2YVCA

Crystal structure of the radixin ferm domain complexed with the nep cytoplasmic tail
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for type II membrane protein binding by ERM proteins revealed by the radixin-neutral endopeptidase 24.11 (NEP) complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 85
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2yvcA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yvcA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2yvcA01
2HJ8A 5HE1A 4ANUA 2DX5A 5JHHA 4FHJA 3WA0A 1KI1B 1UNRA 4MEMA 5J3QA 2L05A 4MH0E 3UQAA 4HWIB 2MWSB 1U5GA 4G0NB 4LDTB 4FJZA 2WX1A 3SU8X 3D8DA 3ZTDA 5DHAB 2UZRA 2J0MA 3U30A 3TCAA 3V62A 3PVWA 3VOQA 1FB8A 2DLWA 4DX90 2CKHB 2O6VD 5DH9B 3VDZA 2G45B 2HE7A 3EPYA 1IRSA 1P9DU 4EMOA 5DIFB 3VUXA 2N4FA 3DCGA 1FHXA 2CR5A 2ELBA 3F0WA 1XD4A 3IFWB 3PLUA 2WDTB 1X1GA 4K1RB 3ZKJC 1U5EA 3U7DA 5CLLB 1GUAB 2N23A 1UZXB 5C23A 4F7ZA 3MJWA 4IW0A 4NNJB 4K7UA 1V9JA 1WZ3A 3HHMA 2LASA 3ULBA 4ZRKA 2COCA 1WF9A 5CTRC 5HE3A 2YLMA 5E6OA 3WALA 4DBGA 4E74A 4HHVA 3VFKA 4AJWA 1XCGA 3L13A 4ANXA 4K7SA 3ZTCA 1VCBA 3V5WA 4I6NB 3RYTA 3VTWA 4EZJA 5D3WA 3LDZE 1GNUA 3EECA 2Z59B 4GDLA 2BWFA 1X86A 4HAUB 4GSWA 2J59M 1V5TA 1RAXA 1WE6A 1W1DA 1FGYA 3ZIMA 3KUCB 3APFA 3KSYA 4HPMB 5D6JB 2ZVNA 5E6NA 5J17A 1Y5OA 2VKIA 3WYFB 5LONB 1KM7A 1QC6A 2AWTA 2BYVE 2GBNA 3ZUNA 4NAWB 2W2XD 3W1YA 1KLVA 2BCJA 2K8HA 4HDOA 5D3VA 3H9DA 3JVZX 2Y5BB 3GOEA 4GDKA 4TQ0A 3M62B 1DROA 3G9WA 1ACAA 2E2XA 3A8QA 1WR6E 4KAXB 1XKEA 1UELA 2FCMA 2ZCBA 3V61A 5J2RA 1BWNA 2O2VA 2L8JA 4ICUA 4WJOA 5KQ4A 1BTKA 4P7IA 1M7EA 3ZW3A 1SIFA 2CU1A 3EC8A 1V5UA 2EMTA 2AL6A 2IO2B 2KMCA 4NY0A 3L16A 1WVHA 3ZO5B 3DBLI 2Z0QA 3APCA 1OTRB 1OQNA 3OJ3A 4IWQA 5J18A 4NSWA 2DKPA 2KNBA 3QC8B 2MBBB 2IO3B 3L08A 4W9IA 1H8CA 2PE9A 3DQVA 3RUIB 2BPSA 2R2QA 1MAIA 1WGDA 3KY9A 2BKRB 4GIVA 2LRUA 1WXVA 4MJSB 2KXJA 2GBJA 3PZDA 3RULA 2I5FA 1E8ZA 4HJKA 3PREA 4W9JA 2RUKB 4L6EA 2IFSA 2C7MB 2BF8B 2DHZA 2K6DB 2LZ6A 5DPTA 4ZYNA 3N30A 3PHWB 4HAVB 2GBRA 4PS7A 2K2JA 1EO6A 3OJ4B 3R3MA 2V4LA 3UIOB 4BKSA 1Q1OA 2KDIA 4ANVA 5JHBA 5C79A 2RR9A 4EUTA 1WMHA 2KZRA 4JLCA 1MIZB 3PEGA 4DX8A 4J6IA 2MQJA 2M14A 3M95A 1EF1A 5KCVA 1NTYA 3O96A 3A8PA 4GXBA 1UBQA 4GOCA 3CIKA 3VH4B 1KZGA 2FAZA 1EVHA 2J0JA 1J0WA 3D8EA 1DBHA 5FI0A 2KWUB 3V6EB 2I5CA 2N0YA 2RLOA 1MG8A 1YX5B 4WSFA 5G2NA 3ODWA 4CHJA 2GCLA 3PRZA 5EDSA 3WAMA 5JLJB 3MHSD 2JUOA 2LGXA 1X1FA 1C1YB 2HRJA 4TYZA 3MPXA 4KHBB 1WI0A 3BJIA 1UNQA 1ZGUB 1FXTB 2IZVB 2LVQA 4DBBA 2FJLA 2NBUA 3H7SA 3KYDD 4MGIE 5HKHA 2JRIB 3QJZA 4E3CA 4TV3A 3ZRFA 2BKFA 5G55A 5EFXA 1XQQA 3MTNB 4W9EA 2NBVB 2W2XC 2L3ZA 3QA8A 2EMSA 1GG3A 3QK0A 4YONA 2Y8GA 1WJUA 4M8NA 3M63B 3PLVA 3AJ4A 2KTRA 3ENEA 1WJ4A 4EOYA 1V5OA 1U2BA 2Y7BA 1LM8B 2D9VA 3Q3FA 2D9WA 2KO3A 1G6JA 2G35A 5IAAC 3A9KB 1WX9A 2J0KA 4NJ6A 2COAA 3VHTC 4AWJA 5KHQA 2A5UA 2FUHB 4F7UP 3GZNI 2GMIC 1V89A 2H7EA 3B08A 2VRWB 4MJSA 5C5BB 5GMVA 3TO1A 1U5FA 4D0NB 1IPGA 4LJPB 4IWOA 4OVVA 1YX6B 1NTIA 4IAPA 2KJRA 1U4AA 2PPHA 2O6VB 2JF5A 3EHVA 2UVMA 1E90A 2KC1A 2KDBA 2GCJA 1DDWA 2COFA 3U8ZA 1U27A 1F9JA 4AOFA 4C0AA 4A3OA 2Z0EB 2C7HA 4DHZE 2DN6A 2LULA 3SV1A 4A6FA 2ZJDA 3L0WB 2IBIB 4W9DA 4W9CA 4XZ4A 4HAWB 1WGQA 4GDLB 3ODOA 3AULA 2IYDB 1XD3B 3A9JB 3RZFA 4KHAA 1PMSA 2DAFA 3K9OB 4WAAA 3ZNID 2D11A 3KZ1A 3PVUA 3H7PA 3HM6X 4JGHB 4W9GA 3VVWB 5D3YA 4BBNC 4CHKA 1Z2MA 2ROVA 3A1QA 5DPSA 3A9KA 4KSLC 1V88A 3PG7A 3DXDA 3CXBB 2LXAA 2LVPA 3BY4B 4ASWC 2JRHA 3WIMA 2MKRA 1FAOA 4XX5A 1U5DA 3ML8A 1Z87A 1DDVA 5D3XA 2GBKA 3TIXA 2KQSA 5FI1A 2LKOA 5JZEB 3M1IB 4MSMB 3QIJA 4DHJD 3GYOA 2D4QA 2DA0A 3ALBA 4PYZA 3PSEB 1KJTA 4GMXB 1WE7A 2LRWA 2O2VB 1ZM0A 4B9KA 2KK8A 4ZDVA 1JRUA 4EZLA 2ABDA 2K39A 4PS8A 1TBEA 3ECIA 2ROZB 1N3HA 2MBQA 2KTRB 4PNKA 2L0TA 3DBRI 4NPNA 3A98B 2KFKA 4I6LB 3NZSA 3OAWA 1HB6A 2CY5A 4CYEA 1V86A 1EUVB 1NU2A 2JT4B 1HBKA 1OMWA 1Q67A 3N3KB 4RM9A 3WAPA 3SNHA 3ZNGC 2G3QB 4EZKA 2L00B 4GZUA 3LJ3A 1P6SA 2D9XA 2JP2A 1Q0WB 3K9PB 2ELAA 2D3GA 1D3ZA 1MPHA 2LOZA 3HW2B 4B6WA 1NBFC 1Z5SB 4A3PA 1WXMA 1WY8A 4WQOB 2LXCA 2K25A 2G4SA 4G50A 4NQLB 3VTVA 2A4ZA 4IUMB 4MSQB 5L95C 2N1WA 2LOXA 1I7AA 1H10A 3TBLD 1YD8U 3IBEA 4W9FA 2ZVOA 4IM2A 4HCNB 1K8RB 2JVCA 2KN5A 2CAYA 1WXSA 1UD7A 3FEHA 3PP2A 1TGZB 1RFAA 3UZTA 2WX0A 3KW5B 1P5TA 2JXXA 2KGXB 3VUWA 4DK5A 1HB8A 5L81A 2MRPA 2VRRB 1YQBA 4F7GA 1WFYA 2NPTB 2EJ8A 1J8CA 4GDKB 1K5DB 2LD9A 3SYXA 2M8SA 2D9ZA 2FIFA 3NS8A 4FN2A 4KSKC 1LB1A 1E7VA 3TVVA 3PGEA 4X57B 2MA9B 5JHAA 4WWPA 1WIAA 2B3AA 2RSUA 1KZ7A 2RVBB 2RNRB 4JQWC 3PTFC 2OTXA 2HTHB 4MK0A 2LYDA 1PQSA 2FCSA 4KIKB 2KHWB 1BTNA 4G11A 2XQNM 2MP2A 2OOBB 3FSSA 1WX7A 3PT2B 4MDKE 2H7DA 5J3TA 2CRFA 1Q5WB 4K17A 3N32A 3LJUX 3T9LA 1WGRA 2LG1A 3KUZA 4MT7A 2DHIA 4A6HA 3KH0A 2P0HA 4AJYB 4ANWA 2ZEQA 3A33B 2JWZA 4K81A 2C7NB 2KLCA 3RCPA 1DYNA 1MK7B 2XBBC 5D2MB 1UGMA 2PZ1A 4EKUA 2V3SA 4ZRIA 4FULA 1RRBA 1AWEA 2YS5A 4HCPB 3SD5A 1WGGA 3QWZB 5AEKB 4URKA 1ISNA 1P1AA 4KDLB 1E8WA 2DX5B 2UYZB 2DENB 1LFDA 1V2YA 3QQ8B 2MFQA 1WGYA 2D10A 3UGBB 5AZFA 1I2HA 4BVUC 2FIDA 3P7ZA 1U29A 4IWPA 3TMPB 2RSGA 1TXDA 1R4NI 1WJNA 3JW0X 5GOWB 3DDCB 4MGKE 5KHOA 3S2AA 4M0WB 2I1KA 3N7CA 2CY4A 1SE9A 1WM2A 1WRDB 2RPQA 3H1UA 5IA7A 3NOBA 4MGYE 3GYPA 3KYCD 4HLEA 3EFUA 3QCAA 4AUQC 2C9WB 2DZMA 2MLBA 4IG7B 2N7EA 4E71A 1CMXB 3D8FA 4H8SA 2KLGA 3V60A 4EEWA 2L2IA 2P8VA 4JL9A 1BAKA 1FHOA 2KJHB 3CMMB 1X11A 2PE6B 2ZZPB 4LDTD 1V81A 4YL8A 1ZW7A 1WJMA 2VSZA 1OGWA 3IVFA 4Z2MB 1E8XA 2JZ3B 1WYWB 2MX2A 4MM3A 1NTVA 2KKCA 4GPTB 2DZIA 2W2WA 3ML9A 5CHFA 4BOZB 3QBVB 3AI5A 1UPQA 3P6AA 1TTNA 4WJNA 1A5RA 1RRPB 4IC7B 1WH3A 4HB3B 2KWVB 2K2UA 1C3TA 1IYFA 1V49A 2DYNA 2MWNB 1P0RA 3UQBA 1QQGA 2KCJA 2LI5A 1W1HA 3PSCA 1WGHA 3DPDA 1BT0A 4FHKA 4HATB 4NAWA 5C1ZA 1OQYA 2IO1B 2CHZA 1OY2A 1OEYJ 2AEHA 2BWES 1V6EA 3NHEB 3RT3B 2KVRA 4HAXB 3D32A 2V76A 4FJVB 4BKSD 3KVFB 1FHWA 3X23A 4GMVA 5DPWA 4FBJB 3KUDB 5LLIA 4KDIC 4TUUA 3RZWC 4TQ1A 5DPRA 2IY0B 3V6CB 1RJ2A 1NI2A 5HE2A 2WH5A 4JIOU 3X0WA 1E5WA 3SDLC 2GS0A 1M7RA 3HM3A 3CSFA 1V61A 5J3YA 2KQ7A 1LXDA 4F8CB 1ZSQA 5D94A 2QKMA 5CLQB 1I42A 2X18A 2MBEA 2DZJA 2LGYA 3AU5A 1PFJA 2LJ5A 3QAQA 3ZLZA 1I35A 4DXAB 2K8BA 2KJ6A 5KQ1A 4GGQA 1WXAA 1AARA 3RD2A 1EF5A 1T0YA 1XX0A 2N1VA 1ZC4B 2IO0B 3APDA 1YJ1A 4CHMA 4GN1A 2NBWB 4HK2A 1XT9B 2FNJB 4WVFB 4LCDE 2IYBA 2DYBA 4A6FB 2N9XA 4B6HA 4GB9A 3TW1A 4HDQA 2KFJA 3UIPB 4LJOB 1GC7A 1Y8RC 2LGDA 2DYQA 5L83A 2BGFA 2MBHA 2I1JA 5D27A 3QHTA 3R66C 1RLFA 2KOXA 2YF0A 3NY5A 3ODXA 3VIAA 2AYOB 5LOPB 3IG3A 4KZ0A 5C5BA 2FCNA 2HD5B 1EAZA 2M4NA 2R09A 2DYOA 3NZUA 3QARA 4XC2A 3FP5A 4GU2A 3CSTA 3B1LX 2N9EB 3AXCA 4NQKE 5CHVC 3SHQA 2W9NA 3W1SC 1IP9A 1LW3A 1NDDA 3HQCA 4II2B 2R2OA 3KRXA 5E6PA 3ZVVA 3UF8A 3ONSA 2Q13A 2DHJA 2YT0A 3QX1A 4WWOA 2JZZA 4I6PA 2PEAA 2D9YA 2C60A 2PJHA 2CHXA 5AZGA 3ZDTA 4K2PA 3F5RA 3FLVA 5IJMA 2NZ8B 2YSZA 2OQBA 3DXEA 1ZKHA 2XK5B 3DVNU 1ST7A 2KDFB 2FCQA 3JYUA 3AU4A 3VQIA 1PLSA 1ZC3B 1V80A 1FOEA 5DHFB 1M94A 2EKEC 1E8YA 2KFKB 2ZNVC 3O65B 2DZKA 1DDMA 2KTFA 1V5MA 2Z0OA 2QHOA 4DDID 4FADA 2L0FA 4Z2NA 3MDBC 3DVGY 2LBBA 3PHXB 2MCNB 2UZSA 2NPTA 1VD2A 3Q3JA 5LXHA 1MKEA 3VXWA 3ZRCA 2M0XA 1J0GA 3WANA 2L7RA 2DYMA 1NVLA 2N9PC 2LVOA 1X1MA 2XEWA 1HE8A 1WR1A 2CS4A 4PQ0A 2WWZA 3DVGX 4DDGD 5JH5C 3TJPA 4DWFA 1LQBA 4FA6A 3P2BA 4CO7A 4KVGB 3SO6A 2MBOA 3M3JA 4W9KA 2CHWA 3I3TB 3JSVB 2UWQA 3ML4A 3NSUA 1MIXA 2JPHA 5JHGA 3DBHI 1EGXA 4II3B 2L1CA 3L10B 4HVBA 2P0FA 2AL3A 1UNPA 4EFOA 3R7QA 4FJYA 3QWMA 2ZPYA 3SUZA 1P3RA 2KX0A 3A9JA 4HAZB 4W9HA 3UINB 4A6KA 4DHJB 1J19A 2M38A 2MW5A 5JP4A 3HK0A 5C16A 1WX8A 3A1QB 5FR6A 1ZVRA 4EJNA 4F7HA 1WI1A 4G3XB 4HXDA 3B0AA 1OEYA 1K5GB 2GOWA 2KWCA 2ZNVB 2M17A 3H7PB 4IM3A 5C6RA 1YIWA 5CX3A 4BBKA 1WG7A 1W1GA 3BINA 4K2OA 2WYQA 3H6NA 3ZNHB 2K1FA 1V5PA 3PS6A 3OLMD 4DHZB 1GJZA 2GBMA 2KD0A 3PVLA 1TZ1A 1UPRA 2Z0DB 3DVNV 2CB8A 3VAWA 1WJ1A 2OJRA 3JSVA 3PV1A 5HE0A 2D2QA 2DTCA 2YT1A 4A5KA 2O6VA 1P3QU 4RM8A 4MELA 2K8CA 5TR5A 2QKLA 2BYEA 4N9F4 4A20A 2DX1A 1S1QB 2RQ1A 2DAJA 4WJPA 3WAOA 4RMAA 4KV2A 2Z0PA 4WJ7A 4KHOA 4FLHA 3TL5A 1UBIA 1WGUA 2YS3A 2IY1B 1AQCA 2ZCCA 5BO4B 1QZEA 3PRMB 5DI9B 2NCNA 2K00A 3VH3B 4HB2B 3KRWA 3VTUA 3L17A 3DOWA 5AZHA 4IM0A 2LWPA 1UEFA 5DCNA 3TFMA 2NVUI 1TJ6A 2LUEA 1FGZA 2NMBA 3OANA 2COPA 1WM3A 1Y19B 2JY6A 1GC6A 3T8MA 3FM8C 4M8MA 1E7UA 2XK5A 4KZCA 2CODA 3A4RA 4PYUA 1L2NA 3DXCA 2R0DA 4NJ7A 5D7GA 2K6QA 1KOTA 2M1MA 1L7YA 2RGFA 4IOYX 3ZDMC 2KDEB 2L76A 4BBNF 1WZ0A 2ADZA 2J7QB 1UH6A 4OVUA 2V1YA 4ICVA 1WMHB 3C0RB 4MGZE 3ZNZB 3A4SC 3W1SA 4AP4C 2DHKA 2P0DA 2ZPNA 5CHWA 2CQUA 2RGNB 3VUYA 3PRPB 2FJ9A 1X05A 2HTHA 4IFSA 2KMAA 4BKTA 5LXIB 2G4DB 4KIKA 4HB0B 2EC1A 2KC2A 1XR0B 3PPAA 1WJ6A 3L54A 3CF6E 3R7RA 2MDXA 4B95A 4W9LA 2YRYA 4TKNA 1P98A 4WWNA 4Y94A 4F1SA 2DKQA 4PS3A 1SHCA 3ZVRA 2N7DA 1XODA 1S3SG 2NS5A 2NR2A 4BKGA 4MY6A 4XWXA 2DFKA 2BYFA 2KUPA 1B55A 2ASQA 2MP2B 2YVCA 1MK9B 2KX3A 2RD0A 2GJYA 4BOSC 2FDQA 4HPLB 4HAYB 2REXA 2KANA 2Y8FA 3T06A 2D07B 3ULCA 3HIZA 4ZRJA 3RCZA 4K7WA 4BFRA 3DBSA 2YS1A 1H4RA 1R4MI 3IHPC 4WJQA 1SGHA 1TQZA 4HB4B 2MSED 2C5LC
chains in the Genus database with same CATH superfamily
5HE1A 1TIFA 2QCZA 1SEBD 4MH0E 2MWSB 1U5GA 2WX1A 3D8DA 3VRAB 3VR8B 4P1BC 2RDBC 4HRSA 2ACZB 2DLWA 2O6VD 5DH9B 2HE7A 2NMQA 2WGSA 3VUXA 2N4FA 3DCGA 4M02A 3IFWB 2ELBA 3PLUA 1GUAB 1UZXB 3MJWA 3I63C 4NNJB 4K7UA 3HHMA 3ZGZA 4ZRKA 5HE3A 5E6OA 4LNOA 4HHVA 3NVYA 3CWIA 5D3WA 2JSVX 1GNUA 4US9A 2Z59B 2WDQB 1X86A 5C3JB 3OHMB 3AEBB 1FGYA 4MM3B 3KUCB 5AUIA 3KSYA 5D6JB 1Y5OA 1CZPA 1KM7A 1QC6A 2R61A 3ZUNA 4NAWB 1JWMD 1KBLA 3H9DA 4BAXA 1ZE3D 3GOEA 4OW0A 1DOIA 3A8QA 1KTKA 1BWNA 1QILA 1JWAD 4P7IA 3L16A 2QSDA 3DBLI 3OJ3A 1NYQA 1YNTE 2DKPA 3DQVA 2R2QA 1FNVA 1MAIA 4GIVA 3SBTA 2D3AA 3URYA 1OQQA 1C9FA 1MPEA 1D4BA 2GLSA 5D3DA 1R7SA 4HJKA 2RUKB 2BF8B 3ZNID 1EO6A 3EA6A 5HG2A 1WRIA 2RR9A 1WMHA 2KZRA 3Q3OC 3PEGA 2M14A 3M95A 2CJNA 1J0WA 4L2YA 4ZRQA 2KWUB 1YX5B 1M4VA 1FM0D 2G1EA 2GCLA 3NWDA 2LVQA 1WI0A 2IZVB 1FXTB 1GGOA 1NI3A 4QJ5B 4TV3A 3HVDA 2R2YA 3NZ3A 2NBVB 1UUPA 2W2XC 3QA8A 1R4NB 3QK0A 1HTQA 3BYTB 3M63B 2WU2B 2KTRA 1LO5D 1WJ4A 2J4XA 4EOYA 2Y7BA 1LM8B 4KGRA 2D9WA 3A9KB 3KWLA 2E3TA 3VHTC 4AWJA 2ZW1A 3AE5B 5KHQA 4F7UP 2GMIC 1V89A 2VH2A 5GMVA 3TO1A 1SE2A 4DXFA 1WWTA 4HEA1 1U4AA 4JKFA 2PPHA 2GCJA 1DDWA 5IO9A 1SJED 4A6FA 3ODOA 1L6VA 4W9GA 5JVLA 2WXLA 2LXAA 3CXBB 3WIMA 2DIKA 1U5DA 1DDVA 1P7EA 5JZEB 2BB5A 1Q10A 2DA0A 3ALBA 4R3DA 2O2VB 1ZM0A 3Q8FA 4WH4A 2ABDA 2K39A 1IUEA 4PNKA 1V86A 2JT4B 4JKAA 1EUVB 1OMWA 3P63A 4GZUA 3GP7A 2JP2A 2ELAA 1I4XA 4ILJA 2D3GA 2V3NA 1IBXB 2I2YA 1B1ZA 1WY8A 2A4ZA 3V3XA 1H10A 3IBEA 1I4QA 2JVCA 2CAYA 2VH1A 1TGZB 3UZTA 3KW5B 1P5TA 3VUWA 2KGXB 1HB8A 1TYGB 4OZAA 1L4ZB 2XNAC 3SBGA 1K5DB 2M8SA 2LD9A 3NS8A 4KSKC 1FD6A 1CQVA 3TVVA 1L4DB 3EUB2 1MHHE 2RVBB 4JQWC 3PTFC 4OZBA 2HTHB 1MI1A 4KIKB 2KHWB 3FSSA 1WX7A 4MDKE 3RNCC 2H7DA 3N32A 3ZYYX 1IGDA 2LG1A 4MT7A 4ANWA 4K81A 2KLCA 3RCPA 1DYNA 3AMZA 1UGMA 2V3SA 3DBRB 4P6VF 3QWZB 5AEKB 1E8WA 2DX5B 2UYZB 1LFDA 1V2YA 3QQ8B 2X8XX 4ARCA 3UGBB 1I2HA 4L23A 4BVUC 3P7ZA 3NS1A 2NTSA 4IWPA 4BKSA 3B77A 4BBNF 1MHXA 4M0WB 2RPQA 1XCTL 2C9WB 2BBCA 2DZMA 2FBWB 2MLBA 3EFCA 1CMXB 1UWMA 4XYCA 2HTME 1K51A 1XLOA 2QC8A 2KJHB 2ZZPB 1WJMA 4Z2MB 1JWBD 4GPTB 3ENBA 5CHFA 2RDGA 1K52A 1TTNA 4WJNA 1RRPB 2IPKD 4JWSC 2K2UA 3UQBA 2LI5A 1W1HA 1L6UA 1BT0A 2CHZA 1OY2A 2PTLA 2BWES 1V6EA 1MI0A 2V76A 2Z13A 4FJVB 1TJEA 3KVFB 2JQRB 4HROA 2BS4B 1B9RA 3KUDB 5MPOA 4KDIC 1FFVA 1ZP0B 5DPRA 3TEZA 4S17A 1NI2A 4JIOU 3SDLC 3HM3A 3IAS1 2LUMA 3MJ5A 4UDUC 5D94A 3RNEC 1I35A 2LJ5A 3E9SA 1Y56A 5KQ1A 1WXAA 3RD2A 1ZC4B 2IO0B 1YJ1A 4GN1A 1E10A 1QOGA 4A6FB 2N9XA 1YQ3B 2WU5B 2Z8LA 1V1OA 4WAFA 2L52A 4HJGE 3E56A 4HDQA 2HJ1A 2DYQA 5L83A 2BGFA 2X38A 2KOXA 3ODXA 2AYOB 2FCNA 3QARA 1EAZA 2DYOA 5JHBA 5T8IA 4E74A 3W1SC 1LW3A 1NDDA 2DHJA 2YT0A 1JWUD 1OQRA 2PEAA 3ETRA 2CHXA 1I4HA 2YSZA 2XK5B 2OQBA 1PLSA 2ZNVC 3O65B 1FOEA 5DHFB 1M94A 2EKEC 2KFKB 3DWGC 1D5XC 3MDBC 3NUHB 2UZSA 2N0SB 5LXHA 4A9AA 1J0GA 1NVLA 2N9PC 5HI1A 1F1HA 2CS4A 1LQBA 4FA6A 3SO6A 3M3JA 2WXMA 3A58A 4HVBA 5JHGA 3O13A 2AL3A 4REZA 1UNPA 3NVWA 4EFOA 3R7QA 3QWMA 2ZPYA 1P3RA 3E9LA 2YEPB 2Y3AA 2M38A 3RPFC 1WX8A 3A1QB 4F7HA 1OEYA 2GOWA 3AV8A 3H7PB 1W1GA 2Z4DA 2W3SA 3BINA 4P1CC 2WYQA 1V5PA 3PS6A 3OLMD 2GBMA 3DVNV 3VAWA 2CB8A 3DHIC 4A8XC 4RM8A 2DX1A 1K50A 4WJPA 3WAOA 4RMAA 4KV2A 4WJ7A 2CJOA 3TL5A 1WGUA 2KQ4X 2YS3A 2OJWA 2PKOA 5BO4B 4QJ3B 3PRMB 4HB2B 4RGTA 3RNGC 3DOWA 5AZHA 1UEFA 3RN9C 3OANA 4LNFA 1WM3A 3SFDB 4JKGB 3I5JC 2CODA 1PGXA 5D7GA 2K6QA 2RGFA 3ZDMC 2KWDA 4ICVA 3A4SC 2D5GA 2ZPNA 2P0DA 2QILA 3PRPB 4BKTA 3AE8B 2G4DB 2J53A 2KC2A 3CF6E 2YRYA 4TKNA 4F1SA 3MHZA 3ZVRA 2N7DA 2NR2A 4BKGA 4MY6A 2ASQA 2MP2B 2YVCA 2HDEA 2GJYA 4HPLB 3SR6A 2LGSA 3RCZA 2KR0A 2YS1A 4JWUC 1IGCA 1QOAA 2LRUA 4IM0A 4YTMB 2HJ8A 2PMVA 2DX5A 3WA0A 1WYGA 4MEMA 5J3QA 3ZTDA 4G0NB 2KIGA 4A90A 2UZRA 2J0MA 3V62A 3VOQA 1FB8A 4DX90 2CKHB 2G45B 1P9DU 3EPYA 1FHXA 1FFUA 3F0WA 3KWVA 1XD4A 1RWSA 4K1RB 2WDTB 3U7DA 5C23A 4YWGG 4F7ZA 2WS3B 4PT5A 1WZ3A 2W3RA 2LASA 4AJWA 4WURA 3L13A 4K7SA 3ZXRA 4EZJA 3V5WA 4I6NB 3RYTA 4AS1A 4GDLA 2QIEB 1D6EC 1RAXA 1W1DA 2ZVNA 5J17A 2AWTA 3BK1A 4DQOC 3BK2A 4YSZB 2Y5BB 3GZNB 2EKIA 4JK9A 3NW8A 5EE3A 2E2XA 1XKEA 2L8JA 2WXHA 2L1AA 5IP4D 3ZW3A 2KMCA 2IO2B 1WVHA 3BIID 4IWQA 2IO3B 3L08A 4GNKB 1HA5A 1H8CA 3U4EG 1TS3A 3KY9A 4MJSB 3W5UB 3R2IA 4KHBA 1QLBB 3BVMA 4W9JA 4BZAA 4JKHA 2K6DB 1ZXIA 4ZYNA 2M56B 4PS7A 4HAVB 2WHIA 2K2JA 3R3MA 2V4LA 3UIOB 1Q1OA 3ZJVA 5C79A 4YXDB 3P4PB 4WAAA 4GXBA 3A8PA 1T0QC 1F0ZA 1EVHA 3V6EB 1DBHA 5FI0A 1RM6C 2N0YA 2AQ1B 4YSXB 2GRIA 3ODWA 3AE9B 2RPVA 1E0ZA 5JLJB 1BXTA 3MHSD 4WJOA 1X1FA 1C1YB 3MPXA 2NBUA 5HKHA 2FJLA 5FK9C 2N9LA 3QJZA 2BKFA 5G55A 5EFXA 3MTNB 4OT1A 2Y8GA 3ENEA 1OFFA 1PGAA 1V5OA 3I9V1 2D9VA 2KO3A 2K3UA 2G35A 5IAAC 4TMAB 1XLQA 2COAA 3GZNI 2VRWB 4MJSA 3ZXVA 2WNMA 1F52A 3HVZA 3AEDB 1JMLA 1NTIA 2RMMA 1HXYD 3EHVA 3FKYA 4ILGB 1F9JA 4C0AA 4A3OA 2C7HA 3L0WB 2IDYA 2LGIA 3BYYB 1L5PA 3AULA 3RZFA 3A9JB 4KHAA 3K9OB 3PVUA 2RRFA 3KZ1A 2LFIA 1T0RC 3H7PA 3HM6X 5D3YA 1TY0A 5DPSA 3A9KA 1V88A 3RMKC 1UF0A 4KGTA 2MKRA 1RFKA 4C7ZA 1Z87A 5D3XA 2KQSA 4MSMB 4DHJD 3GYOA 2WXRA 4B9KA 2LRWA 1WE7A 1L0VB 1JRUA 4EZLA 4PS8A 3ECIA 1YOVB 3LXFA 2MBQA 2KTRB 4I6LB 3OAWA 1HB6A 2NBWB 4CYEA 1HBKA 1Q67A 3SNHA 2L00B 3N1ZC 1Q0WB 3SFEB 2SEBD 3K9PB 2KACA 3HW2B 4B6WA 1ZDVA 3AM9A 1WXMA 4JKCA 2LXCA 2K25A 2G4SA 4G50A 4IUMB 2N1WA 1I7AA 4IM2A 1UD7A 2WX0A 1PFDA 3SEBA 4D6WA 4RCOA 2MRPA 3FC4A 5FR3A 3SYXA 4JKDA 3PGEA 2QDFA 2RSUA 4HKZE 3B2FA 3AN1A 4MK0A 1BTNA 4G11A 4K3BA 3PT2B 1HQRD 1Q5WB 1T77A 3N1YC 3LJUX 1WGRA 2KT7A 2JWZA 2C7NB 5D2MB 4FULA 1RRBA 1AWEA 2YS5A 2WLBA 3Q3MC 5G5GA 4URKA 1P1AA 2JZPA 3DBLB 2DENB 5HFYA 4L1RA 4M01A 5AZFA 2FIDA 1ET6A 3AE3B 2IGHA 3TMPB 1TXDA 3JW0X 5KHOA 4MGKE 4DXGA 3N7CA 2CY4A 1WM2A 1DIKA 3GYPA 3KYCD 4AUQC 3D8FA 4H8SA 4EEWA 2L2IA 2P8VA 4JL9A 1BAKA 1VZ6A 3CMMB 2PE6B 1V81A 1ZW7A 1OGWA 4MM3A 3IVFA 2K8EA 1E8XA 2KKCA 1DGJA 3QBVB 1N61A 1HZ5A 1EWCA 1WH3A 2WDVB 2KWVB 1WGKA 3J9CA 1C3TA 1IYFA 1A70A 1VLBA 2MWNB 1FRDA 3DPDA 4NAWA 1OQYA 1XLNA 2AEHA 2IGDA 3FAHA 4HAXB 4WIPA 3X23A 4GMVA 5LLIA 3RZWC 2WXJA 2WH5A 1M7RA 3LB8C 5J3YA 3Q8CA 2MBEA 1SIJA 1C76A 3ZLZA 1WSPA 2K8BA 2AQ2B 1EF5A 2N1VA 2QJLA 2SAKA 5M4YB 4HK2A 3DBHB 2JXTA 5I2MA 4GB9A 3TW1A 1C78A 2Q5WD 4LJOB 3BZDB 1Y8RC 1T0SC 1GPXA 2MBHA 2I1JA 5D27A 2WQYB 4HSIA 3NY5A 4XC2A 2R09A 5E6NA 3R2TA 5CHVC 2W9NA 1E9MA 3KRXA 3NWFA 1KFYB 5E6PA 1E7PB 4I6PA 2C60A 2XN9C 2KDFB 3VQIA 1IP9A 3C8YA 1DDMA 2KTFA 1V5MA 4DDID 2K22A 2LBBA 2AX5A 2RDHA 5TSSA 1MKEA 3VXWA 2JYEA 1SB3C 2ICIA 1HE8A 3BVZA 3ZJTA 4DDGD 5JH5C 4DWFA 4KVGB 2CHWA 2UWQA 3NSUA 2L1CA 2P0FA 1EWYC 3Q8AA 5BYQA 1XF5L 4FJYA 3A9JA 4HAZB 5JXVA 4DHJB 1TS4A 2INCC 2MW5A 4JE3B 3U7ZA 2ZNVB 4NZLB 3HSAA 1YIWA 5CX3A 1QF6A 3WCQA 4YTPB 3MFGA 4N6EB 2V9HA 2Z0DB 4XDCA 2BB6A 1FNUA 4C7YA 2D2QA 4MELA 2QKLA 2BYEA 4N9F4 4JK8A 1S1QB 2DAJA 1NEKB 3ZJUA 1ROEA 1ET9A 1AQCA 2ZCCA 4P16A 3NG0A 2NCNA 3B2GA 3OWEB 3VH3B 3Q3NC 3KRWA 3L17A 2LWPA 1FGZA 1Y19B 1SE3A 2JY6A 1GC6A 1TKYA 1L2NA 4KZCA 3FILB 4NJ7A 2K5PA 2M1MA 4IOYX 1QOBA 1WZ0A 3T3OA 3EGRA 4OVUA 2V1YA 3ZNZB 1NENB 5CHWA 2RGNB 1J7AA 4IFSA 5LXIB 4KIKA 4HB0B 2EC1A 3PPAA 1XR0B 3L54A 2GI9A 4Y94A 2NS5A 2BYFA 4OZCA 3N20C 4J3OD 2YEPF 2RD0A 4BOSC 3ULCA 4BFRA 3OG5A 4WJQA 3KLSX 5C2TB 4HB4B 3N9YC 2LEKA 4ANUA 2BT6A 4RGNA 5JHHA 3UQAA 4HWIB 4LDTB 4FJZA 5D3IB 5BMIA 1HEZE 3PVWA 3VDZA 1IRSA 5DIFB 3Q69A 2JYTA 5IOIA 1U5EA 5CLLB 2N23A 5BYSA 4IW0A 1V9JA 5GXGB 3ULBA 2COCA 1WF9A 3WALA 3FVCA 2YLMA 2TSSA 3VFKA 4ANXA 1XCGA 3ZTCA 1VCBA 2KIEA 1XXGA 3LDZE 2BWFA 4OSNA 2KYWA 2J59M 1V5TA 2Z14A 1WE6A 3ZIMA 1F77A 3AEAB 3APFA 2ZW0A 4HPMB 2VKIA 3WYFB 5LONB 1VJKA 2E6XA 4CQNA 1KF6B 2BCJA 3RNAC 3IXSA 4HDOA 1PGBA 5IRSA 3FILA 3JVZX 4TQ0A 1EU4A 1DROA 3HIZA 2ZCBA 1WR6E 3V61A 4KAXB 5J2RA 2O2VA 2FUG1 3AECB 5KQ4A 1BTKA 3EC8A 2EMTA 3AEGB 4NY0A 3ZO5B 1ACCA 4PK1A 2Z0QA 1OQNA 4NSWA 2KNBA 1TZOA 3TEWA 2PE9A 3RUIB 2BKRB 1WGDA 1WXVA 2KXJA 4NAMA 3VR9B 2WXIA 1E8ZA 2R82A 1ZYIA 3PREA 2IFSA 5DPTA 3PHWB 3OJ4B 4ITKA 4ANVA 2KMMA 3P4RB 4EUTA 4JLCA 1MIZB 4DX8A 4J6IA 1STEA 4ARIA 4GOCA 3VH4B 5KCVA 1NTYA 2W54A 3CIKA 1KZGA 3C19A 1I7HA 2RLOA 1MG8A 4WSFA 3L4PA 1DOYA 4CHJA 5EDSA 3WAMA 3QAQA 4OVVA 2LGXA 2HRJA 4TYZA 4KHBB 3NOBA 3BJIA 1UNQA 1ZGUB 3H7SA 4DBBA 4MGIE 2JRIB 5BMHA 1P7FA 4E3CA 3ZRFA 1XQQA 4W9EA 1V1PB 2EMSA 1GG3A 3MP9A 4YONA 1J7CA 4M8NA 1VBGA 1U2BA 1L0XB 1SF0A 2N9KA 1QT9A 1G6JA 2J0KA 1PUTA 2A5UA 2FUHB 3GE3C 2L32A 2BW2A 3B08A 4MT5A 5EE9A 5C5BB 1U5FA 1YJJA 1IPGA 1TY2A 4O1NA 4JKGA 4IAPA 2KJRA 4ZRPA 2O6VB 2JF5A 1I4GA 1E90A 2KC1A 4ILHA 2LULA 4W9CA 2ONQA 4W9DA 4HAWB 1WGQA 4GDLB 2MEKA 3HIEA 1AWDA 1I4RA 2D11A 3VVWB 4CHKA 2ROVA 4RH6A 3PG7A 3DXDA 3BY4B 1TKEA 2JRHA 1FAOA 4XX5A 1MJDA 3ML8A 3TIXA 5H92C 5FI1A 2PW9A 2D4QA 4PYZA 2WXOA 1KJTA 4GMXB 4ZDVA 2NBVA 2KK8A 1V1PA 1SBBB 2ROZB 5BYRA 1N3HA 1KRHA 3DBRI 2L0TA 5EE1A 2KFKA 2CY5A 4FN2A 3N3KB 1NU2A 4RM9A 1F2RC 4EZKA 2G3QB 1D3ZA 3DCXA 1MPHA 4GLSC 4RGOS 2LOZA 1J7BA 1NBFC 3W2DA 4A3PA 1C4AA 1JRPA 4NQLB 3VTVA 4ZYSA 3NJTA 5L95C 2LOXA 3IT6B 4W9FA 1N5WA 2ZVOA 2KN4A 1WXSA 1RFAA 4M00A 3PZ7A 4LNIA 5L81A 1WFYA 1N63A 2NPTB 1KH0A 1J8CA 2DNFA 1LB1A 1E7VA 4X57B 5JHAA 2MA9B 3TEXA 2ON8A 4WWPA 2B3AA 1XLPA 1KZ7A 4A6QA 2FCSA 2NTTA 2XQNM 2MP2A 2OOBB 3W9CB 5J3TA 3Q14C 4TSSA 4K17A 1EU3A 2K0PA 3KH0A 1FNWA 3A33B 3ZQ4A 1NVID 2PZ1A 4EKUA 3GE8C 4KDLB 1WGYA 1YN4A 2D10A 4XWWA 1PDXA 4B0EA 2INPE 1U29A 1R4NI 1WJNA 2IGGA 5GOWB 4C4VB 2I1KA 3H1UA 2MJDA 4MGYE 3EFUA 3AE7B 4IG7B 4S0RA 1TS2A 3DWMA 3TEYA 3V60A 3TSSA 2OEDA 4LDTD 1X11A 1BMLC 2JZ3B 2H89B 1NTVA 2DZIA 2W2WA 3BWUD 3ML9A 1PYWD 3AI5A 1QKZA 1A5RA 2DBYA 4HB3B 4XWTA 1V49A 3GB1A 2DYNA 1DYQA 3PSCA 1WGHA 1TKGA 1YN5A 1OEYJ 2QMTA 1E6EB 3NHEB 3AEEB 3D32A 4BKSD 1FHWA 3HRDD 4TUUA 4TQ1A 3V6CB 1RJ2A 5HE2A 4JKEA 4QJ4B 3X0WA 4C56C 3R8BA 1D5MC 1KC7A 3CSFA 1V61A 5G5HA 2KQ7A 2QKMA 5CLQB 1I42A 2X18A 3LYYA 3AU5A 2KJ6A 4GGQA 3U52E 1AARA 4M0WA 4CHMA 2FNJB 2IYBA 5I4DA 1CK1A 2WDRB 4B6HA 4OHJA 2Y5PA 2KFJA 1FRRA 2LGDA 4MACA 1UWXA 4DIXA 3E66A 2YF0A 1FEHA 3IG3A 5C5BA 4QXAB 4GU2A 3SHQA 3CSTA 3B1LX 2N9EB 4II2B 3HQCA 2R2OA 4C4VA 3UF8A 1SSNA 2JU6X 3ONSA 4WWOA 4DK5A 1JQ4A 2D9YA 2WXQA 3ZDTA 3F5RA 5IJMA 3DXEA 4Q2JA 4YTNB 1ZC3B 3T3NA 1E8YA 2DZKA 2H88B 2D3CA 2QHOA 4FADA 2L0FA 4Z2NA 3DVGY 1XO3A 3E9PA 2NPTA 1VD2A 1ZOYB 3WANA 2L7RA 4ZHOA 1GB4A 2LVOA 1X1MA 2XEWA 2WXNA 3TJPA 4CO7A 2MBOA 4W9KA 3I3TB 3JSVB 3ML4A 3DBHI 1MIXA 4II3B 3TUOA 3AH7A 2LHDA 3SUZA 1JCKB 1YJIA 2D3BA 3RNBC 4W9HA 4A6KA 5JP4A 2KVZA 1C4CA 1MG4A 5FR6A 1ZVRA 4EJNA 4A55A 1K5GB 1D5ZC 5C6RA 4BBKA 4LK0M 1SXTA 3U12A 4K2OA 3H6NA 2K1FA 2FE8A 2KD0A 3PVLA 1TZ1A 4ACFA 3JSVA 5HE0A 2K8CA 1MVKA 3P42A 4A20A 2RQ1A 2GUMA 2MHJA 4XDDA 2W55A 2Z0PA 4KHOA 4RGMA 5DI9B 3AE6B 4JKBA 3VTUA 2LHEA 5DCNA 3TFMA 1TJ6A 1XCQL 4XE0A 2COPA 5IKCM 4RNAA 3FM8C 2XK5A 2EELA 3A4RA 3IT4B 2R0DA 1KOTA 1GOZA 4IDIA 4LNNA 1FXIA 2KDEB 2L76A 2BS2B 2ADZA 1UH6A 1WMHB 1ZUD2 3W1SA 3PZ8A 4AP4C 5HHDG 2KMAA 2OHFA 5BMGA 4KGSA 2MDXA 1N60A 3R7RA 1P98A 2N7JA 2WXPA 4PS3A 1SHCA 5E6JA 1VR9A 2KUPA 1B55A 2KX3A 4JX1C 2FDQA 4HAYB 2KANA 2Y8FA 2K9XA 2D07B 2CU3A 1R4MI 2INDC 1TQZA 2MSED 2GBNA 2C5LC 1K53A 2BTEA 4FHJA 1KI1B 1UNRA 2L05A 1ZDXA 3SU8X 3MC8A 5DHAB 3U30A 3TCAA 4EMOA 3NVZA 3AB5A 3W5VB 2CR5A 3ZKJC 1X1GA 3ZVVA 1AN8A 5FKAC 5CTRC 4DBGA 2IJ0A 4C00A 1VZ8A 2PLPA 5EE0A 3EECA 2BQQA 4HAUB 4GSWA 2LJIA 1RYJA 2VZKD 2BYVE 2W2XD 3W1YA 1KLVA 2K8HA 5D3VA 2WP9B 1T3QA 2W82A 3M62B 3G9WA 1ACAA 1SE4A 2FCMA 1C77A 1UELA 1JW9D 2M19A 4ICUA 1JWSD 1M7EA 2J42A 1SIFA 2CU1A 5LG4B 1V5UA 4OVZA 2AL6A 2BS3B 2PVOD 1FPYA 3APCA 5J18A 1OTRB 3QC8B 2MBBB 4W9IA 2BPSA 3VRBB 3AE1B 3RULA 2GBJA 3PZDA 2I5FA 3AE2B 4US8A 4L6EA 2C7MB 2DHZA 2G9HD 2LZ6A 4RF1A 3N30A 1C79A 2GBRA 4ZOHC 1N62A 2KDIA 2WXGA 3UI3A 5DPWA 2MQJA 1EF1A 4EE2A 3O96A 1UBQA 2J52A 3MC0B 2FAZA 3RI7C 2J0JA 3D8EA 2INNE 2I5CA 5G2NA 3PRZA 4IKGA 1UGJA 1TT5B 2MH7A 2JUOA 3VTWA 4USAA 3KYDD 4H2AA 2MJEA 1AW7A 1V8CA 2JX5A 2L3ZA 1WJUA 2DWQA 3PLVA 3AJ4A 3Q3FA 4NJ6A 1WX9A 3I57A 1ENFA 2H7EA 1QOFA 4LJPB 4D0NB 4IWOA 1YX6B 2Y5CA 3RFZB 4FXCA 1L0YB 2UVMA 2KDBA 2COFA 1AYFA 3U8ZA 1U27A 4AOFA 4DHZE 2Z0EB 2DN6A 3SV1A 2ZJDA 2IBIB 4XZ4A 2Z59A 4KKJA 1V97A 1R4MB 1XD3B 2IYDB 4L1BA 1PMSA 2DAFA 4HPPA 4JGHB 4BBNC 3BVGA 4KKIA 1Z2MA 3A1QA 4KSLC 4ASWC 2LVPA 2JWUA 2GBKA 1N5XA 1KLGD 2LKOA 3AE4B 3M1IB 3QIJA 2PVGC 3PSEB 1TBEA 3GS2A 3Q6BA 4NPNA 1BUIC 3A98B 3NZSA 1MFWA 5AZGA 4GDKA 5C1ZA 4WQMA 3WAPA 3ZNGC 1HTOA 3LJ3A 1P6SA 2D9XA 4RFBA 1T6BX 1Z5SB 3NWAA 4N59A 4WQOB 1TS5A 4MSQB 1YMHE 3TBLD 1YD8U 1ESFA 1ZXHA 4HCNB 1K8RB 2KN5A 3FEHA 3PP2A 2JXXA 2VRRB 3DHHC 1YQBA 4F7GA 3Q2AC 2EJ8A 4GDKB 2D9ZA 2AQ3B 2FIFA 1WIAA 2FJUB 2RNRB 1QQRA 2OTXA 2LYDA 1PQSA 1JROA 2ZKMX 2I38A 2CRFA 1JALA 5I2SA 1VRAB 4WWMA 3T9LA 3KUZA 2DHIA 4A6HA 4AJYB 2P0HA 3KQ4A 1CJEA 2ZEQA 1MK7B 2XBBC 3U2SC 4ZRIA 4HCPB 3SD5A 4LLGM 1WGGA 1F2RI 1ISNA 2LMCA 5IN7A 2MFQA 4NJCA 4HKQA 2RSGA 1GB1A 3S2AA 3DDCB 1WRDB 1SE9A 2KDMA 4ZHPA 1ZPSA 5IA7A 4HLEA 3QCAA 2N7EA 4E71A 2KLGA 1FHOA 4IOIE 4YL8A 2KAJA 2VSZA 2MX2A 1WYWB 2YT2A 4BOZB 3Q8EA 1UPQA 3P6AA 4YSYB 4IC7B 1P0RA 4B0MA 1QQGA 2KCJA 3NRZA 4FHKA 4HATB 2IO1B 2WXFA 4YT0B 2GB1A 3RT3B 1VZ7A 2KVRA 2L83A 3CIRB 2QEJC 4FBJB 2PIAA 1FXAA 1VBHA 2IY0B 4JK7A 1E5WA 2GS0A 1IBXA 1FIQA 1LXDA 4F8CB 1ZSQA 3E9OA 2DZJA 2LGYA 1PFJA 4DXAB 1T0YA 1XX0A 3APDA 2BVCA 1XT9B 4WVFB 4LCDE 4MH8A 1WXQA 2DYBA 3H8HA 2WXKA 1UNSA 3UIPB 1GC7A 3PO0A 2V4IB 1KLUD 3QHTA 3R66C 1RLFA 3VIAA 4KZ0A 5LOPB 2HD5B 2M4NA 3NVVA 3FP5A 3AXCA 4NQKE 4N58A 2Q13A 4RF0A 3QX1A 2JZZA 2PJHA 1DOXA 1GAQB 4K2PA 3FLVA 4QAYA 2NZ8B 1ZKHA 3DVNU 1ST7A 4JPSA 2FCQA 3JYUA 3AU4A 3N1XC 1V80A 3NZUA 1FMAD 2Z0OA 5H8YE 3PHXB 2MCNB 2KUQA 3Q3JA 4XGAB 3ZRCA 2M0AA 2M0XA 1HZ6A 1YQ4B 2DYMA 1WR1A 2WWZA 4PQ0A 3DVGX 1SJHD 3P2BA 2V3PA 2MJ3A 2JPHA 2X0SA 1EGXA 3HUIA 3L10B 1YN3A 4LTUA 1FCCC 2KX0A 3UINB 1J19A 5LNK1 3HK0A 5C16A 1VDVA 3P4QB 4G3XB 1WI1A 4HXDA 3B0AA 1EM7A 4IM3A 2KWCA 2M17A 2DLBA 1WG7A 3P1MA 2K49A 3IAM1 3ZNHB 4DHZB 1FCLA 1NYRA 3B9JA 1GJZA 1UPRA 1WJ1A 2OJRA 3PV1A 2DTCA 2YT1A 4C80A 4A5KA 2O6VA 1P3QU 1JDEA 5TR5A 3AEFB 1LGRA 1N6ZA 3MC9A 2B76B 4FLHA 1UBIA 1I4PA 2IY1B 1QZEA 1FO4A 2K00A 1T5XD 2UU7A 2NVUI 2LUEA 2NMBA 2BYTA 3T8MA 4PYUA 2VZKB 1E7UA 4M8MA 1C4PA 3DXCA 1L7YA 4KX6B 4GOUA 2J7QB 4AQ7A 3C0RB 4MGZE 3P4SB 2DHKA 2V0GA 4D2KA 2CQUA 3VUYA 2FJ9A 1X05A 2HTHA 3Q8BA 4K3CA 1XEEA 1WJ6A 4B95A 4LNKA 4W9LA 4WWNA 2DKQA 4CSQA 1XODA 1S3SG 4XWXA 2DFKA 3DHGC 1MK9B 3ABVB 5AUKA 2REXA 3T06A 3RNFC 4ZRJA 4K7WA 3DBSA 1H4RA 3IHPC 1SGHA 3V05A
chains in the Genus database with same CATH topology
5HE1A 4MH0E 2MWSB 1U5GA 2WX1A 3D8DA 2DLWA 2O6VD 5DH9B 2HE7A 3VUXA 2N4FA 3DCGA 3IFWB 2ELBA 3PLUA 1GUAB 1UZXB 3MJWA 4NNJB 4K7UA 3HHMA 4ZRKA 5HE3A 5E6OA 4HHVA 5D3WA 1GNUA 2Z59B 1X86A 1FGYA 3KUCB 3KSYA 5D6JB 1Y5OA 1KM7A 1QC6A 3ZUNA 4NAWB 1KBLA 3H9DA 3GOEA 3A8QA 1BWNA 4P7IA 3L16A 3DBLI 3OJ3A 2DKPA 3DQVA 2R2QA 4GIVA 1MAIA 3SBTA 4HJKA 2RUKB 2BF8B 3ZNID 1EO6A 2RR9A 1WMHA 2KZRA 3PEGA 2M14A 3M95A 1J0WA 2KWUB 1YX5B 2GCLA 2LVQA 1WI0A 2IZVB 1FXTB 1GGOA 4TV3A 2NBVB 2W2XC 3QA8A 3QK0A 3M63B 2KTRA 1WJ4A 4EOYA 2Y7BA 1LM8B 2D9WA 3A9KB 3VHTC 4AWJA 5KHQA 4F7UP 2GMIC 1V89A 5GMVA 3TO1A 1U4AA 4JKFA 2PPHA 2GCJA 1DDWA 4A6FA 3ODOA 4W9GA 5JVLA 2LXAA 3CXBB 3WIMA 2DIKA 1U5DA 1DDVA 5JZEB 2DA0A 3ALBA 2O2VB 1ZM0A 2ABDA 2K39A 4PNKA 1V86A 2JT4B 4JKAA 1EUVB 1OMWA 4GZUA 2JP2A 2ELAA 4ILJA 2D3GA 1WY8A 2A4ZA 1H10A 3IBEA 2JVCA 2CAYA 1TGZB 3UZTA 3KW5B 1P5TA 3VUWA 2KGXB 1HB8A 3SBGA 1K5DB 2LD9A 2M8SA 3NS8A 4KSKC 3TVVA 2RVBB 4JQWC 3PTFC 2HTHB 4KIKB 2KHWB 3FSSA 1WX7A 4MDKE 2H7DA 3N32A 2LG1A 4MT7A 4ANWA 4K81A 2KLCA 3RCPA 1DYNA 1UGMA 2V3SA 3QWZB 5AEKB 1E8WA 2DX5B 2UYZB 1LFDA 1V2YA 3QQ8B 3UGBB 1I2HA 4BVUC 3P7ZA 4IWPA 4BKSA 4BBNF 4M0WB 2RPQA 2C9WB 2DZMA 2MLBA 1CMXB 2KJHB 2ZZPB 1WJMA 4Z2MB 4GPTB 3ENBA 5CHFA 1TTNA 4WJNA 1RRPB 2K2UA 3UQBA 2LI5A 1W1HA 1BT0A 2CHZA 1OY2A 2BWES 1V6EA 2V76A 4FJVB 3KVFB 3KUDB 4KDIC 5DPRA 1NI2A 4JIOU 3SDLC 3HM3A 5D94A 1I35A 2LJ5A 5KQ1A 1WXAA 3RD2A 1ZC4B 2IO0B 1YJ1A 4GN1A 2N9XA 4A6FB 4HDQA 2DYQA 5L83A 2BGFA 2KOXA 3ODXA 2AYOB 2FCNA 3QARA 1EAZA 2DYOA 5JHBA 4E74A 3W1SC 1LW3A 1NDDA 2DHJA 2YT0A 2PEAA 2CHXA 2YSZA 2XK5B 2OQBA 1PLSA 2ZNVC 3O65B 1FOEA 5DHFB 1M94A 2EKEC 2KFKB 3MDBC 2UZSA 5LXHA 1J0GA 1NVLA 2N9PC 2CS4A 1LQBA 4FA6A 3SO6A 3M3JA 4HVBA 5JHGA 2AL3A 1UNPA 4EFOA 3R7QA 3QWMA 2ZPYA 1P3RA 3E9LA 2M38A 1WX8A 3A1QB 4F7HA 1OEYA 2GOWA 3H7PB 1W1GA 3BINA 2WYQA 1V5PA 3PS6A 3OLMD 2GBMA 3DVNV 3VAWA 2CB8A 4RM8A 2DX1A 4WJPA 3WAOA 4RMAA 4KV2A 4WJ7A 3TL5A 1WGUA 2YS3A 5BO4B 3PRMB 4HB2B 3DOWA 5AZHA 1UEFA 3OANA 1WM3A 4JKGB 2CODA 5D7GA 2K6QA 2RGFA 3ZDMC 4ICVA 3A4SC 2ZPNA 2P0DA 3PRPB 4BKTA 2G4DB 2KC2A 3CF6E 2YRYA 4TKNA 4F1SA 3ZVRA 2N7DA 2NR2A 4BKGA 4MY6A 2ASQA 2MP2B 2YVCA 2GJYA 4HPLB 3RCZA 2YS1A 2LRUA 4IM0A 2HJ8A 2DX5A 3WA0A 4MEMA 5J3QA 3ZTDA 4G0NB 2UZRA 2J0MA 3V62A 3VOQA 1FB8A 4DX90 2CKHB 2G45B 1P9DU 3EPYA 1FHXA 4K1RB 3F0WA 1XD4A 2WDTB 3U7DA 5C23A 4F7ZA 1WZ3A 2LASA 4AJWA 3L13A 4K7SA 4EZJA 3V5WA 4I6NB 3RYTA 4GDLA 1RAXA 1W1DA 2ZVNA 5J17A 2AWTA 2Y5BB 4JK9A 2E2XA 1XKEA 2L8JA 3ZW3A 2KMCA 2IO2B 1WVHA 4IWQA 2IO3B 3L08A 1H8CA 3KY9A 4MJSB 4W9JA 4JKHA 2K6DB 4ZYNA 4PS7A 4HAVB 2K2JA 3R3MA 2V4LA 3UIOB 1Q1OA 5C79A 4WAAA 4GXBA 3A8PA 1EVHA 3V6EB 1DBHA 5FI0A 2N0YA 3ODWA 5JLJB 4WJOA 3MHSD 1X1FA 1C1YB 3MPXA 2NBUA 5HKHA 2FJLA 3QJZA 2BKFA 5G55A 5EFXA 3MTNB 2Y8GA 3ENEA 1V5OA 2D9VA 2KO3A 2G35A 5IAAC 2COAA 3GZNI 2VRWB 4MJSA 1NTIA 3EHVA 4ILGB 1F9JA 4C0AA 4A3OA 2C7HA 3L0WB 3AULA 3RZFA 3A9JB 4KHAA 3K9OB 3PVUA 3KZ1A 3H7PA 3HM6X 5D3YA 5DPSA 3A9KA 1V88A 2MKRA 1Z87A 5D3XA 2KQSA 4MSMB 4DHJD 3GYOA 4B9KA 2LRWA 1WE7A 1JRUA 4EZLA 4PS8A 3ECIA 2MBQA 2KTRB 4I6LB 3OAWA 1HB6A 2NBWB 4CYEA 1HBKA 1Q67A 3SNHA 2L00B 1Q0WB 3K9PB 3HW2B 4B6WA 1WXMA 4JKCA 2LXCA 2K25A 2G4SA 4G50A 4IUMB 2N1WA 1I7AA 4IM2A 1UD7A 2WX0A 2MRPA 3SYXA 4JKDA 3PGEA 2RSUA 4MK0A 1BTNA 4G11A 3PT2B 1Q5WB 3LJUX 1WGRA 2JWZA 2C7NB 5D2MB 4FULA 1RRBA 1AWEA 2YS5A 4URKA 1P1AA 2DENB 5AZFA 2FIDA 3TMPB 1TXDA 3JW0X 5KHOA 4MGKE 3N7CA 2CY4A 1WM2A 1DIKA 3GYPA 3KYCD 4AUQC 3D8FA 4H8SA 4EEWA 2L2IA 2P8VA 4JL9A 1BAKA 3CMMB 2PE6B 1V81A 1ZW7A 1OGWA 4MM3A 3IVFA 1E8XA 2KKCA 3QBVB 1WH3A 1C3TA 2KWVB 1IYFA 2MWNB 3DPDA 4NAWA 1OQYA 2AEHA 4HAXB 3X23A 4GMVA 5LLIA 3RZWC 2WH5A 1M7RA 5J3YA 2MBEA 3ZLZA 2K8BA 1EF5A 2N1VA 4HK2A 4GB9A 3TW1A 4LJOB 1Y8RC 2MBHA 2I1JA 5D27A 3NY5A 4XC2A 2R09A 5E6NA 5CHVC 2W9NA 3KRXA 5E6PA 4I6PA 2C60A 2KDFB 3VQIA 1IP9A 1DDMA 2KTFA 1V5MA 4DDID 2LBBA 1MKEA 3VXWA 1HE8A 4DDGD 5JH5C 4DWFA 4KVGB 2CHWA 2UWQA 3NSUA 2L1CA 2P0FA 4FJYA 3A9JA 4HAZB 4DHJB 2MW5A 2ZNVB 1YIWA 5CX3A 2Z0DB 2D2QA 4MELA 2QKLA 2BYEA 4N9F4 4JK8A 1S1QB 2DAJA 1AQCA 2ZCCA 2NCNA 3VH3B 3KRWA 3L17A 2LWPA 1FGZA 1Y19B 2JY6A 1GC6A 1L2NA 4KZCA 4NJ7A 2M1MA 4IOYX 1WZ0A 4OVUA 2V1YA 3ZNZB 5CHWA 2RGNB 4IFSA 5LXIB 4KIKA 4HB0B 2EC1A 3PPAA 1XR0B 3L54A 4Y94A 2NS5A 2BYFA 2RD0A 4BOSC 3ULCA 4BFRA 4WJQA 4HB4B 4ANUA 5JHHA 3UQAA 4HWIB 4LDTB 4FJZA 3PVWA 3VDZA 1IRSA 5DIFB 1U5EA 5CLLB 2N23A 4IW0A 1V9JA 3ULBA 2COCA 1WF9A 3WALA 2YLMA 3VFKA 4ANXA 1XCGA 3ZTCA 1VCBA 3LDZE 2BWFA 2J59M 1V5TA 1WE6A 3ZIMA 3APFA 4HPMB 2VKIA 3WYFB 5LONB 2BCJA 4HDOA 3JVZX 4TQ0A 1DROA 3HIZA 2ZCBA 1WR6E 3V61A 4KAXB 5J2RA 2O2VA 5KQ4A 1BTKA 3EC8A 2EMTA 4NY0A 3ZO5B 2Z0QA 1OQNA 4NSWA 2KNBA 2PE9A 3RUIB 2BKRB 1WGDA 1WXVA 2KXJA 1E8ZA 2R82A 3PREA 2IFSA 5DPTA 3PHWB 3OJ4B 4ANVA 4EUTA 4JLCA 1MIZB 4DX8A 4J6IA 4GOCA 3VH4B 5KCVA 1NTYA 3CIKA 1KZGA 2RLOA 1MG8A 4WSFA 4CHJA 5EDSA 3WAMA 4OVVA 3QAQA 2LGXA 2HRJA 4TYZA 4KHBB 3NOBA 3BJIA 1UNQA 1ZGUB 3H7SA 4DBBA 4MGIE 2JRIB 4E3CA 3ZRFA 1XQQA 4W9EA 2EMSA 1GG3A 4YONA 4M8NA 1VBGA 1U2BA 1G6JA 2J0KA 2A5UA 2FUHB 3B08A 5C5BB 1U5FA 1IPGA 4JKGA 4IAPA 2KJRA 2O6VB 2JF5A 1E90A 2KC1A 4ILHA 2LULA 4W9CA 4W9DA 4HAWB 1WGQA 4GDLB 2D11A 3VVWB 4CHKA 2ROVA 3PG7A 3DXDA 3BY4B 2JRHA 1FAOA 4XX5A 3ML8A 3TIXA 5FI1A 2D4QA 4PYZA 1KJTA 4GMXB 4ZDVA 2KK8A 2ROZB 1N3HA 3DBRI 2L0TA 2KFKA 2CY5A 4FN2A 3N3KB 1NU2A 4RM9A 4EZKA 2G3QB 1D3ZA 1MPHA 2LOZA 1NBFC 4A3PA 4NQLB 3VTVA 5L95C 2LOXA 4W9FA 2ZVOA 1WXSA 1RFAA 5L81A 1WFYA 2NPTB 1J8CA 1LB1A 1E7VA 4X57B 5JHAA 2MA9B 4WWPA 2B3AA 1KZ7A 2FCSA 2XQNM 2MP2A 2OOBB 5J3TA 4K17A 3KH0A 3A33B 2PZ1A 4EKUA 4KDLB 1WGYA 2D10A 1U29A 1R4NI 1WJNA 5GOWB 2I1KA 3H1UA 4MGYE 3EFUA 4IG7B 3V60A 4LDTD 1X11A 2JZ3B 1NTVA 2DZIA 2W2WA 3ML9A 3AI5A 1A5RA 4HB3B 1V49A 2DYNA 3PSCA 1WGHA 1OEYJ 3NHEB 3D32A 4BKSD 1FHWA 4TUUA 4TQ1A 3V6CB 1RJ2A 5HE2A 4JKEA 3X0WA 1KC7A 3CSFA 1V61A 2KQ7A 2QKMA 5CLQB 1I42A 2X18A 3AU5A 2KJ6A 4GGQA 1AARA 4CHMA 2FNJB 2IYBA 4B6HA 2KFJA 2LGDA 3E66A 2YF0A 3IG3A 5C5BA 4GU2A 3SHQA 3CSTA 3B1LX 2N9EB 4II2B 3HQCA 2R2OA 3UF8A 3ONSA 4WWOA 4DK5A 2D9YA 3ZDTA 3F5RA 5IJMA 3DXEA 1ZC3B 1E8YA 2DZKA 2QHOA 4FADA 2L0FA 4Z2NA 3DVGY 3E9PA 2NPTA 1VD2A 3WANA 2L7RA 2LVOA 1X1MA 2XEWA 3TJPA 4CO7A 2MBOA 4W9KA 3I3TB 3JSVB 3ML4A 3DBHI 1MIXA 4II3B 3SUZA 4W9HA 4A6KA 5JP4A 5FR6A 1ZVRA 4EJNA 1K5GB 5C6RA 4BBKA 4K2OA 3H6NA 2K1FA 2KD0A 3PVLA 1TZ1A 3JSVA 5HE0A 2K8CA 4A20A 2RQ1A 2Z0PA 4KHOA 5DI9B 4JKBA 3VTUA 5DCNA 3TFMA 1TJ6A 2COPA 3FM8C 2XK5A 3A4RA 2R0DA 1KOTA 2KDEB 2L76A 2ADZA 1UH6A 1WMHB 3W1SA 4AP4C 2KMAA 3R7RA 2MDXA 1P98A 4PS3A 1SHCA 2KUPA 1B55A 2KX3A 2FDQA 4HAYB 2KANA 2Y8FA 2D07B 1R4MI 1TQZA 2MSED 2GBNA 2C5LC 4FHJA 1KI1B 1UNRA 2L05A 3SU8X 5DHAB 3U30A 3TCAA 4EMOA 2CR5A 3ZKJC 1X1GA 3ZVVA 5CTRC 4DBGA 3EECA 4HAUB 4GSWA 2BYVE 2W2XD 3W1YA 1KLVA 2K8HA 5D3VA 3M62B 3G9WA 1ACAA 2FCMA 1UELA 4ICUA 1M7EA 1SIFA 2CU1A 1V5UA 2AL6A 3APCA 5J18A 1OTRB 3QC8B 2MBBB 4W9IA 2BPSA 3RULA 2GBJA 3PZDA 2I5FA 4L6EA 2C7MB 2DHZA 2LZ6A 3N30A 2GBRA 2KDIA 5DPWA 2MQJA 1EF1A 3O96A 1UBQA 2FAZA 2J0JA 3D8EA 2I5CA 5G2NA 3PRZA 3VTWA 2JUOA 3KYDD 2L3ZA 1WJUA 3PLVA 3AJ4A 3Q3FA 4NJ6A 1WX9A 2H7EA 4LJPB 4D0NB 4IWOA 1YX6B 2UVMA 2KDBA 2COFA 3U8ZA 1U27A 4AOFA 4DHZE 2Z0EB 2DN6A 3SV1A 2ZJDA 2IBIB 4XZ4A 2IYDB 1XD3B 1PMSA 2DAFA 4JGHB 4BBNC 1Z2MA 3A1QA 4KSLC 4ASWC 2LVPA 2GBKA 2LKOA 3M1IB 3QIJA 3PSEB 1TBEA 4NPNA 3A98B 3NZSA 5C1ZA 5AZGA 4GDKA 3WAPA 3ZNGC 3LJ3A 1P6SA 2D9XA 1Z5SB 4WQOB 4MSQB 3TBLD 1YD8U 4HCNB 1K8RB 2KN5A 3FEHA 3PP2A 2JXXA 2VRRB 1YQBA 4F7GA 2EJ8A 4GDKB 2D9ZA 2FIFA 1WIAA 2RNRB 2OTXA 2LYDA 1PQSA 2CRFA 3T9LA 3KUZA 2DHIA 4A6HA 4AJYB 2P0HA 2ZEQA 1MK7B 2XBBC 4ZRIA 4HCPB 3SD5A 1WGGA 1ISNA 2MFQA 2RSGA 3S2AA 3DDCB 1WRDB 1SE9A 5IA7A 4HLEA 3QCAA 2N7EA 4E71A 2KLGA 1FHOA 4YL8A 2VSZA 1WYWB 2MX2A 4BOZB 1UPQA 3P6AA 4IC7B 1P0RA 1QQGA 2KCJA 4FHKA 4HATB 2IO1B 3RT3B 2KVRA 4FBJB 1VBHA 2IY0B 4JK7A 1E5WA 2GS0A 1LXDA 4F8CB 1ZSQA 3E9OA 2DZJA 2LGYA 1PFJA 4DXAB 1T0YA 1XX0A 3APDA 1XT9B 4WVFB 4LCDE 2DYBA 3UIPB 1GC7A 3QHTA 3R66C 1RLFA 3VIAA 4KZ0A 5LOPB 2HD5B 2M4NA 3FP5A 3AXCA 4NQKE 2Q13A 3QX1A 2JZZA 2PJHA 4K2PA 3FLVA 2NZ8B 1ZKHA 3DVNU 1ST7A 2FCQA 3JYUA 3AU4A 3NZUA 1V80A 2Z0OA 3PHXB 2MCNB 3Q3JA 3ZRCA 2M0XA 2DYMA 1WR1A 2WWZA 4PQ0A 3DVGX 3P2BA 2JPHA 2X0SA 1EGXA 3L10B 2KX0A 3UINB 1J19A 3HK0A 5C16A 4G3XB 1WI1A 4HXDA 3B0AA 4IM3A 2KWCA 2M17A 1WG7A 3ZNHB 4DHZB 1GJZA 1UPRA 1WJ1A 2OJRA 3PV1A 2DTCA 2YT1A 4A5KA 2O6VA 1P3QU 1JDEA 5TR5A 4FLHA 1UBIA 2IY1B 1QZEA 2K00A 2NVUI 2LUEA 2NMBA 3T8MA 4PYUA 4M8MA 1E7UA 3DXCA 1L7YA 2J7QB 3C0RB 4MGZE 2DHKA 2CQUA 3VUYA 2FJ9A 1X05A 2HTHA 1WJ6A 4B95A 4W9LA 4WWNA 2DKQA 1XODA 1S3SG 4XWXA 2DFKA 1MK9B 2REXA 3T06A 4ZRJA 4K7WA 3DBSA 1H4RA 3IHPC 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ8 A;  5HE1 A;  4ANU A;  2DX5 A;  5JHH A;  4FHJ A;  3WA0 A;  1KI1 B;  1UNR A;  4MEM A;  5J3Q A;  2L05 A;  4MH0 E;  3UQA A;  4HWI B;  2MWS B;  1U5G A;  4G0N B;  4LDT B;  4FJZ A;  2WX1 A;  3SU8 X;  3D8D A;  3ZTD A;  5DHA B;  2UZR A;  2J0M A;  3U30 A;  3TCA A;  3V62 A;  3PVW A;  3VOQ A;  1FB8 A;  2DLW A;  4DX9 0;  2CKH B;  2O6V D;  5DH9 B;  3VDZ A;  2G45 B;  2HE7 A;  3EPY A;  1IRS A;  1P9D U;  4EMO A;  5DIF B;  3VUX A;  2N4F A;  3DCG A;  1FHX A;  2CR5 A;  2ELB A;  3F0W A;  1XD4 A;  3IFW B;  3PLU A;  2WDT B;  1X1G A;  4K1R B;  3ZKJ C;  1U5E A;  3U7D A;  5CLL B;  1GUA B;  2N23 A;  1UZX B;  5C23 A;  4F7Z A;  3MJW A;  4IW0 A;  4NNJ B;  4K7U A;  1V9J A;  1WZ3 A;  3HHM A;  2LAS A;  3ULB A;  4ZRK A;  2COC A;  1WF9 A;  5CTR C;  5HE3 A;  2YLM A;  5E6O A;  3WAL A;  4DBG A;  4E74 A;  4HHV A;  3VFK A;  4AJW A;  1XCG A;  3L13 A;  4ANX A;  4K7S A;  3ZTC A;  1VCB A;  3V5W A;  4I6N B;  3RYT A;  3VTW A;  4EZJ A;  5D3W A;  3LDZ E;  1GNU A;  3EEC A;  2Z59 B;  4GDL A;  2BWF A;  1X86 A;  4HAU B;  4GSW A;  2J59 M;  1V5T A;  1RAX A;  1WE6 A;  1W1D A;  1FGY A;  3ZIM A;  3KUC B;  3APF A;  3KSY A;  4HPM B;  5D6J B;  2ZVN A;  5E6N A;  5J17 A;  1Y5O A;  2VKI A;  3WYF B;  5LON B;  1KM7 A;  1QC6 A;  2AWT A;  2BYV E;  2GBN A;  3ZUN A;  4NAW B;  2W2X D;  3W1Y A;  1KLV A;  2BCJ A;  2K8H A;  4HDO A;  5D3V A;  3H9D A;  3JVZ X;  2Y5B B;  3GOE A;  4GDK A;  4TQ0 A;  3M62 B;  1DRO A;  3G9W A;  1ACA A;  2E2X A;  3A8Q A;  1WR6 E;  4KAX B;  1XKE A;  1UEL A;  2FCM A;  2ZCB A;  3V61 A;  5J2R A;  1BWN A;  2O2V A;  2L8J A;  4ICU A;  4WJO A;  5KQ4 A;  1BTK A;  4P7I A;  1M7E A;  3ZW3 A;  1SIF A;  2CU1 A;  3EC8 A;  1V5U A;  2EMT A;  2AL6 A;  2IO2 B;  2KMC A;  4NY0 A;  3L16 A;  1WVH A;  3ZO5 B;  3DBL I;  2Z0Q A;  3APC A;  1OTR B;  1OQN A;  3OJ3 A;  4IWQ A;  5J18 A;  4NSW A;  2DKP A;  2KNB A;  3QC8 B;  2MBB B;  2IO3 B;  3L08 A;  4W9I A;  1H8C A;  2PE9 A;  3DQV A;  3RUI B;  2BPS A;  2R2Q A;  1MAI A;  1WGD A;  3KY9 A;  2BKR B;  4GIV A;  2LRU A;  1WXV A;  4MJS B;  2KXJ A;  2GBJ A;  3PZD A;  3RUL A;  2I5F A;  1E8Z A;  4HJK A;  3PRE A;  4W9J A;  2RUK B;  4L6E A;  2IFS A;  2C7M B;  2BF8 B;  2DHZ A;  2K6D B;  2LZ6 A;  5DPT A;  4ZYN A;  3N30 A;  3PHW B;  4HAV B;  2GBR A;  4PS7 A;  2K2J A;  1EO6 A;  3OJ4 B;  3R3M A;  2V4L A;  3UIO B;  4BKS A;  1Q1O A;  2KDI A;  4ANV A;  5JHB A;  5C79 A;  2RR9 A;  4EUT A;  1WMH A;  2KZR A;  4JLC A;  1MIZ B;  3PEG A;  4DX8 A;  4J6I A;  2MQJ A;  2M14 A;  3M95 A;  1EF1 A;  5KCV A;  1NTY A;  3O96 A;  3A8P A;  4GXB A;  1UBQ A;  4GOC A;  3CIK A;  3VH4 B;  1KZG A;  2FAZ A;  1EVH A;  2J0J A;  1J0W A;  3D8E A;  1DBH A;  5FI0 A;  2KWU B;  3V6E B;  2I5C A;  2N0Y A;  2RLO A;  1MG8 A;  1YX5 B;  4WSF A;  5G2N A;  3ODW A;  4CHJ A;  2GCL A;  3PRZ A;  5EDS A;  3WAM A;  5JLJ B;  3MHS D;  2JUO A;  2LGX A;  1X1F A;  1C1Y B;  2HRJ A;  4TYZ A;  3MPX A;  4KHB B;  1WI0 A;  3BJI A;  1UNQ A;  1ZGU B;  1FXT B;  2IZV B;  2LVQ A;  4DBB A;  2FJL A;  2NBU A;  3H7S A;  3KYD D;  4MGI E;  5HKH A;  2JRI B;  3QJZ A;  4E3C A;  4TV3 A;  3ZRF A;  2BKF A;  5G55 A;  5EFX A;  1XQQ A;  3MTN B;  4W9E A;  2NBV B;  2W2X C;  2L3Z A;  3QA8 A;  2EMS A;  1GG3 A;  3QK0 A;  4YON A;  2Y8G A;  1WJU A;  4M8N A;  3M63 B;  3PLV A;  3AJ4 A;  2KTR A;  3ENE A;  1WJ4 A;  4EOY A;  1V5O A;  1U2B A;  2Y7B A;  1LM8 B;  2D9V A;  3Q3F A;  2D9W A;  2KO3 A;  1G6J A;  2G35 A;  5IAA C;  3A9K B;  1WX9 A;  2J0K A;  4NJ6 A;  2COA A;  3VHT C;  4AWJ A;  5KHQ A;  2A5U A;  2FUH B;  4F7U P;  3GZN I;  2GMI C;  1V89 A;  2H7E A;  3B08 A;  2VRW B;  4MJS A;  5C5B B;  5GMV A;  3TO1 A;  1U5F A;  4D0N B;  1IPG A;  4LJP B;  4IWO A;  4OVV A;  1YX6 B;  1NTI A;  4IAP A;  2KJR A;  1U4A A;  2PPH A;  2O6V B;  2JF5 A;  3EHV A;  2UVM A;  1E90 A;  2KC1 A;  2KDB A;  2GCJ A;  1DDW A;  2COF A;  3U8Z A;  1U27 A;  1F9J A;  4AOF A;  4C0A A;  4A3O A;  2Z0E B;  2C7H A;  4DHZ E;  2DN6 A;  2LUL A;  3SV1 A;  4A6F A;  2ZJD A;  3L0W B;  2IBI B;  4W9D A;  4W9C A;  4XZ4 A;  4HAW B;  1WGQ A;  4GDL B;  3ODO A;  3AUL A;  2IYD B;  1XD3 B;  3A9J B;  3RZF A;  4KHA A;  1PMS A;  2DAF A;  3K9O B;  4WAA A;  3ZNI D;  2D11 A;  3KZ1 A;  3PVU A;  3H7P A;  3HM6 X;  4JGH B;  4W9G A;  3VVW B;  5D3Y A;  4BBN C;  4CHK A;  1Z2M A;  2ROV A;  3A1Q A;  5DPS A;  3A9K A;  4KSL C;  1V88 A;  3PG7 A;  3DXD A;  3CXB B;  2LXA A;  2LVP A;  3BY4 B;  4ASW C;  2JRH A;  3WIM A;  2MKR A;  1FAO A;  4XX5 A;  1U5D A;  3ML8 A;  1Z87 A;  1DDV A;  5D3X A;  2GBK A;  3TIX A;  2KQS A;  5FI1 A;  2LKO A;  5JZE B;  3M1I B;  4MSM B;  3QIJ A;  4DHJ D;  3GYO A;  2D4Q A;  2DA0 A;  3ALB A;  4PYZ A;  3PSE B;  1KJT A;  4GMX B;  1WE7 A;  2LRW A;  2O2V B;  1ZM0 A;  4B9K A;  2KK8 A;  4ZDV A;  1JRU A;  4EZL A;  2ABD A;  2K39 A;  4PS8 A;  1TBE A;  3ECI A;  2ROZ B;  1N3H A;  2MBQ A;  2KTR B;  4PNK A;  2L0T A;  3DBR I;  4NPN A;  3A98 B;  2KFK A;  4I6L B;  3NZS A;  3OAW A;  1HB6 A;  2CY5 A;  4CYE A;  1V86 A;  1EUV B;  1NU2 A;  2JT4 B;  1HBK A;  1OMW A;  1Q67 A;  3N3K B;  4RM9 A;  3WAP A;  3SNH A;  3ZNG C;  2G3Q B;  4EZK A;  2L00 B;  4GZU A;  3LJ3 A;  1P6S A;  2D9X A;  2JP2 A;  1Q0W B;  3K9P B;  2ELA A;  2D3G A;  1D3Z A;  1MPH A;  2LOZ A;  3HW2 B;  4B6W A;  1NBF C;  1Z5S B;  4A3P A;  1WXM A;  1WY8 A;  4WQO B;  2LXC A;  2K25 A;  2G4S A;  4G50 A;  4NQL B;  3VTV A;  2A4Z A;  4IUM B;  4MSQ B;  5L95 C;  2N1W A;  2LOX A;  1I7A A;  1H10 A;  3TBL D;  1YD8 U;  3IBE A;  4W9F A;  2ZVO A;  4IM2 A;  4HCN B;  1K8R B;  2JVC A;  2KN5 A;  2CAY A;  1WXS A;  1UD7 A;  3FEH A;  3PP2 A;  1TGZ B;  1RFA A;  3UZT A;  2WX0 A;  3KW5 B;  1P5T A;  2JXX A;  2KGX B;  3VUW A;  4DK5 A;  1HB8 A;  5L81 A;  2MRP A;  2VRR B;  1YQB A;  4F7G A;  1WFY A;  2NPT B;  2EJ8 A;  1J8C A;  4GDK B;  1K5D B;  2LD9 A;  3SYX A;  2M8S A;  2D9Z A;  2FIF A;  3NS8 A;  4FN2 A;  4KSK C;  1LB1 A;  1E7V A;  3TVV A;  3PGE A;  4X57 B;  2MA9 B;  5JHA A;  4WWP A;  1WIA A;  2B3A A;  2RSU A;  1KZ7 A;  2RVB B;  2RNR B;  4JQW C;  3PTF C;  2OTX A;  2HTH B;  4MK0 A;  2LYD A;  1PQS A;  2FCS A;  4KIK B;  2KHW B;  1BTN A;  4G11 A;  2XQN M;  2MP2 A;  2OOB B;  3FSS A;  1WX7 A;  3PT2 B;  4MDK E;  2H7D A;  5J3T A;  2CRF A;  1Q5W B;  4K17 A;  3N32 A;  3LJU X;  3T9L A;  1WGR A;  2LG1 A;  3KUZ A;  4MT7 A;  2DHI A;  4A6H A;  3KH0 A;  2P0H A;  4AJY B;  4ANW A;  2ZEQ A;  3A33 B;  2JWZ A;  4K81 A;  2C7N B;  2KLC A;  3RCP A;  1DYN A;  1MK7 B;  2XBB C;  5D2M B;  1UGM A;  2PZ1 A;  4EKU A;  2V3S A;  4ZRI A;  4FUL A;  1RRB A;  1AWE A;  2YS5 A;  4HCP B;  3SD5 A;  1WGG A;  3QWZ B;  5AEK B;  4URK A;  1ISN A;  1P1A A;  4KDL B;  1E8W A;  2DX5 B;  2UYZ B;  2DEN B;  1LFD A;  1V2Y A;  3QQ8 B;  2MFQ A;  1WGY A;  2D10 A;  3UGB B;  5AZF A;  1I2H A;  4BVU C;  2FID A;  3P7Z A;  1U29 A;  4IWP A;  3TMP B;  2RSG A;  1TXD A;  1R4N I;  1WJN A;  3JW0 X;  5GOW B;  3DDC B;  4MGK E;  5KHO A;  3S2A A;  4M0W B;  2I1K A;  3N7C A;  2CY4 A;  1SE9 A;  1WM2 A;  1WRD B;  2RPQ A;  3H1U A;  5IA7 A;  3NOB A;  4MGY E;  3GYP A;  3KYC D;  4HLE A;  3EFU A;  3QCA A;  4AUQ C;  2C9W B;  2DZM A;  2MLB A;  4IG7 B;  2N7E A;  4E71 A;  1CMX B;  3D8F A;  4H8S A;  2KLG A;  3V60 A;  4EEW A;  2L2I A;  2P8V A;  4JL9 A;  1BAK A;  1FHO A;  2KJH B;  3CMM B;  1X11 A;  2PE6 B;  2ZZP B;  4LDT D;  1V81 A;  4YL8 A;  1ZW7 A;  1WJM A;  2VSZ A;  1OGW A;  3IVF A;  4Z2M B;  1E8X A;  2JZ3 B;  1WYW B;  2MX2 A;  4MM3 A;  1NTV A;  2KKC A;  4GPT B;  2DZI A;  2W2W A;  3ML9 A;  5CHF A;  4BOZ B;  3QBV B;  3AI5 A;  1UPQ A;  3P6A A;  1TTN A;  4WJN A;  1A5R A;  1RRP B;  4IC7 B;  1WH3 A;  4HB3 B;  2KWV B;  2K2U A;  1C3T A;  1IYF A;  1V49 A;  2DYN A;  2MWN B;  1P0R A;  3UQB A;  1QQG A;  2KCJ A;  2LI5 A;  1W1H A;  3PSC A;  1WGH A;  3DPD A;  1BT0 A;  4FHK A;  4HAT B;  4NAW A;  5C1Z A;  1OQY A;  2IO1 B;  2CHZ A;  1OY2 A;  1OEY J;  2AEH A;  2BWE S;  1V6E A;  3NHE B;  3RT3 B;  2KVR A;  4HAX B;  3D32 A;  2V76 A;  4FJV B;  4BKS D;  3KVF B;  1FHW A;  3X23 A;  4GMV A;  5DPW A;  4FBJ B;  3KUD B;  5LLI A;  4KDI C;  4TUU A;  3RZW C;  4TQ1 A;  5DPR A;  2IY0 B;  3V6C B;  1RJ2 A;  1NI2 A;  5HE2 A;  2WH5 A;  4JIO U;  3X0W A;  1E5W A;  3SDL C;  2GS0 A;  1M7R A;  3HM3 A;  3CSF A;  1V61 A;  5J3Y A;  2KQ7 A;  1LXD A;  4F8C B;  1ZSQ A;  5D94 A;  2QKM A;  5CLQ B;  1I42 A;  2X18 A;  2MBE A;  2DZJ A;  2LGY A;  3AU5 A;  1PFJ A;  2LJ5 A;  3QAQ A;  3ZLZ A;  1I35 A;  4DXA B;  2K8B A;  2KJ6 A;  5KQ1 A;  4GGQ A;  1WXA A;  1AAR A;  3RD2 A;  1EF5 A;  1T0Y A;  1XX0 A;  2N1V A;  1ZC4 B;  2IO0 B;  3APD A;  1YJ1 A;  4CHM A;  4GN1 A;  2NBW B;  4HK2 A;  1XT9 B;  2FNJ B;  4WVF B;  4LCD E;  2IYB A;  2DYB A;  4A6F B;  2N9X A;  4B6H A;  4GB9 A;  3TW1 A;  4HDQ A;  2KFJ A;  3UIP B;  4LJO B;  1GC7 A;  1Y8R C;  2LGD A;  2DYQ A;  5L83 A;  2BGF A;  2MBH A;  2I1J A;  5D27 A;  3QHT A;  3R66 C;  1RLF A;  2KOX A;  2YF0 A;  3NY5 A;  3ODX A;  3VIA A;  2AYO B;  5LOP B;  3IG3 A;  4KZ0 A;  5C5B A;  2FCN A;  2HD5 B;  1EAZ A;  2M4N A;  2R09 A;  2DYO A;  3NZU A;  3QAR A;  4XC2 A;  3FP5 A;  4GU2 A;  3CST A;  3B1L X;  2N9E B;  3AXC A;  4NQK E;  5CHV C;  3SHQ A;  2W9N A;  3W1S C;  1IP9 A;  1LW3 A;  1NDD A;  3HQC A;  4II2 B;  2R2O A;  3KRX A;  5E6P A;  3ZVV A;  3UF8 A;  3ONS A;  2Q13 A;  2DHJ A;  2YT0 A;  3QX1 A;  4WWO A;  2JZZ A;  4I6P A;  2PEA A;  2D9Y A;  2C60 A;  2PJH A;  2CHX A;  5AZG A;  3ZDT A;  4K2P A;  3F5R A;  3FLV A;  5IJM A;  2NZ8 B;  2YSZ A;  2OQB A;  3DXE A;  1ZKH A;  2XK5 B;  3DVN U;  1ST7 A;  2KDF B;  2FCQ A;  3JYU A;  3AU4 A;  3VQI A;  1PLS A;  1ZC3 B;  1V80 A;  1FOE A;  5DHF B;  1M94 A;  2EKE C;  1E8Y A;  2KFK B;  2ZNV C;  3O65 B;  2DZK A;  1DDM A;  2KTF A;  1V5M A;  2Z0O A;  2QHO A;  4DDI D;  4FAD A;  2L0F A;  4Z2N A;  3MDB C;  3DVG Y;  2LBB A;  3PHX B;  2MCN B;  2UZS A;  2NPT A;  1VD2 A;  3Q3J A;  5LXH A;  1MKE A;  3VXW A;  3ZRC A;  2M0X A;  1J0G A;  3WAN A;  2L7R A;  2DYM A;  1NVL A;  2N9P C;  2LVO A;  1X1M A;  2XEW A;  1HE8 A;  1WR1 A;  2CS4 A;  4PQ0 A;  2WWZ A;  3DVG X;  4DDG D;  5JH5 C;  3TJP A;  4DWF A;  1LQB A;  4FA6 A;  3P2B A;  4CO7 A;  4KVG B;  3SO6 A;  2MBO A;  3M3J A;  4W9K A;  2CHW A;  3I3T B;  3JSV B;  2UWQ A;  3ML4 A;  3NSU A;  1MIX A;  2JPH A;  5JHG A;  3DBH I;  1EGX A;  4II3 B;  2L1C A;  3L10 B;  4HVB A;  2P0F A;  2AL3 A;  1UNP A;  4EFO A;  3R7Q A;  4FJY A;  3QWM A;  2ZPY A;  3SUZ A;  1P3R A;  2KX0 A;  3A9J A;  4HAZ B;  4W9H A;  3UIN B;  4A6K A;  4DHJ B;  1J19 A;  2M38 A;  2MW5 A;  5JP4 A;  3HK0 A;  5C16 A;  1WX8 A;  3A1Q B;  5FR6 A;  1ZVR A;  4EJN A;  4F7H A;  1WI1 A;  4G3X B;  4HXD A;  3B0A A;  1OEY A;  1K5G B;  2GOW A;  2KWC A;  2ZNV B;  2M17 A;  3H7P B;  4IM3 A;  5C6R A;  1YIW A;  5CX3 A;  4BBK A;  1WG7 A;  1W1G A;  3BIN A;  4K2O A;  2WYQ A;  3H6N A;  3ZNH B;  2K1F A;  1V5P A;  3PS6 A;  3OLM D;  4DHZ B;  1GJZ A;  2GBM A;  2KD0 A;  3PVL A;  1TZ1 A;  1UPR A;  2Z0D B;  3DVN V;  2CB8 A;  3VAW A;  1WJ1 A;  2OJR A;  3JSV A;  3PV1 A;  5HE0 A;  2D2Q A;  2DTC A;  2YT1 A;  4A5K A;  2O6V A;  1P3Q U;  4RM8 A;  4MEL A;  2K8C A;  5TR5 A;  2QKL A;  2BYE A;  4N9F 4;  4A20 A;  2DX1 A;  1S1Q B;  2RQ1 A;  2DAJ A;  4WJP A;  3WAO A;  4RMA A;  4KV2 A;  2Z0P A;  4WJ7 A;  4KHO A;  4FLH A;  3TL5 A;  1UBI A;  1WGU A;  2YS3 A;  2IY1 B;  1AQC A;  2ZCC A;  5BO4 B;  1QZE A;  3PRM B;  5DI9 B;  2NCN A;  2K00 A;  3VH3 B;  4HB2 B;  3KRW A;  3VTU A;  3L17 A;  3DOW A;  5AZH A;  4IM0 A;  2LWP A;  1UEF A;  5DCN A;  3TFM A;  2NVU I;  1TJ6 A;  2LUE A;  1FGZ A;  2NMB A;  3OAN A;  2COP A;  1WM3 A;  1Y19 B;  2JY6 A;  1GC6 A;  3T8M A;  3FM8 C;  4M8M A;  1E7U A;  2XK5 A;  4KZC A;  2COD A;  3A4R A;  4PYU A;  1L2N A;  3DXC A;  2R0D A;  4NJ7 A;  5D7G A;  2K6Q A;  1KOT A;  2M1M A;  1L7Y A;  2RGF A;  4IOY X;  3ZDM C;  2KDE B;  2L76 A;  4BBN F;  1WZ0 A;  2ADZ A;  2J7Q B;  1UH6 A;  4OVU A;  2V1Y A;  4ICV A;  1WMH B;  3C0R B;  4MGZ E;  3ZNZ B;  3A4S C;  3W1S A;  4AP4 C;  2DHK A;  2P0D A;  2ZPN A;  5CHW A;  2CQU A;  2RGN B;  3VUY A;  3PRP B;  2FJ9 A;  1X05 A;  2HTH A;  4IFS A;  2KMA A;  4BKT A;  5LXI B;  2G4D B;  4KIK A;  4HB0 B;  2EC1 A;  2KC2 A;  1XR0 B;  3PPA A;  1WJ6 A;  3L54 A;  3CF6 E;  3R7R A;  2MDX A;  4B95 A;  4W9L A;  2YRY A;  4TKN A;  1P98 A;  4WWN A;  4Y94 A;  4F1S A;  2DKQ A;  4PS3 A;  1SHC A;  3ZVR A;  2N7D A;  1XOD A;  1S3S G;  2NS5 A;  2NR2 A;  4BKG A;  4MY6 A;  4XWX A;  2DFK A;  2BYF A;  2KUP A;  1B55 A;  2ASQ A;  2MP2 B;  2YVC A;  1MK9 B;  2KX3 A;  2RD0 A;  2GJY A;  4BOS C;  2FDQ A;  4HPL B;  4HAY B;  2REX A;  2KAN A;  2Y8F A;  3T06 A;  2D07 B;  3ULC A;  3HIZ A;  4ZRJ A;  3RCZ A;  4K7W A;  4BFR A;  3DBS A;  2YS1 A;  1H4R A;  1R4M I;  3IHP C;  4WJQ A;  1SGH A;  1TQZ A;  4HB4 B;  2MSE D;  2C5L C; 
#chains in the Genus database with same CATH topology
 5HE1 A;  1TIF A;  2QCZ A;  1SEB D;  4MH0 E;  2MWS B;  1U5G A;  2WX1 A;  3D8D A;  3VRA B;  3VR8 B;  4P1B C;  2RDB C;  4HRS A;  2ACZ B;  2DLW A;  2O6V D;  5DH9 B;  2HE7 A;  2NMQ A;  2WGS A;  3VUX A;  2N4F A;  3DCG A;  4M02 A;  3IFW B;  2ELB A;  3PLU A;  1GUA B;  1UZX B;  3MJW A;  3I63 C;  4NNJ B;  4K7U A;  3HHM A;  3ZGZ A;  4ZRK A;  5HE3 A;  5E6O A;  4LNO A;  4HHV A;  3NVY A;  3CWI A;  5D3W A;  2JSV X;  1GNU A;  4US9 A;  2Z59 B;  2WDQ B;  1X86 A;  5C3J B;  3OHM B;  3AEB B;  1FGY A;  4MM3 B;  3KUC B;  5AUI A;  3KSY A;  5D6J B;  1Y5O A;  1CZP A;  1KM7 A;  1QC6 A;  2R61 A;  3ZUN A;  4NAW B;  1JWM D;  1KBL A;  3H9D A;  4BAX A;  1ZE3 D;  3GOE A;  4OW0 A;  1DOI A;  3A8Q A;  1KTK A;  1BWN A;  1QIL A;  1JWA D;  4P7I A;  3L16 A;  2QSD A;  3DBL I;  3OJ3 A;  1NYQ A;  1YNT E;  2DKP A;  3DQV A;  2R2Q A;  1FNV A;  1MAI A;  4GIV A;  3SBT A;  2D3A A;  3URY A;  1OQQ A;  1C9F A;  1MPE A;  1D4B A;  2GLS A;  5D3D A;  1R7S A;  4HJK A;  2RUK B;  2BF8 B;  3ZNI D;  1EO6 A;  3EA6 A;  5HG2 A;  1WRI A;  2RR9 A;  1WMH A;  2KZR A;  3Q3O C;  3PEG A;  2M14 A;  3M95 A;  2CJN A;  1J0W A;  4L2Y A;  4ZRQ A;  2KWU B;  1YX5 B;  1M4V A;  1FM0 D;  2G1E A;  2GCL A;  3NWD A;  2LVQ A;  1WI0 A;  2IZV B;  1FXT B;  1GGO A;  1NI3 A;  4QJ5 B;  4TV3 A;  3HVD A;  2R2Y A;  3NZ3 A;  2NBV B;  1UUP A;  2W2X C;  3QA8 A;  1R4N B;  3QK0 A;  1HTQ A;  3BYT B;  3M63 B;  2WU2 B;  2KTR A;  1LO5 D;  1WJ4 A;  2J4X A;  4EOY A;  2Y7B A;  1LM8 B;  4KGR A;  2D9W A;  3A9K B;  3KWL A;  2E3T A;  3VHT C;  4AWJ A;  2ZW1 A;  3AE5 B;  5KHQ A;  4F7U P;  2GMI C;  1V89 A;  2VH2 A;  5GMV A;  3TO1 A;  1SE2 A;  4DXF A;  1WWT A;  4HEA 1;  1U4A A;  4JKF A;  2PPH A;  2GCJ A;  1DDW A;  5IO9 A;  1SJE D;  4A6F A;  3ODO A;  1L6V A;  4W9G A;  5JVL A;  2WXL A;  2LXA A;  3CXB B;  3WIM A;  2DIK A;  1U5D A;  1DDV A;  1P7E A;  5JZE B;  2BB5 A;  1Q10 A;  2DA0 A;  3ALB A;  4R3D A;  2O2V B;  1ZM0 A;  3Q8F A;  4WH4 A;  2ABD A;  2K39 A;  1IUE A;  4PNK A;  1V86 A;  2JT4 B;  4JKA A;  1EUV B;  1OMW A;  3P63 A;  4GZU A;  3GP7 A;  2JP2 A;  2ELA A;  1I4X A;  4ILJ A;  2D3G A;  2V3N A;  1IBX B;  2I2Y A;  1B1Z A;  1WY8 A;  2A4Z A;  3V3X A;  1H10 A;  3IBE A;  1I4Q A;  2JVC A;  2CAY A;  2VH1 A;  1TGZ B;  3UZT A;  3KW5 B;  1P5T A;  3VUW A;  2KGX B;  1HB8 A;  1TYG B;  4OZA A;  1L4Z B;  2XNA C;  3SBG A;  1K5D B;  2M8S A;  2LD9 A;  3NS8 A;  4KSK C;  1FD6 A;  1CQV A;  3TVV A;  1L4D B;  3EUB 2;  1MHH E;  2RVB B;  4JQW C;  3PTF C;  4OZB A;  2HTH B;  1MI1 A;  4KIK B;  2KHW B;  3FSS A;  1WX7 A;  4MDK E;  3RNC C;  2H7D A;  3N32 A;  3ZYY X;  1IGD A;  2LG1 A;  4MT7 A;  4ANW A;  4K81 A;  2KLC A;  3RCP A;  1DYN A;  3AMZ A;  1UGM A;  2V3S A;  3DBR B;  4P6V F;  3QWZ B;  5AEK B;  1E8W A;  2DX5 B;  2UYZ B;  1LFD A;  1V2Y A;  3QQ8 B;  2X8X X;  4ARC A;  3UGB B;  1I2H A;  4L23 A;  4BVU C;  3P7Z A;  3NS1 A;  2NTS A;  4IWP A;  4BKS A;  3B77 A;  4BBN F;  1MHX A;  4M0W B;  2RPQ A;  1XCT L;  2C9W B;  2BBC A;  2DZM A;  2FBW B;  2MLB A;  3EFC A;  1CMX B;  1UWM A;  4XYC A;  2HTM E;  1K51 A;  1XLO A;  2QC8 A;  2KJH B;  2ZZP B;  1WJM A;  4Z2M B;  1JWB D;  4GPT B;  3ENB A;  5CHF A;  2RDG A;  1K52 A;  1TTN A;  4WJN A;  1RRP B;  2IPK D;  4JWS C;  2K2U A;  3UQB A;  2LI5 A;  1W1H A;  1L6U A;  1BT0 A;  2CHZ A;  1OY2 A;  2PTL A;  2BWE S;  1V6E A;  1MI0 A;  2V76 A;  2Z13 A;  4FJV B;  1TJE A;  3KVF B;  2JQR B;  4HRO A;  2BS4 B;  1B9R A;  3KUD B;  5MPO A;  4KDI C;  1FFV A;  1ZP0 B;  5DPR A;  3TEZ A;  4S17 A;  1NI2 A;  4JIO U;  3SDL C;  3HM3 A;  3IAS 1;  2LUM A;  3MJ5 A;  4UDU C;  5D94 A;  3RNE C;  1I35 A;  2LJ5 A;  3E9S A;  1Y56 A;  5KQ1 A;  1WXA A;  3RD2 A;  1ZC4 B;  2IO0 B;  1YJ1 A;  4GN1 A;  1E10 A;  1QOG A;  4A6F B;  2N9X A;  1YQ3 B;  2WU5 B;  2Z8L A;  1V1O A;  4WAF A;  2L52 A;  4HJG E;  3E56 A;  4HDQ A;  2HJ1 A;  2DYQ A;  5L83 A;  2BGF A;  2X38 A;  2KOX A;  3ODX A;  2AYO B;  2FCN A;  3QAR A;  1EAZ A;  2DYO A;  5JHB A;  5T8I A;  4E74 A;  3W1S C;  1LW3 A;  1NDD A;  2DHJ A;  2YT0 A;  1JWU D;  1OQR A;  2PEA A;  3ETR A;  2CHX A;  1I4H A;  2YSZ A;  2XK5 B;  2OQB A;  1PLS A;  2ZNV C;  3O65 B;  1FOE A;  5DHF B;  1M94 A;  2EKE C;  2KFK B;  3DWG C;  1D5X C;  3MDB C;  3NUH B;  2UZS A;  2N0S B;  5LXH A;  4A9A A;  1J0G A;  1NVL A;  2N9P C;  5HI1 A;  1F1H A;  2CS4 A;  1LQB A;  4FA6 A;  3SO6 A;  3M3J A;  2WXM A;  3A58 A;  4HVB A;  5JHG A;  3O13 A;  2AL3 A;  4REZ A;  1UNP A;  3NVW A;  4EFO A;  3R7Q A;  3QWM A;  2ZPY A;  1P3R A;  3E9L A;  2YEP B;  2Y3A A;  2M38 A;  3RPF C;  1WX8 A;  3A1Q B;  4F7H A;  1OEY A;  2GOW A;  3AV8 A;  3H7P B;  1W1G A;  2Z4D A;  2W3S A;  3BIN A;  4P1C C;  2WYQ A;  1V5P A;  3PS6 A;  3OLM D;  2GBM A;  3DVN V;  3VAW A;  2CB8 A;  3DHI C;  4A8X C;  4RM8 A;  2DX1 A;  1K50 A;  4WJP A;  3WAO A;  4RMA A;  4KV2 A;  4WJ7 A;  2CJO A;  3TL5 A;  1WGU A;  2KQ4 X;  2YS3 A;  2OJW A;  2PKO A;  5BO4 B;  4QJ3 B;  3PRM B;  4HB2 B;  4RGT A;  3RNG C;  3DOW A;  5AZH A;  1UEF A;  3RN9 C;  3OAN A;  4LNF A;  1WM3 A;  3SFD B;  4JKG B;  3I5J C;  2COD A;  1PGX A;  5D7G A;  2K6Q A;  2RGF A;  3ZDM C;  2KWD A;  4ICV A;  3A4S C;  2D5G A;  2ZPN A;  2P0D A;  2QIL A;  3PRP B;  4BKT A;  3AE8 B;  2G4D B;  2J53 A;  2KC2 A;  3CF6 E;  2YRY A;  4TKN A;  4F1S A;  3MHZ A;  3ZVR A;  2N7D A;  2NR2 A;  4BKG A;  4MY6 A;  2ASQ A;  2MP2 B;  2YVC A;  2HDE A;  2GJY A;  4HPL B;  3SR6 A;  2LGS A;  3RCZ A;  2KR0 A;  2YS1 A;  4JWU C;  1IGC A;  1QOA A;  2LRU A;  4IM0 A;  4YTM B;  2HJ8 A;  2PMV A;  2DX5 A;  3WA0 A;  1WYG A;  4MEM A;  5J3Q A;  3ZTD A;  4G0N B;  2KIG A;  4A90 A;  2UZR A;  2J0M A;  3V62 A;  3VOQ A;  1FB8 A;  4DX9 0;  2CKH B;  2G45 B;  1P9D U;  3EPY A;  1FHX A;  1FFU A;  3F0W A;  3KWV A;  1XD4 A;  1RWS A;  4K1R B;  2WDT B;  3U7D A;  5C23 A;  4YWG G;  4F7Z A;  2WS3 B;  4PT5 A;  1WZ3 A;  2W3R A;  2LAS A;  4AJW A;  4WUR A;  3L13 A;  4K7S A;  3ZXR A;  4EZJ A;  3V5W A;  4I6N B;  3RYT A;  4AS1 A;  4GDL A;  2QIE B;  1D6E C;  1RAX A;  1W1D A;  2ZVN A;  5J17 A;  2AWT A;  3BK1 A;  4DQO C;  3BK2 A;  4YSZ B;  2Y5B B;  3GZN B;  2EKI A;  4JK9 A;  3NW8 A;  5EE3 A;  2E2X A;  1XKE A;  2L8J A;  2WXH A;  2L1A A;  5IP4 D;  3ZW3 A;  2KMC A;  2IO2 B;  1WVH A;  3BII D;  4IWQ A;  2IO3 B;  3L08 A;  4GNK B;  1HA5 A;  1H8C A;  3U4E G;  1TS3 A;  3KY9 A;  4MJS B;  3W5U B;  3R2I A;  4KHB A;  1QLB B;  3BVM A;  4W9J A;  4BZA A;  4JKH A;  2K6D B;  1ZXI A;  4ZYN A;  2M56 B;  4PS7 A;  4HAV B;  2WHI A;  2K2J A;  3R3M A;  2V4L A;  3UIO B;  1Q1O A;  3ZJV A;  5C79 A;  4YXD B;  3P4P B;  4WAA A;  4GXB A;  3A8P A;  1T0Q C;  1F0Z A;  1EVH A;  3V6E B;  1DBH A;  5FI0 A;  1RM6 C;  2N0Y A;  2AQ1 B;  4YSX B;  2GRI A;  3ODW A;  3AE9 B;  2RPV A;  1E0Z A;  5JLJ B;  1BXT A;  3MHS D;  4WJO A;  1X1F A;  1C1Y B;  3MPX A;  2NBU A;  5HKH A;  2FJL A;  5FK9 C;  2N9L A;  3QJZ A;  2BKF A;  5G55 A;  5EFX A;  3MTN B;  4OT1 A;  2Y8G A;  3ENE A;  1OFF A;  1PGA A;  1V5O A;  3I9V 1;  2D9V A;  2KO3 A;  2K3U A;  2G35 A;  5IAA C;  4TMA B;  1XLQ A;  2COA A;  3GZN I;  2VRW B;  4MJS A;  3ZXV A;  2WNM A;  1F52 A;  3HVZ A;  3AED B;  1JML A;  1NTI A;  2RMM A;  1HXY D;  3EHV A;  3FKY A;  4ILG B;  1F9J A;  4C0A A;  4A3O A;  2C7H A;  3L0W B;  2IDY A;  2LGI A;  3BYY B;  1L5P A;  3AUL A;  3RZF A;  3A9J B;  4KHA A;  3K9O B;  3PVU A;  2RRF A;  3KZ1 A;  2LFI A;  1T0R C;  3H7P A;  3HM6 X;  5D3Y A;  1TY0 A;  5DPS A;  3A9K A;  1V88 A;  3RMK C;  1UF0 A;  4KGT A;  2MKR A;  1RFK A;  4C7Z A;  1Z87 A;  5D3X A;  2KQS A;  4MSM B;  4DHJ D;  3GYO A;  2WXR A;  4B9K A;  2LRW A;  1WE7 A;  1L0V B;  1JRU A;  4EZL A;  4PS8 A;  3ECI A;  1YOV B;  3LXF A;  2MBQ A;  2KTR B;  4I6L B;  3OAW A;  1HB6 A;  2NBW B;  4CYE A;  1HBK A;  1Q67 A;  3SNH A;  2L00 B;  3N1Z C;  1Q0W B;  3SFE B;  2SEB D;  3K9P B;  2KAC A;  3HW2 B;  4B6W A;  1ZDV A;  3AM9 A;  1WXM A;  4JKC A;  2LXC A;  2K25 A;  2G4S A;  4G50 A;  4IUM B;  2N1W A;  1I7A A;  4IM2 A;  1UD7 A;  2WX0 A;  1PFD A;  3SEB A;  4D6W A;  4RCO A;  2MRP A;  3FC4 A;  5FR3 A;  3SYX A;  4JKD A;  3PGE A;  2QDF A;  2RSU A;  4HKZ E;  3B2F A;  3AN1 A;  4MK0 A;  1BTN A;  4G11 A;  4K3B A;  3PT2 B;  1HQR D;  1Q5W B;  1T77 A;  3N1Y C;  3LJU X;  1WGR A;  2KT7 A;  2JWZ A;  2C7N B;  5D2M B;  4FUL A;  1RRB A;  1AWE A;  2YS5 A;  2WLB A;  3Q3M C;  5G5G A;  4URK A;  1P1A A;  2JZP A;  3DBL B;  2DEN B;  5HFY A;  4L1R A;  4M01 A;  5AZF A;  2FID A;  1ET6 A;  3AE3 B;  2IGH A;  3TMP B;  1TXD A;  3JW0 X;  5KHO A;  4MGK E;  4DXG A;  3N7C A;  2CY4 A;  1WM2 A;  1DIK A;  3GYP A;  3KYC D;  4AUQ C;  3D8F A;  4H8S A;  4EEW A;  2L2I A;  2P8V A;  4JL9 A;  1BAK A;  1VZ6 A;  3CMM B;  2PE6 B;  1V81 A;  1ZW7 A;  1OGW A;  4MM3 A;  3IVF A;  2K8E A;  1E8X A;  2KKC A;  1DGJ A;  3QBV B;  1N61 A;  1HZ5 A;  1EWC A;  1WH3 A;  2WDV B;  2KWV B;  1WGK A;  3J9C A;  1C3T A;  1IYF A;  1A70 A;  1VLB A;  2MWN B;  1FRD A;  3DPD A;  4NAW A;  1OQY A;  1XLN A;  2AEH A;  2IGD A;  3FAH A;  4HAX B;  4WIP A;  3X23 A;  4GMV A;  5LLI A;  3RZW C;  2WXJ A;  2WH5 A;  1M7R A;  3LB8 C;  5J3Y A;  3Q8C A;  2MBE A;  1SIJ A;  1C76 A;  3ZLZ A;  1WSP A;  2K8B A;  2AQ2 B;  1EF5 A;  2N1V A;  2QJL A;  2SAK A;  5M4Y B;  4HK2 A;  3DBH B;  2JXT A;  5I2M A;  4GB9 A;  3TW1 A;  1C78 A;  2Q5W D;  4LJO B;  3BZD B;  1Y8R C;  1T0S C;  1GPX A;  2MBH A;  2I1J A;  5D27 A;  2WQY B;  4HSI A;  3NY5 A;  4XC2 A;  2R09 A;  5E6N A;  3R2T A;  5CHV C;  2W9N A;  1E9M A;  3KRX A;  3NWF A;  1KFY B;  5E6P A;  1E7P B;  4I6P A;  2C60 A;  2XN9 C;  2KDF B;  3VQI A;  1IP9 A;  3C8Y A;  1DDM A;  2KTF A;  1V5M A;  4DDI D;  2K22 A;  2LBB A;  2AX5 A;  2RDH A;  5TSS A;  1MKE A;  3VXW A;  2JYE A;  1SB3 C;  2ICI A;  1HE8 A;  3BVZ A;  3ZJT A;  4DDG D;  5JH5 C;  4DWF A;  4KVG B;  2CHW A;  2UWQ A;  3NSU A;  2L1C A;  2P0F A;  1EWY C;  3Q8A A;  5BYQ A;  1XF5 L;  4FJY A;  3A9J A;  4HAZ B;  5JXV A;  4DHJ B;  1TS4 A;  2INC C;  2MW5 A;  4JE3 B;  3U7Z A;  2ZNV B;  4NZL B;  3HSA A;  1YIW A;  5CX3 A;  1QF6 A;  3WCQ A;  4YTP B;  3MFG A;  4N6E B;  2V9H A;  2Z0D B;  4XDC A;  2BB6 A;  1FNU A;  4C7Y A;  2D2Q A;  4MEL A;  2QKL A;  2BYE A;  4N9F 4;  4JK8 A;  1S1Q B;  2DAJ A;  1NEK B;  3ZJU A;  1ROE A;  1ET9 A;  1AQC A;  2ZCC A;  4P16 A;  3NG0 A;  2NCN A;  3B2G A;  3OWE B;  3VH3 B;  3Q3N C;  3KRW A;  3L17 A;  2LWP A;  1FGZ A;  1Y19 B;  1SE3 A;  2JY6 A;  1GC6 A;  1TKY A;  1L2N A;  4KZC A;  3FIL B;  4NJ7 A;  2K5P A;  2M1M A;  4IOY X;  1QOB A;  1WZ0 A;  3T3O A;  3EGR A;  4OVU A;  2V1Y A;  3ZNZ B;  1NEN B;  5CHW A;  2RGN B;  1J7A A;  4IFS A;  5LXI B;  4KIK A;  4HB0 B;  2EC1 A;  3PPA A;  1XR0 B;  3L54 A;  2GI9 A;  4Y94 A;  2NS5 A;  2BYF A;  4OZC A;  3N20 C;  4J3O D;  2YEP F;  2RD0 A;  4BOS C;  3ULC A;  4BFR A;  3OG5 A;  4WJQ A;  3KLS X;  5C2T B;  4HB4 B;  3N9Y C;  2LEK A;  4ANU A;  2BT6 A;  4RGN A;  5JHH A;  3UQA A;  4HWI B;  4LDT B;  4FJZ A;  5D3I B;  5BMI A;  1HEZ E;  3PVW A;  3VDZ A;  1IRS A;  5DIF B;  3Q69 A;  2JYT A;  5IOI A;  1U5E A;  5CLL B;  2N23 A;  5BYS A;  4IW0 A;  1V9J A;  5GXG B;  3ULB A;  2COC A;  1WF9 A;  3WAL A;  3FVC A;  2YLM A;  2TSS A;  3VFK A;  4ANX A;  1XCG A;  3ZTC A;  1VCB A;  2KIE A;  1XXG A;  3LDZ E;  2BWF A;  4OSN A;  2KYW A;  2J59 M;  1V5T A;  2Z14 A;  1WE6 A;  3ZIM A;  1F77 A;  3AEA B;  3APF A;  2ZW0 A;  4HPM B;  2VKI A;  3WYF B;  5LON B;  1VJK A;  2E6X A;  4CQN A;  1KF6 B;  2BCJ A;  3RNA C;  3IXS A;  4HDO A;  1PGB A;  5IRS A;  3FIL A;  3JVZ X;  4TQ0 A;  1EU4 A;  1DRO A;  3HIZ A;  2ZCB A;  1WR6 E;  3V61 A;  4KAX B;  5J2R A;  2O2V A;  2FUG 1;  3AEC B;  5KQ4 A;  1BTK A;  3EC8 A;  2EMT A;  3AEG B;  4NY0 A;  3ZO5 B;  1ACC A;  4PK1 A;  2Z0Q A;  1OQN A;  4NSW A;  2KNB A;  1TZO A;  3TEW A;  2PE9 A;  3RUI B;  2BKR B;  1WGD A;  1WXV A;  2KXJ A;  4NAM A;  3VR9 B;  2WXI A;  1E8Z A;  2R82 A;  1ZYI A;  3PRE A;  2IFS A;  5DPT A;  3PHW B;  3OJ4 B;  4ITK A;  4ANV A;  2KMM A;  3P4R B;  4EUT A;  4JLC A;  1MIZ B;  4DX8 A;  4J6I A;  1STE A;  4ARI A;  4GOC A;  3VH4 B;  5KCV A;  1NTY A;  2W54 A;  3CIK A;  1KZG A;  3C19 A;  1I7H A;  2RLO A;  1MG8 A;  4WSF A;  3L4P A;  1DOY A;  4CHJ A;  5EDS A;  3WAM A;  3QAQ A;  4OVV A;  2LGX A;  2HRJ A;  4TYZ A;  4KHB B;  3NOB A;  3BJI A;  1UNQ A;  1ZGU B;  3H7S A;  4DBB A;  4MGI E;  2JRI B;  5BMH A;  1P7F A;  4E3C A;  3ZRF A;  1XQQ A;  4W9E A;  1V1P B;  2EMS A;  1GG3 A;  3MP9 A;  4YON A;  1J7C A;  4M8N A;  1VBG A;  1U2B A;  1L0X B;  1SF0 A;  2N9K A;  1QT9 A;  1G6J A;  2J0K A;  1PUT A;  2A5U A;  2FUH B;  3GE3 C;  2L32 A;  2BW2 A;  3B08 A;  4MT5 A;  5EE9 A;  5C5B B;  1U5F A;  1YJJ A;  1IPG A;  1TY2 A;  4O1N A;  4JKG A;  4IAP A;  2KJR A;  4ZRP A;  2O6V B;  2JF5 A;  1I4G A;  1E90 A;  2KC1 A;  4ILH A;  2LUL A;  4W9C A;  2ONQ A;  4W9D A;  4HAW B;  1WGQ A;  4GDL B;  2MEK A;  3HIE A;  1AWD A;  1I4R A;  2D11 A;  3VVW B;  4CHK A;  2ROV A;  4RH6 A;  3PG7 A;  3DXD A;  3BY4 B;  1TKE A;  2JRH A;  1FAO A;  4XX5 A;  1MJD A;  3ML8 A;  3TIX A;  5H92 C;  5FI1 A;  2PW9 A;  2D4Q A;  4PYZ A;  2WXO A;  1KJT A;  4GMX B;  4ZDV A;  2NBV A;  2KK8 A;  1V1P A;  1SBB B;  2ROZ B;  5BYR A;  1N3H A;  1KRH A;  3DBR I;  2L0T A;  5EE1 A;  2KFK A;  2CY5 A;  4FN2 A;  3N3K B;  1NU2 A;  4RM9 A;  1F2R C;  4EZK A;  2G3Q B;  1D3Z A;  3DCX A;  1MPH A;  4GLS C;  4RGO S;  2LOZ A;  1J7B A;  1NBF C;  3W2D A;  4A3P A;  1C4A A;  1JRP A;  4NQL B;  3VTV A;  4ZYS A;  3NJT A;  5L95 C;  2LOX A;  3IT6 B;  4W9F A;  1N5W A;  2ZVO A;  2KN4 A;  1WXS A;  1RFA A;  4M00 A;  3PZ7 A;  4LNI A;  5L81 A;  1WFY A;  1N63 A;  2NPT B;  1KH0 A;  1J8C A;  2DNF A;  1LB1 A;  1E7V A;  4X57 B;  5JHA A;  2MA9 B;  3TEX A;  2ON8 A;  4WWP A;  2B3A A;  1XLP A;  1KZ7 A;  4A6Q A;  2FCS A;  2NTT A;  2XQN M;  2MP2 A;  2OOB B;  3W9C B;  5J3T A;  3Q14 C;  4TSS A;  4K17 A;  1EU3 A;  2K0P A;  3KH0 A;  1FNW A;  3A33 B;  3ZQ4 A;  1NVI D;  2PZ1 A;  4EKU A;  3GE8 C;  4KDL B;  1WGY A;  1YN4 A;  2D10 A;  4XWW A;  1PDX A;  4B0E A;  2INP E;  1U29 A;  1R4N I;  1WJN A;  2IGG A;  5GOW B;  4C4V B;  2I1K A;  3H1U A;  2MJD A;  4MGY E;  3EFU A;  3AE7 B;  4IG7 B;  4S0R A;  1TS2 A;  3DWM A;  3TEY A;  3V60 A;  3TSS A;  2OED A;  4LDT D;  1X11 A;  1BML C;  2JZ3 B;  2H89 B;  1NTV A;  2DZI A;  2W2W A;  3BWU D;  3ML9 A;  1PYW D;  3AI5 A;  1QKZ A;  1A5R A;  2DBY A;  4HB3 B;  4XWT A;  1V49 A;  3GB1 A;  2DYN A;  1DYQ A;  3PSC A;  1WGH A;  1TKG A;  1YN5 A;  1OEY J;  2QMT A;  1E6E B;  3NHE B;  3AEE B;  3D32 A;  4BKS D;  1FHW A;  3HRD D;  4TUU A;  4TQ1 A;  3V6C B;  1RJ2 A;  5HE2 A;  4JKE A;  4QJ4 B;  3X0W A;  4C56 C;  3R8B A;  1D5M C;  1KC7 A;  3CSF A;  1V61 A;  5G5H A;  2KQ7 A;  2QKM A;  5CLQ B;  1I42 A;  2X18 A;  3LYY A;  3AU5 A;  2KJ6 A;  4GGQ A;  3U52 E;  1AAR A;  4M0W A;  4CHM A;  2FNJ B;  2IYB A;  5I4D A;  1CK1 A;  2WDR B;  4B6H A;  4OHJ A;  2Y5P A;  2KFJ A;  1FRR A;  2LGD A;  4MAC A;  1UWX A;  4DIX A;  3E66 A;  2YF0 A;  1FEH A;  3IG3 A;  5C5B A;  4QXA B;  4GU2 A;  3SHQ A;  3CST A;  3B1L X;  2N9E B;  4II2 B;  3HQC A;  2R2O A;  4C4V A;  3UF8 A;  1SSN A;  2JU6 X;  3ONS A;  4WWO A;  4DK5 A;  1JQ4 A;  2D9Y A;  2WXQ A;  3ZDT A;  3F5R A;  5IJM A;  3DXE A;  4Q2J A;  4YTN B;  1ZC3 B;  3T3N A;  1E8Y A;  2DZK A;  2H88 B;  2D3C A;  2QHO A;  4FAD A;  2L0F A;  4Z2N A;  3DVG Y;  1XO3 A;  3E9P A;  2NPT A;  1VD2 A;  1ZOY B;  3WAN A;  2L7R A;  4ZHO A;  1GB4 A;  2LVO A;  1X1M A;  2XEW A;  2WXN A;  3TJP A;  4CO7 A;  2MBO A;  4W9K A;  3I3T B;  3JSV B;  3ML4 A;  3DBH I;  1MIX A;  4II3 B;  3TUO A;  3AH7 A;  2LHD A;  3SUZ A;  1JCK B;  1YJI A;  2D3B A;  3RNB C;  4W9H A;  4A6K A;  5JP4 A;  2KVZ A;  1C4C A;  1MG4 A;  5FR6 A;  1ZVR A;  4EJN A;  4A55 A;  1K5G B;  1D5Z C;  5C6R A;  4BBK A;  4LK0 M;  1SXT A;  3U12 A;  4K2O A;  3H6N A;  2K1F A;  2FE8 A;  2KD0 A;  3PVL A;  1TZ1 A;  4ACF A;  3JSV A;  5HE0 A;  2K8C A;  1MVK A;  3P42 A;  4A20 A;  2RQ1 A;  2GUM A;  2MHJ A;  4XDD A;  2W55 A;  2Z0P A;  4KHO A;  4RGM A;  5DI9 B;  3AE6 B;  4JKB A;  3VTU A;  2LHE A;  5DCN A;  3TFM A;  1TJ6 A;  1XCQ L;  4XE0 A;  2COP A;  5IKC M;  4RNA A;  3FM8 C;  2XK5 A;  2EEL A;  3A4R A;  3IT4 B;  2R0D A;  1KOT A;  1GOZ A;  4IDI A;  4LNN A;  1FXI A;  2KDE B;  2L76 A;  2BS2 B;  2ADZ A;  1UH6 A;  1WMH B;  1ZUD 2;  3W1S A;  3PZ8 A;  4AP4 C;  5HHD G;  2KMA A;  2OHF A;  5BMG A;  4KGS A;  2MDX A;  1N60 A;  3R7R A;  1P98 A;  2N7J A;  2WXP A;  4PS3 A;  1SHC A;  5E6J A;  1VR9 A;  2KUP A;  1B55 A;  2KX3 A;  4JX1 C;  2FDQ A;  4HAY B;  2KAN A;  2Y8F A;  2K9X A;  2D07 B;  2CU3 A;  1R4M I;  2IND C;  1TQZ A;  2MSE D;  2GBN A;  2C5L C;  1K53 A;  2BTE A;  4FHJ A;  1KI1 B;  1UNR A;  2L05 A;  1ZDX A;  3SU8 X;  3MC8 A;  5DHA B;  3U30 A;  3TCA A;  4EMO A;  3NVZ A;  3AB5 A;  3W5V B;  2CR5 A;  3ZKJ C;  1X1G A;  3ZVV A;  1AN8 A;  5FKA C;  5CTR C;  4DBG A;  2IJ0 A;  4C00 A;  1VZ8 A;  2PLP A;  5EE0 A;  3EEC A;  2BQQ A;  4HAU B;  4GSW A;  2LJI A;  1RYJ A;  2VZK D;  2BYV E;  2W2X D;  3W1Y A;  1KLV A;  2K8H A;  5D3V A;  2WP9 B;  1T3Q A;  2W82 A;  3M62 B;  3G9W A;  1ACA A;  1SE4 A;  2FCM A;  1C77 A;  1UEL A;  1JW9 D;  2M19 A;  4ICU A;  1JWS D;  1M7E A;  2J42 A;  1SIF A;  2CU1 A;  5LG4 B;  1V5U A;  4OVZ A;  2AL6 A;  2BS3 B;  2PVO D;  1FPY A;  3APC A;  5J18 A;  1OTR B;  3QC8 B;  2MBB B;  4W9I A;  2BPS A;  3VRB B;  3AE1 B;  3RUL A;  2GBJ A;  3PZD A;  2I5F A;  3AE2 B;  4US8 A;  4L6E A;  2C7M B;  2DHZ A;  2G9H D;  2LZ6 A;  4RF1 A;  3N30 A;  1C79 A;  2GBR A;  4ZOH C;  1N62 A;  2KDI A;  2WXG A;  3UI3 A;  5DPW A;  2MQJ A;  1EF1 A;  4EE2 A;  3O96 A;  1UBQ A;  2J52 A;  3MC0 B;  2FAZ A;  3RI7 C;  2J0J A;  3D8E A;  2INN E;  2I5C A;  5G2N A;  3PRZ A;  4IKG A;  1UGJ A;  1TT5 B;  2MH7 A;  2JUO A;  3VTW A;  4USA A;  3KYD D;  4H2A A;  2MJE A;  1AW7 A;  1V8C A;  2JX5 A;  2L3Z A;  1WJU A;  2DWQ A;  3PLV A;  3AJ4 A;  3Q3F A;  4NJ6 A;  1WX9 A;  3I57 A;  1ENF A;  2H7E A;  1QOF A;  4LJP B;  4D0N B;  4IWO A;  1YX6 B;  2Y5C A;  3RFZ B;  4FXC A;  1L0Y B;  2UVM A;  2KDB A;  2COF A;  1AYF A;  3U8Z A;  1U27 A;  4AOF A;  4DHZ E;  2Z0E B;  2DN6 A;  3SV1 A;  2ZJD A;  2IBI B;  4XZ4 A;  2Z59 A;  4KKJ A;  1V97 A;  1R4M B;  1XD3 B;  2IYD B;  4L1B A;  1PMS A;  2DAF A;  4HPP A;  4JGH B;  4BBN C;  3BVG A;  4KKI A;  1Z2M A;  3A1Q A;  4KSL C;  4ASW C;  2LVP A;  2JWU A;  2GBK A;  1N5X A;  1KLG D;  2LKO A;  3AE4 B;  3M1I B;  3QIJ A;  2PVG C;  3PSE B;  1TBE A;  3GS2 A;  3Q6B A;  4NPN A;  1BUI C;  3A98 B;  3NZS A;  1MFW A;  5AZG A;  4GDK A;  5C1Z A;  4WQM A;  3WAP A;  3ZNG C;  1HTO A;  3LJ3 A;  1P6S A;  2D9X A;  4RFB A;  1T6B X;  1Z5S B;  3NWA A;  4N59 A;  4WQO B;  1TS5 A;  4MSQ B;  1YMH E;  3TBL D;  1YD8 U;  1ESF A;  1ZXH A;  4HCN B;  1K8R B;  2KN5 A;  3FEH A;  3PP2 A;  2JXX A;  2VRR B;  3DHH C;  1YQB A;  4F7G A;  3Q2A C;  2EJ8 A;  4GDK B;  2D9Z A;  2AQ3 B;  2FIF A;  1WIA A;  2FJU B;  2RNR B;  1QQR A;  2OTX A;  2LYD A;  1PQS A;  1JRO A;  2ZKM X;  2I38 A;  2CRF A;  1JAL A;  5I2S A;  1VRA B;  4WWM A;  3T9L A;  3KUZ A;  2DHI A;  4A6H A;  4AJY B;  2P0H A;  3KQ4 A;  1CJE A;  2ZEQ A;  1MK7 B;  2XBB C;  3U2S C;  4ZRI A;  4HCP B;  3SD5 A;  4LLG M;  1WGG A;  1F2R I;  1ISN A;  2LMC A;  5IN7 A;  2MFQ A;  4NJC A;  4HKQ A;  2RSG A;  1GB1 A;  3S2A A;  3DDC B;  1WRD B;  1SE9 A;  2KDM A;  4ZHP A;  1ZPS A;  5IA7 A;  4HLE A;  3QCA A;  2N7E A;  4E71 A;  2KLG A;  1FHO A;  4IOI E;  4YL8 A;  2KAJ A;  2VSZ A;  2MX2 A;  1WYW B;  2YT2 A;  4BOZ B;  3Q8E A;  1UPQ A;  3P6A A;  4YSY B;  4IC7 B;  1P0R A;  4B0M A;  1QQG A;  2KCJ A;  3NRZ A;  4FHK A;  4HAT B;  2IO1 B;  2WXF A;  4YT0 B;  2GB1 A;  3RT3 B;  1VZ7 A;  2KVR A;  2L83 A;  3CIR B;  2QEJ C;  4FBJ B;  2PIA A;  1FXA A;  1VBH A;  2IY0 B;  4JK7 A;  1E5W A;  2GS0 A;  1IBX A;  1FIQ A;  1LXD A;  4F8C B;  1ZSQ A;  3E9O A;  2DZJ A;  2LGY A;  1PFJ A;  4DXA B;  1T0Y A;  1XX0 A;  3APD A;  2BVC A;  1XT9 B;  4WVF B;  4LCD E;  4MH8 A;  1WXQ A;  2DYB A;  3H8H A;  2WXK A;  1UNS A;  3UIP B;  1GC7 A;  3PO0 A;  2V4I B;  1KLU D;  3QHT A;  3R66 C;  1RLF A;  3VIA A;  4KZ0 A;  5LOP B;  2HD5 B;  2M4N A;  3NVV A;  3FP5 A;  3AXC A;  4NQK E;  4N58 A;  2Q13 A;  4RF0 A;  3QX1 A;  2JZZ A;  2PJH A;  1DOX A;  1GAQ B;  4K2P A;  3FLV A;  4QAY A;  2NZ8 B;  1ZKH A;  3DVN U;  1ST7 A;  4JPS A;  2FCQ A;  3JYU A;  3AU4 A;  3N1X C;  1V80 A;  3NZU A;  1FMA D;  2Z0O A;  5H8Y E;  3PHX B;  2MCN B;  2KUQ A;  3Q3J A;  4XGA B;  3ZRC A;  2M0A A;  2M0X A;  1HZ6 A;  1YQ4 B;  2DYM A;  1WR1 A;  2WWZ A;  4PQ0 A;  3DVG X;  1SJH D;  3P2B A;  2V3P A;  2MJ3 A;  2JPH A;  2X0S A;  1EGX A;  3HUI A;  3L10 B;  1YN3 A;  4LTU A;  1FCC C;  2KX0 A;  3UIN B;  1J19 A;  5LNK 1;  3HK0 A;  5C16 A;  1VDV A;  3P4Q B;  4G3X B;  1WI1 A;  4HXD A;  3B0A A;  1EM7 A;  4IM3 A;  2KWC A;  2M17 A;  2DLB A;  1WG7 A;  3P1M A;  2K49 A;  3IAM 1;  3ZNH B;  4DHZ B;  1FCL A;  1NYR A;  3B9J A;  1GJZ A;  1UPR A;  1WJ1 A;  2OJR A;  3PV1 A;  2DTC A;  2YT1 A;  4C80 A;  4A5K A;  2O6V A;  1P3Q U;  1JDE A;  5TR5 A;  3AEF B;  1LGR A;  1N6Z A;  3MC9 A;  2B76 B;  4FLH A;  1UBI A;  1I4P A;  2IY1 B;  1QZE A;  1FO4 A;  2K00 A;  1T5X D;  2UU7 A;  2NVU I;  2LUE A;  2NMB A;  2BYT A;  3T8M A;  4PYU A;  2VZK B;  1E7U A;  4M8M A;  1C4P A;  3DXC A;  1L7Y A;  4KX6 B;  4GOU A;  2J7Q B;  4AQ7 A;  3C0R B;  4MGZ E;  3P4S B;  2DHK A;  2V0G A;  4D2K A;  2CQU A;  3VUY A;  2FJ9 A;  1X05 A;  2HTH A;  3Q8B A;  4K3C A;  1XEE A;  1WJ6 A;  4B95 A;  4LNK A;  4W9L A;  4WWN A;  2DKQ A;  4CSQ A;  1XOD A;  1S3S G;  4XWX A;  2DFK A;  3DHG C;  1MK9 B;  3ABV B;  5AUK A;  2REX A;  3T06 A;  3RNF C;  4ZRJ A;  4K7W A;  3DBS A;  1H4R A;  3IHP C;  1SGH A;  3V05 A; 
#chains in the Genus database with same CATH homology
 5HE1 A;  4MH0 E;  2MWS B;  1U5G A;  2WX1 A;  3D8D A;  2DLW A;  2O6V D;  5DH9 B;  2HE7 A;  3VUX A;  2N4F A;  3DCG A;  3IFW B;  2ELB A;  3PLU A;  1GUA B;  1UZX B;  3MJW A;  4NNJ B;  4K7U A;  3HHM A;  4ZRK A;  5HE3 A;  5E6O A;  4HHV A;  5D3W A;  1GNU A;  2Z59 B;  1X86 A;  1FGY A;  3KUC B;  3KSY A;  5D6J B;  1Y5O A;  1KM7 A;  1QC6 A;  3ZUN A;  4NAW B;  1KBL A;  3H9D A;  3GOE A;  3A8Q A;  1BWN A;  4P7I A;  3L16 A;  3DBL I;  3OJ3 A;  2DKP A;  3DQV A;  2R2Q A;  4GIV A;  1MAI A;  3SBT A;  4HJK A;  2RUK B;  2BF8 B;  3ZNI D;  1EO6 A;  2RR9 A;  1WMH A;  2KZR A;  3PEG A;  2M14 A;  3M95 A;  1J0W A;  2KWU B;  1YX5 B;  2GCL A;  2LVQ A;  1WI0 A;  2IZV B;  1FXT B;  1GGO A;  4TV3 A;  2NBV B;  2W2X C;  3QA8 A;  3QK0 A;  3M63 B;  2KTR A;  1WJ4 A;  4EOY A;  2Y7B A;  1LM8 B;  2D9W A;  3A9K B;  3VHT C;  4AWJ A;  5KHQ A;  4F7U P;  2GMI C;  1V89 A;  5GMV A;  3TO1 A;  1U4A A;  4JKF A;  2PPH A;  2GCJ A;  1DDW A;  4A6F A;  3ODO A;  4W9G A;  5JVL A;  2LXA A;  3CXB B;  3WIM A;  2DIK A;  1U5D A;  1DDV A;  5JZE B;  2DA0 A;  3ALB A;  2O2V B;  1ZM0 A;  2ABD A;  2K39 A;  4PNK A;  1V86 A;  2JT4 B;  4JKA A;  1EUV B;  1OMW A;  4GZU A;  2JP2 A;  2ELA A;  4ILJ A;  2D3G A;  1WY8 A;  2A4Z A;  1H10 A;  3IBE A;  2JVC A;  2CAY A;  1TGZ B;  3UZT A;  3KW5 B;  1P5T A;  3VUW A;  2KGX B;  1HB8 A;  3SBG A;  1K5D B;  2LD9 A;  2M8S A;  3NS8 A;  4KSK C;  3TVV A;  2RVB B;  4JQW C;  3PTF C;  2HTH B;  4KIK B;  2KHW B;  3FSS A;  1WX7 A;  4MDK E;  2H7D A;  3N32 A;  2LG1 A;  4MT7 A;  4ANW A;  4K81 A;  2KLC A;  3RCP A;  1DYN A;  1UGM A;  2V3S A;  3QWZ B;  5AEK B;  1E8W A;  2DX5 B;  2UYZ B;  1LFD A;  1V2Y A;  3QQ8 B;  3UGB B;  1I2H A;  4BVU C;  3P7Z A;  4IWP A;  4BKS A;  4BBN F;  4M0W B;  2RPQ A;  2C9W B;  2DZM A;  2MLB A;  1CMX B;  2KJH B;  2ZZP B;  1WJM A;  4Z2M B;  4GPT B;  3ENB A;  5CHF A;  1TTN A;  4WJN A;  1RRP B;  2K2U A;  3UQB A;  2LI5 A;  1W1H A;  1BT0 A;  2CHZ A;  1OY2 A;  2BWE S;  1V6E A;  2V76 A;  4FJV B;  3KVF B;  3KUD B;  4KDI C;  5DPR A;  1NI2 A;  4JIO U;  3SDL C;  3HM3 A;  5D94 A;  1I35 A;  2LJ5 A;  5KQ1 A;  1WXA A;  3RD2 A;  1ZC4 B;  2IO0 B;  1YJ1 A;  4GN1 A;  2N9X A;  4A6F B;  4HDQ A;  2DYQ A;  5L83 A;  2BGF A;  2KOX A;  3ODX A;  2AYO B;  2FCN A;  3QAR A;  1EAZ A;  2DYO A;  5JHB A;  4E74 A;  3W1S C;  1LW3 A;  1NDD A;  2DHJ A;  2YT0 A;  2PEA A;  2CHX A;  2YSZ A;  2XK5 B;  2OQB A;  1PLS A;  2ZNV C;  3O65 B;  1FOE A;  5DHF B;  1M94 A;  2EKE C;  2KFK B;  3MDB C;  2UZS A;  5LXH A;  1J0G A;  1NVL A;  2N9P C;  2CS4 A;  1LQB A;  4FA6 A;  3SO6 A;  3M3J A;  4HVB A;  5JHG A;  2AL3 A;  1UNP A;  4EFO A;  3R7Q A;  3QWM A;  2ZPY A;  1P3R A;  3E9L A;  2M38 A;  1WX8 A;  3A1Q B;  4F7H A;  1OEY A;  2GOW A;  3H7P B;  1W1G A;  3BIN A;  2WYQ A;  1V5P A;  3PS6 A;  3OLM D;  2GBM A;  3DVN V;  3VAW A;  2CB8 A;  4RM8 A;  2DX1 A;  4WJP A;  3WAO A;  4RMA A;  4KV2 A;  4WJ7 A;  3TL5 A;  1WGU A;  2YS3 A;  5BO4 B;  3PRM B;  4HB2 B;  3DOW A;  5AZH A;  1UEF A;  3OAN A;  1WM3 A;  4JKG B;  2COD A;  5D7G A;  2K6Q A;  2RGF A;  3ZDM C;  4ICV A;  3A4S C;  2ZPN A;  2P0D A;  3PRP B;  4BKT A;  2G4D B;  2KC2 A;  3CF6 E;  2YRY A;  4TKN A;  4F1S A;  3ZVR A;  2N7D A;  2NR2 A;  4BKG A;  4MY6 A;  2ASQ A;  2MP2 B;  2YVC A;  2GJY A;  4HPL B;  3RCZ A;  2YS1 A;  2LRU A;  4IM0 A;  2HJ8 A;  2DX5 A;  3WA0 A;  4MEM A;  5J3Q A;  3ZTD A;  4G0N B;  2UZR A;  2J0M A;  3V62 A;  3VOQ A;  1FB8 A;  4DX9 0;  2CKH B;  2G45 B;  1P9D U;  3EPY A;  1FHX A;  4K1R B;  3F0W A;  1XD4 A;  2WDT B;  3U7D A;  5C23 A;  4F7Z A;  1WZ3 A;  2LAS A;  4AJW A;  3L13 A;  4K7S A;  4EZJ A;  3V5W A;  4I6N B;  3RYT A;  4GDL A;  1RAX A;  1W1D A;  2ZVN A;  5J17 A;  2AWT A;  2Y5B B;  4JK9 A;  2E2X A;  1XKE A;  2L8J A;  3ZW3 A;  2KMC A;  2IO2 B;  1WVH A;  4IWQ A;  2IO3 B;  3L08 A;  1H8C A;  3KY9 A;  4MJS B;  4W9J A;  4JKH A;  2K6D B;  4ZYN A;  4PS7 A;  4HAV B;  2K2J A;  3R3M A;  2V4L A;  3UIO B;  1Q1O A;  5C79 A;  4WAA A;  4GXB A;  3A8P A;  1EVH A;  3V6E B;  1DBH A;  5FI0 A;  2N0Y A;  3ODW A;  5JLJ B;  4WJO A;  3MHS D;  1X1F A;  1C1Y B;  3MPX A;  2NBU A;  5HKH A;  2FJL A;  3QJZ A;  2BKF A;  5G55 A;  5EFX A;  3MTN B;  2Y8G A;  3ENE A;  1V5O A;  2D9V A;  2KO3 A;  2G35 A;  5IAA C;  2COA A;  3GZN I;  2VRW B;  4MJS A;  1NTI A;  3EHV A;  4ILG B;  1F9J A;  4C0A A;  4A3O A;  2C7H A;  3L0W B;  3AUL A;  3RZF A;  3A9J B;  4KHA A;  3K9O B;  3PVU A;  3KZ1 A;  3H7P A;  3HM6 X;  5D3Y A;  5DPS A;  3A9K A;  1V88 A;  2MKR A;  1Z87 A;  5D3X A;  2KQS A;  4MSM B;  4DHJ D;  3GYO A;  4B9K A;  2LRW A;  1WE7 A;  1JRU A;  4EZL A;  4PS8 A;  3ECI A;  2MBQ A;  2KTR B;  4I6L B;  3OAW A;  1HB6 A;  2NBW B;  4CYE A;  1HBK A;  1Q67 A;  3SNH A;  2L00 B;  1Q0W B;  3K9P B;  3HW2 B;  4B6W A;  1WXM A;  4JKC A;  2LXC A;  2K25 A;  2G4S A;  4G50 A;  4IUM B;  2N1W A;  1I7A A;  4IM2 A;  1UD7 A;  2WX0 A;  2MRP A;  3SYX A;  4JKD A;  3PGE A;  2RSU A;  4MK0 A;  1BTN A;  4G11 A;  3PT2 B;  1Q5W B;  3LJU X;  1WGR A;  2JWZ A;  2C7N B;  5D2M B;  4FUL A;  1RRB A;  1AWE A;  2YS5 A;  4URK A;  1P1A A;  2DEN B;  5AZF A;  2FID A;  3TMP B;  1TXD A;  3JW0 X;  5KHO A;  4MGK E;  3N7C A;  2CY4 A;  1WM2 A;  1DIK A;  3GYP A;  3KYC D;  4AUQ C;  3D8F A;  4H8S A;  4EEW A;  2L2I A;  2P8V A;  4JL9 A;  1BAK A;  3CMM B;  2PE6 B;  1V81 A;  1ZW7 A;  1OGW A;  4MM3 A;  3IVF A;  1E8X A;  2KKC A;  3QBV B;  1WH3 A;  1C3T A;  2KWV B;  1IYF A;  2MWN B;  3DPD A;  4NAW A;  1OQY A;  2AEH A;  4HAX B;  3X23 A;  4GMV A;  5LLI A;  3RZW C;  2WH5 A;  1M7R A;  5J3Y A;  2MBE A;  3ZLZ A;  2K8B A;  1EF5 A;  2N1V A;  4HK2 A;  4GB9 A;  3TW1 A;  4LJO B;  1Y8R C;  2MBH A;  2I1J A;  5D27 A;  3NY5 A;  4XC2 A;  2R09 A;  5E6N A;  5CHV C;  2W9N A;  3KRX A;  5E6P A;  4I6P A;  2C60 A;  2KDF B;  3VQI A;  1IP9 A;  1DDM A;  2KTF A;  1V5M A;  4DDI D;  2LBB A;  1MKE A;  3VXW A;  1HE8 A;  4DDG D;  5JH5 C;  4DWF A;  4KVG B;  2CHW A;  2UWQ A;  3NSU A;  2L1C A;  2P0F A;  4FJY A;  3A9J A;  4HAZ B;  4DHJ B;  2MW5 A;  2ZNV B;  1YIW A;  5CX3 A;  2Z0D B;  2D2Q A;  4MEL A;  2QKL A;  2BYE A;  4N9F 4;  4JK8 A;  1S1Q B;  2DAJ A;  1AQC A;  2ZCC A;  2NCN A;  3VH3 B;  3KRW A;  3L17 A;  2LWP A;  1FGZ A;  1Y19 B;  2JY6 A;  1GC6 A;  1L2N A;  4KZC A;  4NJ7 A;  2M1M A;  4IOY X;  1WZ0 A;  4OVU A;  2V1Y A;  3ZNZ B;  5CHW A;  2RGN B;  4IFS A;  5LXI B;  4KIK A;  4HB0 B;  2EC1 A;  3PPA A;  1XR0 B;  3L54 A;  4Y94 A;  2NS5 A;  2BYF A;  2RD0 A;  4BOS C;  3ULC A;  4BFR A;  4WJQ A;  4HB4 B;  4ANU A;  5JHH A;  3UQA A;  4HWI B;  4LDT B;  4FJZ A;  3PVW A;  3VDZ A;  1IRS A;  5DIF B;  1U5E A;  5CLL B;  2N23 A;  4IW0 A;  1V9J A;  3ULB A;  2COC A;  1WF9 A;  3WAL A;  2YLM A;  3VFK A;  4ANX A;  1XCG A;  3ZTC A;  1VCB A;  3LDZ E;  2BWF A;  2J59 M;  1V5T A;  1WE6 A;  3ZIM A;  3APF A;  4HPM B;  2VKI A;  3WYF B;  5LON B;  2BCJ A;  4HDO A;  3JVZ X;  4TQ0 A;  1DRO A;  3HIZ A;  2ZCB A;  1WR6 E;  3V61 A;  4KAX B;  5J2R A;  2O2V A;  5KQ4 A;  1BTK A;  3EC8 A;  2EMT A;  4NY0 A;  3ZO5 B;  2Z0Q A;  1OQN A;  4NSW A;  2KNB A;  2PE9 A;  3RUI B;  2BKR B;  1WGD A;  1WXV A;  2KXJ A;  1E8Z A;  2R82 A;  3PRE A;  2IFS A;  5DPT A;  3PHW B;  3OJ4 B;  4ANV A;  4EUT A;  4JLC A;  1MIZ B;  4DX8 A;  4J6I A;  4GOC A;  3VH4 B;  5KCV A;  1NTY A;  3CIK A;  1KZG A;  2RLO A;  1MG8 A;  4WSF A;  4CHJ A;  5EDS A;  3WAM A;  4OVV A;  3QAQ A;  2LGX A;  2HRJ A;  4TYZ A;  4KHB B;  3NOB A;  3BJI A;  1UNQ A;  1ZGU B;  3H7S A;  4DBB A;  4MGI E;  2JRI B;  4E3C A;  3ZRF A;  1XQQ A;  4W9E A;  2EMS A;  1GG3 A;  4YON A;  4M8N A;  1VBG A;  1U2B A;  1G6J A;  2J0K A;  2A5U A;  2FUH B;  3B08 A;  5C5B B;  1U5F A;  1IPG A;  4JKG A;  4IAP A;  2KJR A;  2O6V B;  2JF5 A;  1E90 A;  2KC1 A;  4ILH A;  2LUL A;  4W9C A;  4W9D A;  4HAW B;  1WGQ A;  4GDL B;  2D11 A;  3VVW B;  4CHK A;  2ROV A;  3PG7 A;  3DXD A;  3BY4 B;  2JRH A;  1FAO A;  4XX5 A;  3ML8 A;  3TIX A;  5FI1 A;  2D4Q A;  4PYZ A;  1KJT A;  4GMX B;  4ZDV A;  2KK8 A;  2ROZ B;  1N3H A;  3DBR I;  2L0T A;  2KFK A;  2CY5 A;  4FN2 A;  3N3K B;  1NU2 A;  4RM9 A;  4EZK A;  2G3Q B;  1D3Z A;  1MPH A;  2LOZ A;  1NBF C;  4A3P A;  4NQL B;  3VTV A;  5L95 C;  2LOX A;  4W9F A;  2ZVO A;  1WXS A;  1RFA A;  5L81 A;  1WFY A;  2NPT B;  1J8C A;  1LB1 A;  1E7V A;  4X57 B;  5JHA A;  2MA9 B;  4WWP A;  2B3A A;  1KZ7 A;  2FCS A;  2XQN M;  2MP2 A;  2OOB B;  5J3T A;  4K17 A;  3KH0 A;  3A33 B;  2PZ1 A;  4EKU A;  4KDL B;  1WGY A;  2D10 A;  1U29 A;  1R4N I;  1WJN A;  5GOW B;  2I1K A;  3H1U A;  4MGY E;  3EFU A;  4IG7 B;  3V60 A;  4LDT D;  1X11 A;  2JZ3 B;  1NTV A;  2DZI A;  2W2W A;  3ML9 A;  3AI5 A;  1A5R A;  4HB3 B;  1V49 A;  2DYN A;  3PSC A;  1WGH A;  1OEY J;  3NHE B;  3D32 A;  4BKS D;  1FHW A;  4TUU A;  4TQ1 A;  3V6C B;  1RJ2 A;  5HE2 A;  4JKE A;  3X0W A;  1KC7 A;  3CSF A;  1V61 A;  2KQ7 A;  2QKM A;  5CLQ B;  1I42 A;  2X18 A;  3AU5 A;  2KJ6 A;  4GGQ A;  1AAR A;  4CHM A;  2FNJ B;  2IYB A;  4B6H A;  2KFJ A;  2LGD A;  3E66 A;  2YF0 A;  3IG3 A;  5C5B A;  4GU2 A;  3SHQ A;  3CST A;  3B1L X;  2N9E B;  4II2 B;  3HQC A;  2R2O A;  3UF8 A;  3ONS A;  4WWO A;  4DK5 A;  2D9Y A;  3ZDT A;  3F5R A;  5IJM A;  3DXE A;  1ZC3 B;  1E8Y A;  2DZK A;  2QHO A;  4FAD A;  2L0F A;  4Z2N A;  3DVG Y;  3E9P A;  2NPT A;  1VD2 A;  3WAN A;  2L7R A;  2LVO A;  1X1M A;  2XEW A;  3TJP A;  4CO7 A;  2MBO A;  4W9K A;  3I3T B;  3JSV B;  3ML4 A;  3DBH I;  1MIX A;  4II3 B;  3SUZ A;  4W9H A;  4A6K A;  5JP4 A;  5FR6 A;  1ZVR A;  4EJN A;  1K5G B;  5C6R A;  4BBK A;  4K2O A;  3H6N A;  2K1F A;  2KD0 A;  3PVL A;  1TZ1 A;  3JSV A;  5HE0 A;  2K8C A;  4A20 A;  2RQ1 A;  2Z0P A;  4KHO A;  5DI9 B;  4JKB A;  3VTU A;  5DCN A;  3TFM A;  1TJ6 A;  2COP A;  3FM8 C;  2XK5 A;  3A4R A;  2R0D A;  1KOT A;  2KDE B;  2L76 A;  2ADZ A;  1UH6 A;  1WMH B;  3W1S A;  4AP4 C;  2KMA A;  3R7R A;  2MDX A;  1P98 A;  4PS3 A;  1SHC A;  2KUP A;  1B55 A;  2KX3 A;  2FDQ A;  4HAY B;  2KAN A;  2Y8F A;  2D07 B;  1R4M I;  1TQZ A;  2MSE D;  2GBN A;  2C5L C;  4FHJ A;  1KI1 B;  1UNR A;  2L05 A;  3SU8 X;  5DHA B;  3U30 A;  3TCA A;  4EMO A;  2CR5 A;  3ZKJ C;  1X1G A;  3ZVV A;  5CTR C;  4DBG A;  3EEC A;  4HAU B;  4GSW A;  2BYV E;  2W2X D;  3W1Y A;  1KLV A;  2K8H A;  5D3V A;  3M62 B;  3G9W A;  1ACA A;  2FCM A;  1UEL A;  4ICU A;  1M7E A;  1SIF A;  2CU1 A;  1V5U A;  2AL6 A;  3APC A;  5J18 A;  1OTR B;  3QC8 B;  2MBB B;  4W9I A;  2BPS A;  3RUL A;  2GBJ A;  3PZD A;  2I5F A;  4L6E A;  2C7M B;  2DHZ A;  2LZ6 A;  3N30 A;  2GBR A;  2KDI A;  5DPW A;  2MQJ A;  1EF1 A;  3O96 A;  1UBQ A;  2FAZ A;  2J0J A;  3D8E A;  2I5C A;  5G2N A;  3PRZ A;  3VTW A;  2JUO A;  3KYD D;  2L3Z A;  1WJU A;  3PLV A;  3AJ4 A;  3Q3F A;  4NJ6 A;  1WX9 A;  2H7E A;  4LJP B;  4D0N B;  4IWO A;  1YX6 B;  2UVM A;  2KDB A;  2COF A;  3U8Z A;  1U27 A;  4AOF A;  4DHZ E;  2Z0E B;  2DN6 A;  3SV1 A;  2ZJD A;  2IBI B;  4XZ4 A;  2IYD B;  1XD3 B;  1PMS A;  2DAF A;  4JGH B;  4BBN C;  1Z2M A;  3A1Q A;  4KSL C;  4ASW C;  2LVP A;  2GBK A;  2LKO A;  3M1I B;  3QIJ A;  3PSE B;  1TBE A;  4NPN A;  3A98 B;  3NZS A;  5C1Z A;  5AZG A;  4GDK A;  3WAP A;  3ZNG C;  3LJ3 A;  1P6S A;  2D9X A;  1Z5S B;  4WQO B;  4MSQ B;  3TBL D;  1YD8 U;  4HCN B;  1K8R B;  2KN5 A;  3FEH A;  3PP2 A;  2JXX A;  2VRR B;  1YQB A;  4F7G A;  2EJ8 A;  4GDK B;  2D9Z A;  2FIF A;  1WIA A;  2RNR B;  2OTX A;  2LYD A;  1PQS A;  2CRF A;  3T9L A;  3KUZ A;  2DHI A;  4A6H A;  4AJY B;  2P0H A;  2ZEQ A;  1MK7 B;  2XBB C;  4ZRI A;  4HCP B;  3SD5 A;  1WGG A;  1ISN A;  2MFQ A;  2RSG A;  3S2A A;  3DDC B;  1WRD B;  1SE9 A;  5IA7 A;  4HLE A;  3QCA A;  2N7E A;  4E71 A;  2KLG A;  1FHO A;  4YL8 A;  2VSZ A;  1WYW B;  2MX2 A;  4BOZ B;  1UPQ A;  3P6A A;  4IC7 B;  1P0R A;  1QQG A;  2KCJ A;  4FHK A;  4HAT B;  2IO1 B;  3RT3 B;  2KVR A;  4FBJ B;  1VBH A;  2IY0 B;  4JK7 A;  1E5W A;  2GS0 A;  1LXD A;  4F8C B;  1ZSQ A;  3E9O A;  2DZJ A;  2LGY A;  1PFJ A;  4DXA B;  1T0Y A;  1XX0 A;  3APD A;  1XT9 B;  4WVF B;  4LCD E;  2DYB A;  3UIP B;  1GC7 A;  3QHT A;  3R66 C;  1RLF A;  3VIA A;  4KZ0 A;  5LOP B;  2HD5 B;  2M4N A;  3FP5 A;  3AXC A;  4NQK E;  2Q13 A;  3QX1 A;  2JZZ A;  2PJH A;  4K2P A;  3FLV A;  2NZ8 B;  1ZKH A;  3DVN U;  1ST7 A;  2FCQ A;  3JYU A;  3AU4 A;  3NZU A;  1V80 A;  2Z0O A;  3PHX B;  2MCN B;  3Q3J A;  3ZRC A;  2M0X A;  2DYM A;  1WR1 A;  2WWZ A;  4PQ0 A;  3DVG X;  3P2B A;  2JPH A;  2X0S A;  1EGX A;  3L10 B;  2KX0 A;  3UIN B;  1J19 A;  3HK0 A;  5C16 A;  4G3X B;  1WI1 A;  4HXD A;  3B0A A;  4IM3 A;  2KWC A;  2M17 A;  1WG7 A;  3ZNH B;  4DHZ B;  1GJZ A;  1UPR A;  1WJ1 A;  2OJR A;  3PV1 A;  2DTC A;  2YT1 A;  4A5K A;  2O6V A;  1P3Q U;  1JDE A;  5TR5 A;  4FLH A;  1UBI A;  2IY1 B;  1QZE A;  2K00 A;  2NVU I;  2LUE A;  2NMB A;  3T8M A;  4PYU A;  4M8M A;  1E7U A;  3DXC A;  1L7Y A;  2J7Q B;  3C0R B;  4MGZ E;  2DHK A;  2CQU A;  3VUY A;  2FJ9 A;  1X05 A;  2HTH A;  1WJ6 A;  4B95 A;  4W9L A;  4WWN A;  2DKQ A;  1XOD A;  1S3S G;  4XWX A;  2DFK A;  1MK9 B;  2REX A;  3T06 A;  4ZRJ A;  4K7W A;  3DBS A;  1H4R A;  3IHP C;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...