2YVCA

Crystal structure of the radixin ferm domain complexed with the nep cytoplasmic tail
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Radixin
publication title Structural basis for type II membrane protein binding by ERM proteins revealed by the radixin-neutral endopeptidase 24.11 (NEP) complex
pubmed doi rcsb
source organism Mus musculus
total genus 85
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2yvcA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yvcA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2yvcA01
3RUIB 4B95A 3UIOB 3DXCA 3VOQA 2YT0A 3D8FA 3W1SC 4HAWB 2CAYA 3N3KB 1U5GA 2JXXA 3KUCB 2Z0PA 4ZYNA 2C7NB 2ZNVB 2I1JA 4CHKA 1R4MI 4A6HA 2OJRA 4MH0E 4H8SA 2FJ9A 5AZGA 2L0FA 4NSWA 1I42A 3LJUX 1ZM0A 1UNPA 3SHQA 1K5GB 3KH0A 3K9OB 4GN1A 3JSVB 1MPHA 4F7ZA 3UQAA 1X05A 3JSVA 4JQWC 3HM6X 2CHXA 2COCA 1LQBA 4NJ7A 4HB0B 4II3B 4KIKB 2L3ZA 1HB6A 3EC8A 1P3RA 1P5TA 2R0DA 3PHWB 4KIKA 2ZVNA 5AZHA 4EUTA 3NY5A 2GBKA 2IY1B 3UF8A 2FUHB 3ZDMC 4ZRKA 2D9XA 3VXWA 2ZPNA 3EPYA 5AEKB 1V5OA 1E8WA 2L0TA 1W1GA 3ULCA 4E3CA 2YVCA 2EJ8A 4NPNA 3ODXA 3APFA 4IG7B 2MLBA 2FAZA 3V6EB 2DLWA 3OJ3A 1PMSA 2REXA 4K2OA 2G4SA 2IY0B 4W9GA 4ZRIA 2KDFB 2HJ8A 2EMTA 1RJ2A 1PLSA 3EECA 1QZEA 4M0WB 3HQCA 3VUYA 2C7MB 3NHEB 2LWPA 1ZGUB 2LI5A 4W9FA 1XD3B 2LOXA 2O6VB 1RLFA 1NU2A 3R7QA 3ZRFA 5KHQA 2L00B 1WR1A 1YQBA 2O6VA 4MEMA 2JRIB 3FEHA 3WAOA 1WGDA 2XQNM 2GMIC 4KVGB 4AP4C 3PS6A 1E5WA 3H6NA 4IWPA 5DPTA 3RCPA 2DZKA 3ZRCA 2JVCA 2R2OA 2KK8A 3VUXA 3QAQA 1WMHB 2ZVOA 2KX0A 2LVQA 1OY2A 2ZCBA 5DI9B 1I2HA 1WMHA 3DVNU 2DAFA 2P0FA 4PS3A 4JLCA 4EZKA 4IWOA 2Y8FA 1V2YA 1V88A 4TKNA 4MGIE 3A9KA 2DTCA 2O6VD 2RD0A 3DXDA 1TGZB 2P0HA 1YD8U 5DH9B 3PSCA 1PFJA 4GPTB 2KLGA 5IAAC 1PQSA 2D10A 4IC7B 4GU2A 1FGYA 3VDZA 3UQBA 1UBQA 1WR6E 2JWZA 2LD9A 2Z0OA 2MBQA 3CSFA 4OVVA 3U30A 3RULA 4FHJA 4JL9A 2C9WB 4WWPA 3P7ZA 4A3PA 3H7PB 3HK0A 2KMAA 4HAYB 1C3TA 4CYEA 3H7PA 2E2XA 2KJ6A 4GSWA 3CF6E 1WI0A 4RM8A 2COFA 5J18A 4KHOA 2UVMA 4GMXB 1WXMA 3CMMB 3RCZA 1NTVA 1MIZB 4HAZB 3OLMD 1ZC3B 1XCGA 1WJMA 4WJQA 5D3VA 3UIPB 1S3SG 1SE9A 2FDQA 5BO4B 4GZUA 2D11A 2DHJA 2CQUA 1AQCA 3F0WA 2KO3A 2K6QA 3M62B 1YX5B 1WVHA 4MGYE 4C0AA 1Y8RC 3VUWA 2J7QB 5AZFA 2YT1A 2R09A 4EKUA 1ACAA 3VQIA 2AEHA 1WIAA 3ECIA 1TTNA 2MW5A 1XKEA 1ISNA 4EZJA 1V86A 3B08A 4MGKE 5D94A 3TIXA 2XK5B 3MJWA 2RNRB 3QJZA 1YX6B 2BYFA 1GNUA 1H10A 5D27A 2XK5A 1SIFA 4A6FB 4CHJA 2JY6A 3FLVA 3QHTA 5LOPB 2BKRB 1V5MA 4XZ4A 3F5RA 4A6FA 4B6HA 2DA0A 3VTUA 2KCJA 4I6PA 4PYZA 4EMOA 5D6JB 1K5DB 4TQ0A 2KWUB 1WE6A 3U7DA 2GCJA 4KV2A 3WYFB 1WGUA 2QKLA 2ZCCA 1FOEA 2LRUA 1M7RA 2JRHA 3OANA 4BBKA 3HW2B 4HWIB 1QQGA 4NAWB 2M0XA 2K2UA 2LYDA 1WGQA 2N9XA 4AJYB 1IP9A 4FBJB 4NAWA 4M8MA 3V60A 2LGDA 2V1YA 1BTKA 2JP2A 3A98B 2D07B 3M3JA 1ZVRA 5LXHA 3A4SC 2N7DA 1BWNA 3PT2B 1DROA 1JRUA 2CKHB 5E6OA 1FHXA 3ML8A 1WM2A 1WE7A 3APCA 2MSED 2KX3A 1XD4A 3KUZA 3TFMA 2IO1B 2PE9A 4DK5A 4A20A 3IVFA 4HVBA 3ZLZA 1E8XA 4W9CA 2YSZA 1EF5A 1NTIA 5E6PA 2ROVA 1WXSA 3PG7A 1H8CA 3SYXA 2DKQA 1DDMA 4W9IA 1QC6A 3EFUA 3QARA 2NVUI 2UYZB 4IFSA 2G45B 3SD5A 1B55A 2COAA 4NQLB 2K6DB 2K00A 2ROZB 3RZWC 1WJ4A 2VRWB 5J17A 2DX5B 2KC1A 2DYQA 1J0WA 3QWMA 1TJ6A 3ZTDA 2MBEA 1FXTB 1Q1OA 2DX5A 2N7EA 3AJ4A 5EFXA 3VAWA 3DDCB 4ANXA 2IO2B 2A5UA 5DHAB 3ODOA 2AWTA 2MWSB 3IG3A 3WANA 2J59M 5HKHA 3NZUA 2RGFA 2ZEQA 2GBNA 4HB3B 1XQQA 3PRMB 4EZLA 3W1YA 3M1IB 1RRPB 3VIAA 1EF1A 1UBIA 2KTRB 3Q3JA 1WGRA 2DYBA 5J3TA 2PE6B 1V49A 2KTRA 3PTFC 3H9DA 4FJYA 2HD5B 4LJOB 3VTWA 4DBBA 5IJMA 1Z5SB 2AL3A 2WDTB 2IBIB 2FCSA 5J3YA 1CMXB 3QK0A 4HK2A 4ANUA 3A8PA 1WGGA 3ZO5B 4ICUA 4N9F4 2LXCA 5J3QA 2ADZA 4PS8A 2YRYA 1NDDA 2AL6A 1A5RA 5D2MB 4YONA 1WFYA 2Y7BA 2FIDA 2KANA 5JHBA 2K8CA 3V62A 4HAXB 3DBHI 4K1RB 3SUZA 1TQZA 4KZ0A 2KDEB 2M8SA 3PGEA 2RQ1A 2MFQA 3A33B 2CY5A 4WJOA 1X1GA 3ZVVA 1OQNA 5G2NA 1P9DU 4TQ1A 3RT3B 3ZDTA 2MBBB 4MSQB 3ULBA 5C16A 3T06A 1HB8A 1X11A 5L95C 3A4RA 5C5BB 2XBBC 5JHAA 1V5UA 2LGYA 5C5BA 4HAVB 3TMPB 5HE3A 1T0YA 1XT9B 2KDIA 2A4ZA 3ZNID 2Z59B 4HDQA 2NBUA 1GJZA 2LGXA 4Z2MB 3I3TB 4W9HA 1J8CA 3AI5A 1ZSQA 1M7EA 4JGHB 4XWXA 2JT4B 2HRJA 2PZ1A 2LULA 1X1FA 2M38A 1FB8A 4HLEA 3AU4A 1BTNA 2LXAA 5LONB 3V61A 1KJTA 4MDKE 2CRFA 4HPLB 3WAMA 4BFRA 2OQBA 3VVWB 5JP4A 3B1LX 3LDZE 4AUQC 1EO6A 2L05A 3ZIMA 3ZNZB 1D3ZA 3NSUA 5KQ1A 2NR2A 2MA9B 3L16A 2KVRA 3PLUA 3QX1A 2MQJA 3GOEA 2Z0DB 2M4NA 3L13A 4NNJB 2NCNA 1MK7B 1IPGA 2R2QA 5DPWA 3R66C 4K81A 3R3MA 4BVUC 5CLLB 4PNKA 4AJWA 4MY6A 3G9WA 4BKTA 3T8MA 4HCNB 1P3QU 3VH3B 4CHMA 3O96A 2V76A 3L10B 3V5WA 1W1HA 3DBLI 4YL8A 1L2NA 1UELA 1YIWA 2CS4A 1HBKA 3NOBA 4WAAA 4DDID 1OTRB 4BKGA 4BKSA 2MP2B 5JLJB 5FI0A 3ZVRA 5DHFB 3C0RB 4GDKB 2MP2A 1WM3A 3VHTC 1V80A 4GDKA 4M8NA 4F1SA 2COPA 4HATB 5G55A 2L8JA 3H1UA 3GYOA 4Z2NA 5D3WA 2CHZA 1NBFC 2DKPA 1Q0WB 2BWFA 2L1CA 4RMAA 3PREA 3A8QA 3Q3FA 2KN5A 3BINA 3QWZB 4WJPA 1LW3A 3DVGX 2L7RA 2ASQA 2FJLA 2KHWB 4BOZB 3CXBB 2DYMA 3FM8C 3HHMA 2IO3B 2WWZA 2LVPA 1K8RB 4BKSD 5L81A 4RM9A 1WX8A 2N1WA 5LXIB 2FIFA 4TV3A 4DX8A 3PHXB 2RSGA 1U2BA 2HTHB 5FI1A 3KVFB 2HTHA 5C23A 4IWQA 2EMSA 1WGYA 1NI2A 2QKMA 3KW5B 1GG3A 3ONSA 3KRXA 3IHPC 5D3XA 2KFJA 2RVBB 1P6SA 2FCMA 1LXDA 4EEWA 2DFKA 1V89A 2KWCA 3RZFA 4HXDA 2C5LC 2N4FA 4II2B 4CO7A 3UGBB 2V4LA 4HPMB 1UD7A 3QBVB 1AARA 3IBEA 3WAPA 2KJRA 2KJHB 3D32A 3OJ4B 1G6JA 2VKIA 3TW1A 2J0JA 2HE7A 3L0WB 4HJKA 1SHCA 3JVZX 4I6NB 4FHKA 4DDGD 4G3XB 4DHJB 2YF0A 5CX3A 3SU8X 4URKA 1MKEA 2LASA 2NBWB 4TYZA 1WXVA 2VSZA 4FN2A 5JZEB 4BBNF 4HB2B 3QCAA 3A1QB 5IA7A 2V3SA 3PP2A 4LCDE 1KOTA 2NZ8B 2NMBA 1C1YB 3A1QA 2MKRA 1WXAA 3PRZA 1MIXA 4GOCA 3BY4B 3EHVA 3ODWA 3P2BA 2H7EA 3PEGA 3MDBC 2P0DA 1OQYA 3UZTA 3DOWA 1EVHA 2BPSA 5KQ4A 4NQKE 1V5PA 3M95A 2KLCA 4P7IA 1P1AA 2ZPYA 2D9ZA 3VH4B 4DHJD 3D8EA 4KHAA 2FNJB 1U5DA 5CHVC 3VFKA 2KMCA 5E6NA 2RSUA 3KSYA 2W2XC 4GGQA 2RUKB 3ALBA 3NS8A 4GXBA 2WH5A 3TJPA 2N9PC 3NZSA 2DHZA 3D8DA 1N3HA 2DAJA 2NS5A 2KXJA 2KGXB 3VTVA 2KNBA 1W1DA 5CHWA 1E7VA 1YJ1A 3WIMA 1WH3A 2KDBA 1U4AA 5FR6A 2WX0A 1V6EA 1NTYA 2EC1A 5D3YA 1TZ1A 3RYTA 3AULA 3ZKJC 2DHKA 2LKOA 4HB4B 3LJ3A 2MX2A 3MTNB 3KYDD 1WJ1A 1R4NI 4MJSB 3X23A 5JH5C 3TBLD 1I7AA 1IYFA 5KCVA 4MJSA 3SV1A 4EJNA 4B9KA 2IFSA 1KZ7A 2DN6A 2DYOA 2CODA 4FA6A 4F7UP 2QHOA 4WWOA 1XODA 2DHIA 4AWJA 1TBEA 2M1MA 3N30A 4MM3A 4ANWA 1EGXA 4MGZE 2FCNA 1WGHA 1E8YA 1XX0A 1ZW7A 5DIFB 2GBJA 4FADA 4MT7A 4E71A 3S2AA 4GIVA 1KZGA 2K8HA 2FCQA 4EFOA 1E7UA 5EDSA 1UZXB 5GOWB 3FP5A 5C1ZA 3QQ8B 2P8VA 4DWFA 2GJYA 3GYPA 1V5TA 3PPAA 3ML9A 1J19A 5LLIA 1AWEA 4DBGA 1NVLA 4K7WA 2K1FA 3ZNHB 1ZC4B 4WSFA 1MAIA 2RLOA 2KD0A 1WF9A 3N7CA 2Y5BB 1WX9A 1P0RA 3SDLC 2DENB 2MRPA 2YLMA 3JW0X 4LJPB 1UEFA 4PYUA 2BCJA 3L08A 1OEYJ 4W9DA 2BYEA 4WVFB 4KDIC 4L6EA 4B6WA 3H7SA 2GOWA 3PSEB 1WJUA 3ZUNA 1OGWA 5JHGA 2W2WA 2JZZA 3TVVA 2G4DB 3PZDA 3CSTA 1S1QB 2Q13A 1DDVA 1FGZA 1F9JA 5DPSA 2DZIA 4IM0A 3ML4A 1MK9B 2D9WA 4BOSC 4K7UA 1FHWA 2PJHA 3DVGY 3KYCD 4EOYA 2IYBA 4W9JA 5HE2A 1RRBA 2Z0EB 1ZKHA 1LFDA 3CIKA 2WYQA 1Z2MA 2DYNA 4K2PA 3PVLA 4Y94A 1WZ3A 5GMVA 4DX90 4WJNA 4E74A 3X0WA 2YS1A 1U5FA 2DZJA 2GS0A 4IAPA 2L76A 4DHZE 1X1MA 2LZ6A 4WWNA 3TCAA 4GDLB 4IOYX 2JPHA 1UNRA 1WY8A 1WJNA 3T9LA 4NY0A 4GDLA 2Z0QA 2K8BA 2RGNB 4PS7A 1WRDB 2D9YA 2O2VB 5J2RA 2O2VA 2LUEA 2J0MA 4ASWC 3U8ZA 2IYDB 1BAKA 3ENEA 4K7SA 3HIZA 4MSMB 4IM2A 4MELA 5KHOA 2J0KA 1VD2A 2LVOA 4G50A 1LB1A 4WQOB 3TO1A 2I5CA 2B3AA 3QIJA 4KHBB 1J0GA 2IO0B 2UZSA 1Q67A 3A9KB 2H7DA 3GZNI 3ZNGC 1P98A 3FSSA 3AU5A 3O65B 4G0NB 3B0AA 1XR0B 2MDXA 1GC6A 3N32A 2C7HA 2KOXA 2BF8B 4A3OA 2GCLA 2MCNB 4J6IA 1V61A 2ZNVC 2MBOA 2M14A 1IRSA 4BBNC 5DCNA 2D4QA 4FULA 1Y19B 5L83A 2CR5A 4XC2A 3HM3A 4OVUA 2ELBA 2ABDA 3IFWB 4W9LA 4ANVA 4AOFA 4PQ0A 3AXCA 2X18A 3DCGA 1GC7A 1U5EA 2C60A 4ZRJA 5CTRC 2BWES 2ZJDA 3A9JB 3UINB 4KDLB 4FLHA 2GBRA 1KM7A 5HE0A 2CY4A 4XX5A 4WJ7A 2KZRA 3A9JA 3L54A 2W2XD 1ST7A 2KC2A 3K9PB 1TXDA 1UPQA 1L7YA 2KKCA 4W9KA 3ZTCA 2PPHA 2BGFA 2VRRB 2N23A 3PV1A 1KI1B 1Z87A 2EKEC 3WALA 5JHHA 1DBHA 3PRPB 2Y8GA 3V6CB 4JIOU 1GUAB 1I35A 4G11A 2MBHA 3APDA 2RR9A 5HE1A 3KZ1A 1BT0A 1LM8B 2G3QB 4ICVA 1OEYA 5DPRA 1FHOA 4IM3A 2NBVB 3P6AA 1M94A 4GMVA 1SGHA 2DZMA 1WJ6A 3DQVA 3W1SA 3OAWA 3KY9A 2W9NA 4TUUA 1DDWA 3M63B 1VCBA 4LDTB 5C6RA 3ZW3A 3RD2A 3SO6A 2NPTB 1Q5WB 1U29A 2IZVB 1H4RA 2UZRA 4HCPB 2KWVB 2NPTA 2BKFA 1V9JA 2D2QA 1UNQA 2N0YA 4D0NB 4A5KA 2OTXA 1EAZA 4HAUB 1WYWB 5CLQB 2RPQA 2LG1A 1MG8A 2AYOB 4NJ6A 2KTFA 2ZZPB 4KSLC 1WI1A 4A6KA 3SNHA 3R7RA 2D9VA 3PLVA 3PVUA 4LDTD 4ZDVA 4KSKC 1WX7A 4I6LB 4F8CB 2CU1A 3BJIA 2LBBA 2DX1A 2BYVE 1Y5OA 2D3GA 3DVNV 2K2JA 3DPDA 2KQ7A 2N9EB 3MHSD 5C79A 4IUMB 3QC8B 2K39A 2LRWA 4F7GA 2KFKB 3KUDB 2YS5A 2KUPA 3TL5A 4FJZA 2CHWA 2KFKA 4W9EA 2ELAA 4HDOA 1E90A 1X86A 4X57B 2OOBB 5CHFA 1UGMA 2N1VA 5TR5A 3KRWA 3DXEA 4KAXB 1E8ZA 3L17A 4K17A 2PEAA 3QA8A 1HE8A 1UH6A 1U27A 2GBMA 2XEWA 2YS3A 2JZ3B 2CB8A 2K25A 3JYUA 2I1KA 2I5FA 2WX1A 1WG7A 2LOZA 1WZ0A 2MWNB 2JF5A 3DBSA 3PVWA 4MK0A 1RAXA 4IW0A 1V81A 2L2IA 4KZCA 1EUVB 1RFAA 4DHZB 2UWQA 1KLVA 4GB9A 4F7HA 3DBRI 4FJVB 3WA0A 2JUOA 1UPRA 4DXAB 2M17A 3MPXA 2KQSA 5D7GA 1OMWA 1DYNA 4HHVA 1FAOA 2LJ5A 2G35A
chains in the Genus database with same CATH superfamily
3RUIB 4B95A 3UIOB 3DXCA 3BZDB 3VOQA 2YT0A 3MC0B 2M19A 3D8FA 3W1SC 4HAWB 2CAYA 3N3KB 1U5GA 2JXXA 2ON8A 3KUCB 2Z0PA 4ZYNA 1XLOA 2C7NB 2ZNVB 2I1JA 3Q14C 4CHKA 3T3NA 4A8XC 1R4MI 4A6HA 4IDIA 2OJRA 3R2IA 4OZCA 4MH0E 1KLGD 1JALA 4H8SA 2FJ9A 3U2SC 5AZGA 2L0FA 4NSWA 1VZ8A 1I42A 2B76B 3LJUX 1ZM0A 1UNPA 3SHQA 3BYTB 1K5GB 2JX5A 3KH0A 2KR0A 3K9OB 3MC8A 4GN1A 3JSVB 1MPHA 4F7ZA 3UQAA 4ITKA 4HSIA 5I4DA 2XN9C 1X05A 3JSVA 4JQWC 3HM6X 3W2DA 2CHXA 2COCA 1B1ZA 2WXHA 1LQBA 2WXQA 3KWLA 1N61A 4NJ7A 4HB0B 4II3B 4KIKB 1QOGA 2L3ZA 4JPSA 1HB6A 2N7JA 3EC8A 1KC7A 1P3RA 1P5TA 2R0DA 3PHWB 2Y5CA 4KIKA 2ZVNA 5AZHA 4EUTA 3NY5A 1V1OA 2GBKA 3SFEB 4YWGG 2IY1B 3UF8A 2FUHB 3U12A 3DBLB 3ZDMC 1WWTA 4ZRKA 2WXOA 2D9XA 3VXWA 2ZPNA 3EPYA 5AEKB 1V5OA 1E8WA 1V1PB 2L0TA 3HVDA 1W1GA 3ULCA 4E3CA 2YVCA 4TSSA 3KQ4A 4NZLB 3DHHC 3AEAB 2EJ8A 4FXCA 4NPNA 3ODXA 3APFA 4IG7B 1C77A 2MLBA 2FAZA 4HRSA 3V6EB 2DLWA 3RNAC 3E9SA 4B0EA 3OJ3A 1STEA 1PMSA 1XEEA 2REXA 1DOXA 4K2OA 1L0YB 2G4SA 4L2YA 2LHEA 2IDYA 2IY0B 4W9GA 4ZRIA 3HSAA 2KDFB 2HJ8A 3IXSA 3DHIC 5EE0A 2EMTA 3FC4A 4JK9A 1RJ2A 3GP7A 1PLSA 3EECA 3NG0A 1QZEA 3AEFB 4M0WB 4O1NA 3HQCA 3BYYB 3VUYA 2C7MB 3NHEB 2LWPA 1ZGUB 2LI5A 4M0WA 3HVZA 4W9FA 1ZXHA 1QF6A 1XD3B 2LOXA 2O6VB 1RLFA 1NU2A 3R7QA 1L5PA 3BVZA 4DIXA 1QOBA 3ZRFA 5KHQA 2L00B 3AE8B 1WR1A 1VRAB 1YQBA 2L1AA 2O6VA 4MEMA 2JRIB 3FEHA 3WAOA 1WGDA 2XQNM 1JRPA 2IGDA 2WQYB 2GMIC 4KVGB 4AP4C 2QSDA 2X0SA 3PS6A 1E5WA 3H6NA 4IWPA 1TT5B 5DPTA 3RCPA 2DZKA 3ZRCA 2JVCA 2R2OA 2KK8A 4OZBA 5I2MA 1RM6C 3VUXA 3QAQA 1WMHB 2ZVOA 4ZHPA 5JXVA 2KX0A 2LVQA 1OY2A 2ZCBA 5DI9B 3Q8CA 1I2HA 1WMHA 3RNBC 3DVNU 2KIGA 2DAFA 2P0FA 3KLSX 4PS3A 4JLCA 1F2RC 4EZKA 4JKDA 4IWOA 3TSSA 2Y8FA 1N60A 1V2YA 4TKNA 1V88A 2I2YA 3ENBA 3SFDB 1GB4A 4MGIE 3A9KA 2DTCA 2O6VD 2RD0A 3AE7B 3DXDA 3E66A 1QOAA 1TGZB 4JE3B 1TKYA 3A58A 2P0HA 1YD8U 2DIKA 5DH9B 3PSCA 1PFJA 4GPTB 3ABVB 2KLGA 3P4SB 5IAAC 1PQSA 2D10A 4M01A 1PYWD 4IC7B 4GU2A 1FGYA 3VDZA 3UQBA 2BB6A 1UBQA 1XLNA 2D3AA 2WDVB 3MC9A 1WR6E 1UWMA 3RPFC 2BW2A 1TZOA 2JWZA 2LD9A 2ZW1A 3IAS1 2Z0OA 2BVCA 2MBQA 3CSFA 4OVVA 3U30A 4XGAB 3RULA 5EE9A 4FHJA 4JL9A 4K3CA 3E9LA 2C9WB 4WWPA 3ZJUA 3P7ZA 2MEKA 4A3PA 3H7PB 3HK0A 2KMAA 1ZP0B 4HAYB 1C3TA 1SE4A 2IGGA 4CYEA 3H7PA 2E2XA 2KJ6A 4JKAA 4GSWA 3CF6E 2JU6X 1WI0A 3GE8C 1D5ZC 3AEGB 1NVID 1T0SC 1HTQA 4RM8A 1J7AA 1T0RC 1SEBD 1VBGA 2COFA 4J3OD 5J18A 2QCZA 4KHOA 2UVMA 2OEDA 4GMXB 1WXMA 1EWYC 3CMMB 1VR9A 3RCZA 1NTVA 1MIZB 4HAZB 3OLMD 2NTTA 1ZC3B 4HPPA 5AUIA 1XCGA 1WJMA 2FBWB 4WJQA 1M4VA 1RYJA 5D3VA 4LNFA 3UIPB 1S3SG 1SE9A 4D6WA 3VR8B 2L32A 2FDQA 5BO4B 4GZUA 1Y56A 2D11A 2DHJA 2CQUA 2N0SB 3I63C 1AQCA 3F0WA 2KO3A 2K6QA 4LNOA 5BMIA 3M62B 1YX5B 1WVHA 2WXKA 1K53A 3U52E 1SXTA 4LNKA 4MGYE 3Q3OC 4C0AA 1Y8RC 1T77A 3VUWA 1WGKA 4JKEA 3HRDD 4RGNA 1SE2A 2J7QB 3O13A 5AZFA 2JZPA 3W9CB 2YT1A 2R09A 4EKUA 1ACAA 3VQIA 2AEHA 5IRSA 1WIAA 3ECIA 4WIPA 5D3DA 1TTNA 2MW5A 1XKEA 1ISNA 4EZJA 1V86A 3B08A 4MGKE 1NI3A 5D94A 3TIXA 4S0RA 2W82A 4XYCA 2XK5B 3MJWA 2RNRB 4ACFA 3QJZA 1YX6B 4A90A 5LG4B 2BYFA 1GNUA 3FILB 1H10A 5BYQA 1EU3A 2ICIA 4B0MA 5D27A 2XK5A 1SIFA 4A6FB 4CHJA 3FILA 2JY6A 3FLVA 1KRHA 3QHTA 4A6QA 5LOPB 1SBBB 2BKRB 4A9AA 3LB8C 1V5MA 4XZ4A 3F5RA 4A6FA 1TKEA 2KWDA 4B6HA 3Q2AC 2DA0A 2KCJA 3VTUA 4I6PA 1HTOA 2PW9A 4PYZA 4EMOA 3MFGA 5D6JB 2UU7A 1K5DB 2OJWA 4TQ0A 2KWUB 1WE6A 3U7DA 2V9HA 2J53A 2GCJA 4HKZE 2WU5B 4KV2A 3WYFB 3Q8EA 1WGUA 3P4QB 1YQ3B 2QKLA 2ZCCA 1FOEA 2LRUA 1ZOYB 1YOVB 1M7RA 1JWAD 2JRHA 2WXMA 2AQ3B 3EUB2 3OANA 3LYYA 4BBKA 3HW2B 4HWIB 1QQGA 4NAWB 5E6JA 3NWFA 2M0XA 2K2UA 2LYDA 1WGQA 2N9XA 2HDEA 4AJYB 1IP9A 4FBJB 3AN1A 4NAWA 4M8MA 3V60A 2LGDA 2V1YA 4KKIA 4N58A 1BTKA 1HXYD 2JP2A 3A98B 1YQ4B 2D07B 1NEKB 2KAJA 1JQ4A 3M3JA 1ZVRA 4L1BA 5LXHA 3A4SC 1MHHE 2N7DA 3FAHA 1BWNA 2NMQA 1FD6A 1N63A 3PT2B 1DYQA 4R3DA 1DROA 1JRUA 4P6VF 2CKHB 2LFIA 5E6OA 1FHXA 1FNWA 2CJNA 3ML8A 2AX5A 1WM2A 1WE7A 1HA5A 1N5XA 3APCA 3IAM1 2MSED 2KX3A 1XD4A 4GNKB 3KUZA 3TFMA 2K5PA 2IO1B 3P1MA 3KWVA 2PE9A 4DK5A 4A20A 3IVFA 4HVBA 1BUIC 3ZLZA 2IPKD 1E8XA 4W9CA 4HEA1 2YSZA 1EF5A 1NTIA 3AM9A 5E6PA 2INCC 2K0PA 2ROVA 1WXSA 3PG7A 5HI1A 1H8CA 1XCTL 3SYXA 2DKQA 1DDMA 2QJLA 4D2KA 4W9IA 4ZRQA 4OSNA 1QC6A 3EFUA 3QARA 2NVUI 1OQRA 2UYZB 2L52A 4IFSA 2G45B 3SD5A 3FKYA 1TY2A 1SB3C 2Q5WD 1B55A 2COAA 4NQLB 2K6DB 4N59A 2K00A 2ROZB 3RZWC 4REZA 1WJ4A 2VRWB 5J17A 2DX5B 2KC1A 2DYQA 2EELA 1J0WA 3QWMA 1TJ6A 3ZTDA 3AB5A 2MBEA 1FXTB 1Q1OA 1ZDXA 2DX5A 2N7EA 3E56A 3AJ4A 5EFXA 3VAWA 3DDCB 4ANXA 2IO2B 2A5UA 3AE4B 5BYSA 5DHAB 3ODOA 2AWTA 2MWSB 3IG3A 3WANA 2J59M 5HKHA 3NZUA 2RGFA 2ZEQA 2GBNA 4HB3B 2HJ1A 1XQQA 1B9RA 1DIKA 3ZYYX 3PRMB 2W54A 2VH1A 1N5WA 1FXIA 1KLUD 4EZLA 4YTMB 5BMGA 1TKGA 3M1IB 3W1YA 1RRPB 3VIAA 1EF1A 2YT2A 4KKJA 1UBIA 4JKHA 1AW7A 2KTRB 3Q3JA 2RRFA 1WGRA 2DYBA 5J3TA 2PE6B 1I4GA 1V49A 2KVZA 3P42A 2KTRA 3PTFC 3BWUD 3H9DA 4FJYA 2HD5B 4LJOB 4YSXB 1FCLA 4JKGB 2W3RA 3VTWA 4DBBA 5IJMA 3GB1A 1Z5SB 2AL3A 2WDTB 4LK0M 2IBIB 2FCSA 5J3YA 1CMXB 3QK0A 4JKGA 3MHZA 4HK2A 4ANUA 3A8PA 1WGGA 3ZO5B 1IBXB 4ICUA 4N9F4 2LXCA 4N6EB 4YT0B 5J3QA 1F1HA 2IJ0A 2ADZA 1JROA 4PS8A 1GOZA 1IBXA 2D3CA 2YRYA 1I4RA 1NDDA 1E9MA 5HG2A 3U7ZA 4C00A 2AL6A 1A5RA 5D2MB 4YONA 3ZGZA 1WFYA 2Y7BA 2FIDA 5IKCM 2KANA 4S17A 3P4RB 5JHBA 2K8CA 3AE3B 2JQRB 3V62A 4HAXB 5EE3A 4XWTA 3DBHI 4JK7A 4K1RB 3W5VB 3SUZA 1YMHE 1TQZA 4KZ0A 2INNE 2KDEB 2M8SA 1SJHD 3PGEA 2RQ1A 3Q8BA 2MFQA 3A33B 1JW9D 2CY5A 4WJOA 1X1GA 3ZVVA 1OQNA 5G2NA 1P9DU 4TQ1A 3RT3B 3ZDTA 2MBBB 2GLSA 3Q8FA 4MSQB 1BMLC 3ULBA 2PVOD 5C16A 3T06A 1HB8A 1X11A 3HIEA 5L95C 3A4RA 5C5BB 1V1PA 2QEJC 2XBBC 5JHAA 2D5GA 1V5UA 2LGYA 5C5BA 4HAVB 3TMPB 3EA6A 4RFBA 5HE3A 4YTNB 1T0YA 1XT9B 2J42A 2KDIA 2A4ZA 3ZNID 2Z59B 4HDQA 2NBUA 1GJZA 2LGXA 1SJED 4Z2MB 3I3TB 1HQRD 4W9HA 1J8CA 1UGJA 3AI5A 1ZSQA 1M7EA 2Z59A 4JGHB 4US9A 4JWSC 4XWXA 2JT4B 2YEPF 3BK2A 3N9YC 2HRJA 2PZ1A 4XDDA 1Q10A 2LULA 1X1FA 2M38A 2LGIA 1FB8A 1PGBA 1F2RI 2FUG1 4HLEA 3AU4A 1BTNA 1TS2A 5LONB 1IGDA 2LXAA 3V61A 1KJTA 4MDKE 1J7BA 2CRFA 4KGSA 2K3UA 2BS2B 4KGRA 4HPLB 3IT6B 3DCXA 4QXAB 3WAMA 4YSYB 2JWUA 4BFRA 2OQBA 5JP4A 4NAMA 3VVWB 4HKQA 2MJDA 3B1LX 3LDZE 4AUQC 4XWWA 1QKZA 2LJIA 2INPE 1EO6A 4XDCA 1FIQA 4OW0A 2L05A 2Y3AA 3ZIMA 1UWXA 3ZNZB 2R61A 1L4ZB 1XLPA 1D3ZA 3NSUA 5KQ1A 1FO4A 2NR2A 3EGRA 2MA9B 3L16A 1AN8A 2KVRA 2RDBC 1NYQA 1T5XD 1IUEA 3PLUA 1MVKA 2MQJA 3QX1A 3GOEA 2PKOA 1JWUD 2Z0DB 1L0XB 2M4NA 3L13A 5AUKA 3NW8A 4NNJB 3E9OA 2NCNA 1MK7B 1IPGA 2R2QA 5DPWA 1FRRA 3R66C 4DQOC 5HHDG 2GUMA 5G5HA 4K81A 2R2YA 1WRIA 3PZ8A 3R3MA 4BVUC 5CLLB 4PNKA 4AJWA 1YNTE 3AH7A 4MY6A 2OHFA 2GI9A 3G9WA 4QJ5B 4BKTA 3T8MA 4HCNB 1P3QU 3VH3B 1CJEA 2BQQA 1E6EB 4CHMA 4QJ3B 3O96A 2V76A 3L10B 2Z8LA 1I4HA 1A70A 2R82A 3V5WA 2I38A 4HJGE 2LGSA 3OG5A 1W1HA 3DBLI 4YL8A 1L2NA 1UELA 4H2AA 1YIWA 3RFZB 4P16A 2CS4A 1HBKA 3NOBA 1MI0A 4WAAA 4DDID 1OTRB 3DHGC 4BKGA 4BKSA 2MP2B 5JLJB 5FI0A 3ZVRA 5DHFB 1FRDA 3C0RB 4GDKB 2WLBA 2MP2A 1WM3A 3WCQA 3VHTC 3TEYA 1V80A 1K50A 4GDKA 4M8NA 4JKBA 4F1SA 2COPA 4HATB 5G55A 2L8JA 1MFWA 3H1UA 4RCOA 2N9KA 3GYOA 4Z2NA 5D3WA 2CHZA 1NBFC 2DKPA 1Q0WB 2BWFA 1VBHA 2L1CA 4RMAA 3PREA 3A8QA 3Q3FA 2KN5A 2KACA 3BINA 5IN7A 4ARCA 3ZXVA 3QWZB 4WJPA 1LW3A 3DVGX 2L7RA 2ASQA 3MJ5A 2FJLA 2KHWB 3URYA 1ZDVA 4BOZB 1QT9A 3CXBB 2DYMA 4GOUA 3FM8C 3HHMA 2IO3B 2WWZA 2K49A 2LVPA 1K8RB 4BKSD 1DOYA 5IP4D 4M02A 5L81A 4RM9A 1WX8A 2N1WA 3AV8A 4TMAB 5LXIB 1JWSD 4YXDB 2FIFA 4TV3A 4DX8A 3PHXB 1TS3A 2RSGA 1U2BA 2HTHB 1JWMD 1I4XA 5JVLA 5FI1A 3KVFB 4JK8A 5HFYA 2WXNA 2HTHA 5C23A 2PLPA 2PVGC 1TS4A 4IWQA 2EMSA 1WGYA 1NI2A 2QKMA 1YN5A 5GXGB 3KW5B 1GG3A 3ONSA 4MACA 3KRXA 4AQ7A 3IHPC 5D3XA 2DNFA 2KFJA 2V3NA 2RVBB 3IT4B 4ILGB 1P6SA 3TEXA 1YJIA 2FCMA 1LXDA 3Q6BA 2DFKA 4P1BC 4EEWA 3RI7C 1V89A 2KWCA 4BAXA 3RZFA 4HXDA 3H8HA 2C5LC 2N4FA 4II2B 4CO7A 4ILJA 3UGBB 1R4NB 2V4LA 2BBCA 4HPMB 1I7HA 1UD7A 2PTLA 2JYTA 3QBVB 4QAYA 1AARA 2MJEA 3UI3A 3IBEA 3WAPA 4RNAA 2KJRA 4OT1A 2PIAA 2KJHB 3D32A 3OJ4B 1G6JA 2VKIA 3TW1A 2J0JA 2HE7A 3L0WB 3MP9A 4HJKA 1SHCA 2M0AA 3JVZX 4I6NB 4FHKA 4DDGD 2RMMA 2WDRB 4G3XB 4DHJB 2YF0A 2RDHA 5CX3A 3SU8X 4ARIA 5C3JB 2JXTA 4URKA 4HROA 1MKEA 4PT5A 2LASA 3VRAB 1PDXA 1T6BX 2NBWB 2FJUB 4TYZA 1WXVA 2VSZA 2H88B 4FN2A 5JZEB 4BBNF 3B77A 4HB2B 3QCAA 3A1QB 5IA7A 2V3SA 3AE9B 3PP2A 2DBYA 4LCDE 3NZ3A 1C76A 1KOTA 2NZ8B 2NMBA 3BIID 1C1YB 3A1QA 2MKRA 1IGCA 2QDFA 1WXAA 3PRZA 1MIXA 4GOCA 3W5UB 2DLBA 2CJOA 1MHXA 3BY4B 3ODWA 3EHVA 1XF5L 3P2BA 2H7EA 3VRBB 3PEGA 3MDBC 4RGMA 2P0DA 1OQYA 3UZTA 1ET6A 2QC8A 3ZXRA 3DOWA 1EVHA 2NTSA 1V8CA 2BPSA 2WXGA 5KQ4A 2QIEB 4NQKE 3U4EG 1V5PA 3M95A 2KLCA 2KT7A 4P7IA 1I4QA 1P1AA 2ZPYA 2D9ZA 3VH4B 4DHJD 3D8EA 4KHAA 2FNJB 1U5DA 3OHMB 5CHVC 3VFKA 3SEBA 1L4DB 2AQ1B 1F52A 2KMCA 3P4PB 2RSUA 5E6NA 3SBGA 3KSYA 2W2XC 4GGQA 2RUKB 3ALBA 3NS8A 4GXBA 2WH5A 3R2TA 1PGXA 1P7EA 3TJPA 2N9PC 3NZSA 2DHZA 3AEDB 3D8DA 1AWDA 1HEZE 1N3HA 2DAJA 1E10A 2NS5A 4JKCA 1J7CA 2CU3A 4C4VB 2KXJA 2KGXB 1VJKA 1CK1A 3VTVA 1MJDA 2KNBA 1W1DA 5CHWA 2WU2B 4NJCA 1E7VA 1CZPA 1YJ1A 4C4VA 1ZE3D 3WIMA 1L0VB 3N1ZC 1WH3A 2KDBA 1BXTA 3Q8AA 1U4AA 3NVWA 5FR6A 2WX0A 1V6EA 1NTYA 2EC1A 5D3YA 1TZ1A 3RYTA 3AULA 3ZKJC 2XNAC 2DHKA 2LKOA 2QMTA 4HB4B 1UF0A 3LJ3A 2MX2A 3MTNB 3KYDD 4OZAA 1WJ1A 1R4NI 5FR3A 4MJSB 3X23A 5JH5C 3TBLD 4KX6B 1I7AA 1IYFA 5M4YB 5KCVA 4MJSA 3SV1A 3Q3MC 4EJNA 1UNSA 4B9KA 2IFSA 4MH8A 5H8YE 1KZ7A 2DN6A 2DYOA 2CODA 2LUMA 4FA6A 4F7UP 2QHOA 3Q69A 4WWOA 3CIRB 1XODA 2DHIA 1FCCC 4MM3B 2BT6A 1TBEA 4AWJA 2M1MA 3N30A 4RH6A 2ONQA 1E7PB 4MM3A 4ANWA 1MPEA 1E0ZA 1EGXA 4MGZE 2FCNA 1WGHA 1E8YA 1XX0A 1ZW7A 5DIFB 2GBJA 3V3XA 4FADA 4MT7A 4JWUC 4LNIA 4E71A 3S2AA 4GIVA 3ZJTA 1KZGA 2K8HA 2FCQA 4C7YA 2W55A 1I4PA 4EFOA 1E7UA 5EDSA 2WXPA 1UZXB 5GOWB 2WXIA 3NS1A 3FP5A 5C1ZA 2J52A 1EWCA 4L1RA 1GAQB 3QQ8B 2P8VA 2JYEA 4ZRPA 2GJYA 4DWFA 1RFKA 2Z14A 1D4BA 3AE1B 2EKIA 2V0GA 3GYPA 1V5TA 3PPAA 3ML9A 3I9V1 4YSZB 1NYRA 1J19A 1XLQA 5LLIA 1AWEA 4DBGA 1XXGA 3LXFA 4L23A 1NVLA 4K7WA 2BB5A 2K1FA 3ZNHB 1ZC4B 4WSFA 2WDQB 1MAIA 2RLOA 4K3BA 1C4CA 2KD0A 4UDUC 1WF9A 4M00A 4OHJA 3N7CA 2Y5BB 2M56B 1WX9A 1ESFA 1P0RA 3SDLC 2DENB 3TEWA 2MRPA 2YLMA 3JW0X 4LJPB 1UEFA 2J4XA 2K9XA 4PYUA 3TUOA 2BCJA 1T0QC 3GZNB 3L08A 4WWMA 1OEYJ 1LGRA 1AYFA 4RGTA 4W9DA 2BYEA 4WVFB 1JCKB 3C8YA 4L6EA 4KDIC 4DXFA 1LO5D 1VZ6A 1TIFA 3Q3NC 4B6WA 3I5JC 3H7SA 2GOWA 3C19A 3RNFC 4Q2JA 3PSEB 1WJUA 3ZUNA 1OGWA 5JHGA 2W2WA 2JZZA 3TVVA 1R7SA 4YTPB 2RPVA 1T3QA 2G4DB 3J9CA 3PZDA 3AE6B 3CSTA 1F0ZA 1S1QB 4KGTA 1PFDA 2Q13A 1DDVA 1FGZA 1F9JA 2E6XA 5FK9C 5DPSA 4RF1A 2DZIA 4IM0A 1TYGB 3ML4A 3RMKC 1KH0A 1MK9B 2D9WA 4BOSC 2WHIA 4K7UA 1FHWA 1C4AA 2PJHA 3DVGY 3KYCD 1FFUA 2IYBA 1WXQA 4EOYA 2KYWA 4W9JA 5HE2A 2KN4A 4C80A 1RRBA 2Z0EB 1ET9A 1ZKHA 1GGOA 1LFDA 3PO0A 3CIKA 2Y5PA 2WYQA 1JWBD 1HZ6A 1Z2MA 2DYNA 4K2PA 3PVLA 4Y94A 1WZ3A 5GMVA 2X8XX 3ETRA 4DX90 4WJNA 4E74A 2D3BA 3X0WA 1VDVA 2YS1A 1U5FA 2DZJA 2GS0A 2INDC 2Z13A 4IAPA 3AMZA 1C9FA 2L76A 4DHZE 1X1MA 2LZ6A 3AE5B 4WWNA 3TCAA 4GDLB 2TSSA 1FFVA 1OFFA 4IOYX 2JPHA 1UNRA 1WY8A 1WJNA 2KMMA 3T9LA 4NY0A 2H89B 2Z0QA 4GDLA 5IO9A 3TEZA 2K8BA 3RNGC 2BYTA 2RGNB 4PS7A 4A55A 1WRDB 2ZW0A 1JDEA 2D9YA 3L4PA 3NVZA 2O2VB 5J2RA 1DOIA 1QILA 2O2VA 2LUEA 3GE3C 2KQ4X 3DWMA 4MT5A 2J0MA 4ASWC 2GRIA 3U8ZA 2IYDB 1BAKA 3ENEA 4K7SA 3HIZA 4MSMB 4WQMA 4IM2A 2Z4DA 3SBTA 4MELA 2WXRA 5KHOA 2J0KA 1VD2A 1PGAA 1ROEA 2W3SA 2LVOA 4G50A 1LB1A 4WQOB 3TO1A 2I5CA 2B3AA 3QIJA 1K52A 1ZXIA 4ZYSA 4KHBB 5BYRA 1J0GA 1C78A 2UZSA 2IO0B 3B2GA 1Q67A 3A9KB 2H7DA 3GZNI 4KHBA 3ZNGC 1P98A 2WS3B 1V97A 3FSSA 3AU5A 3NUHB 4C7ZA 3O65B 3HUIA 4G0NB 3B0AA 1XR0B 2MDXA 1KBLA 1GC6A 4JX1C 3N32A 2C7HA 1KFYB 3NWDA 2KOXA 5C2TB 3R8BA 2BF8B 4A3OA 2GCLA 2MCNB 4J6IA 1V61A 2ZNVC 2MBOA 2M14A 1ENFA 3N20C 1IRSA 4BBNC 5DCNA 1OQQA 2D4QA 2WXJA 1Y19B 4FULA 4GLSC 3B9JA 5L83A 4CSQA 3SR6A 2CR5A 1QQRA 4XC2A 3HM3A 4OVUA 2ELBA 2ABDA 3IFWB 3AEBB 1RWSA 1P7FA 4W9LA 4XE0A 2LHDA 4USAA 4ANVA 1DGJA 3N1XC 4PQ0A 3AXCA 4AOFA 2X18A 3DCGA 1GC7A 3RN9C 1U5EA 2C60A 4ZRJA 5CTRC 2BWES 4EE2A 2QILA 2ZJDA 4LLGM 3P63A 3A9JB 3UINB 4KDLB 3E9PA 2GBRA 4FLHA 1ZUD2 1KM7A 5HE0A 1D5MC 2CY4A 4XX5A 4WJ7A 2KZRA 3A9JA 2HTME 1ZPSA 3L54A 1D5XC 3NWAA 2W2XD 3AE2B 2FE8A 2V3PA 1ST7A 5D3IB 2IGHA 2KC2A 5TSSA 3K9PB 1TXDA 1UPQA 1L7YA 3NVYA 3GS2A 3ZJVA 2KKCA 2E3TA 4W9KA 4BZAA 1C79A 3ZTCA 2PPHA 2YEPB 1GPXA 2BGFA 1PUTA 2VRRB 2WXFA 2N23A 1SF0A 1L6UA 3PV1A 1KI1B 1Z87A 2EKEC 5FKAC 1FNVA 5JHHA 1DBHA 3WALA 3PRPB 1K51A 2Y8GA 2SAKA 3V6CB 4JIOU 1GUAB 1I35A 2K22A 1GB1A 1EM7A 4G11A 2MBHA 3APDA 1VZ7A 2RR9A 5HE1A 3EFCA 3KZ1A 1BT0A 1LM8B 2G3QB 3AEEB 1OEYA 4ICVA 5DPRA 3NJTA 1FHOA 2AQ2B 3I57A 1FPYA 3NVVA 3B2FA 4IM3A 2NBVB 3PZ7A 3P6AA 3N1YC 5MPOA 1TY0A 5EE1A 1M94A 4GMVA 1SGHA 2DZMA 1WJ6A 3DQVA 2NBVA 3W1SA 3OAWA 2KUQA 4RGOS 2DWQA 2JSVX 3KY9A 2PMVA 2W9NA 2X38A 2BS4B 1YJJA 4TUUA 1DDWA 2BS3B 4IOIE 3M63B 1WYGA 3RNEC 1VCBA 4LDTB 4AS1A 5C6RA 2WXLA 1JMLA 1HZ5A 3DBRB 1F77A 3ZW3A 3RD2A 3SO6A 1FEHA 2NPTB 1SE3A 1Q5WB 1U29A 2IZVB 1H4RA 2UZRA 4HCPB 2MHJA 2KWVB 2NPTA 2BTEA 2BKFA 5LNK1 1V9JA 2D2QA 1UNQA 2WNMA 1SSNA 4ILHA 2N0YA 2G1EA 5IOIA 4D0NB 1FXAA 3ZQ4A 4A5KA 3AECB 2OTXA 1YN4A 4DXGA 4US8A 1EAZA 3T3OA 4HAUB 4P1CC 1WYWB 2KDMA 5CLQB 2RPQA 4PK1A 2RDGA 2LG1A 1ZYIA 1MG8A 2AYOB 1R4MB 4NJ6A 2ZKMX 2VH2A 2KTFA 2ZZPB 4KSLC 1WI1A 4A6KA 3SNHA 1NENB 3R7RA 1EU4A 2V4IB 4RF0A 4ZOHC 2D9VA 1FNUA 3PLVA 3PVUA 2LMCA 4LDTD 4ZDVA 1MI1A 4KSKC 1WX7A 4I6LB 3VR9B 4F8CB 2CU1A 3BJIA 2MH7A 2LBBA 3FVCA 2DX1A 2BYVE 1Y5OA 2D3GA 2G9HD 4ZHOA 3DVNV 1D6EC 1KTKA 2K8EA 4JKFA 5T8IA 2K2JA 1WSPA 1XCQL 3DPDA 1UUPA 1L6VA 2KQ7A 2N9EB 3MHSD 5C79A 4IUMB 2WGSA 3DBHB 3QC8B 2K39A 2LRWA 2N9LA 4CQNA 4F7GA 4IKGA 1TJEA 2KFKB 3KUDB 1N62A 2YS5A 1N6ZA 1FM0D 2KUPA 3TL5A 4FJZA 2CHWA 2KFKA 4W9EA 2ELAA 4HDOA 1E90A 1QLBB 1X86A 1VLBA 2VZKB 4X57B 2GB1A 2OOBB 1CQVA 5CHFA 2KIEA 1UGMA 2LEKA 1YN3A 3BVMA 5I2SA 2N1VA 4WAFA 1C4PA 3RNCC 4QJ4B 3DWGC 1SIJA 1XO3A 3KRWA 5TR5A 3DXEA 4KAXB 4OVZA 1E8ZA 3V05A 3L17A 4K17A 5G5GA 2PEAA 1TS5A 2WP9B 3QA8A 1HE8A 1UH6A 1U27A 2GBMA 2XEWA 2YS3A 2JZ3B 2CB8A 4LNNA 2K25A 3JYUA 3CWIA 2I1KA 2I5FA 2WX1A 5H92C 1WG7A 2LOZA 1ACCA 1WZ0A 4WH4A 2MWNB 5BMHA 1FMAD 2JF5A 3DBSA 1KF6B 3BK1A 3PVWA 4MK0A 1RAXA 4IW0A 1V81A 2L2IA 4KZCA 1EUVB 1RFAA 4DHZB 2UWQA 1KLVA 4GB9A 1MG4A 4F7HA 3DBRI 4FJVB 3NRZA 3WA0A 2JUOA 1QOFA 3OWEB 4C56C 4WURA 3BVGA 2MJ3A 1UPRA 2ACZB 4LTUA 4DXAB 2M17A 3MPXA 2SEBD 2KQSA 2L83A 5D7GA 1OMWA 1DYNA 4HHVA 1FAOA 2LJ5A 2G35A 2VZKD
chains in the Genus database with same CATH topology
3RUIB 4B95A 3UIOB 3DXCA 3VOQA 2YT0A 3D8FA 3W1SC 4HAWB 2CAYA 3N3KB 1U5GA 2JXXA 3KUCB 2Z0PA 4ZYNA 2C7NB 2ZNVB 2I1JA 4CHKA 1R4MI 4A6HA 2OJRA 4MH0E 4H8SA 2FJ9A 5AZGA 2L0FA 4NSWA 1I42A 3LJUX 1ZM0A 1UNPA 3SHQA 1K5GB 3KH0A 3K9OB 4GN1A 3JSVB 1MPHA 4F7ZA 3UQAA 1X05A 3JSVA 4JQWC 3HM6X 2CHXA 2COCA 1LQBA 4NJ7A 4HB0B 4II3B 4KIKB 2L3ZA 1HB6A 3EC8A 1KC7A 1P3RA 2R0DA 1P5TA 3PHWB 4KIKA 2ZVNA 5AZHA 4EUTA 3NY5A 2GBKA 2IY1B 3UF8A 2FUHB 3ZDMC 4ZRKA 2D9XA 3VXWA 2ZPNA 3EPYA 5AEKB 1V5OA 1E8WA 2L0TA 1W1GA 3ULCA 4E3CA 2YVCA 2EJ8A 4NPNA 3ODXA 3APFA 4IG7B 2MLBA 2FAZA 3V6EB 2DLWA 3OJ3A 1PMSA 2REXA 4K2OA 2G4SA 2IY0B 4W9GA 4ZRIA 2KDFB 2HJ8A 2EMTA 4JK9A 1RJ2A 1PLSA 3EECA 1QZEA 4M0WB 3HQCA 3VUYA 2C7MB 3NHEB 2LWPA 1ZGUB 2LI5A 4W9FA 1XD3B 2LOXA 2O6VB 1RLFA 1NU2A 3R7QA 3ZRFA 5KHQA 2L00B 1WR1A 1YQBA 2O6VA 4MEMA 2JRIB 3FEHA 3WAOA 1WGDA 2XQNM 2GMIC 4KVGB 4AP4C 2X0SA 3PS6A 1E5WA 3H6NA 4IWPA 5DPTA 3RCPA 2DZKA 3ZRCA 2JVCA 2R2OA 2KK8A 3VUXA 3QAQA 1WMHB 2ZVOA 2KX0A 2LVQA 1OY2A 2ZCBA 5DI9B 1I2HA 1WMHA 3DVNU 2DAFA 2P0FA 4PS3A 4JLCA 4EZKA 4JKDA 4IWOA 2Y8FA 1V2YA 4TKNA 1V88A 3ENBA 4MGIE 3A9KA 2DTCA 2O6VD 2RD0A 3DXDA 3E66A 1TGZB 2P0HA 1YD8U 2DIKA 5DH9B 3PSCA 1PFJA 4GPTB 2KLGA 5IAAC 1PQSA 2D10A 4IC7B 4GU2A 1FGYA 3VDZA 3UQBA 1UBQA 1WR6E 2JWZA 2LD9A 2Z0OA 2MBQA 3CSFA 4OVVA 3U30A 3RULA 4FHJA 4JL9A 3E9LA 2C9WB 4WWPA 3P7ZA 4A3PA 3H7PB 3HK0A 2KMAA 4HAYB 1C3TA 4CYEA 3H7PA 2E2XA 2KJ6A 4JKAA 4GSWA 3CF6E 1WI0A 4RM8A 1VBGA 2COFA 5J18A 4KHOA 2UVMA 4GMXB 1WXMA 3CMMB 3RCZA 1NTVA 1MIZB 4HAZB 3OLMD 1ZC3B 1XCGA 1WJMA 4WJQA 5D3VA 3UIPB 1S3SG 1SE9A 2FDQA 5BO4B 4GZUA 2D11A 2DHJA 2CQUA 1AQCA 3F0WA 2KO3A 2K6QA 3M62B 1YX5B 1WVHA 4MGYE 4C0AA 1Y8RC 3VUWA 4JKEA 2J7QB 5AZFA 2YT1A 2R09A 4EKUA 1ACAA 3VQIA 2AEHA 1WIAA 3ECIA 1TTNA 2MW5A 1XKEA 1ISNA 4EZJA 1V86A 3B08A 4MGKE 5D94A 3TIXA 2XK5B 3MJWA 2RNRB 3QJZA 1YX6B 2BYFA 1GNUA 1H10A 5D27A 2XK5A 1SIFA 4A6FB 4CHJA 2JY6A 3FLVA 3QHTA 5LOPB 2BKRB 1V5MA 4XZ4A 3F5RA 4A6FA 4B6HA 2DA0A 2KCJA 3VTUA 4I6PA 4PYZA 4EMOA 5D6JB 1K5DB 4TQ0A 2KWUB 1WE6A 3U7DA 2GCJA 4KV2A 3WYFB 1WGUA 2QKLA 2ZCCA 1FOEA 2LRUA 1M7RA 2JRHA 3OANA 4BBKA 3HW2B 4HWIB 1QQGA 4NAWB 2M0XA 2K2UA 2LYDA 1WGQA 2N9XA 4AJYB 1IP9A 4FBJB 4NAWA 4M8MA 3V60A 2LGDA 2V1YA 1BTKA 2JP2A 3A98B 2D07B 3M3JA 1ZVRA 5LXHA 3A4SC 2N7DA 1BWNA 3PT2B 1DROA 1JRUA 2CKHB 5E6OA 1FHXA 3ML8A 1WM2A 1WE7A 3APCA 2MSED 2KX3A 1XD4A 3KUZA 3TFMA 2IO1B 2PE9A 4DK5A 4A20A 3IVFA 4HVBA 3ZLZA 1E8XA 4W9CA 2YSZA 1EF5A 1NTIA 5E6PA 2ROVA 1WXSA 3PG7A 1H8CA 3SYXA 2DKQA 1DDMA 4W9IA 1QC6A 3EFUA 3QARA 2NVUI 2UYZB 4IFSA 2G45B 3SD5A 1B55A 2COAA 4NQLB 2K6DB 2K00A 2ROZB 3RZWC 1WJ4A 2VRWB 5J17A 2DX5B 2KC1A 2DYQA 1J0WA 3QWMA 1TJ6A 3ZTDA 2MBEA 1FXTB 1Q1OA 2DX5A 2N7EA 3AJ4A 5EFXA 3VAWA 3DDCB 4ANXA 2IO2B 2A5UA 5DHAB 3ODOA 2AWTA 2MWSB 3IG3A 3WANA 2J59M 5HKHA 3NZUA 2RGFA 2ZEQA 2GBNA 4HB3B 1XQQA 1DIKA 3PRMB 4EZLA 3W1YA 3M1IB 1RRPB 3VIAA 1EF1A 1UBIA 4JKHA 2KTRB 3Q3JA 1WGRA 2DYBA 5J3TA 2PE6B 1V49A 2KTRA 3PTFC 3H9DA 4FJYA 2HD5B 4LJOB 4JKGB 3VTWA 4DBBA 5IJMA 1Z5SB 2AL3A 2WDTB 2IBIB 2FCSA 5J3YA 1CMXB 3QK0A 4JKGA 4HK2A 4ANUA 3A8PA 1WGGA 3ZO5B 4ICUA 4N9F4 2LXCA 5J3QA 2ADZA 4PS8A 2YRYA 1NDDA 2AL6A 1A5RA 5D2MB 4YONA 1WFYA 2Y7BA 2FIDA 2KANA 5JHBA 2K8CA 3V62A 4HAXB 3DBHI 4JK7A 4K1RB 3SUZA 1TQZA 4KZ0A 2KDEB 2M8SA 3PGEA 2RQ1A 2MFQA 3A33B 2CY5A 4WJOA 1X1GA 3ZVVA 1OQNA 5G2NA 1P9DU 4TQ1A 3RT3B 3ZDTA 2MBBB 4MSQB 3ULBA 5C16A 3T06A 1HB8A 1X11A 5L95C 3A4RA 5C5BB 2XBBC 5JHAA 1V5UA 2LGYA 5C5BA 4HAVB 3TMPB 5HE3A 1T0YA 1XT9B 2KDIA 2A4ZA 3ZNID 2Z59B 4HDQA 2NBUA 1GJZA 2LGXA 4Z2MB 3I3TB 4W9HA 1J8CA 3AI5A 1ZSQA 1M7EA 4JGHB 4XWXA 2JT4B 2HRJA 2PZ1A 2LULA 1X1FA 2M38A 1FB8A 4HLEA 3AU4A 1BTNA 2LXAA 5LONB 3V61A 1KJTA 4MDKE 2CRFA 4HPLB 3WAMA 4BFRA 2OQBA 5JP4A 3VVWB 3B1LX 3LDZE 4AUQC 1EO6A 2L05A 3ZIMA 3ZNZB 1D3ZA 3NSUA 5KQ1A 2NR2A 2MA9B 3L16A 2KVRA 3PLUA 3QX1A 2MQJA 3GOEA 2Z0DB 2M4NA 3L13A 4NNJB 3E9OA 2NCNA 1MK7B 1IPGA 2R2QA 5DPWA 3R66C 4K81A 3R3MA 4BVUC 5CLLB 4PNKA 4AJWA 4MY6A 3G9WA 4BKTA 3T8MA 4HCNB 1P3QU 3VH3B 4CHMA 3O96A 2V76A 3L10B 2R82A 3V5WA 1W1HA 3DBLI 4YL8A 1L2NA 1UELA 1YIWA 2CS4A 1HBKA 3NOBA 4WAAA 4DDID 1OTRB 4BKGA 4BKSA 2MP2B 5JLJB 5FI0A 3ZVRA 5DHFB 3C0RB 4GDKB 2MP2A 1WM3A 3VHTC 1V80A 4GDKA 4M8NA 4JKBA 4F1SA 2COPA 4HATB 5G55A 2L8JA 3H1UA 3GYOA 4Z2NA 5D3WA 2CHZA 1NBFC 2DKPA 1Q0WB 2BWFA 1VBHA 2L1CA 4RMAA 3PREA 3A8QA 3Q3FA 2KN5A 3BINA 3QWZB 4WJPA 1LW3A 3DVGX 2L7RA 2ASQA 2FJLA 2KHWB 4BOZB 3CXBB 2DYMA 3FM8C 3HHMA 2IO3B 2WWZA 2LVPA 1K8RB 4BKSD 5L81A 4RM9A 1WX8A 2N1WA 5LXIB 2FIFA 4TV3A 4DX8A 3PHXB 2RSGA 1U2BA 2HTHB 5JVLA 5FI1A 3KVFB 4JK8A 2HTHA 5C23A 4IWQA 2EMSA 1WGYA 1NI2A 2QKMA 3KW5B 1GG3A 3ONSA 3KRXA 3IHPC 5D3XA 2KFJA 2RVBB 4ILGB 1P6SA 2FCMA 1LXDA 4EEWA 2DFKA 1V89A 2KWCA 3RZFA 4HXDA 2C5LC 2N4FA 4II2B 4CO7A 4ILJA 3UGBB 2V4LA 4HPMB 1UD7A 3QBVB 1AARA 3IBEA 3WAPA 2KJRA 2KJHB 3D32A 3OJ4B 1G6JA 2VKIA 3TW1A 2J0JA 2HE7A 3L0WB 4HJKA 1SHCA 3JVZX 4I6NB 4FHKA 4DDGD 4G3XB 4DHJB 2YF0A 5CX3A 3SU8X 4URKA 1MKEA 2LASA 2NBWB 4TYZA 1WXVA 2VSZA 4FN2A 5JZEB 4BBNF 4HB2B 3QCAA 3A1QB 5IA7A 2V3SA 3PP2A 4LCDE 1KOTA 2NZ8B 2NMBA 1C1YB 3A1QA 2MKRA 1WXAA 3PRZA 1MIXA 4GOCA 3BY4B 3EHVA 3ODWA 3P2BA 2H7EA 3PEGA 3MDBC 2P0DA 1OQYA 3UZTA 3DOWA 1EVHA 2BPSA 5KQ4A 4NQKE 1V5PA 3M95A 2KLCA 4P7IA 1P1AA 2ZPYA 2D9ZA 3VH4B 4DHJD 3D8EA 4KHAA 2FNJB 1U5DA 5CHVC 3VFKA 2KMCA 5E6NA 2RSUA 3SBGA 3KSYA 2W2XC 4GGQA 2RUKB 3ALBA 3NS8A 4GXBA 2WH5A 3TJPA 2N9PC 3NZSA 2DHZA 3D8DA 1N3HA 2DAJA 2NS5A 4JKCA 2KXJA 2KGXB 3VTVA 2KNBA 1W1DA 5CHWA 1E7VA 1YJ1A 3WIMA 1WH3A 2KDBA 1U4AA 5FR6A 2WX0A 1V6EA 1NTYA 2EC1A 5D3YA 1TZ1A 3RYTA 3AULA 3ZKJC 2DHKA 2LKOA 4HB4B 3LJ3A 2MX2A 3MTNB 3KYDD 1WJ1A 1R4NI 4MJSB 3X23A 5JH5C 3TBLD 1I7AA 1IYFA 5KCVA 4MJSA 3SV1A 4EJNA 4B9KA 2IFSA 1KZ7A 2DN6A 2DYOA 2CODA 4FA6A 4F7UP 2QHOA 4WWOA 1XODA 2DHIA 4AWJA 1TBEA 2M1MA 3N30A 4MM3A 4ANWA 1EGXA 4MGZE 2FCNA 1WGHA 1E8YA 1XX0A 1ZW7A 5DIFB 2GBJA 4FADA 4MT7A 4E71A 3S2AA 4GIVA 1KZGA 2K8HA 2FCQA 4EFOA 1E7UA 5EDSA 1UZXB 5GOWB 3FP5A 5C1ZA 3QQ8B 2P8VA 4DWFA 2GJYA 3GYPA 1V5TA 3PPAA 3ML9A 1J19A 5LLIA 1AWEA 4DBGA 1NVLA 4K7WA 2K1FA 3ZNHB 1ZC4B 4WSFA 1MAIA 2RLOA 2KD0A 1WF9A 3N7CA 2Y5BB 1WX9A 1P0RA 3SDLC 2DENB 2MRPA 2YLMA 3JW0X 4LJPB 1UEFA 4PYUA 2BCJA 3L08A 1OEYJ 4W9DA 2BYEA 4WVFB 4KDIC 4L6EA 4B6WA 3H7SA 2GOWA 3PSEB 1WJUA 3ZUNA 1OGWA 5JHGA 2W2WA 2JZZA 3TVVA 2G4DB 3PZDA 3CSTA 1S1QB 2Q13A 1DDVA 1FGZA 1F9JA 5DPSA 2DZIA 4IM0A 3ML4A 1MK9B 2D9WA 4BOSC 4K7UA 1FHWA 2PJHA 3DVGY 3KYCD 4EOYA 2IYBA 4W9JA 5HE2A 1RRBA 2Z0EB 1ZKHA 1GGOA 1LFDA 3CIKA 2WYQA 1Z2MA 2DYNA 4K2PA 3PVLA 4Y94A 1WZ3A 5GMVA 4DX90 4WJNA 4E74A 3X0WA 2YS1A 1U5FA 2DZJA 2GS0A 4IAPA 2L76A 4DHZE 1X1MA 2LZ6A 4WWNA 3TCAA 4GDLB 4IOYX 2JPHA 1UNRA 1WY8A 1WJNA 3T9LA 4NY0A 4GDLA 2Z0QA 2K8BA 2RGNB 4PS7A 1WRDB 1JDEA 2D9YA 2O2VB 5J2RA 2O2VA 2LUEA 2J0MA 4ASWC 3U8ZA 2IYDB 1BAKA 3ENEA 4K7SA 3HIZA 4MSMB 4IM2A 3SBTA 4MELA 5KHOA 2J0KA 1VD2A 2LVOA 4G50A 1LB1A 4WQOB 3TO1A 2I5CA 2B3AA 3QIJA 4KHBB 1J0GA 2IO0B 2UZSA 1Q67A 3A9KB 2H7DA 3GZNI 3ZNGC 1P98A 3FSSA 3AU5A 3O65B 4G0NB 3B0AA 1XR0B 2MDXA 1KBLA 1GC6A 3N32A 2C7HA 2KOXA 2BF8B 4A3OA 2GCLA 2MCNB 4J6IA 1V61A 2ZNVC 2MBOA 2M14A 1IRSA 4BBNC 5DCNA 2D4QA 4FULA 1Y19B 5L83A 2CR5A 4XC2A 3HM3A 4OVUA 2ELBA 2ABDA 3IFWB 4W9LA 4ANVA 4AOFA 4PQ0A 3AXCA 2X18A 3DCGA 1GC7A 1U5EA 2C60A 4ZRJA 5CTRC 2BWES 2ZJDA 3A9JB 3UINB 4KDLB 3E9PA 2GBRA 4FLHA 1KM7A 5HE0A 2CY4A 4XX5A 4WJ7A 2KZRA 3A9JA 3L54A 2W2XD 1ST7A 2KC2A 3K9PB 1TXDA 1UPQA 1L7YA 2KKCA 4W9KA 3ZTCA 2PPHA 2BGFA 2VRRB 2N23A 3PV1A 1KI1B 1Z87A 2EKEC 3WALA 5JHHA 1DBHA 3PRPB 2Y8GA 3V6CB 4JIOU 1GUAB 1I35A 4G11A 2MBHA 3APDA 2RR9A 5HE1A 3KZ1A 1BT0A 1LM8B 2G3QB 4ICVA 1OEYA 5DPRA 1FHOA 4IM3A 2NBVB 3P6AA 1M94A 4GMVA 1SGHA 2DZMA 1WJ6A 3DQVA 3W1SA 3OAWA 3KY9A 2W9NA 4TUUA 1DDWA 3M63B 1VCBA 4LDTB 5C6RA 3ZW3A 3RD2A 3SO6A 2NPTB 1Q5WB 1U29A 2IZVB 1H4RA 2UZRA 4HCPB 2KWVB 2NPTA 2BKFA 1V9JA 2D2QA 1UNQA 4ILHA 2N0YA 4D0NB 4A5KA 2OTXA 1EAZA 4HAUB 1WYWB 5CLQB 2RPQA 2LG1A 1MG8A 2AYOB 4NJ6A 2KTFA 2ZZPB 4KSLC 1WI1A 4A6KA 3SNHA 3R7RA 2D9VA 3PLVA 3PVUA 4LDTD 4ZDVA 4KSKC 1WX7A 4I6LB 4F8CB 2CU1A 3BJIA 2LBBA 2DX1A 2BYVE 1Y5OA 2D3GA 3DVNV 4JKFA 2K2JA 3DPDA 2KQ7A 2N9EB 3MHSD 5C79A 4IUMB 3QC8B 2K39A 2LRWA 4F7GA 2KFKB 3KUDB 2YS5A 2KUPA 3TL5A 4FJZA 2CHWA 2KFKA 4W9EA 2ELAA 4HDOA 1E90A 1X86A 4X57B 2OOBB 5CHFA 1UGMA 2N1VA 5TR5A 3KRWA 3DXEA 4KAXB 1E8ZA 3L17A 4K17A 2PEAA 3QA8A 1HE8A 1UH6A 1U27A 2GBMA 2XEWA 2YS3A 2JZ3B 2CB8A 2K25A 3JYUA 2I1KA 2I5FA 2WX1A 1WG7A 2LOZA 1WZ0A 2MWNB 2JF5A 3DBSA 3PVWA 4MK0A 1RAXA 4IW0A 1V81A 2L2IA 4KZCA 1EUVB 1RFAA 4DHZB 2UWQA 1KLVA 4GB9A 4F7HA 3DBRI 4FJVB 3WA0A 2JUOA 1UPRA 4DXAB 2M17A 3MPXA 2KQSA 5D7GA 1OMWA 1DYNA 4HHVA 1FAOA 2LJ5A 2G35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUI B;  4B95 A;  3UIO B;  3DXC A;  3VOQ A;  2YT0 A;  3D8F A;  3W1S C;  4HAW B;  2CAY A;  3N3K B;  1U5G A;  2JXX A;  3KUC B;  2Z0P A;  4ZYN A;  2C7N B;  2ZNV B;  2I1J A;  4CHK A;  1R4M I;  4A6H A;  2OJR A;  4MH0 E;  4H8S A;  2FJ9 A;  5AZG A;  2L0F A;  4NSW A;  1I42 A;  3LJU X;  1ZM0 A;  1UNP A;  3SHQ A;  1K5G B;  3KH0 A;  3K9O B;  4GN1 A;  3JSV B;  1MPH A;  4F7Z A;  3UQA A;  1X05 A;  3JSV A;  4JQW C;  3HM6 X;  2CHX A;  2COC A;  1LQB A;  4NJ7 A;  4HB0 B;  4II3 B;  4KIK B;  2L3Z A;  1HB6 A;  3EC8 A;  1P3R A;  1P5T A;  2R0D A;  3PHW B;  4KIK A;  2ZVN A;  5AZH A;  4EUT A;  3NY5 A;  2GBK A;  2IY1 B;  3UF8 A;  2FUH B;  3ZDM C;  4ZRK A;  2D9X A;  3VXW A;  2ZPN A;  3EPY A;  5AEK B;  1V5O A;  1E8W A;  2L0T A;  1W1G A;  3ULC A;  4E3C A;  2YVC A;  2EJ8 A;  4NPN A;  3ODX A;  3APF A;  4IG7 B;  2MLB A;  2FAZ A;  3V6E B;  2DLW A;  3OJ3 A;  1PMS A;  2REX A;  4K2O A;  2G4S A;  2IY0 B;  4W9G A;  4ZRI A;  2KDF B;  2HJ8 A;  2EMT A;  1RJ2 A;  1PLS A;  3EEC A;  1QZE A;  4M0W B;  3HQC A;  3VUY A;  2C7M B;  3NHE B;  2LWP A;  1ZGU B;  2LI5 A;  4W9F A;  1XD3 B;  2LOX A;  2O6V B;  1RLF A;  1NU2 A;  3R7Q A;  3ZRF A;  5KHQ A;  2L00 B;  1WR1 A;  1YQB A;  2O6V A;  4MEM A;  2JRI B;  3FEH A;  3WAO A;  1WGD A;  2XQN M;  2GMI C;  4KVG B;  4AP4 C;  3PS6 A;  1E5W A;  3H6N A;  4IWP A;  5DPT A;  3RCP A;  2DZK A;  3ZRC A;  2JVC A;  2R2O A;  2KK8 A;  3VUX A;  3QAQ A;  1WMH B;  2ZVO A;  2KX0 A;  2LVQ A;  1OY2 A;  2ZCB A;  5DI9 B;  1I2H A;  1WMH A;  3DVN U;  2DAF A;  2P0F A;  4PS3 A;  4JLC A;  4EZK A;  4IWO A;  2Y8F A;  1V2Y A;  1V88 A;  4TKN A;  4MGI E;  3A9K A;  2DTC A;  2O6V D;  2RD0 A;  3DXD A;  1TGZ B;  2P0H A;  1YD8 U;  5DH9 B;  3PSC A;  1PFJ A;  4GPT B;  2KLG A;  5IAA C;  1PQS A;  2D10 A;  4IC7 B;  4GU2 A;  1FGY A;  3VDZ A;  3UQB A;  1UBQ A;  1WR6 E;  2JWZ A;  2LD9 A;  2Z0O A;  2MBQ A;  3CSF A;  4OVV A;  3U30 A;  3RUL A;  4FHJ A;  4JL9 A;  2C9W B;  4WWP A;  3P7Z A;  4A3P A;  3H7P B;  3HK0 A;  2KMA A;  4HAY B;  1C3T A;  4CYE A;  3H7P A;  2E2X A;  2KJ6 A;  4GSW A;  3CF6 E;  1WI0 A;  4RM8 A;  2COF A;  5J18 A;  4KHO A;  2UVM A;  4GMX B;  1WXM A;  3CMM B;  3RCZ A;  1NTV A;  1MIZ B;  4HAZ B;  3OLM D;  1ZC3 B;  1XCG A;  1WJM A;  4WJQ A;  5D3V A;  3UIP B;  1S3S G;  1SE9 A;  2FDQ A;  5BO4 B;  4GZU A;  2D11 A;  2DHJ A;  2CQU A;  1AQC A;  3F0W A;  2KO3 A;  2K6Q A;  3M62 B;  1YX5 B;  1WVH A;  4MGY E;  4C0A A;  1Y8R C;  3VUW A;  2J7Q B;  5AZF A;  2YT1 A;  2R09 A;  4EKU A;  1ACA A;  3VQI A;  2AEH A;  1WIA A;  3ECI A;  1TTN A;  2MW5 A;  1XKE A;  1ISN A;  4EZJ A;  1V86 A;  3B08 A;  4MGK E;  5D94 A;  3TIX A;  2XK5 B;  3MJW A;  2RNR B;  3QJZ A;  1YX6 B;  2BYF A;  1GNU A;  1H10 A;  5D27 A;  2XK5 A;  1SIF A;  4A6F B;  4CHJ A;  2JY6 A;  3FLV A;  3QHT A;  5LOP B;  2BKR B;  1V5M A;  4XZ4 A;  3F5R A;  4A6F A;  4B6H A;  2DA0 A;  3VTU A;  2KCJ A;  4I6P A;  4PYZ A;  4EMO A;  5D6J B;  1K5D B;  4TQ0 A;  2KWU B;  1WE6 A;  3U7D A;  2GCJ A;  4KV2 A;  3WYF B;  1WGU A;  2QKL A;  2ZCC A;  1FOE A;  2LRU A;  1M7R A;  2JRH A;  3OAN A;  4BBK A;  3HW2 B;  4HWI B;  1QQG A;  4NAW B;  2M0X A;  2K2U A;  2LYD A;  1WGQ A;  2N9X A;  4AJY B;  1IP9 A;  4FBJ B;  4NAW A;  4M8M A;  3V60 A;  2LGD A;  2V1Y A;  1BTK A;  2JP2 A;  3A98 B;  2D07 B;  3M3J A;  1ZVR A;  5LXH A;  3A4S C;  2N7D A;  1BWN A;  3PT2 B;  1DRO A;  1JRU A;  2CKH B;  5E6O A;  1FHX A;  3ML8 A;  1WM2 A;  1WE7 A;  3APC A;  2MSE D;  2KX3 A;  1XD4 A;  3KUZ A;  3TFM A;  2IO1 B;  2PE9 A;  4DK5 A;  4A20 A;  3IVF A;  4HVB A;  3ZLZ A;  1E8X A;  4W9C A;  2YSZ A;  1EF5 A;  1NTI A;  5E6P A;  2ROV A;  1WXS A;  3PG7 A;  1H8C A;  3SYX A;  2DKQ A;  1DDM A;  4W9I A;  1QC6 A;  3EFU A;  3QAR A;  2NVU I;  2UYZ B;  4IFS A;  2G45 B;  3SD5 A;  1B55 A;  2COA A;  4NQL B;  2K6D B;  2K00 A;  2ROZ B;  3RZW C;  1WJ4 A;  2VRW B;  5J17 A;  2DX5 B;  2KC1 A;  2DYQ A;  1J0W A;  3QWM A;  1TJ6 A;  3ZTD A;  2MBE A;  1FXT B;  1Q1O A;  2DX5 A;  2N7E A;  3AJ4 A;  5EFX A;  3VAW A;  3DDC B;  4ANX A;  2IO2 B;  2A5U A;  5DHA B;  3ODO A;  2AWT A;  2MWS B;  3IG3 A;  3WAN A;  2J59 M;  5HKH A;  3NZU A;  2RGF A;  2ZEQ A;  2GBN A;  4HB3 B;  1XQQ A;  3PRM B;  4EZL A;  3W1Y A;  3M1I B;  1RRP B;  3VIA A;  1EF1 A;  1UBI A;  2KTR B;  3Q3J A;  1WGR A;  2DYB A;  5J3T A;  2PE6 B;  1V49 A;  2KTR A;  3PTF C;  3H9D A;  4FJY A;  2HD5 B;  4LJO B;  3VTW A;  4DBB A;  5IJM A;  1Z5S B;  2AL3 A;  2WDT B;  2IBI B;  2FCS A;  5J3Y A;  1CMX B;  3QK0 A;  4HK2 A;  4ANU A;  3A8P A;  1WGG A;  3ZO5 B;  4ICU A;  4N9F 4;  2LXC A;  5J3Q A;  2ADZ A;  4PS8 A;  2YRY A;  1NDD A;  2AL6 A;  1A5R A;  5D2M B;  4YON A;  1WFY A;  2Y7B A;  2FID A;  2KAN A;  5JHB A;  2K8C A;  3V62 A;  4HAX B;  3DBH I;  4K1R B;  3SUZ A;  1TQZ A;  4KZ0 A;  2KDE B;  2M8S A;  3PGE A;  2RQ1 A;  2MFQ A;  3A33 B;  2CY5 A;  4WJO A;  1X1G A;  3ZVV A;  1OQN A;  5G2N A;  1P9D U;  4TQ1 A;  3RT3 B;  3ZDT A;  2MBB B;  4MSQ B;  3ULB A;  5C16 A;  3T06 A;  1HB8 A;  1X11 A;  5L95 C;  3A4R A;  5C5B B;  2XBB C;  5JHA A;  1V5U A;  2LGY A;  5C5B A;  4HAV B;  3TMP B;  5HE3 A;  1T0Y A;  1XT9 B;  2KDI A;  2A4Z A;  3ZNI D;  2Z59 B;  4HDQ A;  2NBU A;  1GJZ A;  2LGX A;  4Z2M B;  3I3T B;  4W9H A;  1J8C A;  3AI5 A;  1ZSQ A;  1M7E A;  4JGH B;  4XWX A;  2JT4 B;  2HRJ A;  2PZ1 A;  2LUL A;  1X1F A;  2M38 A;  1FB8 A;  4HLE A;  3AU4 A;  1BTN A;  2LXA A;  5LON B;  3V61 A;  1KJT A;  4MDK E;  2CRF A;  4HPL B;  3WAM A;  4BFR A;  2OQB A;  3VVW B;  5JP4 A;  3B1L X;  3LDZ E;  4AUQ C;  1EO6 A;  2L05 A;  3ZIM A;  3ZNZ B;  1D3Z A;  3NSU A;  5KQ1 A;  2NR2 A;  2MA9 B;  3L16 A;  2KVR A;  3PLU A;  3QX1 A;  2MQJ A;  3GOE A;  2Z0D B;  2M4N A;  3L13 A;  4NNJ B;  2NCN A;  1MK7 B;  1IPG A;  2R2Q A;  5DPW A;  3R66 C;  4K81 A;  3R3M A;  4BVU C;  5CLL B;  4PNK A;  4AJW A;  4MY6 A;  3G9W A;  4BKT A;  3T8M A;  4HCN B;  1P3Q U;  3VH3 B;  4CHM A;  3O96 A;  2V76 A;  3L10 B;  3V5W A;  1W1H A;  3DBL I;  4YL8 A;  1L2N A;  1UEL A;  1YIW A;  2CS4 A;  1HBK A;  3NOB A;  4WAA A;  4DDI D;  1OTR B;  4BKG A;  4BKS A;  2MP2 B;  5JLJ B;  5FI0 A;  3ZVR A;  5DHF B;  3C0R B;  4GDK B;  2MP2 A;  1WM3 A;  3VHT C;  1V80 A;  4GDK A;  4M8N A;  4F1S A;  2COP A;  4HAT B;  5G55 A;  2L8J A;  3H1U A;  3GYO A;  4Z2N A;  5D3W A;  2CHZ A;  1NBF C;  2DKP A;  1Q0W B;  2BWF A;  2L1C A;  4RMA A;  3PRE A;  3A8Q A;  3Q3F A;  2KN5 A;  3BIN A;  3QWZ B;  4WJP A;  1LW3 A;  3DVG X;  2L7R A;  2ASQ A;  2FJL A;  2KHW B;  4BOZ B;  3CXB B;  2DYM A;  3FM8 C;  3HHM A;  2IO3 B;  2WWZ A;  2LVP A;  1K8R B;  4BKS D;  5L81 A;  4RM9 A;  1WX8 A;  2N1W A;  5LXI B;  2FIF A;  4TV3 A;  4DX8 A;  3PHX B;  2RSG A;  1U2B A;  2HTH B;  5FI1 A;  3KVF B;  2HTH A;  5C23 A;  4IWQ A;  2EMS A;  1WGY A;  1NI2 A;  2QKM A;  3KW5 B;  1GG3 A;  3ONS A;  3KRX A;  3IHP C;  5D3X A;  2KFJ A;  2RVB B;  1P6S A;  2FCM A;  1LXD A;  4EEW A;  2DFK A;  1V89 A;  2KWC A;  3RZF A;  4HXD A;  2C5L C;  2N4F A;  4II2 B;  4CO7 A;  3UGB B;  2V4L A;  4HPM B;  1UD7 A;  3QBV B;  1AAR A;  3IBE A;  3WAP A;  2KJR A;  2KJH B;  3D32 A;  3OJ4 B;  1G6J A;  2VKI A;  3TW1 A;  2J0J A;  2HE7 A;  3L0W B;  4HJK A;  1SHC A;  3JVZ X;  4I6N B;  4FHK A;  4DDG D;  4G3X B;  4DHJ B;  2YF0 A;  5CX3 A;  3SU8 X;  4URK A;  1MKE A;  2LAS A;  2NBW B;  4TYZ A;  1WXV A;  2VSZ A;  4FN2 A;  5JZE B;  4BBN F;  4HB2 B;  3QCA A;  3A1Q B;  5IA7 A;  2V3S A;  3PP2 A;  4LCD E;  1KOT A;  2NZ8 B;  2NMB A;  1C1Y B;  3A1Q A;  2MKR A;  1WXA A;  3PRZ A;  1MIX A;  4GOC A;  3BY4 B;  3EHV A;  3ODW A;  3P2B A;  2H7E A;  3PEG A;  3MDB C;  2P0D A;  1OQY A;  3UZT A;  3DOW A;  1EVH A;  2BPS A;  5KQ4 A;  4NQK E;  1V5P A;  3M95 A;  2KLC A;  4P7I A;  1P1A A;  2ZPY A;  2D9Z A;  3VH4 B;  4DHJ D;  3D8E A;  4KHA A;  2FNJ B;  1U5D A;  5CHV C;  3VFK A;  2KMC A;  5E6N A;  2RSU A;  3KSY A;  2W2X C;  4GGQ A;  2RUK B;  3ALB A;  3NS8 A;  4GXB A;  2WH5 A;  3TJP A;  2N9P C;  3NZS A;  2DHZ A;  3D8D A;  1N3H A;  2DAJ A;  2NS5 A;  2KXJ A;  2KGX B;  3VTV A;  2KNB A;  1W1D A;  5CHW A;  1E7V A;  1YJ1 A;  3WIM A;  1WH3 A;  2KDB A;  1U4A A;  5FR6 A;  2WX0 A;  1V6E A;  1NTY A;  2EC1 A;  5D3Y A;  1TZ1 A;  3RYT A;  3AUL A;  3ZKJ C;  2DHK A;  2LKO A;  4HB4 B;  3LJ3 A;  2MX2 A;  3MTN B;  3KYD D;  1WJ1 A;  1R4N I;  4MJS B;  3X23 A;  5JH5 C;  3TBL D;  1I7A A;  1IYF A;  5KCV A;  4MJS A;  3SV1 A;  4EJN A;  4B9K A;  2IFS A;  1KZ7 A;  2DN6 A;  2DYO A;  2COD A;  4FA6 A;  4F7U P;  2QHO A;  4WWO A;  1XOD A;  2DHI A;  4AWJ A;  1TBE A;  2M1M A;  3N30 A;  4MM3 A;  4ANW A;  1EGX A;  4MGZ E;  2FCN A;  1WGH A;  1E8Y A;  1XX0 A;  1ZW7 A;  5DIF B;  2GBJ A;  4FAD A;  4MT7 A;  4E71 A;  3S2A A;  4GIV A;  1KZG A;  2K8H A;  2FCQ A;  4EFO A;  1E7U A;  5EDS A;  1UZX B;  5GOW B;  3FP5 A;  5C1Z A;  3QQ8 B;  2P8V A;  4DWF A;  2GJY A;  3GYP A;  1V5T A;  3PPA A;  3ML9 A;  1J19 A;  5LLI A;  1AWE A;  4DBG A;  1NVL A;  4K7W A;  2K1F A;  3ZNH B;  1ZC4 B;  4WSF A;  1MAI A;  2RLO A;  2KD0 A;  1WF9 A;  3N7C A;  2Y5B B;  1WX9 A;  1P0R A;  3SDL C;  2DEN B;  2MRP A;  2YLM A;  3JW0 X;  4LJP B;  1UEF A;  4PYU A;  2BCJ A;  3L08 A;  1OEY J;  4W9D A;  2BYE A;  4WVF B;  4KDI C;  4L6E A;  4B6W A;  3H7S A;  2GOW A;  3PSE B;  1WJU A;  3ZUN A;  1OGW A;  5JHG A;  2W2W A;  2JZZ A;  3TVV A;  2G4D B;  3PZD A;  3CST A;  1S1Q B;  2Q13 A;  1DDV A;  1FGZ A;  1F9J A;  5DPS A;  2DZI A;  4IM0 A;  3ML4 A;  1MK9 B;  2D9W A;  4BOS C;  4K7U A;  1FHW A;  2PJH A;  3DVG Y;  3KYC D;  4EOY A;  2IYB A;  4W9J A;  5HE2 A;  1RRB A;  2Z0E B;  1ZKH A;  1LFD A;  3CIK A;  2WYQ A;  1Z2M A;  2DYN A;  4K2P A;  3PVL A;  4Y94 A;  1WZ3 A;  5GMV A;  4DX9 0;  4WJN A;  4E74 A;  3X0W A;  2YS1 A;  1U5F A;  2DZJ A;  2GS0 A;  4IAP A;  2L76 A;  4DHZ E;  1X1M A;  2LZ6 A;  4WWN A;  3TCA A;  4GDL B;  4IOY X;  2JPH A;  1UNR A;  1WY8 A;  1WJN A;  3T9L A;  4NY0 A;  4GDL A;  2Z0Q A;  2K8B A;  2RGN B;  4PS7 A;  1WRD B;  2D9Y A;  2O2V B;  5J2R A;  2O2V A;  2LUE A;  2J0M A;  4ASW C;  3U8Z A;  2IYD B;  1BAK A;  3ENE A;  4K7S A;  3HIZ A;  4MSM B;  4IM2 A;  4MEL A;  5KHO A;  2J0K A;  1VD2 A;  2LVO A;  4G50 A;  1LB1 A;  4WQO B;  3TO1 A;  2I5C A;  2B3A A;  3QIJ A;  4KHB B;  1J0G A;  2IO0 B;  2UZS A;  1Q67 A;  3A9K B;  2H7D A;  3GZN I;  3ZNG C;  1P98 A;  3FSS A;  3AU5 A;  3O65 B;  4G0N B;  3B0A A;  1XR0 B;  2MDX A;  1GC6 A;  3N32 A;  2C7H A;  2KOX A;  2BF8 B;  4A3O A;  2GCL A;  2MCN B;  4J6I A;  1V61 A;  2ZNV C;  2MBO A;  2M14 A;  1IRS A;  4BBN C;  5DCN A;  2D4Q A;  4FUL A;  1Y19 B;  5L83 A;  2CR5 A;  4XC2 A;  3HM3 A;  4OVU A;  2ELB A;  2ABD A;  3IFW B;  4W9L A;  4ANV A;  4AOF A;  4PQ0 A;  3AXC A;  2X18 A;  3DCG A;  1GC7 A;  1U5E A;  2C60 A;  4ZRJ A;  5CTR C;  2BWE S;  2ZJD A;  3A9J B;  3UIN B;  4KDL B;  4FLH A;  2GBR A;  1KM7 A;  5HE0 A;  2CY4 A;  4XX5 A;  4WJ7 A;  2KZR A;  3A9J A;  3L54 A;  2W2X D;  1ST7 A;  2KC2 A;  3K9P B;  1TXD A;  1UPQ A;  1L7Y A;  2KKC A;  4W9K A;  3ZTC A;  2PPH A;  2BGF A;  2VRR B;  2N23 A;  3PV1 A;  1KI1 B;  1Z87 A;  2EKE C;  3WAL A;  5JHH A;  1DBH A;  3PRP B;  2Y8G A;  3V6C B;  4JIO U;  1GUA B;  1I35 A;  4G11 A;  2MBH A;  3APD A;  2RR9 A;  5HE1 A;  3KZ1 A;  1BT0 A;  1LM8 B;  2G3Q B;  4ICV A;  1OEY A;  5DPR A;  1FHO A;  4IM3 A;  2NBV B;  3P6A A;  1M94 A;  4GMV A;  1SGH A;  2DZM A;  1WJ6 A;  3DQV A;  3W1S A;  3OAW A;  3KY9 A;  2W9N A;  4TUU A;  1DDW A;  3M63 B;  1VCB A;  4LDT B;  5C6R A;  3ZW3 A;  3RD2 A;  3SO6 A;  2NPT B;  1Q5W B;  1U29 A;  2IZV B;  1H4R A;  2UZR A;  4HCP B;  2KWV B;  2NPT A;  2BKF A;  1V9J A;  2D2Q A;  1UNQ A;  2N0Y A;  4D0N B;  4A5K A;  2OTX A;  1EAZ A;  4HAU B;  1WYW B;  5CLQ B;  2RPQ A;  2LG1 A;  1MG8 A;  2AYO B;  4NJ6 A;  2KTF A;  2ZZP B;  4KSL C;  1WI1 A;  4A6K A;  3SNH A;  3R7R A;  2D9V A;  3PLV A;  3PVU A;  4LDT D;  4ZDV A;  4KSK C;  1WX7 A;  4I6L B;  4F8C B;  2CU1 A;  3BJI A;  2LBB A;  2DX1 A;  2BYV E;  1Y5O A;  2D3G A;  3DVN V;  2K2J A;  3DPD A;  2KQ7 A;  2N9E B;  3MHS D;  5C79 A;  4IUM B;  3QC8 B;  2K39 A;  2LRW A;  4F7G A;  2KFK B;  3KUD B;  2YS5 A;  2KUP A;  3TL5 A;  4FJZ A;  2CHW A;  2KFK A;  4W9E A;  2ELA A;  4HDO A;  1E90 A;  1X86 A;  4X57 B;  2OOB B;  5CHF A;  1UGM A;  2N1V A;  5TR5 A;  3KRW A;  3DXE A;  4KAX B;  1E8Z A;  3L17 A;  4K17 A;  2PEA A;  3QA8 A;  1HE8 A;  1UH6 A;  1U27 A;  2GBM A;  2XEW A;  2YS3 A;  2JZ3 B;  2CB8 A;  2K25 A;  3JYU A;  2I1K A;  2I5F A;  2WX1 A;  1WG7 A;  2LOZ A;  1WZ0 A;  2MWN B;  2JF5 A;  3DBS A;  3PVW A;  4MK0 A;  1RAX A;  4IW0 A;  1V81 A;  2L2I A;  4KZC A;  1EUV B;  1RFA A;  4DHZ B;  2UWQ A;  1KLV A;  4GB9 A;  4F7H A;  3DBR I;  4FJV B;  3WA0 A;  2JUO A;  1UPR A;  4DXA B;  2M17 A;  3MPX A;  2KQS A;  5D7G A;  1OMW A;  1DYN A;  4HHV A;  1FAO A;  2LJ5 A;  2G35 A; 
#chains in the Genus database with same CATH topology
 3RUI B;  4B95 A;  3UIO B;  3DXC A;  3BZD B;  3VOQ A;  2YT0 A;  3MC0 B;  2M19 A;  3D8F A;  3W1S C;  4HAW B;  2CAY A;  3N3K B;  1U5G A;  2JXX A;  2ON8 A;  3KUC B;  2Z0P A;  4ZYN A;  1XLO A;  2C7N B;  2ZNV B;  2I1J A;  3Q14 C;  4CHK A;  3T3N A;  4A8X C;  1R4M I;  4A6H A;  4IDI A;  2OJR A;  3R2I A;  4OZC A;  4MH0 E;  1KLG D;  1JAL A;  4H8S A;  2FJ9 A;  3U2S C;  5AZG A;  2L0F A;  4NSW A;  1VZ8 A;  1I42 A;  2B76 B;  3LJU X;  1ZM0 A;  1UNP A;  3SHQ A;  3BYT B;  1K5G B;  2JX5 A;  3KH0 A;  2KR0 A;  3K9O B;  3MC8 A;  4GN1 A;  3JSV B;  1MPH A;  4F7Z A;  3UQA A;  4ITK A;  4HSI A;  5I4D A;  2XN9 C;  1X05 A;  3JSV A;  4JQW C;  3HM6 X;  3W2D A;  2CHX A;  2COC A;  1B1Z A;  2WXH A;  1LQB A;  2WXQ A;  3KWL A;  1N61 A;  4NJ7 A;  4HB0 B;  4II3 B;  4KIK B;  1QOG A;  2L3Z A;  4JPS A;  1HB6 A;  2N7J A;  3EC8 A;  1KC7 A;  1P3R A;  1P5T A;  2R0D A;  3PHW B;  2Y5C A;  4KIK A;  2ZVN A;  5AZH A;  4EUT A;  3NY5 A;  1V1O A;  2GBK A;  3SFE B;  4YWG G;  2IY1 B;  3UF8 A;  2FUH B;  3U12 A;  3DBL B;  3ZDM C;  1WWT A;  4ZRK A;  2WXO A;  2D9X A;  3VXW A;  2ZPN A;  3EPY A;  5AEK B;  1V5O A;  1E8W A;  1V1P B;  2L0T A;  3HVD A;  1W1G A;  3ULC A;  4E3C A;  2YVC A;  4TSS A;  3KQ4 A;  4NZL B;  3DHH C;  3AEA B;  2EJ8 A;  4FXC A;  4NPN A;  3ODX A;  3APF A;  4IG7 B;  1C77 A;  2MLB A;  2FAZ A;  4HRS A;  3V6E B;  2DLW A;  3RNA C;  3E9S A;  4B0E A;  3OJ3 A;  1STE A;  1PMS A;  1XEE A;  2REX A;  1DOX A;  4K2O A;  1L0Y B;  2G4S A;  4L2Y A;  2LHE A;  2IDY A;  2IY0 B;  4W9G A;  4ZRI A;  3HSA A;  2KDF B;  2HJ8 A;  3IXS A;  3DHI C;  5EE0 A;  2EMT A;  3FC4 A;  4JK9 A;  1RJ2 A;  3GP7 A;  1PLS A;  3EEC A;  3NG0 A;  1QZE A;  3AEF B;  4M0W B;  4O1N A;  3HQC A;  3BYY B;  3VUY A;  2C7M B;  3NHE B;  2LWP A;  1ZGU B;  2LI5 A;  4M0W A;  3HVZ A;  4W9F A;  1ZXH A;  1QF6 A;  1XD3 B;  2LOX A;  2O6V B;  1RLF A;  1NU2 A;  3R7Q A;  1L5P A;  3BVZ A;  4DIX A;  1QOB A;  3ZRF A;  5KHQ A;  2L00 B;  3AE8 B;  1WR1 A;  1VRA B;  1YQB A;  2L1A A;  2O6V A;  4MEM A;  2JRI B;  3FEH A;  3WAO A;  1WGD A;  2XQN M;  1JRP A;  2IGD A;  2WQY B;  2GMI C;  4KVG B;  4AP4 C;  2QSD A;  2X0S A;  3PS6 A;  1E5W A;  3H6N A;  4IWP A;  1TT5 B;  5DPT A;  3RCP A;  2DZK A;  3ZRC A;  2JVC A;  2R2O A;  2KK8 A;  4OZB A;  5I2M A;  1RM6 C;  3VUX A;  3QAQ A;  1WMH B;  2ZVO A;  4ZHP A;  5JXV A;  2KX0 A;  2LVQ A;  1OY2 A;  2ZCB A;  5DI9 B;  3Q8C A;  1I2H A;  1WMH A;  3RNB C;  3DVN U;  2KIG A;  2DAF A;  2P0F A;  3KLS X;  4PS3 A;  4JLC A;  1F2R C;  4EZK A;  4JKD A;  4IWO A;  3TSS A;  2Y8F A;  1N60 A;  1V2Y A;  4TKN A;  1V88 A;  2I2Y A;  3ENB A;  3SFD B;  1GB4 A;  4MGI E;  3A9K A;  2DTC A;  2O6V D;  2RD0 A;  3AE7 B;  3DXD A;  3E66 A;  1QOA A;  1TGZ B;  4JE3 B;  1TKY A;  3A58 A;  2P0H A;  1YD8 U;  2DIK A;  5DH9 B;  3PSC A;  1PFJ A;  4GPT B;  3ABV B;  2KLG A;  3P4S B;  5IAA C;  1PQS A;  2D10 A;  4M01 A;  1PYW D;  4IC7 B;  4GU2 A;  1FGY A;  3VDZ A;  3UQB A;  2BB6 A;  1UBQ A;  1XLN A;  2D3A A;  2WDV B;  3MC9 A;  1WR6 E;  1UWM A;  3RPF C;  2BW2 A;  1TZO A;  2JWZ A;  2LD9 A;  2ZW1 A;  3IAS 1;  2Z0O A;  2BVC A;  2MBQ A;  3CSF A;  4OVV A;  3U30 A;  4XGA B;  3RUL A;  5EE9 A;  4FHJ A;  4JL9 A;  4K3C A;  3E9L A;  2C9W B;  4WWP A;  3ZJU A;  3P7Z A;  2MEK A;  4A3P A;  3H7P B;  3HK0 A;  2KMA A;  1ZP0 B;  4HAY B;  1C3T A;  1SE4 A;  2IGG A;  4CYE A;  3H7P A;  2E2X A;  2KJ6 A;  4JKA A;  4GSW A;  3CF6 E;  2JU6 X;  1WI0 A;  3GE8 C;  1D5Z C;  3AEG B;  1NVI D;  1T0S C;  1HTQ A;  4RM8 A;  1J7A A;  1T0R C;  1SEB D;  1VBG A;  2COF A;  4J3O D;  5J18 A;  2QCZ A;  4KHO A;  2UVM A;  2OED A;  4GMX B;  1WXM A;  1EWY C;  3CMM B;  1VR9 A;  3RCZ A;  1NTV A;  1MIZ B;  4HAZ B;  3OLM D;  2NTT A;  1ZC3 B;  4HPP A;  5AUI A;  1XCG A;  1WJM A;  2FBW B;  4WJQ A;  1M4V A;  1RYJ A;  5D3V A;  4LNF A;  3UIP B;  1S3S G;  1SE9 A;  4D6W A;  3VR8 B;  2L32 A;  2FDQ A;  5BO4 B;  4GZU A;  1Y56 A;  2D11 A;  2DHJ A;  2CQU A;  2N0S B;  3I63 C;  1AQC A;  3F0W A;  2KO3 A;  2K6Q A;  4LNO A;  5BMI A;  3M62 B;  1YX5 B;  1WVH A;  2WXK A;  1K53 A;  3U52 E;  1SXT A;  4LNK A;  4MGY E;  3Q3O C;  4C0A A;  1Y8R C;  1T77 A;  3VUW A;  1WGK A;  4JKE A;  3HRD D;  4RGN A;  1SE2 A;  2J7Q B;  3O13 A;  5AZF A;  2JZP A;  3W9C B;  2YT1 A;  2R09 A;  4EKU A;  1ACA A;  3VQI A;  2AEH A;  5IRS A;  1WIA A;  3ECI A;  4WIP A;  5D3D A;  1TTN A;  2MW5 A;  1XKE A;  1ISN A;  4EZJ A;  1V86 A;  3B08 A;  4MGK E;  1NI3 A;  5D94 A;  3TIX A;  4S0R A;  2W82 A;  4XYC A;  2XK5 B;  3MJW A;  2RNR B;  4ACF A;  3QJZ A;  1YX6 B;  4A90 A;  5LG4 B;  2BYF A;  1GNU A;  3FIL B;  1H10 A;  5BYQ A;  1EU3 A;  2ICI A;  4B0M A;  5D27 A;  2XK5 A;  1SIF A;  4A6F B;  4CHJ A;  3FIL A;  2JY6 A;  3FLV A;  1KRH A;  3QHT A;  4A6Q A;  5LOP B;  1SBB B;  2BKR B;  4A9A A;  3LB8 C;  1V5M A;  4XZ4 A;  3F5R A;  4A6F A;  1TKE A;  2KWD A;  4B6H A;  3Q2A C;  2DA0 A;  2KCJ A;  3VTU A;  4I6P A;  1HTO A;  2PW9 A;  4PYZ A;  4EMO A;  3MFG A;  5D6J B;  2UU7 A;  1K5D B;  2OJW A;  4TQ0 A;  2KWU B;  1WE6 A;  3U7D A;  2V9H A;  2J53 A;  2GCJ A;  4HKZ E;  2WU5 B;  4KV2 A;  3WYF B;  3Q8E A;  1WGU A;  3P4Q B;  1YQ3 B;  2QKL A;  2ZCC A;  1FOE A;  2LRU A;  1ZOY B;  1YOV B;  1M7R A;  1JWA D;  2JRH A;  2WXM A;  2AQ3 B;  3EUB 2;  3OAN A;  3LYY A;  4BBK A;  3HW2 B;  4HWI B;  1QQG A;  4NAW B;  5E6J A;  3NWF A;  2M0X A;  2K2U A;  2LYD A;  1WGQ A;  2N9X A;  2HDE A;  4AJY B;  1IP9 A;  4FBJ B;  3AN1 A;  4NAW A;  4M8M A;  3V60 A;  2LGD A;  2V1Y A;  4KKI A;  4N58 A;  1BTK A;  1HXY D;  2JP2 A;  3A98 B;  1YQ4 B;  2D07 B;  1NEK B;  2KAJ A;  1JQ4 A;  3M3J A;  1ZVR A;  4L1B A;  5LXH A;  3A4S C;  1MHH E;  2N7D A;  3FAH A;  1BWN A;  2NMQ A;  1FD6 A;  1N63 A;  3PT2 B;  1DYQ A;  4R3D A;  1DRO A;  1JRU A;  4P6V F;  2CKH B;  2LFI A;  5E6O A;  1FHX A;  1FNW A;  2CJN A;  3ML8 A;  2AX5 A;  1WM2 A;  1WE7 A;  1HA5 A;  1N5X A;  3APC A;  3IAM 1;  2MSE D;  2KX3 A;  1XD4 A;  4GNK B;  3KUZ A;  3TFM A;  2K5P A;  2IO1 B;  3P1M A;  3KWV A;  2PE9 A;  4DK5 A;  4A20 A;  3IVF A;  4HVB A;  1BUI C;  3ZLZ A;  2IPK D;  1E8X A;  4W9C A;  4HEA 1;  2YSZ A;  1EF5 A;  1NTI A;  3AM9 A;  5E6P A;  2INC C;  2K0P A;  2ROV A;  1WXS A;  3PG7 A;  5HI1 A;  1H8C A;  1XCT L;  3SYX A;  2DKQ A;  1DDM A;  2QJL A;  4D2K A;  4W9I A;  4ZRQ A;  4OSN A;  1QC6 A;  3EFU A;  3QAR A;  2NVU I;  1OQR A;  2UYZ B;  2L52 A;  4IFS A;  2G45 B;  3SD5 A;  3FKY A;  1TY2 A;  1SB3 C;  2Q5W D;  1B55 A;  2COA A;  4NQL B;  2K6D B;  4N59 A;  2K00 A;  2ROZ B;  3RZW C;  4REZ A;  1WJ4 A;  2VRW B;  5J17 A;  2DX5 B;  2KC1 A;  2DYQ A;  2EEL A;  1J0W A;  3QWM A;  1TJ6 A;  3ZTD A;  3AB5 A;  2MBE A;  1FXT B;  1Q1O A;  1ZDX A;  2DX5 A;  2N7E A;  3E56 A;  3AJ4 A;  5EFX A;  3VAW A;  3DDC B;  4ANX A;  2IO2 B;  2A5U A;  3AE4 B;  5BYS A;  5DHA B;  3ODO A;  2AWT A;  2MWS B;  3IG3 A;  3WAN A;  2J59 M;  5HKH A;  3NZU A;  2RGF A;  2ZEQ A;  2GBN A;  4HB3 B;  2HJ1 A;  1XQQ A;  1B9R A;  1DIK A;  3ZYY X;  3PRM B;  2W54 A;  2VH1 A;  1N5W A;  1FXI A;  1KLU D;  4EZL A;  4YTM B;  5BMG A;  1TKG A;  3M1I B;  3W1Y A;  1RRP B;  3VIA A;  1EF1 A;  2YT2 A;  4KKJ A;  1UBI A;  4JKH A;  1AW7 A;  2KTR B;  3Q3J A;  2RRF A;  1WGR A;  2DYB A;  5J3T A;  2PE6 B;  1I4G A;  1V49 A;  2KVZ A;  3P42 A;  2KTR A;  3PTF C;  3BWU D;  3H9D A;  4FJY A;  2HD5 B;  4LJO B;  4YSX B;  1FCL A;  4JKG B;  2W3R A;  3VTW A;  4DBB A;  5IJM A;  3GB1 A;  1Z5S B;  2AL3 A;  2WDT B;  4LK0 M;  2IBI B;  2FCS A;  5J3Y A;  1CMX B;  3QK0 A;  4JKG A;  3MHZ A;  4HK2 A;  4ANU A;  3A8P A;  1WGG A;  3ZO5 B;  1IBX B;  4ICU A;  4N9F 4;  2LXC A;  4N6E B;  4YT0 B;  5J3Q A;  1F1H A;  2IJ0 A;  2ADZ A;  1JRO A;  4PS8 A;  1GOZ A;  1IBX A;  2D3C A;  2YRY A;  1I4R A;  1NDD A;  1E9M A;  5HG2 A;  3U7Z A;  4C00 A;  2AL6 A;  1A5R A;  5D2M B;  4YON A;  3ZGZ A;  1WFY A;  2Y7B A;  2FID A;  5IKC M;  2KAN A;  4S17 A;  3P4R B;  5JHB A;  2K8C A;  3AE3 B;  2JQR B;  3V62 A;  4HAX B;  5EE3 A;  4XWT A;  3DBH I;  4JK7 A;  4K1R B;  3W5V B;  3SUZ A;  1YMH E;  1TQZ A;  4KZ0 A;  2INN E;  2KDE B;  2M8S A;  1SJH D;  3PGE A;  2RQ1 A;  3Q8B A;  2MFQ A;  3A33 B;  1JW9 D;  2CY5 A;  4WJO A;  1X1G A;  3ZVV A;  1OQN A;  5G2N A;  1P9D U;  4TQ1 A;  3RT3 B;  3ZDT A;  2MBB B;  2GLS A;  3Q8F A;  4MSQ B;  1BML C;  3ULB A;  2PVO D;  5C16 A;  3T06 A;  1HB8 A;  1X11 A;  3HIE A;  5L95 C;  3A4R A;  5C5B B;  1V1P A;  2QEJ C;  2XBB C;  5JHA A;  2D5G A;  1V5U A;  2LGY A;  5C5B A;  4HAV B;  3TMP B;  3EA6 A;  4RFB A;  5HE3 A;  4YTN B;  1T0Y A;  1XT9 B;  2J42 A;  2KDI A;  2A4Z A;  3ZNI D;  2Z59 B;  4HDQ A;  2NBU A;  1GJZ A;  2LGX A;  1SJE D;  4Z2M B;  3I3T B;  1HQR D;  4W9H A;  1J8C A;  1UGJ A;  3AI5 A;  1ZSQ A;  1M7E A;  2Z59 A;  4JGH B;  4US9 A;  4JWS C;  4XWX A;  2JT4 B;  2YEP F;  3BK2 A;  3N9Y C;  2HRJ A;  2PZ1 A;  4XDD A;  1Q10 A;  2LUL A;  1X1F A;  2M38 A;  2LGI A;  1FB8 A;  1PGB A;  1F2R I;  2FUG 1;  4HLE A;  3AU4 A;  1BTN A;  1TS2 A;  5LON B;  1IGD A;  2LXA A;  3V61 A;  1KJT A;  4MDK E;  1J7B A;  2CRF A;  4KGS A;  2K3U A;  2BS2 B;  4KGR A;  4HPL B;  3IT6 B;  3DCX A;  4QXA B;  3WAM A;  4YSY B;  2JWU A;  4BFR A;  2OQB A;  5JP4 A;  4NAM A;  3VVW B;  4HKQ A;  2MJD A;  3B1L X;  3LDZ E;  4AUQ C;  4XWW A;  1QKZ A;  2LJI A;  2INP E;  1EO6 A;  4XDC A;  1FIQ A;  4OW0 A;  2L05 A;  2Y3A A;  3ZIM A;  1UWX A;  3ZNZ B;  2R61 A;  1L4Z B;  1XLP A;  1D3Z A;  3NSU A;  5KQ1 A;  1FO4 A;  2NR2 A;  3EGR A;  2MA9 B;  3L16 A;  1AN8 A;  2KVR A;  2RDB C;  1NYQ A;  1T5X D;  1IUE A;  3PLU A;  1MVK A;  2MQJ A;  3QX1 A;  3GOE A;  2PKO A;  1JWU D;  2Z0D B;  1L0X B;  2M4N A;  3L13 A;  5AUK A;  3NW8 A;  4NNJ B;  3E9O A;  2NCN A;  1MK7 B;  1IPG A;  2R2Q A;  5DPW A;  1FRR A;  3R66 C;  4DQO C;  5HHD G;  2GUM A;  5G5H A;  4K81 A;  2R2Y A;  1WRI A;  3PZ8 A;  3R3M A;  4BVU C;  5CLL B;  4PNK A;  4AJW A;  1YNT E;  3AH7 A;  4MY6 A;  2OHF A;  2GI9 A;  3G9W A;  4QJ5 B;  4BKT A;  3T8M A;  4HCN B;  1P3Q U;  3VH3 B;  1CJE A;  2BQQ A;  1E6E B;  4CHM A;  4QJ3 B;  3O96 A;  2V76 A;  3L10 B;  2Z8L A;  1I4H A;  1A70 A;  2R82 A;  3V5W A;  2I38 A;  4HJG E;  2LGS A;  3OG5 A;  1W1H A;  3DBL I;  4YL8 A;  1L2N A;  1UEL A;  4H2A A;  1YIW A;  3RFZ B;  4P16 A;  2CS4 A;  1HBK A;  3NOB A;  1MI0 A;  4WAA A;  4DDI D;  1OTR B;  3DHG C;  4BKG A;  4BKS A;  2MP2 B;  5JLJ B;  5FI0 A;  3ZVR A;  5DHF B;  1FRD A;  3C0R B;  4GDK B;  2WLB A;  2MP2 A;  1WM3 A;  3WCQ A;  3VHT C;  3TEY A;  1V80 A;  1K50 A;  4GDK A;  4M8N A;  4JKB A;  4F1S A;  2COP A;  4HAT B;  5G55 A;  2L8J A;  1MFW A;  3H1U A;  4RCO A;  2N9K A;  3GYO A;  4Z2N A;  5D3W A;  2CHZ A;  1NBF C;  2DKP A;  1Q0W B;  2BWF A;  1VBH A;  2L1C A;  4RMA A;  3PRE A;  3A8Q A;  3Q3F A;  2KN5 A;  2KAC A;  3BIN A;  5IN7 A;  4ARC A;  3ZXV A;  3QWZ B;  4WJP A;  1LW3 A;  3DVG X;  2L7R A;  2ASQ A;  3MJ5 A;  2FJL A;  2KHW B;  3URY A;  1ZDV A;  4BOZ B;  1QT9 A;  3CXB B;  2DYM A;  4GOU A;  3FM8 C;  3HHM A;  2IO3 B;  2WWZ A;  2K49 A;  2LVP A;  1K8R B;  4BKS D;  1DOY A;  5IP4 D;  4M02 A;  5L81 A;  4RM9 A;  1WX8 A;  2N1W A;  3AV8 A;  4TMA B;  5LXI B;  1JWS D;  4YXD B;  2FIF A;  4TV3 A;  4DX8 A;  3PHX B;  1TS3 A;  2RSG A;  1U2B A;  2HTH B;  1JWM D;  1I4X A;  5JVL A;  5FI1 A;  3KVF B;  4JK8 A;  5HFY A;  2WXN A;  2HTH A;  5C23 A;  2PLP A;  2PVG C;  1TS4 A;  4IWQ A;  2EMS A;  1WGY A;  1NI2 A;  2QKM A;  1YN5 A;  5GXG B;  3KW5 B;  1GG3 A;  3ONS A;  4MAC A;  3KRX A;  4AQ7 A;  3IHP C;  5D3X A;  2DNF A;  2KFJ A;  2V3N A;  2RVB B;  3IT4 B;  4ILG B;  1P6S A;  3TEX A;  1YJI A;  2FCM A;  1LXD A;  3Q6B A;  2DFK A;  4P1B C;  4EEW A;  3RI7 C;  1V89 A;  2KWC A;  4BAX A;  3RZF A;  4HXD A;  3H8H A;  2C5L C;  2N4F A;  4II2 B;  4CO7 A;  4ILJ A;  3UGB B;  1R4N B;  2V4L A;  2BBC A;  4HPM B;  1I7H A;  1UD7 A;  2PTL A;  2JYT A;  3QBV B;  4QAY A;  1AAR A;  2MJE A;  3UI3 A;  3IBE A;  3WAP A;  4RNA A;  2KJR A;  4OT1 A;  2PIA A;  2KJH B;  3D32 A;  3OJ4 B;  1G6J A;  2VKI A;  3TW1 A;  2J0J A;  2HE7 A;  3L0W B;  3MP9 A;  4HJK A;  1SHC A;  2M0A A;  3JVZ X;  4I6N B;  4FHK A;  4DDG D;  2RMM A;  2WDR B;  4G3X B;  4DHJ B;  2YF0 A;  2RDH A;  5CX3 A;  3SU8 X;  4ARI A;  5C3J B;  2JXT A;  4URK A;  4HRO A;  1MKE A;  4PT5 A;  2LAS A;  3VRA B;  1PDX A;  1T6B X;  2NBW B;  2FJU B;  4TYZ A;  1WXV A;  2VSZ A;  2H88 B;  4FN2 A;  5JZE B;  4BBN F;  3B77 A;  4HB2 B;  3QCA A;  3A1Q B;  5IA7 A;  2V3S A;  3AE9 B;  3PP2 A;  2DBY A;  4LCD E;  3NZ3 A;  1C76 A;  1KOT A;  2NZ8 B;  2NMB A;  3BII D;  1C1Y B;  3A1Q A;  2MKR A;  1IGC A;  2QDF A;  1WXA A;  3PRZ A;  1MIX A;  4GOC A;  3W5U B;  2DLB A;  2CJO A;  1MHX A;  3BY4 B;  3ODW A;  3EHV A;  1XF5 L;  3P2B A;  2H7E A;  3VRB B;  3PEG A;  3MDB C;  4RGM A;  2P0D A;  1OQY A;  3UZT A;  1ET6 A;  2QC8 A;  3ZXR A;  3DOW A;  1EVH A;  2NTS A;  1V8C A;  2BPS A;  2WXG A;  5KQ4 A;  2QIE B;  4NQK E;  3U4E G;  1V5P A;  3M95 A;  2KLC A;  2KT7 A;  4P7I A;  1I4Q A;  1P1A A;  2ZPY A;  2D9Z A;  3VH4 B;  4DHJ D;  3D8E A;  4KHA A;  2FNJ B;  1U5D A;  3OHM B;  5CHV C;  3VFK A;  3SEB A;  1L4D B;  2AQ1 B;  1F52 A;  2KMC A;  3P4P B;  2RSU A;  5E6N A;  3SBG A;  3KSY A;  2W2X C;  4GGQ A;  2RUK B;  3ALB A;  3NS8 A;  4GXB A;  2WH5 A;  3R2T A;  1PGX A;  1P7E A;  3TJP A;  2N9P C;  3NZS A;  2DHZ A;  3AED B;  3D8D A;  1AWD A;  1HEZ E;  1N3H A;  2DAJ A;  1E10 A;  2NS5 A;  4JKC A;  1J7C A;  2CU3 A;  4C4V B;  2KXJ A;  2KGX B;  1VJK A;  1CK1 A;  3VTV A;  1MJD A;  2KNB A;  1W1D A;  5CHW A;  2WU2 B;  4NJC A;  1E7V A;  1CZP A;  1YJ1 A;  4C4V A;  1ZE3 D;  3WIM A;  1L0V B;  3N1Z C;  1WH3 A;  2KDB A;  1BXT A;  3Q8A A;  1U4A A;  3NVW A;  5FR6 A;  2WX0 A;  1V6E A;  1NTY A;  2EC1 A;  5D3Y A;  1TZ1 A;  3RYT A;  3AUL A;  3ZKJ C;  2XNA C;  2DHK A;  2LKO A;  2QMT A;  4HB4 B;  1UF0 A;  3LJ3 A;  2MX2 A;  3MTN B;  3KYD D;  4OZA A;  1WJ1 A;  1R4N I;  5FR3 A;  4MJS B;  3X23 A;  5JH5 C;  3TBL D;  4KX6 B;  1I7A A;  1IYF A;  5M4Y B;  5KCV A;  4MJS A;  3SV1 A;  3Q3M C;  4EJN A;  1UNS A;  4B9K A;  2IFS A;  4MH8 A;  5H8Y E;  1KZ7 A;  2DN6 A;  2DYO A;  2COD A;  2LUM A;  4FA6 A;  4F7U P;  2QHO A;  3Q69 A;  4WWO A;  3CIR B;  1XOD A;  2DHI A;  1FCC C;  4MM3 B;  2BT6 A;  1TBE A;  4AWJ A;  2M1M A;  3N30 A;  4RH6 A;  2ONQ A;  1E7P B;  4MM3 A;  4ANW A;  1MPE A;  1E0Z A;  1EGX A;  4MGZ E;  2FCN A;  1WGH A;  1E8Y A;  1XX0 A;  1ZW7 A;  5DIF B;  2GBJ A;  3V3X A;  4FAD A;  4MT7 A;  4JWU C;  4LNI A;  4E71 A;  3S2A A;  4GIV A;  3ZJT A;  1KZG A;  2K8H A;  2FCQ A;  4C7Y A;  2W55 A;  1I4P A;  4EFO A;  1E7U A;  5EDS A;  2WXP A;  1UZX B;  5GOW B;  2WXI A;  3NS1 A;  3FP5 A;  5C1Z A;  2J52 A;  1EWC A;  4L1R A;  1GAQ B;  3QQ8 B;  2P8V A;  2JYE A;  4ZRP A;  2GJY A;  4DWF A;  1RFK A;  2Z14 A;  1D4B A;  3AE1 B;  2EKI A;  2V0G A;  3GYP A;  1V5T A;  3PPA A;  3ML9 A;  3I9V 1;  4YSZ B;  1NYR A;  1J19 A;  1XLQ A;  5LLI A;  1AWE A;  4DBG A;  1XXG A;  3LXF A;  4L23 A;  1NVL A;  4K7W A;  2BB5 A;  2K1F A;  3ZNH B;  1ZC4 B;  4WSF A;  2WDQ B;  1MAI A;  2RLO A;  4K3B A;  1C4C A;  2KD0 A;  4UDU C;  1WF9 A;  4M00 A;  4OHJ A;  3N7C A;  2Y5B B;  2M56 B;  1WX9 A;  1ESF A;  1P0R A;  3SDL C;  2DEN B;  3TEW A;  2MRP A;  2YLM A;  3JW0 X;  4LJP B;  1UEF A;  2J4X A;  2K9X A;  4PYU A;  3TUO A;  2BCJ A;  1T0Q C;  3GZN B;  3L08 A;  4WWM A;  1OEY J;  1LGR A;  1AYF A;  4RGT A;  4W9D A;  2BYE A;  4WVF B;  1JCK B;  3C8Y A;  4L6E A;  4KDI C;  4DXF A;  1LO5 D;  1VZ6 A;  1TIF A;  3Q3N C;  4B6W A;  3I5J C;  3H7S A;  2GOW A;  3C19 A;  3RNF C;  4Q2J A;  3PSE B;  1WJU A;  3ZUN A;  1OGW A;  5JHG A;  2W2W A;  2JZZ A;  3TVV A;  1R7S A;  4YTP B;  2RPV A;  1T3Q A;  2G4D B;  3J9C A;  3PZD A;  3AE6 B;  3CST A;  1F0Z A;  1S1Q B;  4KGT A;  1PFD A;  2Q13 A;  1DDV A;  1FGZ A;  1F9J A;  2E6X A;  5FK9 C;  5DPS A;  4RF1 A;  2DZI A;  4IM0 A;  1TYG B;  3ML4 A;  3RMK C;  1KH0 A;  1MK9 B;  2D9W A;  4BOS C;  2WHI A;  4K7U A;  1FHW A;  1C4A A;  2PJH A;  3DVG Y;  3KYC D;  1FFU A;  2IYB A;  1WXQ A;  4EOY A;  2KYW A;  4W9J A;  5HE2 A;  2KN4 A;  4C80 A;  1RRB A;  2Z0E B;  1ET9 A;  1ZKH A;  1GGO A;  1LFD A;  3PO0 A;  3CIK A;  2Y5P A;  2WYQ A;  1JWB D;  1HZ6 A;  1Z2M A;  2DYN A;  4K2P A;  3PVL A;  4Y94 A;  1WZ3 A;  5GMV A;  2X8X X;  3ETR A;  4DX9 0;  4WJN A;  4E74 A;  2D3B A;  3X0W A;  1VDV A;  2YS1 A;  1U5F A;  2DZJ A;  2GS0 A;  2IND C;  2Z13 A;  4IAP A;  3AMZ A;  1C9F A;  2L76 A;  4DHZ E;  1X1M A;  2LZ6 A;  3AE5 B;  4WWN A;  3TCA A;  4GDL B;  2TSS A;  1FFV A;  1OFF A;  4IOY X;  2JPH A;  1UNR A;  1WY8 A;  1WJN A;  2KMM A;  3T9L A;  4NY0 A;  2H89 B;  2Z0Q A;  4GDL A;  5IO9 A;  3TEZ A;  2K8B A;  3RNG C;  2BYT A;  2RGN B;  4PS7 A;  4A55 A;  1WRD B;  2ZW0 A;  1JDE A;  2D9Y A;  3L4P A;  3NVZ A;  2O2V B;  5J2R A;  1DOI A;  1QIL A;  2O2V A;  2LUE A;  3GE3 C;  2KQ4 X;  3DWM A;  4MT5 A;  2J0M A;  4ASW C;  2GRI A;  3U8Z A;  2IYD B;  1BAK A;  3ENE A;  4K7S A;  3HIZ A;  4MSM B;  4WQM A;  4IM2 A;  2Z4D A;  3SBT A;  4MEL A;  2WXR A;  5KHO A;  2J0K A;  1VD2 A;  1PGA A;  1ROE A;  2W3S A;  2LVO A;  4G50 A;  1LB1 A;  4WQO B;  3TO1 A;  2I5C A;  2B3A A;  3QIJ A;  1K52 A;  1ZXI A;  4ZYS A;  4KHB B;  5BYR A;  1J0G A;  1C78 A;  2UZS A;  2IO0 B;  3B2G A;  1Q67 A;  3A9K B;  2H7D A;  3GZN I;  4KHB A;  3ZNG C;  1P98 A;  2WS3 B;  1V97 A;  3FSS A;  3AU5 A;  3NUH B;  4C7Z A;  3O65 B;  3HUI A;  4G0N B;  3B0A A;  1XR0 B;  2MDX A;  1KBL A;  1GC6 A;  4JX1 C;  3N32 A;  2C7H A;  1KFY B;  3NWD A;  2KOX A;  5C2T B;  3R8B A;  2BF8 B;  4A3O A;  2GCL A;  2MCN B;  4J6I A;  1V61 A;  2ZNV C;  2MBO A;  2M14 A;  1ENF A;  3N20 C;  1IRS A;  4BBN C;  5DCN A;  1OQQ A;  2D4Q A;  2WXJ A;  1Y19 B;  4FUL A;  4GLS C;  3B9J A;  5L83 A;  4CSQ A;  3SR6 A;  2CR5 A;  1QQR A;  4XC2 A;  3HM3 A;  4OVU A;  2ELB A;  2ABD A;  3IFW B;  3AEB B;  1RWS A;  1P7F A;  4W9L A;  4XE0 A;  2LHD A;  4USA A;  4ANV A;  1DGJ A;  3N1X C;  4PQ0 A;  3AXC A;  4AOF A;  2X18 A;  3DCG A;  1GC7 A;  3RN9 C;  1U5E A;  2C60 A;  4ZRJ A;  5CTR C;  2BWE S;  4EE2 A;  2QIL A;  2ZJD A;  4LLG M;  3P63 A;  3A9J B;  3UIN B;  4KDL B;  3E9P A;  2GBR A;  4FLH A;  1ZUD 2;  1KM7 A;  5HE0 A;  1D5M C;  2CY4 A;  4XX5 A;  4WJ7 A;  2KZR A;  3A9J A;  2HTM E;  1ZPS A;  3L54 A;  1D5X C;  3NWA A;  2W2X D;  3AE2 B;  2FE8 A;  2V3P A;  1ST7 A;  5D3I B;  2IGH A;  2KC2 A;  5TSS A;  3K9P B;  1TXD A;  1UPQ A;  1L7Y A;  3NVY A;  3GS2 A;  3ZJV A;  2KKC A;  2E3T A;  4W9K A;  4BZA A;  1C79 A;  3ZTC A;  2PPH A;  2YEP B;  1GPX A;  2BGF A;  1PUT A;  2VRR B;  2WXF A;  2N23 A;  1SF0 A;  1L6U A;  3PV1 A;  1KI1 B;  1Z87 A;  2EKE C;  5FKA C;  1FNV A;  5JHH A;  1DBH A;  3WAL A;  3PRP B;  1K51 A;  2Y8G A;  2SAK A;  3V6C B;  4JIO U;  1GUA B;  1I35 A;  2K22 A;  1GB1 A;  1EM7 A;  4G11 A;  2MBH A;  3APD A;  1VZ7 A;  2RR9 A;  5HE1 A;  3EFC A;  3KZ1 A;  1BT0 A;  1LM8 B;  2G3Q B;  3AEE B;  1OEY A;  4ICV A;  5DPR A;  3NJT A;  1FHO A;  2AQ2 B;  3I57 A;  1FPY A;  3NVV A;  3B2F A;  4IM3 A;  2NBV B;  3PZ7 A;  3P6A A;  3N1Y C;  5MPO A;  1TY0 A;  5EE1 A;  1M94 A;  4GMV A;  1SGH A;  2DZM A;  1WJ6 A;  3DQV A;  2NBV A;  3W1S A;  3OAW A;  2KUQ A;  4RGO S;  2DWQ A;  2JSV X;  3KY9 A;  2PMV A;  2W9N A;  2X38 A;  2BS4 B;  1YJJ A;  4TUU A;  1DDW A;  2BS3 B;  4IOI E;  3M63 B;  1WYG A;  3RNE C;  1VCB A;  4LDT B;  4AS1 A;  5C6R A;  2WXL A;  1JML A;  1HZ5 A;  3DBR B;  1F77 A;  3ZW3 A;  3RD2 A;  3SO6 A;  1FEH A;  2NPT B;  1SE3 A;  1Q5W B;  1U29 A;  2IZV B;  1H4R A;  2UZR A;  4HCP B;  2MHJ A;  2KWV B;  2NPT A;  2BTE A;  2BKF A;  5LNK 1;  1V9J A;  2D2Q A;  1UNQ A;  2WNM A;  1SSN A;  4ILH A;  2N0Y A;  2G1E A;  5IOI A;  4D0N B;  1FXA A;  3ZQ4 A;  4A5K A;  3AEC B;  2OTX A;  1YN4 A;  4DXG A;  4US8 A;  1EAZ A;  3T3O A;  4HAU B;  4P1C C;  1WYW B;  2KDM A;  5CLQ B;  2RPQ A;  4PK1 A;  2RDG A;  2LG1 A;  1ZYI A;  1MG8 A;  2AYO B;  1R4M B;  4NJ6 A;  2ZKM X;  2VH2 A;  2KTF A;  2ZZP B;  4KSL C;  1WI1 A;  4A6K A;  3SNH A;  1NEN B;  3R7R A;  1EU4 A;  2V4I B;  4RF0 A;  4ZOH C;  2D9V A;  1FNU A;  3PLV A;  3PVU A;  2LMC A;  4LDT D;  4ZDV A;  1MI1 A;  4KSK C;  1WX7 A;  4I6L B;  3VR9 B;  4F8C B;  2CU1 A;  3BJI A;  2MH7 A;  2LBB A;  3FVC A;  2DX1 A;  2BYV E;  1Y5O A;  2D3G A;  2G9H D;  4ZHO A;  3DVN V;  1D6E C;  1KTK A;  2K8E A;  4JKF A;  5T8I A;  2K2J A;  1WSP A;  1XCQ L;  3DPD A;  1UUP A;  1L6V A;  2KQ7 A;  2N9E B;  3MHS D;  5C79 A;  4IUM B;  2WGS A;  3DBH B;  3QC8 B;  2K39 A;  2LRW A;  2N9L A;  4CQN A;  4F7G A;  4IKG A;  1TJE A;  2KFK B;  3KUD B;  1N62 A;  2YS5 A;  1N6Z A;  1FM0 D;  2KUP A;  3TL5 A;  4FJZ A;  2CHW A;  2KFK A;  4W9E A;  2ELA A;  4HDO A;  1E90 A;  1QLB B;  1X86 A;  1VLB A;  2VZK B;  4X57 B;  2GB1 A;  2OOB B;  1CQV A;  5CHF A;  2KIE A;  1UGM A;  2LEK A;  1YN3 A;  3BVM A;  5I2S A;  2N1V A;  4WAF A;  1C4P A;  3RNC C;  4QJ4 B;  3DWG C;  1SIJ A;  1XO3 A;  3KRW A;  5TR5 A;  3DXE A;  4KAX B;  4OVZ A;  1E8Z A;  3V05 A;  3L17 A;  4K17 A;  5G5G A;  2PEA A;  1TS5 A;  2WP9 B;  3QA8 A;  1HE8 A;  1UH6 A;  1U27 A;  2GBM A;  2XEW A;  2YS3 A;  2JZ3 B;  2CB8 A;  4LNN A;  2K25 A;  3JYU A;  3CWI A;  2I1K A;  2I5F A;  2WX1 A;  5H92 C;  1WG7 A;  2LOZ A;  1ACC A;  1WZ0 A;  4WH4 A;  2MWN B;  5BMH A;  1FMA D;  2JF5 A;  3DBS A;  1KF6 B;  3BK1 A;  3PVW A;  4MK0 A;  1RAX A;  4IW0 A;  1V81 A;  2L2I A;  4KZC A;  1EUV B;  1RFA A;  4DHZ B;  2UWQ A;  1KLV A;  4GB9 A;  1MG4 A;  4F7H A;  3DBR I;  4FJV B;  3NRZ A;  3WA0 A;  2JUO A;  1QOF A;  3OWE B;  4C56 C;  4WUR A;  3BVG A;  2MJ3 A;  1UPR A;  2ACZ B;  4LTU A;  4DXA B;  2M17 A;  3MPX A;  2SEB D;  2KQS A;  2L83 A;  5D7G A;  1OMW A;  1DYN A;  4HHV A;  1FAO A;  2LJ5 A;  2G35 A;  2VZK D; 
#chains in the Genus database with same CATH homology
 3RUI B;  4B95 A;  3UIO B;  3DXC A;  3VOQ A;  2YT0 A;  3D8F A;  3W1S C;  4HAW B;  2CAY A;  3N3K B;  1U5G A;  2JXX A;  3KUC B;  2Z0P A;  4ZYN A;  2C7N B;  2ZNV B;  2I1J A;  4CHK A;  1R4M I;  4A6H A;  2OJR A;  4MH0 E;  4H8S A;  2FJ9 A;  5AZG A;  2L0F A;  4NSW A;  1I42 A;  3LJU X;  1ZM0 A;  1UNP A;  3SHQ A;  1K5G B;  3KH0 A;  3K9O B;  4GN1 A;  3JSV B;  1MPH A;  4F7Z A;  3UQA A;  1X05 A;  3JSV A;  4JQW C;  3HM6 X;  2CHX A;  2COC A;  1LQB A;  4NJ7 A;  4HB0 B;  4II3 B;  4KIK B;  2L3Z A;  1HB6 A;  3EC8 A;  1KC7 A;  1P3R A;  2R0D A;  1P5T A;  3PHW B;  4KIK A;  2ZVN A;  5AZH A;  4EUT A;  3NY5 A;  2GBK A;  2IY1 B;  3UF8 A;  2FUH B;  3ZDM C;  4ZRK A;  2D9X A;  3VXW A;  2ZPN A;  3EPY A;  5AEK B;  1V5O A;  1E8W A;  2L0T A;  1W1G A;  3ULC A;  4E3C A;  2YVC A;  2EJ8 A;  4NPN A;  3ODX A;  3APF A;  4IG7 B;  2MLB A;  2FAZ A;  3V6E B;  2DLW A;  3OJ3 A;  1PMS A;  2REX A;  4K2O A;  2G4S A;  2IY0 B;  4W9G A;  4ZRI A;  2KDF B;  2HJ8 A;  2EMT A;  4JK9 A;  1RJ2 A;  1PLS A;  3EEC A;  1QZE A;  4M0W B;  3HQC A;  3VUY A;  2C7M B;  3NHE B;  2LWP A;  1ZGU B;  2LI5 A;  4W9F A;  1XD3 B;  2LOX A;  2O6V B;  1RLF A;  1NU2 A;  3R7Q A;  3ZRF A;  5KHQ A;  2L00 B;  1WR1 A;  1YQB A;  2O6V A;  4MEM A;  2JRI B;  3FEH A;  3WAO A;  1WGD A;  2XQN M;  2GMI C;  4KVG B;  4AP4 C;  2X0S A;  3PS6 A;  1E5W A;  3H6N A;  4IWP A;  5DPT A;  3RCP A;  2DZK A;  3ZRC A;  2JVC A;  2R2O A;  2KK8 A;  3VUX A;  3QAQ A;  1WMH B;  2ZVO A;  2KX0 A;  2LVQ A;  1OY2 A;  2ZCB A;  5DI9 B;  1I2H A;  1WMH A;  3DVN U;  2DAF A;  2P0F A;  4PS3 A;  4JLC A;  4EZK A;  4JKD A;  4IWO A;  2Y8F A;  1V2Y A;  4TKN A;  1V88 A;  3ENB A;  4MGI E;  3A9K A;  2DTC A;  2O6V D;  2RD0 A;  3DXD A;  3E66 A;  1TGZ B;  2P0H A;  1YD8 U;  2DIK A;  5DH9 B;  3PSC A;  1PFJ A;  4GPT B;  2KLG A;  5IAA C;  1PQS A;  2D10 A;  4IC7 B;  4GU2 A;  1FGY A;  3VDZ A;  3UQB A;  1UBQ A;  1WR6 E;  2JWZ A;  2LD9 A;  2Z0O A;  2MBQ A;  3CSF A;  4OVV A;  3U30 A;  3RUL A;  4FHJ A;  4JL9 A;  3E9L A;  2C9W B;  4WWP A;  3P7Z A;  4A3P A;  3H7P B;  3HK0 A;  2KMA A;  4HAY B;  1C3T A;  4CYE A;  3H7P A;  2E2X A;  2KJ6 A;  4JKA A;  4GSW A;  3CF6 E;  1WI0 A;  4RM8 A;  1VBG A;  2COF A;  5J18 A;  4KHO A;  2UVM A;  4GMX B;  1WXM A;  3CMM B;  3RCZ A;  1NTV A;  1MIZ B;  4HAZ B;  3OLM D;  1ZC3 B;  1XCG A;  1WJM A;  4WJQ A;  5D3V A;  3UIP B;  1S3S G;  1SE9 A;  2FDQ A;  5BO4 B;  4GZU A;  2D11 A;  2DHJ A;  2CQU A;  1AQC A;  3F0W A;  2KO3 A;  2K6Q A;  3M62 B;  1YX5 B;  1WVH A;  4MGY E;  4C0A A;  1Y8R C;  3VUW A;  4JKE A;  2J7Q B;  5AZF A;  2YT1 A;  2R09 A;  4EKU A;  1ACA A;  3VQI A;  2AEH A;  1WIA A;  3ECI A;  1TTN A;  2MW5 A;  1XKE A;  1ISN A;  4EZJ A;  1V86 A;  3B08 A;  4MGK E;  5D94 A;  3TIX A;  2XK5 B;  3MJW A;  2RNR B;  3QJZ A;  1YX6 B;  2BYF A;  1GNU A;  1H10 A;  5D27 A;  2XK5 A;  1SIF A;  4A6F B;  4CHJ A;  2JY6 A;  3FLV A;  3QHT A;  5LOP B;  2BKR B;  1V5M A;  4XZ4 A;  3F5R A;  4A6F A;  4B6H A;  2DA0 A;  2KCJ A;  3VTU A;  4I6P A;  4PYZ A;  4EMO A;  5D6J B;  1K5D B;  4TQ0 A;  2KWU B;  1WE6 A;  3U7D A;  2GCJ A;  4KV2 A;  3WYF B;  1WGU A;  2QKL A;  2ZCC A;  1FOE A;  2LRU A;  1M7R A;  2JRH A;  3OAN A;  4BBK A;  3HW2 B;  4HWI B;  1QQG A;  4NAW B;  2M0X A;  2K2U A;  2LYD A;  1WGQ A;  2N9X A;  4AJY B;  1IP9 A;  4FBJ B;  4NAW A;  4M8M A;  3V60 A;  2LGD A;  2V1Y A;  1BTK A;  2JP2 A;  3A98 B;  2D07 B;  3M3J A;  1ZVR A;  5LXH A;  3A4S C;  2N7D A;  1BWN A;  3PT2 B;  1DRO A;  1JRU A;  2CKH B;  5E6O A;  1FHX A;  3ML8 A;  1WM2 A;  1WE7 A;  3APC A;  2MSE D;  2KX3 A;  1XD4 A;  3KUZ A;  3TFM A;  2IO1 B;  2PE9 A;  4DK5 A;  4A20 A;  3IVF A;  4HVB A;  3ZLZ A;  1E8X A;  4W9C A;  2YSZ A;  1EF5 A;  1NTI A;  5E6P A;  2ROV A;  1WXS A;  3PG7 A;  1H8C A;  3SYX A;  2DKQ A;  1DDM A;  4W9I A;  1QC6 A;  3EFU A;  3QAR A;  2NVU I;  2UYZ B;  4IFS A;  2G45 B;  3SD5 A;  1B55 A;  2COA A;  4NQL B;  2K6D B;  2K00 A;  2ROZ B;  3RZW C;  1WJ4 A;  2VRW B;  5J17 A;  2DX5 B;  2KC1 A;  2DYQ A;  1J0W A;  3QWM A;  1TJ6 A;  3ZTD A;  2MBE A;  1FXT B;  1Q1O A;  2DX5 A;  2N7E A;  3AJ4 A;  5EFX A;  3VAW A;  3DDC B;  4ANX A;  2IO2 B;  2A5U A;  5DHA B;  3ODO A;  2AWT A;  2MWS B;  3IG3 A;  3WAN A;  2J59 M;  5HKH A;  3NZU A;  2RGF A;  2ZEQ A;  2GBN A;  4HB3 B;  1XQQ A;  1DIK A;  3PRM B;  4EZL A;  3W1Y A;  3M1I B;  1RRP B;  3VIA A;  1EF1 A;  1UBI A;  4JKH A;  2KTR B;  3Q3J A;  1WGR A;  2DYB A;  5J3T A;  2PE6 B;  1V49 A;  2KTR A;  3PTF C;  3H9D A;  4FJY A;  2HD5 B;  4LJO B;  4JKG B;  3VTW A;  4DBB A;  5IJM A;  1Z5S B;  2AL3 A;  2WDT B;  2IBI B;  2FCS A;  5J3Y A;  1CMX B;  3QK0 A;  4JKG A;  4HK2 A;  4ANU A;  3A8P A;  1WGG A;  3ZO5 B;  4ICU A;  4N9F 4;  2LXC A;  5J3Q A;  2ADZ A;  4PS8 A;  2YRY A;  1NDD A;  2AL6 A;  1A5R A;  5D2M B;  4YON A;  1WFY A;  2Y7B A;  2FID A;  2KAN A;  5JHB A;  2K8C A;  3V62 A;  4HAX B;  3DBH I;  4JK7 A;  4K1R B;  3SUZ A;  1TQZ A;  4KZ0 A;  2KDE B;  2M8S A;  3PGE A;  2RQ1 A;  2MFQ A;  3A33 B;  2CY5 A;  4WJO A;  1X1G A;  3ZVV A;  1OQN A;  5G2N A;  1P9D U;  4TQ1 A;  3RT3 B;  3ZDT A;  2MBB B;  4MSQ B;  3ULB A;  5C16 A;  3T06 A;  1HB8 A;  1X11 A;  5L95 C;  3A4R A;  5C5B B;  2XBB C;  5JHA A;  1V5U A;  2LGY A;  5C5B A;  4HAV B;  3TMP B;  5HE3 A;  1T0Y A;  1XT9 B;  2KDI A;  2A4Z A;  3ZNI D;  2Z59 B;  4HDQ A;  2NBU A;  1GJZ A;  2LGX A;  4Z2M B;  3I3T B;  4W9H A;  1J8C A;  3AI5 A;  1ZSQ A;  1M7E A;  4JGH B;  4XWX A;  2JT4 B;  2HRJ A;  2PZ1 A;  2LUL A;  1X1F A;  2M38 A;  1FB8 A;  4HLE A;  3AU4 A;  1BTN A;  2LXA A;  5LON B;  3V61 A;  1KJT A;  4MDK E;  2CRF A;  4HPL B;  3WAM A;  4BFR A;  2OQB A;  5JP4 A;  3VVW B;  3B1L X;  3LDZ E;  4AUQ C;  1EO6 A;  2L05 A;  3ZIM A;  3ZNZ B;  1D3Z A;  3NSU A;  5KQ1 A;  2NR2 A;  2MA9 B;  3L16 A;  2KVR A;  3PLU A;  3QX1 A;  2MQJ A;  3GOE A;  2Z0D B;  2M4N A;  3L13 A;  4NNJ B;  3E9O A;  2NCN A;  1MK7 B;  1IPG A;  2R2Q A;  5DPW A;  3R66 C;  4K81 A;  3R3M A;  4BVU C;  5CLL B;  4PNK A;  4AJW A;  4MY6 A;  3G9W A;  4BKT A;  3T8M A;  4HCN B;  1P3Q U;  3VH3 B;  4CHM A;  3O96 A;  2V76 A;  3L10 B;  2R82 A;  3V5W A;  1W1H A;  3DBL I;  4YL8 A;  1L2N A;  1UEL A;  1YIW A;  2CS4 A;  1HBK A;  3NOB A;  4WAA A;  4DDI D;  1OTR B;  4BKG A;  4BKS A;  2MP2 B;  5JLJ B;  5FI0 A;  3ZVR A;  5DHF B;  3C0R B;  4GDK B;  2MP2 A;  1WM3 A;  3VHT C;  1V80 A;  4GDK A;  4M8N A;  4JKB A;  4F1S A;  2COP A;  4HAT B;  5G55 A;  2L8J A;  3H1U A;  3GYO A;  4Z2N A;  5D3W A;  2CHZ A;  1NBF C;  2DKP A;  1Q0W B;  2BWF A;  1VBH A;  2L1C A;  4RMA A;  3PRE A;  3A8Q A;  3Q3F A;  2KN5 A;  3BIN A;  3QWZ B;  4WJP A;  1LW3 A;  3DVG X;  2L7R A;  2ASQ A;  2FJL A;  2KHW B;  4BOZ B;  3CXB B;  2DYM A;  3FM8 C;  3HHM A;  2IO3 B;  2WWZ A;  2LVP A;  1K8R B;  4BKS D;  5L81 A;  4RM9 A;  1WX8 A;  2N1W A;  5LXI B;  2FIF A;  4TV3 A;  4DX8 A;  3PHX B;  2RSG A;  1U2B A;  2HTH B;  5JVL A;  5FI1 A;  3KVF B;  4JK8 A;  2HTH A;  5C23 A;  4IWQ A;  2EMS A;  1WGY A;  1NI2 A;  2QKM A;  3KW5 B;  1GG3 A;  3ONS A;  3KRX A;  3IHP C;  5D3X A;  2KFJ A;  2RVB B;  4ILG B;  1P6S A;  2FCM A;  1LXD A;  4EEW A;  2DFK A;  1V89 A;  2KWC A;  3RZF A;  4HXD A;  2C5L C;  2N4F A;  4II2 B;  4CO7 A;  4ILJ A;  3UGB B;  2V4L A;  4HPM B;  1UD7 A;  3QBV B;  1AAR A;  3IBE A;  3WAP A;  2KJR A;  2KJH B;  3D32 A;  3OJ4 B;  1G6J A;  2VKI A;  3TW1 A;  2J0J A;  2HE7 A;  3L0W B;  4HJK A;  1SHC A;  3JVZ X;  4I6N B;  4FHK A;  4DDG D;  4G3X B;  4DHJ B;  2YF0 A;  5CX3 A;  3SU8 X;  4URK A;  1MKE A;  2LAS A;  2NBW B;  4TYZ A;  1WXV A;  2VSZ A;  4FN2 A;  5JZE B;  4BBN F;  4HB2 B;  3QCA A;  3A1Q B;  5IA7 A;  2V3S A;  3PP2 A;  4LCD E;  1KOT A;  2NZ8 B;  2NMB A;  1C1Y B;  3A1Q A;  2MKR A;  1WXA A;  3PRZ A;  1MIX A;  4GOC A;  3BY4 B;  3EHV A;  3ODW A;  3P2B A;  2H7E A;  3PEG A;  3MDB C;  2P0D A;  1OQY A;  3UZT A;  3DOW A;  1EVH A;  2BPS A;  5KQ4 A;  4NQK E;  1V5P A;  3M95 A;  2KLC A;  4P7I A;  1P1A A;  2ZPY A;  2D9Z A;  3VH4 B;  4DHJ D;  3D8E A;  4KHA A;  2FNJ B;  1U5D A;  5CHV C;  3VFK A;  2KMC A;  5E6N A;  2RSU A;  3SBG A;  3KSY A;  2W2X C;  4GGQ A;  2RUK B;  3ALB A;  3NS8 A;  4GXB A;  2WH5 A;  3TJP A;  2N9P C;  3NZS A;  2DHZ A;  3D8D A;  1N3H A;  2DAJ A;  2NS5 A;  4JKC A;  2KXJ A;  2KGX B;  3VTV A;  2KNB A;  1W1D A;  5CHW A;  1E7V A;  1YJ1 A;  3WIM A;  1WH3 A;  2KDB A;  1U4A A;  5FR6 A;  2WX0 A;  1V6E A;  1NTY A;  2EC1 A;  5D3Y A;  1TZ1 A;  3RYT A;  3AUL A;  3ZKJ C;  2DHK A;  2LKO A;  4HB4 B;  3LJ3 A;  2MX2 A;  3MTN B;  3KYD D;  1WJ1 A;  1R4N I;  4MJS B;  3X23 A;  5JH5 C;  3TBL D;  1I7A A;  1IYF A;  5KCV A;  4MJS A;  3SV1 A;  4EJN A;  4B9K A;  2IFS A;  1KZ7 A;  2DN6 A;  2DYO A;  2COD A;  4FA6 A;  4F7U P;  2QHO A;  4WWO A;  1XOD A;  2DHI A;  4AWJ A;  1TBE A;  2M1M A;  3N30 A;  4MM3 A;  4ANW A;  1EGX A;  4MGZ E;  2FCN A;  1WGH A;  1E8Y A;  1XX0 A;  1ZW7 A;  5DIF B;  2GBJ A;  4FAD A;  4MT7 A;  4E71 A;  3S2A A;  4GIV A;  1KZG A;  2K8H A;  2FCQ A;  4EFO A;  1E7U A;  5EDS A;  1UZX B;  5GOW B;  3FP5 A;  5C1Z A;  3QQ8 B;  2P8V A;  4DWF A;  2GJY A;  3GYP A;  1V5T A;  3PPA A;  3ML9 A;  1J19 A;  5LLI A;  1AWE A;  4DBG A;  1NVL A;  4K7W A;  2K1F A;  3ZNH B;  1ZC4 B;  4WSF A;  1MAI A;  2RLO A;  2KD0 A;  1WF9 A;  3N7C A;  2Y5B B;  1WX9 A;  1P0R A;  3SDL C;  2DEN B;  2MRP A;  2YLM A;  3JW0 X;  4LJP B;  1UEF A;  4PYU A;  2BCJ A;  3L08 A;  1OEY J;  4W9D A;  2BYE A;  4WVF B;  4KDI C;  4L6E A;  4B6W A;  3H7S A;  2GOW A;  3PSE B;  1WJU A;  3ZUN A;  1OGW A;  5JHG A;  2W2W A;  2JZZ A;  3TVV A;  2G4D B;  3PZD A;  3CST A;  1S1Q B;  2Q13 A;  1DDV A;  1FGZ A;  1F9J A;  5DPS A;  2DZI A;  4IM0 A;  3ML4 A;  1MK9 B;  2D9W A;  4BOS C;  4K7U A;  1FHW A;  2PJH A;  3DVG Y;  3KYC D;  4EOY A;  2IYB A;  4W9J A;  5HE2 A;  1RRB A;  2Z0E B;  1ZKH A;  1GGO A;  1LFD A;  3CIK A;  2WYQ A;  1Z2M A;  2DYN A;  4K2P A;  3PVL A;  4Y94 A;  1WZ3 A;  5GMV A;  4DX9 0;  4WJN A;  4E74 A;  3X0W A;  2YS1 A;  1U5F A;  2DZJ A;  2GS0 A;  4IAP A;  2L76 A;  4DHZ E;  1X1M A;  2LZ6 A;  4WWN A;  3TCA A;  4GDL B;  4IOY X;  2JPH A;  1UNR A;  1WY8 A;  1WJN A;  3T9L A;  4NY0 A;  4GDL A;  2Z0Q A;  2K8B A;  2RGN B;  4PS7 A;  1WRD B;  1JDE A;  2D9Y A;  2O2V B;  5J2R A;  2O2V A;  2LUE A;  2J0M A;  4ASW C;  3U8Z A;  2IYD B;  1BAK A;  3ENE A;  4K7S A;  3HIZ A;  4MSM B;  4IM2 A;  3SBT A;  4MEL A;  5KHO A;  2J0K A;  1VD2 A;  2LVO A;  4G50 A;  1LB1 A;  4WQO B;  3TO1 A;  2I5C A;  2B3A A;  3QIJ A;  4KHB B;  1J0G A;  2IO0 B;  2UZS A;  1Q67 A;  3A9K B;  2H7D A;  3GZN I;  3ZNG C;  1P98 A;  3FSS A;  3AU5 A;  3O65 B;  4G0N B;  3B0A A;  1XR0 B;  2MDX A;  1KBL A;  1GC6 A;  3N32 A;  2C7H A;  2KOX A;  2BF8 B;  4A3O A;  2GCL A;  2MCN B;  4J6I A;  1V61 A;  2ZNV C;  2MBO A;  2M14 A;  1IRS A;  4BBN C;  5DCN A;  2D4Q A;  4FUL A;  1Y19 B;  5L83 A;  2CR5 A;  4XC2 A;  3HM3 A;  4OVU A;  2ELB A;  2ABD A;  3IFW B;  4W9L A;  4ANV A;  4AOF A;  4PQ0 A;  3AXC A;  2X18 A;  3DCG A;  1GC7 A;  1U5E A;  2C60 A;  4ZRJ A;  5CTR C;  2BWE S;  2ZJD A;  3A9J B;  3UIN B;  4KDL B;  3E9P A;  2GBR A;  4FLH A;  1KM7 A;  5HE0 A;  2CY4 A;  4XX5 A;  4WJ7 A;  2KZR A;  3A9J A;  3L54 A;  2W2X D;  1ST7 A;  2KC2 A;  3K9P B;  1TXD A;  1UPQ A;  1L7Y A;  2KKC A;  4W9K A;  3ZTC A;  2PPH A;  2BGF A;  2VRR B;  2N23 A;  3PV1 A;  1KI1 B;  1Z87 A;  2EKE C;  3WAL A;  5JHH A;  1DBH A;  3PRP B;  2Y8G A;  3V6C B;  4JIO U;  1GUA B;  1I35 A;  4G11 A;  2MBH A;  3APD A;  2RR9 A;  5HE1 A;  3KZ1 A;  1BT0 A;  1LM8 B;  2G3Q B;  4ICV A;  1OEY A;  5DPR A;  1FHO A;  4IM3 A;  2NBV B;  3P6A A;  1M94 A;  4GMV A;  1SGH A;  2DZM A;  1WJ6 A;  3DQV A;  3W1S A;  3OAW A;  3KY9 A;  2W9N A;  4TUU A;  1DDW A;  3M63 B;  1VCB A;  4LDT B;  5C6R A;  3ZW3 A;  3RD2 A;  3SO6 A;  2NPT B;  1Q5W B;  1U29 A;  2IZV B;  1H4R A;  2UZR A;  4HCP B;  2KWV B;  2NPT A;  2BKF A;  1V9J A;  2D2Q A;  1UNQ A;  4ILH A;  2N0Y A;  4D0N B;  4A5K A;  2OTX A;  1EAZ A;  4HAU B;  1WYW B;  5CLQ B;  2RPQ A;  2LG1 A;  1MG8 A;  2AYO B;  4NJ6 A;  2KTF A;  2ZZP B;  4KSL C;  1WI1 A;  4A6K A;  3SNH A;  3R7R A;  2D9V A;  3PLV A;  3PVU A;  4LDT D;  4ZDV A;  4KSK C;  1WX7 A;  4I6L B;  4F8C B;  2CU1 A;  3BJI A;  2LBB A;  2DX1 A;  2BYV E;  1Y5O A;  2D3G A;  3DVN V;  4JKF A;  2K2J A;  3DPD A;  2KQ7 A;  2N9E B;  3MHS D;  5C79 A;  4IUM B;  3QC8 B;  2K39 A;  2LRW A;  4F7G A;  2KFK B;  3KUD B;  2YS5 A;  2KUP A;  3TL5 A;  4FJZ A;  2CHW A;  2KFK A;  4W9E A;  2ELA A;  4HDO A;  1E90 A;  1X86 A;  4X57 B;  2OOB B;  5CHF A;  1UGM A;  2N1V A;  5TR5 A;  3KRW A;  3DXE A;  4KAX B;  1E8Z A;  3L17 A;  4K17 A;  2PEA A;  3QA8 A;  1HE8 A;  1UH6 A;  1U27 A;  2GBM A;  2XEW A;  2YS3 A;  2JZ3 B;  2CB8 A;  2K25 A;  3JYU A;  2I1K A;  2I5F A;  2WX1 A;  1WG7 A;  2LOZ A;  1WZ0 A;  2MWN B;  2JF5 A;  3DBS A;  3PVW A;  4MK0 A;  1RAX A;  4IW0 A;  1V81 A;  2L2I A;  4KZC A;  1EUV B;  1RFA A;  4DHZ B;  2UWQ A;  1KLV A;  4GB9 A;  4F7H A;  3DBR I;  4FJV B;  3WA0 A;  2JUO A;  1UPR A;  4DXA B;  2M17 A;  3MPX A;  2KQS A;  5D7G A;  1OMW A;  1DYN A;  4HHV A;  1FAO A;  2LJ5 A;  2G35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...