2EMTA

Crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
313
Chain Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQARVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PSGL-1 binding to ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 89
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2emtA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2emtA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2emtA01
3NZUA 2FAZA 1UGMA 1OGWA 1WX8A 1TXDA 2LZ6A 4W9CA 2QHOA 4HPLB 1WGGA 3WANA 4TV3A 2RNRB 2JWZA 4OVUA 2EJ8A 2L0TA 2DZIA 2MBEA 2OJRA 5TR5A 4HATB 3SDLC 2MWSB 5HE0A 2NPTB 3DDCB 3IHPC 1WZ0A 3L08A 2YVCA 1WJ1A 2LOZA 2V76A 1RAXA 3OJ3A 3SD5A 2KQ7A 1PMSA 3DCGA 2FIFA 2G3QB 3MHSD 3A9JA 2GS0A 5HE3A 3TBLD 2DYOA 3ML9A 2L00B 3Q3JA 4GGQA 4EZLA 1MIXA 3M1IB 4F7HA 1WF9A 4FN2A 3V6EB 2E2XA 1XX0A 2N1VA 3T06A 5JLJB 4GN1A 4IAPA 1RRBA 1WXSA 2DYNA 2C7NB 2IZVB 2XK5B 3M3JA 4IOYX 1WXMA 1BTKA 2N9PC 3L54A 2MP2A 4K7SA 1OEYA 2ABDA 4Z2MB 5JZEB 3TO1A 2KUPA 3ZDTA 3TL5A 4AUQC 1NVLA 4JIOU 1PFJA 4PQ0A 4K7UA 2DFKA 1XQQA 4WJOA 4G11A 4BOZB 1J8CA 5HE1A 3BJIA 2C7MB 2KDIA 2JY6A 2A5UA 2KOXA 3QQ8B 2PJHA 4HCNB 3MDBC 2KMAA 3FM8C 3CSTA 2NS5A 3N30A 4DBGA 2ZCBA 1QQGA 2Y7BA 2EC1A 2JT4B 2KJ6A 2NVUI 3H1UA 4E71A 4IWQA 1SIFA 2PE6B 5CTRC 3H6NA 4PYUA 3O96A 4URKA 1FGZA 4NNJB 2OOBB 5LXHA 3P2BA 3P7ZA 2HD5B 2KJRA 1GC7A 4LJPB 2V1YA 3H7PB 2FCQA 2KK8A 2RPQA 2K6DB 3M62B 3WALA 1DBHA 2GBKA 2KX3A 2K2JA 3L13A 1I2HA 1K5DB 3H9DA 3LJUX 2IO2B 2KX0A 4I6PA 2MX2A 4IFSA 2AWTA 1GNUA 2LXAA 3KW5B 2BKRB 4KHOA 2D07B 2O6VA 3A1QA 4LDTB 3OAWA 2CU1A 3R7RA 5J17A 3QWMA 5E6NA 4CO7A 5C6RA 2JZ3B 3ULCA 2Y5BB 1VD2A 3T8MA 3VH4B 4BFRA 3VVWB 3ZTDA 3MPXA 1E7UA 1UBIA 2KWUB 2XK5A 4MJSA 3VDZA 4EZKA 5LXIB 3QK0A 2BYFA 2D9XA 1J0GA 1UPQA 2FUHB 2DZMA 1HB8A 3RD2A 5C16A 1Z87A 2KXJA 5C23A 3VH3B 4GDKA 2YSZA 2LOXA 1CMXB 1EF5A 4W9FA 1WXVA 5LOPB 4FULA 3NS8A 4AP4C 3UGBB 3A4SC 4BBKA 3SHQA 2IFSA 3UIOB 2JPHA 1U5DA 4BKTA 5JHBA 4NQLB 2G4SA 2DHJA 2GOWA 1FB8A 3M95A 1PQSA 1MK7B 4W9KA 3ZO5B 4K2PA 4I6LB 5KCVA 5CLLB 1HE8A 3HK0A 2MBQA 2RR9A 4RM9A 1BAKA 3EHVA 4M0WB 4W9EA 3L0WB 1WR1A 2PEAA 4ZRKA 5E6PA 2L76A 3WAOA 3IVFA 2UZRA 1X1MA 2EKEC 4FJZA 1WGUA 2CR5A 2ROVA 3HHMA 2EMSA 2H7DA 4K7WA 3ODWA 1U4AA 3NZSA 4WJQA 1FHWA 3VAWA 2JUOA 5D3XA 1FXTB 3DVGX 3ZTCA 4FADA 1V5PA 1OQYA 1OMWA 1XD4A 2OTXA 5HE2A 1TQZA 1UZXB 2DAFA 3GZNI 1RFAA 1XKEA 1YD8U 2DLWA 2Z0QA 3QJZA 4W9LA 4BKSA 4HLEA 1RRPB 2N1WA 3ECIA 1U5EA 2YS1A 3L16A 3DBRI 4MEMA 1ACAA 4JGHB 2R2QA 3RYTA 4AWJA 1P3RA 4ANWA 4DXAB 2KTRA 5DH9B 4IUMB 4ZRJA 1MKEA 5DCNA 1L2NA 3QC8B 4HWIB 1V5OA 5AZGA 3AU4A 1V5MA 2L7RA 4IWOA 4N9F4 2X18A 2RQ1A 2HTHB 1WY8A 2IO0B 3VUWA 5IAAC 2R09A 2V3SA 2R2OA 1U29A 1WH3A 2KQSA 2JXXA 3SU8X 1WGRA 2ZPNA 4DHZE 1V61A 3PRPB 2FCSA 2ADZA 1M7RA 1UBQA 1FGYA 1WX7A 1FHOA 4F8CB 1KLVA 4ASWC 1E8XA 2Z0EB 4KV2A 2BCJA 1NU2A 2K2UA 1ZKHA 4G0NB 5CHWA 3ZNHB 3JSVB 2CB8A 4G3XB 4HB3B 4DHJB 5JHGA 2LRWA 3KRWA 5DIFB 4HAUB 2KZRA 2ZZPB 5L83A 2A4ZA 4FA6A 2COCA 3N32A 2RUKB 2BPSA 4HDOA 3KSYA 4IW0A 2KKCA 3CSFA 3PV1A 4GSWA 3WAMA 5J18A 2DHZA 4X57B 5EFXA 3EPYA 3APCA 1WJMA 3ZUNA 3F5RA 3T9LA 4BKSD 1OEYJ 2M8SA 4MSMB 1FHXA 2XQNM 2BGFA 1YJ1A 4E74A 3HM6X 4IC7B 1YX6B 3WIMA 5KQ1A 1WRDB 4OVVA 4EKUA 3WA0A 4B6HA 1UH6A 2UWQA 1MK9B 2FCNA 3NOBA 5D2MB 4EZJA 4DX8A 2JRHA 1J19A 4W9IA 2DKPA 3A8PA 4AJWA 1I42A 2COFA 5D3YA 4HVBA 3WYFB 2MBHA 4KSKC 3RCPA 2Z59B 2JP2A 2G35A 3UZTA 1E8ZA 2C60A 3S2AA 2MBBB 3VUXA 1WJUA 3U8ZA 2K8BA 1ZC4B 3B0AA 3DOWA 2RSGA 4IM3A 3UINB 1FOEA 2CAYA 2QKMA 3PREA 1YIWA 4LJOB 4TQ0A 2MCNB 1WGHA 2LVQA 4NJ7A 4TYZA 4A3PA 2FCMA 4EOYA 5C1ZA 3ENEA 3RZFA 1R4NI 2D10A 2AEHA 2O6VB 2J0KA 3VIAA 1S1QB 3KVFB 4II3B 3RT3B 2RGFA 4HAWB 2PE9A 4IG7B 2IO1B 4EJNA 3A33B 2NCNA 3PG7A 2RD0A 5D7GA 2ZNVB 2P0DA 1NI2A 3PVLA 2GCJA 4A5KA 3KUZA 1WGQA 2MFQA 4NSWA 3DQVA 3KYCD 3PHWB 3Q3FA 4MGZE 4W9GA 2R0DA 3QHTA 4XWXA 3H7PA 1V80A 3VTWA 1I35A 2LUEA 1GJZA 2W2XD 2M38A 3B1LX 1GG3A 1M7EA 1SE9A 2KO3A 1AWEA 3QA8A 4IWPA 4M8NA 2ZJDA 2DHKA 2OQBA 2DX5B 4BVUC 2LULA 4HAZB 2YRYA 3L17A 4MH0E 3SYXA 5D3WA 2KN5A 2PPHA 3PSCA 2MW5A 4IM0A 2ZEQA 4GMVA 1QZEA 4FJVB 5KHQA 1A5RA 2LYDA 1V89A 1V88A 1WE7A 2N23A 2L05A 2CHWA 4KZ0A 2L2IA 1WR6E 1WG7A 3PVUA 1WZ3A 1XD3B 4NQKE 2O6VD 4II2B 4MJSB 5DPSA 2Z0PA 2I5FA 4M8MA 1DDWA 2J0MA 2BWES 2LD9A 3A8QA 1OTRB 5CHVC 1KZGA 2RVBB 3IBEA 3JYUA 1T0YA 1P3QU 4KIKA 2D11A 2L3ZA 3PT2B 2JRIB 4DWFA 1GUAB 1J0WA 4KDLB 2NBUA 1WM3A 1LM8B 1Y8RC 2N9EB 3TW1A 2O2VA 1Q1OA 2V4LA 4BBNF 1X05A 4FHKA 1V5TA 3DXDA 1WXAA 4DHJD 2RLOA 4MT7A 3W1YA 2FJ9A 3CXBB 4WAAA 1X11A 3U30A 5D27A 4MGYE 2D2QA 3KH0A 4PS3A 5IJMA 2K25A 1ZSQA 3QBVB 1Y5OA 5JHHA 3V6CB 2J0JA 2D4QA 2LVPA 1IYFA 1WMHB 4ANUA 3A9KB 2LG1A 4KIKB 2YS3A 2N4FA 5GMVA 3TMPB 4FHJA 3W1SA 2WH5A 2CRFA 3PHXB 1NDDA 3UQAA 3ALBA 3SUZA 2D3GA 1K8RB 1P9DU 2MBOA 2NMBA 2KNBA 2KVRA 2MRPA 2LKOA 1OQNA 1ISNA 1EVHA 2DX1A 1WGYA 3PS6A 2K6QA 1V9JA 4EEWA 5JHAA 2WDTB 2ELBA 3AJ4A 1WM2A 2KLGA 1WIAA 3G9WA 4NY0A 2NBVB 3RZWC 1ZGUB 2KLCA 3UF8A 2KDFB 3AULA 1Y19B 1UNPA 2REXA 4JLCA 2CODA 1I7AA 1E8WA 2I1KA 3GOEA 3DBSA 3DVGY 4PNKA 4HK2A 2JF5A 3U7DA 4WQOB 2NZ8B 4MGKE 5FR6A 3UIPB 4DDGD 5IA7A 4GIVA 4E3CA 2D9ZA 1L7YA 1LFDA 4CYEA 3ZW3A 3ZIMA 4HDQA 1NBFC 3I3TB 3HM3A 3KRXA 2WX1A 2KD0A 5DHAB 3CF6E 3PSEB 1LQBA 1BTNA 1WE6A 4MM3A 4XX5A 2ZPYA 3PP2A 1IRSA 4KHBB 4HB2B 1QC6A 1V6EA 5G2NA 3SO6A 2MQJA 1KJTA 2NPTA 3ZRFA 1GC6A 4KDIC 3ODXA 1UD7A 4F7ZA 5D3VA 1AARA 1R4MI 1WJNA 2DZJA 2G4DB 4LDTD 4B95A 1WVHA 4FBJB 4F1SA 3CIKA 2MLBA 4DBBA 3APFA 3GYPA 2L0FA 4GU2A 5L95C 4H8SA 2NBWB 5J3TA 4IM2A 4WJNA 1PLSA 1XODA 4HAVB 4TKNA 2D9VA 3D8FA 4A6FB 1P1AA 2KFJA 3D8EA 1S3SG 1EGXA 2KMCA 2GBNA 1EAZA 3KUDB 4ZRIA 2M0XA 4KSLC 2KTFA 2VSZA 4AJYB 3O65B 2BWFA 2IY1B 3RUIB 3PPAA 3MJWA 1ST7A 4RMAA 3WAPA 2L8JA 3VFKA 2Y8FA 3GYOA 3DXCA 5JH5C 4KZCA 4EMOA 2K00A 4NAWA 1TZ1A 4B9KA 3VOQA 1WFYA 2P0HA 2DTCA 1V81A 2BYVE 2LGXA 2W2XC 4GXBA 1DDMA 2LGDA 4HJKA 1ZVRA 3A9KA 1WI1A 1Q5WB 3X0WA 2MSED 1DDVA 3QIJA 1E7VA 3KUCB 3M63B 3AU5A 2COAA 3P6AA 4Y94A 1NTIA 3N7CA 3W1SC 5C5BA 3H7SA 2DENB 1U27A 2D9WA 5L81A 4JL9A 4GDKB 3RCZA 1F9JA 4GDLB 4A6KA 4WWPA 2DA0A 2K39A 2N9XA 3B08A 3KZ1A 2LGYA 3IG3A 1D3ZA 3EECA 2H7EA 2YS5A 2GCLA 3LDZE 3R66C 5DPTA 3AI5A 2COPA 1E90A 2KC1A 1V49A 3DPDA 4JQWC 1H10A 1RJ2A 4GZUA 3VQIA 3ZDMC 1TTNA 3UQBA 1H4RA 1UEFA 2FDQA 4HB4B 2ASQA 2RSUA 4YONA 3PLUA 3V62A 4HXDA 3FSSA 2DYMA 2NR2A 3A1QB 1KI1B 4FLHA 2KFKB 4WWOA 5G55A 3ZNZB 2GBJA 4GMXB 3OJ4B 1WI0A 5AZHA 2Q13A 1MIZB 4ZYNA 1XT9B 3V61A 2LWPA 3D8DA 2HTHA 2W9NA 3VUYA 5LONB 2IYBA 4FJYA 4HAXB 2CS4A 1RLFA 3ULBA 1ZM0A 1SHCA 2DYBA 2WYQA 5EDSA 3DXEA 2MDXA 2BF8B 2N7DA 2ZCCA 1E5WA 1FAOA 1JRUA 2VKIA 3PEGA 1KM7A 2O2VB 3K9OB 3LJ3A 3QCAA 4W9JA 5CLQB 2AL6A 5D94A 2ROZB 2LXCA 2UYZB 3KY9A 3AXCA 1NTVA 2IY0B 2KC2A 1V86A 2BKFA 3A4RA 4LCDE 1KOTA 1G6JA 1NTYA 1P98A 3JW0X 4ICUA 1IP9A 3QAQA 4MGIE 3MTNB 2HJ8A 3PRZA 1WJ6A 4PS7A 3TVVA 3L10B 1AQCA 1K5GB 4BOSC 3HQCA 3KYDD 2W2WA 4HCPB 3A98B 1P0RA 2AL3A 5KQ4A 2XEWA 1WGDA 2IYDB 3DVNU 2AYOB 3JVZX 1UNRA 4XC2A 2MP2B 4EFOA 2DYQA 1TJ6A 4CHKA 2CHZA 1SGHA 4B6WA 4CHMA 3PRMB 2DHIA 1MAIA 2ZVNA 3D32A 2FIDA 1V2YA 3DVNV 5HKHA 2UVMA 3ZVVA 1Q0WB 5J3QA 2MWNB 4MSQB 2K1FA 5FI0A 4ICVA 5AZFA 2M1MA 1V5UA 1BWNA 3F0WA 3K9PB 3RULA 3BINA 1W1GA 5KHOA 3FEHA 1WX9A 2IO3B 2CQUA 1XCGA 2YT0A 2J7QB 2JVCA 4HPMB 3V60A 4DX90 2JZZA 2ELAA 2Z0DB 5DPWA 5LLIA 3EFUA 4MELA 2M17A 3HW2B 4GPTB 1ZC3B 4WVFB 2P8VA 5DPRA 3X23A 3CMMB 3R7QA 2I5CA 2GJYA 2KCJA 4A20A 3VTUA 4K17A 1M94A 2LVOA 2K8CA 2Z0OA 1EF1A 4WSFA 2MKRA 4K2OA 2M4NA 3QX1A 3ZKJC 2LI5A 4F7GA 1UPRA 2KDBA 3APDA 2C9WB 4G50A 4ZDVA 3HIZA 4DDID 2LJ5A 2QKLA 3ML8A 2KWVB 4A3OA 4AOFA 1U5FA 1LW3A 1HBKA 4MY6A 4KHAA 1Z5SB 4F7UP 4KAXB 2HE7A 3BY4B 4BKGA 3DBHI 2N7EA 3ZLZA 4WJ7A 1Q67A 4GDLA 3DBLI 1X86A 5D6JB 1DROA 2ZVOA 3ONSA 2C7HA 5C79A 4KVGB 5C5BB 2KANA 4Z2NA 1WJ4A 1C1YB 1WMHA 1DYNA 3VXWA 5DHFB 3OANA 2KGXB 3FP5A 1KZ7A 3V5WA 1TBEA 2EMTA 2VRRB 1MG8A 1IPGA 2C5LC 2FJLA 2WWZA 5J3YA 5DI9B 1Z2MA 4WWNA 1VCBA 1H8CA 1TGZB 2BYEA 4ANVA 1B55A 4P7IA 1UNQA 4GB9A 3VHTC 3PVWA 1U2BA 1WYWB 4D0NB 2DAJA 1W1DA 2XBBC 3R3MA 5E6OA 2L1CA 3ZNID 2DKQA 3NY5A 2GBRA 5GOWB 2Y8GA 2KFKA 5JP4A 3TJPA 2HRJA 3PZDA 4BBNC 1X1GA 1XR0B 4HHVA 3JSVA 3N3KB 4DK5A 4TUUA 2PZ1A 3VTVA 4A6FA 5FI1A 3TIXA 1U5GA 3ZRCA 3PTFC 1N3HA 4HB0B 2CY5A 1P6SA 3SNHA 2D9YA 2N0YA 4A6HA 3TFMA 2DN6A 4DHZB 4MK0A 2MA9B 2RGNB 2KDEB 1W1HA 3PGEA 4K1RB 2M14A 2YT1A 2G45B 5J2RA 3C0RB 2YLMA 3TCAA 4C0AA 3A9JB 3ML4A 1YQBA 2KWCA 2I1JA 1MPHA 4HAYB 3SV1A 1EO6A 1LXDA 5CHFA 1LB1A 4EUTA 2LRUA 2DX5A 2KTRB 4PS8A 3EC8A 3NHEB 2IBIB 4GOCA 1ZW7A 5AEKB 1OY2A 4W9HA 4J6IA 4XZ4A 1C3TA 2VRWB 5CX3A 4W9DA 2UZSA 1UELA 1HB6A 4RM8A 3NSUA 3QARA 2K8HA 4PYZA 3QWZB 2GMIC 1P5TA 1YX5B 1EUVB 3OLMD 4NAWB 3PLVA 2GBMA 3ZNGC 2LASA 1X1FA 2CY4A 2CHXA 4K81A 2FNJB 3ODOA 4I6NB 4MDKE 2P0FA 4ANXA 2B3AA 2J59M 4WJPA 2DZKA 2KJHB 3FLVA 3ZVRA 2KHWB 2WX0A 3IFWB 4CHJA 4L6EA 1BT0A 4TQ1A 4NJ6A 4NPNA 5BO4B 1E8YA 2LBBA 2ZNVC 4YL8A 2YF0A 2CKHB
chains in the Genus database with same CATH superfamily
3NZUA 1F2RC 2FAZA 1WX8A 1TXDA 2LZ6A 2BTEA 2BYTA 2DZIA 1QOAA 4HATB 3R2TA 3AEEB 2LOZA 4OZBA 5IN7A 2FIFA 3MHSD 2L52A 4GGQA 3M1IB 4F7HA 5JLJB 1MHHE 2ABDA 4Z2MB 5JZEB 3TO1A 4P1BC 3ZDTA 1NVLA 1NYQA 2VH1A 4G11A 3VRBB 5HE1A 3BJIA 1D5ZC 2KOXA 2JY6A 3MDBC 4L2YA 2ZCBA 2NVUI 3NVWA 2PKOA 1SIFA 3GP7A 4IWQA 4URKA 3O96A 3FC4A 1GB1A 2KJRA 3DBLB 2KK8A 3WALA 1DBHA 4ILHA 4A9AA 2IO2B 2AWTA 5AUIA 2BKRB 2D07B 2WXMA 2CU1A 5E6NA 1E0ZA 2Y5BB 1C76A 2W54A 3EFCA 4MJSA 1VBHA 2D9XA 3RNAC 1CJEA 3AE9B 3VH3B 3TEYA 1WXVA 5M4YB 3LB8C 4BBKA 3BVMA 3SHQA 3PO0A 2G4SA 4RGOS 3DHHC 1FB8A 1PQSA 1MK7B 4P6VF 4W9KA 3ZO5B 2MJ3A 2QEJC 2MBQA 1BAKA 4M0WB 2PEAA 5E6PA 1BXTA 4JWSC 2K3UA 3HHMA 2KT7A 1U4AA 4WJQA 2JUOA 4FADA 2KR0A 2G9HD 2KYWA 3ZTCA 1V5PA 4P16A 2JQRB 1RFAA 3ZGZA 4HLEA 2YS1A 3DBRI 4MEMA 1JROA 3RYTA 2WP9B 1J7AA 3ETRA 4LNOA 3CWIA 2W3RA 4R3DA 2WXRA 1WY8A 2HTHB 1TS5A 1NYRA 5IAAC 2R09A 1U29A 2KQSA 2JXXA 1WGRA 2ZPNA 3AEDB 4GNKB 1FIQA 5I4DA 4ASWC 1ZKHA 4G0NB 3JSVB 2CB8A 1L6UA 1VR9A 4DHJB 2N9KA 2KZRA 1ROEA 3N32A 1JWBD 2KKCA 3CSFA 3WAMA 1SJHD 4XGAB 1WJMA 2M8SA 2BT6A 1FHXA 4REZA 2BS4B 4E74A 5KQ1A 4OVVA 4EZJA 2JRHA 1Q10A 1J19A 1UUPA 5D3YA 4HVBA 3WYFB 3FAHA 2JP2A 1KBLA 2MBBB 1SE2A 2K8BA 3VUXA 3UINB 1ZC4B 4XWWA 2QKMA 4LJOB 2MCNB 5I2SA 2MEKA 5C1ZA 2Z13A 2INNE 4II3B 2J0KA 4BKSD 1V97A 1I4RA 3PG7A 5D7GA 3E66A 2P0DA 2MFQA 3Q3FA 3KYCD 3PHWB 4HJGE 2R0DA 4IKGA 3HVDA 2W2XD 4M8NA 2KO3A 4IWPA 5D3IB 2ZJDA 1TJEA 2DX5B 1T0RC 3ZJUA 4MH0E 2WLBA 3N20C 2PPHA 1A5RA 4GMVA 1QZEA 3B9JA 3TSSA 1PUTA 2YEPF 1JWUD 2ZW1A 4M00A 1OFFA 2O6VD 4HKQA 4M8MA 3AN1A 2LD9A 1F1HA 4DWFA 1I4XA 3Q3NC 3PZ8A 1Y8RC 1LM8B 2V4LA 4BBNF 5G5GA 4WWMA 1ZUD2 4DHJD 2RLOA 5T8IA 4M02A 2VZKD 4MGYE 2D2QA 4B0MA 1HZ6A 1MI0A 3QBVB 3V6CB 4LTUA 2EKIA 2J0JA 2LVPA 1WMHB 2WH5A 3UQAA 1K8RB 1P9DU 2KNBA 2V0GA 1OQNA 1ISNA 2DX1A 3DHIC 1UWXA 1V9JA 2WDTB 1WM2A 1WIAA 3PZ7A 2KLCA 3AULA 1QT9A 2D3CA 1MVKA 3E9OA 2I1KA 2D9ZA 5IOIA 1LFDA 4CQNA 4NAMA 2WX1A 3PSEB 2Y5PA 4MM3A 1XLNA 1T77A 4KHBB 1IRSA 5G2NA 4KDIC 3BWUD 4F7ZA 2Z8LA 2K22A 4ZYSA 2G4DB 1R4MI 4LDTD 1WVHA 3AECB 3CIKA 2MLBA 4DBBA 2AQ2B 1FXIA 2NBWB 1L6VA 5J3TA 4WJNA 1XODA 1SXTA 1P1AA 4A6FB 1FEHA 2GBNA 4ZRIA 2GRIA 2KTFA 2IY1B 1ST7A 1N63A 1FMAD 1GB4A 4NAWA 1TZ1A 1WFYA 2Z0EB 2X8XX 2W2XC 5GXGB 1Q5WB 1DDVA 2RPVA 3P6AA 1NTIA 3N7CA 3W1SC 5C5BA 5EE3A 1U27A 4GDKB 1I4GA 1RWSA 2R82A 3EECA 4Q2JA 3DPDA 4OZCA 1YOVB 1UEFA 3I5JC 1T6BX 3V62A 3FSSA 5HG2A 2DYMA 3A1QB 4FLHA 1KI1B 3OWEB 2KFKB 4GMXB 2Q13A 3V61A 1XT9B 1VDVA 3VUYA 2HTHA 3MC9A 5LONB 5EE9A 2DNFA 1SHCA 2WYQA 3KQ4A 3DXEA 4NJ6A 1E5WA 4L23A 2IGDA 1XEEA 2DBYA 4C4VB 4ICUA 3PRZA 4JWUC 3TVVA 3L10B 2ONQA 2PVOD 1AQCA 1K5GB 3IXSA 3KYDD 2W2WA 1J8CA 5KQ4A 3JVZX 2DLBA 1TJ6A 1SGHA 4WQMA 4B6WA 1QKZA 3ABVB 1V2YA 2UVMA 4MSQB 4YSYB 5AZFA 1V5UA 4TMAB 3E56A 1HXYD 3RULA 1W1GA 1WX9A 1XCGA 4QAYA 1L5PA 4JE3B 2KIEA 1STEA 3DWGC 4MELA 3HW2B 2Z0OA 2M4NA 3ZKJC 2MKRA 4XE0A 2C9WB 1QQRA 1HQRD 2B76B 1HBKA 2JXTA 3BY4B 1I4QA 2JSVX 4BKGA 3DBHI 3Q3MC 1KH0A 4WJ7A 1X86A 1NENB 3ONSA 3Q8BA 5C79A 4KVGB 4RGMA 1TBEA 3FP5A 1KZ7A 3J9CA 2VRRB 3BYTB 1IPGA 2FJLA 5J3YA 5DI9B 1FO4A 1H8CA 4WURA 4QXAB 4P7IA 1UNQA 4GB9A 4D0NB 1DYQA 2Y5CA 5E6OA 2L1CA 2KWDA 3ZNID 2DKQA 5LG4B 2KMMA 2GBRA 3NY5A 2HRJA 1XR0B 2JZPA 3JSVA 3N3KB 4TUUA 1N60A 2CY5A 4US9A 1KRHA 2D9YA 2N0YA 4DHZB 2DN6A 1VBGA 4C0AA 1YQBA 2RRFA 5CHFA 3SV1A 4RGTA 5HI1A 3W5VB 2IBIB 3A58A 3QWZB 2GMIC 1K50A 1YX5B 1EUVB 4L1BA 4NAWB 1FD6A 3VR9B 3ZNGC 1X1FA 2WGSA 4I6NB 1C79A 2J59M 2IPKD 2WX0A 4TQ1A 4L6EA 2XNAC 4NPNA 3Q8AA 1E8YA 2IGGA 2LBBA 3AE3B 3X0WA 2YF0A 5JXVA 1OGWA 1YQ4B 4W9CA 2QHOA 5EE1A 1WGGA 2RNRB 4OVUA 2EJ8A 2MBEA 2OJRA 5FK9C 3SDLC 3DDCB 3DCGA 3A9JA 1EM7A 2DYOA 2GLSA 3ML9A 2L00B 3Q3JA 2K49A 1MIXA 1WF9A 3NG0A 4FN2A 3V6EB 2C7NB 1TKYA 4NQKE 3M3JA 1ET9A 4IOYX 4OSNA 3TL5A 4BOZB 2C7MB 2A5UA 3CSTA 2NS5A 4YWGG 4DBGA 5E6JA 2KJ6A 4E71A 2PE6B 5CTRC 2YT2A 4PYUA 4YT0B 3P2BA 1GC7A 1AWDA 2JYEA 4AQ7A 4A55A 2V1YA 2RPQA 2K6DB 4YTMB 4LK0M 2K2JA 3L13A 1I2HA 4C56C 1GNUA 4IDIA 3OAWA 5J17A 3R7RA 3DBRB 4ZOHC 4CO7A 2JZ3B 3VH4B 3T8MA 4BFRA 2QILA 3MPXA 1E7UA 5LXIB 1ZDVA 3VDZA 3QK0A 3RD2A 1HB8A 5C16A 2LGIA 4JPSA 4W9FA 2LOXA 1CMXB 1HTQA 1I4HA 3A4SC 2IFSA 3UIOB 1C9FA 5JHBA 1RFKA 4NQLB 2ON8A 2DHJA 4CSQA 1FFUA 2D5GA 2GOWA 1ZE3D 3WCQA 1D5XC 1ET6A 5KCVA 3L0WB 1JMLA 1WR1A 4ZRKA 4OW0A 1K53A 4LNNA 4FJZA 1WGUA 2CR5A 1FHWA 3VAWA 1FXTB 1N5XA 1OMWA 5HE2A 1UZXB 1YD8U 1RRPB 2N1WA 3ECIA 3GS2A 1FRDA 4JGHB 4ANWA 3AE4B 1FXAA 5DH9B 1L2NA 1L4ZB 2W82A 1V5MA 2RQ1A 3VUWA 2Y3AA 2V3SA 1V8CA 1WRIA 2AX5A 3PRPB 2FCSA 1WX7A 1UBQA 3NVZA 2BW2A 2BCJA 2K2UA 4N59A 2ZZPB 5DIFB 5L83A 2A4ZA 3Q8FA 3L4PA 2BPSA 4HROA 4HDOA 4QJ4B 4GSWA 1UNSA 3EPYA 1VZ7A 3APCA 3ZUNA 2VZKB 3T9LA 1OEYJ 1AW7A 4GLSC 2XQNM 3HM6X 5IRSA 4IC7B 3WIMA 4D6WA 3SEBA 2FCNA 2MHJA 4W9IA 3A8PA 4AJWA 1N62A 2COFA 2MBHA 3RCPA 1MHXA 2G35A 3UZTA 1GAQB 2LHEA 3B0AA 3DOWA 2RSGA 2CAYA 4TQ0A 4ITKA 3SBTA 4A3PA 2FCMA 2HTME 3FILB 4EOYA 1DOXA 2DIKA 2O6VB 2D10A 2AEHA 3VIAA 1RYJA 4IG7B 2IO1B 4M0WA 1R7SA 3IT4B 3DQVA 5AUKA 4W9GA 2LGSA 3VTWA 3H7PA 1TKEA 2LUEA 3B1LX 1SE9A 1M7EA 4OHJA 4S17A 2GUMA 3RI7C 3L17A 3SYXA 3PSCA 2WXOA 2ZEQA 4FJVB 3C19A 2LYDA 1V89A 1WE7A 2N23A 1P7EA 2CHWA 4KZ0A 2L2IA 1WR6E 1XD3B 3PVUA 5DPSA 1AN8A 4MJSB 1OQRA 1OTRB 2FUG1 1P3QU 4KIKA 1PDXA 2RDGA 3NWFA 2N9EB 3SFDB 3TW1A 1FFVA 1V5TA 1X11A 2ICIA 5D27A 2K25A 1ZSQA 1CK1A 2D4QA 4ANUA 3A9KB 2LG1A 3AV8A 2YS3A 4KIKB 5GMVA 3W1SA 3ALBA 2D3GA 2MBOA 2NMBA 3AE7B 3P4PB 3TEXA 4EEWA 3PS6A 1EVHA 2WXNA 2K6QA 3AJ4A 3G9WA 3RZWC 1ZGUB 1Y19B 1UNPA 2CODA 3AE8B 3GOEA 3DVGY 4PNKA 4WQOB 4O1NA 4DDGD 3VR8B 2INDC 3ZIMA 1GGOA 4HDQA 1NBFC 3I3TB 2FJUB 3KRXA 4XX5A 3PP2A 3OHMB 1T0SC 2I2YA 2MQJA 2NPTA 1GC6A 3ODXA 1UD7A 1WJNA 4F1SA 4L1RA 2JWUA 3GYPA 1T3QA 2L0FA 5L95C 4IM2A 2CU3A 1P7FA 4HAVB 4TKNA 2D9VA 3D8FA 2WXFA 3D8EA 1S3SG 4KSLC 4EE2A 3O65B 2BWFA 1FRRA 2J42A 2L8JA 4IOIE 2Y8FA 5JH5C 2INPE 4QJ3B 4B9KA 2LGXA 3Q8EA 2BYVE 4B0EA 4HJKA 3A9KA 3DHGC 2COAA 1YNTE 3H7SA 4KGSA 4ZRQA 3RCZA 1F9JA 1DOIA 4A90A 2DA0A 4C7YA 2N9XA 2MJEA 2GCLA 3LDZE 3AI5A 1E90A 1QF6A 4HRSA 4P1CC 3VQIA 1DOYA 1H4RA 2RSUA 3PLUA 2NR2A 5G55A 3ZNZB 3AMZA 2GBJA 3OJ4B 3HIEA 2LWPA 4LLGM 2WDQB 2IYBA 1ZPSA 4N6EB 1ZM0A 2DYBA 2WS3B 1CZPA 1JRUA 2VKIA 1KM7A 3Q2AC 5CLQB 2NTTA 2UYZB 3KY9A 1ZYIA 3AXCA 2BKFA 3ZYYX 5BMIA 4ARIA 1G6JA 1NTYA 1KOTA 3BVZA 5TSSA 2RMMA 1WJ6A 3LYYA 4UDUC 4JKCA 4BOSC 3DVNU 1P0RA 2AL3A 3ZLZA 4EFOA 2CHZA 4CHMA 2ZVNA 3DVNV 1AYFA 1QOGA 2K1FA 3BK1A 2LHDA 1KF6B 3AE6B 5G5HA 2KUQA 5C2TB 4XDDA 3FEHA 2IO3B 2QDFA 2YT0A 5H8YE 3HUIA 4YSZB 3RNFC 2JZZA 5MPOA 1PGXA 2AQ1B 1ZC3B 2P8VA 3X23A 3R7QA 2KCJA 3VTUA 1M94A 4WSFA 1UPRA 2H89B 2LJ5A 2QKLA 4AOFA 4A3OA 2KDMA 1U5FA 3AEAB 1ENFA 1SSNA 2N7EA 3DBLI 2KANA 4Z2NA 1WJ4A 2N7JA 3W5UB 2QCZA 2KGXB 2WWZA 1EU4A 1XCQL 1VCBA 1TGZB 2QSDA 3NVVA 3PVWA 3VHTC 1WYWB 1W1DA 3R3MA 2V4IB 1JRPA 3MP9A 3Q8CA 5JP4A 1IUEA 3TJPA 4BBNC 1EU3A 2PZ1A 3VTVA 2WNMA 1P6SA 3TFMA 4MK0A 2MA9B 2RGNB 2KDEB 3PGEA 2WU5B 4K1RB 3C0RB 2YLMA 3A9JB 4HAYB 1LXDA 3NZ3A 4EUTA 2LRUA 5LNK1 2KTRB 3P42A 4PS8A 3NHEB 1OY2A 1JWMD 4W9HA 1UELA 4RM8A 3QARA 1P5TA 3OLMD 3PLVA 3EA6A 1JWSD 1MJDA 2LASA 3Q14C 1QLBB 3RPFC 2FNJB 2P0FA 3ZVRA 4CHJA 3B08A 2ZNVC 2WDRB 1UGMA 3MC8A 4YSXB 1E10A 4HPLB 4TV3A 2JWZA 3MHZA 1E9MA 2R61A 1V1PB 3I57A 5HE0A 3IHPC 1WZ0A 3L08A 2PIAA 1WJ1A 2V76A 1PMSA 4XWTA 2K9XA 2GS0A 3TBLD 4EZLA 2N1VA 4IAPA 2XK5B 2DYNA 1WXMA 2N9PC 2MP2A 3BYYB 1FCCC 2KUPA 4JIOU 1PFJA 3EGRA 4K7UA 1HEZE 2JU6X 4WJOA 3RFZB 2KDIA 2PJHA 2WXJA 4ACFA 4HCNB 1PYWD 3N30A 1YN3A 1QQGA 3H1UA 2JT4B 3AEFB 3H6NA 4NNJB 3N9YC 2X38A 3IT6B 3KWLA 1TT5B 3BVGA 3H7PB 1V1OA 2KIGA 3Q69A 4ILJA 2MX2A 2V3PA 4IFSA 1C77A 2O6VA 4LDTB 3QWMA 3FILA 3ULCA 3MC0B 4H2AA 3P4RB 3VVWB 1UBIA 2KWUB 2XK5A 4C00A 4LNFA 2DZMA 2KXJA 1KFYB 2YSZA 1EF5A 1TYGB 5LOPB 3NJTA 3NS8A 4AP4C 1NEKB 1NI3A 2JPHA 2PW9A 4JK7A 3MJ5A 3NWAA 4K2PA 3URYA 1GOZA 2J53A 2M0AA 3EHVA 4RM9A 2UZRA 1X1MA 1UWMA 3Q6BA 2ROVA 4K7WA 3TEWA 5D3XA 3DVGX 1OQYA 4RCOA 2OTXA 1TQZA 2NTSA 3QJZA 2Z0QA 4BKSA 3FKYA 2GI9A 2SEBD 2K8EA 2BS2B 2X0SA 3L16A 2OJWA 3E9PA 4AWJA 4DXAB 5BMHA 2W3SA 4ZRJA 1MKEA 5DCNA 3NRZA 4HWIB 5IO9A 5AZGA 3AU4A 2BQQA 2L7RA 4IWOA 4N9F4 2X18A 2IO0B 1J7CA 3SU8X 1WH3A 2SAKA 3ZXVA 4DXGA 4DHZE 1V61A 2ADZA 2IDYA 3E9SA 1FHOA 3AE5B 4KV2A 4KKIA 2ZW0A 4G3XB 1SE3A 2LRWA 3KRWA 2COCA 2RUKB 3KSYA 4IW0A 3PV1A 1GPXA 3O13A 3I63C 4X57B 4ZHOA 2QMTA 1YMHE 3R8BA 1YX6B 2MH7A 5JVLA 1WRDB 1ZP0B 3WA0A 4B6HA 1UH6A 2UWQA 4TSSA 5D2MB 4DX8A 2IJ0A 4RNAA 2DKPA 1I42A 2XN9C 3NWDA 3U52E 2R2YA 1C78A 5FKAC 3S2AA 1WJUA 4IM3A 1FOEA 3PREA 1YIWA 1N5WA 4TYZA 3KVFB 2RGFA 4EJNA 2NCNA 2ZNVB 1NI2A 2GCJA 3KUZA 5BYRA 1WGQA 4NSWA 4MGZE 3QHTA 4XWXA 3OG5A 2M38A 2WQYB 2BS3B 4BVUC 2YRYA 2HDEA 4KX6B 4JKHA 1WZ3A 4II2B 2Z0PA 2I5FA 1DDWA 2J0MA 2BWES 3ZJVA 3A8QA 3RMKC 2RVBB 3IBEA 1T0YA 2MJDA 1QOFA 2D11A 2L3ZA 1DGJA 1L0VB 3P1MA 1J0WA 4KDLB 2NBUA 1WM3A 2O2VA 2QIEB 1Q1OA 1SB3C 1X05A 4FHKA 1WXAA 4ZRPA 4K3CA 4MT5A 4MT7A 1L0YB 2FJ9A 3CXBB 1LGRA 4WAAA 3U30A 3W1YA 3KH0A 5IJMA 2KAJA 1IYFA 1BMLC 2N4FA 3ZJTA 1MG4A 2CRFA 3PHXB 3SUZA 1CQVA 3T3OA 4FXCA 2LKOA 3DBHB 1WGYA 2ELBA 5BYSA 2J4XA 3IAM1 2KDFB 4JLCA 2REXA 4F8CB 4HK2A 3DBSA 4HPPA 5IA7A 3U7DA 2NZ8B 1JW9D 1D6EC 4E3CA 1LO5D 1L7YA 2WXIA 4CYEA 1SF0A 3NVYA 3B2GA 4PK1A 2KD0A 1LQBA 1BTNA 1WE6A 3AEBB 2ZPYA 4HB2B 1V6EA 1R4NB 3ZRFA 3AE1B 1YQ3B 4FBJB 3APFA 1KC7A 1PLSA 3KUDB 1MI1A 1EGXA 4RFBA 1EAZA 3UI3A 4USAA 2RDBC 4DIXA 2VSZA 2WXHA 4ZHPA 3RUIB 3PPAA 3MJWA 5C3JB 1ZDXA 1UGJA 3GYOA 3DXCA 1D5MC 4EMOA 2K00A 2P0HA 2DTCA 1V81A 4GXBA 3I9V1 1ZVRA 3RNEC 5BYQA 3VRAB 1C4PA 3KUCB 4Y94A 2Q5WD 1YN4A 5L81A 4JL9A 4GDLB 4A6KA 4WWPA 3HSAA 2K39A 3KZ1A 2LGYA 1KLUD 3IG3A 5HFYA 1ACCA 3R66C 5DPTA 2COPA 2KC1A 3T3NA 1RJ2A 4GZUA 3ZDMC 1TTNA 1F0ZA 2ASQA 2WXQA 4YONA 3NUHB 4WWOA 1K51A 1PGAA 5EE0A 1WI0A 5AZHA 1WYGA 2FBWB 1E6EB 2W9NA 4FJYA 2CS4A 3ULBA 2N7DA 2MDXA 2ZCCA 3M95A 1FM0D 1FAOA 3QCAA 3W2DA 1IBXB 3PEGA 3K9OB 1V1PA 2AL6A 2WHIA 1NTVA 1V86A 2ACZB 1P98A 1IP9A 1VZ8A 3MTNB 1XLOA 4PS7A 4S0RA 3U2SC 4YXDB 4KGRA 3HQCA 4HCPB 3A98B 2XEWA 2IYDB 1K52A 4XC2A 2MP2B 3W9CB 2E3TA 2DHIA 4C4VA 1Q0WB 5J3QA 2MWNB 3B77A 2E6XA 5FI0A 2K0PA 3F0WA 3K9PB 3BINA 4KHBA 5KHOA 4LNIA 2JVCA 2J7QB 4HPMB 4DX90 1HA5A 2ELAA 2M19A 5DPWA 5LLIA 3BIID 5DPRA 4WVFB 3CMMB 2GJYA 1J7BA 1I4PA 3QX1A 2LI5A 4F7GA 2KDBA 3APDA 4G50A 3HIZA 2TSSA 2KWVB 3ML8A 2LMCA 3AE2B 4KHAA 1Z5SB 4KAXB 2N0SB 2HE7A 5I2MA 1Q67A 2BBCA 2ZVOA 5C5BB 1C1YB 1DYNA 3V5WA 1MG8A 4JKEA 1PGBA 2EELA 2BYEA 4ANVA 1B55A 1M4VA 1TS2A 2DAJA 2XBBC 3FVCA 3RNBC 3PZDA 1X1GA 4HHVA 4DK5A 4RF1A 5FI1A 3ZRCA 3PTFC 2CJOA 3SNHA 3GZNB 4A6HA 5J2RA 1C4CA 2G45B 3TCAA 1IGDA 4C7ZA 4US8A 1D4BA 5HKHA 2I1JA 1MPHA 1JCKB 1LB1A 2LJIA 2DX5A 2JX5A 4GOCA 1ZW7A 5AEKB 4J6IA 3V3XA 4JKFA 2VRWB 5CX3A 4W9DA 2K8HA 2GBMA 1EWCA 1HTOA 1VZ6A 2CY4A 3GE8C 4K81A 2RDHA 4ANXA 2B3AA 4ILGB 2DZKA 3FLVA 5BO4B 1BT0A 2PTLA 2DWQA 1KTKA 4YL8A 4JKGA 2CKHB 4OZAA 3R2IA 1Y56A 1XXGA 3WANA 5TR5A 2WXGA 2L0TA 2KN4A 2QC8A 2MWSB 2NPTB 1YJJA 2YVCA 1RAXA 3OJ3A 3SD5A 4HKZE 2KQ7A 2G3QB 4DXFA 5HE3A 1A70A 3N1ZC 2E2XA 1XX0A 3T06A 1RRBA 4GN1A 5LXHA 1WXSA 2IZVB 1TY2A 1BTKA 3L54A 4K7SA 1FCLA 4JK9A 1OEYA 1C4AA 4AUQC 4PQ0A 2DFKA 1XQQA 2BB5A 3QQ8B 1EWYC 2KMAA 3FM8C 2Y7BA 2M56B 2EC1A 1RM6C 1FGZA 1JWAD 1MPEA 2OOBB 3P7ZA 2HD5B 4LJPB 4JKDA 2FCQA 3M62B 2GBKA 2KX3A 1K5DB 2LUMA 3H9DA 3LJUX 4JKBA 2KX0A 4I6PA 5IKCM 2LXAA 3KW5B 4KHOA 3A1QA 3ZXRA 1OQQA 3SR6A 5C6RA 4YTNB 1VD2A 2BVCA 4JK8A 3ZTDA 4EZKA 1J0GA 2BYFA 1UPQA 2FUHB 1Z87A 2Z59A 5C23A 1ZXHA 1F2RI 4GDKA 1XF5L 4FULA 1N61A 3UGBB 4BKTA 1U5DA 2NMQA 2OHFA 4JX1C 4I6LB 3SFEB 5CLLB 1HE8A 3GE3C 3HVZA 3HK0A 2RR9A 4W9EA 3WAOA 2L76A 3IVFA 3C8YA 2EKEC 1TS3A 2EMSA 3DWMA 2H7DA 3ODWA 3NZSA 4HEA1 3RN9C 2N9LA 4NZLB 1XD4A 2DAFA 3GZNI 4W9LA 1XKEA 2DLWA 1WXQA 1U5EA 1F52A 1ACAA 2R2QA 1P3RA 2KTRA 4IUMB 3AH7A 3QC8B 1V5OA 4OVZA 4AS1A 2LFIA 2R2OA 1NVID 3ZQ4A 4XYCA 3E9LA 1M7RA 1FGYA 3U4EG 5D3DA 1KLVA 1PFDA 1E8XA 2V3NA 1DIKA 3ZNHB 1NU2A 5CHWA 1MFWA 4HB3B 1FNVA 5JHGA 2INCC 4HAUB 1L0XB 4FA6A 3N1XC 3Q3OC 2KQ4X 1WWTA 5J18A 1ESFA 2KVZA 2DHZA 5EFXA 3F5RA 2IGHA 4MSMB 1SIJA 3KWVA 2BGFA 1JDEA 1YJ1A 3TUOA 4EKUA 3NOBA 1MK9B 1XCTL 4WAFA 5BMGA 2WDVB 3EUB2 4KSKC 3TEZA 2Z59B 3BK2A 2C60A 1E8ZA 1TY0A 3U8ZA 1WGKA 1WGHA 2LVQA 4NJ7A 1R4MB 3ENEA 3RZFA 1R4NI 4BZAA 3RT3B 3CIRB 1S1QB 4HAWB 2PE9A 1E7PB 3A33B 2RD0A 2LEKA 3PVLA 4A5KA 1IGCA 4MACA 1ZOYB 4ARCA 4LNKA 1V80A 1I35A 1GJZA 1GG3A 1AWEA 3QA8A 2DHKA 2OQBA 2J52A 2KACA 1VRAB 2LULA 4XDCA 4NJCA 4HAZB 5FR3A 2L83A 5D3WA 2KN5A 2MW5A 4IM0A 5KHQA 1V88A 2L05A 1VLBA 3H8HA 1WG7A 3NW8A 4OT1A 4D2KA 5CHVC 1KZGA 3JYUA 2PMVA 3PT2B 2JRIB 1GUAB 3AB5A 1L4DB 2D3AA 1IBXA 2GB1A 3IAS1 3DXDA 3B2FA 3P63A 4RH6A 2CJNA 4PS3A 1Y5OA 5JHHA 3DCXA 3TMPB 4FHJA 1NDDA 3SBGA 2WXLA 2KVRA 3MFGA 2MRPA 5JHAA 3BZDB 1BUIC 2KLGA 2NBVB 4NY0A 3UF8A 2AQ3B 4KKJA 1I7AA 1E8WA 2JF5A 3UIPB 4MGKE 5FR6A 4GIVA 1FNWA 5HHDG 3ZW3A 3N1YC 1JALA 4DQOC 3HM3A 1FPYA 2PVGC 5IP4D 1TKGA 5DHAB 3CF6E 3ENBA 1QC6A 3SO6A 1KJTA 5D3VA 1AARA 2DZJA 4B95A 2HJ1A 1YN5A 4N58A 1N6ZA 4GU2A 4H8SA 1XLPA 2KMCA 2KFJA 2FE8A 3NS1A 2M0XA 4AJYB 1T0QC 5H92C 4RMAA 1T5XD 3WAPA 3VFKA 4PT5A 4KZCA 2G1EA 3VOQA 1DDMA 2LGDA 4JKAA 1WI1A 3AM9A 2MSED 3QIJA 1E7VA 3M63B 3AU5A 1SBBB 2DENB 2D9WA 2UU7A 1ZXIA 1HZ5A 4A6QA 2OEDA 4QJ5B 2NBVA 1XLQA 1D3ZA 2H7EA 2YS5A 4JQWC 1V49A 1H10A 2BB6A 3UQBA 1SE4A 2FDQA 4HB4B 4HXDA 4RF0A 1QOBA 1MIZB 4ZYNA 3D8DA 1YJIA 4HAXB 1RLFA 4K3BA 5EDSA 4ZDVA 2BF8B 1FNUA 2O2VB 3LJ3A 3AEGB 1SJED 4W9JA 5D94A 2ROZB 2LXCA 4C80A 2IY0B 2KC2A 3A4RA 4LCDE 1TIFA 3JW0X 4MH8A 2WXPA 4JKGB 3QAQA 4MGIE 2HJ8A 1B9RA 2PLPA 2L32A 2V9HA 1WSPA 1VJKA 1WGDA 2AYOB 1UNRA 2WXKA 2DYQA 3P4SB 4CHKA 4KGTA 3PRMB 3U12A 1MAIA 3D32A 2FIDA 1JQ4A 1XO3A 3ZVVA 4ICVA 2M1MA 4RGNA 1BWNA 3HRDD 3U7ZA 1F77A 4YTPB 1TS4A 2CQUA 3V60A 2Z4DA 2Z0DB 3V05A 3EFUA 2M17A 4GPTB 2QJLA 2I5CA 4A20A 1SEBD 4K17A 2LVOA 1KLGD 2K8CA 1EF1A 4K2OA 2H88B 4A8XC 4M01A 4DDID 2YEPB 1LW3A 4MY6A 4F7UP 3P4QB 4BAXA 4GDLA 5D6JB 1DROA 2C7HA 3VXWA 1WMHA 2I38A 5DHFB 3OANA 2EMTA 2C5LC 1Z2MA 4WWNA 1UF0A 1I7HA 1U2BA 2VH2A 4J3OD 5GOWB 2Y8GA 2KFKA 2WU2B 4A6FA 3TIXA 1U5GA 3RNGC 3RNCC 1B1ZA 1N3HA 4WIPA 4HB0B 2K5PA 2L1AA 1W1HA 2M14A 2YT1A 4GOUA 2KWCA 3ML4A 1EO6A 4WH4A 2Z14A 1QILA 3GB1A 3EC8A 4MM3B 3LXFA 4XZ4A 1C3TA 2UZSA 1HB6A 3NSUA 4PYZA 2JYTA 3KLSX 2D3BA 2CHXA 3ODOA 4HSIA 4MDKE 1TZOA 4WJPA 2KJHB 3IFWB 2KHWB 2W55A 2ZKMX
chains in the Genus database with same CATH topology
3NZUA 2FAZA 1WX8A 1TXDA 2LZ6A 2DZIA 4HATB 2LOZA 2FIFA 3MHSD 4GGQA 3M1IB 4F7HA 5JLJB 2ABDA 4Z2MB 5JZEB 3TO1A 3ZDTA 1NVLA 4G11A 5HE1A 3BJIA 2KOXA 2JY6A 3MDBC 2ZCBA 2NVUI 4IWQA 1SIFA 4URKA 3O96A 2KJRA 2KK8A 3WALA 1DBHA 4ILHA 2IO2B 2AWTA 2BKRB 2D07B 2CU1A 5E6NA 2Y5BB 4MJSA 1VBHA 2D9XA 3VH3B 1WXVA 4BBKA 3SHQA 2G4SA 1FB8A 1PQSA 1MK7B 4W9KA 3ZO5B 2MBQA 1BAKA 4M0WB 2PEAA 5E6PA 3HHMA 1U4AA 4WJQA 2JUOA 4FADA 3ZTCA 1V5PA 1RFAA 4HLEA 2YS1A 3DBRI 4MEMA 3RYTA 1WY8A 2HTHB 5IAAC 2R09A 1U29A 2KQSA 2JXXA 1WGRA 2ZPNA 4ASWC 1ZKHA 4G0NB 3JSVB 2CB8A 4DHJB 2KZRA 3N32A 2KKCA 3CSFA 3WAMA 1WJMA 2M8SA 1FHXA 4E74A 5KQ1A 4OVVA 4EZJA 2JRHA 1J19A 5D3YA 4HVBA 3WYFB 2JP2A 1KBLA 2MBBB 3VUXA 2K8BA 3UINB 1ZC4B 2QKMA 4LJOB 2MCNB 5C1ZA 4BKSD 4II3B 2J0KA 3PG7A 5D7GA 3E66A 2P0DA 2MFQA 3Q3FA 3KYCD 3PHWB 2R0DA 2W2XD 4M8NA 2KO3A 4IWPA 2ZJDA 2DX5B 4MH0E 2PPHA 1A5RA 4GMVA 1QZEA 2O6VD 4M8MA 2LD9A 4DWFA 1Y8RC 1LM8B 2V4LA 4BBNF 4DHJD 2RLOA 4MGYE 2D2QA 3QBVB 3V6CB 2J0JA 2LVPA 1WMHB 2WH5A 3UQAA 1K8RB 1P9DU 2KNBA 1OQNA 1ISNA 2DX1A 1V9JA 2WDTB 1WM2A 1WIAA 2KLCA 3AULA 3E9OA 2I1KA 2D9ZA 1LFDA 2WX1A 3PSEB 4MM3A 4KHBB 1IRSA 5G2NA 4KDIC 4F7ZA 2G4DB 1R4MI 4LDTD 1WVHA 3CIKA 2MLBA 4DBBA 2NBWB 5J3TA 4WJNA 1XODA 1P1AA 4A6FB 2GBNA 4ZRIA 2KTFA 2IY1B 1ST7A 4NAWA 1TZ1A 2Z0EB 1WFYA 2W2XC 1Q5WB 1DDVA 3P6AA 1NTIA 3N7CA 3W1SC 5C5BA 1U27A 4GDKB 2R82A 3EECA 3DPDA 1UEFA 3V62A 3FSSA 2DYMA 3A1QB 4FLHA 1KI1B 2KFKB 4GMXB 2Q13A 3V61A 1XT9B 3VUYA 2HTHA 5LONB 1SHCA 2WYQA 3DXEA 4NJ6A 1E5WA 4ICUA 3PRZA 3TVVA 3L10B 1AQCA 1K5GB 3KYDD 2W2WA 1J8CA 5KQ4A 3JVZX 1TJ6A 1SGHA 4B6WA 1V2YA 2UVMA 4MSQB 5AZFA 1V5UA 3RULA 1W1GA 1WX9A 1XCGA 4MELA 3HW2B 2Z0OA 2M4NA 3ZKJC 2MKRA 2C9WB 1HBKA 3BY4B 4BKGA 3DBHI 4WJ7A 1X86A 3ONSA 5C79A 4KVGB 1TBEA 3FP5A 1KZ7A 2VRRB 1IPGA 2FJLA 5J3YA 5DI9B 1H8CA 4P7IA 1UNQA 4GB9A 4D0NB 5E6OA 2L1CA 3ZNID 2DKQA 3NY5A 2GBRA 2HRJA 1XR0B 3JSVA 3N3KB 4TUUA 2CY5A 2D9YA 2N0YA 4DHZB 2DN6A 1VBGA 4C0AA 1YQBA 5CHFA 3SV1A 2IBIB 3QWZB 2GMIC 1YX5B 1EUVB 4NAWB 3ZNGC 1X1FA 4I6NB 2J59M 2WX0A 4TQ1A 4L6EA 4NPNA 1E8YA 3X0WA 2LBBA 2YF0A 1OGWA 4W9CA 2QHOA 1WGGA 2RNRB 4OVUA 2EJ8A 2MBEA 2OJRA 3SDLC 3DDCB 3DCGA 3A9JA 2DYOA 3ML9A 2L00B 3Q3JA 1MIXA 1WF9A 3V6EB 4FN2A 2C7NB 4NQKE 3M3JA 4IOYX 3TL5A 4BOZB 2C7MB 2A5UA 3CSTA 2NS5A 4DBGA 2KJ6A 4E71A 2PE6B 5CTRC 4PYUA 3P2BA 1GC7A 2V1YA 2RPQA 2K6DB 2K2JA 3L13A 1I2HA 1GNUA 3OAWA 5J17A 3R7RA 4CO7A 2JZ3B 3VH4B 3T8MA 4BFRA 3MPXA 1E7UA 5LXIB 3VDZA 3QK0A 3RD2A 1HB8A 5C16A 4W9FA 2LOXA 1CMXB 3A4SC 2IFSA 3UIOB 5JHBA 4NQLB 2DHJA 2GOWA 5KCVA 3L0WB 1WR1A 4ZRKA 4FJZA 1WGUA 2CR5A 1FHWA 3VAWA 1FXTB 1OMWA 5HE2A 1UZXB 1YD8U 1RRPB 2N1WA 3ECIA 4JGHB 4ANWA 5DH9B 1L2NA 1V5MA 2RQ1A 3VUWA 2V3SA 3PRPB 2FCSA 1WX7A 1UBQA 2BCJA 2K2UA 2ZZPB 5DIFB 5L83A 2A4ZA 2BPSA 4HDOA 4GSWA 3EPYA 3APCA 3ZUNA 3T9LA 1OEYJ 2XQNM 3HM6X 4IC7B 3WIMA 2FCNA 4W9IA 3A8PA 4AJWA 2COFA 2MBHA 3RCPA 2G35A 3UZTA 3B0AA 3DOWA 2RSGA 2CAYA 4TQ0A 3SBTA 4A3PA 2FCMA 4EOYA 2DIKA 2O6VB 2D10A 2AEHA 3VIAA 4IG7B 2IO1B 3DQVA 4W9GA 3VTWA 3H7PA 2LUEA 3B1LX 1SE9A 1M7EA 3L17A 3SYXA 3PSCA 2ZEQA 4FJVB 2LYDA 1V89A 1WE7A 2N23A 2CHWA 4KZ0A 2L2IA 1WR6E 1XD3B 3PVUA 5DPSA 4MJSB 1OTRB 1P3QU 4KIKA 2N9EB 3TW1A 1V5TA 1X11A 5D27A 2K25A 1ZSQA 2D4QA 4ANUA 3A9KB 2LG1A 4KIKB 2YS3A 3W1SA 5GMVA 3ALBA 2D3GA 2MBOA 2NMBA 4EEWA 3PS6A 1EVHA 2K6QA 3AJ4A 3G9WA 3RZWC 1ZGUB 1Y19B 1UNPA 2CODA 3GOEA 3DVGY 4PNKA 4WQOB 4DDGD 3ZIMA 1GGOA 4HDQA 1NBFC 3I3TB 3KRXA 4XX5A 3PP2A 2MQJA 2NPTA 1GC6A 3ODXA 1UD7A 1WJNA 4F1SA 3GYPA 2L0FA 5L95C 4IM2A 4HAVB 4TKNA 2D9VA 3D8FA 3D8EA 1S3SG 4KSLC 3O65B 2BWFA 2L8JA 2Y8FA 5JH5C 4B9KA 2LGXA 2BYVE 4HJKA 3A9KA 2COAA 3H7SA 3RCZA 1F9JA 2DA0A 2N9XA 2GCLA 3LDZE 3AI5A 1E90A 3VQIA 1H4RA 2RSUA 3PLUA 2NR2A 5G55A 3ZNZB 2GBJA 3OJ4B 2LWPA 2IYBA 1ZM0A 2DYBA 1JRUA 2VKIA 1KM7A 5CLQB 2UYZB 3KY9A 3AXCA 2BKFA 1KOTA 1G6JA 1NTYA 1WJ6A 4JKCA 4BOSC 3DVNU 1P0RA 2AL3A 3ZLZA 4EFOA 2CHZA 4CHMA 2ZVNA 3DVNV 2K1FA 3FEHA 2IO3B 2YT0A 2JZZA 1ZC3B 2P8VA 3X23A 3R7QA 2KCJA 3VTUA 1M94A 4WSFA 1UPRA 2LJ5A 2QKLA 4AOFA 4A3OA 1U5FA 2N7EA 3DBLI 2KANA 4Z2NA 1WJ4A 2KGXB 2WWZA 1VCBA 1TGZB 3VHTC 3PVWA 1WYWB 1W1DA 3R3MA 5JP4A 3TJPA 4BBNC 2PZ1A 3VTVA 1P6SA 3TFMA 4MK0A 2MA9B 2RGNB 2KDEB 3PGEA 4K1RB 3C0RB 2YLMA 3A9JB 4HAYB 1LXDA 4EUTA 2LRUA 2KTRB 4PS8A 3NHEB 1OY2A 4W9HA 1UELA 4RM8A 3QARA 1P5TA 3OLMD 3PLVA 2LASA 2FNJB 2P0FA 3ZVRA 4CHJA 3B08A 2ZNVC 1UGMA 4HPLB 4TV3A 2JWZA 5HE0A 3IHPC 1WZ0A 3L08A 1WJ1A 2V76A 1PMSA 2GS0A 3TBLD 4EZLA 2N1VA 4IAPA 2XK5B 2DYNA 1WXMA 2N9PC 2MP2A 2KUPA 4JIOU 1PFJA 4K7UA 4WJOA 2KDIA 2PJHA 4HCNB 3N30A 1QQGA 3H1UA 2JT4B 3H6NA 4NNJB 3H7PB 4ILJA 2MX2A 4IFSA 2O6VA 4LDTB 3QWMA 3ULCA 3VVWB 1UBIA 2KWUB 2XK5A 2DZMA 2KXJA 2YSZA 1EF5A 5LOPB 3NS8A 4AP4C 2JPHA 4JK7A 4K2PA 4RM9A 3EHVA 2UZRA 1X1MA 2ROVA 4K7WA 5D3XA 3DVGX 1OQYA 2OTXA 1TQZA 3QJZA 2Z0QA 4BKSA 3L16A 2X0SA 3E9PA 4AWJA 4DXAB 4ZRJA 1MKEA 5DCNA 4HWIB 5AZGA 3AU4A 2L7RA 4IWOA 4N9F4 2X18A 2IO0B 3SU8X 1WH3A 4DHZE 1V61A 2ADZA 1FHOA 4KV2A 4G3XB 2LRWA 3KRWA 2COCA 2RUKB 3KSYA 4IW0A 3PV1A 4X57B 1YX6B 5JVLA 1WRDB 3WA0A 4B6HA 1UH6A 2UWQA 5D2MB 4DX8A 2DKPA 1I42A 3S2AA 1WJUA 4IM3A 1FOEA 3PREA 1YIWA 4TYZA 3KVFB 2RGFA 4EJNA 2NCNA 2ZNVB 1NI2A 2GCJA 3KUZA 1WGQA 4NSWA 4MGZE 3QHTA 4XWXA 2M38A 4BVUC 2YRYA 4JKHA 1WZ3A 4II2B 2Z0PA 2I5FA 1DDWA 2J0MA 2BWES 3A8QA 2RVBB 3IBEA 1T0YA 2D11A 2L3ZA 1J0WA 4KDLB 2NBUA 1WM3A 2O2VA 1Q1OA 1X05A 4FHKA 1WXAA 4MT7A 3W1YA 2FJ9A 3CXBB 4WAAA 3U30A 3KH0A 5IJMA 1IYFA 2N4FA 2CRFA 3PHXB 3SUZA 2LKOA 1WGYA 2ELBA 2KDFB 4JLCA 4F8CB 2REXA 4HK2A 3DBSA 5IA7A 3U7DA 2NZ8B 4E3CA 1L7YA 4CYEA 2KD0A 1LQBA 1BTNA 1WE6A 2ZPYA 4HB2B 1V6EA 3ZRFA 4FBJB 3APFA 1KC7A 1PLSA 3KUDB 1EGXA 1EAZA 2VSZA 3RUIB 3PPAA 3MJWA 3GYOA 3DXCA 4EMOA 2K00A 2P0HA 2DTCA 1V81A 4GXBA 1ZVRA 3KUCB 4Y94A 5L81A 4JL9A 4GDLB 4A6KA 4WWPA 2K39A 3KZ1A 2LGYA 3IG3A 3R66C 5DPTA 2COPA 2KC1A 1RJ2A 4GZUA 3ZDMC 1TTNA 2ASQA 4YONA 4WWOA 1WI0A 5AZHA 2W9NA 4FJYA 2CS4A 3ULBA 2N7DA 3M95A 2MDXA 2ZCCA 1FAOA 3QCAA 3PEGA 3K9OB 2AL6A 1NTVA 1V86A 1P98A 1IP9A 3MTNB 4PS7A 3HQCA 4HCPB 3A98B 2XEWA 2IYDB 4XC2A 2MP2B 2DHIA 1Q0WB 5J3QA 2MWNB 5FI0A 3F0WA 3K9PB 3BINA 5KHOA 2JVCA 2J7QB 4HPMB 4DX90 2ELAA 5DPWA 5LLIA 5DPRA 4WVFB 3CMMB 2GJYA 3QX1A 2LI5A 4F7GA 2KDBA 3APDA 4G50A 3HIZA 3ML8A 2KWVB 4KHAA 1Z5SB 4KAXB 2HE7A 1Q67A 2ZVOA 5C5BB 1C1YB 1DYNA 3V5WA 1MG8A 4JKEA 2BYEA 4ANVA 1B55A 2DAJA 2XBBC 3PZDA 1X1GA 4HHVA 4DK5A 5FI1A 3ZRCA 3PTFC 3SNHA 4A6HA 5J2RA 2G45B 3TCAA 5HKHA 2I1JA 1MPHA 1LB1A 2DX5A 4GOCA 1ZW7A 5AEKB 4J6IA 4JKFA 2VRWB 5CX3A 4W9DA 2K8HA 2GBMA 2CY4A 4K81A 4ANXA 2B3AA 4ILGB 2DZKA 3FLVA 5BO4B 1BT0A 4YL8A 4JKGA 2CKHB 3WANA 5TR5A 2L0TA 2MWSB 2NPTB 2YVCA 1RAXA 3OJ3A 3SD5A 2KQ7A 2G3QB 5HE3A 2E2XA 1XX0A 3T06A 1RRBA 4GN1A 5LXHA 1WXSA 2IZVB 1BTKA 3L54A 4K7SA 4JK9A 1OEYA 4AUQC 4PQ0A 2DFKA 1XQQA 3QQ8B 2KMAA 3FM8C 2Y7BA 2EC1A 1FGZA 2OOBB 3P7ZA 2HD5B 4LJPB 4JKDA 2FCQA 3M62B 2GBKA 2KX3A 1K5DB 3H9DA 3LJUX 4JKBA 2KX0A 4I6PA 2LXAA 3KW5B 4KHOA 3A1QA 5C6RA 1VD2A 4JK8A 3ZTDA 4EZKA 1J0GA 2BYFA 1UPQA 2FUHB 1Z87A 5C23A 4GDKA 4FULA 3UGBB 4BKTA 1U5DA 4I6LB 5CLLB 1HE8A 3HK0A 2RR9A 4W9EA 3WAOA 2L76A 3IVFA 2EKEC 2EMSA 2H7DA 3ODWA 3NZSA 1XD4A 2DAFA 3GZNI 4W9LA 1XKEA 2DLWA 1U5EA 1ACAA 2R2QA 1P3RA 2KTRA 4IUMB 3QC8B 1V5OA 2R2OA 3E9LA 1M7RA 1FGYA 1KLVA 1E8XA 1DIKA 3ZNHB 1NU2A 5CHWA 4HB3B 5JHGA 4HAUB 4FA6A 5J18A 2DHZA 5EFXA 3F5RA 4MSMB 2BGFA 1JDEA 1YJ1A 4EKUA 3NOBA 1MK9B 4KSKC 2Z59B 2C60A 1E8ZA 3U8ZA 1WGHA 2LVQA 4NJ7A 3ENEA 3RZFA 1R4NI 3RT3B 1S1QB 4HAWB 2PE9A 3A33B 2RD0A 3PVLA 4A5KA 1V80A 1I35A 1GJZA 1GG3A 1AWEA 3QA8A 2DHKA 2OQBA 2LULA 4HAZB 5D3WA 2KN5A 2MW5A 4IM0A 5KHQA 1V88A 2L05A 1WG7A 5CHVC 1KZGA 3JYUA 3PT2B 2JRIB 1GUAB 3DXDA 4PS3A 1Y5OA 5JHHA 3TMPB 4FHJA 1NDDA 3SBGA 2KVRA 2MRPA 5JHAA 2KLGA 2NBVB 4NY0A 3UF8A 1I7AA 1E8WA 2JF5A 3UIPB 4MGKE 5FR6A 4GIVA 3ZW3A 3HM3A 3CF6E 5DHAB 3ENBA 1QC6A 3SO6A 1KJTA 5D3VA 1AARA 2DZJA 4B95A 4GU2A 4H8SA 2KMCA 2KFJA 2M0XA 4AJYB 3WAPA 4RMAA 3VFKA 4KZCA 3VOQA 1DDMA 2LGDA 4JKAA 1WI1A 2MSED 3QIJA 1E7VA 3M63B 3AU5A 2DENB 2D9WA 1D3ZA 2H7EA 2YS5A 4JQWC 1V49A 1H10A 3UQBA 2FDQA 4HB4B 4HXDA 1MIZB 4ZYNA 3D8DA 4HAXB 1RLFA 5EDSA 4ZDVA 2BF8B 2O2VB 3LJ3A 4W9JA 5D94A 2ROZB 2LXCA 2IY0B 2KC2A 3A4RA 4LCDE 3JW0X 4JKGB 3QAQA 4MGIE 2HJ8A 1WGDA 2AYOB 1UNRA 2DYQA 4CHKA 3PRMB 1MAIA 3D32A 2FIDA 3ZVVA 4ICVA 2M1MA 1BWNA 2CQUA 3V60A 2Z0DB 3EFUA 2M17A 4GPTB 2I5CA 4A20A 4K17A 2LVOA 2K8CA 1EF1A 4K2OA 4DDID 1LW3A 4MY6A 4F7UP 4GDLA 5D6JB 1DROA 2C7HA 3VXWA 1WMHA 5DHFB 3OANA 2EMTA 2C5LC 1Z2MA 4WWNA 1U2BA 5GOWB 2Y8GA 2KFKA 4A6FA 3TIXA 1U5GA 1N3HA 4HB0B 1W1HA 2M14A 2YT1A 3ML4A 2KWCA 1EO6A 3EC8A 4XZ4A 1C3TA 2UZSA 1HB6A 3NSUA 4PYZA 2CHXA 3ODOA 4MDKE 4WJPA 2KJHB 3IFWB 2KHWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZU A;  2FAZ A;  1UGM A;  1OGW A;  1WX8 A;  1TXD A;  2LZ6 A;  4W9C A;  2QHO A;  4HPL B;  1WGG A;  3WAN A;  4TV3 A;  2RNR B;  2JWZ A;  4OVU A;  2EJ8 A;  2L0T A;  2DZI A;  2MBE A;  2OJR A;  5TR5 A;  4HAT B;  3SDL C;  2MWS B;  5HE0 A;  2NPT B;  3DDC B;  3IHP C;  1WZ0 A;  3L08 A;  2YVC A;  1WJ1 A;  2LOZ A;  2V76 A;  1RAX A;  3OJ3 A;  3SD5 A;  2KQ7 A;  1PMS A;  3DCG A;  2FIF A;  2G3Q B;  3MHS D;  3A9J A;  2GS0 A;  5HE3 A;  3TBL D;  2DYO A;  3ML9 A;  2L00 B;  3Q3J A;  4GGQ A;  4EZL A;  1MIX A;  3M1I B;  4F7H A;  1WF9 A;  4FN2 A;  3V6E B;  2E2X A;  1XX0 A;  2N1V A;  3T06 A;  5JLJ B;  4GN1 A;  4IAP A;  1RRB A;  1WXS A;  2DYN A;  2C7N B;  2IZV B;  2XK5 B;  3M3J A;  4IOY X;  1WXM A;  1BTK A;  2N9P C;  3L54 A;  2MP2 A;  4K7S A;  1OEY A;  2ABD A;  4Z2M B;  5JZE B;  3TO1 A;  2KUP A;  3ZDT A;  3TL5 A;  4AUQ C;  1NVL A;  4JIO U;  1PFJ A;  4PQ0 A;  4K7U A;  2DFK A;  1XQQ A;  4WJO A;  4G11 A;  4BOZ B;  1J8C A;  5HE1 A;  3BJI A;  2C7M B;  2KDI A;  2JY6 A;  2A5U A;  2KOX A;  3QQ8 B;  2PJH A;  4HCN B;  3MDB C;  2KMA A;  3FM8 C;  3CST A;  2NS5 A;  3N30 A;  4DBG A;  2ZCB A;  1QQG A;  2Y7B A;  2EC1 A;  2JT4 B;  2KJ6 A;  2NVU I;  3H1U A;  4E71 A;  4IWQ A;  1SIF A;  2PE6 B;  5CTR C;  3H6N A;  4PYU A;  3O96 A;  4URK A;  1FGZ A;  4NNJ B;  2OOB B;  5LXH A;  3P2B A;  3P7Z A;  2HD5 B;  2KJR A;  1GC7 A;  4LJP B;  2V1Y A;  3H7P B;  2FCQ A;  2KK8 A;  2RPQ A;  2K6D B;  3M62 B;  3WAL A;  1DBH A;  2GBK A;  2KX3 A;  2K2J A;  3L13 A;  1I2H A;  1K5D B;  3H9D A;  3LJU X;  2IO2 B;  2KX0 A;  4I6P A;  2MX2 A;  4IFS A;  2AWT A;  1GNU A;  2LXA A;  3KW5 B;  2BKR B;  4KHO A;  2D07 B;  2O6V A;  3A1Q A;  4LDT B;  3OAW A;  2CU1 A;  3R7R A;  5J17 A;  3QWM A;  5E6N A;  4CO7 A;  5C6R A;  2JZ3 B;  3ULC A;  2Y5B B;  1VD2 A;  3T8M A;  3VH4 B;  4BFR A;  3VVW B;  3ZTD A;  3MPX A;  1E7U A;  1UBI A;  2KWU B;  2XK5 A;  4MJS A;  3VDZ A;  4EZK A;  5LXI B;  3QK0 A;  2BYF A;  2D9X A;  1J0G A;  1UPQ A;  2FUH B;  2DZM A;  1HB8 A;  3RD2 A;  5C16 A;  1Z87 A;  2KXJ A;  5C23 A;  3VH3 B;  4GDK A;  2YSZ A;  2LOX A;  1CMX B;  1EF5 A;  4W9F A;  1WXV A;  5LOP B;  4FUL A;  3NS8 A;  4AP4 C;  3UGB B;  3A4S C;  4BBK A;  3SHQ A;  2IFS A;  3UIO B;  2JPH A;  1U5D A;  4BKT A;  5JHB A;  4NQL B;  2G4S A;  2DHJ A;  2GOW A;  1FB8 A;  3M95 A;  1PQS A;  1MK7 B;  4W9K A;  3ZO5 B;  4K2P A;  4I6L B;  5KCV A;  5CLL B;  1HE8 A;  3HK0 A;  2MBQ A;  2RR9 A;  4RM9 A;  1BAK A;  3EHV A;  4M0W B;  4W9E A;  3L0W B;  1WR1 A;  2PEA A;  4ZRK A;  5E6P A;  2L76 A;  3WAO A;  3IVF A;  2UZR A;  1X1M A;  2EKE C;  4FJZ A;  1WGU A;  2CR5 A;  2ROV A;  3HHM A;  2EMS A;  2H7D A;  4K7W A;  3ODW A;  1U4A A;  3NZS A;  4WJQ A;  1FHW A;  3VAW A;  2JUO A;  5D3X A;  1FXT B;  3DVG X;  3ZTC A;  4FAD A;  1V5P A;  1OQY A;  1OMW A;  1XD4 A;  2OTX A;  5HE2 A;  1TQZ A;  1UZX B;  2DAF A;  3GZN I;  1RFA A;  1XKE A;  1YD8 U;  2DLW A;  2Z0Q A;  3QJZ A;  4W9L A;  4BKS A;  4HLE A;  1RRP B;  2N1W A;  3ECI A;  1U5E A;  2YS1 A;  3L16 A;  3DBR I;  4MEM A;  1ACA A;  4JGH B;  2R2Q A;  3RYT A;  4AWJ A;  1P3R A;  4ANW A;  4DXA B;  2KTR A;  5DH9 B;  4IUM B;  4ZRJ A;  1MKE A;  5DCN A;  1L2N A;  3QC8 B;  4HWI B;  1V5O A;  5AZG A;  3AU4 A;  1V5M A;  2L7R A;  4IWO A;  4N9F 4;  2X18 A;  2RQ1 A;  2HTH B;  1WY8 A;  2IO0 B;  3VUW A;  5IAA C;  2R09 A;  2V3S A;  2R2O A;  1U29 A;  1WH3 A;  2KQS A;  2JXX A;  3SU8 X;  1WGR A;  2ZPN A;  4DHZ E;  1V61 A;  3PRP B;  2FCS A;  2ADZ A;  1M7R A;  1UBQ A;  1FGY A;  1WX7 A;  1FHO A;  4F8C B;  1KLV A;  4ASW C;  1E8X A;  2Z0E B;  4KV2 A;  2BCJ A;  1NU2 A;  2K2U A;  1ZKH A;  4G0N B;  5CHW A;  3ZNH B;  3JSV B;  2CB8 A;  4G3X B;  4HB3 B;  4DHJ B;  5JHG A;  2LRW A;  3KRW A;  5DIF B;  4HAU B;  2KZR A;  2ZZP B;  5L83 A;  2A4Z A;  4FA6 A;  2COC A;  3N32 A;  2RUK B;  2BPS A;  4HDO A;  3KSY A;  4IW0 A;  2KKC A;  3CSF A;  3PV1 A;  4GSW A;  3WAM A;  5J18 A;  2DHZ A;  4X57 B;  5EFX A;  3EPY A;  3APC A;  1WJM A;  3ZUN A;  3F5R A;  3T9L A;  4BKS D;  1OEY J;  2M8S A;  4MSM B;  1FHX A;  2XQN M;  2BGF A;  1YJ1 A;  4E74 A;  3HM6 X;  4IC7 B;  1YX6 B;  3WIM A;  5KQ1 A;  1WRD B;  4OVV A;  4EKU A;  3WA0 A;  4B6H A;  1UH6 A;  2UWQ A;  1MK9 B;  2FCN A;  3NOB A;  5D2M B;  4EZJ A;  4DX8 A;  2JRH A;  1J19 A;  4W9I A;  2DKP A;  3A8P A;  4AJW A;  1I42 A;  2COF A;  5D3Y A;  4HVB A;  3WYF B;  2MBH A;  4KSK C;  3RCP A;  2Z59 B;  2JP2 A;  2G35 A;  3UZT A;  1E8Z A;  2C60 A;  3S2A A;  2MBB B;  3VUX A;  1WJU A;  3U8Z A;  2K8B A;  1ZC4 B;  3B0A A;  3DOW A;  2RSG A;  4IM3 A;  3UIN B;  1FOE A;  2CAY A;  2QKM A;  3PRE A;  1YIW A;  4LJO B;  4TQ0 A;  2MCN B;  1WGH A;  2LVQ A;  4NJ7 A;  4TYZ A;  4A3P A;  2FCM A;  4EOY A;  5C1Z A;  3ENE A;  3RZF A;  1R4N I;  2D10 A;  2AEH A;  2O6V B;  2J0K A;  3VIA A;  1S1Q B;  3KVF B;  4II3 B;  3RT3 B;  2RGF A;  4HAW B;  2PE9 A;  4IG7 B;  2IO1 B;  4EJN A;  3A33 B;  2NCN A;  3PG7 A;  2RD0 A;  5D7G A;  2ZNV B;  2P0D A;  1NI2 A;  3PVL A;  2GCJ A;  4A5K A;  3KUZ A;  1WGQ A;  2MFQ A;  4NSW A;  3DQV A;  3KYC D;  3PHW B;  3Q3F A;  4MGZ E;  4W9G A;  2R0D A;  3QHT A;  4XWX A;  3H7P A;  1V80 A;  3VTW A;  1I35 A;  2LUE A;  1GJZ A;  2W2X D;  2M38 A;  3B1L X;  1GG3 A;  1M7E A;  1SE9 A;  2KO3 A;  1AWE A;  3QA8 A;  4IWP A;  4M8N A;  2ZJD A;  2DHK A;  2OQB A;  2DX5 B;  4BVU C;  2LUL A;  4HAZ B;  2YRY A;  3L17 A;  4MH0 E;  3SYX A;  5D3W A;  2KN5 A;  2PPH A;  3PSC A;  2MW5 A;  4IM0 A;  2ZEQ A;  4GMV A;  1QZE A;  4FJV B;  5KHQ A;  1A5R A;  2LYD A;  1V89 A;  1V88 A;  1WE7 A;  2N23 A;  2L05 A;  2CHW A;  4KZ0 A;  2L2I A;  1WR6 E;  1WG7 A;  3PVU A;  1WZ3 A;  1XD3 B;  4NQK E;  2O6V D;  4II2 B;  4MJS B;  5DPS A;  2Z0P A;  2I5F A;  4M8M A;  1DDW A;  2J0M A;  2BWE S;  2LD9 A;  3A8Q A;  1OTR B;  5CHV C;  1KZG A;  2RVB B;  3IBE A;  3JYU A;  1T0Y A;  1P3Q U;  4KIK A;  2D11 A;  2L3Z A;  3PT2 B;  2JRI B;  4DWF A;  1GUA B;  1J0W A;  4KDL B;  2NBU A;  1WM3 A;  1LM8 B;  1Y8R C;  2N9E B;  3TW1 A;  2O2V A;  1Q1O A;  2V4L A;  4BBN F;  1X05 A;  4FHK A;  1V5T A;  3DXD A;  1WXA A;  4DHJ D;  2RLO A;  4MT7 A;  3W1Y A;  2FJ9 A;  3CXB B;  4WAA A;  1X11 A;  3U30 A;  5D27 A;  4MGY E;  2D2Q A;  3KH0 A;  4PS3 A;  5IJM A;  2K25 A;  1ZSQ A;  3QBV B;  1Y5O A;  5JHH A;  3V6C B;  2J0J A;  2D4Q A;  2LVP A;  1IYF A;  1WMH B;  4ANU A;  3A9K B;  2LG1 A;  4KIK B;  2YS3 A;  2N4F A;  5GMV A;  3TMP B;  4FHJ A;  3W1S A;  2WH5 A;  2CRF A;  3PHX B;  1NDD A;  3UQA A;  3ALB A;  3SUZ A;  2D3G A;  1K8R B;  1P9D U;  2MBO A;  2NMB A;  2KNB A;  2KVR A;  2MRP A;  2LKO A;  1OQN A;  1ISN A;  1EVH A;  2DX1 A;  1WGY A;  3PS6 A;  2K6Q A;  1V9J A;  4EEW A;  5JHA A;  2WDT B;  2ELB A;  3AJ4 A;  1WM2 A;  2KLG A;  1WIA A;  3G9W A;  4NY0 A;  2NBV B;  3RZW C;  1ZGU B;  2KLC A;  3UF8 A;  2KDF B;  3AUL A;  1Y19 B;  1UNP A;  2REX A;  4JLC A;  2COD A;  1I7A A;  1E8W A;  2I1K A;  3GOE A;  3DBS A;  3DVG Y;  4PNK A;  4HK2 A;  2JF5 A;  3U7D A;  4WQO B;  2NZ8 B;  4MGK E;  5FR6 A;  3UIP B;  4DDG D;  5IA7 A;  4GIV A;  4E3C A;  2D9Z A;  1L7Y A;  1LFD A;  4CYE A;  3ZW3 A;  3ZIM A;  4HDQ A;  1NBF C;  3I3T B;  3HM3 A;  3KRX A;  2WX1 A;  2KD0 A;  5DHA B;  3CF6 E;  3PSE B;  1LQB A;  1BTN A;  1WE6 A;  4MM3 A;  4XX5 A;  2ZPY A;  3PP2 A;  1IRS A;  4KHB B;  4HB2 B;  1QC6 A;  1V6E A;  5G2N A;  3SO6 A;  2MQJ A;  1KJT A;  2NPT A;  3ZRF A;  1GC6 A;  4KDI C;  3ODX A;  1UD7 A;  4F7Z A;  5D3V A;  1AAR A;  1R4M I;  1WJN A;  2DZJ A;  2G4D B;  4LDT D;  4B95 A;  1WVH A;  4FBJ B;  4F1S A;  3CIK A;  2MLB A;  4DBB A;  3APF A;  3GYP A;  2L0F A;  4GU2 A;  5L95 C;  4H8S A;  2NBW B;  5J3T A;  4IM2 A;  4WJN A;  1PLS A;  1XOD A;  4HAV B;  4TKN A;  2D9V A;  3D8F A;  4A6F B;  1P1A A;  2KFJ A;  3D8E A;  1S3S G;  1EGX A;  2KMC A;  2GBN A;  1EAZ A;  3KUD B;  4ZRI A;  2M0X A;  4KSL C;  2KTF A;  2VSZ A;  4AJY B;  3O65 B;  2BWF A;  2IY1 B;  3RUI B;  3PPA A;  3MJW A;  1ST7 A;  4RMA A;  3WAP A;  2L8J A;  3VFK A;  2Y8F A;  3GYO A;  3DXC A;  5JH5 C;  4KZC A;  4EMO A;  2K00 A;  4NAW A;  1TZ1 A;  4B9K A;  3VOQ A;  1WFY A;  2P0H A;  2DTC A;  1V81 A;  2BYV E;  2LGX A;  2W2X C;  4GXB A;  1DDM A;  2LGD A;  4HJK A;  1ZVR A;  3A9K A;  1WI1 A;  1Q5W B;  3X0W A;  2MSE D;  1DDV A;  3QIJ A;  1E7V A;  3KUC B;  3M63 B;  3AU5 A;  2COA A;  3P6A A;  4Y94 A;  1NTI A;  3N7C A;  3W1S C;  5C5B A;  3H7S A;  2DEN B;  1U27 A;  2D9W A;  5L81 A;  4JL9 A;  4GDK B;  3RCZ A;  1F9J A;  4GDL B;  4A6K A;  4WWP A;  2DA0 A;  2K39 A;  2N9X A;  3B08 A;  3KZ1 A;  2LGY A;  3IG3 A;  1D3Z A;  3EEC A;  2H7E A;  2YS5 A;  2GCL A;  3LDZ E;  3R66 C;  5DPT A;  3AI5 A;  2COP A;  1E90 A;  2KC1 A;  1V49 A;  3DPD A;  4JQW C;  1H10 A;  1RJ2 A;  4GZU A;  3VQI A;  3ZDM C;  1TTN A;  3UQB A;  1H4R A;  1UEF A;  2FDQ A;  4HB4 B;  2ASQ A;  2RSU A;  4YON A;  3PLU A;  3V62 A;  4HXD A;  3FSS A;  2DYM A;  2NR2 A;  3A1Q B;  1KI1 B;  4FLH A;  2KFK B;  4WWO A;  5G55 A;  3ZNZ B;  2GBJ A;  4GMX B;  3OJ4 B;  1WI0 A;  5AZH A;  2Q13 A;  1MIZ B;  4ZYN A;  1XT9 B;  3V61 A;  2LWP A;  3D8D A;  2HTH A;  2W9N A;  3VUY A;  5LON B;  2IYB A;  4FJY A;  4HAX B;  2CS4 A;  1RLF A;  3ULB A;  1ZM0 A;  1SHC A;  2DYB A;  2WYQ A;  5EDS A;  3DXE A;  2MDX A;  2BF8 B;  2N7D A;  2ZCC A;  1E5W A;  1FAO A;  1JRU A;  2VKI A;  3PEG A;  1KM7 A;  2O2V B;  3K9O B;  3LJ3 A;  3QCA A;  4W9J A;  5CLQ B;  2AL6 A;  5D94 A;  2ROZ B;  2LXC A;  2UYZ B;  3KY9 A;  3AXC A;  1NTV A;  2IY0 B;  2KC2 A;  1V86 A;  2BKF A;  3A4R A;  4LCD E;  1KOT A;  1G6J A;  1NTY A;  1P98 A;  3JW0 X;  4ICU A;  1IP9 A;  3QAQ A;  4MGI E;  3MTN B;  2HJ8 A;  3PRZ A;  1WJ6 A;  4PS7 A;  3TVV A;  3L10 B;  1AQC A;  1K5G B;  4BOS C;  3HQC A;  3KYD D;  2W2W A;  4HCP B;  3A98 B;  1P0R A;  2AL3 A;  5KQ4 A;  2XEW A;  1WGD A;  2IYD B;  3DVN U;  2AYO B;  3JVZ X;  1UNR A;  4XC2 A;  2MP2 B;  4EFO A;  2DYQ A;  1TJ6 A;  4CHK A;  2CHZ A;  1SGH A;  4B6W A;  4CHM A;  3PRM B;  2DHI A;  1MAI A;  2ZVN A;  3D32 A;  2FID A;  1V2Y A;  3DVN V;  5HKH A;  2UVM A;  3ZVV A;  1Q0W B;  5J3Q A;  2MWN B;  4MSQ B;  2K1F A;  5FI0 A;  4ICV A;  5AZF A;  2M1M A;  1V5U A;  1BWN A;  3F0W A;  3K9P B;  3RUL A;  3BIN A;  1W1G A;  5KHO A;  3FEH A;  1WX9 A;  2IO3 B;  2CQU A;  1XCG A;  2YT0 A;  2J7Q B;  2JVC A;  4HPM B;  3V60 A;  4DX9 0;  2JZZ A;  2ELA A;  2Z0D B;  5DPW A;  5LLI A;  3EFU A;  4MEL A;  2M17 A;  3HW2 B;  4GPT B;  1ZC3 B;  4WVF B;  2P8V A;  5DPR A;  3X23 A;  3CMM B;  3R7Q A;  2I5C A;  2GJY A;  2KCJ A;  4A20 A;  3VTU A;  4K17 A;  1M94 A;  2LVO A;  2K8C A;  2Z0O A;  1EF1 A;  4WSF A;  2MKR A;  4K2O A;  2M4N A;  3QX1 A;  3ZKJ C;  2LI5 A;  4F7G A;  1UPR A;  2KDB A;  3APD A;  2C9W B;  4G50 A;  4ZDV A;  3HIZ A;  4DDI D;  2LJ5 A;  2QKL A;  3ML8 A;  2KWV B;  4A3O A;  4AOF A;  1U5F A;  1LW3 A;  1HBK A;  4MY6 A;  4KHA A;  1Z5S B;  4F7U P;  4KAX B;  2HE7 A;  3BY4 B;  4BKG A;  3DBH I;  2N7E A;  3ZLZ A;  4WJ7 A;  1Q67 A;  4GDL A;  3DBL I;  1X86 A;  5D6J B;  1DRO A;  2ZVO A;  3ONS A;  2C7H A;  5C79 A;  4KVG B;  5C5B B;  2KAN A;  4Z2N A;  1WJ4 A;  1C1Y B;  1WMH A;  1DYN A;  3VXW A;  5DHF B;  3OAN A;  2KGX B;  3FP5 A;  1KZ7 A;  3V5W A;  1TBE A;  2EMT A;  2VRR B;  1MG8 A;  1IPG A;  2C5L C;  2FJL A;  2WWZ A;  5J3Y A;  5DI9 B;  1Z2M A;  4WWN A;  1VCB A;  1H8C A;  1TGZ B;  2BYE A;  4ANV A;  1B55 A;  4P7I A;  1UNQ A;  4GB9 A;  3VHT C;  3PVW A;  1U2B A;  1WYW B;  4D0N B;  2DAJ A;  1W1D A;  2XBB C;  3R3M A;  5E6O A;  2L1C A;  3ZNI D;  2DKQ A;  3NY5 A;  2GBR A;  5GOW B;  2Y8G A;  2KFK A;  5JP4 A;  3TJP A;  2HRJ A;  3PZD A;  4BBN C;  1X1G A;  1XR0 B;  4HHV A;  3JSV A;  3N3K B;  4DK5 A;  4TUU A;  2PZ1 A;  3VTV A;  4A6F A;  5FI1 A;  3TIX A;  1U5G A;  3ZRC A;  3PTF C;  1N3H A;  4HB0 B;  2CY5 A;  1P6S A;  3SNH A;  2D9Y A;  2N0Y A;  4A6H A;  3TFM A;  2DN6 A;  4DHZ B;  4MK0 A;  2MA9 B;  2RGN B;  2KDE B;  1W1H A;  3PGE A;  4K1R B;  2M14 A;  2YT1 A;  2G45 B;  5J2R A;  3C0R B;  2YLM A;  3TCA A;  4C0A A;  3A9J B;  3ML4 A;  1YQB A;  2KWC A;  2I1J A;  1MPH A;  4HAY B;  3SV1 A;  1EO6 A;  1LXD A;  5CHF A;  1LB1 A;  4EUT A;  2LRU A;  2DX5 A;  2KTR B;  4PS8 A;  3EC8 A;  3NHE B;  2IBI B;  4GOC A;  1ZW7 A;  5AEK B;  1OY2 A;  4W9H A;  4J6I A;  4XZ4 A;  1C3T A;  2VRW B;  5CX3 A;  4W9D A;  2UZS A;  1UEL A;  1HB6 A;  4RM8 A;  3NSU A;  3QAR A;  2K8H A;  4PYZ A;  3QWZ B;  2GMI C;  1P5T A;  1YX5 B;  1EUV B;  3OLM D;  4NAW B;  3PLV A;  2GBM A;  3ZNG C;  2LAS A;  1X1F A;  2CY4 A;  2CHX A;  4K81 A;  2FNJ B;  3ODO A;  4I6N B;  4MDK E;  2P0F A;  4ANX A;  2B3A A;  2J59 M;  4WJP A;  2DZK A;  2KJH B;  3FLV A;  3ZVR A;  2KHW B;  2WX0 A;  3IFW B;  4CHJ A;  4L6E A;  1BT0 A;  4TQ1 A;  4NJ6 A;  4NPN A;  5BO4 B;  1E8Y A;  2LBB A;  2ZNV C;  4YL8 A;  2YF0 A;  2CKH B; 
#chains in the Genus database with same CATH topology
 3NZU A;  1F2R C;  2FAZ A;  1WX8 A;  1TXD A;  2LZ6 A;  2BTE A;  2BYT A;  2DZI A;  1QOA A;  4HAT B;  3R2T A;  3AEE B;  2LOZ A;  4OZB A;  5IN7 A;  2FIF A;  3MHS D;  2L52 A;  4GGQ A;  3M1I B;  4F7H A;  5JLJ B;  1MHH E;  2ABD A;  4Z2M B;  5JZE B;  3TO1 A;  4P1B C;  3ZDT A;  1NVL A;  1NYQ A;  2VH1 A;  4G11 A;  3VRB B;  5HE1 A;  3BJI A;  1D5Z C;  2KOX A;  2JY6 A;  3MDB C;  4L2Y A;  2ZCB A;  2NVU I;  3NVW A;  2PKO A;  1SIF A;  3GP7 A;  4IWQ A;  4URK A;  3O96 A;  3FC4 A;  1GB1 A;  2KJR A;  3DBL B;  2KK8 A;  3WAL A;  1DBH A;  4ILH A;  4A9A A;  2IO2 B;  2AWT A;  5AUI A;  2BKR B;  2D07 B;  2WXM A;  2CU1 A;  5E6N A;  1E0Z A;  2Y5B B;  1C76 A;  2W54 A;  3EFC A;  4MJS A;  1VBH A;  2D9X A;  3RNA C;  1CJE A;  3AE9 B;  3VH3 B;  3TEY A;  1WXV A;  5M4Y B;  3LB8 C;  4BBK A;  3BVM A;  3SHQ A;  3PO0 A;  2G4S A;  4RGO S;  3DHH C;  1FB8 A;  1PQS A;  1MK7 B;  4P6V F;  4W9K A;  3ZO5 B;  2MJ3 A;  2QEJ C;  2MBQ A;  1BAK A;  4M0W B;  2PEA A;  5E6P A;  1BXT A;  4JWS C;  2K3U A;  3HHM A;  2KT7 A;  1U4A A;  4WJQ A;  2JUO A;  4FAD A;  2KR0 A;  2G9H D;  2KYW A;  3ZTC A;  1V5P A;  4P16 A;  2JQR B;  1RFA A;  3ZGZ A;  4HLE A;  2YS1 A;  3DBR I;  4MEM A;  1JRO A;  3RYT A;  2WP9 B;  1J7A A;  3ETR A;  4LNO A;  3CWI A;  2W3R A;  4R3D A;  2WXR A;  1WY8 A;  2HTH B;  1TS5 A;  1NYR A;  5IAA C;  2R09 A;  1U29 A;  2KQS A;  2JXX A;  1WGR A;  2ZPN A;  3AED B;  4GNK B;  1FIQ A;  5I4D A;  4ASW C;  1ZKH A;  4G0N B;  3JSV B;  2CB8 A;  1L6U A;  1VR9 A;  4DHJ B;  2N9K A;  2KZR A;  1ROE A;  3N32 A;  1JWB D;  2KKC A;  3CSF A;  3WAM A;  1SJH D;  4XGA B;  1WJM A;  2M8S A;  2BT6 A;  1FHX A;  4REZ A;  2BS4 B;  4E74 A;  5KQ1 A;  4OVV A;  4EZJ A;  2JRH A;  1Q10 A;  1J19 A;  1UUP A;  5D3Y A;  4HVB A;  3WYF B;  3FAH A;  2JP2 A;  1KBL A;  2MBB B;  1SE2 A;  2K8B A;  3VUX A;  3UIN B;  1ZC4 B;  4XWW A;  2QKM A;  4LJO B;  2MCN B;  5I2S A;  2MEK A;  5C1Z A;  2Z13 A;  2INN E;  4II3 B;  2J0K A;  4BKS D;  1V97 A;  1I4R A;  3PG7 A;  5D7G A;  3E66 A;  2P0D A;  2MFQ A;  3Q3F A;  3KYC D;  3PHW B;  4HJG E;  2R0D A;  4IKG A;  3HVD A;  2W2X D;  4M8N A;  2KO3 A;  4IWP A;  5D3I B;  2ZJD A;  1TJE A;  2DX5 B;  1T0R C;  3ZJU A;  4MH0 E;  2WLB A;  3N20 C;  2PPH A;  1A5R A;  4GMV A;  1QZE A;  3B9J A;  3TSS A;  1PUT A;  2YEP F;  1JWU D;  2ZW1 A;  4M00 A;  1OFF A;  2O6V D;  4HKQ A;  4M8M A;  3AN1 A;  2LD9 A;  1F1H A;  4DWF A;  1I4X A;  3Q3N C;  3PZ8 A;  1Y8R C;  1LM8 B;  2V4L A;  4BBN F;  5G5G A;  4WWM A;  1ZUD 2;  4DHJ D;  2RLO A;  5T8I A;  4M02 A;  2VZK D;  4MGY E;  2D2Q A;  4B0M A;  1HZ6 A;  1MI0 A;  3QBV B;  3V6C B;  4LTU A;  2EKI A;  2J0J A;  2LVP A;  1WMH B;  2WH5 A;  3UQA A;  1K8R B;  1P9D U;  2KNB A;  2V0G A;  1OQN A;  1ISN A;  2DX1 A;  3DHI C;  1UWX A;  1V9J A;  2WDT B;  1WM2 A;  1WIA A;  3PZ7 A;  2KLC A;  3AUL A;  1QT9 A;  2D3C A;  1MVK A;  3E9O A;  2I1K A;  2D9Z A;  5IOI A;  1LFD A;  4CQN A;  4NAM A;  2WX1 A;  3PSE B;  2Y5P A;  4MM3 A;  1XLN A;  1T77 A;  4KHB B;  1IRS A;  5G2N A;  4KDI C;  3BWU D;  4F7Z A;  2Z8L A;  2K22 A;  4ZYS A;  2G4D B;  1R4M I;  4LDT D;  1WVH A;  3AEC B;  3CIK A;  2MLB A;  4DBB A;  2AQ2 B;  1FXI A;  2NBW B;  1L6V A;  5J3T A;  4WJN A;  1XOD A;  1SXT A;  1P1A A;  4A6F B;  1FEH A;  2GBN A;  4ZRI A;  2GRI A;  2KTF A;  2IY1 B;  1ST7 A;  1N63 A;  1FMA D;  1GB4 A;  4NAW A;  1TZ1 A;  1WFY A;  2Z0E B;  2X8X X;  2W2X C;  5GXG B;  1Q5W B;  1DDV A;  2RPV A;  3P6A A;  1NTI A;  3N7C A;  3W1S C;  5C5B A;  5EE3 A;  1U27 A;  4GDK B;  1I4G A;  1RWS A;  2R82 A;  3EEC A;  4Q2J A;  3DPD A;  4OZC A;  1YOV B;  1UEF A;  3I5J C;  1T6B X;  3V62 A;  3FSS A;  5HG2 A;  2DYM A;  3A1Q B;  4FLH A;  1KI1 B;  3OWE B;  2KFK B;  4GMX B;  2Q13 A;  3V61 A;  1XT9 B;  1VDV A;  3VUY A;  2HTH A;  3MC9 A;  5LON B;  5EE9 A;  2DNF A;  1SHC A;  2WYQ A;  3KQ4 A;  3DXE A;  4NJ6 A;  1E5W A;  4L23 A;  2IGD A;  1XEE A;  2DBY A;  4C4V B;  4ICU A;  3PRZ A;  4JWU C;  3TVV A;  3L10 B;  2ONQ A;  2PVO D;  1AQC A;  1K5G B;  3IXS A;  3KYD D;  2W2W A;  1J8C A;  5KQ4 A;  3JVZ X;  2DLB A;  1TJ6 A;  1SGH A;  4WQM A;  4B6W A;  1QKZ A;  3ABV B;  1V2Y A;  2UVM A;  4MSQ B;  4YSY B;  5AZF A;  1V5U A;  4TMA B;  3E56 A;  1HXY D;  3RUL A;  1W1G A;  1WX9 A;  1XCG A;  4QAY A;  1L5P A;  4JE3 B;  2KIE A;  1STE A;  3DWG C;  4MEL A;  3HW2 B;  2Z0O A;  2M4N A;  3ZKJ C;  2MKR A;  4XE0 A;  2C9W B;  1QQR A;  1HQR D;  2B76 B;  1HBK A;  2JXT A;  3BY4 B;  1I4Q A;  2JSV X;  4BKG A;  3DBH I;  3Q3M C;  1KH0 A;  4WJ7 A;  1X86 A;  1NEN B;  3ONS A;  3Q8B A;  5C79 A;  4KVG B;  4RGM A;  1TBE A;  3FP5 A;  1KZ7 A;  3J9C A;  2VRR B;  3BYT B;  1IPG A;  2FJL A;  5J3Y A;  5DI9 B;  1FO4 A;  1H8C A;  4WUR A;  4QXA B;  4P7I A;  1UNQ A;  4GB9 A;  4D0N B;  1DYQ A;  2Y5C A;  5E6O A;  2L1C A;  2KWD A;  3ZNI D;  2DKQ A;  5LG4 B;  2KMM A;  2GBR A;  3NY5 A;  2HRJ A;  1XR0 B;  2JZP A;  3JSV A;  3N3K B;  4TUU A;  1N60 A;  2CY5 A;  4US9 A;  1KRH A;  2D9Y A;  2N0Y A;  4DHZ B;  2DN6 A;  1VBG A;  4C0A A;  1YQB A;  2RRF A;  5CHF A;  3SV1 A;  4RGT A;  5HI1 A;  3W5V B;  2IBI B;  3A58 A;  3QWZ B;  2GMI C;  1K50 A;  1YX5 B;  1EUV B;  4L1B A;  4NAW B;  1FD6 A;  3VR9 B;  3ZNG C;  1X1F A;  2WGS A;  4I6N B;  1C79 A;  2J59 M;  2IPK D;  2WX0 A;  4TQ1 A;  4L6E A;  2XNA C;  4NPN A;  3Q8A A;  1E8Y A;  2IGG A;  2LBB A;  3AE3 B;  3X0W A;  2YF0 A;  5JXV A;  1OGW A;  1YQ4 B;  4W9C A;  2QHO A;  5EE1 A;  1WGG A;  2RNR B;  4OVU A;  2EJ8 A;  2MBE A;  2OJR A;  5FK9 C;  3SDL C;  3DDC B;  3DCG A;  3A9J A;  1EM7 A;  2DYO A;  2GLS A;  3ML9 A;  2L00 B;  3Q3J A;  2K49 A;  1MIX A;  1WF9 A;  3NG0 A;  4FN2 A;  3V6E B;  2C7N B;  1TKY A;  4NQK E;  3M3J A;  1ET9 A;  4IOY X;  4OSN A;  3TL5 A;  4BOZ B;  2C7M B;  2A5U A;  3CST A;  2NS5 A;  4YWG G;  4DBG A;  5E6J A;  2KJ6 A;  4E71 A;  2PE6 B;  5CTR C;  2YT2 A;  4PYU A;  4YT0 B;  3P2B A;  1GC7 A;  1AWD A;  2JYE A;  4AQ7 A;  4A55 A;  2V1Y A;  2RPQ A;  2K6D B;  4YTM B;  4LK0 M;  2K2J A;  3L13 A;  1I2H A;  4C56 C;  1GNU A;  4IDI A;  3OAW A;  5J17 A;  3R7R A;  3DBR B;  4ZOH C;  4CO7 A;  2JZ3 B;  3VH4 B;  3T8M A;  4BFR A;  2QIL A;  3MPX A;  1E7U A;  5LXI B;  1ZDV A;  3VDZ A;  3QK0 A;  3RD2 A;  1HB8 A;  5C16 A;  2LGI A;  4JPS A;  4W9F A;  2LOX A;  1CMX B;  1HTQ A;  1I4H A;  3A4S C;  2IFS A;  3UIO B;  1C9F A;  5JHB A;  1RFK A;  4NQL B;  2ON8 A;  2DHJ A;  4CSQ A;  1FFU A;  2D5G A;  2GOW A;  1ZE3 D;  3WCQ A;  1D5X C;  1ET6 A;  5KCV A;  3L0W B;  1JML A;  1WR1 A;  4ZRK A;  4OW0 A;  1K53 A;  4LNN A;  4FJZ A;  1WGU A;  2CR5 A;  1FHW A;  3VAW A;  1FXT B;  1N5X A;  1OMW A;  5HE2 A;  1UZX B;  1YD8 U;  1RRP B;  2N1W A;  3ECI A;  3GS2 A;  1FRD A;  4JGH B;  4ANW A;  3AE4 B;  1FXA A;  5DH9 B;  1L2N A;  1L4Z B;  2W82 A;  1V5M A;  2RQ1 A;  3VUW A;  2Y3A A;  2V3S A;  1V8C A;  1WRI A;  2AX5 A;  3PRP B;  2FCS A;  1WX7 A;  1UBQ A;  3NVZ A;  2BW2 A;  2BCJ A;  2K2U A;  4N59 A;  2ZZP B;  5DIF B;  5L83 A;  2A4Z A;  3Q8F A;  3L4P A;  2BPS A;  4HRO A;  4HDO A;  4QJ4 B;  4GSW A;  1UNS A;  3EPY A;  1VZ7 A;  3APC A;  3ZUN A;  2VZK B;  3T9L A;  1OEY J;  1AW7 A;  4GLS C;  2XQN M;  3HM6 X;  5IRS A;  4IC7 B;  3WIM A;  4D6W A;  3SEB A;  2FCN A;  2MHJ A;  4W9I A;  3A8P A;  4AJW A;  1N62 A;  2COF A;  2MBH A;  3RCP A;  1MHX A;  2G35 A;  3UZT A;  1GAQ B;  2LHE A;  3B0A A;  3DOW A;  2RSG A;  2CAY A;  4TQ0 A;  4ITK A;  3SBT A;  4A3P A;  2FCM A;  2HTM E;  3FIL B;  4EOY A;  1DOX A;  2DIK A;  2O6V B;  2D10 A;  2AEH A;  3VIA A;  1RYJ A;  4IG7 B;  2IO1 B;  4M0W A;  1R7S A;  3IT4 B;  3DQV A;  5AUK A;  4W9G A;  2LGS A;  3VTW A;  3H7P A;  1TKE A;  2LUE A;  3B1L X;  1SE9 A;  1M7E A;  4OHJ A;  4S17 A;  2GUM A;  3RI7 C;  3L17 A;  3SYX A;  3PSC A;  2WXO A;  2ZEQ A;  4FJV B;  3C19 A;  2LYD A;  1V89 A;  1WE7 A;  2N23 A;  1P7E A;  2CHW A;  4KZ0 A;  2L2I A;  1WR6 E;  1XD3 B;  3PVU A;  5DPS A;  1AN8 A;  4MJS B;  1OQR A;  1OTR B;  2FUG 1;  1P3Q U;  4KIK A;  1PDX A;  2RDG A;  3NWF A;  2N9E B;  3SFD B;  3TW1 A;  1FFV A;  1V5T A;  1X11 A;  2ICI A;  5D27 A;  2K25 A;  1ZSQ A;  1CK1 A;  2D4Q A;  4ANU A;  3A9K B;  2LG1 A;  3AV8 A;  2YS3 A;  4KIK B;  5GMV A;  3W1S A;  3ALB A;  2D3G A;  2MBO A;  2NMB A;  3AE7 B;  3P4P B;  3TEX A;  4EEW A;  3PS6 A;  1EVH A;  2WXN A;  2K6Q A;  3AJ4 A;  3G9W A;  3RZW C;  1ZGU B;  1Y19 B;  1UNP A;  2COD A;  3AE8 B;  3GOE A;  3DVG Y;  4PNK A;  4WQO B;  4O1N A;  4DDG D;  3VR8 B;  2IND C;  3ZIM A;  1GGO A;  4HDQ A;  1NBF C;  3I3T B;  2FJU B;  3KRX A;  4XX5 A;  3PP2 A;  3OHM B;  1T0S C;  2I2Y A;  2MQJ A;  2NPT A;  1GC6 A;  3ODX A;  1UD7 A;  1WJN A;  4F1S A;  4L1R A;  2JWU A;  3GYP A;  1T3Q A;  2L0F A;  5L95 C;  4IM2 A;  2CU3 A;  1P7F A;  4HAV B;  4TKN A;  2D9V A;  3D8F A;  2WXF A;  3D8E A;  1S3S G;  4KSL C;  4EE2 A;  3O65 B;  2BWF A;  1FRR A;  2J42 A;  2L8J A;  4IOI E;  2Y8F A;  5JH5 C;  2INP E;  4QJ3 B;  4B9K A;  2LGX A;  3Q8E A;  2BYV E;  4B0E A;  4HJK A;  3A9K A;  3DHG C;  2COA A;  1YNT E;  3H7S A;  4KGS A;  4ZRQ A;  3RCZ A;  1F9J A;  1DOI A;  4A90 A;  2DA0 A;  4C7Y A;  2N9X A;  2MJE A;  2GCL A;  3LDZ E;  3AI5 A;  1E90 A;  1QF6 A;  4HRS A;  4P1C C;  3VQI A;  1DOY A;  1H4R A;  2RSU A;  3PLU A;  2NR2 A;  5G55 A;  3ZNZ B;  3AMZ A;  2GBJ A;  3OJ4 B;  3HIE A;  2LWP A;  4LLG M;  2WDQ B;  2IYB A;  1ZPS A;  4N6E B;  1ZM0 A;  2DYB A;  2WS3 B;  1CZP A;  1JRU A;  2VKI A;  1KM7 A;  3Q2A C;  5CLQ B;  2NTT A;  2UYZ B;  3KY9 A;  1ZYI A;  3AXC A;  2BKF A;  3ZYY X;  5BMI A;  4ARI A;  1G6J A;  1NTY A;  1KOT A;  3BVZ A;  5TSS A;  2RMM A;  1WJ6 A;  3LYY A;  4UDU C;  4JKC A;  4BOS C;  3DVN U;  1P0R A;  2AL3 A;  3ZLZ A;  4EFO A;  2CHZ A;  4CHM A;  2ZVN A;  3DVN V;  1AYF A;  1QOG A;  2K1F A;  3BK1 A;  2LHD A;  1KF6 B;  3AE6 B;  5G5H A;  2KUQ A;  5C2T B;  4XDD A;  3FEH A;  2IO3 B;  2QDF A;  2YT0 A;  5H8Y E;  3HUI A;  4YSZ B;  3RNF C;  2JZZ A;  5MPO A;  1PGX A;  2AQ1 B;  1ZC3 B;  2P8V A;  3X23 A;  3R7Q A;  2KCJ A;  3VTU A;  1M94 A;  4WSF A;  1UPR A;  2H89 B;  2LJ5 A;  2QKL A;  4AOF A;  4A3O A;  2KDM A;  1U5F A;  3AEA B;  1ENF A;  1SSN A;  2N7E A;  3DBL I;  2KAN A;  4Z2N A;  1WJ4 A;  2N7J A;  3W5U B;  2QCZ A;  2KGX B;  2WWZ A;  1EU4 A;  1XCQ L;  1VCB A;  1TGZ B;  2QSD A;  3NVV A;  3PVW A;  3VHT C;  1WYW B;  1W1D A;  3R3M A;  2V4I B;  1JRP A;  3MP9 A;  3Q8C A;  5JP4 A;  1IUE A;  3TJP A;  4BBN C;  1EU3 A;  2PZ1 A;  3VTV A;  2WNM A;  1P6S A;  3TFM A;  4MK0 A;  2MA9 B;  2RGN B;  2KDE B;  3PGE A;  2WU5 B;  4K1R B;  3C0R B;  2YLM A;  3A9J B;  4HAY B;  1LXD A;  3NZ3 A;  4EUT A;  2LRU A;  5LNK 1;  2KTR B;  3P42 A;  4PS8 A;  3NHE B;  1OY2 A;  1JWM D;  4W9H A;  1UEL A;  4RM8 A;  3QAR A;  1P5T A;  3OLM D;  3PLV A;  3EA6 A;  1JWS D;  1MJD A;  2LAS A;  3Q14 C;  1QLB B;  3RPF C;  2FNJ B;  2P0F A;  3ZVR A;  4CHJ A;  3B08 A;  2ZNV C;  2WDR B;  1UGM A;  3MC8 A;  4YSX B;  1E10 A;  4HPL B;  4TV3 A;  2JWZ A;  3MHZ A;  1E9M A;  2R61 A;  1V1P B;  3I57 A;  5HE0 A;  3IHP C;  1WZ0 A;  3L08 A;  2PIA A;  1WJ1 A;  2V76 A;  1PMS A;  4XWT A;  2K9X A;  2GS0 A;  3TBL D;  4EZL A;  2N1V A;  4IAP A;  2XK5 B;  2DYN A;  1WXM A;  2N9P C;  2MP2 A;  3BYY B;  1FCC C;  2KUP A;  4JIO U;  1PFJ A;  3EGR A;  4K7U A;  1HEZ E;  2JU6 X;  4WJO A;  3RFZ B;  2KDI A;  2PJH A;  2WXJ A;  4ACF A;  4HCN B;  1PYW D;  3N30 A;  1YN3 A;  1QQG A;  3H1U A;  2JT4 B;  3AEF B;  3H6N A;  4NNJ B;  3N9Y C;  2X38 A;  3IT6 B;  3KWL A;  1TT5 B;  3BVG A;  3H7P B;  1V1O A;  2KIG A;  3Q69 A;  4ILJ A;  2MX2 A;  2V3P A;  4IFS A;  1C77 A;  2O6V A;  4LDT B;  3QWM A;  3FIL A;  3ULC A;  3MC0 B;  4H2A A;  3P4R B;  3VVW B;  1UBI A;  2KWU B;  2XK5 A;  4C00 A;  4LNF A;  2DZM A;  2KXJ A;  1KFY B;  2YSZ A;  1EF5 A;  1TYG B;  5LOP B;  3NJT A;  3NS8 A;  4AP4 C;  1NEK B;  1NI3 A;  2JPH A;  2PW9 A;  4JK7 A;  3MJ5 A;  3NWA A;  4K2P A;  3URY A;  1GOZ A;  2J53 A;  2M0A A;  3EHV A;  4RM9 A;  2UZR A;  1X1M A;  1UWM A;  3Q6B A;  2ROV A;  4K7W A;  3TEW A;  5D3X A;  3DVG X;  1OQY A;  4RCO A;  2OTX A;  1TQZ A;  2NTS A;  3QJZ A;  2Z0Q A;  4BKS A;  3FKY A;  2GI9 A;  2SEB D;  2K8E A;  2BS2 B;  2X0S A;  3L16 A;  2OJW A;  3E9P A;  4AWJ A;  4DXA B;  5BMH A;  2W3S A;  4ZRJ A;  1MKE A;  5DCN A;  3NRZ A;  4HWI B;  5IO9 A;  5AZG A;  3AU4 A;  2BQQ A;  2L7R A;  4IWO A;  4N9F 4;  2X18 A;  2IO0 B;  1J7C A;  3SU8 X;  1WH3 A;  2SAK A;  3ZXV A;  4DXG A;  4DHZ E;  1V61 A;  2ADZ A;  2IDY A;  3E9S A;  1FHO A;  3AE5 B;  4KV2 A;  4KKI A;  2ZW0 A;  4G3X B;  1SE3 A;  2LRW A;  3KRW A;  2COC A;  2RUK B;  3KSY A;  4IW0 A;  3PV1 A;  1GPX A;  3O13 A;  3I63 C;  4X57 B;  4ZHO A;  2QMT A;  1YMH E;  3R8B A;  1YX6 B;  2MH7 A;  5JVL A;  1WRD B;  1ZP0 B;  3WA0 A;  4B6H A;  1UH6 A;  2UWQ A;  4TSS A;  5D2M B;  4DX8 A;  2IJ0 A;  4RNA A;  2DKP A;  1I42 A;  2XN9 C;  3NWD A;  3U52 E;  2R2Y A;  1C78 A;  5FKA C;  3S2A A;  1WJU A;  4IM3 A;  1FOE A;  3PRE A;  1YIW A;  1N5W A;  4TYZ A;  3KVF B;  2RGF A;  4EJN A;  2NCN A;  2ZNV B;  1NI2 A;  2GCJ A;  3KUZ A;  5BYR A;  1WGQ A;  4NSW A;  4MGZ E;  3QHT A;  4XWX A;  3OG5 A;  2M38 A;  2WQY B;  2BS3 B;  4BVU C;  2YRY A;  2HDE A;  4KX6 B;  4JKH A;  1WZ3 A;  4II2 B;  2Z0P A;  2I5F A;  1DDW A;  2J0M A;  2BWE S;  3ZJV A;  3A8Q A;  3RMK C;  2RVB B;  3IBE A;  1T0Y A;  2MJD A;  1QOF A;  2D11 A;  2L3Z A;  1DGJ A;  1L0V B;  3P1M A;  1J0W A;  4KDL B;  2NBU A;  1WM3 A;  2O2V A;  2QIE B;  1Q1O A;  1SB3 C;  1X05 A;  4FHK A;  1WXA A;  4ZRP A;  4K3C A;  4MT5 A;  4MT7 A;  1L0Y B;  2FJ9 A;  3CXB B;  1LGR A;  4WAA A;  3U30 A;  3W1Y A;  3KH0 A;  5IJM A;  2KAJ A;  1IYF A;  1BML C;  2N4F A;  3ZJT A;  1MG4 A;  2CRF A;  3PHX B;  3SUZ A;  1CQV A;  3T3O A;  4FXC A;  2LKO A;  3DBH B;  1WGY A;  2ELB A;  5BYS A;  2J4X A;  3IAM 1;  2KDF B;  4JLC A;  2REX A;  4F8C B;  4HK2 A;  3DBS A;  4HPP A;  5IA7 A;  3U7D A;  2NZ8 B;  1JW9 D;  1D6E C;  4E3C A;  1LO5 D;  1L7Y A;  2WXI A;  4CYE A;  1SF0 A;  3NVY A;  3B2G A;  4PK1 A;  2KD0 A;  1LQB A;  1BTN A;  1WE6 A;  3AEB B;  2ZPY A;  4HB2 B;  1V6E A;  1R4N B;  3ZRF A;  3AE1 B;  1YQ3 B;  4FBJ B;  3APF A;  1KC7 A;  1PLS A;  3KUD B;  1MI1 A;  1EGX A;  4RFB A;  1EAZ A;  3UI3 A;  4USA A;  2RDB C;  4DIX A;  2VSZ A;  2WXH A;  4ZHP A;  3RUI B;  3PPA A;  3MJW A;  5C3J B;  1ZDX A;  1UGJ A;  3GYO A;  3DXC A;  1D5M C;  4EMO A;  2K00 A;  2P0H A;  2DTC A;  1V81 A;  4GXB A;  3I9V 1;  1ZVR A;  3RNE C;  5BYQ A;  3VRA B;  1C4P A;  3KUC B;  4Y94 A;  2Q5W D;  1YN4 A;  5L81 A;  4JL9 A;  4GDL B;  4A6K A;  4WWP A;  3HSA A;  2K39 A;  3KZ1 A;  2LGY A;  1KLU D;  3IG3 A;  5HFY A;  1ACC A;  3R66 C;  5DPT A;  2COP A;  2KC1 A;  3T3N A;  1RJ2 A;  4GZU A;  3ZDM C;  1TTN A;  1F0Z A;  2ASQ A;  2WXQ A;  4YON A;  3NUH B;  4WWO A;  1K51 A;  1PGA A;  5EE0 A;  1WI0 A;  5AZH A;  1WYG A;  2FBW B;  1E6E B;  2W9N A;  4FJY A;  2CS4 A;  3ULB A;  2N7D A;  2MDX A;  2ZCC A;  3M95 A;  1FM0 D;  1FAO A;  3QCA A;  3W2D A;  1IBX B;  3PEG A;  3K9O B;  1V1P A;  2AL6 A;  2WHI A;  1NTV A;  1V86 A;  2ACZ B;  1P98 A;  1IP9 A;  1VZ8 A;  3MTN B;  1XLO A;  4PS7 A;  4S0R A;  3U2S C;  4YXD B;  4KGR A;  3HQC A;  4HCP B;  3A98 B;  2XEW A;  2IYD B;  1K52 A;  4XC2 A;  2MP2 B;  3W9C B;  2E3T A;  2DHI A;  4C4V A;  1Q0W B;  5J3Q A;  2MWN B;  3B77 A;  2E6X A;  5FI0 A;  2K0P A;  3F0W A;  3K9P B;  3BIN A;  4KHB A;  5KHO A;  4LNI A;  2JVC A;  2J7Q B;  4HPM B;  4DX9 0;  1HA5 A;  2ELA A;  2M19 A;  5DPW A;  5LLI A;  3BII D;  5DPR A;  4WVF B;  3CMM B;  2GJY A;  1J7B A;  1I4P A;  3QX1 A;  2LI5 A;  4F7G A;  2KDB A;  3APD A;  4G50 A;  3HIZ A;  2TSS A;  2KWV B;  3ML8 A;  2LMC A;  3AE2 B;  4KHA A;  1Z5S B;  4KAX B;  2N0S B;  2HE7 A;  5I2M A;  1Q67 A;  2BBC A;  2ZVO A;  5C5B B;  1C1Y B;  1DYN A;  3V5W A;  1MG8 A;  4JKE A;  1PGB A;  2EEL A;  2BYE A;  4ANV A;  1B55 A;  1M4V A;  1TS2 A;  2DAJ A;  2XBB C;  3FVC A;  3RNB C;  3PZD A;  1X1G A;  4HHV A;  4DK5 A;  4RF1 A;  5FI1 A;  3ZRC A;  3PTF C;  2CJO A;  3SNH A;  3GZN B;  4A6H A;  5J2R A;  1C4C A;  2G45 B;  3TCA A;  1IGD A;  4C7Z A;  4US8 A;  1D4B A;  5HKH A;  2I1J A;  1MPH A;  1JCK B;  1LB1 A;  2LJI A;  2DX5 A;  2JX5 A;  4GOC A;  1ZW7 A;  5AEK B;  4J6I A;  3V3X A;  4JKF A;  2VRW B;  5CX3 A;  4W9D A;  2K8H A;  2GBM A;  1EWC A;  1HTO A;  1VZ6 A;  2CY4 A;  3GE8 C;  4K81 A;  2RDH A;  4ANX A;  2B3A A;  4ILG B;  2DZK A;  3FLV A;  5BO4 B;  1BT0 A;  2PTL A;  2DWQ A;  1KTK A;  4YL8 A;  4JKG A;  2CKH B;  4OZA A;  3R2I A;  1Y56 A;  1XXG A;  3WAN A;  5TR5 A;  2WXG A;  2L0T A;  2KN4 A;  2QC8 A;  2MWS B;  2NPT B;  1YJJ A;  2YVC A;  1RAX A;  3OJ3 A;  3SD5 A;  4HKZ E;  2KQ7 A;  2G3Q B;  4DXF A;  5HE3 A;  1A70 A;  3N1Z C;  2E2X A;  1XX0 A;  3T06 A;  1RRB A;  4GN1 A;  5LXH A;  1WXS A;  2IZV B;  1TY2 A;  1BTK A;  3L54 A;  4K7S A;  1FCL A;  4JK9 A;  1OEY A;  1C4A A;  4AUQ C;  4PQ0 A;  2DFK A;  1XQQ A;  2BB5 A;  3QQ8 B;  1EWY C;  2KMA A;  3FM8 C;  2Y7B A;  2M56 B;  2EC1 A;  1RM6 C;  1FGZ A;  1JWA D;  1MPE A;  2OOB B;  3P7Z A;  2HD5 B;  4LJP B;  4JKD A;  2FCQ A;  3M62 B;  2GBK A;  2KX3 A;  1K5D B;  2LUM A;  3H9D A;  3LJU X;  4JKB A;  2KX0 A;  4I6P A;  5IKC M;  2LXA A;  3KW5 B;  4KHO A;  3A1Q A;  3ZXR A;  1OQQ A;  3SR6 A;  5C6R A;  4YTN B;  1VD2 A;  2BVC A;  4JK8 A;  3ZTD A;  4EZK A;  1J0G A;  2BYF A;  1UPQ A;  2FUH B;  1Z87 A;  2Z59 A;  5C23 A;  1ZXH A;  1F2R I;  4GDK A;  1XF5 L;  4FUL A;  1N61 A;  3UGB B;  4BKT A;  1U5D A;  2NMQ A;  2OHF A;  4JX1 C;  4I6L B;  3SFE B;  5CLL B;  1HE8 A;  3GE3 C;  3HVZ A;  3HK0 A;  2RR9 A;  4W9E A;  3WAO A;  2L76 A;  3IVF A;  3C8Y A;  2EKE C;  1TS3 A;  2EMS A;  3DWM A;  2H7D A;  3ODW A;  3NZS A;  4HEA 1;  3RN9 C;  2N9L A;  4NZL B;  1XD4 A;  2DAF A;  3GZN I;  4W9L A;  1XKE A;  2DLW A;  1WXQ A;  1U5E A;  1F52 A;  1ACA A;  2R2Q A;  1P3R A;  2KTR A;  4IUM B;  3AH7 A;  3QC8 B;  1V5O A;  4OVZ A;  4AS1 A;  2LFI A;  2R2O A;  1NVI D;  3ZQ4 A;  4XYC A;  3E9L A;  1M7R A;  1FGY A;  3U4E G;  5D3D A;  1KLV A;  1PFD A;  1E8X A;  2V3N A;  1DIK A;  3ZNH B;  1NU2 A;  5CHW A;  1MFW A;  4HB3 B;  1FNV A;  5JHG A;  2INC C;  4HAU B;  1L0X B;  4FA6 A;  3N1X C;  3Q3O C;  2KQ4 X;  1WWT A;  5J18 A;  1ESF A;  2KVZ A;  2DHZ A;  5EFX A;  3F5R A;  2IGH A;  4MSM B;  1SIJ A;  3KWV A;  2BGF A;  1JDE A;  1YJ1 A;  3TUO A;  4EKU A;  3NOB A;  1MK9 B;  1XCT L;  4WAF A;  5BMG A;  2WDV B;  3EUB 2;  4KSK C;  3TEZ A;  2Z59 B;  3BK2 A;  2C60 A;  1E8Z A;  1TY0 A;  3U8Z A;  1WGK A;  1WGH A;  2LVQ A;  4NJ7 A;  1R4M B;  3ENE A;  3RZF A;  1R4N I;  4BZA A;  3RT3 B;  3CIR B;  1S1Q B;  4HAW B;  2PE9 A;  1E7P B;  3A33 B;  2RD0 A;  2LEK A;  3PVL A;  4A5K A;  1IGC A;  4MAC A;  1ZOY B;  4ARC A;  4LNK A;  1V80 A;  1I35 A;  1GJZ A;  1GG3 A;  1AWE A;  3QA8 A;  2DHK A;  2OQB A;  2J52 A;  2KAC A;  1VRA B;  2LUL A;  4XDC A;  4NJC A;  4HAZ B;  5FR3 A;  2L83 A;  5D3W A;  2KN5 A;  2MW5 A;  4IM0 A;  5KHQ A;  1V88 A;  2L05 A;  1VLB A;  3H8H A;  1WG7 A;  3NW8 A;  4OT1 A;  4D2K A;  5CHV C;  1KZG A;  3JYU A;  2PMV A;  3PT2 B;  2JRI B;  1GUA B;  3AB5 A;  1L4D B;  2D3A A;  1IBX A;  2GB1 A;  3IAS 1;  3DXD A;  3B2F A;  3P63 A;  4RH6 A;  2CJN A;  4PS3 A;  1Y5O A;  5JHH A;  3DCX A;  3TMP B;  4FHJ A;  1NDD A;  3SBG A;  2WXL A;  2KVR A;  3MFG A;  2MRP A;  5JHA A;  3BZD B;  1BUI C;  2KLG A;  2NBV B;  4NY0 A;  3UF8 A;  2AQ3 B;  4KKJ A;  1I7A A;  1E8W A;  2JF5 A;  3UIP B;  4MGK E;  5FR6 A;  4GIV A;  1FNW A;  5HHD G;  3ZW3 A;  3N1Y C;  1JAL A;  4DQO C;  3HM3 A;  1FPY A;  2PVG C;  5IP4 D;  1TKG A;  5DHA B;  3CF6 E;  3ENB A;  1QC6 A;  3SO6 A;  1KJT A;  5D3V A;  1AAR A;  2DZJ A;  4B95 A;  2HJ1 A;  1YN5 A;  4N58 A;  1N6Z A;  4GU2 A;  4H8S A;  1XLP A;  2KMC A;  2KFJ A;  2FE8 A;  3NS1 A;  2M0X A;  4AJY B;  1T0Q C;  5H92 C;  4RMA A;  1T5X D;  3WAP A;  3VFK A;  4PT5 A;  4KZC A;  2G1E A;  3VOQ A;  1DDM A;  2LGD A;  4JKA A;  1WI1 A;  3AM9 A;  2MSE D;  3QIJ A;  1E7V A;  3M63 B;  3AU5 A;  1SBB B;  2DEN B;  2D9W A;  2UU7 A;  1ZXI A;  1HZ5 A;  4A6Q A;  2OED A;  4QJ5 B;  2NBV A;  1XLQ A;  1D3Z A;  2H7E A;  2YS5 A;  4JQW C;  1V49 A;  1H10 A;  2BB6 A;  3UQB A;  1SE4 A;  2FDQ A;  4HB4 B;  4HXD A;  4RF0 A;  1QOB A;  1MIZ B;  4ZYN A;  3D8D A;  1YJI A;  4HAX B;  1RLF A;  4K3B A;  5EDS A;  4ZDV A;  2BF8 B;  1FNU A;  2O2V B;  3LJ3 A;  3AEG B;  1SJE D;  4W9J A;  5D94 A;  2ROZ B;  2LXC A;  4C80 A;  2IY0 B;  2KC2 A;  3A4R A;  4LCD E;  1TIF A;  3JW0 X;  4MH8 A;  2WXP A;  4JKG B;  3QAQ A;  4MGI E;  2HJ8 A;  1B9R A;  2PLP A;  2L32 A;  2V9H A;  1WSP A;  1VJK A;  1WGD A;  2AYO B;  1UNR A;  2WXK A;  2DYQ A;  3P4S B;  4CHK A;  4KGT A;  3PRM B;  3U12 A;  1MAI A;  3D32 A;  2FID A;  1JQ4 A;  1XO3 A;  3ZVV A;  4ICV A;  2M1M A;  4RGN A;  1BWN A;  3HRD D;  3U7Z A;  1F77 A;  4YTP B;  1TS4 A;  2CQU A;  3V60 A;  2Z4D A;  2Z0D B;  3V05 A;  3EFU A;  2M17 A;  4GPT B;  2QJL A;  2I5C A;  4A20 A;  1SEB D;  4K17 A;  2LVO A;  1KLG D;  2K8C A;  1EF1 A;  4K2O A;  2H88 B;  4A8X C;  4M01 A;  4DDI D;  2YEP B;  1LW3 A;  4MY6 A;  4F7U P;  3P4Q B;  4BAX A;  4GDL A;  5D6J B;  1DRO A;  2C7H A;  3VXW A;  1WMH A;  2I38 A;  5DHF B;  3OAN A;  2EMT A;  2C5L C;  1Z2M A;  4WWN A;  1UF0 A;  1I7H A;  1U2B A;  2VH2 A;  4J3O D;  5GOW B;  2Y8G A;  2KFK A;  2WU2 B;  4A6F A;  3TIX A;  1U5G A;  3RNG C;  3RNC C;  1B1Z A;  1N3H A;  4WIP A;  4HB0 B;  2K5P A;  2L1A A;  1W1H A;  2M14 A;  2YT1 A;  4GOU A;  2KWC A;  3ML4 A;  1EO6 A;  4WH4 A;  2Z14 A;  1QIL A;  3GB1 A;  3EC8 A;  4MM3 B;  3LXF A;  4XZ4 A;  1C3T A;  2UZS A;  1HB6 A;  3NSU A;  4PYZ A;  2JYT A;  3KLS X;  2D3B A;  2CHX A;  3ODO A;  4HSI A;  4MDK E;  1TZO A;  4WJP A;  2KJH B;  3IFW B;  2KHW B;  2W55 A;  2ZKM X; 
#chains in the Genus database with same CATH homology
 3NZU A;  2FAZ A;  1WX8 A;  1TXD A;  2LZ6 A;  2DZI A;  4HAT B;  2LOZ A;  2FIF A;  3MHS D;  4GGQ A;  3M1I B;  4F7H A;  5JLJ B;  2ABD A;  4Z2M B;  5JZE B;  3TO1 A;  3ZDT A;  1NVL A;  4G11 A;  5HE1 A;  3BJI A;  2KOX A;  2JY6 A;  3MDB C;  2ZCB A;  2NVU I;  4IWQ A;  1SIF A;  4URK A;  3O96 A;  2KJR A;  2KK8 A;  3WAL A;  1DBH A;  4ILH A;  2IO2 B;  2AWT A;  2BKR B;  2D07 B;  2CU1 A;  5E6N A;  2Y5B B;  4MJS A;  1VBH A;  2D9X A;  3VH3 B;  1WXV A;  4BBK A;  3SHQ A;  2G4S A;  1FB8 A;  1PQS A;  1MK7 B;  4W9K A;  3ZO5 B;  2MBQ A;  1BAK A;  4M0W B;  2PEA A;  5E6P A;  3HHM A;  1U4A A;  4WJQ A;  2JUO A;  4FAD A;  3ZTC A;  1V5P A;  1RFA A;  4HLE A;  2YS1 A;  3DBR I;  4MEM A;  3RYT A;  1WY8 A;  2HTH B;  5IAA C;  2R09 A;  1U29 A;  2KQS A;  2JXX A;  1WGR A;  2ZPN A;  4ASW C;  1ZKH A;  4G0N B;  3JSV B;  2CB8 A;  4DHJ B;  2KZR A;  3N32 A;  2KKC A;  3CSF A;  3WAM A;  1WJM A;  2M8S A;  1FHX A;  4E74 A;  5KQ1 A;  4OVV A;  4EZJ A;  2JRH A;  1J19 A;  5D3Y A;  4HVB A;  3WYF B;  2JP2 A;  1KBL A;  2MBB B;  3VUX A;  2K8B A;  3UIN B;  1ZC4 B;  2QKM A;  4LJO B;  2MCN B;  5C1Z A;  4BKS D;  4II3 B;  2J0K A;  3PG7 A;  5D7G A;  3E66 A;  2P0D A;  2MFQ A;  3Q3F A;  3KYC D;  3PHW B;  2R0D A;  2W2X D;  4M8N A;  2KO3 A;  4IWP A;  2ZJD A;  2DX5 B;  4MH0 E;  2PPH A;  1A5R A;  4GMV A;  1QZE A;  2O6V D;  4M8M A;  2LD9 A;  4DWF A;  1Y8R C;  1LM8 B;  2V4L A;  4BBN F;  4DHJ D;  2RLO A;  4MGY E;  2D2Q A;  3QBV B;  3V6C B;  2J0J A;  2LVP A;  1WMH B;  2WH5 A;  3UQA A;  1K8R B;  1P9D U;  2KNB A;  1OQN A;  1ISN A;  2DX1 A;  1V9J A;  2WDT B;  1WM2 A;  1WIA A;  2KLC A;  3AUL A;  3E9O A;  2I1K A;  2D9Z A;  1LFD A;  2WX1 A;  3PSE B;  4MM3 A;  4KHB B;  1IRS A;  5G2N A;  4KDI C;  4F7Z A;  2G4D B;  1R4M I;  4LDT D;  1WVH A;  3CIK A;  2MLB A;  4DBB A;  2NBW B;  5J3T A;  4WJN A;  1XOD A;  1P1A A;  4A6F B;  2GBN A;  4ZRI A;  2KTF A;  2IY1 B;  1ST7 A;  4NAW A;  1TZ1 A;  2Z0E B;  1WFY A;  2W2X C;  1Q5W B;  1DDV A;  3P6A A;  1NTI A;  3N7C A;  3W1S C;  5C5B A;  1U27 A;  4GDK B;  2R82 A;  3EEC A;  3DPD A;  1UEF A;  3V62 A;  3FSS A;  2DYM A;  3A1Q B;  4FLH A;  1KI1 B;  2KFK B;  4GMX B;  2Q13 A;  3V61 A;  1XT9 B;  3VUY A;  2HTH A;  5LON B;  1SHC A;  2WYQ A;  3DXE A;  4NJ6 A;  1E5W A;  4ICU A;  3PRZ A;  3TVV A;  3L10 B;  1AQC A;  1K5G B;  3KYD D;  2W2W A;  1J8C A;  5KQ4 A;  3JVZ X;  1TJ6 A;  1SGH A;  4B6W A;  1V2Y A;  2UVM A;  4MSQ B;  5AZF A;  1V5U A;  3RUL A;  1W1G A;  1WX9 A;  1XCG A;  4MEL A;  3HW2 B;  2Z0O A;  2M4N A;  3ZKJ C;  2MKR A;  2C9W B;  1HBK A;  3BY4 B;  4BKG A;  3DBH I;  4WJ7 A;  1X86 A;  3ONS A;  5C79 A;  4KVG B;  1TBE A;  3FP5 A;  1KZ7 A;  2VRR B;  1IPG A;  2FJL A;  5J3Y A;  5DI9 B;  1H8C A;  4P7I A;  1UNQ A;  4GB9 A;  4D0N B;  5E6O A;  2L1C A;  3ZNI D;  2DKQ A;  3NY5 A;  2GBR A;  2HRJ A;  1XR0 B;  3JSV A;  3N3K B;  4TUU A;  2CY5 A;  2D9Y A;  2N0Y A;  4DHZ B;  2DN6 A;  1VBG A;  4C0A A;  1YQB A;  5CHF A;  3SV1 A;  2IBI B;  3QWZ B;  2GMI C;  1YX5 B;  1EUV B;  4NAW B;  3ZNG C;  1X1F A;  4I6N B;  2J59 M;  2WX0 A;  4TQ1 A;  4L6E A;  4NPN A;  1E8Y A;  3X0W A;  2LBB A;  2YF0 A;  1OGW A;  4W9C A;  2QHO A;  1WGG A;  2RNR B;  4OVU A;  2EJ8 A;  2MBE A;  2OJR A;  3SDL C;  3DDC B;  3DCG A;  3A9J A;  2DYO A;  3ML9 A;  2L00 B;  3Q3J A;  1MIX A;  1WF9 A;  3V6E B;  4FN2 A;  2C7N B;  4NQK E;  3M3J A;  4IOY X;  3TL5 A;  4BOZ B;  2C7M B;  2A5U A;  3CST A;  2NS5 A;  4DBG A;  2KJ6 A;  4E71 A;  2PE6 B;  5CTR C;  4PYU A;  3P2B A;  1GC7 A;  2V1Y A;  2RPQ A;  2K6D B;  2K2J A;  3L13 A;  1I2H A;  1GNU A;  3OAW A;  5J17 A;  3R7R A;  4CO7 A;  2JZ3 B;  3VH4 B;  3T8M A;  4BFR A;  3MPX A;  1E7U A;  5LXI B;  3VDZ A;  3QK0 A;  3RD2 A;  1HB8 A;  5C16 A;  4W9F A;  2LOX A;  1CMX B;  3A4S C;  2IFS A;  3UIO B;  5JHB A;  4NQL B;  2DHJ A;  2GOW A;  5KCV A;  3L0W B;  1WR1 A;  4ZRK A;  4FJZ A;  1WGU A;  2CR5 A;  1FHW A;  3VAW A;  1FXT B;  1OMW A;  5HE2 A;  1UZX B;  1YD8 U;  1RRP B;  2N1W A;  3ECI A;  4JGH B;  4ANW A;  5DH9 B;  1L2N A;  1V5M A;  2RQ1 A;  3VUW A;  2V3S A;  3PRP B;  2FCS A;  1WX7 A;  1UBQ A;  2BCJ A;  2K2U A;  2ZZP B;  5DIF B;  5L83 A;  2A4Z A;  2BPS A;  4HDO A;  4GSW A;  3EPY A;  3APC A;  3ZUN A;  3T9L A;  1OEY J;  2XQN M;  3HM6 X;  4IC7 B;  3WIM A;  2FCN A;  4W9I A;  3A8P A;  4AJW A;  2COF A;  2MBH A;  3RCP A;  2G35 A;  3UZT A;  3B0A A;  3DOW A;  2RSG A;  2CAY A;  4TQ0 A;  3SBT A;  4A3P A;  2FCM A;  4EOY A;  2DIK A;  2O6V B;  2D10 A;  2AEH A;  3VIA A;  4IG7 B;  2IO1 B;  3DQV A;  4W9G A;  3VTW A;  3H7P A;  2LUE A;  3B1L X;  1SE9 A;  1M7E A;  3L17 A;  3SYX A;  3PSC A;  2ZEQ A;  4FJV B;  2LYD A;  1V89 A;  1WE7 A;  2N23 A;  2CHW A;  4KZ0 A;  2L2I A;  1WR6 E;  1XD3 B;  3PVU A;  5DPS A;  4MJS B;  1OTR B;  1P3Q U;  4KIK A;  2N9E B;  3TW1 A;  1V5T A;  1X11 A;  5D27 A;  2K25 A;  1ZSQ A;  2D4Q A;  4ANU A;  3A9K B;  2LG1 A;  4KIK B;  2YS3 A;  3W1S A;  5GMV A;  3ALB A;  2D3G A;  2MBO A;  2NMB A;  4EEW A;  3PS6 A;  1EVH A;  2K6Q A;  3AJ4 A;  3G9W A;  3RZW C;  1ZGU B;  1Y19 B;  1UNP A;  2COD A;  3GOE A;  3DVG Y;  4PNK A;  4WQO B;  4DDG D;  3ZIM A;  1GGO A;  4HDQ A;  1NBF C;  3I3T B;  3KRX A;  4XX5 A;  3PP2 A;  2MQJ A;  2NPT A;  1GC6 A;  3ODX A;  1UD7 A;  1WJN A;  4F1S A;  3GYP A;  2L0F A;  5L95 C;  4IM2 A;  4HAV B;  4TKN A;  2D9V A;  3D8F A;  3D8E A;  1S3S G;  4KSL C;  3O65 B;  2BWF A;  2L8J A;  2Y8F A;  5JH5 C;  4B9K A;  2LGX A;  2BYV E;  4HJK A;  3A9K A;  2COA A;  3H7S A;  3RCZ A;  1F9J A;  2DA0 A;  2N9X A;  2GCL A;  3LDZ E;  3AI5 A;  1E90 A;  3VQI A;  1H4R A;  2RSU A;  3PLU A;  2NR2 A;  5G55 A;  3ZNZ B;  2GBJ A;  3OJ4 B;  2LWP A;  2IYB A;  1ZM0 A;  2DYB A;  1JRU A;  2VKI A;  1KM7 A;  5CLQ B;  2UYZ B;  3KY9 A;  3AXC A;  2BKF A;  1KOT A;  1G6J A;  1NTY A;  1WJ6 A;  4JKC A;  4BOS C;  3DVN U;  1P0R A;  2AL3 A;  3ZLZ A;  4EFO A;  2CHZ A;  4CHM A;  2ZVN A;  3DVN V;  2K1F A;  3FEH A;  2IO3 B;  2YT0 A;  2JZZ A;  1ZC3 B;  2P8V A;  3X23 A;  3R7Q A;  2KCJ A;  3VTU A;  1M94 A;  4WSF A;  1UPR A;  2LJ5 A;  2QKL A;  4AOF A;  4A3O A;  1U5F A;  2N7E A;  3DBL I;  2KAN A;  4Z2N A;  1WJ4 A;  2KGX B;  2WWZ A;  1VCB A;  1TGZ B;  3VHT C;  3PVW A;  1WYW B;  1W1D A;  3R3M A;  5JP4 A;  3TJP A;  4BBN C;  2PZ1 A;  3VTV A;  1P6S A;  3TFM A;  4MK0 A;  2MA9 B;  2RGN B;  2KDE B;  3PGE A;  4K1R B;  3C0R B;  2YLM A;  3A9J B;  4HAY B;  1LXD A;  4EUT A;  2LRU A;  2KTR B;  4PS8 A;  3NHE B;  1OY2 A;  4W9H A;  1UEL A;  4RM8 A;  3QAR A;  1P5T A;  3OLM D;  3PLV A;  2LAS A;  2FNJ B;  2P0F A;  3ZVR A;  4CHJ A;  3B08 A;  2ZNV C;  1UGM A;  4HPL B;  4TV3 A;  2JWZ A;  5HE0 A;  3IHP C;  1WZ0 A;  3L08 A;  1WJ1 A;  2V76 A;  1PMS A;  2GS0 A;  3TBL D;  4EZL A;  2N1V A;  4IAP A;  2XK5 B;  2DYN A;  1WXM A;  2N9P C;  2MP2 A;  2KUP A;  4JIO U;  1PFJ A;  4K7U A;  4WJO A;  2KDI A;  2PJH A;  4HCN B;  3N30 A;  1QQG A;  3H1U A;  2JT4 B;  3H6N A;  4NNJ B;  3H7P B;  4ILJ A;  2MX2 A;  4IFS A;  2O6V A;  4LDT B;  3QWM A;  3ULC A;  3VVW B;  1UBI A;  2KWU B;  2XK5 A;  2DZM A;  2KXJ A;  2YSZ A;  1EF5 A;  5LOP B;  3NS8 A;  4AP4 C;  2JPH A;  4JK7 A;  4K2P A;  4RM9 A;  3EHV A;  2UZR A;  1X1M A;  2ROV A;  4K7W A;  5D3X A;  3DVG X;  1OQY A;  2OTX A;  1TQZ A;  3QJZ A;  2Z0Q A;  4BKS A;  3L16 A;  2X0S A;  3E9P A;  4AWJ A;  4DXA B;  4ZRJ A;  1MKE A;  5DCN A;  4HWI B;  5AZG A;  3AU4 A;  2L7R A;  4IWO A;  4N9F 4;  2X18 A;  2IO0 B;  3SU8 X;  1WH3 A;  4DHZ E;  1V61 A;  2ADZ A;  1FHO A;  4KV2 A;  4G3X B;  2LRW A;  3KRW A;  2COC A;  2RUK B;  3KSY A;  4IW0 A;  3PV1 A;  4X57 B;  1YX6 B;  5JVL A;  1WRD B;  3WA0 A;  4B6H A;  1UH6 A;  2UWQ A;  5D2M B;  4DX8 A;  2DKP A;  1I42 A;  3S2A A;  1WJU A;  4IM3 A;  1FOE A;  3PRE A;  1YIW A;  4TYZ A;  3KVF B;  2RGF A;  4EJN A;  2NCN A;  2ZNV B;  1NI2 A;  2GCJ A;  3KUZ A;  1WGQ A;  4NSW A;  4MGZ E;  3QHT A;  4XWX A;  2M38 A;  4BVU C;  2YRY A;  4JKH A;  1WZ3 A;  4II2 B;  2Z0P A;  2I5F A;  1DDW A;  2J0M A;  2BWE S;  3A8Q A;  2RVB B;  3IBE A;  1T0Y A;  2D11 A;  2L3Z A;  1J0W A;  4KDL B;  2NBU A;  1WM3 A;  2O2V A;  1Q1O A;  1X05 A;  4FHK A;  1WXA A;  4MT7 A;  3W1Y A;  2FJ9 A;  3CXB B;  4WAA A;  3U30 A;  3KH0 A;  5IJM A;  1IYF A;  2N4F A;  2CRF A;  3PHX B;  3SUZ A;  2LKO A;  1WGY A;  2ELB A;  2KDF B;  4JLC A;  4F8C B;  2REX A;  4HK2 A;  3DBS A;  5IA7 A;  3U7D A;  2NZ8 B;  4E3C A;  1L7Y A;  4CYE A;  2KD0 A;  1LQB A;  1BTN A;  1WE6 A;  2ZPY A;  4HB2 B;  1V6E A;  3ZRF A;  4FBJ B;  3APF A;  1KC7 A;  1PLS A;  3KUD B;  1EGX A;  1EAZ A;  2VSZ A;  3RUI B;  3PPA A;  3MJW A;  3GYO A;  3DXC A;  4EMO A;  2K00 A;  2P0H A;  2DTC A;  1V81 A;  4GXB A;  1ZVR A;  3KUC B;  4Y94 A;  5L81 A;  4JL9 A;  4GDL B;  4A6K A;  4WWP A;  2K39 A;  3KZ1 A;  2LGY A;  3IG3 A;  3R66 C;  5DPT A;  2COP A;  2KC1 A;  1RJ2 A;  4GZU A;  3ZDM C;  1TTN A;  2ASQ A;  4YON A;  4WWO A;  1WI0 A;  5AZH A;  2W9N A;  4FJY A;  2CS4 A;  3ULB A;  2N7D A;  3M95 A;  2MDX A;  2ZCC A;  1FAO A;  3QCA A;  3PEG A;  3K9O B;  2AL6 A;  1NTV A;  1V86 A;  1P98 A;  1IP9 A;  3MTN B;  4PS7 A;  3HQC A;  4HCP B;  3A98 B;  2XEW A;  2IYD B;  4XC2 A;  2MP2 B;  2DHI A;  1Q0W B;  5J3Q A;  2MWN B;  5FI0 A;  3F0W A;  3K9P B;  3BIN A;  5KHO A;  2JVC A;  2J7Q B;  4HPM B;  4DX9 0;  2ELA A;  5DPW A;  5LLI A;  5DPR A;  4WVF B;  3CMM B;  2GJY A;  3QX1 A;  2LI5 A;  4F7G A;  2KDB A;  3APD A;  4G50 A;  3HIZ A;  3ML8 A;  2KWV B;  4KHA A;  1Z5S B;  4KAX B;  2HE7 A;  1Q67 A;  2ZVO A;  5C5B B;  1C1Y B;  1DYN A;  3V5W A;  1MG8 A;  4JKE A;  2BYE A;  4ANV A;  1B55 A;  2DAJ A;  2XBB C;  3PZD A;  1X1G A;  4HHV A;  4DK5 A;  5FI1 A;  3ZRC A;  3PTF C;  3SNH A;  4A6H A;  5J2R A;  2G45 B;  3TCA A;  5HKH A;  2I1J A;  1MPH A;  1LB1 A;  2DX5 A;  4GOC A;  1ZW7 A;  5AEK B;  4J6I A;  4JKF A;  2VRW B;  5CX3 A;  4W9D A;  2K8H A;  2GBM A;  2CY4 A;  4K81 A;  4ANX A;  2B3A A;  4ILG B;  2DZK A;  3FLV A;  5BO4 B;  1BT0 A;  4YL8 A;  4JKG A;  2CKH B;  3WAN A;  5TR5 A;  2L0T A;  2MWS B;  2NPT B;  2YVC A;  1RAX A;  3OJ3 A;  3SD5 A;  2KQ7 A;  2G3Q B;  5HE3 A;  2E2X A;  1XX0 A;  3T06 A;  1RRB A;  4GN1 A;  5LXH A;  1WXS A;  2IZV B;  1BTK A;  3L54 A;  4K7S A;  4JK9 A;  1OEY A;  4AUQ C;  4PQ0 A;  2DFK A;  1XQQ A;  3QQ8 B;  2KMA A;  3FM8 C;  2Y7B A;  2EC1 A;  1FGZ A;  2OOB B;  3P7Z A;  2HD5 B;  4LJP B;  4JKD A;  2FCQ A;  3M62 B;  2GBK A;  2KX3 A;  1K5D B;  3H9D A;  3LJU X;  4JKB A;  2KX0 A;  4I6P A;  2LXA A;  3KW5 B;  4KHO A;  3A1Q A;  5C6R A;  1VD2 A;  4JK8 A;  3ZTD A;  4EZK A;  1J0G A;  2BYF A;  1UPQ A;  2FUH B;  1Z87 A;  5C23 A;  4GDK A;  4FUL A;  3UGB B;  4BKT A;  1U5D A;  4I6L B;  5CLL B;  1HE8 A;  3HK0 A;  2RR9 A;  4W9E A;  3WAO A;  2L76 A;  3IVF A;  2EKE C;  2EMS A;  2H7D A;  3ODW A;  3NZS A;  1XD4 A;  2DAF A;  3GZN I;  4W9L A;  1XKE A;  2DLW A;  1U5E A;  1ACA A;  2R2Q A;  1P3R A;  2KTR A;  4IUM B;  3QC8 B;  1V5O A;  2R2O A;  3E9L A;  1M7R A;  1FGY A;  1KLV A;  1E8X A;  1DIK A;  3ZNH B;  1NU2 A;  5CHW A;  4HB3 B;  5JHG A;  4HAU B;  4FA6 A;  5J18 A;  2DHZ A;  5EFX A;  3F5R A;  4MSM B;  2BGF A;  1JDE A;  1YJ1 A;  4EKU A;  3NOB A;  1MK9 B;  4KSK C;  2Z59 B;  2C60 A;  1E8Z A;  3U8Z A;  1WGH A;  2LVQ A;  4NJ7 A;  3ENE A;  3RZF A;  1R4N I;  3RT3 B;  1S1Q B;  4HAW B;  2PE9 A;  3A33 B;  2RD0 A;  3PVL A;  4A5K A;  1V80 A;  1I35 A;  1GJZ A;  1GG3 A;  1AWE A;  3QA8 A;  2DHK A;  2OQB A;  2LUL A;  4HAZ B;  5D3W A;  2KN5 A;  2MW5 A;  4IM0 A;  5KHQ A;  1V88 A;  2L05 A;  1WG7 A;  5CHV C;  1KZG A;  3JYU A;  3PT2 B;  2JRI B;  1GUA B;  3DXD A;  4PS3 A;  1Y5O A;  5JHH A;  3TMP B;  4FHJ A;  1NDD A;  3SBG A;  2KVR A;  2MRP A;  5JHA A;  2KLG A;  2NBV B;  4NY0 A;  3UF8 A;  1I7A A;  1E8W A;  2JF5 A;  3UIP B;  4MGK E;  5FR6 A;  4GIV A;  3ZW3 A;  3HM3 A;  3CF6 E;  5DHA B;  3ENB A;  1QC6 A;  3SO6 A;  1KJT A;  5D3V A;  1AAR A;  2DZJ A;  4B95 A;  4GU2 A;  4H8S A;  2KMC A;  2KFJ A;  2M0X A;  4AJY B;  3WAP A;  4RMA A;  3VFK A;  4KZC A;  3VOQ A;  1DDM A;  2LGD A;  4JKA A;  1WI1 A;  2MSE D;  3QIJ A;  1E7V A;  3M63 B;  3AU5 A;  2DEN B;  2D9W A;  1D3Z A;  2H7E A;  2YS5 A;  4JQW C;  1V49 A;  1H10 A;  3UQB A;  2FDQ A;  4HB4 B;  4HXD A;  1MIZ B;  4ZYN A;  3D8D A;  4HAX B;  1RLF A;  5EDS A;  4ZDV A;  2BF8 B;  2O2V B;  3LJ3 A;  4W9J A;  5D94 A;  2ROZ B;  2LXC A;  2IY0 B;  2KC2 A;  3A4R A;  4LCD E;  3JW0 X;  4JKG B;  3QAQ A;  4MGI E;  2HJ8 A;  1WGD A;  2AYO B;  1UNR A;  2DYQ A;  4CHK A;  3PRM B;  1MAI A;  3D32 A;  2FID A;  3ZVV A;  4ICV A;  2M1M A;  1BWN A;  2CQU A;  3V60 A;  2Z0D B;  3EFU A;  2M17 A;  4GPT B;  2I5C A;  4A20 A;  4K17 A;  2LVO A;  2K8C A;  1EF1 A;  4K2O A;  4DDI D;  1LW3 A;  4MY6 A;  4F7U P;  4GDL A;  5D6J B;  1DRO A;  2C7H A;  3VXW A;  1WMH A;  5DHF B;  3OAN A;  2EMT A;  2C5L C;  1Z2M A;  4WWN A;  1U2B A;  5GOW B;  2Y8G A;  2KFK A;  4A6F A;  3TIX A;  1U5G A;  1N3H A;  4HB0 B;  1W1H A;  2M14 A;  2YT1 A;  3ML4 A;  2KWC A;  1EO6 A;  3EC8 A;  4XZ4 A;  1C3T A;  2UZS A;  1HB6 A;  3NSU A;  4PYZ A;  2CHX A;  3ODO A;  4MDK E;  4WJP A;  2KJH B;  3IFW B;  2KHW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...