JWSD 2LVPA 3E56A 1YN4A 3J9CA 1OGWA 2J0MA 1QF6A 2V4IB 1K5GB 3MC9A 4TYZA 3QHTA 3ODWA 1Q10A 1YJ1A 4QJ4B 3X23A 3EECA 3T06A 2GBMA 4RNAA 3VFKA 1T5XD 3QQ8B 1P3QU 3T3OA 4C7ZA 3GZNI 3WALA 2O6VA 2DHIA 1U5DA 1WM2A 3BK1A 3PHWB 4JKEA 3ECIA 2FIFA 2WXPA 1WFYA 4Q2JA 5DI9B 1E90A 3DVGX 2KO3A 2L76A 2E3TA 2I2YA 2BS3B 4MJSB 4AWJA 3WIMA 1Y5OA 2KFKB 2C9WB 2DHZA 2WDQB 3P4PB 1ZDVA 4II3B 2WDRB 2RNRB 1ACAA 4P1BC 4DIXA 2K25A 2HRJA 4IOYX 2E6XA 5IO9A 3PP2A 5D3VA 3CIRB 4MT7A 1WYWB 3EUB2 1ET6A 4B0MA 1RAXA 3PSCA 2ZPNA 3VOQA 3D8DA 2FUHB 2LHEA 3KYDD 2VH1A 2BW2A 4BKTA 3KUDB 4N9F4 3IFWB 3I5JC 2LI5A 3JSVB 4P1CC 1C79A 1R4MI 4YTNB 2MHJA 4WSFA 5EE9A 3HIEA 2LASA 4KX6B 1Y56A 1C9FA 2RGNB 2L52A 4ZYSA 1TZOA 2AQ2B 4URKA 3EA6A 2DKPA 5JP4A 2PW9A 4XDCA 3RD2A 5BMIA 4JKGB 2N9XA 3DBHB 4E74A 3ZO5B 2LMCA 1ZE3D 2HDEA 1UF0A 2BB5A 4M8NA 1GC6A 1TKEA 2JU6X 1HEZE 2A5UA 3B08A 4M0WA 3URYA 2DFKA 1RFAA 2MA9B 4MSQB 1I2HA 4CQNA 2MQJA 3LB8C 3GB1A 3ZJTA 3B77A 5CHVC 2FDQA 3L0WB 2GCLA 3UINB 3UZTA 1JWAD 2K6DB 2MEKA 3DVNU 4YSYB 1M7RA 2M19A 2KDBA 2LHDA 1ENFA 4W9CA 5AEKB 1SJHD 2GBRA 4BVUC 1DOYA 1YMHE 4JKFA 1L4ZB 1P9DU 4LNOA 3QJZA 2PJHA 1MPHA 2VKIA 1MAIA 2KX3A 2QHOA 4TSSA 1AYFA 1KI1B 1FNUA 2K8HA 3CMMB 1EU3A 1OQYA 2V4LA 3R66C 4OSNA 4GDLA 2CHZA 2PE9A 3BWUD 2LXCA 2MW5A 3B1LX 3DVGY 4XWXA 1Z87A 1H10A 2QKLA 2INNE 2C7HA 4M8MA 5LLIA 4DX90 1DGJA 4HVBA 4E3CA 2G3QB 4LNFA 1KOTA 2KUPA 1FNWA 5D3IB 1EM7A 1E7PB 2AEHA 2WDTB 1FXTB 1P3RA 4Z2MB 1RM6C 2KDEB 1OEYJ 1PMSA 1MG4A 4K2PA 1X11A 1V5MA 4AQ7A 3A4RA 4A55A 4A3OA 3W1YA 4JGHB 4HROA 1UELA 2MH7A 3VVWB 4ZRIA 3KRXA 3Q8EA 1C4CA 3UGBB 3V61A 4IUMB 2BKFA 3SBTA 4MSMB 1IP9A 4WVFB 1UNSA 1XXGA 5AZFA 1ZVRA 2KN5A 4LDTD 1UGJA 2NZ8B 2KN4A 3APCA 2KUQA 4A6QA 1Z5SB 4ZRJA 1NEKB 5BYSA 4ZOHC 4EFOA 4PS7A 3SD5A 1TY0A 1TKYA 1WXAA 3IT4B 1V81A 4KVGB 3SO6A 2JSVX 1UPQA 3T9LA 3L13A 4K2OA 4J6IA 4WIPA 5FKAC 2H7EA 1PDXA 1EWCA 2KLGA 4KSLC 1XO3A 2R0DA 2ROZB 2V3NA 2FCNA 5HE2A 5D94A 2Y5CA 4DHJD 4D0NB 2XNAC 5TR5A 1ZP0B 3U2SC 2KJRA 2QKMA 1H4RA 1FHOA 2MBHA 4KHBB 1D5ZC 1L0XB 1MFWA 2KXJA 2AX5A 4GLSC 5EE3A 4C00A 2R09A 1MHHE 2YEPB 1TJEA 2W3SA 1B1ZA 4KHAA 1FMAD 1VZ8A 3TEZA 4LDTB 3A9KA 1BMLC 4JL9A 3V62A 2C7MB 2BTEA 3FLVA 4W9KA 4OZBA 3ZDTA 1B55A 1VBHA 1VBGA 2TSSA 1U2BA 2G4SA 1NI3A 2DX5B 3VDZA 1AWEA 4C4VB 2ZNVC 4YWGG 4DX8A 1K52A 1TS4A 3U30A 2RDHA 2LVOA 3C19A 4K7SA 2NMBA 2FAZA 3ZVVA 3R8BA 2NVUI 2OJWA 4NSWA 3ENEA 1UPRA 5JHHA 4HXDA 1ACCA 1F9JA 4HJKA 2GCJA 3TFMA 5CLQB 2A4ZA 2PVGC 3A1QB 1FAOA 3O96A 2N4FA 4RF1A 1D4BA 3WA0A 2LVQA 4ZYNA 2LEKA 3OLMD 2BBCA 3RFZB 2LGSA 1EF1A 1CMXB 2AL6A 2PKOA 4DHJB 4XWWA 5DHAB 3NSUA 2LWPA 2LFIA 4WJPA 2DNFA 1C3TA 3V5WA 2KTRB 4GZUA 2KC2A 4F7ZA 5J3QA 4HAYB 1FHXA 2KDIA 1V80A 1WGGA 1ZPSA 4Y94A 2JPHA 4FJVB 4NAWA 4PYUA 2KJ6A 2DKQA 2LRWA 2D10A 3SBGA 3FSSA 1E6EB 1QOBA 3VTVA 1SJED 2I38A 4WWMA 2WNMA 3TCAA 1R7SA 4ANXA 2L00B 3B9JA 3FILB 4CHMA 2COPA 2KJHB 3RNCC 4AOFA 4MGZE 1KH0A 5IRSA 4US8A 1UD7A 1SE2A 2N1WA 1PLSA 3BVZA 1N60A 3GS2A 5KQ4A 3NRZA 1P7FA 1FOEA 3UF8A 2D3AA 3DXCA 4WJOA 2NBVA 2KFJA 2GLSA 2NCNA 3E66A 2L32A 3AE5B 1MPEA 4ICVA 3SNHA 3ML8A 2KZRA 2KWDA 3U52E 2DAFA 3AM9A 3A4SC 2BKRB 3KH0A 2K6QA 1PGAA 2JXXA 2ZKMX 2PLPA 1F1HA 3DHIC 4ZHOA 3D8FA 3ODOA 3T3NA 2DYQA 2VRWB 3AMZA 5D3XA 2I1JA 2HTHA 4RGNA 1IUEA 5AUIA 3R7RA 1T0YA 4REZA 3AV8A 1VZ6A 1KLUD 2PZ1A 4GMXB 1L0YB 4LLGM 4MELA 3QWZB 2BWES 3VH4B 1DDWA 3CSFA 5DIFB 1ISNA 4FHKA 1XKEA 4F7UP 4KGRA 3KWLA 1V86A 3MDBC 1V49A 3G9WA 2J7QB 3AEBB 4ANWA 3OJ3A 4W9GA 4FULA 5C16A 1XLOA 3Q2AC 1N62A 1GG3A 1RYJA 1N5XA 4RFBA 1NBFC 2WXKA 2CODA 4WJ7A 3A58A 1VR9A 2JYEA 1UEFA 3FVCA 5KHOA 4EOYA 1WGUA 3WYFB 2UZSA 2L8JA 1FRDA 3VRBB 1WX7A 1FNVA 5L95C 3OAWA 3F5RA 1EWYC 4BKSD 2RMMA 3H7PB 1MIZB 1ROEA 3TJPA 2JVCA 2N7JA 4RM9A 2WP9B 5G2NA 3AB5A 1YQ3B 3ZNGC 2R82A 3EFUA 5D2MB 1SF0A 4WJQA 1NVID 1N6ZA 2KOXA 4AJYB 4YSZB 3NS1A 3ZNHB 1KC7A 5C6RA 1GAQB 1WRDB 3WAMA 4TUUA 1E8XA 2WX1A 2MKRA 3DHHC 3NZSA 3N30A 3ZTCA 3AE2B 2IGGA 1SHCA 2K3UA 2NBWB 4XWTA 3F0WA 1D5XC 3NZUA 4EJNA 2WXJA 1V5UA 4RGTA 1EO6A 1SE3A 3NHEB 5BMHA 1XD4A 2D9XA 3PZDA 2HTME 2N9LA 3L10B 3P4RB 4ASWC 4QXAB 5C5BA 3Q3FA 3PVUA 3VXWA 2DYOA 2WXOA 3HVDA 2BS2B 1I4XA 1WI0A 1I7AA 2QC8A 4US9A 1OY2A 1WGRA 4XYCA 4LJPB 2KANA 4HK2A 2IGHA 2BYTA 2N0YA 4IC7B 5HE1A 3ML9A 5E6NA 1XQQA 3TMPB 1WJ1A 5C2TB 4O1NA 2FE8A 3U7DA 3AEGB 2JRHA 3N1XC 3H7SA 4IM0A 5I2SA 2KFKA 4OW0A 3Q3OC 2FCQA 2COAA 3AH7A 3H1UA 4IG7B 1WMHB 2GJYA 3FC4A 3NWDA 3A98B 1WJNA 2ZCBA 1Q67A 1FM0D 1EGXA 3EFCA 3HM3A 4HCPB 1V61A 1F2RC 5TSSA 2VZKD 3TVVA 2ZZPB 3V6EB 1AQCA 1KFYB 1Q1OA 4M00A 2H7DA 2KD0A 3QBVB 3FP5A 2UVMA 1MK7B 1TY2A 1CQVA 3JSVA 4RF0A 2CJOA 1QILA 3WAOA 1ZM0A 4DQOC 3CXBB 4CHJA 2P0HA 1YQ4B 4YL8A 2RRFA 2N0SB 2CY5A 1GB4A 1NTYA 2I5FA 1UUPA 2FCSA 2DLBA 4IAPA 1F52A 1TS3A 3SDLC 1YN5A 3Q6BA 1JWBD 4L1RA 2RDGA 2NR2A 4DHZB 3BVMA 2BGFA 3NVZA 2LKOA 1BTKA 5D27A 2ZCCA 1N61A 4M01A 1UGMA 2LXAA 2KQSA 1BAKA 2KWVB 1PUTA 1E5WA 2I5CA 1JROA 1P98A 5D3WA 1J7AA 2LUEA 5FR6A 3VR8B 2EMSA 1U29A 4G50A 2DWQA 1I4QA 1VD2A 2L7RA 4KIKB 3BIID 5EE0A 3AE4B 4GXBA 2L1CA 1LFDA 1C78A 1DYNA 3RNBC 4WAFA 1E7VA 4G3XB 4HKQA 2JQRB 2QDFA 4C56C 1HA5A 1RRPB 2BPSA 4NAMA 1WX8A 1B9RA 2DX1A 1T3QA 4HJGE 2IYDB 3B0AA 3IXSA 4MM3B 4JK9A 1NYQA 2VZKB 2ELBA 2ZVOA 3V3XA 1T0RC 2X18A 3JVZX 4K81A 2CHWA 1NVLA 1SGHA 5JXVA 2RGFA 4GIVA 1C4AA 1WR1A 3ZNID 5H8YE 1S1QB 3JW0X 4W9JA 4EE2A 4DDID 2NPTB 2WXIA 3EHVA 5KQ1A 4BZAA 4HHVA 4KZCA 1J19A 1BTNA 1QOGA 4ARIA 2O6VD 3ZDMC 4FLHA 5I4DA 2NBUA 3VQIA 2K8CA 4W9HA 2EC1A 4W9IA 3V05A 1ESFA 1IPGA 1EUVB 1NI2A 2Z59A 4N59A 2KWCA 1D5MC 3DBLI 1ST7A 2JF5A 4JWUC 3RNEC 3JYUA 1RLFA 3ZRFA 2GUMA 3IT6B 3H8HA 4WQMA 1V6EA 4XC2A 2DZJA 3M62B 1TQZA 4HPPA 1P7EA 1GUAB 4M02A 4XDDA 4EZJA 2FUG1 3VAWA 3HM6X 2M8SA 2JT4B 4IDIA 1ZUD2 2COCA 2DTCA 2WXHA 2RR9A 3TW1A 5G55A 4XGAB 5HE0A 4NJ6A 1U5GA 4R3DA 2N9PC 3M95A 1VDVA 3P2BA 2IZVB 4W9FA 1E0ZA 3HSAA 5DCNA 4I6NB 2J53A 4MGKE 4BBNC 2KK8A 4GB9A 2LULA 4C0AA 3B2FA 1OFFA 5GOWB 3HUIA 1E8YA 4JLCA 2D3GA 2W2WA 3QC8B 2KMAA 5HHDG 1EVHA 2XK5A 4G0NB 3PPAA 4RGMA 2LZ6A 4IM2A 1WIAA 1IGCA 1N3HA 1SIJA 3TEWA 2Y5BB 4AS1A 1JW9D 4QAYA 4KHBA 2FBWB 3MC0B 4FXCA 4MT5A 3PVLA 1RWSA 3VUYA 2ADZA 3AE1B 3V6CB 1BT0A 4YTMB 2PIAA 3KYCD 1SXTA 3VHTC 5DPRA 1T77A 1K50A 2DN6A 1XCQL 3I57A 1SIFA 3BK2A 3Q3MC 3RUIB 2M17A 3DBSA 3Q8BA 1DYQA 2IPKD 4A3PA 2JUOA 1C77A 2JRIB 2ICIA 3I63C 3RNAC 4C4VA 2KGXB 3EC8A 5D7GA 2CQUA 1L2NA 2W55A 2WXNA 4HEA1 4HRSA 2L0TA 3ZTDA 4A6HA 1R4NB 2MBEA 3DCGA 4BFRA 4JKBA 4DXAB 2NTSA 4LNNA 2M14A 3APDA 3ONSA 5JHAA 5BMGA 3QWMA 5HI1A 3I9V1 4PS3A 2WHIA 1WJ6A 3ZQ4A 2W2XC 3A1QA 3ALBA 1X05A 2DIKA 1I4GA 4CO7A 3DBRB 1G6JA 4BOSC 2QSDA 4MH8A 2JWUA 4DBBA 4M0WB 1OTRB 2KVRA 2N9EB 3A9JB 1JRPA 4KDIC 4HAWB 2ZVNA 2YLMA 2ZW0A 3ENBA 1V1PA 3RZFA 4PQ0A 2O2VB 3SYXA 1XODA 2HJ1A 2KTRA 4OVUA 2IO2B 5BO4B 4IWQA 3SU8X 2SAKA 1J0GA 3AJ4A 2R2OA 2CB8A 4N6EB 2DBYA 5D6JB 2QILA 1M4VA 2G45B 3MP9A 3KWVA 1L4DB 3TEXA 4HAUB 3ZNZB 2ONQA 3RMKC 3DWGC 2GBKA 2ON8A 5HKHA 2J42A 2VSZA 1JALA 1U5FA 3ZRCA 5IP4D 4FADA 4JKDA 3CWIA 2PE6B 3DWMA 1V5TA 3KRWA 3HRDD 3ZKJC 1WXQA 3M63B 2QIEB 1I4PA 3OWEB 4B6HA 3VUWA 3X0WA 3LJUX 3DBHI 4HATB 2IO1B 1I35A 4ARCA 2J0KA 1XLPA 2QEJC 4KGTA 2ELAA 3P1MA 4JKHA 2XEWA 1W1GA 3SEBA 2KMMA 1CZPA 3Q8CA 1HE8A 4XX5A 3PTFC 2KT7A 2L2IA 2LOZA 2WXLA 1NU2A 1E10A 2J4XA 3W5VB 3AU4A 2DZKA 3VR9B 4KAXB 2CY4A 2DHKA 5D3DA 1N5WA 5I2MA 2IO0B 1GGOA 1U27A 5JLJB 1EAZA 1L6UA 2I1KA 3PRZA 3DVNV 2JP2A 4K7UA 3ZXVA 1EU4A 5HG2A 1WY8A 1XR0B 5LXHA 4GDKB 4ILHA 3ZUNA 3KSYA 3OANA 3E9PA 2PTLA 2GI9A 3ULBA 4IFSA 3MTNB 3RZWC 2LJ5A 1NTVA 3ZXRA 3QA8A 4HWIB 1W1HA 4EMOA 4GN1A 2INDC 1E9MA 2PMVA 2Z0QA 1ZOYB 2RD0A 1LQBA 5JHBA 1T0QC 2K5PA 1TXDA 1L5PA 2HD5B 3AEFB 3H7PA 4ANVA 5FI0A 1MJDA 1TTNA 3W5UB 2WU5B 4I6PA 2AWTA 2KCJA 3SR6A 1FCLA 2K22A 3WAPA 4YONA 3RCPA 5AZHA 3KQ4A 1WGHA 2WU2B 2UWQA 1PQSA 1WGQA 1VCBA 1JDEA 1TZ1A 3GYPA 3MJ5A 2YS3A 2Z8LA 3IG3A 4L23A 2EMTA 2QMTA 3RYTA 2W82A 2K8EA 2Y8GA 1HTOA 3FKYA 3NVWA 2RSGA 3NZ3A 4HAVB 1E8ZA 5CTRC 1T6BX 4KGSA 1K8RB 3R2TA 3QARA 4JK8A 1L7YA 3RULA 3ZLZA 4KDLB 2RUKB 5G5GA 2VH2A 4K3CA 1VRAB 2K39A 1AWDA 3T8MA 4ZRPA 1KJTA 1K5DB 4ZHPA 5CHWA 3HQCA 4K17A 3Q8FA 1P0RA 4BKGA 5FR3A 5G5HA 3N9YC 2D9ZA 3LXFA 2B3AA 1PFJA 3PEGA 5LXIB 1IBXA 3AXCA 4FN2A 4HDOA 1FCCC 2KTFA 4BBNF 4JX1C 3APFA 2Y3AA 2IY0B 4HCNB 4XE0A 1IGDA 3P4SB 5E6OA 1WG7A 4NJCA 4DK5A 4PK1A 1WGYA 3AEAB 5LG4B 5HE3A 1FB8A 1MIXA 1WMHA 4FJYA 1WE7A 2UZRA 3VTWA 1ZDXA 4KHOA 1MVKA 2WXMA 4NJ7A 1OQRA 1UZXB 5DHFB 2KDFB 3O65B 2WQYB 2ZNVB 4A90A 3GZNB 4K3BA 2M0AA 2LGDA 2X38A 3M1IB 2K2UA 2LGXA 3P63A 4A8XC 1YQBA 1LM8B 4N58A 3QCAA 3SUZA 1NTIA 3ZW3A 2LRUA 2L05A 2FIDA 5LONB 2KVZA 1Y8RC 3RNFC 2P0DA 4NAWB 2W9NA 1E8WA 3L17A 3NVYA 1F0ZA 3BYYB 2EKIA 3PVWA 1WGDA 5J18A 4DDGD 3GYOA 1YIWA 3KUCB 2LBBA 2BYEA 2D11A 4JK7A 3MHSD 2H89B 5L83A 2CAYA 5EE1A 1Q0WB 3LYYA 2DLWA 1YJIA 2P8VA 3P6AA 1HZ5A 4MEMA 1HZ6A 4YTPB 3PZ7A 1J7BA 3PRMB 3D8EA 1UNQA 1HBKA 2D07B 3N20C 1DDVA 3KVFB 1R4MB 1ZKHA 1SB3C 2NTTA 4KIKA 2GBJA 3DPDA 3PT2B 3PS6A 4WWNA 1NYRA 2D9YA 3CSTA 1JMLA 3KY9A 3N32A 1WI1A 2Q5WD 2N23A 2RDBC 2CU3A 1V88A 3K9PB 1XT9B 1TT5B 3AI5A 2K8BA 4A20A 2HTHB 3TUOA 1TBEA 4JIOU 1BWNA 4MJSA 1A5RA 4MM3A 2GS0A 4KZ0A 3NWAA 4MY6A 1ZGUB 3I3TB 3UQBA 4A6FB 2CS4A 2J0JA 5J3TA 2EJ8A 4HB4B 1X1MA 2WX0A 2MP2B 4USAA 2IO3B 3A33B 2L0FA 3W1SA 4ANUA 4BOZB 4TMAB 1YX6B 1NDDA 2ZPYA 4S0RA 1U4AA 2BQQA 1ZYIA 4HB2B 1M7EA 3TEYA 1QKZA 2KACA 1XEEA 2KHWB 1QC6A 3VIAA 1QOFA 2R2YA 2D2QA 3UI3A 1FFVA 2P0FA 4XZ4A 1WSPA 3Q69A 2REXA 5FI1A 4D6WA 1UNRA 2D9WA 2MX2A 2QCZA 5IN7A 2C5LC 3N1ZC 1WM3A 3VTUA 4B9KA 2Z0EB 2KDMA 1T0SC 4JKGA 2IYBA 2DAJA 3GOEA 3ZGZA 3P4QB 4ZRKA 4HPLB 2R61A 1SBBB 3M3JA 3GE3C 3ZVRA 2N7EA 1AW7A 4H8SA 4IM3A 2DZIA 1DROA 4W9LA 1X1GA 3MJWA 4WWOA 2OHFA 1WZ0A 1ZSQA 3EGRA 2BCJA 2YT0A 4GGQA 1WH3A 4YT0B 3BINA 1MHXA 2J59M 3DQVA 1KZGA 4OT1A 2CU1A 4A5KA 2WXFA 2MJEA 2XN9C 1V97A 4FJZA 4K1RB 5DH9B 3LDZE 4P7IA 4TQ1A 1WGKA 3E9SA 4MH0E 5IA7A 1BXTA 1CK1A 3PRPB 1LGRA 2MDXA 4ICUA 4OHJA 1GJZA 5C5BB 1LB1A 2WH5A 2JYTA 2YF0A 2LGIA 1QQGA 3IAM1 4DHZE 1EF5A 3ULCA 4L1BA 4W9EA 5MPOA 1FO4A 1TGZB 3AE3B 2KQ7A 1LO5D 3BZDB 2K1FA 3L4PA 3C0RB 1QT9A 4K7WA 3B2GA 1FPYA 1QQRA 3OHMB 1OEYA 4RCOA 4WURA 1ZXHA 3KLSX 2ABDA 1GC7A 1MG8A 4E71A 2LD9A 2LYDA 2GMIC 1WF9A 1X1FA 2V1YA 5CLLB 3QIJA 2KNBA 2WXGA 3SHQA 4EEWA 5EFXA 2MJDA 2MBOA 2LOXA 2IY1B 3BVGA 3P7ZA 3U8ZA 2KIGA 3Q3NC 3QAQA 3SV1A 3AN1A 2XQNM 3ML4A 2AQ3B 1DBHA 2N1VA 1D6EC 1SSNA 2JY6A 3D32A 4WJNA 1YOVB 1P6SA 4IKGA 2WGSA 4KSKC 2D4QA 2BWFA 3O13A 1XLQA 1F77A 2B76B 2WYQA 1ZC3B 1KM7A 2KR0A 3E9OA 2KMCA 3NWFA 5J2RA 4WQOB 1FXAA 2MBBB 2BYVE 2Y5PA 4HLEA 2Z13A 5FK9C 1N63A 3PG7A 3CF6E 1STEA 2D3BA 1RRBA 3UQAA 2N9KA 1HB6A 3TSSA 3A9JA 3ZIMA 3U12A 2M1MA 3A8PA 3H6NA 3PZ8A 5AUKA 1ET9A 2G1EA 3N7CA 4IW0A 2O2VA 3S2AA 4C80A 1SEBD 2KQ4X 4A9AA 2KLCA 2MWNB
chains in the Genus database with same CATH topology
3NOBA 1IYFA 3ODXA 1J8CA 1WZ3A 1RJ2A 3UIPB 1M94A 1JRUA 5LOPB 2O6VB 5CHFA 3L08A 4PS8A 1XCGA 3RCZA 4HB0B 2BYFA 4NQLB 2G35A 4BBKA 5C79A 3KW5B 2IFSA 2ZJDA 2KWUB 3PLVA 5E6PA 2V3SA 4NY0A 4I6LB 3DOWA 4F7GA 2DX5A 2DYBA 1XD3B 4IWOA 3BJIA 2HJ8A 4F7HA 4MK0A 2MRPA 2YSZA 4RMAA 2C7NB 2Z59B 3VUXA 2LG1A 3PV1A 4II2B 2FCMA 3IHPC 1W1DA 3K9OB 3MPXA 2LGYA 2OQBA 4GDKA 1D3ZA 4TQ0A 2GOWA 1WJMA 4CHKA 2Z0OA 1V2YA 1U5EA 1E7UA 2DZMA 4HB3B 2RSUA 4IWPA 4DBGA 1Q5WB 2RQ1A 1H8CA 5IJMA 2RLOA 2M0XA 4GDLB 3L54A 2CRFA 4EZKA 1V9JA 4WWPA 1UNPA 2X0SA 1WR6E 4MGIE 2XK5B 1FGYA 4AJWA 4ILJA 1V5OA 4ZDVA 1DDMA 2DA0A 5JH5C 2W2XD 3R7QA 5C23A 2DYMA 3HK0A 1WVHA 2K2JA 1WXSA 5D3YA 2YVCA 4GU2A 3HW2B 4GMVA 4TV3A 5AZGA 5CX3A 1P1AA 2RVBB 2MWSB 3TBLD 2NS5A 3PREA 4FA6A 3DXEA 2GBNA 4KV2A 3DXDA 2YT1A 4MGYE 4Z2NA 1YD8U 1XX0A 5J17A 5J3YA 3H9DA 1C1YB 1Y19B 2AYOB 1HB8A 3TO1A 2G4DB 2CKHB 4GSWA 3RT3B 2Z0PA 5JZEB 4NNJB 3AULA 3OJ4B 5C1ZA 1DIKA 4OVVA 1Z2MA 2IBIB 3LJ3A 2KKCA 1ZC4B 1MK9B 3E9LA 2D9VA 3NS8A 4CYEA 5JHGA 2MLBA 2ASQA 3FEHA 2ZEQA 4X57B 3IBEA 1KBLA 2CR5A 4WAAA 4EUTA 2N7DA 3KZ1A 2OJRA 5KCVA 1R4NI 2WWZA 2R2QA 1WJUA 2DYNA 1AARA 3HHMA 1OQNA 3PSEB 2DENB 3A9KB 3DBRI 2FJ9A 3PHXB 1WX9A 2UYZB 2L3ZA 4DWFA 3PGEA 2E2XA 2YS5A 2M38A 4JKCA 3WANA 1FHWA 2EKEC 3VH3B 1LXDA 2YS1A 2Y8FA 1WJ4A 1WE6A 2KC1A 4BKSA 2AL3A 4A6FA 2MBQA 3UIOB 4W9DA 4PYZA 2MP2A 4FBJB 3AU5A 4A6KA 2OTXA 3TIXA 3L16A 2JZ3B 3R3MA 4GPTB 1TJ6A 4B95A 3N3KB 5IAAC 1UBIA 1WXMA 4AP4C 2Q13A 1IRSA 4LJOB 2C60A 1SE9A 1GNUA 1S3SG 4HAXB 2Z0DB 4PNKA 1LW3A 1FGZA 1V5PA 2XBBC 2FNJB 4GOCA 4G11A 2VRRB 4HPMB 2V76A 3KUZA 4RM8A 3EPYA 3HIZA 1V89A 4NQKE 2NBVB 2BF8B 2M4NA 3QK0A 1I42A 4B6WA 3W1SC 1KLVA 5DPTA 4EKUA 1X86A 1YX5B 2MSED 2K00A 4MDKE 3IVFA 1MKEA 2MCNB 2RPQA 3BY4B 1QZEA 4EZLA 4JKAA 1KZ7A 3V60A 4L6EA 2PPHA 4HDQA 4NPNA 4LCDE 5L81A 2JWZA 2NPTA 2HE7A 5DPWA 3DDCB 3A8QA 2YRYA 3PLUA 1UH6A 5GMVA 2COFA 2Y7BA 5EDSA 3CIKA 5JVLA 2CHXA 3Q3JA 4TKNA 3QX1A 2DHJA 3FM8C 1P5TA 1J0WA 1ZW7A 2OOBB 3NY5A 4AUQC 4F8CB 4JQWC 5KHQA 1UBQA 2JZZA 3TL5A 4ILGB 1WXVA 5DPSA 2KX0A 2FJLA 1OMWA 2ROVA 2PEAA 4FHJA 4HAZB 4F1SA 2MFQA 2LVPA 1OGWA 2J0MA 1K5GB 4TYZA 3QHTA 3ODWA 1YJ1A 3X23A 3EECA 3T06A 2GBMA 3VFKA 3QQ8B 1P3QU 3GZNI 3WALA 2O6VA 2DHIA 1U5DA 1WM2A 3PHWB 4JKEA 3ECIA 2FIFA 1WFYA 5DI9B 1E90A 3DVGX 2KO3A 2L76A 4MJSB 4AWJA 3WIMA 1Y5OA 2KFKB 2C9WB 2DHZA 4II3B 2RNRB 1ACAA 2K25A 2HRJA 4IOYX 3PP2A 5D3VA 4MT7A 1WYWB 1RAXA 3PSCA 2ZPNA 3VOQA 3D8DA 2FUHB 3KYDD 4BKTA 3KUDB 4N9F4 3IFWB 2LI5A 3JSVB 1R4MI 4WSFA 2LASA 2RGNB 4URKA 2DKPA 5JP4A 3RD2A 4JKGB 2N9XA 4E74A 3ZO5B 4M8NA 1GC6A 2A5UA 3B08A 2DFKA 1RFAA 2MA9B 4MSQB 1I2HA 2MQJA 5CHVC 2FDQA 3L0WB 2GCLA 3UINB 3UZTA 2K6DB 3DVNU 1M7RA 2KDBA 4W9CA 5AEKB 2GBRA 4BVUC 4JKFA 1P9DU 3QJZA 2PJHA 1MPHA 2VKIA 1MAIA 2KX3A 2QHOA 1KI1B 2K8HA 3CMMB 1OQYA 2V4LA 3R66C 4GDLA 2CHZA 2PE9A 2LXCA 2MW5A 3B1LX 3DVGY 4XWXA 1Z87A 1H10A 2QKLA 2C7HA 4M8MA 5LLIA 4DX90 4HVBA 4E3CA 2G3QB 1KOTA 2KUPA 2AEHA 2WDTB 1FXTB 1P3RA 4Z2MB 2KDEB 1OEYJ 1PMSA 4K2PA 1X11A 1V5MA 3A4RA 4A3OA 3W1YA 4JGHB 1UELA 3VVWB 4ZRIA 3KRXA 3UGBB 3V61A 4IUMB 2BKFA 3SBTA 4MSMB 1IP9A 4WVFB 5AZFA 1ZVRA 2KN5A 4LDTD 2NZ8B 3APCA 1Z5SB 4ZRJA 4EFOA 4PS7A 3SD5A 1WXAA 1V81A 4KVGB 3SO6A 1UPQA 3T9LA 3L13A 4K2OA 4J6IA 2H7EA 2KLGA 4KSLC 2R0DA 2ROZB 2FCNA 5HE2A 5D94A 4DHJD 4D0NB 5TR5A 2QKMA 1H4RA 1FHOA 2KJRA 2MBHA 4KHBB 2KXJA 2R09A 4KHAA 4LDTB 3A9KA 4JL9A 3V62A 2C7MB 3FLVA 4W9KA 3ZDTA 1B55A 1VBHA 1VBGA 1U2BA 2G4SA 2DX5B 3VDZA 1AWEA 2ZNVC 4DX8A 3U30A 2LVOA 4K7SA 2NMBA 2FAZA 3ZVVA 2NVUI 3ENEA 4NSWA 1UPRA 5JHHA 4HXDA 1F9JA 4HJKA 2GCJA 3TFMA 5CLQB 2A4ZA 3A1QB 1FAOA 3O96A 2N4FA 3WA0A 2LVQA 4ZYNA 3OLMD 1EF1A 1CMXB 2AL6A 4DHJB 5DHAB 3NSUA 2LWPA 4WJPA 1C3TA 3V5WA 2KTRB 4GZUA 2KC2A 4F7ZA 5J3QA 4HAYB 1FHXA 2KDIA 1V80A 1WGGA 4Y94A 2JPHA 4FJVB 4NAWA 4PYUA 2KJ6A 2DKQA 2LRWA 2D10A 3SBGA 3FSSA 3VTVA 3TCAA 4ANXA 2L00B 4CHMA 2COPA 2KJHB 4AOFA 4MGZE 1UD7A 2N1WA 1PLSA 5KQ4A 1FOEA 3UF8A 3DXCA 4WJOA 2KFJA 2NCNA 3E66A 4ICVA 3SNHA 3ML8A 2KZRA 2DAFA 3A4SC 2BKRB 3KH0A 2K6QA 2JXXA 3D8FA 3ODOA 2DYQA 2VRWB 5D3XA 2I1JA 2HTHA 3R7RA 1T0YA 2PZ1A 4GMXB 4MELA 3QWZB 2BWES 3VH4B 1DDWA 3CSFA 5DIFB 1ISNA 4FHKA 1XKEA 4F7UP 1V86A 3MDBC 1V49A 3G9WA 2J7QB 4ANWA 3OJ3A 4W9GA 4FULA 5C16A 1GG3A 1NBFC 2CODA 4WJ7A 1UEFA 5KHOA 4EOYA 1WGUA 3WYFB 2UZSA 2L8JA 1WX7A 5L95C 3OAWA 3F5RA 4BKSD 3H7PB 1MIZB 3TJPA 2JVCA 4RM9A 5G2NA 3ZNGC 2R82A 3EFUA 5D2MB 4WJQA 2KOXA 4AJYB 3ZNHB 1KC7A 5C6RA 1WRDB 3WAMA 4TUUA 1E8XA 2WX1A 2MKRA 3ZTCA 3NZSA 3N30A 1SHCA 2NBWB 3F0WA 3NZUA 4EJNA 1V5UA 1EO6A 3NHEB 1XD4A 2D9XA 3PZDA 3L10B 4ASWC 5C5BA 3Q3FA 3PVUA 3VXWA 2DYOA 1WI0A 1I7AA 1OY2A 1WGRA 4LJPB 2KANA 4HK2A 2N0YA 4IC7B 5HE1A 5E6NA 3ML9A 1XQQA 3TMPB 1WJ1A 3U7DA 2JRHA 3H7SA 4IM0A 2KFKA 2FCQA 2COAA 3H1UA 4IG7B 1WMHB 2GJYA 3A98B 1WJNA 2ZCBA 1Q67A 1EGXA 3HM3A 4HCPB 1V61A 3TVVA 2ZZPB 3V6EB 1AQCA 1Q1OA 2H7DA 2KD0A 3QBVB 3FP5A 2UVMA 1MK7B 3JSVA 3WAOA 1ZM0A 3CXBB 4CHJA 2P0HA 4YL8A 2CY5A 1NTYA 2I5FA 2FCSA 4IAPA 3SDLC 2NR2A 4DHZB 2BGFA 2LKOA 1BTKA 5D27A 2ZCCA 1UGMA 2LXAA 2KQSA 1BAKA 2KWVB 1E5WA 2I5CA 1P98A 5D3WA 2LUEA 5FR6A 2EMSA 1U29A 4G50A 1VD2A 2L7RA 4KIKB 4GXBA 2L1CA 1LFDA 1DYNA 1E7VA 4G3XB 1RRPB 2BPSA 1WX8A 2DX1A 2IYDB 3B0AA 4JK9A 2ELBA 2ZVOA 2X18A 3JVZX 4K81A 2CHWA 1NVLA 1SGHA 2RGFA 4GIVA 1WR1A 3ZNID 1S1QB 3JW0X 4W9JA 4DDID 2NPTB 3EHVA 5KQ1A 4HHVA 4KZCA 1J19A 1BTNA 2O6VD 3ZDMC 4FLHA 2NBUA 3VQIA 2K8CA 4W9HA 2EC1A 4W9IA 1IPGA 1EUVB 1NI2A 2KWCA 3DBLI 1ST7A 2JF5A 3JYUA 1RLFA 3ZRFA 1V6EA 4XC2A 2DZJA 3M62B 1TQZA 1GUAB 4EZJA 3VAWA 3HM6X 2M8SA 2JT4B 2COCA 2DTCA 5G55A 2RR9A 3TW1A 5HE0A 4NJ6A 1U5GA 2N9PC 3M95A 3P2BA 2IZVB 4W9FA 5DCNA 4I6NB 4MGKE 4BBNC 2KK8A 4GB9A 2LULA 4C0AA 5GOWB 1E8YA 4JLCA 2D3GA 2W2WA 3QC8B 2KMAA 1EVHA 2XK5A 4G0NB 3PPAA 2LZ6A 4IM2A 1WIAA 1N3HA 2Y5BB 3PVLA 3VUYA 2ADZA 3V6CB 1BT0A 3KYCD 3VHTC 5DPRA 2DN6A 1SIFA 3RUIB 2M17A 3DBSA 4A3PA 2JUOA 2JRIB 2KGXB 3EC8A 5D7GA 2CQUA 1L2NA 2L0TA 3ZTDA 4A6HA 2MBEA 3DCGA 4BFRA 4JKBA 4DXAB 2M14A 3APDA 3ONSA 5JHAA 3QWMA 4PS3A 1WJ6A 2W2XC 3A1QA 3ALBA 1X05A 2DIKA 4CO7A 1G6JA 4BOSC 4DBBA 4M0WB 1OTRB 2KVRA 2N9EB 3A9JB 4KDIC 4HAWB 2ZVNA 2YLMA 3ENBA 3RZFA 4PQ0A 2O2VB 3SYXA 1XODA 2KTRA 4OVUA 2IO2B 5BO4B 4IWQA 3SU8X 1J0GA 3AJ4A 2R2OA 2CB8A 5D6JB 2G45B 4HAUB 3ZNZB 2GBKA 5HKHA 2VSZA 1U5FA 3ZRCA 4FADA 4JKDA 2PE6B 1V5TA 3KRWA 3ZKJC 3M63B 4B6HA 3VUWA 3X0WA 3LJUX 3DBHI 4HATB 2IO1B 1I35A 2J0KA 2ELAA 4JKHA 2XEWA 1W1GA 1HE8A 4XX5A 3PTFC 2L2IA 2LOZA 1NU2A 3AU4A 2DZKA 4KAXB 2CY4A 2DHKA 2IO0B 1GGOA 1U27A 5JLJB 1EAZA 2I1KA 3PRZA 3DVNV 2JP2A 4K7UA 1WY8A 1XR0B 5LXHA 4GDKB 4ILHA 3ZUNA 3KSYA 3OANA 3E9PA 3ULBA 4IFSA 3MTNB 3RZWC 2LJ5A 1NTVA 3QA8A 4HWIB 1W1HA 4EMOA 4GN1A 2Z0QA 2RD0A 1LQBA 5JHBA 1TXDA 2HD5B 3H7PA 4ANVA 5FI0A 1TTNA 4I6PA 2AWTA 2KCJA 3WAPA 4YONA 3RCPA 5AZHA 1WGHA 2UWQA 1PQSA 1WGQA 1VCBA 1JDEA 1TZ1A 3GYPA 2YS3A 3IG3A 2EMTA 3RYTA 2Y8GA 2RSGA 4HAVB 1E8ZA 5CTRC 1K8RB 3QARA 4JK8A 1L7YA 3RULA 3ZLZA 4KDLB 2RUKB 2K39A 3T8MA 1KJTA 1K5DB 5CHWA 3HQCA 4K17A 1P0RA 4BKGA 2D9ZA 2B3AA 1PFJA 3PEGA 5LXIB 3AXCA 4FN2A 4HDOA 2KTFA 4BBNF 3APFA 2IY0B 4HCNB 5E6OA 1WG7A 4DK5A 1WGYA 5HE3A 1FB8A 1MIXA 1WMHA 4FJYA 1WE7A 2UZRA 3VTWA 4KHOA 4NJ7A 1UZXB 5DHFB 2KDFB 3O65B 2ZNVB 2LGDA 3M1IB 2K2UA 2LGXA 1YQBA 1LM8B 3QCAA 3SUZA 1NTIA 3ZW3A 2LRUA 2L05A 2FIDA 5LONB 1Y8RC 2P0DA 4NAWB 2W9NA 1E8WA 3L17A 3PVWA 1WGDA 5J18A 4DDGD 3GYOA 1YIWA 3KUCB 2LBBA 2BYEA 2D11A 4JK7A 3MHSD 5L83A 2CAYA 1Q0WB 2DLWA 2P8VA 3P6AA 4MEMA 3PRMB 3D8EA 1UNQA 1HBKA 2D07B 1DDVA 3KVFB 1ZKHA 4KIKA 2GBJA 3DPDA 3PT2B 3PS6A 4WWNA 2D9YA 3CSTA 3KY9A 3N32A 1WI1A 2N23A 1V88A 3K9PB 1XT9B 3AI5A 2K8BA 4A20A 2HTHB 1TBEA 4JIOU 1BWNA 4MJSA 1A5RA 4MM3A 2GS0A 4KZ0A 3UQBA 4MY6A 1ZGUB 3I3TB 4A6FB 2CS4A 2J0JA 5J3TA 2EJ8A 4HB4B 1X1MA 2WX0A 2MP2B 2IO3B 3A33B 2L0FA 3W1SA 4ANUA 4BOZB 1YX6B 1NDDA 2ZPYA 1U4AA 4HB2B 1M7EA 2KHWB 1QC6A 3VIAA 2D2QA 4XZ4A 2P0FA 2REXA 5FI1A 1UNRA 2D9WA 2MX2A 2C5LC 1WM3A 3VTUA 4B9KA 2Z0EB 4JKGA 2IYBA 2DAJA 3GOEA 4ZRKA 4HPLB 3M3JA 3ZVRA 2N7EA 4H8SA 4IM3A 2DZIA 1DROA 4W9LA 1X1GA 3MJWA 4WWOA 1WZ0A 1ZSQA 2BCJA 2YT0A 4GGQA 1WH3A 3BINA 2J59M 3DQVA 1KZGA 2CU1A 4A5KA 4FJZA 4K1RB 5DH9B 3LDZE 4P7IA 4TQ1A 4MH0E 5IA7A 3PRPB 2MDXA 4ICUA 1GJZA 5C5BB 1LB1A 2WH5A 2YF0A 1QQGA 4DHZE 1EF5A 3ULCA 4W9EA 1TGZB 2KQ7A 2K1FA 3C0RB 4K7WA 1OEYA 2ABDA 1GC7A 1MG8A 4E71A 2LD9A 2LYDA 2GMIC 1WF9A 1X1FA 2V1YA 5CLLB 3QIJA 2KNBA 3SHQA 4EEWA 5EFXA 2MBOA 2LOXA 2IY1B 3P7ZA 3U8ZA 3QAQA 3SV1A 2XQNM 3ML4A 1DBHA 2N1VA 2JY6A 3D32A 4WJNA 1P6SA 4KSKC 2D4QA 2BWFA 2WYQA 1ZC3B 1KM7A 3E9OA 2KMCA 5J2RA 4WQOB 2MBBB 2BYVE 4HLEA 3PG7A 3CF6E 1RRBA 3UQAA 1HB6A 3A9JA 3ZIMA 2M1MA 3A8PA 3H6NA 3N7CA 4IW0A 2O2VA 3S2AA 2KLCA 2MWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOB A;  1IYF A;  3ODX A;  1J8C A;  1WZ3 A;  1RJ2 A;  3UIP B;  1M94 A;  1JRU A;  5LOP B;  2O6V B;  5CHF A;  3L08 A;  4PS8 A;  1XCG A;  3RCZ A;  4HB0 B;  2BYF A;  4NQL B;  2G35 A;  4BBK A;  5C79 A;  3KW5 B;  2IFS A;  2ZJD A;  2KWU B;  3PLV A;  5E6P A;  2V3S A;  4NY0 A;  4I6L B;  3DOW A;  4F7G A;  2DX5 A;  2DYB A;  1XD3 B;  4IWO A;  3BJI A;  2HJ8 A;  4F7H A;  4MK0 A;  2MRP A;  2YSZ A;  4RMA A;  2C7N B;  2Z59 B;  3VUX A;  2LG1 A;  3PV1 A;  4II2 B;  2FCM A;  3IHP C;  1W1D A;  3K9O B;  3MPX A;  2LGY A;  2OQB A;  4GDK A;  1D3Z A;  4TQ0 A;  2GOW A;  1WJM A;  4CHK A;  2Z0O A;  1V2Y A;  1U5E A;  1E7U A;  2DZM A;  4HB3 B;  2RSU A;  4IWP A;  4DBG A;  1Q5W B;  2RQ1 A;  1H8C A;  5IJM A;  2RLO A;  2M0X A;  4GDL B;  3L54 A;  2CRF A;  4EZK A;  1V9J A;  4WWP A;  1UNP A;  1WR6 E;  4MGI E;  2XK5 B;  1FGY A;  4AJW A;  1V5O A;  4ZDV A;  1DDM A;  2DA0 A;  5JH5 C;  2W2X D;  3R7Q A;  5C23 A;  2DYM A;  3HK0 A;  1WVH A;  2K2J A;  1WXS A;  5D3Y A;  2YVC A;  4GU2 A;  3HW2 B;  4GMV A;  4TV3 A;  5AZG A;  5CX3 A;  1P1A A;  2RVB B;  2MWS B;  3TBL D;  2NS5 A;  3PRE A;  4FA6 A;  3DXE A;  2GBN A;  4KV2 A;  3DXD A;  2YT1 A;  4MGY E;  4Z2N A;  1YD8 U;  1XX0 A;  5J17 A;  5J3Y A;  3H9D A;  1C1Y B;  1Y19 B;  2AYO B;  1HB8 A;  3TO1 A;  2G4D B;  2CKH B;  4GSW A;  3RT3 B;  2Z0P A;  5JZE B;  4NNJ B;  3AUL A;  3OJ4 B;  5C1Z A;  4OVV A;  1Z2M A;  2IBI B;  3LJ3 A;  2KKC A;  1ZC4 B;  1MK9 B;  2D9V A;  3NS8 A;  4CYE A;  5JHG A;  2MLB A;  2ASQ A;  3FEH A;  2ZEQ A;  4X57 B;  3IBE A;  2CR5 A;  4WAA A;  4EUT A;  2N7D A;  3KZ1 A;  2OJR A;  5KCV A;  1R4N I;  2WWZ A;  2R2Q A;  1WJU A;  2DYN A;  1AAR A;  3HHM A;  1OQN A;  3PSE B;  2DEN B;  3A9K B;  3DBR I;  2FJ9 A;  3PHX B;  1WX9 A;  2UYZ B;  2L3Z A;  4DWF A;  3PGE A;  2E2X A;  2YS5 A;  2M38 A;  3WAN A;  1FHW A;  2EKE C;  3VH3 B;  1LXD A;  2YS1 A;  2Y8F A;  1WJ4 A;  1WE6 A;  2KC1 A;  4BKS A;  2AL3 A;  4A6F A;  2MBQ A;  3UIO B;  4W9D A;  4PYZ A;  2MP2 A;  4FBJ B;  3AU5 A;  4A6K A;  2OTX A;  3TIX A;  3L16 A;  2JZ3 B;  3R3M A;  4GPT B;  1TJ6 A;  4B95 A;  3N3K B;  5IAA C;  1UBI A;  1WXM A;  4AP4 C;  2Q13 A;  1IRS A;  4LJO B;  2C60 A;  1SE9 A;  1GNU A;  1S3S G;  4HAX B;  2Z0D B;  4PNK A;  1LW3 A;  1FGZ A;  1V5P A;  2XBB C;  2FNJ B;  4GOC A;  4G11 A;  2VRR B;  4HPM B;  2V76 A;  3KUZ A;  4RM8 A;  3EPY A;  3HIZ A;  1V89 A;  4NQK E;  2NBV B;  2BF8 B;  2M4N A;  3QK0 A;  1I42 A;  4B6W A;  3W1S C;  1KLV A;  5DPT A;  4EKU A;  1X86 A;  1YX5 B;  2MSE D;  2K00 A;  4MDK E;  3IVF A;  1MKE A;  2MCN B;  2RPQ A;  3BY4 B;  1QZE A;  4EZL A;  1KZ7 A;  3V60 A;  4L6E A;  2PPH A;  4HDQ A;  4NPN A;  4LCD E;  5L81 A;  2JWZ A;  2NPT A;  2HE7 A;  5DPW A;  3DDC B;  3A8Q A;  2YRY A;  3PLU A;  1UH6 A;  5GMV A;  2COF A;  2Y7B A;  5EDS A;  3CIK A;  2CHX A;  3Q3J A;  4TKN A;  3QX1 A;  2DHJ A;  3FM8 C;  1P5T A;  1J0W A;  1ZW7 A;  2OOB B;  3NY5 A;  4AUQ C;  4F8C B;  4JQW C;  5KHQ A;  1UBQ A;  2JZZ A;  3TL5 A;  1WXV A;  5DPS A;  2KX0 A;  2FJL A;  1OMW A;  2ROV A;  2PEA A;  4FHJ A;  4HAZ B;  4F1S A;  2MFQ A;  2LVP A;  1OGW A;  2J0M A;  1K5G B;  4TYZ A;  3QHT A;  3ODW A;  1YJ1 A;  3X23 A;  3EEC A;  3T06 A;  2GBM A;  3VFK A;  3QQ8 B;  1P3Q U;  3GZN I;  3WAL A;  2O6V A;  2DHI A;  1U5D A;  1WM2 A;  3PHW B;  3ECI A;  2FIF A;  1WFY A;  5DI9 B;  1E90 A;  3DVG X;  2KO3 A;  2L76 A;  4MJS B;  4AWJ A;  3WIM A;  1Y5O A;  2KFK B;  2C9W B;  2DHZ A;  4II3 B;  2RNR B;  1ACA A;  2K25 A;  2HRJ A;  4IOY X;  3PP2 A;  5D3V A;  4MT7 A;  1WYW B;  1RAX A;  3PSC A;  2ZPN A;  3VOQ A;  3D8D A;  2FUH B;  3KYD D;  4BKT A;  3KUD B;  4N9F 4;  3IFW B;  2LI5 A;  3JSV B;  1R4M I;  4WSF A;  2LAS A;  2RGN B;  4URK A;  2DKP A;  5JP4 A;  3RD2 A;  2N9X A;  4E74 A;  3ZO5 B;  4M8N A;  1GC6 A;  2A5U A;  3B08 A;  2DFK A;  1RFA A;  2MA9 B;  4MSQ B;  1I2H A;  2MQJ A;  5CHV C;  2FDQ A;  3L0W B;  2GCL A;  3UIN B;  3UZT A;  2K6D B;  3DVN U;  1M7R A;  2KDB A;  4W9C A;  5AEK B;  2GBR A;  4BVU C;  1P9D U;  3QJZ A;  2PJH A;  1MPH A;  2VKI A;  1MAI A;  2KX3 A;  2QHO A;  1KI1 B;  2K8H A;  3CMM B;  1OQY A;  2V4L A;  3R66 C;  4GDL A;  2CHZ A;  2PE9 A;  2LXC A;  2MW5 A;  3B1L X;  3DVG Y;  4XWX A;  1Z87 A;  1H10 A;  2QKL A;  2C7H A;  4M8M A;  5LLI A;  4DX9 0;  4HVB A;  4E3C A;  2G3Q B;  1KOT A;  2KUP A;  2AEH A;  2WDT B;  1FXT B;  1P3R A;  4Z2M B;  2KDE B;  1OEY J;  1PMS A;  4K2P A;  1X11 A;  1V5M A;  3A4R A;  4A3O A;  3W1Y A;  4JGH B;  1UEL A;  3VVW B;  4ZRI A;  3KRX A;  3UGB B;  3V61 A;  4IUM B;  2BKF A;  4MSM B;  1IP9 A;  4WVF B;  5AZF A;  1ZVR A;  2KN5 A;  4LDT D;  2NZ8 B;  3APC A;  1Z5S B;  4ZRJ A;  4EFO A;  4PS7 A;  3SD5 A;  1WXA A;  1V81 A;  4KVG B;  3SO6 A;  1UPQ A;  3T9L A;  3L13 A;  4K2O A;  4J6I A;  2H7E A;  2KLG A;  4KSL C;  2R0D A;  2ROZ B;  2FCN A;  5HE2 A;  5D94 A;  4DHJ D;  4D0N B;  5TR5 A;  2QKM A;  1H4R A;  1FHO A;  2KJR A;  2MBH A;  4KHB B;  2KXJ A;  2R09 A;  4KHA A;  4LDT B;  3A9K A;  4JL9 A;  3V62 A;  2C7M B;  3FLV A;  4W9K A;  3ZDT A;  1B55 A;  1U2B A;  2G4S A;  2DX5 B;  3VDZ A;  1AWE A;  2ZNV C;  4DX8 A;  3U30 A;  2LVO A;  4K7S A;  2NMB A;  2FAZ A;  3ZVV A;  2NVU I;  3ENE A;  4NSW A;  1UPR A;  5JHH A;  4HXD A;  1F9J A;  4HJK A;  2GCJ A;  3TFM A;  5CLQ B;  2A4Z A;  3A1Q B;  1FAO A;  3O96 A;  2N4F A;  3WA0 A;  2LVQ A;  4ZYN A;  3OLM D;  1EF1 A;  1CMX B;  2AL6 A;  4DHJ B;  5DHA B;  3NSU A;  2LWP A;  4WJP A;  1C3T A;  3V5W A;  2KTR B;  4GZU A;  2KC2 A;  4F7Z A;  5J3Q A;  4HAY B;  1FHX A;  2KDI A;  1V80 A;  1WGG A;  4Y94 A;  2JPH A;  4FJV B;  4NAW A;  4PYU A;  2KJ6 A;  2DKQ A;  2LRW A;  2D10 A;  3FSS A;  3VTV A;  3TCA A;  4ANX A;  2L00 B;  4CHM A;  2COP A;  2KJH B;  4AOF A;  4MGZ E;  1UD7 A;  2N1W A;  1PLS A;  5KQ4 A;  1FOE A;  3UF8 A;  3DXC A;  4WJO A;  2KFJ A;  2NCN A;  4ICV A;  3SNH A;  3ML8 A;  2KZR A;  2DAF A;  3A4S C;  2BKR B;  3KH0 A;  2K6Q A;  2JXX A;  3D8F A;  3ODO A;  2DYQ A;  2VRW B;  5D3X A;  2I1J A;  2HTH A;  3R7R A;  1T0Y A;  2PZ1 A;  4GMX B;  4MEL A;  3QWZ B;  2BWE S;  3VH4 B;  1DDW A;  3CSF A;  5DIF B;  1ISN A;  4FHK A;  1XKE A;  4F7U P;  1V86 A;  3MDB C;  1V49 A;  3G9W A;  2J7Q B;  4ANW A;  3OJ3 A;  4W9G A;  4FUL A;  5C16 A;  1GG3 A;  1NBF C;  2COD A;  4WJ7 A;  1UEF A;  5KHO A;  4EOY A;  1WGU A;  3WYF B;  2UZS A;  2L8J A;  1WX7 A;  5L95 C;  3OAW A;  3F5R A;  4BKS D;  3H7P B;  1MIZ B;  3TJP A;  2JVC A;  4RM9 A;  5G2N A;  3ZNG C;  3EFU A;  5D2M B;  4WJQ A;  2KOX A;  4AJY B;  3ZNH B;  1WRD B;  5C6R A;  3WAM A;  4TUU A;  1E8X A;  2WX1 A;  2MKR A;  3ZTC A;  3NZS A;  3N30 A;  1SHC A;  2NBW B;  3F0W A;  3NZU A;  4EJN A;  1V5U A;  1EO6 A;  3NHE B;  1XD4 A;  2D9X A;  3PZD A;  3L10 B;  4ASW C;  5C5B A;  3Q3F A;  3PVU A;  3VXW A;  2DYO A;  1WI0 A;  1I7A A;  1OY2 A;  1WGR A;  4LJP B;  2KAN A;  4HK2 A;  2N0Y A;  4IC7 B;  5HE1 A;  5E6N A;  3ML9 A;  1XQQ A;  3TMP B;  1WJ1 A;  3U7D A;  2JRH A;  3H7S A;  4IM0 A;  2KFK A;  2FCQ A;  2COA A;  3H1U A;  4IG7 B;  1WMH B;  2GJY A;  3A98 B;  1WJN A;  2ZCB A;  1Q67 A;  1EGX A;  3HM3 A;  4HCP B;  1V61 A;  3TVV A;  2ZZP B;  3V6E B;  1AQC A;  1Q1O A;  2H7D A;  2KD0 A;  3QBV B;  3FP5 A;  2UVM A;  1MK7 B;  3JSV A;  3WAO A;  1ZM0 A;  3CXB B;  4CHJ A;  2P0H A;  4YL8 A;  2CY5 A;  1NTY A;  2I5F A;  2FCS A;  4IAP A;  3SDL C;  2NR2 A;  4DHZ B;  2BGF A;  2LKO A;  1BTK A;  5D27 A;  2ZCC A;  1UGM A;  2LXA A;  2KQS A;  1BAK A;  2KWV B;  1E5W A;  2I5C A;  1P98 A;  5D3W A;  2LUE A;  5FR6 A;  2EMS A;  1U29 A;  4G50 A;  1VD2 A;  2L7R A;  4KIK B;  4GXB A;  2L1C A;  1LFD A;  1DYN A;  1E7V A;  4G3X B;  1RRP B;  2BPS A;  1WX8 A;  2DX1 A;  2IYD B;  3B0A A;  2ELB A;  2ZVO A;  2X18 A;  3JVZ X;  4K81 A;  2CHW A;  1NVL A;  1SGH A;  2RGF A;  4GIV A;  1WR1 A;  3ZNI D;  1S1Q B;  3JW0 X;  4W9J A;  4DDI D;  2NPT B;  3EHV A;  5KQ1 A;  4HHV A;  4KZC A;  1J19 A;  1BTN A;  2O6V D;  3ZDM C;  4FLH A;  2NBU A;  3VQI A;  2K8C A;  4W9H A;  2EC1 A;  4W9I A;  1IPG A;  1EUV B;  1NI2 A;  2KWC A;  3DBL I;  1ST7 A;  2JF5 A;  3JYU A;  1RLF A;  3ZRF A;  1V6E A;  4XC2 A;  2DZJ A;  3M62 B;  1TQZ A;  1GUA B;  4EZJ A;  3VAW A;  3HM6 X;  2M8S A;  2JT4 B;  2COC A;  2DTC A;  5G55 A;  2RR9 A;  3TW1 A;  5HE0 A;  4NJ6 A;  1U5G A;  2N9P C;  3M95 A;  3P2B A;  2IZV B;  4W9F A;  5DCN A;  4I6N B;  4MGK E;  4BBN C;  2KK8 A;  4GB9 A;  2LUL A;  4C0A A;  5GOW B;  1E8Y A;  4JLC A;  2D3G A;  2W2W A;  3QC8 B;  2KMA A;  1EVH A;  2XK5 A;  4G0N B;  3PPA A;  2LZ6 A;  4IM2 A;  1WIA A;  1N3H A;  2Y5B B;  3PVL A;  3VUY A;  2ADZ A;  3V6C B;  1BT0 A;  3KYC D;  3VHT C;  5DPR A;  2DN6 A;  1SIF A;  3RUI B;  2M17 A;  3DBS A;  4A3P A;  2JUO A;  2JRI B;  2KGX B;  3EC8 A;  5D7G A;  2CQU A;  1L2N A;  2L0T A;  3ZTD A;  4A6H A;  2MBE A;  3DCG A;  4BFR A;  4DXA B;  2M14 A;  3APD A;  3ONS A;  5JHA A;  3QWM A;  4PS3 A;  1WJ6 A;  2W2X C;  3A1Q A;  3ALB A;  1X05 A;  4CO7 A;  1G6J A;  4BOS C;  4DBB A;  4M0W B;  1OTR B;  2KVR A;  2N9E B;  3A9J B;  4KDI C;  4HAW B;  2ZVN A;  2YLM A;  3RZF A;  4PQ0 A;  2O2V B;  3SYX A;  1XOD A;  2KTR A;  4OVU A;  2IO2 B;  5BO4 B;  4IWQ A;  3SU8 X;  1J0G A;  3AJ4 A;  2R2O A;  2CB8 A;  5D6J B;  2G45 B;  4HAU B;  3ZNZ B;  2GBK A;  5HKH A;  2VSZ A;  1U5F A;  3ZRC A;  4FAD A;  2PE6 B;  1V5T A;  3KRW A;  3ZKJ C;  3M63 B;  4B6H A;  3VUW A;  3X0W A;  3LJU X;  3DBH I;  4HAT B;  2IO1 B;  1I35 A;  2J0K A;  2ELA A;  2XEW A;  1W1G A;  1HE8 A;  4XX5 A;  3PTF C;  2L2I A;  2LOZ A;  1NU2 A;  3AU4 A;  2DZK A;  4KAX B;  2CY4 A;  2DHK A;  2IO0 B;  1U27 A;  5JLJ B;  1EAZ A;  2I1K A;  3PRZ A;  3DVN V;  2JP2 A;  4K7U A;  1WY8 A;  1XR0 B;  5LXH A;  4GDK B;  3ZUN A;  3KSY A;  3OAN A;  3ULB A;  4IFS A;  3MTN B;  3RZW C;  2LJ5 A;  1NTV A;  3QA8 A;  4HWI B;  1W1H A;  4EMO A;  4GN1 A;  2Z0Q A;  2RD0 A;  1LQB A;  5JHB A;  1TXD A;  2HD5 B;  3H7P A;  4ANV A;  5FI0 A;  1TTN A;  4I6P A;  2AWT A;  2KCJ A;  3WAP A;  4YON A;  3RCP A;  5AZH A;  1WGH A;  2UWQ A;  1PQS A;  1WGQ A;  1VCB A;  1TZ1 A;  3GYP A;  2YS3 A;  3IG3 A;  2EMT A;  3RYT A;  2Y8G A;  2RSG A;  4HAV B;  1E8Z A;  5CTR C;  1K8R B;  3QAR A;  1L7Y A;  3RUL A;  3ZLZ A;  4KDL B;  2RUK B;  2K39 A;  3T8M A;  1KJT A;  1K5D B;  5CHW A;  3HQC A;  4K17 A;  1P0R A;  4BKG A;  2D9Z A;  2B3A A;  1PFJ A;  3PEG A;  5LXI B;  3AXC A;  4FN2 A;  4HDO A;  2KTF A;  4BBN F;  3APF A;  2IY0 B;  4HCN B;  5E6O A;  1WG7 A;  4DK5 A;  1WGY A;  5HE3 A;  1FB8 A;  1MIX A;  1WMH A;  4FJY A;  1WE7 A;  2UZR A;  3VTW A;  4KHO A;  4NJ7 A;  1UZX B;  5DHF B;  2KDF B;  3O65 B;  2ZNV B;  2LGD A;  3M1I B;  2K2U A;  2LGX A;  1YQB A;  1LM8 B;  3QCA A;  3SUZ A;  1NTI A;  3ZW3 A;  2LRU A;  2L05 A;  2FID A;  5LON B;  1Y8R C;  2P0D A;  4NAW B;  2W9N A;  1E8W A;  3L17 A;  3PVW A;  1WGD A;  5J18 A;  4DDG D;  3GYO A;  1YIW A;  3KUC B;  2LBB A;  2BYE A;  2D11 A;  3MHS D;  5L83 A;  2CAY A;  1Q0W B;  2DLW A;  2P8V A;  3P6A A;  4MEM A;  3PRM B;  3D8E A;  1UNQ A;  1HBK A;  2D07 B;  1DDV A;  3KVF B;  1ZKH A;  4KIK A;  2GBJ A;  3DPD A;  3PT2 B;  3PS6 A;  4WWN A;  2D9Y A;  3CST A;  3KY9 A;  3N32 A;  1WI1 A;  2N23 A;  1V88 A;  3K9P B;  1XT9 B;  3AI5 A;  2K8B A;  4A20 A;  2HTH B;  1TBE A;  4JIO U;  1BWN A;  4MJS A;  1A5R A;  4MM3 A;  2GS0 A;  4KZ0 A;  3UQB A;  4MY6 A;  1ZGU B;  3I3T B;  4A6F B;  2CS4 A;  2J0J A;  5J3T A;  2EJ8 A;  4HB4 B;  1X1M A;  2WX0 A;  2MP2 B;  2IO3 B;  3A33 B;  2L0F A;  3W1S A;  4ANU A;  4BOZ B;  1YX6 B;  1NDD A;  2ZPY A;  1U4A A;  4HB2 B;  1M7E A;  2KHW B;  1QC6 A;  3VIA A;  2D2Q A;  4XZ4 A;  2P0F A;  2REX A;  5FI1 A;  1UNR A;  2D9W A;  2MX2 A;  2C5L C;  1WM3 A;  3VTU A;  4B9K A;  2Z0E B;  2IYB A;  2DAJ A;  3GOE A;  4ZRK A;  4HPL B;  3M3J A;  3ZVR A;  2N7E A;  4H8S A;  4IM3 A;  2DZI A;  1DRO A;  4W9L A;  1X1G A;  3MJW A;  4WWO A;  1WZ0 A;  1ZSQ A;  2BCJ A;  2YT0 A;  4GGQ A;  1WH3 A;  3BIN A;  2J59 M;  3DQV A;  1KZG A;  2CU1 A;  4A5K A;  4FJZ A;  4K1R B;  5DH9 B;  3LDZ E;  4P7I A;  4TQ1 A;  4MH0 E;  5IA7 A;  3PRP B;  2MDX A;  4ICU A;  1GJZ A;  5C5B B;  1LB1 A;  2WH5 A;  2YF0 A;  1QQG A;  4DHZ E;  1EF5 A;  3ULC A;  4W9E A;  1TGZ B;  2KQ7 A;  2K1F A;  3C0R B;  4K7W A;  1OEY A;  2ABD A;  1GC7 A;  1MG8 A;  4E71 A;  2LD9 A;  2LYD A;  2GMI C;  1WF9 A;  1X1F A;  2V1Y A;  5CLL B;  3QIJ A;  2KNB A;  3SHQ A;  4EEW A;  5EFX A;  2MBO A;  2LOX A;  2IY1 B;  3P7Z A;  3U8Z A;  3QAQ A;  3SV1 A;  2XQN M;  3ML4 A;  1DBH A;  2N1V A;  2JY6 A;  3D32 A;  4WJN A;  1P6S A;  4KSK C;  2D4Q A;  2BWF A;  2WYQ A;  1ZC3 B;  1KM7 A;  2KMC A;  5J2R A;  4WQO B;  2MBB B;  2BYV E;  4HLE A;  3PG7 A;  3CF6 E;  1RRB A;  3UQA A;  1HB6 A;  3A9J A;  3ZIM A;  2M1M A;  3A8P A;  3H6N A;  3N7C A;  4IW0 A;  2O2V A;  3S2A A;  2KLC A;  2MWN B; 
#chains in the Genus database with same CATH topology
 3NOB A;  1IYF A;  3ODX A;  1J8C A;  2Z4D A;  1WZ3 A;  1RJ2 A;  2OED A;  3C8Y A;  3UIP B;  1M94 A;  1JRU A;  2JZP A;  5LOP B;  2O6V B;  5CHF A;  3L08 A;  1WYG A;  4PS8 A;  3MHZ A;  1XCG A;  5H92 C;  3RCZ A;  4HB0 B;  1BUI C;  4IOI E;  3RN9 C;  2BYF A;  4NQL B;  4BAX A;  4OVZ A;  3N1Y C;  3BYT B;  2G35 A;  4BBK A;  3AE6 B;  4LNK A;  5C79 A;  2WDV B;  3KW5 B;  2IFS A;  2ZJD A;  2KWU B;  1C76 A;  3PLV A;  3W9C B;  5E6P A;  2V3S A;  4NY0 A;  4I6L B;  3DOW A;  4F7G A;  1HTQ A;  2G9H D;  2DX5 A;  2DYB A;  3AE7 B;  2IGD A;  1XD3 B;  2Z14 A;  3Q8A A;  4IWO A;  3BJI A;  2HJ8 A;  5IOI A;  4F7H A;  2JX5 A;  4MK0 A;  2MRP A;  2YSZ A;  4RMA A;  3VRA B;  2C7N B;  2D5G A;  2Z59 B;  1GOZ A;  1QLB B;  3VUX A;  2LG1 A;  2BVC A;  2GRI A;  3PV1 A;  4II2 B;  2FCM A;  3IHP C;  3SFD B;  1W1D A;  2PVO D;  3K9O B;  3MPX A;  2LGY A;  3AE8 B;  2OQB A;  3NUH B;  4GDK A;  1D3Z A;  4TQ0 A;  2GOW A;  1WJM A;  3U7Z A;  4CHK A;  2Z0O A;  1V2Y A;  4D2K A;  1U5E A;  1E7U A;  2DZM A;  5T8I A;  4HB3 B;  2RSU A;  4IWP A;  4DBG A;  1Q5W B;  2RQ1 A;  1H8C A;  5IJM A;  1TYG B;  2RLO A;  3MFG A;  2M0X A;  3FIL A;  2SEB D;  4MAC A;  3NW8 A;  4GDL B;  3L54 A;  2CRF A;  4EZK A;  1V9J A;  3P42 A;  4WWP A;  1UNP A;  2X0S A;  1WR6 E;  3DHG C;  4MGI E;  2XK5 B;  1FGY A;  4AJW A;  2H88 B;  2JXT A;  4ILJ A;  1V5O A;  1C4P A;  1VLB A;  2ACZ B;  2BS4 B;  4ZDV A;  3W2D A;  1DDM A;  2DA0 A;  5JH5 C;  4JPS A;  2W2X D;  3R7Q A;  5C23 A;  2DYM A;  3HK0 A;  5BYQ A;  1WVH A;  2K2J A;  1WXS A;  1JQ4 A;  5D3Y A;  2YVC A;  1SE4 A;  4GU2 A;  3HW2 B;  4GMV A;  4TV3 A;  5AZG A;  5CX3 A;  1V8C A;  1P1A A;  4ACF A;  2RVB B;  2MWS B;  2LUM A;  3R2I A;  1K51 A;  3TBL D;  2NS5 A;  1OQQ A;  3PRE A;  1I4H A;  2INP E;  4FA6 A;  1F2R I;  3DXE A;  2GBN A;  4KV2 A;  3DXD A;  2YT1 A;  4MGY E;  2KAJ A;  4Z2N A;  4GNK B;  1QOA A;  1YD8 U;  1XX0 A;  4OZC A;  5J17 A;  5J3Y A;  4CSQ A;  3H9D A;  2KYW A;  1C1Y B;  5LNK 1;  1Y19 B;  2AYO B;  1HB8 A;  3TO1 A;  2UU7 A;  2EEL A;  2G4D B;  3U4E G;  2RPV A;  1V1O A;  4QJ5 B;  2CKH B;  2K9X A;  4GSW A;  1I7H A;  1TS2 A;  1CJE A;  3RT3 B;  2Z0P A;  5JZE B;  1PGB A;  4ZRQ A;  4J3O D;  2W3R A;  4NNJ B;  2MJ3 A;  2WXQ A;  3AUL A;  3OJ4 B;  4RH6 A;  2V9H A;  1DIK A;  1V1P B;  5C1Z A;  4OVV A;  1Z2M A;  2IBI B;  3LJ3 A;  3ZJU A;  2KKC A;  1ZC4 B;  1MK9 B;  3E9L A;  2D9V A;  3NS8 A;  1GB1 A;  4CYE A;  1DOI A;  1PFD A;  1TS5 A;  5JHG A;  2MLB A;  2ASQ A;  1FD6 A;  3FEH A;  2ZEQ A;  4X57 B;  3IBE A;  4GOU A;  3RNG C;  1KBL A;  2CR5 A;  1L6V A;  4WAA A;  4EUT A;  2N7D A;  3PO0 A;  3KZ1 A;  2OJR A;  2WS3 B;  5KCV A;  1R4N I;  2WWZ A;  2R2Q A;  1WJU A;  2DYN A;  4B0E A;  4ITK A;  1YN3 A;  1AAR A;  4WH4 A;  3HHM A;  3AED B;  1OQN A;  2IJ0 A;  2V0G A;  3PSE B;  2DEN B;  3A9K B;  1PGX A;  3AE9 B;  2CJN A;  3DBR I;  2FJ9 A;  3PHX B;  1WX9 A;  4QJ3 B;  2UYZ B;  2L3Z A;  1KF6 B;  1FEH A;  4DWF A;  3PGE A;  1KTK A;  4H2A A;  2E2X A;  2QJL A;  2YS5 A;  2M38 A;  4JKC A;  1VZ7 A;  3WAN A;  1WRI A;  2YEP F;  1FHW A;  2EKE C;  3VH3 B;  1LXD A;  2YS1 A;  4JWS C;  2YT2 A;  2Y8F A;  4NZL B;  1I4R A;  1WJ4 A;  5BYR A;  1KRH A;  1WE6 A;  4OZA A;  2KC1 A;  4BKS A;  2AL3 A;  4A6F A;  1HQR D;  2MBQ A;  3UIO B;  4W9D A;  4PYZ A;  1GPX A;  2MP2 A;  4FBJ B;  3AU5 A;  2ZW1 A;  4A6K A;  4P6V F;  1L0V B;  1WWT A;  2OTX A;  3TIX A;  3L16 A;  1YNT E;  2JZ3 B;  3R3M A;  3RI7 C;  1MI1 A;  1PYW D;  2WLB A;  2FJU B;  4GPT B;  4YSX B;  2GB1 A;  1TJ6 A;  5C3J B;  4B95 A;  3RPF C;  1K53 A;  3N3K B;  2W54 A;  5IAA C;  4DXF A;  3Q14 C;  1J7C A;  1JCK B;  1UBI A;  1WXM A;  4AP4 C;  2Q13 A;  1IRS A;  1XF5 L;  2D3C A;  4LJO B;  2C60 A;  3WCQ A;  1SE9 A;  1GNU A;  1S3S G;  4PT5 A;  4HAX B;  2Z0D B;  4C7Y A;  2IDY A;  4LTU A;  4PNK A;  1LW3 A;  1FGZ A;  1V5P A;  2AQ1 B;  2XBB C;  1DOX A;  2FNJ B;  4GOC A;  5GXG B;  4G11 A;  3ABV B;  2VRR B;  4HPM B;  2V76 A;  2M56 B;  3KUZ A;  4RM8 A;  3EPY A;  1XLN A;  4DXG A;  3HIZ A;  1V89 A;  4NQK E;  2NBV B;  1HXY D;  2BF8 B;  2M4N A;  3QK0 A;  4UDU C;  1I42 A;  2LJI A;  4B6W A;  5IKC M;  3W1S C;  3DBL B;  1KLV A;  5DPT A;  4L2Y A;  4EKU A;  1NEN B;  1XCT L;  5HFY A;  1X86 A;  1YX5 B;  1UWX A;  2MSE D;  2K00 A;  3GP7 A;  3FAH A;  1FRR A;  2NMQ A;  3OG5 A;  2K49 A;  4LNI A;  4MDK E;  4KKJ A;  3IVF A;  3ETR A;  1MI0 A;  1MKE A;  2L83 A;  4LK0 M;  2V3P A;  2MCN B;  3ZYY X;  1JWM D;  4YXD B;  1TKG A;  2RPQ A;  3AEE B;  3BY4 B;  1QZE A;  4EZL A;  4JE3 B;  1IBX B;  3AEC B;  4JKA A;  3NG0 A;  2J52 A;  1KZ7 A;  3V60 A;  4L6E A;  2X8X X;  1KLG D;  2KIE A;  2PPH A;  1RFK A;  4HDQ A;  4NPN A;  4LCD E;  5L81 A;  2WXR A;  2JWZ A;  2NPT A;  2HE7 A;  5DPW A;  3DDC B;  3A8Q A;  3SFE B;  2YRY A;  1JWU D;  2INC C;  2L1A A;  1ZXI A;  4KKI A;  3PLU A;  1UH6 A;  5GMV A;  2COF A;  2Y7B A;  5EDS A;  3CIK A;  5JVL A;  4HSI A;  1FFU A;  4P16 A;  1A70 A;  1UWM A;  1FXI A;  2CHX A;  3Q3J A;  4TKN A;  1AN8 A;  3QX1 A;  2DHJ A;  5M4Y B;  3FM8 C;  1FIQ A;  2BB6 A;  3NVV A;  3HVZ A;  1TIF A;  1P5T A;  3GE8 C;  3DCX A;  4S17 A;  1J0W A;  1ZW7 A;  2OOB B;  3NY5 A;  4AUQ C;  4F8C B;  4JQW C;  5KHQ A;  1UBQ A;  3ZJV A;  2JZZ A;  3TL5 A;  4ILG B;  1YJJ A;  2BT6 A;  1WXV A;  5DPS A;  1VJK A;  2KX0 A;  2FJL A;  5E6J A;  1OMW A;  2ROV A;  4RGO S;  2PEA A;  3IAS 1;  4FHJ A;  4HAZ B;  4F1S A;  2MFQ A;  2K0P A;  3NJT A;  3MC8 A;  4HKZ E;  1JWS D;  2LVP A;  3E56 A;  1YN4 A;  3J9C A;  1OGW A;  2J0M A;  1QF6 A;  2V4I B;  1K5G B;  3MC9 A;  4TYZ A;  3QHT A;  3ODW A;  1Q10 A;  1YJ1 A;  4QJ4 B;  3X23 A;  3EEC A;  3T06 A;  2GBM A;  4RNA A;  3VFK A;  1T5X D;  3QQ8 B;  1P3Q U;  3T3O A;  4C7Z A;  3GZN I;  3WAL A;  2O6V A;  2DHI A;  1U5D A;  1WM2 A;  3BK1 A;  3PHW B;  4JKE A;  3ECI A;  2FIF A;  2WXP A;  1WFY A;  4Q2J A;  5DI9 B;  1E90 A;  3DVG X;  2KO3 A;  2L76 A;  2E3T A;  2I2Y A;  2BS3 B;  4MJS B;  4AWJ A;  3WIM A;  1Y5O A;  2KFK B;  2C9W B;  2DHZ A;  2WDQ B;  3P4P B;  1ZDV A;  4II3 B;  2WDR B;  2RNR B;  1ACA A;  4P1B C;  4DIX A;  2K25 A;  2HRJ A;  4IOY X;  2E6X A;  5IO9 A;  3PP2 A;  5D3V A;  3CIR B;  4MT7 A;  1WYW B;  3EUB 2;  1ET6 A;  4B0M A;  1RAX A;  3PSC A;  2ZPN A;  3VOQ A;  3D8D A;  2FUH B;  2LHE A;  3KYD D;  2VH1 A;  2BW2 A;  4BKT A;  3KUD B;  4N9F 4;  3IFW B;  3I5J C;  2LI5 A;  3JSV B;  4P1C C;  1C79 A;  1R4M I;  4YTN B;  2MHJ A;  4WSF A;  5EE9 A;  3HIE A;  2LAS A;  4KX6 B;  1Y56 A;  1C9F A;  2RGN B;  2L52 A;  4ZYS A;  1TZO A;  2AQ2 B;  4URK A;  3EA6 A;  2DKP A;  5JP4 A;  2PW9 A;  4XDC A;  3RD2 A;  5BMI A;  4JKG B;  2N9X A;  3DBH B;  4E74 A;  3ZO5 B;  2LMC A;  1ZE3 D;  2HDE A;  1UF0 A;  2BB5 A;  4M8N A;  1GC6 A;  1TKE A;  2JU6 X;  1HEZ E;  2A5U A;  3B08 A;  4M0W A;  3URY A;  2DFK A;  1RFA A;  2MA9 B;  4MSQ B;  1I2H A;  4CQN A;  2MQJ A;  3LB8 C;  3GB1 A;  3ZJT A;  3B77 A;  5CHV C;  2FDQ A;  3L0W B;  2GCL A;  3UIN B;  3UZT A;  1JWA D;  2K6D B;  2MEK A;  3DVN U;  4YSY B;  1M7R A;  2M19 A;  2KDB A;  2LHD A;  1ENF A;  4W9C A;  5AEK B;  1SJH D;  2GBR A;  4BVU C;  1DOY A;  1YMH E;  4JKF A;  1L4Z B;  1P9D U;  4LNO A;  3QJZ A;  2PJH A;  1MPH A;  2VKI A;  1MAI A;  2KX3 A;  2QHO A;  4TSS A;  1AYF A;  1KI1 B;  1FNU A;  2K8H A;  3CMM B;  1EU3 A;  1OQY A;  2V4L A;  3R66 C;  4OSN A;  4GDL A;  2CHZ A;  2PE9 A;  3BWU D;  2LXC A;  2MW5 A;  3B1L X;  3DVG Y;  4XWX A;  1Z87 A;  1H10 A;  2QKL A;  2INN E;  2C7H A;  4M8M A;  5LLI A;  4DX9 0;  1DGJ A;  4HVB A;  4E3C A;  2G3Q B;  4LNF A;  1KOT A;  2KUP A;  1FNW A;  5D3I B;  1EM7 A;  1E7P B;  2AEH A;  2WDT B;  1FXT B;  1P3R A;  4Z2M B;  1RM6 C;  2KDE B;  1OEY J;  1PMS A;  1MG4 A;  4K2P A;  1X11 A;  1V5M A;  4AQ7 A;  3A4R A;  4A55 A;  4A3O A;  3W1Y A;  4JGH B;  4HRO A;  1UEL A;  2MH7 A;  3VVW B;  4ZRI A;  3KRX A;  3Q8E A;  1C4C A;  3UGB B;  3V61 A;  4IUM B;  2BKF A;  3SBT A;  4MSM B;  1IP9 A;  4WVF B;  1UNS A;  1XXG A;  5AZF A;  1ZVR A;  2KN5 A;  4LDT D;  1UGJ A;  2NZ8 B;  2KN4 A;  3APC A;  2KUQ A;  4A6Q A;  1Z5S B;  4ZRJ A;  1NEK B;  5BYS A;  4ZOH C;  4EFO A;  4PS7 A;  3SD5 A;  1TY0 A;  1TKY A;  1WXA A;  3IT4 B;  1V81 A;  4KVG B;  3SO6 A;  2JSV X;  1UPQ A;  3T9L A;  3L13 A;  4K2O A;  4J6I A;  4WIP A;  5FKA C;  2H7E A;  1PDX A;  1EWC A;  2KLG A;  4KSL C;  1XO3 A;  2R0D A;  2ROZ B;  2V3N A;  2FCN A;  5HE2 A;  5D94 A;  2Y5C A;  4DHJ D;  4D0N B;  2XNA C;  5TR5 A;  1ZP0 B;  3U2S C;  2KJR A;  2QKM A;  1H4R A;  1FHO A;  2MBH A;  4KHB B;  1D5Z C;  1L0X B;  1MFW A;  2KXJ A;  2AX5 A;  4GLS C;  5EE3 A;  4C00 A;  2R09 A;  1MHH E;  2YEP B;  1TJE A;  2W3S A;  1B1Z A;  4KHA A;  1FMA D;  1VZ8 A;  3TEZ A;  4LDT B;  3A9K A;  1BML C;  4JL9 A;  3V62 A;  2C7M B;  2BTE A;  3FLV A;  4W9K A;  4OZB A;  3ZDT A;  1B55 A;  1VBH A;  1VBG A;  2TSS A;  1U2B A;  2G4S A;  1NI3 A;  2DX5 B;  3VDZ A;  1AWE A;  4C4V B;  2ZNV C;  4YWG G;  4DX8 A;  1K52 A;  1TS4 A;  3U30 A;  2RDH A;  2LVO A;  3C19 A;  4K7S A;  2NMB A;  2FAZ A;  3ZVV A;  3R8B A;  2NVU I;  2OJW A;  4NSW A;  3ENE A;  1UPR A;  5JHH A;  4HXD A;  1ACC A;  1F9J A;  4HJK A;  2GCJ A;  3TFM A;  5CLQ B;  2A4Z A;  2PVG C;  3A1Q B;  1FAO A;  3O96 A;  2N4F A;  4RF1 A;  1D4B A;  3WA0 A;  2LVQ A;  4ZYN A;  2LEK A;  3OLM D;  2BBC A;  3RFZ B;  2LGS A;  1EF1 A;  1CMX B;  2AL6 A;  2PKO A;  4DHJ B;  4XWW A;  5DHA B;  3NSU A;  2LWP A;  2LFI A;  4WJP A;  2DNF A;  1C3T A;  3V5W A;  2KTR B;  4GZU A;  2KC2 A;  4F7Z A;  5J3Q A;  4HAY B;  1FHX A;  2KDI A;  1V80 A;  1WGG A;  1ZPS A;  4Y94 A;  2JPH A;  4FJV B;  4NAW A;  4PYU A;  2KJ6 A;  2DKQ A;  2LRW A;  2D10 A;  3SBG A;  3FSS A;  1E6E B;  1QOB A;  3VTV A;  1SJE D;  2I38 A;  4WWM A;  2WNM A;  3TCA A;  1R7S A;  4ANX A;  2L00 B;  3B9J A;  3FIL B;  4CHM A;  2COP A;  2KJH B;  3RNC C;  4AOF A;  4MGZ E;  1KH0 A;  5IRS A;  4US8 A;  1UD7 A;  1SE2 A;  2N1W A;  1PLS A;  3BVZ A;  1N60 A;  3GS2 A;  5KQ4 A;  3NRZ A;  1P7F A;  1FOE A;  3UF8 A;  2D3A A;  3DXC A;  4WJO A;  2NBV A;  2KFJ A;  2GLS A;  2NCN A;  3E66 A;  2L32 A;  3AE5 B;  1MPE A;  4ICV A;  3SNH A;  3ML8 A;  2KZR A;  2KWD A;  3U52 E;  2DAF A;  3AM9 A;  3A4S C;  2BKR B;  3KH0 A;  2K6Q A;  1PGA A;  2JXX A;  2ZKM X;  2PLP A;  1F1H A;  3DHI C;  4ZHO A;  3D8F A;  3ODO A;  3T3N A;  2DYQ A;  2VRW B;  3AMZ A;  5D3X A;  2I1J A;  2HTH A;  4RGN A;  1IUE A;  5AUI A;  3R7R A;  1T0Y A;  4REZ A;  3AV8 A;  1VZ6 A;  1KLU D;  2PZ1 A;  4GMX B;  1L0Y B;  4LLG M;  4MEL A;  3QWZ B;  2BWE S;  3VH4 B;  1DDW A;  3CSF A;  5DIF B;  1ISN A;  4FHK A;  1XKE A;  4F7U P;  4KGR A;  3KWL A;  1V86 A;  3MDB C;  1V49 A;  3G9W A;  2J7Q B;  3AEB B;  4ANW A;  3OJ3 A;  4W9G A;  4FUL A;  5C16 A;  1XLO A;  3Q2A C;  1N62 A;  1GG3 A;  1RYJ A;  1N5X A;  4RFB A;  1NBF C;  2WXK A;  2COD A;  4WJ7 A;  3A58 A;  1VR9 A;  2JYE A;  1UEF A;  3FVC A;  5KHO A;  4EOY A;  1WGU A;  3WYF B;  2UZS A;  2L8J A;  1FRD A;  3VRB B;  1WX7 A;  1FNV A;  5L95 C;  3OAW A;  3F5R A;  1EWY C;  4BKS D;  2RMM A;  3H7P B;  1MIZ B;  1ROE A;  3TJP A;  2JVC A;  2N7J A;  4RM9 A;  2WP9 B;  5G2N A;  3AB5 A;  1YQ3 B;  3ZNG C;  2R82 A;  3EFU A;  5D2M B;  1SF0 A;  4WJQ A;  1NVI D;  1N6Z A;  2KOX A;  4AJY B;  4YSZ B;  3NS1 A;  3ZNH B;  1KC7 A;  5C6R A;  1GAQ B;  1WRD B;  3WAM A;  4TUU A;  1E8X A;  2WX1 A;  2MKR A;  3DHH C;  3NZS A;  3N30 A;  3ZTC A;  3AE2 B;  2IGG A;  1SHC A;  2K3U A;  2NBW B;  4XWT A;  3F0W A;  1D5X C;  3NZU A;  4EJN A;  2WXJ A;  1V5U A;  4RGT A;  1EO6 A;  1SE3 A;  3NHE B;  5BMH A;  1XD4 A;  2D9X A;  3PZD A;  2HTM E;  2N9L A;  3L10 B;  3P4R B;  4ASW C;  4QXA B;  5C5B A;  3Q3F A;  3PVU A;  3VXW A;  2DYO A;  2WXO A;  3HVD A;  2BS2 B;  1I4X A;  1WI0 A;  1I7A A;  2QC8 A;  4US9 A;  1OY2 A;  1WGR A;  4XYC A;  4LJP B;  2KAN A;  4HK2 A;  2IGH A;  2BYT A;  2N0Y A;  4IC7 B;  5HE1 A;  3ML9 A;  5E6N A;  1XQQ A;  3TMP B;  1WJ1 A;  5C2T B;  4O1N A;  2FE8 A;  3U7D A;  3AEG B;  2JRH A;  3N1X C;  3H7S A;  4IM0 A;  5I2S A;  2KFK A;  4OW0 A;  3Q3O C;  2FCQ A;  2COA A;  3AH7 A;  3H1U A;  4IG7 B;  1WMH B;  2GJY A;  3FC4 A;  3NWD A;  3A98 B;  1WJN A;  2ZCB A;  1Q67 A;  1FM0 D;  1EGX A;  3EFC A;  3HM3 A;  4HCP B;  1V61 A;  1F2R C;  5TSS A;  2VZK D;  3TVV A;  2ZZP B;  3V6E B;  1AQC A;  1KFY B;  1Q1O A;  4M00 A;  2H7D A;  2KD0 A;  3QBV B;  3FP5 A;  2UVM A;  1MK7 B;  1TY2 A;  1CQV A;  3JSV A;  4RF0 A;  2CJO A;  1QIL A;  3WAO A;  1ZM0 A;  4DQO C;  3CXB B;  4CHJ A;  2P0H A;  1YQ4 B;  4YL8 A;  2RRF A;  2N0S B;  2CY5 A;  1GB4 A;  1NTY A;  2I5F A;  1UUP A;  2FCS A;  2DLB A;  4IAP A;  1F52 A;  1TS3 A;  3SDL C;  1YN5 A;  3Q6B A;  1JWB D;  4L1R A;  2RDG A;  2NR2 A;  4DHZ B;  3BVM A;  2BGF A;  3NVZ A;  2LKO A;  1BTK A;  5D27 A;  2ZCC A;  1N61 A;  4M01 A;  1UGM A;  2LXA A;  2KQS A;  1BAK A;  2KWV B;  1PUT A;  1E5W A;  2I5C A;  1JRO A;  1P98 A;  5D3W A;  1J7A A;  2LUE A;  5FR6 A;  3VR8 B;  2EMS A;  1U29 A;  4G50 A;  2DWQ A;  1I4Q A;  1VD2 A;  2L7R A;  4KIK B;  3BII D;  5EE0 A;  3AE4 B;  4GXB A;  2L1C A;  1LFD A;  1C78 A;  1DYN A;  3RNB C;  4WAF A;  1E7V A;  4G3X B;  4HKQ A;  2JQR B;  2QDF A;  4C56 C;  1HA5 A;  1RRP B;  2BPS A;  4NAM A;  1WX8 A;  1B9R A;  2DX1 A;  1T3Q A;  4HJG E;  2IYD B;  3B0A A;  3IXS A;  4MM3 B;  4JK9 A;  1NYQ A;  2VZK B;  2ELB A;  2ZVO A;  3V3X A;  1T0R C;  2X18 A;  3JVZ X;  4K81 A;  2CHW A;  1NVL A;  1SGH A;  5JXV A;  2RGF A;  4GIV A;  1C4A A;  1WR1 A;  3ZNI D;  5H8Y E;  1S1Q B;  3JW0 X;  4W9J A;  4EE2 A;  4DDI D;  2NPT B;  2WXI A;  3EHV A;  5KQ1 A;  4BZA A;  4HHV A;  4KZC A;  1J19 A;  1BTN A;  1QOG A;  4ARI A;  2O6V D;  3ZDM C;  4FLH A;  5I4D A;  2NBU A;  3VQI A;  2K8C A;  4W9H A;  2EC1 A;  4W9I A;  3V05 A;  1ESF A;  1IPG A;  1EUV B;  1NI2 A;  2Z59 A;  4N59 A;  2KWC A;  1D5M C;  3DBL I;  1ST7 A;  2JF5 A;  4JWU C;  3RNE C;  3JYU A;  1RLF A;  3ZRF A;  2GUM A;  3IT6 B;  3H8H A;  4WQM A;  1V6E A;  4XC2 A;  2DZJ A;  3M62 B;  1TQZ A;  4HPP A;  1P7E A;  1GUA B;  4M02 A;  4XDD A;  4EZJ A;  2FUG 1;  3VAW A;  3HM6 X;  2M8S A;  2JT4 B;  4IDI A;  1ZUD 2;  2COC A;  2DTC A;  2WXH A;  2RR9 A;  3TW1 A;  5G55 A;  4XGA B;  5HE0 A;  4NJ6 A;  1U5G A;  4R3D A;  2N9P C;  3M95 A;  1VDV A;  3P2B A;  2IZV B;  4W9F A;  1E0Z A;  3HSA A;  5DCN A;  4I6N B;  2J53 A;  4MGK E;  4BBN C;  2KK8 A;  4GB9 A;  2LUL A;  4C0A A;  3B2F A;  1OFF A;  5GOW B;  3HUI A;  1E8Y A;  4JLC A;  2D3G A;  2W2W A;  3QC8 B;  2KMA A;  5HHD G;  1EVH A;  2XK5 A;  4G0N B;  3PPA A;  4RGM A;  2LZ6 A;  4IM2 A;  1WIA A;  1IGC A;  1N3H A;  1SIJ A;  3TEW A;  2Y5B B;  4AS1 A;  1JW9 D;  4QAY A;  4KHB A;  2FBW B;  3MC0 B;  4FXC A;  4MT5 A;  3PVL A;  1RWS A;  3VUY A;  2ADZ A;  3AE1 B;  3V6C B;  1BT0 A;  4YTM B;  2PIA A;  3KYC D;  1SXT A;  3VHT C;  5DPR A;  1T77 A;  1K50 A;  2DN6 A;  1XCQ L;  3I57 A;  1SIF A;  3BK2 A;  3Q3M C;  3RUI B;  2M17 A;  3DBS A;  3Q8B A;  1DYQ A;  2IPK D;  4A3P A;  2JUO A;  1C77 A;  2JRI B;  2ICI A;  3I63 C;  3RNA C;  4C4V A;  2KGX B;  3EC8 A;  5D7G A;  2CQU A;  1L2N A;  2W55 A;  2WXN A;  4HEA 1;  4HRS A;  2L0T A;  3ZTD A;  4A6H A;  1R4N B;  2MBE A;  3DCG A;  4BFR A;  4JKB A;  4DXA B;  2NTS A;  4LNN A;  2M14 A;  3APD A;  3ONS A;  5JHA A;  5BMG A;  3QWM A;  5HI1 A;  3I9V 1;  4PS3 A;  2WHI A;  1WJ6 A;  3ZQ4 A;  2W2X C;  3A1Q A;  3ALB A;  1X05 A;  2DIK A;  1I4G A;  4CO7 A;  3DBR B;  1G6J A;  4BOS C;  2QSD A;  4MH8 A;  2JWU A;  4DBB A;  4M0W B;  1OTR B;  2KVR A;  2N9E B;  3A9J B;  1JRP A;  4KDI C;  4HAW B;  2ZVN A;  2YLM A;  2ZW0 A;  3ENB A;  1V1P A;  3RZF A;  4PQ0 A;  2O2V B;  3SYX A;  1XOD A;  2HJ1 A;  2KTR A;  4OVU A;  2IO2 B;  5BO4 B;  4IWQ A;  3SU8 X;  2SAK A;  1J0G A;  3AJ4 A;  2R2O A;  2CB8 A;  4N6E B;  2DBY A;  5D6J B;  2QIL A;  1M4V A;  2G45 B;  3MP9 A;  3KWV A;  1L4D B;  3TEX A;  4HAU B;  3ZNZ B;  2ONQ A;  3RMK C;  3DWG C;  2GBK A;  2ON8 A;  5HKH A;  2J42 A;  2VSZ A;  1JAL A;  1U5F A;  3ZRC A;  5IP4 D;  4FAD A;  4JKD A;  3CWI A;  2PE6 B;  3DWM A;  1V5T A;  3KRW A;  3HRD D;  3ZKJ C;  1WXQ A;  3M63 B;  2QIE B;  1I4P A;  3OWE B;  4B6H A;  3VUW A;  3X0W A;  3LJU X;  3DBH I;  4HAT B;  2IO1 B;  1I35 A;  4ARC A;  2J0K A;  1XLP A;  2QEJ C;  4KGT A;  2ELA A;  3P1M A;  4JKH A;  2XEW A;  1W1G A;  3SEB A;  2KMM A;  1CZP A;  3Q8C A;  1HE8 A;  4XX5 A;  3PTF C;  2KT7 A;  2L2I A;  2LOZ A;  2WXL A;  1NU2 A;  1E10 A;  2J4X A;  3W5V B;  3AU4 A;  2DZK A;  3VR9 B;  4KAX B;  2CY4 A;  2DHK A;  5D3D A;  1N5W A;  5I2M A;  2IO0 B;  1GGO A;  1U27 A;  5JLJ B;  1EAZ A;  1L6U A;  2I1K A;  3PRZ A;  3DVN V;  2JP2 A;  4K7U A;  3ZXV A;  1EU4 A;  5HG2 A;  1WY8 A;  1XR0 B;  5LXH A;  4GDK B;  4ILH A;  3ZUN A;  3KSY A;  3OAN A;  3E9P A;  2PTL A;  2GI9 A;  3ULB A;  4IFS A;  3MTN B;  3RZW C;  2LJ5 A;  1NTV A;  3ZXR A;  3QA8 A;  4HWI B;  1W1H A;  4EMO A;  4GN1 A;  2IND C;  1E9M A;  2PMV A;  2Z0Q A;  1ZOY B;  2RD0 A;  1LQB A;  5JHB A;  1T0Q C;  2K5P A;  1TXD A;  1L5P A;  2HD5 B;  3AEF B;  3H7P A;  4ANV A;  5FI0 A;  1MJD A;  1TTN A;  3W5U B;  2WU5 B;  4I6P A;  2AWT A;  2KCJ A;  3SR6 A;  1FCL A;  2K22 A;  3WAP A;  4YON A;  3RCP A;  5AZH A;  3KQ4 A;  1WGH A;  2WU2 B;  2UWQ A;  1PQS A;  1WGQ A;  1VCB A;  1JDE A;  1TZ1 A;  3GYP A;  3MJ5 A;  2YS3 A;  2Z8L A;  3IG3 A;  4L23 A;  2EMT A;  2QMT A;  3RYT A;  2W82 A;  2K8E A;  2Y8G A;  1HTO A;  3FKY A;  3NVW A;  2RSG A;  3NZ3 A;  4HAV B;  1E8Z A;  5CTR C;  1T6B X;  4KGS A;  1K8R B;  3R2T A;  3QAR A;  4JK8 A;  1L7Y A;  3RUL A;  3ZLZ A;  4KDL B;  2RUK B;  5G5G A;  2VH2 A;  4K3C A;  1VRA B;  2K39 A;  1AWD A;  3T8M A;  4ZRP A;  1KJT A;  1K5D B;  4ZHP A;  5CHW A;  3HQC A;  4K17 A;  3Q8F A;  1P0R A;  4BKG A;  5FR3 A;  5G5H A;  3N9Y C;  2D9Z A;  3LXF A;  2B3A A;  1PFJ A;  3PEG A;  5LXI B;  1IBX A;  3AXC A;  4FN2 A;  4HDO A;  1FCC C;  2KTF A;  4BBN F;  4JX1 C;  3APF A;  2Y3A A;  2IY0 B;  4HCN B;  4XE0 A;  1IGD A;  3P4S B;  5E6O A;  1WG7 A;  4NJC A;  4DK5 A;  4PK1 A;  1WGY A;  3AEA B;  5LG4 B;  5HE3 A;  1FB8 A;  1MIX A;  1WMH A;  4FJY A;  1WE7 A;  2UZR A;  3VTW A;  1ZDX A;  4KHO A;  1MVK A;  2WXM A;  4NJ7 A;  1OQR A;  1UZX B;  5DHF B;  2KDF B;  3O65 B;  2WQY B;  2ZNV B;  4A90 A;  3GZN B;  4K3B A;  2M0A A;  2LGD A;  2X38 A;  3M1I B;  2K2U A;  2LGX A;  3P63 A;  4A8X C;  1YQB A;  1LM8 B;  4N58 A;  3QCA A;  3SUZ A;  1NTI A;  3ZW3 A;  2LRU A;  2L05 A;  2FID A;  5LON B;  2KVZ A;  1Y8R C;  3RNF C;  2P0D A;  4NAW B;  2W9N A;  1E8W A;  3L17 A;  3NVY A;  1F0Z A;  3BYY B;  2EKI A;  3PVW A;  1WGD A;  5J18 A;  4DDG D;  3GYO A;  1YIW A;  3KUC B;  2LBB A;  2BYE A;  2D11 A;  4JK7 A;  3MHS D;  2H89 B;  5L83 A;  2CAY A;  5EE1 A;  1Q0W B;  3LYY A;  2DLW A;  1YJI A;  2P8V A;  3P6A A;  1HZ5 A;  4MEM A;  1HZ6 A;  4YTP B;  3PZ7 A;  1J7B A;  3PRM B;  3D8E A;  1UNQ A;  1HBK A;  2D07 B;  3N20 C;  1DDV A;  3KVF B;  1R4M B;  1ZKH A;  1SB3 C;  2NTT A;  4KIK A;  2GBJ A;  3DPD A;  3PT2 B;  3PS6 A;  4WWN A;  1NYR A;  2D9Y A;  3CST A;  1JML A;  3KY9 A;  3N32 A;  1WI1 A;  2Q5W D;  2N23 A;  2RDB C;  2CU3 A;  1V88 A;  3K9P B;  1XT9 B;  1TT5 B;  3AI5 A;  2K8B A;  4A20 A;  2HTH B;  3TUO A;  1TBE A;  4JIO U;  1BWN A;  4MJS A;  1A5R A;  4MM3 A;  2GS0 A;  4KZ0 A;  3NWA A;  4MY6 A;  1ZGU B;  3I3T B;  3UQB A;  4A6F B;  2CS4 A;  2J0J A;  5J3T A;  2EJ8 A;  4HB4 B;  1X1M A;  2WX0 A;  2MP2 B;  4USA A;  2IO3 B;  3A33 B;  2L0F A;  3W1S A;  4ANU A;  4BOZ B;  4TMA B;  1YX6 B;  1NDD A;  2ZPY A;  4S0R A;  1U4A A;  2BQQ A;  1ZYI A;  4HB2 B;  1M7E A;  3TEY A;  1QKZ A;  2KAC A;  1XEE A;  2KHW B;  1QC6 A;  3VIA A;  1QOF A;  2R2Y A;  2D2Q A;  3UI3 A;  1FFV A;  2P0F A;  4XZ4 A;  1WSP A;  3Q69 A;  2REX A;  5FI1 A;  4D6W A;  1UNR A;  2D9W A;  2MX2 A;  2QCZ A;  5IN7 A;  2C5L C;  3N1Z C;  1WM3 A;  3VTU A;  4B9K A;  2Z0E B;  2KDM A;  1T0S C;  4JKG A;  2IYB A;  2DAJ A;  3GOE A;  3ZGZ A;  3P4Q B;  4ZRK A;  4HPL B;  2R61 A;  1SBB B;  3M3J A;  3GE3 C;  3ZVR A;  2N7E A;  1AW7 A;  4H8S A;  4IM3 A;  2DZI A;  1DRO A;  4W9L A;  1X1G A;  3MJW A;  4WWO A;  2OHF A;  1WZ0 A;  1ZSQ A;  3EGR A;  2BCJ A;  2YT0 A;  4GGQ A;  1WH3 A;  4YT0 B;  3BIN A;  1MHX A;  2J59 M;  3DQV A;  1KZG A;  4OT1 A;  2CU1 A;  4A5K A;  2WXF A;  2MJE A;  2XN9 C;  1V97 A;  4FJZ A;  4K1R B;  5DH9 B;  3LDZ E;  4P7I A;  4TQ1 A;  1WGK A;  3E9S A;  4MH0 E;  5IA7 A;  1BXT A;  1CK1 A;  3PRP B;  1LGR A;  2MDX A;  4ICU A;  4OHJ A;  1GJZ A;  5C5B B;  1LB1 A;  2WH5 A;  2JYT A;  2YF0 A;  2LGI A;  1QQG A;  3IAM 1;  4DHZ E;  1EF5 A;  3ULC A;  4L1B A;  4W9E A;  5MPO A;  1FO4 A;  1TGZ B;  3AE3 B;  2KQ7 A;  1LO5 D;  3BZD B;  2K1F A;  3L4P A;  3C0R B;  1QT9 A;  4K7W A;  3B2G A;  1FPY A;  1QQR A;  3OHM B;  1OEY A;  4RCO A;  4WUR A;  1ZXH A;  3KLS X;  2ABD A;  1GC7 A;  1MG8 A;  4E71 A;  2LD9 A;  2LYD A;  2GMI C;  1WF9 A;  1X1F A;  2V1Y A;  5CLL B;  3QIJ A;  2KNB A;  2WXG A;  3SHQ A;  4EEW A;  5EFX A;  2MJD A;  2MBO A;  2LOX A;  2IY1 B;  3BVG A;  3P7Z A;  3U8Z A;  2KIG A;  3Q3N C;  3QAQ A;  3SV1 A;  3AN1 A;  2XQN M;  3ML4 A;  2AQ3 B;  1DBH A;  2N1V A;  1D6E C;  1SSN A;  2JY6 A;  3D32 A;  4WJN A;  1YOV B;  1P6S A;  4IKG A;  2WGS A;  4KSK C;  2D4Q A;  2BWF A;  3O13 A;  1XLQ A;  1F77 A;  2B76 B;  2WYQ A;  1ZC3 B;  1KM7 A;  2KR0 A;  3E9O A;  2KMC A;  3NWF A;  5J2R A;  4WQO B;  1FXA A;  2MBB B;  2BYV E;  2Y5P A;  4HLE A;  2Z13 A;  5FK9 C;  1N63 A;  3PG7 A;  3CF6 E;  1STE A;  2D3B A;  1RRB A;  3UQA A;  2N9K A;  1HB6 A;  3TSS A;  3A9J A;  3ZIM A;  3U12 A;  2M1M A;  3A8P A;  3H6N A;  3PZ8 A;  5AUK A;  1ET9 A;  2G1E A;  3N7C A;  4IW0 A;  2O2V A;  3S2A A;  4C80 A;  1SEB D;  2KQ4 X;  4A9A A;  2KLC A;  2MWN B; 
#chains in the Genus database with same CATH homology
 3NOB A;  1IYF A;  3ODX A;  1J8C A;  1WZ3 A;  1RJ2 A;  3UIP B;  1M94 A;  1JRU A;  5LOP B;  2O6V B;  5CHF A;  3L08 A;  4PS8 A;  1XCG A;  3RCZ A;  4HB0 B;  2BYF A;  4NQL B;  2G35 A;  4BBK A;  5C79 A;  3KW5 B;  2IFS A;  2ZJD A;  2KWU B;  3PLV A;  5E6P A;  2V3S A;  4NY0 A;  4I6L B;  3DOW A;  4F7G A;  2DX5 A;  2DYB A;  1XD3 B;  4IWO A;  3BJI A;  2HJ8 A;  4F7H A;  4MK0 A;  2MRP A;  2YSZ A;  4RMA A;  2C7N B;  2Z59 B;  3VUX A;  2LG1 A;  3PV1 A;  4II2 B;  2FCM A;  3IHP C;  1W1D A;  3K9O B;  3MPX A;  2LGY A;  2OQB A;  4GDK A;  1D3Z A;  4TQ0 A;  2GOW A;  1WJM A;  4CHK A;  2Z0O A;  1V2Y A;  1U5E A;  1E7U A;  2DZM A;  4HB3 B;  2RSU A;  4IWP A;  4DBG A;  1Q5W B;  2RQ1 A;  1H8C A;  5IJM A;  2RLO A;  2M0X A;  4GDL B;  3L54 A;  2CRF A;  4EZK A;  1V9J A;  4WWP A;  1UNP A;  2X0S A;  1WR6 E;  4MGI E;  2XK5 B;  1FGY A;  4AJW A;  4ILJ A;  1V5O A;  4ZDV A;  1DDM A;  2DA0 A;  5JH5 C;  2W2X D;  3R7Q A;  5C23 A;  2DYM A;  3HK0 A;  1WVH A;  2K2J A;  1WXS A;  5D3Y A;  2YVC A;  4GU2 A;  3HW2 B;  4GMV A;  4TV3 A;  5AZG A;  5CX3 A;  1P1A A;  2RVB B;  2MWS B;  3TBL D;  2NS5 A;  3PRE A;  4FA6 A;  3DXE A;  2GBN A;  4KV2 A;  3DXD A;  2YT1 A;  4MGY E;  4Z2N A;  1YD8 U;  1XX0 A;  5J17 A;  5J3Y A;  3H9D A;  1C1Y B;  1Y19 B;  2AYO B;  1HB8 A;  3TO1 A;  2G4D B;  2CKH B;  4GSW A;  3RT3 B;  2Z0P A;  5JZE B;  4NNJ B;  3AUL A;  3OJ4 B;  5C1Z A;  1DIK A;  4OVV A;  1Z2M A;  2IBI B;  3LJ3 A;  2KKC A;  1ZC4 B;  1MK9 B;  3E9L A;  2D9V A;  3NS8 A;  4CYE A;  5JHG A;  2MLB A;  2ASQ A;  3FEH A;  2ZEQ A;  4X57 B;  3IBE A;  1KBL A;  2CR5 A;  4WAA A;  4EUT A;  2N7D A;  3KZ1 A;  2OJR A;  5KCV A;  1R4N I;  2WWZ A;  2R2Q A;  1WJU A;  2DYN A;  1AAR A;  3HHM A;  1OQN A;  3PSE B;  2DEN B;  3A9K B;  3DBR I;  2FJ9 A;  3PHX B;  1WX9 A;  2UYZ B;  2L3Z A;  4DWF A;  3PGE A;  2E2X A;  2YS5 A;  2M38 A;  4JKC A;  3WAN A;  1FHW A;  2EKE C;  3VH3 B;  1LXD A;  2YS1 A;  2Y8F A;  1WJ4 A;  1WE6 A;  2KC1 A;  4BKS A;  2AL3 A;  4A6F A;  2MBQ A;  3UIO B;  4W9D A;  4PYZ A;  2MP2 A;  4FBJ B;  3AU5 A;  4A6K A;  2OTX A;  3TIX A;  3L16 A;  2JZ3 B;  3R3M A;  4GPT B;  1TJ6 A;  4B95 A;  3N3K B;  5IAA C;  1UBI A;  1WXM A;  4AP4 C;  2Q13 A;  1IRS A;  4LJO B;  2C60 A;  1SE9 A;  1GNU A;  1S3S G;  4HAX B;  2Z0D B;  4PNK A;  1LW3 A;  1FGZ A;  1V5P A;  2XBB C;  2FNJ B;  4GOC A;  4G11 A;  2VRR B;  4HPM B;  2V76 A;  3KUZ A;  4RM8 A;  3EPY A;  3HIZ A;  1V89 A;  4NQK E;  2NBV B;  2BF8 B;  2M4N A;  3QK0 A;  1I42 A;  4B6W A;  3W1S C;  1KLV A;  5DPT A;  4EKU A;  1X86 A;  1YX5 B;  2MSE D;  2K00 A;  4MDK E;  3IVF A;  1MKE A;  2MCN B;  2RPQ A;  3BY4 B;  1QZE A;  4EZL A;  4JKA A;  1KZ7 A;  3V60 A;  4L6E A;  2PPH A;  4HDQ A;  4NPN A;  4LCD E;  5L81 A;  2JWZ A;  2NPT A;  2HE7 A;  5DPW A;  3DDC B;  3A8Q A;  2YRY A;  3PLU A;  1UH6 A;  5GMV A;  2COF A;  2Y7B A;  5EDS A;  3CIK A;  5JVL A;  2CHX A;  3Q3J A;  4TKN A;  3QX1 A;  2DHJ A;  3FM8 C;  1P5T A;  1J0W A;  1ZW7 A;  2OOB B;  3NY5 A;  4AUQ C;  4F8C B;  4JQW C;  5KHQ A;  1UBQ A;  2JZZ A;  3TL5 A;  4ILG B;  1WXV A;  5DPS A;  2KX0 A;  2FJL A;  1OMW A;  2ROV A;  2PEA A;  4FHJ A;  4HAZ B;  4F1S A;  2MFQ A;  2LVP A;  1OGW A;  2J0M A;  1K5G B;  4TYZ A;  3QHT A;  3ODW A;  1YJ1 A;  3X23 A;  3EEC A;  3T06 A;  2GBM A;  3VFK A;  3QQ8 B;  1P3Q U;  3GZN I;  3WAL A;  2O6V A;  2DHI A;  1U5D A;  1WM2 A;  3PHW B;  4JKE A;  3ECI A;  2FIF A;  1WFY A;  5DI9 B;  1E90 A;  3DVG X;  2KO3 A;  2L76 A;  4MJS B;  4AWJ A;  3WIM A;  1Y5O A;  2KFK B;  2C9W B;  2DHZ A;  4II3 B;  2RNR B;  1ACA A;  2K25 A;  2HRJ A;  4IOY X;  3PP2 A;  5D3V A;  4MT7 A;  1WYW B;  1RAX A;  3PSC A;  2ZPN A;  3VOQ A;  3D8D A;  2FUH B;  3KYD D;  4BKT A;  3KUD B;  4N9F 4;  3IFW B;  2LI5 A;  3JSV B;  1R4M I;  4WSF A;  2LAS A;  2RGN B;  4URK A;  2DKP A;  5JP4 A;  3RD2 A;  4JKG B;  2N9X A;  4E74 A;  3ZO5 B;  4M8N A;  1GC6 A;  2A5U A;  3B08 A;  2DFK A;  1RFA A;  2MA9 B;  4MSQ B;  1I2H A;  2MQJ A;  5CHV C;  2FDQ A;  3L0W B;  2GCL A;  3UIN B;  3UZT A;  2K6D B;  3DVN U;  1M7R A;  2KDB A;  4W9C A;  5AEK B;  2GBR A;  4BVU C;  4JKF A;  1P9D U;  3QJZ A;  2PJH A;  1MPH A;  2VKI A;  1MAI A;  2KX3 A;  2QHO A;  1KI1 B;  2K8H A;  3CMM B;  1OQY A;  2V4L A;  3R66 C;  4GDL A;  2CHZ A;  2PE9 A;  2LXC A;  2MW5 A;  3B1L X;  3DVG Y;  4XWX A;  1Z87 A;  1H10 A;  2QKL A;  2C7H A;  4M8M A;  5LLI A;  4DX9 0;  4HVB A;  4E3C A;  2G3Q B;  1KOT A;  2KUP A;  2AEH A;  2WDT B;  1FXT B;  1P3R A;  4Z2M B;  2KDE B;  1OEY J;  1PMS A;  4K2P A;  1X11 A;  1V5M A;  3A4R A;  4A3O A;  3W1Y A;  4JGH B;  1UEL A;  3VVW B;  4ZRI A;  3KRX A;  3UGB B;  3V61 A;  4IUM B;  2BKF A;  3SBT A;  4MSM B;  1IP9 A;  4WVF B;  5AZF A;  1ZVR A;  2KN5 A;  4LDT D;  2NZ8 B;  3APC A;  1Z5S B;  4ZRJ A;  4EFO A;  4PS7 A;  3SD5 A;  1WXA A;  1V81 A;  4KVG B;  3SO6 A;  1UPQ A;  3T9L A;  3L13 A;  4K2O A;  4J6I A;  2H7E A;  2KLG A;  4KSL C;  2R0D A;  2ROZ B;  2FCN A;  5HE2 A;  5D94 A;  4DHJ D;  4D0N B;  5TR5 A;  2QKM A;  1H4R A;  1FHO A;  2KJR A;  2MBH A;  4KHB B;  2KXJ A;  2R09 A;  4KHA A;  4LDT B;  3A9K A;  4JL9 A;  3V62 A;  2C7M B;  3FLV A;  4W9K A;  3ZDT A;  1B55 A;  1VBH A;  1VBG A;  1U2B A;  2G4S A;  2DX5 B;  3VDZ A;  1AWE A;  2ZNV C;  4DX8 A;  3U30 A;  2LVO A;  4K7S A;  2NMB A;  2FAZ A;  3ZVV A;  2NVU I;  3ENE A;  4NSW A;  1UPR A;  5JHH A;  4HXD A;  1F9J A;  4HJK A;  2GCJ A;  3TFM A;  5CLQ B;  2A4Z A;  3A1Q B;  1FAO A;  3O96 A;  2N4F A;  3WA0 A;  2LVQ A;  4ZYN A;  3OLM D;  1EF1 A;  1CMX B;  2AL6 A;  4DHJ B;  5DHA B;  3NSU A;  2LWP A;  4WJP A;  1C3T A;  3V5W A;  2KTR B;  4GZU A;  2KC2 A;  4F7Z A;  5J3Q A;  4HAY B;  1FHX A;  2KDI A;  1V80 A;  1WGG A;  4Y94 A;  2JPH A;  4FJV B;  4NAW A;  4PYU A;  2KJ6 A;  2DKQ A;  2LRW A;  2D10 A;  3SBG A;  3FSS A;  3VTV A;  3TCA A;  4ANX A;  2L00 B;  4CHM A;  2COP A;  2KJH B;  4AOF A;  4MGZ E;  1UD7 A;  2N1W A;  1PLS A;  5KQ4 A;  1FOE A;  3UF8 A;  3DXC A;  4WJO A;  2KFJ A;  2NCN A;  3E66 A;  4ICV A;  3SNH A;  3ML8 A;  2KZR A;  2DAF A;  3A4S C;  2BKR B;  3KH0 A;  2K6Q A;  2JXX A;  3D8F A;  3ODO A;  2DYQ A;  2VRW B;  5D3X A;  2I1J A;  2HTH A;  3R7R A;  1T0Y A;  2PZ1 A;  4GMX B;  4MEL A;  3QWZ B;  2BWE S;  3VH4 B;  1DDW A;  3CSF A;  5DIF B;  1ISN A;  4FHK A;  1XKE A;  4F7U P;  1V86 A;  3MDB C;  1V49 A;  3G9W A;  2J7Q B;  4ANW A;  3OJ3 A;  4W9G A;  4FUL A;  5C16 A;  1GG3 A;  1NBF C;  2COD A;  4WJ7 A;  1UEF A;  5KHO A;  4EOY A;  1WGU A;  3WYF B;  2UZS A;  2L8J A;  1WX7 A;  5L95 C;  3OAW A;  3F5R A;  4BKS D;  3H7P B;  1MIZ B;  3TJP A;  2JVC A;  4RM9 A;  5G2N A;  3ZNG C;  2R82 A;  3EFU A;  5D2M B;  4WJQ A;  2KOX A;  4AJY B;  3ZNH B;  1KC7 A;  5C6R A;  1WRD B;  3WAM A;  4TUU A;  1E8X A;  2WX1 A;  2MKR A;  3ZTC A;  3NZS A;  3N30 A;  1SHC A;  2NBW B;  3F0W A;  3NZU A;  4EJN A;  1V5U A;  1EO6 A;  3NHE B;  1XD4 A;  2D9X A;  3PZD A;  3L10 B;  4ASW C;  5C5B A;  3Q3F A;  3PVU A;  3VXW A;  2DYO A;  1WI0 A;  1I7A A;  1OY2 A;  1WGR A;  4LJP B;  2KAN A;  4HK2 A;  2N0Y A;  4IC7 B;  5HE1 A;  5E6N A;  3ML9 A;  1XQQ A;  3TMP B;  1WJ1 A;  3U7D A;  2JRH A;  3H7S A;  4IM0 A;  2KFK A;  2FCQ A;  2COA A;  3H1U A;  4IG7 B;  1WMH B;  2GJY A;  3A98 B;  1WJN A;  2ZCB A;  1Q67 A;  1EGX A;  3HM3 A;  4HCP B;  1V61 A;  3TVV A;  2ZZP B;  3V6E B;  1AQC A;  1Q1O A;  2H7D A;  2KD0 A;  3QBV B;  3FP5 A;  2UVM A;  1MK7 B;  3JSV A;  3WAO A;  1ZM0 A;  3CXB B;  4CHJ A;  2P0H A;  4YL8 A;  2CY5 A;  1NTY A;  2I5F A;  2FCS A;  4IAP A;  3SDL C;  2NR2 A;  4DHZ B;  2BGF A;  2LKO A;  1BTK A;  5D27 A;  2ZCC A;  1UGM A;  2LXA A;  2KQS A;  1BAK A;  2KWV B;  1E5W A;  2I5C A;  1P98 A;  5D3W A;  2LUE A;  5FR6 A;  2EMS A;  1U29 A;  4G50 A;  1VD2 A;  2L7R A;  4KIK B;  4GXB A;  2L1C A;  1LFD A;  1DYN A;  1E7V A;  4G3X B;  1RRP B;  2BPS A;  1WX8 A;  2DX1 A;  2IYD B;  3B0A A;  4JK9 A;  2ELB A;  2ZVO A;  2X18 A;  3JVZ X;  4K81 A;  2CHW A;  1NVL A;  1SGH A;  2RGF A;  4GIV A;  1WR1 A;  3ZNI D;  1S1Q B;  3JW0 X;  4W9J A;  4DDI D;  2NPT B;  3EHV A;  5KQ1 A;  4HHV A;  4KZC A;  1J19 A;  1BTN A;  2O6V D;  3ZDM C;  4FLH A;  2NBU A;  3VQI A;  2K8C A;  4W9H A;  2EC1 A;  4W9I A;  1IPG A;  1EUV B;  1NI2 A;  2KWC A;  3DBL I;  1ST7 A;  2JF5 A;  3JYU A;  1RLF A;  3ZRF A;  1V6E A;  4XC2 A;  2DZJ A;  3M62 B;  1TQZ A;  1GUA B;  4EZJ A;  3VAW A;  3HM6 X;  2M8S A;  2JT4 B;  2COC A;  2DTC A;  5G55 A;  2RR9 A;  3TW1 A;  5HE0 A;  4NJ6 A;  1U5G A;  2N9P C;  3M95 A;  3P2B A;  2IZV B;  4W9F A;  5DCN A;  4I6N B;  4MGK E;  4BBN C;  2KK8 A;  4GB9 A;  2LUL A;  4C0A A;  5GOW B;  1E8Y A;  4JLC A;  2D3G A;  2W2W A;  3QC8 B;  2KMA A;  1EVH A;  2XK5 A;  4G0N B;  3PPA A;  2LZ6 A;  4IM2 A;  1WIA A;  1N3H A;  2Y5B B;  3PVL A;  3VUY A;  2ADZ A;  3V6C B;  1BT0 A;  3KYC D;  3VHT C;  5DPR A;  2DN6 A;  1SIF A;  3RUI B;  2M17 A;  3DBS A;  4A3P A;  2JUO A;  2JRI B;  2KGX B;  3EC8 A;  5D7G A;  2CQU A;  1L2N A;  2L0T A;  3ZTD A;  4A6H A;  2MBE A;  3DCG A;  4BFR A;  4JKB A;  4DXA B;  2M14 A;  3APD A;  3ONS A;  5JHA A;  3QWM A;  4PS3 A;  1WJ6 A;  2W2X C;  3A1Q A;  3ALB A;  1X05 A;  2DIK A;  4CO7 A;  1G6J A;  4BOS C;  4DBB A;  4M0W B;  1OTR B;  2KVR A;  2N9E B;  3A9J B;  4KDI C;  4HAW B;  2ZVN A;  2YLM A;  3ENB A;  3RZF A;  4PQ0 A;  2O2V B;  3SYX A;  1XOD A;  2KTR A;  4OVU A;  2IO2 B;  5BO4 B;  4IWQ A;  3SU8 X;  1J0G A;  3AJ4 A;  2R2O A;  2CB8 A;  5D6J B;  2G45 B;  4HAU B;  3ZNZ B;  2GBK A;  5HKH A;  2VSZ A;  1U5F A;  3ZRC A;  4FAD A;  4JKD A;  2PE6 B;  1V5T A;  3KRW A;  3ZKJ C;  3M63 B;  4B6H A;  3VUW A;  3X0W A;  3LJU X;  3DBH I;  4HAT B;  2IO1 B;  1I35 A;  2J0K A;  2ELA A;  4JKH A;  2XEW A;  1W1G A;  1HE8 A;  4XX5 A;  3PTF C;  2L2I A;  2LOZ A;  1NU2 A;  3AU4 A;  2DZK A;  4KAX B;  2CY4 A;  2DHK A;  2IO0 B;  1GGO A;  1U27 A;  5JLJ B;  1EAZ A;  2I1K A;  3PRZ A;  3DVN V;  2JP2 A;  4K7U A;  1WY8 A;  1XR0 B;  5LXH A;  4GDK B;  4ILH A;  3ZUN A;  3KSY A;  3OAN A;  3E9P A;  3ULB A;  4IFS A;  3MTN B;  3RZW C;  2LJ5 A;  1NTV A;  3QA8 A;  4HWI B;  1W1H A;  4EMO A;  4GN1 A;  2Z0Q A;  2RD0 A;  1LQB A;  5JHB A;  1TXD A;  2HD5 B;  3H7P A;  4ANV A;  5FI0 A;  1TTN A;  4I6P A;  2AWT A;  2KCJ A;  3WAP A;  4YON A;  3RCP A;  5AZH A;  1WGH A;  2UWQ A;  1PQS A;  1WGQ A;  1VCB A;  1JDE A;  1TZ1 A;  3GYP A;  2YS3 A;  3IG3 A;  2EMT A;  3RYT A;  2Y8G A;  2RSG A;  4HAV B;  1E8Z A;  5CTR C;  1K8R B;  3QAR A;  4JK8 A;  1L7Y A;  3RUL A;  3ZLZ A;  4KDL B;  2RUK B;  2K39 A;  3T8M A;  1KJT A;  1K5D B;  5CHW A;  3HQC A;  4K17 A;  1P0R A;  4BKG A;  2D9Z A;  2B3A A;  1PFJ A;  3PEG A;  5LXI B;  3AXC A;  4FN2 A;  4HDO A;  2KTF A;  4BBN F;  3APF A;  2IY0 B;  4HCN B;  5E6O A;  1WG7 A;  4DK5 A;  1WGY A;  5HE3 A;  1FB8 A;  1MIX A;  1WMH A;  4FJY A;  1WE7 A;  2UZR A;  3VTW A;  4KHO A;  4NJ7 A;  1UZX B;  5DHF B;  2KDF B;  3O65 B;  2ZNV B;  2LGD A;  3M1I B;  2K2U A;  2LGX A;  1YQB A;  1LM8 B;  3QCA A;  3SUZ A;  1NTI A;  3ZW3 A;  2LRU A;  2L05 A;  2FID A;  5LON B;  1Y8R C;  2P0D A;  4NAW B;  2W9N A;  1E8W A;  3L17 A;  3PVW A;  1WGD A;  5J18 A;  4DDG D;  3GYO A;  1YIW A;  3KUC B;  2LBB A;  2BYE A;  2D11 A;  4JK7 A;  3MHS D;  5L83 A;  2CAY A;  1Q0W B;  2DLW A;  2P8V A;  3P6A A;  4MEM A;  3PRM B;  3D8E A;  1UNQ A;  1HBK A;  2D07 B;  1DDV A;  3KVF B;  1ZKH A;  4KIK A;  2GBJ A;  3DPD A;  3PT2 B;  3PS6 A;  4WWN A;  2D9Y A;  3CST A;  3KY9 A;  3N32 A;  1WI1 A;  2N23 A;  1V88 A;  3K9P B;  1XT9 B;  3AI5 A;  2K8B A;  4A20 A;  2HTH B;  1TBE A;  4JIO U;  1BWN A;  4MJS A;  1A5R A;  4MM3 A;  2GS0 A;  4KZ0 A;  3UQB A;  4MY6 A;  1ZGU B;  3I3T B;  4A6F B;  2CS4 A;  2J0J A;  5J3T A;  2EJ8 A;  4HB4 B;  1X1M A;  2WX0 A;  2MP2 B;  2IO3 B;  3A33 B;  2L0F A;  3W1S A;  4ANU A;  4BOZ B;  1YX6 B;  1NDD A;  2ZPY A;  1U4A A;  4HB2 B;  1M7E A;  2KHW B;  1QC6 A;  3VIA A;  2D2Q A;  4XZ4 A;  2P0F A;  2REX A;  5FI1 A;  1UNR A;  2D9W A;  2MX2 A;  2C5L C;  1WM3 A;  3VTU A;  4B9K A;  2Z0E B;  4JKG A;  2IYB A;  2DAJ A;  3GOE A;  4ZRK A;  4HPL B;  3M3J A;  3ZVR A;  2N7E A;  4H8S A;  4IM3 A;  2DZI A;  1DRO A;  4W9L A;  1X1G A;  3MJW A;  4WWO A;  1WZ0 A;  1ZSQ A;  2BCJ A;  2YT0 A;  4GGQ A;  1WH3 A;  3BIN A;  2J59 M;  3DQV A;  1KZG A;  2CU1 A;  4A5K A;  4FJZ A;  4K1R B;  5DH9 B;  3LDZ E;  4P7I A;  4TQ1 A;  4MH0 E;  5IA7 A;  3PRP B;  2MDX A;  4ICU A;  1GJZ A;  5C5B B;  1LB1 A;  2WH5 A;  2YF0 A;  1QQG A;  4DHZ E;  1EF5 A;  3ULC A;  4W9E A;  1TGZ B;  2KQ7 A;  2K1F A;  3C0R B;  4K7W A;  1OEY A;  2ABD A;  1GC7 A;  1MG8 A;  4E71 A;  2LD9 A;  2LYD A;  2GMI C;  1WF9 A;  1X1F A;  2V1Y A;  5CLL B;  3QIJ A;  2KNB A;  3SHQ A;  4EEW A;  5EFX A;  2MBO A;  2LOX A;  2IY1 B;  3P7Z A;  3U8Z A;  3QAQ A;  3SV1 A;  2XQN M;  3ML4 A;  1DBH A;  2N1V A;  2JY6 A;  3D32 A;  4WJN A;  1P6S A;  4KSK C;  2D4Q A;  2BWF A;  2WYQ A;  1ZC3 B;  1KM7 A;  3E9O A;  2KMC A;  5J2R A;  4WQO B;  2MBB B;  2BYV E;  4HLE A;  3PG7 A;  3CF6 E;  1RRB A;  3UQA A;  1HB6 A;  3A9J A;  3ZIM A;  2M1M A;  3A8P A;  3H6N A;  3N7C A;  4IW0 A;  2O2V A;  3S2A A;  2KLC A;  2MWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...