2YVCA

Crystal structure of the radixin ferm domain complexed with the nep cytoplasmic tail
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for type II membrane protein binding by ERM proteins revealed by the radixin-neutral endopeptidase 24.11 (NEP) complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 85
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2yvcA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yvcA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2yvcA01
3A9KA 1KLVA 2IO3B 3MTNB 2WX1A 1WX9A 5L95C 2KTRB 3KRWA 4DX90 5D2MB 1U5FA 2BGFA 2GBRA 2D9YA 2BF8B 4M8NA 2J0MA 4ZYNA 2R2OA 3PVWA 4PS7A 3NOBA 2UZSA 1WJ1A 4B6WA 4FN2A 2RVBB 2J0KA 5IAAC 4BOSC 3ECIA 5DPTA 1VD2A 1U27A 4B95A 1WZ3A 1UGMA 1FB8A 3PREA 3PVUA 3WA0A 2WH5A 4A6FA 2R2QA 3QA8A 2XEWA 3HIZA 2KWVB 3PGEA 1L2NA 1LXDA 3NY5A 1Y5OA 4L6EA 5KHOA 2Q13A 4W9EA 4GDKB 2CQUA 2Z0DB 2DKPA 2LKOA 4DHJD 4HPLB 2M4NA 4MSQB 5D6JB 3NZUA 4C0AA 5AZFA 4NJ7A 3ODOA 4EZLA 3H1UA 1ZSQA 3VDZA 1WGRA 3DXCA 4G50A 1BWNA 3U7DA 3NZSA 1FHOA 3PRMB 3DVGX 5JLJB 2CHWA 2NR2A 1WG7A 1XD4A 4IAPA 5G55A 2FUHB 1MK9B 2NBVB 4B6HA 3PT2B 4FHJA 1WX7A 1QQGA 3HQCA 3VTVA 2R0DA 1NTVA 5LLIA 2NS5A 3DVNU 4M8MA 4HWIB 2RGFA 2KFKB 2DAJA 3PG7A 5AZGA 3O96A 2HE7A 3A9KB 4ANXA 5JHHA 4FHKA 1ACAA 2EKEC 2KQSA 1WR1A 2KVRA 4EZJA 3RD2A 4CO7A 1WGGA 2MA9B 1AARA 3RYTA 5JP4A 2M1MA 2C7NB 1P1AA 2Z59B 2KWCA 1Y8RC 4BKTA 2MWNB 2VRWB 2O6VA 3QWZB 1TTNA 4K2OA 1ZW7A 3VUWA 3EPYA 1KOTA 4W9GA 2DYMA 4EZKA 1WXAA 3PTFC 4F7HA 5CHFA 2LXAA 4IC7B 2LGXA 3JYUA 1IYFA 2JP2A 1WRDB 2LYDA 2ZZPB 4XX5A 1B55A 3BJIA 1HB6A 1WGDA 4HHVA 5E6NA 1FHXA 4A6FB 5D3YA 2BKFA 2R09A 4HB4B 4LJOB 3TL5A 1WJNA 2JXXA 4WAAA 3U8ZA 4NQKE 2AEHA 1K5DB 4NSWA 1C1YB 3TCAA 1D3ZA 4IOYX 3SYXA 3AULA 4HDOA 3F0WA 4EJNA 3RZWC 3K9PB 2DYNA 3ML9A 3HHMA 2NCNA 4E3CA 4F7ZA 2KX0A 3PS6A 2GBKA 5JZEB 3MPXA 2GBJA 4KHBB 2N7DA 2RGNB 1FXTB 1JRUA 3ZKJC 3KRXA 1NVLA 1W1DA 2KDFB 1WJ6A 3T8MA 5FR6A 1IP9A 1ST7A 3CF6E 1DDVA 3M3JA 3PVLA 4DHZB 4HDQA 2Y7BA 2GMIC 2N1VA 3ULBA 2YF0A 2KHWB 1XR0B 1UEFA 2IY1B 3ZO5B 2Z0PA 3ZDTA 1OEYJ 3DXDA 3DBRI 2C60A 2CY5A 3AXCA 2K00A 2AWTA 2DHIA 4IG7B 1UELA 1ZKHA 5IJMA 2Z0OA 3V61A 4PYZA 1MPHA 3JVZX 3ZVVA 4OVVA 5LXHA 1P98A 2O6VB 3A8QA 4J6IA 3S2AA 2N4FA 2M14A 1WYWB 3HM3A 2DX5B 1S1QB 4CHKA 2BWFA 3B1LX 3VXWA 4EKUA 2LGDA 3ZTDA 1P6SA 4HAXB 3ZNID 3KUDB 5CX3A 2CB8A 1UPQA 3IG3A 5KHQA 1W1GA 3KZ1A 4WJNA 3W1SC 5FI1A 3A98B 2HTHA 4F7UP 2YT0A 5DPSA 2LBBA 1V61A 1E8ZA 3ZVRA 2KKCA 5LXIB 3EECA 1YD8U 2JZ3B 2COCA 2N1WA 4CHJA 2NBUA 2CRFA 3WAMA 1V81A 2A4ZA 2MBEA 4HAWB 4IUMB 3TBLD 2N0YA 2YS1A 1WI1A 3HK0A 5DPRA 5HE1A 2C7MB 3N30A 4MEMA 3RZFA 4MM3A 1U2BA 5DH9B 3WALA 4WWNA 3K9OB 1P3QU 4I6NB 3M62B 1FGZA 1H10A 2C5LC 4IWQA 2PE9A 1LM8B 1NDDA 4KV2A 1MIZB 2NPTB 3OJ3A 2NZ8B 3M95A 2L8JA 2JZZA 1I42A 2ABDA 1T0YA 1E8WA 1WXSA 2KWUB 1X86A 2DZIA 5KQ4A 2BWES 2N9PC 2DTCA 2EC1A 3KUCB 2P0FA 2MWSB 2CODA 4HB2B 4KSKC 3H7SA 1EF1A 1K5GB 2KDBA 2KX3A 2MCNB 3RUIB 1N3HA 1SIFA 3A9JB 2AL3A 4MY6A 2GS0A 2CAYA 3SDLC 2W2XD 3PSEB 4AUQC 2ZEQA 3VUXA 4BBNF 4LJPB 2COFA 2L1CA 2QHOA 4N9F4 4WWPA 2W2XC 2DYOA 2MBHA 3ZW3A 2O2VA 3VH4B 1WGYA 2ZJDA 2ROVA 2NVUI 4DX8A 2IY0B 1HB8A 2NMBA 2LWPA 3ML4A 1E8XA 3D8DA 2KJRA 2Y8FA 1E90A 4IM3A 2LULA 4Z2NA 3ULCA 2LRWA 4TQ1A 3VTUA 4A20A 3VIAA 2HTHB 3PHWB 2L0FA 4M0WB 1H4RA 5E6OA 5CLLB 3V62A 4FJVB 1NTIA 4GIVA 1K8RB 3QAQA 3OAWA 4NJ6A 2DHZA 3EFUA 3QIJA 3L0WB 2K25A 3QHTA 4EOYA 3TVVA 2KXJA 2I5FA 2N9XA 1J8CA 3Q3FA 4MJSA 2K6DB 3PRZA 2LI5A 1E8YA 4TUUA 3KSYA 3L54A 4HCPB 2C9WB 3TFMA 2V76A 4LDTD 4A3PA 4ZRKA 4ZRJA 4DHZE 4OVUA 2CKHB 2YVCA 3DCGA 1WE6A 1UBIA 2AYOB 2IO0B 1IPGA 3CIKA 3GYPA 1R4NI 1V88A 3SO6A 5D27A 2N9EB 2W9NA 1WIAA 4HAVB 3ZUNA 3QC8B 3P6AA 2KJ6A 1M7EA 4BKSD 2CHXA 4FJYA 1E7UA 2L3ZA 4ICVA 4A3OA 2O2VB 1J19A 1Z2MA 2M8SA 4KHAA 5KCVA 2KGXB 3X0WA 1Q0WB 2DYBA 2UYZB 4W9LA 4X57B 3ZTCA 5CHWA 1DDMA 4EUTA 2NBWB 1V2YA 3WYFB 4TQ0A 2ZVNA 1R4MI 5L83A 3WIMA 4XC2A 3KW5B 4W9HA 2P0DA 2RUKB 2L7RA 3ZNHB 3OANA 3FM8C 1WM2A 3PHXB 5DI9B 3KH0A 5G2NA 3PEGA 2PZ1A 1Z5SB 2IYDB 3ZDMC 4KVGB 5CLQB 3QX1A 4ASWC 2OOBB 2K8HA 3FP5A 1DROA 1SGHA 3HM6X 2MP2A 3NHEB 2DX1A 4ANWA 5FI0A 4HAYB 4A5KA 5TR5A 2DAFA 2EMTA 1UNQA 3DBSA 1MK7B 4BFRA 1WZ0A 4B9KA 4WVFB 2OQBA 1W1HA 2IFSA 3ODWA 4MT7A 2D4QA 4MJSB 2DFKA 4II3B 2VSZA 4HLEA 3V6CB 2DLWA 4FA6A 1OGWA 1U5EA 4K7WA 1P0RA 2DN6A 3FEHA 4GXBA 3WANA 2D3GA 2BPSA 3SD5A 5J3QA 1PLSA 2JRIB 3PLVA 2GOWA 1V5UA 4IFSA 1WGUA 2CU1A 2VRRB 1M7RA 3VAWA 1AQCA 4AOFA 1TBEA 1WI0A 2EJ8A 2D9WA 1UH6A 3B08A 5L81A 4NNJB 1IRSA 3KYCD 3SUZA 2M38A 5DHFB 4ZDVA 5E6PA 1X1GA 2LD9A 1LFDA 1EF5A 3D8EA 1QC6A 2L05A 5C16A 4FJZA 4TKNA 3NS8A 4MELA 3QBVB 2LOZA 4CHMA 2DHJA 2KJHB 2V4LA 2XBBC 4WJPA 4JIOU 1DDWA 3F5RA 2KMAA 4JQWC 3APFA 2WWZA 2LOXA 2L0TA 3FLVA 1CMXB 2V3SA 4HB3B 3VQIA 5EDSA 3P7ZA 4XZ4A 3DQVA 3R3MA 4YL8A 1MIXA 2LVQA 3H6NA 2LASA 3AU5A 3ZNZB 3V5WA 3U30A 4E74A 1WGQA 3ENEA 2KK8A 3IHPC 2RPQA 2COAA 2LJ5A 2FCMA 2IZVB 1WM3A 2KFJA 5J18A 5J3YA 5JHBA 2MP2B 1EO6A 3BY4B 3AI5A 2GBNA 4NAWA 3KUZA 1LW3A 2LVOA 4TV3A 5D7GA 3UZTA 2BCJA 4KIKA 4ZRIA 4K7UA 2H7EA 1E5WA 1FOEA 2P0HA 2Y8GA 3ALBA 2FCQA 2IO2B 1J0GA 1WF9A 2K6QA 2XQNM 4FBJB 1KJTA 2CS4A 1ISNA 3A1QA 2H7DA 1L7YA 2KCJA 4NY0A 2MLBA 2DA0A 3L17A 5C5BA 2DZKA 1V86A 2YS3A 1C3TA 5KQ1A 1XQQA 1GG3A 3RULA 5D94A 3AJ4A 1GJZA 4DHJB 2I1KA 1OTRB 2OTXA 2G4SA 2P8VA 4YONA 3CSTA 5AZHA 2G45B 1XODA 3X23A 4F7GA 1RRBA 4EMOA 2YRYA 1TGZB 2KC1A 1BTNA 1DYNA 2KANA 1GC7A 3DBHI 5J2RA 1WVHA 4PS3A 3T9LA 1X05A 2M17A 3CXBB 1WJUA 2ZCBA 2DKQA 1V5PA 1V5TA 2BYVE 2I1JA 1WH3A 4KSLC 1P9DU 3W1YA 4HK2A 5HE3A 4HB0B 2L76A 2CR5A 2Z0EB 4HATB 2UWQA 2FIDA 2Y5BB 2KLGA 1X1FA 4Z2MB 3VOQA 1SE9A 4LCDE 4DK5A 4I6LB 4I6PA 1GC6A 1V5MA 4A6HA 2JF5A 1A5RA 2RNRB 1WFYA 4W9IA 4MGIE 1GUAB 4BBNC 2COPA 1UZXB 1BAKA 4NAWB 2D11A 2D10A 1HE8A 1OQNA 1EUVB 2JRHA 3QQ8B 3KY9A 2ADZA 4KIKB 5DPWA 3QARA 1HBKA 4KAXB 4K7SA 4IWOA 2KC2A 4MK0A 4HPMB 1YIWA 2PEAA 3W1SA 2J7QB 4W9FA 3CSFA 4IM2A 4FLHA 2K2JA 4K81A 2ZPYA 2LGYA 3A1QB 2PE6B 2KUPA 2UZRA 3UQAA 4IW0A 1V89A 2YS5A 4ANUA 3EC8A 4G3XB 4GMVA 3ML8A 4HCNB 1U5GA 1PMSA 1H8CA 2ZNVB 4GSWA 2W2WA 4G0NB 5GMVA 4GDLA 1U29A 5D3WA 2K8CA 2JWZA 5DCNA 3PRPB 5HE2A 4HVBA 3ZLZA 1XD3B 1RAXA 4FADA 4MSMB 3WAOA 1UNPA 3M63B 2CY4A 3LJUX 1F9JA 4JL9A 2K2UA 4KZ0A 1WJMA 3SNHA 4HJKA 4KZCA 2ELAA 4E71A 3SU8X 2RQ1A 2O6VD 2QKLA 3M1IB 3UQBA 1UBQA 2BKRB 3KVFB 2ZVOA 3DPDA 4WWOA 4DWFA 4MDKE 4URKA 4HXDA 2KDIA 2EMSA 1V6EA 3TO1A 4HAZB 2MBBB 2MBOA 1YQBA 4BBKA 2G3QB 2FCNA 1DBHA 1I2HA 3HW2B 2JPHA 3BINA 1Y19B 2L00B 5D3VA 4KDIC 5J3TA 2KO3A 4W9CA 3RCZA 1WY8A 2IBIB 4HAUB 3WAPA 3UF8A 1OMWA 4AJYB 4WJOA 3GYOA 2C7HA 3L13A 5IA7A 3NSUA 2KNBA 1FGYA 4PQ0A 2KOXA 3ZIMA 1ZC3B 3LDZE 1WMHA 1I35A 1MG8A 1KZ7A 5D3XA 2KDEB 4BVUC 2DZJA 1PFJA 2K1FA 4IM0A 3DDCB 2FJLA 2A5UA 4WJ7A 4MGZE 2WDTB 3H9DA 1Q67A 3TW1A 3H7PA 4BKGA 3P2BA 2GBMA 2RSGA 3UINB 2UVMA 3IVFA 4W9DA 2LUEA 2LXCA 2J59M 1EGXA 4G11A 1VCBA 2MW5A 3QJZA 5LOPB 2X18A 3VVWB 3A33B 4GDLB 1XX0A 2JUOA 2JVCA 2WYQA 3RT3B 2GCJA 2DZMA 2RD0A 1WJ4A 2PPHA 1Q5WB 4MH0E 2HJ8A 1NBFC 1BTKA 3N3KB 1XCGA 3PPAA 2MQJA 3Q3JA 1OQYA 3APDA 1NTYA 3D32A 1FHWA 4AP4C 2ASQA 4RMAA 2ZCCA 2FJ9A 3PP2A 2DX5A 3L08A 5CHVC 3MHSD 1BT0A 5HKHA 4K1RB 1AWEA 2D9ZA 4GMXB 4EEWA 1EAZA 3TMPB 3V60A 2JT4B 2KZRA 3DBLI 1WGHA 3CMMB 1RLFA 1U5DA 4AJWA 3DOWA 4NPNA 2FNJB 2LG1A 4JGHB 2MSED 3ODXA 1MKEA 1OEYA 2BYEA 2GJYA 5C1ZA 5DHAB 1RFAA 4BKSA 1WX8A 1KZGA 1KM7A 2IYBA 1V49A 4ICUA 2FCSA 2AL6A 1G6JA 2FDQA 3PZDA 4II2B 3SV1A 2V1YA 2ZNVC 1RRPB 3JSVA 2DHKA 2KTFA 1FAOA 2LVPA 4P7IA 2OJRA 1U4AA 3SHQA 3OLMD 3T06A 1WMHB 3VUYA 1ZC4B 4KDLB 2Z0QA 2MRPA 3R7QA 2G4DB 1V5OA 1WXMA 2L2IA 3H7PB 3JW0X 4RM9A 2NPTA 2J0JA 3APCA 4RM8A 2ROZB 1E7VA 2DYQA 3L10B 1SHCA 1TJ6A 3DXEA 3FSSA 4CYEA 1S3SG 3RCPA 3MJWA 4K2PA 3L16A 3VHTC 1WE7A 5LONB 2KN5A 2M0XA 2E2XA 5JHGA 3A9JA 3A8PA 2KMCA 2B3AA 3B0AA 3VFKA 2ELBA 3QCAA 4JLCA 4XWXA 4F1SA 3N32A 2YSZA 1UD7A 1P5TA 2LRUA 2DENB 4DBGA 1WR6E 2QKMA 1TZ1A 3LJ3A 2MX2A 3MDBC 2MFQA 3ZNGC 3A4RA 3GZNI 5AEKB 1WXVA 4GPTB 1NU2A 1QZEA 4GB9A 3G9WA 3AU4A 2RLOA 1ZVRA 4LDTB 3R66C 3TIXA 1YX5B 3KYDD 2MDXA 2XK5A 1I7AA 4MGYE 4F8CB 4W9KA 4TYZA 1GNUA 2N23A 4ANVA 5GOWB 2IO1B 2GCLA 3A4SC 2K39A 4WQOB 2KLCA 1PQSA 2FAZA 2I5CA 1M94A 1KI1B 2MKRA 1Q1OA 3EHVA 2KD0A 3ONSA 2VKIA 1YJ1A 1XKEA 4K17A 4DBBA 1TQZA 2HD5B 3O65B 2KTRA 4EFOA 3D8FA 5JHAA 3DVGY 1ZM0A 4NQLB 5C6RA 3JSVB 2K8BA 5HE0A 2D07B 3R7RA 3QWMA 1Z87A 5C79A 4IWPA 2BYFA 5EFXA 3IFWB 1YX6B 3UIPB 1ZGUB 1X1MA 3VTWA 2ZPNA 3N7CA 2WX0A 4GN1A 3PLUA 1UNRA 4DDID 3VH3B 4A6KA 4WJQA 2HRJA 2CHZA 2REXA 3UGBB 3IBEA 1LB1A 2PJHA 2RSUA 3ZRFA 3UIOB 1NI2A 2FIFA 3ZRCA 1V9JA 1LQBA 1J0WA 4AWJA 1UPRA 3OJ4B 1RJ2A 1MAIA 1P3RA 2G35A 2KQ7A 1OY2A 4GDKA 2N7EA 2MBQA 2JY6A 4GOCA 4WSFA 4DDGD 4GZUA 5C23A 5JH5C 2YT1A 1X11A 3TJPA 5DIFB 3DVNV 4H8SA 5BO4B 4DXAB 5J17A 1EVHA 3PV1A 4PS8A 4KHOA 5CTRC 2D9VA 3PSCA 3V6EB 3I3TB 4Y94A 4FULA 2D9XA 4PNKA 3GOEA 1V80A 4GGQA 4GU2A 5C5BB 2XK5B 3C0RB 4PYUA 2YLMA 1XT9B 3QK0A 4D0NB 4BOZB 2RR9A 2KFKA 2LZ6A 4MGKE 2D2QA 1TXDA 4W9JA
chains in the Genus database with same CATH superfamily
3A9KA 2R2YA 1KLVA 1TKYA 2IO3B 3MTNB 1TJEA 1TS4A 3KWVA 1AW7A 2WX1A 3B2FA 1WX9A 5L95C 2KTRB 3KRWA 1E9MA 4DX90 5D2MB 1U5FA 2BVCA 3I57A 2BGFA 2GBRA 3AE9B 3N20C 2Z59A 3H8HA 1R4NB 2D9YA 2BF8B 4M8NA 3BIID 2J0MA 1CQVA 2K22A 4ZYNA 2R2OA 3PVWA 2QSDA 4PS7A 3NOBA 3AV8A 2WXHA 2UZSA 1WJ1A 2E6XA 2TSSA 4B6WA 4FN2A 2KVZA 4FXCA 5G5HA 2RVBB 2J0KA 5I2SA 5IAAC 4BOSC 4IKGA 2W3RA 3ECIA 3AN1A 5DPTA 1VD2A 1FNUA 2KMMA 1V97A 2JSVX 3Q8CA 4C80A 4K3BA 3SBGA 1U27A 3BYTB 1N61A 4B95A 1WZ3A 1UGMA 1FB8A 3V05A 2MJDA 3PREA 3ENBA 3PVUA 3WA0A 2WH5A 3AEDB 4A6FA 2R2QA 3MHZA 2RRFA 1FRDA 2XEWA 2Y5CA 3QA8A 5JXVA 3HIZA 2KWVB 3HSAA 1R4MB 3PGEA 1LXDA 4JE3B 1L2NA 4YTMB 3NY5A 1Y5OA 4L6EA 4L1BA 2LMCA 5KHOA 2Q13A 4GOUA 4W9EA 4GDKB 2X38A 2CQUA 2Z0DB 4XE0A 2DKPA 2LKOA 4DHJD 4HPLB 2M4NA 4MSQB 5D6JB 5LG4B 3NZUA 4C0AA 5AZFA 4NJ7A 3ODOA 4CSQA 4EZLA 3H1UA 1ZSQA 3VDZA 1WGRA 1KFYB 3DXCA 1FO4A 2L52A 4G50A 1BWNA 3U7DA 3E9OA 1FHOA 3NZSA 3PRMB 5BMIA 2V3NA 3DVGX 1TY0A 5JLJB 4RNAA 1I7HA 2DBYA 2CHWA 2GB1A 2NR2A 4KHBA 1WG7A 3WCQA 1XD4A 4IAPA 1D5XC 2GLSA 2WDVB 1N62A 1RM6C 1ACCA 3BVZA 5G55A 2FUHB 1XF5L 1MK9B 2NBVB 4B6HA 3AE2B 3BYYB 3PT2B 4FHJA 1WX7A 1FFUA 1QQGA 3HQCA 2JWUA 3VTVA 1WSPA 2R0DA 1NTVA 1PUTA 5LLIA 2NS5A 3DVNU 4HKZE 4M8MA 4HWIB 2RGFA 4UDUC 1XLPA 2KFKB 2DAJA 3PG7A 2RMMA 3TEWA 5AZGA 1YJJA 3MC8A 3O96A 2HE7A 3A9KB 4ANXA 4D6WA 5JHHA 4FHKA 1ACAA 2EKEC 2KACA 2KQSA 1WR1A 1XLQA 3AB5A 2KVRA 1FNWA 4EZJA 3RD2A 4CO7A 4ITKA 1WGGA 2MA9B 1AARA 3RYTA 5JP4A 2IGHA 2M1MA 4RCOA 2C7NB 1P1AA 3DBLB 2Z59B 3SEBA 2LEKA 2KWCA 1ESFA 4OVZA 1Y8RC 2SEBD 4BKTA 3LYYA 2MWNB 2INCC 2DLBA 2VRWB 3NWAA 1PYWD 2O6VA 2ACZB 3QWZB 1TTNA 4K2OA 1ZW7A 2EELA 3EPYA 3VUWA 1DOYA 1KOTA 4W9GA 2DYMA 4EZKA 1B1ZA 2RPVA 1GOZA 1WXAA 2IJ0A 3PTFC 3RNCC 4QXAB 4F7HA 1MFWA 3Q8AA 5CHFA 2LXAA 1KTKA 2BQQA 4IC7B 2LGXA 3JYUA 3FILA 1IYFA 2JP2A 5IKCM 1WRDB 2LYDA 2ZZPB 4XX5A 1C77A 1B55A 4P6VF 1F77A 2W82A 3BJIA 1HB6A 1WGDA 3E66A 4HHVA 3P42A 3R2IA 1F1HA 5E6NA 2JU6X 1FHXA 4A6FB 3DCXA 5D3YA 1YMHE 2BKFA 3AM9A 3ZXVA 2R09A 4HB4B 3E9SA 4LJOB 3TL5A 2BT6A 1J7AA 1WJNA 2JXXA 2UU7A 3NZ3A 4WAAA 2INNE 3U8ZA 1JALA 4NQKE 2AEHA 1K5DB 4NSWA 1C1YB 3TCAA 1D3ZA 4NZLB 3NWFA 3EUB2 2OJWA 4IOYX 1LGRA 3SYXA 3AULA 4HDOA 3F0WA 1WGKA 1L5PA 2WU2B 4EJNA 1BXTA 4KGSA 4ILHA 4A55A 3RZWC 3EA6A 2VH1A 3K9PB 3NVZA 2DYNA 2V0GA 3U52E 3ML9A 3HHMA 2NCNA 2D3BA 4E3CA 4F7ZA 2KX0A 3PS6A 1T0RC 2GBKA 1CZPA 5JZEB 3MPXA 3PZ7A 2GBJA 4KHBB 1UF0A 2N7DA 1I4HA 2LUMA 1VRAB 1SB3C 2RGNB 2BS3B 1FXTB 1JRUA 4DXGA 3ZKJC 3KRXA 1HQRD 1BUIC 1NVLA 1W1DA 2KDFB 1WJ6A 3T8MA 5FR6A 3GZNB 1ST7A 1FXIA 4R3DA 1IP9A 3RNBC 3CF6E 1DDVA 3I9V1 3AEAB 3M3JA 3P4SB 3PVLA 2N9KA 4DHZB 4HDQA 1C4CA 2Y7BA 2GMIC 2N1VA 3GB1A 4C7ZA 1YOVB 1ZYIA 2NMQA 3ULBA 2YF0A 2INPE 2KHWB 4ILJA 1XR0B 1UEFA 4XDDA 2IY1B 1QLBB 3ZO5B 4AQ7A 2Z0PA 4MH8A 3ZDTA 3AE4B 1OEYJ 2WXPA 3DXDA 2AQ3B 5H8YE 3DBRI 1XCQL 2C60A 3MFGA 2CY5A 3AXCA 2K00A 2AWTA 4XGAB 2QC8A 2DHIA 4IG7B 1UELA 1ZKHA 3KWLA 3V3XA 5IJMA 2Z0OA 1OQRA 1K51A 3V61A 4JPSA 1XO3A 4PYZA 1MPHA 3N1XC 3JVZX 3ZVVA 4OVVA 1VDVA 5LXHA 3KQ4A 1P98A 2O6VB 3N1YC 4JKHA 3AEEB 3A8QA 1CJEA 4J6IA 3S2AA 4US9A 3RFZB 1KC7A 2N4FA 2M14A 1WYWB 3HM3A 2DX5B 1S1QB 4CHKA 2BWFA 3B1LX 4RGMA 3DBHB 1J7BA 5H92C 4ZHOA 3VXWA 2IPKD 2LGDA 4EKUA 2OEDA 3FILB 1P6SA 3ZTDA 4HAXB 3ZNID 2CJNA 3KUDB 3DWGC 5CX3A 1M4VA 2CB8A 4N58A 1UPQA 3IG3A 5KHQA 1W1GA 3MP9A 3KZ1A 4WJNA 3W1SC 4S0RA 5FI1A 3B77A 3A98B 2HTHA 4F7UP 2R82A 2YT0A 5DPSA 2LBBA 2DWQA 1V61A 4JWUC 2H88B 3HVDA 1E8ZA 3ZVRA 2KKCA 5LXIB 3TSSA 1SEBD 4XWWA 3EECA 2WU5B 2JZ3B 1YD8U 1EU3A 2COCA 2N1WA 4CHJA 3Q2AC 2NBUA 2CRFA 3WAMA 2IGDA 1CK1A 1V81A 2A4ZA 2INDC 2K3UA 5D3DA 2MBEA 3DHGC 4HAWB 4IUMB 3TBLD 2N0YA 2YS1A 1WXQA 1WI1A 3HK0A 5DPRA 5HE1A 2C7MB 3N30A 4MEMA 1XXGA 3RZFA 1IUEA 4WWMA 4B0MA 4MM3A 1U2BA 1K53A 5DH9B 1SSNA 3WALA 5TSSA 4WWNA 3K9OB 1P3QU 4I6NB 3M62B 1FGZA 1H10A 2G1EA 3ABVB 2C5LC 4IWQA 1SE3A 2PE9A 3RPFC 4KGTA 1LM8B 1NDDA 1ZDXA 1PGXA 4HKQA 4KV2A 2IGGA 1FPYA 1MIZB 2NPTB 3OJ3A 3I63C 2NZ8B 3M95A 2L8JA 2JZZA 1I42A 2ABDA 1T0YA 2BW2A 1E8WA 1WXSA 2KWUB 1X86A 2DZIA 5KQ4A 2JYEA 2BWES 2N9PC 2DTCA 2EC1A 1PGBA 3RI7C 1QT9A 3KUCB 2P0FA 5LNK1 2MWSB 2CODA 4HB2B 4KSKC 3AMZA 3H7SA 4OZBA 1EF1A 1K5GB 2KDBA 2KX3A 2MCNB 3RUIB 1N3HA 1SIFA 3A9JB 1V1PA 2AL3A 1YN4A 4WH4A 4ZRPA 4MY6A 2GS0A 2CAYA 4C56C 3SDLC 3W5VB 3ZGZA 2W2XD 3PSEB 1WWTA 2H89B 4AUQC 2ZEQA 3VUXA 4BBNF 4LJPB 1TY2A 4Q2JA 2COFA 2L1CA 3FVCA 2QHOA 3NS1A 4N9F4 4WWPA 4ZOHC 5AUIA 2W2XC 1T6BX 2DYOA 2MBHA 3ZW3A 2O2VA 3AEBB 3VH4B 1JCKB 1WGYA 3BVGA 2FJUB 2ZJDA 2ROVA 2NVUI 4JKBA 1ET9A 4DX8A 2IY0B 1HB8A 5FK9C 2NMBA 2LWPA 3ML4A 1E8XA 3D8DA 2KJRA 3LB8C 2Y8FA 4JK7A 1YQ4B 1E90A 4IM3A 1SIJA 2N9LA 2LULA 3VR8B 3TEZA 4Z2NA 3ULCA 4D2KA 2LRWA 2QIEB 4TQ1A 4LNIA 1NVID 3VTUA 2I38A 4A20A 3VIAA 2HTHB 3PHWB 2L0FA 4M0WB 2I2YA 1H4RA 1STEA 4N6EB 5E6OA 3ETRA 4QJ5B 5CLLB 3RNAC 3V62A 4FJVB 1NTIA 2Z14A 4LK0M 1VBHA 1C76A 2ZKMX 1IGCA 2WNMA 4GIVA 1YQ3B 1K8RB 3QAQA 3OAWA 4NJ6A 2L1AA 5BYSA 2DHZA 3EFUA 3QIJA 3L0WB 5EE0A 2KDMA 4JK8A 4C7YA 2K25A 2PLPA 4RGOS 3QHTA 3KLSX 2HDEA 4EOYA 4MM3B 3TVVA 2KXJA 1TZOA 4HRSA 2I5FA 2JQRB 4RGNA 2HTME 4AS1A 2N9XA 1J8CA 3Q3FA 4MJSA 2AQ2B 4JKAA 2K6DB 2KUQA 2SAKA 3PRZA 2LI5A 1DIKA 3SFEB 2BTEA 1E8YA 2JXTA 2NTTA 4TUUA 1DYQA 3KSYA 1E7PB 3L54A 4HCPB 2C9WB 3R8BA 1HTOA 3TFMA 2V76A 4LDTD 4LNOA 4A3PA 4ZRKA 4ZRJA 1PDXA 4DHZE 4OVUA 2CKHB 3AECB 4L2YA 2YVCA 5FKAC 3DCGA 1WE6A 1UBIA 2AYOB 1JWUD 4S17A 2MJ3A 2IO0B 1IPGA 3OWEB 3CIKA 3GYPA 1V1PB 1R4NI 4NJCA 1V88A 2KAJA 1GB4A 1IGDA 3SO6A 5D27A 2N9EB 3FKYA 4HEA1 2W9NA 2L32A 1TS3A 1WIAA 4HAVB 1QF6A 4JX1C 3ZUNA 3QC8B 3P6AA 3RNFC 2KJ6A 1M7EA 4BKSD 2CHXA 4FJYA 1E7UA 2L3ZA 1EU4A 4ICVA 4A3OA 2O2VB 4P16A 1J19A 3ZJVA 3SR6A 1I4PA 5I2MA 1Z2MA 2M8SA 4KHAA 5KCVA 2KGXB 3X0WA 1Q0WB 2DYBA 2UYZB 3I5JC 4W9LA 4X57B 3P4RB 3ZTCA 5CHWA 3U2SC 1AYFA 1DDMA 4B0EA 4IOIE 4EUTA 2NBWB 1V2YA 1JDEA 4YSYB 2WXLA 5IO9A 2PKOA 3WYFB 1C79A 1UNSA 2ZVNA 2ON8A 4TQ0A 1R4MI 5L83A 3WIMA 4XC2A 3KW5B 4W9HA 2P0DA 2RUKB 2L7RA 2WGSA 2FBWB 3ZNHB 3OANA 3FM8C 3EGRA 2Z4DA 1WM2A 3PHXB 3ZYYX 5DI9B 3KH0A 3GS2A 5G2NA 3PEGA 2PZ1A 1Z5SB 2IYDB 1IBXA 2WXKA 4OZCA 3ZDMC 4KVGB 5CLQB 2V9HA 3QX1A 4ASWC 2OOBB 1NI3A 2K8HA 3FP5A 5G5GA 1GGOA 1DROA 1SGHA 1Q10A 3HM6X 3TEXA 2KYWA 2MP2A 3NHEB 2PVGC 2DX1A 4ANWA 5FI0A 3W5UB 3ZJTA 4M02A 4HAYB 4A5KA 1ZOYB 5TR5A 2DAFA 2EMTA 1UNQA 3DBSA 2K8EA 1MK7B 4BFRA 1PGAA 1WZ0A 4B9KA 4WVFB 2CU3A 2OQBA 1W1HA 2MHJA 2IFSA 3ODWA 4MT7A 2D4QA 1UGJA 4MJSB 2DFKA 3HVZA 3FAHA 4II3B 4REZA 3IT6B 1NYQA 2VSZA 4HLEA 3V6CB 1N60A 2Q5WD 3RNEC 2DLWA 4FA6A 1OGWA 1U5EA 2DIKA 4K7WA 1P0RA 2DN6A 3FEHA 3TEYA 1C4PA 4GXBA 1KBLA 3WANA 2D3GA 2BPSA 2WS3B 1QOBA 3SD5A 5J3QA 1PLSA 2JRIB 3PLVA 2GOWA 1V5UA 4IFSA 1WGUA 2CU1A 2VRRB 1TKEA 2YEPB 4L23A 1M7RA 3VAWA 1AQCA 4AOFA 1TBEA 1N5XA 1WI0A 2AQ1B 2EJ8A 3VRAB 2RDHA 2WXFA 2D9WA 4DQOC 1UH6A 4K3CA 1UUPA 3B08A 5EE9A 5L81A 4NNJB 1IRSA 3KYCD 4RF0A 3SUZA 2M38A 5DHFB 4ZDVA 5E6PA 1X1GA 4RFBA 2LD9A 1LFDA 2J42A 1EF5A 2N7JA 4WIPA 3E56A 3D8EA 1QC6A 2L05A 5C16A 4FJZA 4TKNA 2WDQB 3NS8A 4MELA 2N0SB 3QBVB 3ZQ4A 2LOZA 3DBRB 4JK9A 4CHMA 2DHJA 2KJHB 2V4LA 1KLUD 2XBBC 4WJPA 1FCLA 1YNTE 2PIAA 4JIOU 1DDWA 3F5RA 2KMAA 4JQWC 3APFA 2B76B 4GLSC 2WWZA 2LOXA 4J3OD 4O1NA 1Y56A 2L0TA 4XDCA 1D6EC 3FLVA 2XN9C 1CMXB 2PMVA 4HB3B 2V3SA 1QOAA 3VQIA 2QILA 5EDSA 3P7ZA 4XZ4A 3DQVA 2LHEA 3R3MA 4YL8A 2PTLA 4YTNB 1MIXA 2LVQA 3H6NA 2LASA 3N1ZC 3AU5A 3Q8BA 1SE4A 1DGJA 1OFFA 3ZNZB 3AE8B 3V5WA 3U30A 4E74A 1FIQA 2ICIA 2LFIA 1AWDA 1WGQA 3ENEA 2KK8A 1SJED 3IHPC 2RPQA 2COAA 2V4IB 1F0ZA 2LJ5A 3CWIA 2FCMA 1ZXIA 2IZVB 4KKJA 3AE7B 1MVKA 1WM3A 2KFJA 5J18A 5J3YA 1D4BA 5JHBA 2WLBA 2MP2B 3T3OA 1EO6A 3BY4B 1E10A 3AI5A 2GBNA 4MT5A 1I4GA 1FFVA 4NAWA 3KUZA 1F2RC 1LW3A 2LVOA 4TV3A 5D7GA 1SBBB 3UZTA 2BCJA 2Z8LA 4KIKA 4ZRIA 1SF0A 4K7UA 4OT1A 1QQRA 4ILGB 1YN5A 2H7EA 1E5WA 1FOEA 2P0HA 2Y8GA 3ALBA 5GXGB 2IDYA 1L4ZB 2FCQA 1MHHE 2IO2B 2BS4B 5I4DA 1J0GA 1WF9A 3TUOA 2K6QA 2XQNM 4FBJB 1L0XB 1KJTA 2CS4A 1ISNA 2K49A 3A1QA 2GRIA 2H7DA 1L7YA 2KCJA 4NY0A 2MLBA 2DA0A 3C8YA 3L17A 5C5BA 2DZKA 1V86A 2FE8A 2YS3A 4JWSC 1C3TA 5KQ1A 1XQQA 3E9PA 1GG3A 4ACFA 3RULA 5D94A 4RGTA 3AJ4A 1GJZA 4HSIA 4DHJB 3HRDD 2I1KA 1OTRB 2OTXA 2G4SA 2P8VA 4YONA 4RH6A 3CSTA 5AZHA 2G45B 1UWMA 1SJHD 1XODA 3X23A 4F7GA 1RRBA 4EMOA 2YRYA 1TGZB 4WURA 3NRZA 2WXIA 2KC1A 1GAQB 1BTNA 1DYNA 1TT5B 2KANA 1J7CA 1GC7A 3DBHI 3NVWA 4TSSA 4GNKB 5J2RA 1WVHA 3MC9A 3W9CB 3RNGC 1T5XD 2AX5A 4PS3A 3T9LA 1L6VA 1JROA 1X05A 2WXGA 3SFDB 1NENB 2M17A 2WXQA 3CXBB 1WJUA 2ZCBA 3NWDA 1ET6A 2DKQA 4M00A 1V5PA 1JWMD 4TMAB 1V5TA 2BYVE 2I1JA 1WH3A 4KSLC 1P9DU 1ZDVA 3LXFA 3W1YA 3BK1A 4HK2A 2QJLA 5HE3A 1UWXA 4HB0B 2L76A 2CR5A 2Z0EB 4LNFA 4HATB 2UWQA 4YWGG 2FIDA 2Y5BB 2KLGA 1X1FA 4Z2MB 3VOQA 3RMKC 1SE9A 1PFDA 4LCDE 1GB1A 4DK5A 1L4DB 2L83A 4I6LB 2X0SA 4I6PA 1T3QA 1GC6A 1JWBD 1V5MA 4A6HA 2JF5A 1A5RA 2RNRB 1WFYA 4W9IA 2YEPF 4MGIE 4LTUA 1GUAB 4BBNC 2COPA 4ARIA 1UZXB 1BAKA 4NAWB 2LGIA 2D11A 2D10A 2GUMA 1HE8A 1OQNA 1EUVB 1ZE3D 2QMTA 2JRHA 3QQ8B 3KY9A 2ADZA 4KIKB 5DPWA 3QARA 1HBKA 4KAXB 4K7SA 1QKZA 1T77A 4IWOA 2KC2A 4ZYSA 4MK0A 1R7SA 4HPMB 3PO0A 4JKFA 4H2AA 4DXFA 5AUKA 1T0QC 1YIWA 2QEJC 2RDGA 2PEAA 3W1SA 1XEEA 2J7QB 4W9FA 2K5PA 3CSFA 4IM2A 2BS2B 1HEZE 4FLHA 2K0PA 2K2JA 4K81A 2ZPYA 1RFKA 2CJOA 2LGYA 3A1QB 2PE6B 2KUPA 2WQYB 2UZRA 1MG4A 3UQAA 2WP9B 4IW0A 1V89A 2YS5A 4ANUA 3EC8A 4ZRQA 4G3XB 4GMVA 3ML8A 4HCNB 1U5GA 1PMSA 1H8CA 2Y3AA 2ZNVB 1HXYD 1GPXA 4GSWA 2W2WA 4G0NB 5GMVA 1ZXHA 1U29A 2KIGA 5D3WA 2K8CA 4GDLA 4P1BC 2JWZA 5DCNA 2MJEA 3PRPB 2MH7A 5HE2A 4HVBA 3ZLZA 1XD3B 1RAXA 3UI3A 4FADA 4MSMB 3WAOA 1UNPA 3M63B 2GI9A 2CY4A 3LJUX 1F9JA 4JL9A 4N59A 2K2UA 5C2TB 1FM0D 4LNKA 4KZ0A 3Q8FA 1WJMA 3SNHA 1TKGA 1V1OA 3P63A 4HJKA 4KZCA 2ELAA 1TIFA 4E71A 2BBCA 3IAM1 1NEKB 3Q3OC 3SU8X 3HUIA 2RQ1A 3T3NA 2O6VD 3E9LA 3Q6BA 2QKLA 1FMAD 4QJ3B 3M1IB 3UQBA 1UBQA 2WXJA 1L0VB 2BKRB 3KVFB 1JWSD 2M19A 2ZVOA 3DPDA 3OHMB 3AE1B 4WWOA 3W2DA 4DWFA 2D3AA 4WAFA 1JMLA 4MDKE 2QDFA 4URKA 1FNVA 2WXMA 2KDIA 2EMSA 4HXDA 1V6EA 3TO1A 4HAZB 2MBBB 2MBOA 1YQBA 1C9FA 4BBKA 2G3QB 2FCNA 3NJTA 2JYTA 1DBHA 3BZDB 2KIEA 5BYRA 4KKIA 3NUHB 5HHDG 1I2HA 3HW2B 2JPHA 2V3PA 5BYQA 3BINA 1Y19B 1KRHA 2L00B 4HROA 1HZ5A 2M0AA 3O13A 5D3VA 4KDIC 3NW8A 5J3TA 2KO3A 4W9CA 1MI0A 3RCZA 1WY8A 1XLNA 3U7ZA 1MJDA 2IBIB 4HAUB 3WAPA 3L4PA 3UF8A 1I4XA 1OMWA 1FEHA 5M4YB 4AJYB 4WJOA 3GYOA 2OHFA 2C7HA 2WXRA 3L13A 3NSUA 2KNBA 1FGYA 4PQ0A 2KOXA 5IA7A 4C4VA 1KF6B 2KWDA 2RDBC 3ZIMA 2E3TA 1ZC3B 1FRRA 1WMHA 3LDZE 1I35A 1MG8A 1RYJA 1KZ7A 5D3XA 2KDEB 4BVUC 2DZJA 1PFJA 2W55A 2K1FA 1ZUD2 3DDCB 4IM0A 2FJLA 2A5UA 4WJ7A 3HIEA 4P1CC 4MGZE 2WDTB 3H9DA 1BMLC 1F2RI 1Q67A 3TW1A 3H7PA 4JKGA 2YT2A 2VZKB 4LLGM 1DOIA 4BKGA 3P2BA 3CIRB 2GBMA 2RSGA 3UINB 3U4EG 2UVMA 5HFYA 1QILA 3IVFA 4W9DA 2W54A 2LUEA 2LXCA 4KGRA 2J59M 1C78A 1YJIA 1EGXA 1TS5A 4G11A 1VCBA 4QAYA 1LO5D 2MW5A 3QJZA 2JZPA 4BAXA 5LOPB 5IRSA 1P7EA 2X18A 3VVWB 3Q3MC 3A33B 4GDLB 3J9CA 1XX0A 4QJ4B 2JUOA 2JVCA 2WYQA 3AH7A 3A58A 3RT3B 2EKIA 3EFCA 2WXOA 2GCJA 2DZMA 2RD0A 3AEFB 4USAA 1L0YB 3NG0A 1WJ4A 1MPEA 1L6UA 2PPHA 1FCCC 1Q5WB 4US8A 4MH0E 2HJ8A 4PK1A 1NBFC 1I4QA 1BTKA 3N3KB 1VZ7A 1XCGA 3PPAA 1N6ZA 2JX5A 2MQJA 3P1MA 3Q3JA 2PW9A 1OQYA 3APDA 1NTYA 3D32A 1FHWA 5IOIA 1XLOA 3FC4A 4AP4C 2ASQA 1FD6A 4RMAA 2ZCCA 2FJ9A 3PP2A 2DX5A 3L08A 4CQNA 3BVMA 3OG5A 5CHVC 3MHSD 1VJKA 1BT0A 2BB6A 5C3JB 5HKHA 1ZPSA 4K1RB 4XYCA 1AWEA 3GE8C 2D9ZA 3VR9B 3B9JA 4GMXB 4EEWA 3U12A 1EAZA 3TMPB 3V60A 3AE5B 2JT4B 2KZRA 3DBLI 2NTSA 1WGHA 3CMMB 1RLFA 1U5DA 4AJWA 3DOWA 4C00A 4NPNA 2FNJB 2LG1A 4JGHB 1QOFA 2MSED 3ODXA 4WQMA 1MKEA 1OEYA 4KX6B 3SBTA 1NYRA 4OW0A 2BYEA 2ZW0A 2GJYA 5C1ZA 4OZAA 5DHAB 1RFAA 2KT7A 2D3CA 4BKSA 1KLGD 1WX8A 3R2TA 5HI1A 2BB5A 1ENFA 1KZGA 1KM7A 2IYBA 1JW9D 1OQQA 1V49A 4ICUA 3P4PB 2FCSA 2AL6A 1G6JA 2FDQA 3AE3B 3PZ8A 3PZDA 1JRPA 4II2B 3SV1A 2PVOD 2V1YA 2ZNVC 3BK2A 2K9XA 1RRPB 3JSVA 2DHKA 2KTFA 1FAOA 2LVPA 4P7IA 2OJRA 4C4VB 3RN9C 1U4AA 2W3SA 3SHQA 3OLMD 3T06A 1WMHB 4HPPA 1ZC4B 3VUYA 1KH0A 4KDLB 3DHHC 2Z0QA 2MRPA 3R7QA 1MHXA 3C19A 2G4DB 1V5OA 1WXMA 3BWUD 3NVYA 5FR3A 4EE2A 2L2IA 5BMGA 1WRIA 3H7PB 4JKGB 3JW0X 4RM9A 2WXNA 1N5WA 2NPTA 2J0JA 3APCA 4RM8A 2ROZB 1E7VA 3AEGB 2DYQA 3L10B 1SHCA 1TJ6A 3DXEA 3FSSA 4CYEA 1S3SG 4RF1A 2FUG1 3RCPA 3MJWA 3DHIC 4K2PA 1IBXB 3L16A 3VHTC 4MACA 3NVVA 1WE7A 5LONB 2WDRB 1I4RA 1HA5A 1SXTA 2KN5A 2M0XA 1VZ6A 2WHIA 2E2XA 5JHGA 4PT5A 1FXAA 3A9JA 1K50A 2LJIA 2Y5PA 3A8PA 3ZXRA 5D3IB 2KMCA 2B3AA 3B0AA 3VFKA 2ELBA 3QCAA 4YSZB 4JLCA 4XWXA 4OSNA 3N32A 2XNAC 4F1SA 2YSZA 1UD7A 1P5TA 2LRUA 2DENB 4DBGA 1WR6E 2QKMA 1TZ1A 3LJ3A 1VZ8A 2MX2A 3MDBC 4YSXB 2MFQA 3ZNGC 3A4RA 5T8IA 4HJGE 3GZNI 5HG2A 3GP7A 3VRBB 5AEKB 1WXVA 4GPTB 1NU2A 1QZEA 4GB9A 1ZP0B 3Q14C 4YXDB 3G9WA 3AU4A 2RLOA 1ZVRA 1C4AA 2LGSA 1JWAD 4LDTB 3R66C 3TIXA 5BMHA 1VBGA 4M01A 1YX5B 5EE1A 3KYDD 2MDXA 2XK5A 1I7AA 4MGYE 1D5MC 4F8CB 4W9KA 4TYZA 1GNUA 1HTQA 2N23A 4ANVA 1MI1A 5GOWB 2IO1B 3AE6B 2GCLA 3A4SC 2K39A 2X8XX 4WQOB 2KLCA 2VZKD 1PQSA 2FAZA 4JKCA 2I5CA 4M0WA 4XWTA 1M94A 1KI1B 2MKRA 1Q1OA 1B9RA 2J53A 3EHVA 2KD0A 3IAS1 3ONSA 2VKIA 4JKEA 1YJ1A 4A8XC 3IT4B 3GE3C 5IP4D 2HJ1A 1EM7A 4DIXA 1XKEA 4K17A 4DBBA 1TQZA 2HD5B 3O65B 2KTRA 4EFOA 3D8FA 5E6JA 1T0SC 1K52A 1QOGA 3DVGY 1ZM0A 5JHAA 3Q69A 4NQLB 5C6RA 1F52A 1EWCA 3JSVB 2K8BA 5EE3A 5HE0A 2D07B 3R7RA 3QWMA 1Z87A 5C79A 1VR9A 4IWPA 2BYFA 5EFXA 3IFWB 1YX6B 3UIPB 1ZGUB 1E6EB 1X1MA 3P4QB 1HZ6A 3VTWA 2VH2A 5MPOA 2M56B 2ZPNA 3N7CA 2LHDA 2WX0A 2ZW1A 4GN1A 3PLUA 1TYGB 1UNRA 4DDID 3VH3B 4A6KA 4WJQA 2HRJA 3B2GA 1ROEA 2CHZA 2REXA 3Q8EA 2MEKA 3UGBB 3IBEA 4YTPB 1V8CA 4LNNA 1LB1A 2KQ4X 2PJHA 1JQ4A 2RSUA 3ZRFA 3UIOB 4NAMA 1NI2A 2FIFA 3ZRCA 1V9JA 4JKDA 1LQBA 1J0WA 1A70A 4AWJA 2R61A 2G9HD 1UPRA 3OJ4B 2D5GA 1RJ2A 5IN7A 1MAIA 1P3RA 2G35A 1YN3A 2KQ7A 1XCTL 1OY2A 4GDKA 2N7EA 3Q3NC 4L1RA 2J4XA 2MBQA 1D5ZC 2JY6A 4GOCA 4WSFA 4IDIA 4DDGD 4GZUA 3N9YC 1DOXA 5C23A 1WYGA 5JH5C 2YT1A 1X11A 3IXSA 3DWMA 3TJPA 5DIFB 3DVNV 2Z13A 2DNFA 2KN4A 4H8SA 4OHJA 5BO4B 4DXAB 5J17A 1EVHA 3MJ5A 1EWYC 1VLBA 2KR0A 3PV1A 4KHOA 1P7FA 4PS8A 5CTRC 2QCZA 2BYTA 2D9VA 1N63A 3PSCA 3V6EB 3MC0B 3I3TB 4Y94A 4FULA 2NBVA 4BZAA 2D9XA 4A90A 3ZJUA 4PNKA 1AN8A 3GOEA 4YT0B 2ONQA 1V80A 4ZHPA 4GGQA 4GU2A 5C5BB 5JVLA 2XK5B 3C0RB 1RWSA 4PYUA 3URYA 2YLMA 1XT9B 3QK0A 1TS2A 4D0NB 4BOZB 4A6QA 2RR9A 1SE2A 2KFKA 2LZ6A 4ARCA 4MGKE 1E0ZA 2J52A 4A9AA 2D2QA 1TXDA 4W9JA
chains in the Genus database with same CATH topology
3A9KA 1KLVA 2IO3B 3MTNB 2WX1A 1WX9A 5L95C 2KTRB 3KRWA 4DX90 5D2MB 1U5FA 2BGFA 2GBRA 2D9YA 2BF8B 4M8NA 2J0MA 4ZYNA 2R2OA 3PVWA 4PS7A 3NOBA 2UZSA 1WJ1A 4B6WA 4FN2A 2RVBB 2J0KA 5IAAC 4BOSC 3ECIA 5DPTA 1VD2A 3SBGA 1U27A 4B95A 1WZ3A 1UGMA 1FB8A 3PREA 3ENBA 3PVUA 3WA0A 2WH5A 4A6FA 2R2QA 3QA8A 2XEWA 3HIZA 2KWVB 3PGEA 1L2NA 1LXDA 3NY5A 1Y5OA 4L6EA 5KHOA 2Q13A 4W9EA 4GDKB 2CQUA 2Z0DB 2DKPA 2LKOA 4DHJD 4HPLB 2M4NA 4MSQB 5D6JB 3NZUA 4C0AA 5AZFA 4NJ7A 3ODOA 4EZLA 3H1UA 1ZSQA 3VDZA 1WGRA 3DXCA 4G50A 1BWNA 3U7DA 3E9OA 1FHOA 3NZSA 3PRMB 3DVGX 5JLJB 2CHWA 2NR2A 1WG7A 1XD4A 4IAPA 5G55A 2FUHB 1MK9B 2NBVB 4B6HA 3PT2B 4FHJA 1WX7A 1QQGA 3HQCA 3VTVA 2R0DA 1NTVA 5LLIA 2NS5A 3DVNU 4M8MA 4HWIB 2RGFA 2KFKB 2DAJA 3PG7A 5AZGA 3O96A 2HE7A 3A9KB 4ANXA 5JHHA 4FHKA 1ACAA 2EKEC 2KQSA 1WR1A 2KVRA 4EZJA 3RD2A 4CO7A 1WGGA 2MA9B 1AARA 3RYTA 5JP4A 2M1MA 2C7NB 1P1AA 2Z59B 2KWCA 1Y8RC 4BKTA 2MWNB 2VRWB 2O6VA 3QWZB 1TTNA 4K2OA 1ZW7A 3VUWA 3EPYA 1KOTA 4W9GA 2DYMA 4EZKA 1WXAA 3PTFC 4F7HA 5CHFA 2LXAA 4IC7B 2LGXA 3JYUA 1IYFA 2JP2A 1WRDB 2LYDA 2ZZPB 4XX5A 1B55A 3BJIA 1HB6A 1WGDA 3E66A 4HHVA 5E6NA 1FHXA 4A6FB 5D3YA 2BKFA 2R09A 4HB4B 4LJOB 3TL5A 1WJNA 2JXXA 4WAAA 3U8ZA 4NQKE 2AEHA 1K5DB 4NSWA 1C1YB 3TCAA 1D3ZA 4IOYX 3SYXA 3AULA 4HDOA 3F0WA 4EJNA 4ILHA 3RZWC 3K9PB 2DYNA 3ML9A 3HHMA 2NCNA 4E3CA 4F7ZA 2KX0A 3PS6A 2GBKA 5JZEB 3MPXA 2GBJA 4KHBB 2N7DA 2RGNB 1FXTB 1JRUA 3ZKJC 3KRXA 1NVLA 1W1DA 2KDFB 1WJ6A 3T8MA 5FR6A 1IP9A 1ST7A 3CF6E 1DDVA 3M3JA 3PVLA 4DHZB 4HDQA 2Y7BA 2GMIC 2N1VA 3ULBA 2YF0A 2KHWB 4ILJA 1XR0B 1UEFA 2IY1B 3ZO5B 2Z0PA 3ZDTA 1OEYJ 3DXDA 3DBRI 2C60A 2CY5A 3AXCA 2K00A 2AWTA 2DHIA 4IG7B 1UELA 1ZKHA 5IJMA 2Z0OA 3V61A 4PYZA 1MPHA 3JVZX 3ZVVA 4OVVA 5LXHA 1P98A 2O6VB 4JKHA 3A8QA 4J6IA 3S2AA 1KC7A 2N4FA 2M14A 1WYWB 3HM3A 2DX5B 1S1QB 4CHKA 2BWFA 3B1LX 3VXWA 4EKUA 2LGDA 3ZTDA 1P6SA 4HAXB 3ZNID 3KUDB 5CX3A 2CB8A 1UPQA 3IG3A 5KHQA 1W1GA 3KZ1A 4WJNA 3W1SC 5FI1A 3A98B 2HTHA 4F7UP 2R82A 2YT0A 5DPSA 2LBBA 1V61A 1E8ZA 3ZVRA 2KKCA 5LXIB 3EECA 1YD8U 2JZ3B 2COCA 2N1WA 4CHJA 2NBUA 2CRFA 3WAMA 1V81A 2A4ZA 2MBEA 4HAWB 4IUMB 3TBLD 2N0YA 2YS1A 1WI1A 3HK0A 5DPRA 5HE1A 2C7MB 3N30A 4MEMA 3RZFA 4MM3A 1U2BA 5DH9B 3WALA 4WWNA 3K9OB 1P3QU 4I6NB 3M62B 1FGZA 1H10A 2C5LC 4IWQA 2PE9A 1LM8B 1NDDA 4KV2A 1MIZB 2NPTB 3OJ3A 2NZ8B 3M95A 2L8JA 2JZZA 1I42A 2ABDA 1T0YA 1E8WA 1WXSA 2KWUB 1X86A 2DZIA 5KQ4A 2BWES 2N9PC 2DTCA 2EC1A 3KUCB 2P0FA 2MWSB 2CODA 4HB2B 4KSKC 3H7SA 1EF1A 1K5GB 2KDBA 2KX3A 2MCNB 3RUIB 1N3HA 1SIFA 3A9JB 2AL3A 4MY6A 2GS0A 2CAYA 3SDLC 2W2XD 3PSEB 4AUQC 2ZEQA 3VUXA 4BBNF 4LJPB 2COFA 2L1CA 2QHOA 4N9F4 4WWPA 2W2XC 2DYOA 2MBHA 3ZW3A 2O2VA 3VH4B 1WGYA 2ZJDA 2ROVA 2NVUI 4JKBA 4DX8A 2IY0B 1HB8A 2NMBA 2LWPA 3ML4A 1E8XA 3D8DA 2KJRA 2Y8FA 4JK7A 1E90A 4IM3A 2LULA 4Z2NA 3ULCA 2LRWA 4TQ1A 3VTUA 4A20A 3VIAA 2HTHB 3PHWB 2L0FA 4M0WB 1H4RA 5E6OA 5CLLB 3V62A 4FJVB 1NTIA 1VBHA 4GIVA 1K8RB 3QAQA 3OAWA 4NJ6A 2DHZA 3EFUA 3QIJA 3L0WB 4JK8A 2K25A 3QHTA 4EOYA 3TVVA 2KXJA 2I5FA 2N9XA 1J8CA 3Q3FA 4MJSA 4JKAA 2K6DB 3PRZA 2LI5A 1DIKA 1E8YA 4TUUA 3KSYA 3L54A 4HCPB 2C9WB 3TFMA 2V76A 4LDTD 4A3PA 4ZRKA 4ZRJA 4DHZE 4OVUA 2CKHB 2YVCA 3DCGA 1WE6A 1UBIA 2AYOB 2IO0B 1IPGA 3CIKA 3GYPA 1R4NI 1V88A 3SO6A 5D27A 2N9EB 2W9NA 1WIAA 4HAVB 3ZUNA 3QC8B 3P6AA 2KJ6A 1M7EA 4BKSD 2CHXA 4FJYA 1E7UA 2L3ZA 4ICVA 4A3OA 2O2VB 1J19A 1Z2MA 2M8SA 4KHAA 5KCVA 2KGXB 3X0WA 1Q0WB 2DYBA 2UYZB 4W9LA 4X57B 3ZTCA 5CHWA 1DDMA 4EUTA 2NBWB 1V2YA 1JDEA 3WYFB 4TQ0A 2ZVNA 1R4MI 5L83A 3WIMA 4XC2A 3KW5B 4W9HA 2P0DA 2RUKB 2L7RA 3ZNHB 3OANA 3FM8C 1WM2A 3PHXB 5DI9B 3KH0A 5G2NA 3PEGA 2PZ1A 1Z5SB 2IYDB 3ZDMC 4KVGB 5CLQB 3QX1A 4ASWC 2OOBB 2K8HA 3FP5A 1GGOA 1DROA 1SGHA 3HM6X 2MP2A 3NHEB 2DX1A 4ANWA 5FI0A 4HAYB 4A5KA 5TR5A 2DAFA 2EMTA 1UNQA 3DBSA 1MK7B 4BFRA 1WZ0A 4B9KA 4WVFB 2OQBA 1W1HA 2IFSA 3ODWA 4MT7A 2D4QA 4MJSB 2DFKA 4II3B 2VSZA 4HLEA 3V6CB 2DLWA 4FA6A 1OGWA 1U5EA 2DIKA 4K7WA 1P0RA 2DN6A 3FEHA 4GXBA 1KBLA 3WANA 2D3GA 2BPSA 3SD5A 5J3QA 1PLSA 2JRIB 3PLVA 2GOWA 1V5UA 4IFSA 1WGUA 2CU1A 2VRRB 1M7RA 3VAWA 1AQCA 4AOFA 1TBEA 1WI0A 2EJ8A 2D9WA 1UH6A 3B08A 5L81A 4NNJB 1IRSA 3KYCD 3SUZA 2M38A 5DHFB 4ZDVA 5E6PA 1X1GA 2LD9A 1LFDA 1EF5A 3D8EA 1QC6A 2L05A 5C16A 4FJZA 4TKNA 3NS8A 4MELA 3QBVB 2LOZA 4JK9A 4CHMA 2DHJA 2KJHB 2V4LA 2XBBC 4WJPA 4JIOU 1DDWA 3F5RA 2KMAA 4JQWC 3APFA 2WWZA 2LOXA 2L0TA 3FLVA 1CMXB 2V3SA 4HB3B 3VQIA 5EDSA 3P7ZA 4XZ4A 3DQVA 3R3MA 4YL8A 1MIXA 2LVQA 3H6NA 2LASA 3AU5A 3ZNZB 3V5WA 3U30A 4E74A 1WGQA 3ENEA 2KK8A 3IHPC 2RPQA 2COAA 2LJ5A 2FCMA 2IZVB 1WM3A 2KFJA 5J18A 5J3YA 5JHBA 2MP2B 1EO6A 3BY4B 3AI5A 2GBNA 4NAWA 3KUZA 1LW3A 2LVOA 4TV3A 5D7GA 3UZTA 2BCJA 4KIKA 4ZRIA 4K7UA 4ILGB 2H7EA 1E5WA 1FOEA 2P0HA 2Y8GA 3ALBA 2FCQA 2IO2B 1J0GA 1WF9A 2K6QA 2XQNM 4FBJB 1KJTA 2CS4A 1ISNA 3A1QA 2H7DA 1L7YA 2KCJA 4NY0A 2MLBA 2DA0A 3L17A 5C5BA 2DZKA 1V86A 2YS3A 1C3TA 5KQ1A 1XQQA 3E9PA 1GG3A 3RULA 5D94A 3AJ4A 1GJZA 4DHJB 2I1KA 1OTRB 2OTXA 2G4SA 2P8VA 4YONA 3CSTA 5AZHA 2G45B 1XODA 3X23A 4F7GA 1RRBA 4EMOA 2YRYA 1TGZB 2KC1A 1BTNA 1DYNA 2KANA 1GC7A 3DBHI 5J2RA 1WVHA 4PS3A 3T9LA 1X05A 2M17A 3CXBB 1WJUA 2ZCBA 2DKQA 1V5PA 1V5TA 2BYVE 2I1JA 1WH3A 4KSLC 1P9DU 3W1YA 4HK2A 5HE3A 4HB0B 2L76A 2CR5A 2Z0EB 4HATB 2UWQA 2FIDA 2Y5BB 2KLGA 1X1FA 4Z2MB 3VOQA 1SE9A 4LCDE 4DK5A 4I6LB 2X0SA 4I6PA 1GC6A 1V5MA 4A6HA 2JF5A 1A5RA 2RNRB 1WFYA 4W9IA 4MGIE 1GUAB 4BBNC 2COPA 1UZXB 1BAKA 4NAWB 2D11A 2D10A 1HE8A 1OQNA 1EUVB 2JRHA 3QQ8B 3KY9A 2ADZA 4KIKB 5DPWA 3QARA 1HBKA 4KAXB 4K7SA 4IWOA 2KC2A 4MK0A 4HPMB 4JKFA 1YIWA 2PEAA 3W1SA 2J7QB 4W9FA 3CSFA 4IM2A 4FLHA 2K2JA 4K81A 2ZPYA 2LGYA 3A1QB 2PE6B 2KUPA 2UZRA 3UQAA 4IW0A 1V89A 2YS5A 4ANUA 3EC8A 4G3XB 4GMVA 3ML8A 4HCNB 1U5GA 1PMSA 1H8CA 2ZNVB 4GSWA 2W2WA 4G0NB 5GMVA 4GDLA 1U29A 5D3WA 2K8CA 2JWZA 5DCNA 3PRPB 5HE2A 4HVBA 3ZLZA 1XD3B 1RAXA 4FADA 4MSMB 3WAOA 1UNPA 3M63B 2CY4A 3LJUX 1F9JA 4JL9A 2K2UA 4KZ0A 1WJMA 3SNHA 4HJKA 4KZCA 2ELAA 4E71A 3SU8X 2RQ1A 2O6VD 3E9LA 2QKLA 3M1IB 3UQBA 1UBQA 2BKRB 3KVFB 2ZVOA 3DPDA 4WWOA 4DWFA 4MDKE 4URKA 4HXDA 2KDIA 2EMSA 1V6EA 3TO1A 4HAZB 2MBBB 2MBOA 1YQBA 4BBKA 2G3QB 2FCNA 1DBHA 1I2HA 3HW2B 2JPHA 3BINA 1Y19B 2L00B 5D3VA 4KDIC 5J3TA 2KO3A 4W9CA 3RCZA 1WY8A 2IBIB 4HAUB 3WAPA 3UF8A 1OMWA 4AJYB 4WJOA 3GYOA 2C7HA 3L13A 5IA7A 3NSUA 2KNBA 1FGYA 4PQ0A 2KOXA 3ZIMA 1ZC3B 3LDZE 1WMHA 1I35A 1MG8A 1KZ7A 5D3XA 2KDEB 4BVUC 2DZJA 1PFJA 2K1FA 4IM0A 3DDCB 2FJLA 2A5UA 4WJ7A 4MGZE 2WDTB 3H9DA 1Q67A 3TW1A 3H7PA 4JKGA 4BKGA 3P2BA 2GBMA 2RSGA 3UINB 2UVMA 3IVFA 4W9DA 2LUEA 2LXCA 2J59M 1EGXA 4G11A 1VCBA 2MW5A 3QJZA 5LOPB 2X18A 3VVWB 3A33B 4GDLB 1XX0A 2JUOA 2JVCA 2WYQA 3RT3B 2GCJA 2DZMA 2RD0A 1WJ4A 2PPHA 1Q5WB 4MH0E 2HJ8A 1NBFC 1BTKA 3N3KB 1XCGA 3PPAA 2MQJA 3Q3JA 1OQYA 3APDA 1NTYA 3D32A 1FHWA 4AP4C 2ASQA 4RMAA 2ZCCA 2FJ9A 3PP2A 2DX5A 3L08A 5CHVC 3MHSD 1BT0A 5HKHA 4K1RB 1AWEA 2D9ZA 4GMXB 4EEWA 1EAZA 3TMPB 3V60A 2JT4B 2KZRA 3DBLI 1WGHA 3CMMB 1RLFA 1U5DA 4AJWA 3DOWA 4NPNA 2FNJB 2LG1A 4JGHB 2MSED 3ODXA 1MKEA 1OEYA 3SBTA 2BYEA 2GJYA 5C1ZA 5DHAB 1RFAA 4BKSA 1WX8A 1KZGA 1KM7A 2IYBA 1V49A 4ICUA 2FCSA 2AL6A 1G6JA 2FDQA 3PZDA 4II2B 3SV1A 2V1YA 2ZNVC 1RRPB 3JSVA 2DHKA 2KTFA 1FAOA 2LVPA 4P7IA 2OJRA 1U4AA 3SHQA 3OLMD 3T06A 1WMHB 3VUYA 1ZC4B 4KDLB 2Z0QA 2MRPA 3R7QA 2G4DB 1V5OA 1WXMA 2L2IA 3H7PB 4JKGB 3JW0X 4RM9A 2NPTA 2J0JA 3APCA 4RM8A 2ROZB 1E7VA 2DYQA 3L10B 1SHCA 1TJ6A 3DXEA 3FSSA 4CYEA 1S3SG 3RCPA 3MJWA 4K2PA 3L16A 3VHTC 1WE7A 5LONB 2KN5A 2M0XA 2E2XA 5JHGA 3A9JA 3A8PA 2KMCA 2B3AA 3B0AA 3VFKA 2ELBA 3QCAA 4JLCA 4XWXA 4F1SA 3N32A 2YSZA 1UD7A 1P5TA 2LRUA 2DENB 4DBGA 1WR6E 2QKMA 1TZ1A 3LJ3A 2MX2A 3MDBC 2MFQA 3ZNGC 3A4RA 3GZNI 5AEKB 1WXVA 4GPTB 1NU2A 1QZEA 4GB9A 3G9WA 3AU4A 2RLOA 1ZVRA 4LDTB 3R66C 3TIXA 1VBGA 1YX5B 3KYDD 2MDXA 2XK5A 1I7AA 4MGYE 4F8CB 4W9KA 4TYZA 1GNUA 2N23A 4ANVA 5GOWB 2IO1B 2GCLA 3A4SC 2K39A 4WQOB 2KLCA 1PQSA 2FAZA 4JKCA 2I5CA 1M94A 1KI1B 2MKRA 1Q1OA 3EHVA 2KD0A 3ONSA 2VKIA 4JKEA 1YJ1A 1XKEA 4K17A 4DBBA 1TQZA 2HD5B 3O65B 2KTRA 4EFOA 3D8FA 5JHAA 3DVGY 1ZM0A 4NQLB 5C6RA 3JSVB 2K8BA 5HE0A 2D07B 3R7RA 3QWMA 1Z87A 5C79A 4IWPA 2BYFA 5EFXA 3IFWB 1YX6B 3UIPB 1ZGUB 1X1MA 3VTWA 2ZPNA 3N7CA 2WX0A 4GN1A 3PLUA 1UNRA 4DDID 3VH3B 4A6KA 4WJQA 2HRJA 2CHZA 2REXA 3UGBB 3IBEA 1LB1A 2PJHA 2RSUA 3ZRFA 3UIOB 1NI2A 2FIFA 3ZRCA 1V9JA 4JKDA 1LQBA 1J0WA 4AWJA 1UPRA 3OJ4B 1RJ2A 1MAIA 1P3RA 2G35A 2KQ7A 1OY2A 4GDKA 2N7EA 2MBQA 2JY6A 4GOCA 4WSFA 4DDGD 4GZUA 5C23A 5JH5C 2YT1A 1X11A 3TJPA 5DIFB 3DVNV 4H8SA 5BO4B 4DXAB 5J17A 1EVHA 3PV1A 4PS8A 4KHOA 5CTRC 2D9VA 3PSCA 3V6EB 3I3TB 4Y94A 4FULA 2D9XA 4PNKA 3GOEA 1V80A 4GGQA 4GU2A 5C5BB 5JVLA 2XK5B 3C0RB 4PYUA 2YLMA 1XT9B 3QK0A 4D0NB 4BOZB 2RR9A 2KFKA 2LZ6A 4MGKE 2D2QA 1TXDA 4W9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9K A;  1KLV A;  2IO3 B;  3MTN B;  2WX1 A;  1WX9 A;  5L95 C;  2KTR B;  3KRW A;  4DX9 0;  5D2M B;  1U5F A;  2BGF A;  2GBR A;  2D9Y A;  2BF8 B;  4M8N A;  2J0M A;  4ZYN A;  2R2O A;  3PVW A;  4PS7 A;  3NOB A;  2UZS A;  1WJ1 A;  4B6W A;  4FN2 A;  2RVB B;  2J0K A;  5IAA C;  4BOS C;  3ECI A;  5DPT A;  1VD2 A;  1U27 A;  4B95 A;  1WZ3 A;  1UGM A;  1FB8 A;  3PRE A;  3PVU A;  3WA0 A;  2WH5 A;  4A6F A;  2R2Q A;  3QA8 A;  2XEW A;  3HIZ A;  2KWV B;  3PGE A;  1L2N A;  1LXD A;  3NY5 A;  1Y5O A;  4L6E A;  5KHO A;  2Q13 A;  4W9E A;  4GDK B;  2CQU A;  2Z0D B;  2DKP A;  2LKO A;  4DHJ D;  4HPL B;  2M4N A;  4MSQ B;  5D6J B;  3NZU A;  4C0A A;  5AZF A;  4NJ7 A;  3ODO A;  4EZL A;  3H1U A;  1ZSQ A;  3VDZ A;  1WGR A;  3DXC A;  4G50 A;  1BWN A;  3U7D A;  3NZS A;  1FHO A;  3PRM B;  3DVG X;  5JLJ B;  2CHW A;  2NR2 A;  1WG7 A;  1XD4 A;  4IAP A;  5G55 A;  2FUH B;  1MK9 B;  2NBV B;  4B6H A;  3PT2 B;  4FHJ A;  1WX7 A;  1QQG A;  3HQC A;  3VTV A;  2R0D A;  1NTV A;  5LLI A;  2NS5 A;  3DVN U;  4M8M A;  4HWI B;  2RGF A;  2KFK B;  2DAJ A;  3PG7 A;  5AZG A;  3O96 A;  2HE7 A;  3A9K B;  4ANX A;  5JHH A;  4FHK A;  1ACA A;  2EKE C;  2KQS A;  1WR1 A;  2KVR A;  4EZJ A;  3RD2 A;  4CO7 A;  1WGG A;  2MA9 B;  1AAR A;  3RYT A;  5JP4 A;  2M1M A;  2C7N B;  1P1A A;  2Z59 B;  2KWC A;  1Y8R C;  4BKT A;  2MWN B;  2VRW B;  2O6V A;  3QWZ B;  1TTN A;  4K2O A;  1ZW7 A;  3VUW A;  3EPY A;  1KOT A;  4W9G A;  2DYM A;  4EZK A;  1WXA A;  3PTF C;  4F7H A;  5CHF A;  2LXA A;  4IC7 B;  2LGX A;  3JYU A;  1IYF A;  2JP2 A;  1WRD B;  2LYD A;  2ZZP B;  4XX5 A;  1B55 A;  3BJI A;  1HB6 A;  1WGD A;  4HHV A;  5E6N A;  1FHX A;  4A6F B;  5D3Y A;  2BKF A;  2R09 A;  4HB4 B;  4LJO B;  3TL5 A;  1WJN A;  2JXX A;  4WAA A;  3U8Z A;  4NQK E;  2AEH A;  1K5D B;  4NSW A;  1C1Y B;  3TCA A;  1D3Z A;  4IOY X;  3SYX A;  3AUL A;  4HDO A;  3F0W A;  4EJN A;  3RZW C;  3K9P B;  2DYN A;  3ML9 A;  3HHM A;  2NCN A;  4E3C A;  4F7Z A;  2KX0 A;  3PS6 A;  2GBK A;  5JZE B;  3MPX A;  2GBJ A;  4KHB B;  2N7D A;  2RGN B;  1FXT B;  1JRU A;  3ZKJ C;  3KRX A;  1NVL A;  1W1D A;  2KDF B;  1WJ6 A;  3T8M A;  5FR6 A;  1IP9 A;  1ST7 A;  3CF6 E;  1DDV A;  3M3J A;  3PVL A;  4DHZ B;  4HDQ A;  2Y7B A;  2GMI C;  2N1V A;  3ULB A;  2YF0 A;  2KHW B;  1XR0 B;  1UEF A;  2IY1 B;  3ZO5 B;  2Z0P A;  3ZDT A;  1OEY J;  3DXD A;  3DBR I;  2C60 A;  2CY5 A;  3AXC A;  2K00 A;  2AWT A;  2DHI A;  4IG7 B;  1UEL A;  1ZKH A;  5IJM A;  2Z0O A;  3V61 A;  4PYZ A;  1MPH A;  3JVZ X;  3ZVV A;  4OVV A;  5LXH A;  1P98 A;  2O6V B;  3A8Q A;  4J6I A;  3S2A A;  2N4F A;  2M14 A;  1WYW B;  3HM3 A;  2DX5 B;  1S1Q B;  4CHK A;  2BWF A;  3B1L X;  3VXW A;  4EKU A;  2LGD A;  3ZTD A;  1P6S A;  4HAX B;  3ZNI D;  3KUD B;  5CX3 A;  2CB8 A;  1UPQ A;  3IG3 A;  5KHQ A;  1W1G A;  3KZ1 A;  4WJN A;  3W1S C;  5FI1 A;  3A98 B;  2HTH A;  4F7U P;  2YT0 A;  5DPS A;  2LBB A;  1V61 A;  1E8Z A;  3ZVR A;  2KKC A;  5LXI B;  3EEC A;  1YD8 U;  2JZ3 B;  2COC A;  2N1W A;  4CHJ A;  2NBU A;  2CRF A;  3WAM A;  1V81 A;  2A4Z A;  2MBE A;  4HAW B;  4IUM B;  3TBL D;  2N0Y A;  2YS1 A;  1WI1 A;  3HK0 A;  5DPR A;  5HE1 A;  2C7M B;  3N30 A;  4MEM A;  3RZF A;  4MM3 A;  1U2B A;  5DH9 B;  3WAL A;  4WWN A;  3K9O B;  1P3Q U;  4I6N B;  3M62 B;  1FGZ A;  1H10 A;  2C5L C;  4IWQ A;  2PE9 A;  1LM8 B;  1NDD A;  4KV2 A;  1MIZ B;  2NPT B;  3OJ3 A;  2NZ8 B;  3M95 A;  2L8J A;  2JZZ A;  1I42 A;  2ABD A;  1T0Y A;  1E8W A;  1WXS A;  2KWU B;  1X86 A;  2DZI A;  5KQ4 A;  2BWE S;  2N9P C;  2DTC A;  2EC1 A;  3KUC B;  2P0F A;  2MWS B;  2COD A;  4HB2 B;  4KSK C;  3H7S A;  1EF1 A;  1K5G B;  2KDB A;  2KX3 A;  2MCN B;  3RUI B;  1N3H A;  1SIF A;  3A9J B;  2AL3 A;  4MY6 A;  2GS0 A;  2CAY A;  3SDL C;  2W2X D;  3PSE B;  4AUQ C;  2ZEQ A;  3VUX A;  4BBN F;  4LJP B;  2COF A;  2L1C A;  2QHO A;  4N9F 4;  4WWP A;  2W2X C;  2DYO A;  2MBH A;  3ZW3 A;  2O2V A;  3VH4 B;  1WGY A;  2ZJD A;  2ROV A;  2NVU I;  4DX8 A;  2IY0 B;  1HB8 A;  2NMB A;  2LWP A;  3ML4 A;  1E8X A;  3D8D A;  2KJR A;  2Y8F A;  1E90 A;  4IM3 A;  2LUL A;  4Z2N A;  3ULC A;  2LRW A;  4TQ1 A;  3VTU A;  4A20 A;  3VIA A;  2HTH B;  3PHW B;  2L0F A;  4M0W B;  1H4R A;  5E6O A;  5CLL B;  3V62 A;  4FJV B;  1NTI A;  4GIV A;  1K8R B;  3QAQ A;  3OAW A;  4NJ6 A;  2DHZ A;  3EFU A;  3QIJ A;  3L0W B;  2K25 A;  3QHT A;  4EOY A;  3TVV A;  2KXJ A;  2I5F A;  2N9X A;  1J8C A;  3Q3F A;  4MJS A;  2K6D B;  3PRZ A;  2LI5 A;  1E8Y A;  4TUU A;  3KSY A;  3L54 A;  4HCP B;  2C9W B;  3TFM A;  2V76 A;  4LDT D;  4A3P A;  4ZRK A;  4ZRJ A;  4DHZ E;  4OVU A;  2CKH B;  2YVC A;  3DCG A;  1WE6 A;  1UBI A;  2AYO B;  2IO0 B;  1IPG A;  3CIK A;  3GYP A;  1R4N I;  1V88 A;  3SO6 A;  5D27 A;  2N9E B;  2W9N A;  1WIA A;  4HAV B;  3ZUN A;  3QC8 B;  3P6A A;  2KJ6 A;  1M7E A;  4BKS D;  2CHX A;  4FJY A;  1E7U A;  2L3Z A;  4ICV A;  4A3O A;  2O2V B;  1J19 A;  1Z2M A;  2M8S A;  4KHA A;  5KCV A;  2KGX B;  3X0W A;  1Q0W B;  2DYB A;  2UYZ B;  4W9L A;  4X57 B;  3ZTC A;  5CHW A;  1DDM A;  4EUT A;  2NBW B;  1V2Y A;  3WYF B;  4TQ0 A;  2ZVN A;  1R4M I;  5L83 A;  3WIM A;  4XC2 A;  3KW5 B;  4W9H A;  2P0D A;  2RUK B;  2L7R A;  3ZNH B;  3OAN A;  3FM8 C;  1WM2 A;  3PHX B;  5DI9 B;  3KH0 A;  5G2N A;  3PEG A;  2PZ1 A;  1Z5S B;  2IYD B;  3ZDM C;  4KVG B;  5CLQ B;  3QX1 A;  4ASW C;  2OOB B;  2K8H A;  3FP5 A;  1DRO A;  1SGH A;  3HM6 X;  2MP2 A;  3NHE B;  2DX1 A;  4ANW A;  5FI0 A;  4HAY B;  4A5K A;  5TR5 A;  2DAF A;  2EMT A;  1UNQ A;  3DBS A;  1MK7 B;  4BFR A;  1WZ0 A;  4B9K A;  4WVF B;  2OQB A;  1W1H A;  2IFS A;  3ODW A;  4MT7 A;  2D4Q A;  4MJS B;  2DFK A;  4II3 B;  2VSZ A;  4HLE A;  3V6C B;  2DLW A;  4FA6 A;  1OGW A;  1U5E A;  4K7W A;  1P0R A;  2DN6 A;  3FEH A;  4GXB A;  3WAN A;  2D3G A;  2BPS A;  3SD5 A;  5J3Q A;  1PLS A;  2JRI B;  3PLV A;  2GOW A;  1V5U A;  4IFS A;  1WGU A;  2CU1 A;  2VRR B;  1M7R A;  3VAW A;  1AQC A;  4AOF A;  1TBE A;  1WI0 A;  2EJ8 A;  2D9W A;  1UH6 A;  3B08 A;  5L81 A;  4NNJ B;  1IRS A;  3KYC D;  3SUZ A;  2M38 A;  5DHF B;  4ZDV A;  5E6P A;  1X1G A;  2LD9 A;  1LFD A;  1EF5 A;  3D8E A;  1QC6 A;  2L05 A;  5C16 A;  4FJZ A;  4TKN A;  3NS8 A;  4MEL A;  3QBV B;  2LOZ A;  4CHM A;  2DHJ A;  2KJH B;  2V4L A;  2XBB C;  4WJP A;  4JIO U;  1DDW A;  3F5R A;  2KMA A;  4JQW C;  3APF A;  2WWZ A;  2LOX A;  2L0T A;  3FLV A;  1CMX B;  2V3S A;  4HB3 B;  3VQI A;  5EDS A;  3P7Z A;  4XZ4 A;  3DQV A;  3R3M A;  4YL8 A;  1MIX A;  2LVQ A;  3H6N A;  2LAS A;  3AU5 A;  3ZNZ B;  3V5W A;  3U30 A;  4E74 A;  1WGQ A;  3ENE A;  2KK8 A;  3IHP C;  2RPQ A;  2COA A;  2LJ5 A;  2FCM A;  2IZV B;  1WM3 A;  2KFJ A;  5J18 A;  5J3Y A;  5JHB A;  2MP2 B;  1EO6 A;  3BY4 B;  3AI5 A;  2GBN A;  4NAW A;  3KUZ A;  1LW3 A;  2LVO A;  4TV3 A;  5D7G A;  3UZT A;  2BCJ A;  4KIK A;  4ZRI A;  4K7U A;  2H7E A;  1E5W A;  1FOE A;  2P0H A;  2Y8G A;  3ALB A;  2FCQ A;  2IO2 B;  1J0G A;  1WF9 A;  2K6Q A;  2XQN M;  4FBJ B;  1KJT A;  2CS4 A;  1ISN A;  3A1Q A;  2H7D A;  1L7Y A;  2KCJ A;  4NY0 A;  2MLB A;  2DA0 A;  3L17 A;  5C5B A;  2DZK A;  1V86 A;  2YS3 A;  1C3T A;  5KQ1 A;  1XQQ A;  1GG3 A;  3RUL A;  5D94 A;  3AJ4 A;  1GJZ A;  4DHJ B;  2I1K A;  1OTR B;  2OTX A;  2G4S A;  2P8V A;  4YON A;  3CST A;  5AZH A;  2G45 B;  1XOD A;  3X23 A;  4F7G A;  1RRB A;  4EMO A;  2YRY A;  1TGZ B;  2KC1 A;  1BTN A;  1DYN A;  2KAN A;  1GC7 A;  3DBH I;  5J2R A;  1WVH A;  4PS3 A;  3T9L A;  1X05 A;  2M17 A;  3CXB B;  1WJU A;  2ZCB A;  2DKQ A;  1V5P A;  1V5T A;  2BYV E;  2I1J A;  1WH3 A;  4KSL C;  1P9D U;  3W1Y A;  4HK2 A;  5HE3 A;  4HB0 B;  2L76 A;  2CR5 A;  2Z0E B;  4HAT B;  2UWQ A;  2FID A;  2Y5B B;  2KLG A;  1X1F A;  4Z2M B;  3VOQ A;  1SE9 A;  4LCD E;  4DK5 A;  4I6L B;  4I6P A;  1GC6 A;  1V5M A;  4A6H A;  2JF5 A;  1A5R A;  2RNR B;  1WFY A;  4W9I A;  4MGI E;  1GUA B;  4BBN C;  2COP A;  1UZX B;  1BAK A;  4NAW B;  2D11 A;  2D10 A;  1HE8 A;  1OQN A;  1EUV B;  2JRH A;  3QQ8 B;  3KY9 A;  2ADZ A;  4KIK B;  5DPW A;  3QAR A;  1HBK A;  4KAX B;  4K7S A;  4IWO A;  2KC2 A;  4MK0 A;  4HPM B;  1YIW A;  2PEA A;  3W1S A;  2J7Q B;  4W9F A;  3CSF A;  4IM2 A;  4FLH A;  2K2J A;  4K81 A;  2ZPY A;  2LGY A;  3A1Q B;  2PE6 B;  2KUP A;  2UZR A;  3UQA A;  4IW0 A;  1V89 A;  2YS5 A;  4ANU A;  3EC8 A;  4G3X B;  4GMV A;  3ML8 A;  4HCN B;  1U5G A;  1PMS A;  1H8C A;  2ZNV B;  4GSW A;  2W2W A;  4G0N B;  5GMV A;  4GDL A;  1U29 A;  5D3W A;  2K8C A;  2JWZ A;  5DCN A;  3PRP B;  5HE2 A;  4HVB A;  3ZLZ A;  1XD3 B;  1RAX A;  4FAD A;  4MSM B;  3WAO A;  1UNP A;  3M63 B;  2CY4 A;  3LJU X;  1F9J A;  4JL9 A;  2K2U A;  4KZ0 A;  1WJM A;  3SNH A;  4HJK A;  4KZC A;  2ELA A;  4E71 A;  3SU8 X;  2RQ1 A;  2O6V D;  2QKL A;  3M1I B;  3UQB A;  1UBQ A;  2BKR B;  3KVF B;  2ZVO A;  3DPD A;  4WWO A;  4DWF A;  4MDK E;  4URK A;  4HXD A;  2KDI A;  2EMS A;  1V6E A;  3TO1 A;  4HAZ B;  2MBB B;  2MBO A;  1YQB A;  4BBK A;  2G3Q B;  2FCN A;  1DBH A;  1I2H A;  3HW2 B;  2JPH A;  3BIN A;  1Y19 B;  2L00 B;  5D3V A;  4KDI C;  5J3T A;  2KO3 A;  4W9C A;  3RCZ A;  1WY8 A;  2IBI B;  4HAU B;  3WAP A;  3UF8 A;  1OMW A;  4AJY B;  4WJO A;  3GYO A;  2C7H A;  3L13 A;  5IA7 A;  3NSU A;  2KNB A;  1FGY A;  4PQ0 A;  2KOX A;  3ZIM A;  1ZC3 B;  3LDZ E;  1WMH A;  1I35 A;  1MG8 A;  1KZ7 A;  5D3X A;  2KDE B;  4BVU C;  2DZJ A;  1PFJ A;  2K1F A;  4IM0 A;  3DDC B;  2FJL A;  2A5U A;  4WJ7 A;  4MGZ E;  2WDT B;  3H9D A;  1Q67 A;  3TW1 A;  3H7P A;  4BKG A;  3P2B A;  2GBM A;  2RSG A;  3UIN B;  2UVM A;  3IVF A;  4W9D A;  2LUE A;  2LXC A;  2J59 M;  1EGX A;  4G11 A;  1VCB A;  2MW5 A;  3QJZ A;  5LOP B;  2X18 A;  3VVW B;  3A33 B;  4GDL B;  1XX0 A;  2JUO A;  2JVC A;  2WYQ A;  3RT3 B;  2GCJ A;  2DZM A;  2RD0 A;  1WJ4 A;  2PPH A;  1Q5W B;  4MH0 E;  2HJ8 A;  1NBF C;  1BTK A;  3N3K B;  1XCG A;  3PPA A;  2MQJ A;  3Q3J A;  1OQY A;  3APD A;  1NTY A;  3D32 A;  1FHW A;  4AP4 C;  2ASQ A;  4RMA A;  2ZCC A;  2FJ9 A;  3PP2 A;  2DX5 A;  3L08 A;  5CHV C;  3MHS D;  1BT0 A;  5HKH A;  4K1R B;  1AWE A;  2D9Z A;  4GMX B;  4EEW A;  1EAZ A;  3TMP B;  3V60 A;  2JT4 B;  2KZR A;  3DBL I;  1WGH A;  3CMM B;  1RLF A;  1U5D A;  4AJW A;  3DOW A;  4NPN A;  2FNJ B;  2LG1 A;  4JGH B;  2MSE D;  3ODX A;  1MKE A;  1OEY A;  2BYE A;  2GJY A;  5C1Z A;  5DHA B;  1RFA A;  4BKS A;  1WX8 A;  1KZG A;  1KM7 A;  2IYB A;  1V49 A;  4ICU A;  2FCS A;  2AL6 A;  1G6J A;  2FDQ A;  3PZD A;  4II2 B;  3SV1 A;  2V1Y A;  2ZNV C;  1RRP B;  3JSV A;  2DHK A;  2KTF A;  1FAO A;  2LVP A;  4P7I A;  2OJR A;  1U4A A;  3SHQ A;  3OLM D;  3T06 A;  1WMH B;  3VUY A;  1ZC4 B;  4KDL B;  2Z0Q A;  2MRP A;  3R7Q A;  2G4D B;  1V5O A;  1WXM A;  2L2I A;  3H7P B;  3JW0 X;  4RM9 A;  2NPT A;  2J0J A;  3APC A;  4RM8 A;  2ROZ B;  1E7V A;  2DYQ A;  3L10 B;  1SHC A;  1TJ6 A;  3DXE A;  3FSS A;  4CYE A;  1S3S G;  3RCP A;  3MJW A;  4K2P A;  3L16 A;  3VHT C;  1WE7 A;  5LON B;  2KN5 A;  2M0X A;  2E2X A;  5JHG A;  3A9J A;  3A8P A;  2KMC A;  2B3A A;  3B0A A;  3VFK A;  2ELB A;  3QCA A;  4JLC A;  4XWX A;  4F1S A;  3N32 A;  2YSZ A;  1UD7 A;  1P5T A;  2LRU A;  2DEN B;  4DBG A;  1WR6 E;  2QKM A;  1TZ1 A;  3LJ3 A;  2MX2 A;  3MDB C;  2MFQ A;  3ZNG C;  3A4R A;  3GZN I;  5AEK B;  1WXV A;  4GPT B;  1NU2 A;  1QZE A;  4GB9 A;  3G9W A;  3AU4 A;  2RLO A;  1ZVR A;  4LDT B;  3R66 C;  3TIX A;  1YX5 B;  3KYD D;  2MDX A;  2XK5 A;  1I7A A;  4MGY E;  4F8C B;  4W9K A;  4TYZ A;  1GNU A;  2N23 A;  4ANV A;  5GOW B;  2IO1 B;  2GCL A;  3A4S C;  2K39 A;  4WQO B;  2KLC A;  1PQS A;  2FAZ A;  2I5C A;  1M94 A;  1KI1 B;  2MKR A;  1Q1O A;  3EHV A;  2KD0 A;  3ONS A;  2VKI A;  1YJ1 A;  1XKE A;  4K17 A;  4DBB A;  1TQZ A;  2HD5 B;  3O65 B;  2KTR A;  4EFO A;  3D8F A;  5JHA A;  3DVG Y;  1ZM0 A;  4NQL B;  5C6R A;  3JSV B;  2K8B A;  5HE0 A;  2D07 B;  3R7R A;  3QWM A;  1Z87 A;  5C79 A;  4IWP A;  2BYF A;  5EFX A;  3IFW B;  1YX6 B;  3UIP B;  1ZGU B;  1X1M A;  3VTW A;  2ZPN A;  3N7C A;  2WX0 A;  4GN1 A;  3PLU A;  1UNR A;  4DDI D;  3VH3 B;  4A6K A;  4WJQ A;  2HRJ A;  2CHZ A;  2REX A;  3UGB B;  3IBE A;  1LB1 A;  2PJH A;  2RSU A;  3ZRF A;  3UIO B;  1NI2 A;  2FIF A;  3ZRC A;  1V9J A;  1LQB A;  1J0W A;  4AWJ A;  1UPR A;  3OJ4 B;  1RJ2 A;  1MAI A;  1P3R A;  2G35 A;  2KQ7 A;  1OY2 A;  4GDK A;  2N7E A;  2MBQ A;  2JY6 A;  4GOC A;  4WSF A;  4DDG D;  4GZU A;  5C23 A;  5JH5 C;  2YT1 A;  1X11 A;  3TJP A;  5DIF B;  3DVN V;  4H8S A;  5BO4 B;  4DXA B;  5J17 A;  1EVH A;  3PV1 A;  4PS8 A;  4KHO A;  5CTR C;  2D9V A;  3PSC A;  3V6E B;  3I3T B;  4Y94 A;  4FUL A;  2D9X A;  4PNK A;  3GOE A;  1V80 A;  4GGQ A;  4GU2 A;  5C5B B;  2XK5 B;  3C0R B;  4PYU A;  2YLM A;  1XT9 B;  3QK0 A;  4D0N B;  4BOZ B;  2RR9 A;  2KFK A;  2LZ6 A;  4MGK E;  2D2Q A;  1TXD A;  4W9J A; 
#chains in the Genus database with same CATH topology
 3A9K A;  2R2Y A;  1KLV A;  1TKY A;  2IO3 B;  3MTN B;  1TJE A;  1TS4 A;  3KWV A;  1AW7 A;  2WX1 A;  3B2F A;  1WX9 A;  5L95 C;  2KTR B;  3KRW A;  1E9M A;  4DX9 0;  5D2M B;  1U5F A;  2BVC A;  3I57 A;  2BGF A;  2GBR A;  3AE9 B;  3N20 C;  2Z59 A;  3H8H A;  1R4N B;  2D9Y A;  2BF8 B;  4M8N A;  3BII D;  2J0M A;  1CQV A;  2K22 A;  4ZYN A;  2R2O A;  3PVW A;  2QSD A;  4PS7 A;  3NOB A;  3AV8 A;  2WXH A;  2UZS A;  1WJ1 A;  2E6X A;  2TSS A;  4B6W A;  4FN2 A;  2KVZ A;  4FXC A;  5G5H A;  2RVB B;  2J0K A;  5I2S A;  5IAA C;  4BOS C;  4IKG A;  2W3R A;  3ECI A;  3AN1 A;  5DPT A;  1VD2 A;  1FNU A;  2KMM A;  1V97 A;  2JSV X;  3Q8C A;  4C80 A;  4K3B A;  3SBG A;  1U27 A;  3BYT B;  1N61 A;  4B95 A;  1WZ3 A;  1UGM A;  1FB8 A;  3V05 A;  2MJD A;  3PRE A;  3ENB A;  3PVU A;  3WA0 A;  2WH5 A;  3AED B;  4A6F A;  2R2Q A;  3MHZ A;  2RRF A;  1FRD A;  2XEW A;  2Y5C A;  3QA8 A;  5JXV A;  3HIZ A;  2KWV B;  3HSA A;  1R4M B;  3PGE A;  1LXD A;  4JE3 B;  1L2N A;  4YTM B;  3NY5 A;  1Y5O A;  4L6E A;  4L1B A;  2LMC A;  5KHO A;  2Q13 A;  4GOU A;  4W9E A;  4GDK B;  2X38 A;  2CQU A;  2Z0D B;  4XE0 A;  2DKP A;  2LKO A;  4DHJ D;  4HPL B;  2M4N A;  4MSQ B;  5D6J B;  5LG4 B;  3NZU A;  4C0A A;  5AZF A;  4NJ7 A;  3ODO A;  4CSQ A;  4EZL A;  3H1U A;  1ZSQ A;  3VDZ A;  1WGR A;  1KFY B;  3DXC A;  1FO4 A;  2L52 A;  4G50 A;  1BWN A;  3U7D A;  3E9O A;  1FHO A;  3NZS A;  3PRM B;  5BMI A;  2V3N A;  3DVG X;  1TY0 A;  5JLJ B;  4RNA A;  1I7H A;  2DBY A;  2CHW A;  2GB1 A;  2NR2 A;  4KHB A;  1WG7 A;  3WCQ A;  1XD4 A;  4IAP A;  1D5X C;  2GLS A;  2WDV B;  1N62 A;  1RM6 C;  1ACC A;  3BVZ A;  5G55 A;  2FUH B;  1XF5 L;  1MK9 B;  2NBV B;  4B6H A;  3AE2 B;  3BYY B;  3PT2 B;  4FHJ A;  1WX7 A;  1FFU A;  1QQG A;  3HQC A;  2JWU A;  3VTV A;  1WSP A;  2R0D A;  1NTV A;  1PUT A;  5LLI A;  2NS5 A;  3DVN U;  4HKZ E;  4M8M A;  4HWI B;  2RGF A;  4UDU C;  1XLP A;  2KFK B;  2DAJ A;  3PG7 A;  2RMM A;  3TEW A;  5AZG A;  1YJJ A;  3MC8 A;  3O96 A;  2HE7 A;  3A9K B;  4ANX A;  4D6W A;  5JHH A;  4FHK A;  1ACA A;  2EKE C;  2KAC A;  2KQS A;  1WR1 A;  1XLQ A;  3AB5 A;  2KVR A;  1FNW A;  4EZJ A;  3RD2 A;  4CO7 A;  4ITK A;  1WGG A;  2MA9 B;  1AAR A;  3RYT A;  5JP4 A;  2IGH A;  2M1M A;  4RCO A;  2C7N B;  1P1A A;  3DBL B;  2Z59 B;  3SEB A;  2LEK A;  2KWC A;  1ESF A;  4OVZ A;  1Y8R C;  2SEB D;  4BKT A;  3LYY A;  2MWN B;  2INC C;  2DLB A;  2VRW B;  3NWA A;  1PYW D;  2O6V A;  2ACZ B;  3QWZ B;  1TTN A;  4K2O A;  1ZW7 A;  2EEL A;  3EPY A;  3VUW A;  1DOY A;  1KOT A;  4W9G A;  2DYM A;  4EZK A;  1B1Z A;  2RPV A;  1GOZ A;  1WXA A;  2IJ0 A;  3PTF C;  3RNC C;  4QXA B;  4F7H A;  1MFW A;  3Q8A A;  5CHF A;  2LXA A;  1KTK A;  2BQQ A;  4IC7 B;  2LGX A;  3JYU A;  3FIL A;  1IYF A;  2JP2 A;  5IKC M;  1WRD B;  2LYD A;  2ZZP B;  4XX5 A;  1C77 A;  1B55 A;  4P6V F;  1F77 A;  2W82 A;  3BJI A;  1HB6 A;  1WGD A;  3E66 A;  4HHV A;  3P42 A;  3R2I A;  1F1H A;  5E6N A;  2JU6 X;  1FHX A;  4A6F B;  3DCX A;  5D3Y A;  1YMH E;  2BKF A;  3AM9 A;  3ZXV A;  2R09 A;  4HB4 B;  3E9S A;  4LJO B;  3TL5 A;  2BT6 A;  1J7A A;  1WJN A;  2JXX A;  2UU7 A;  3NZ3 A;  4WAA A;  2INN E;  3U8Z A;  1JAL A;  4NQK E;  2AEH A;  1K5D B;  4NSW A;  1C1Y B;  3TCA A;  1D3Z A;  4NZL B;  3NWF A;  3EUB 2;  2OJW A;  4IOY X;  1LGR A;  3SYX A;  3AUL A;  4HDO A;  3F0W A;  1WGK A;  1L5P A;  2WU2 B;  4EJN A;  1BXT A;  4KGS A;  4ILH A;  4A55 A;  3RZW C;  3EA6 A;  2VH1 A;  3K9P B;  3NVZ A;  2DYN A;  2V0G A;  3U52 E;  3ML9 A;  3HHM A;  2NCN A;  2D3B A;  4E3C A;  4F7Z A;  2KX0 A;  3PS6 A;  1T0R C;  2GBK A;  1CZP A;  5JZE B;  3MPX A;  3PZ7 A;  2GBJ A;  4KHB B;  1UF0 A;  2N7D A;  1I4H A;  2LUM A;  1VRA B;  1SB3 C;  2RGN B;  2BS3 B;  1FXT B;  1JRU A;  4DXG A;  3ZKJ C;  3KRX A;  1HQR D;  1BUI C;  1NVL A;  1W1D A;  2KDF B;  1WJ6 A;  3T8M A;  5FR6 A;  3GZN B;  1ST7 A;  1FXI A;  4R3D A;  1IP9 A;  3RNB C;  3CF6 E;  1DDV A;  3I9V 1;  3AEA B;  3M3J A;  3P4S B;  3PVL A;  2N9K A;  4DHZ B;  4HDQ A;  1C4C A;  2Y7B A;  2GMI C;  2N1V A;  3GB1 A;  4C7Z A;  1YOV B;  1ZYI A;  2NMQ A;  3ULB A;  2YF0 A;  2INP E;  2KHW B;  4ILJ A;  1XR0 B;  1UEF A;  4XDD A;  2IY1 B;  1QLB B;  3ZO5 B;  4AQ7 A;  2Z0P A;  4MH8 A;  3ZDT A;  3AE4 B;  1OEY J;  2WXP A;  3DXD A;  2AQ3 B;  5H8Y E;  3DBR I;  1XCQ L;  2C60 A;  3MFG A;  2CY5 A;  3AXC A;  2K00 A;  2AWT A;  4XGA B;  2QC8 A;  2DHI A;  4IG7 B;  1UEL A;  1ZKH A;  3KWL A;  3V3X A;  5IJM A;  2Z0O A;  1OQR A;  1K51 A;  3V61 A;  4JPS A;  1XO3 A;  4PYZ A;  1MPH A;  3N1X C;  3JVZ X;  3ZVV A;  4OVV A;  1VDV A;  5LXH A;  3KQ4 A;  1P98 A;  2O6V B;  3N1Y C;  4JKH A;  3AEE B;  3A8Q A;  1CJE A;  4J6I A;  3S2A A;  4US9 A;  3RFZ B;  1KC7 A;  2N4F A;  2M14 A;  1WYW B;  3HM3 A;  2DX5 B;  1S1Q B;  4CHK A;  2BWF A;  3B1L X;  4RGM A;  3DBH B;  1J7B A;  5H92 C;  4ZHO A;  3VXW A;  2IPK D;  2LGD A;  4EKU A;  2OED A;  3FIL B;  1P6S A;  3ZTD A;  4HAX B;  3ZNI D;  2CJN A;  3KUD B;  3DWG C;  5CX3 A;  1M4V A;  2CB8 A;  4N58 A;  1UPQ A;  3IG3 A;  5KHQ A;  1W1G A;  3MP9 A;  3KZ1 A;  4WJN A;  3W1S C;  4S0R A;  5FI1 A;  3B77 A;  3A98 B;  2HTH A;  4F7U P;  2R82 A;  2YT0 A;  5DPS A;  2LBB A;  2DWQ A;  1V61 A;  4JWU C;  2H88 B;  3HVD A;  1E8Z A;  3ZVR A;  2KKC A;  5LXI B;  3TSS A;  1SEB D;  4XWW A;  3EEC A;  2WU5 B;  2JZ3 B;  1YD8 U;  1EU3 A;  2COC A;  2N1W A;  4CHJ A;  3Q2A C;  2NBU A;  2CRF A;  3WAM A;  2IGD A;  1CK1 A;  1V81 A;  2A4Z A;  2IND C;  2K3U A;  5D3D A;  2MBE A;  3DHG C;  4HAW B;  4IUM B;  3TBL D;  2N0Y A;  2YS1 A;  1WXQ A;  1WI1 A;  3HK0 A;  5DPR A;  5HE1 A;  2C7M B;  3N30 A;  4MEM A;  1XXG A;  3RZF A;  1IUE A;  4WWM A;  4B0M A;  4MM3 A;  1U2B A;  1K53 A;  5DH9 B;  1SSN A;  3WAL A;  5TSS A;  4WWN A;  3K9O B;  1P3Q U;  4I6N B;  3M62 B;  1FGZ A;  1H10 A;  2G1E A;  3ABV B;  2C5L C;  4IWQ A;  1SE3 A;  2PE9 A;  3RPF C;  4KGT A;  1LM8 B;  1NDD A;  1ZDX A;  1PGX A;  4HKQ A;  4KV2 A;  2IGG A;  1FPY A;  1MIZ B;  2NPT B;  3OJ3 A;  3I63 C;  2NZ8 B;  3M95 A;  2L8J A;  2JZZ A;  1I42 A;  2ABD A;  1T0Y A;  2BW2 A;  1E8W A;  1WXS A;  2KWU B;  1X86 A;  2DZI A;  5KQ4 A;  2JYE A;  2BWE S;  2N9P C;  2DTC A;  2EC1 A;  1PGB A;  3RI7 C;  1QT9 A;  3KUC B;  2P0F A;  5LNK 1;  2MWS B;  2COD A;  4HB2 B;  4KSK C;  3AMZ A;  3H7S A;  4OZB A;  1EF1 A;  1K5G B;  2KDB A;  2KX3 A;  2MCN B;  3RUI B;  1N3H A;  1SIF A;  3A9J B;  1V1P A;  2AL3 A;  1YN4 A;  4WH4 A;  4ZRP A;  4MY6 A;  2GS0 A;  2CAY A;  4C56 C;  3SDL C;  3W5V B;  3ZGZ A;  2W2X D;  3PSE B;  1WWT A;  2H89 B;  4AUQ C;  2ZEQ A;  3VUX A;  4BBN F;  4LJP B;  1TY2 A;  4Q2J A;  2COF A;  2L1C A;  3FVC A;  2QHO A;  3NS1 A;  4N9F 4;  4WWP A;  4ZOH C;  5AUI A;  2W2X C;  1T6B X;  2DYO A;  2MBH A;  3ZW3 A;  2O2V A;  3AEB B;  3VH4 B;  1JCK B;  1WGY A;  3BVG A;  2FJU B;  2ZJD A;  2ROV A;  2NVU I;  4JKB A;  1ET9 A;  4DX8 A;  2IY0 B;  1HB8 A;  5FK9 C;  2NMB A;  2LWP A;  3ML4 A;  1E8X A;  3D8D A;  2KJR A;  3LB8 C;  2Y8F A;  4JK7 A;  1YQ4 B;  1E90 A;  4IM3 A;  1SIJ A;  2N9L A;  2LUL A;  3VR8 B;  3TEZ A;  4Z2N A;  3ULC A;  4D2K A;  2LRW A;  2QIE B;  4TQ1 A;  4LNI A;  1NVI D;  3VTU A;  2I38 A;  4A20 A;  3VIA A;  2HTH B;  3PHW B;  2L0F A;  4M0W B;  2I2Y A;  1H4R A;  1STE A;  4N6E B;  5E6O A;  3ETR A;  4QJ5 B;  5CLL B;  3RNA C;  3V62 A;  4FJV B;  1NTI A;  2Z14 A;  4LK0 M;  1VBH A;  1C76 A;  2ZKM X;  1IGC A;  2WNM A;  4GIV A;  1YQ3 B;  1K8R B;  3QAQ A;  3OAW A;  4NJ6 A;  2L1A A;  5BYS A;  2DHZ A;  3EFU A;  3QIJ A;  3L0W B;  5EE0 A;  2KDM A;  4JK8 A;  4C7Y A;  2K25 A;  2PLP A;  4RGO S;  3QHT A;  3KLS X;  2HDE A;  4EOY A;  4MM3 B;  3TVV A;  2KXJ A;  1TZO A;  4HRS A;  2I5F A;  2JQR B;  4RGN A;  2HTM E;  4AS1 A;  2N9X A;  1J8C A;  3Q3F A;  4MJS A;  2AQ2 B;  4JKA A;  2K6D B;  2KUQ A;  2SAK A;  3PRZ A;  2LI5 A;  1DIK A;  3SFE B;  2BTE A;  1E8Y A;  2JXT A;  2NTT A;  4TUU A;  1DYQ A;  3KSY A;  1E7P B;  3L54 A;  4HCP B;  2C9W B;  3R8B A;  1HTO A;  3TFM A;  2V76 A;  4LDT D;  4LNO A;  4A3P A;  4ZRK A;  4ZRJ A;  1PDX A;  4DHZ E;  4OVU A;  2CKH B;  3AEC B;  4L2Y A;  2YVC A;  5FKA C;  3DCG A;  1WE6 A;  1UBI A;  2AYO B;  1JWU D;  4S17 A;  2MJ3 A;  2IO0 B;  1IPG A;  3OWE B;  3CIK A;  3GYP A;  1V1P B;  1R4N I;  4NJC A;  1V88 A;  2KAJ A;  1GB4 A;  1IGD A;  3SO6 A;  5D27 A;  2N9E B;  3FKY A;  4HEA 1;  2W9N A;  2L32 A;  1TS3 A;  1WIA A;  4HAV B;  1QF6 A;  4JX1 C;  3ZUN A;  3QC8 B;  3P6A A;  3RNF C;  2KJ6 A;  1M7E A;  4BKS D;  2CHX A;  4FJY A;  1E7U A;  2L3Z A;  1EU4 A;  4ICV A;  4A3O A;  2O2V B;  4P16 A;  1J19 A;  3ZJV A;  3SR6 A;  1I4P A;  5I2M A;  1Z2M A;  2M8S A;  4KHA A;  5KCV A;  2KGX B;  3X0W A;  1Q0W B;  2DYB A;  2UYZ B;  3I5J C;  4W9L A;  4X57 B;  3P4R B;  3ZTC A;  5CHW A;  3U2S C;  1AYF A;  1DDM A;  4B0E A;  4IOI E;  4EUT A;  2NBW B;  1V2Y A;  1JDE A;  4YSY B;  2WXL A;  5IO9 A;  2PKO A;  3WYF B;  1C79 A;  1UNS A;  2ZVN A;  2ON8 A;  4TQ0 A;  1R4M I;  5L83 A;  3WIM A;  4XC2 A;  3KW5 B;  4W9H A;  2P0D A;  2RUK B;  2L7R A;  2WGS A;  2FBW B;  3ZNH B;  3OAN A;  3FM8 C;  3EGR A;  2Z4D A;  1WM2 A;  3PHX B;  3ZYY X;  5DI9 B;  3KH0 A;  3GS2 A;  5G2N A;  3PEG A;  2PZ1 A;  1Z5S B;  2IYD B;  1IBX A;  2WXK A;  4OZC A;  3ZDM C;  4KVG B;  5CLQ B;  2V9H A;  3QX1 A;  4ASW C;  2OOB B;  1NI3 A;  2K8H A;  3FP5 A;  5G5G A;  1GGO A;  1DRO A;  1SGH A;  1Q10 A;  3HM6 X;  3TEX A;  2KYW A;  2MP2 A;  3NHE B;  2PVG C;  2DX1 A;  4ANW A;  5FI0 A;  3W5U B;  3ZJT A;  4M02 A;  4HAY B;  4A5K A;  1ZOY B;  5TR5 A;  2DAF A;  2EMT A;  1UNQ A;  3DBS A;  2K8E A;  1MK7 B;  4BFR A;  1PGA A;  1WZ0 A;  4B9K A;  4WVF B;  2CU3 A;  2OQB A;  1W1H A;  2MHJ A;  2IFS A;  3ODW A;  4MT7 A;  2D4Q A;  1UGJ A;  4MJS B;  2DFK A;  3HVZ A;  3FAH A;  4II3 B;  4REZ A;  3IT6 B;  1NYQ A;  2VSZ A;  4HLE A;  3V6C B;  1N60 A;  2Q5W D;  3RNE C;  2DLW A;  4FA6 A;  1OGW A;  1U5E A;  2DIK A;  4K7W A;  1P0R A;  2DN6 A;  3FEH A;  3TEY A;  1C4P A;  4GXB A;  1KBL A;  3WAN A;  2D3G A;  2BPS A;  2WS3 B;  1QOB A;  3SD5 A;  5J3Q A;  1PLS A;  2JRI B;  3PLV A;  2GOW A;  1V5U A;  4IFS A;  1WGU A;  2CU1 A;  2VRR B;  1TKE A;  2YEP B;  4L23 A;  1M7R A;  3VAW A;  1AQC A;  4AOF A;  1TBE A;  1N5X A;  1WI0 A;  2AQ1 B;  2EJ8 A;  3VRA B;  2RDH A;  2WXF A;  2D9W A;  4DQO C;  1UH6 A;  4K3C A;  1UUP A;  3B08 A;  5EE9 A;  5L81 A;  4NNJ B;  1IRS A;  3KYC D;  4RF0 A;  3SUZ A;  2M38 A;  5DHF B;  4ZDV A;  5E6P A;  1X1G A;  4RFB A;  2LD9 A;  1LFD A;  2J42 A;  1EF5 A;  2N7J A;  4WIP A;  3E56 A;  3D8E A;  1QC6 A;  2L05 A;  5C16 A;  4FJZ A;  4TKN A;  2WDQ B;  3NS8 A;  4MEL A;  2N0S B;  3QBV B;  3ZQ4 A;  2LOZ A;  3DBR B;  4JK9 A;  4CHM A;  2DHJ A;  2KJH B;  2V4L A;  1KLU D;  2XBB C;  4WJP A;  1FCL A;  1YNT E;  2PIA A;  4JIO U;  1DDW A;  3F5R A;  2KMA A;  4JQW C;  3APF A;  2B76 B;  4GLS C;  2WWZ A;  2LOX A;  4J3O D;  4O1N A;  1Y56 A;  2L0T A;  4XDC A;  1D6E C;  3FLV A;  2XN9 C;  1CMX B;  2PMV A;  4HB3 B;  2V3S A;  1QOA A;  3VQI A;  2QIL A;  5EDS A;  3P7Z A;  4XZ4 A;  3DQV A;  2LHE A;  3R3M A;  4YL8 A;  2PTL A;  4YTN B;  1MIX A;  2LVQ A;  3H6N A;  2LAS A;  3N1Z C;  3AU5 A;  3Q8B A;  1SE4 A;  1DGJ A;  1OFF A;  3ZNZ B;  3AE8 B;  3V5W A;  3U30 A;  4E74 A;  1FIQ A;  2ICI A;  2LFI A;  1AWD A;  1WGQ A;  3ENE A;  2KK8 A;  1SJE D;  3IHP C;  2RPQ A;  2COA A;  2V4I B;  1F0Z A;  2LJ5 A;  3CWI A;  2FCM A;  1ZXI A;  2IZV B;  4KKJ A;  3AE7 B;  1MVK A;  1WM3 A;  2KFJ A;  5J18 A;  5J3Y A;  1D4B A;  5JHB A;  2WLB A;  2MP2 B;  3T3O A;  1EO6 A;  3BY4 B;  1E10 A;  3AI5 A;  2GBN A;  4MT5 A;  1I4G A;  1FFV A;  4NAW A;  3KUZ A;  1F2R C;  1LW3 A;  2LVO A;  4TV3 A;  5D7G A;  1SBB B;  3UZT A;  2BCJ A;  2Z8L A;  4KIK A;  4ZRI A;  1SF0 A;  4K7U A;  4OT1 A;  1QQR A;  4ILG B;  1YN5 A;  2H7E A;  1E5W A;  1FOE A;  2P0H A;  2Y8G A;  3ALB A;  5GXG B;  2IDY A;  1L4Z B;  2FCQ A;  1MHH E;  2IO2 B;  2BS4 B;  5I4D A;  1J0G A;  1WF9 A;  3TUO A;  2K6Q A;  2XQN M;  4FBJ B;  1L0X B;  1KJT A;  2CS4 A;  1ISN A;  2K49 A;  3A1Q A;  2GRI A;  2H7D A;  1L7Y A;  2KCJ A;  4NY0 A;  2MLB A;  2DA0 A;  3C8Y A;  3L17 A;  5C5B A;  2DZK A;  1V86 A;  2FE8 A;  2YS3 A;  4JWS C;  1C3T A;  5KQ1 A;  1XQQ A;  3E9P A;  1GG3 A;  4ACF A;  3RUL A;  5D94 A;  4RGT A;  3AJ4 A;  1GJZ A;  4HSI A;  4DHJ B;  3HRD D;  2I1K A;  1OTR B;  2OTX A;  2G4S A;  2P8V A;  4YON A;  4RH6 A;  3CST A;  5AZH A;  2G45 B;  1UWM A;  1SJH D;  1XOD A;  3X23 A;  4F7G A;  1RRB A;  4EMO A;  2YRY A;  1TGZ B;  4WUR A;  3NRZ A;  2WXI A;  2KC1 A;  1GAQ B;  1BTN A;  1DYN A;  1TT5 B;  2KAN A;  1J7C A;  1GC7 A;  3DBH I;  3NVW A;  4TSS A;  4GNK B;  5J2R A;  1WVH A;  3MC9 A;  3W9C B;  3RNG C;  1T5X D;  2AX5 A;  4PS3 A;  3T9L A;  1L6V A;  1JRO A;  1X05 A;  2WXG A;  3SFD B;  1NEN B;  2M17 A;  2WXQ A;  3CXB B;  1WJU A;  2ZCB A;  3NWD A;  1ET6 A;  2DKQ A;  4M00 A;  1V5P A;  1JWM D;  4TMA B;  1V5T A;  2BYV E;  2I1J A;  1WH3 A;  4KSL C;  1P9D U;  1ZDV A;  3LXF A;  3W1Y A;  3BK1 A;  4HK2 A;  2QJL A;  5HE3 A;  1UWX A;  4HB0 B;  2L76 A;  2CR5 A;  2Z0E B;  4LNF A;  4HAT B;  2UWQ A;  4YWG G;  2FID A;  2Y5B B;  2KLG A;  1X1F A;  4Z2M B;  3VOQ A;  3RMK C;  1SE9 A;  1PFD A;  4LCD E;  1GB1 A;  4DK5 A;  1L4D B;  2L83 A;  4I6L B;  2X0S A;  4I6P A;  1T3Q A;  1GC6 A;  1JWB D;  1V5M A;  4A6H A;  2JF5 A;  1A5R A;  2RNR B;  1WFY A;  4W9I A;  2YEP F;  4MGI E;  4LTU A;  1GUA B;  4BBN C;  2COP A;  4ARI A;  1UZX B;  1BAK A;  4NAW B;  2LGI A;  2D11 A;  2D10 A;  2GUM A;  1HE8 A;  1OQN A;  1EUV B;  1ZE3 D;  2QMT A;  2JRH A;  3QQ8 B;  3KY9 A;  2ADZ A;  4KIK B;  5DPW A;  3QAR A;  1HBK A;  4KAX B;  4K7S A;  1QKZ A;  1T77 A;  4IWO A;  2KC2 A;  4ZYS A;  4MK0 A;  1R7S A;  4HPM B;  3PO0 A;  4JKF A;  4H2A A;  4DXF A;  5AUK A;  1T0Q C;  1YIW A;  2QEJ C;  2RDG A;  2PEA A;  3W1S A;  1XEE A;  2J7Q B;  4W9F A;  2K5P A;  3CSF A;  4IM2 A;  2BS2 B;  1HEZ E;  4FLH A;  2K0P A;  2K2J A;  4K81 A;  2ZPY A;  1RFK A;  2CJO A;  2LGY A;  3A1Q B;  2PE6 B;  2KUP A;  2WQY B;  2UZR A;  1MG4 A;  3UQA A;  2WP9 B;  4IW0 A;  1V89 A;  2YS5 A;  4ANU A;  3EC8 A;  4ZRQ A;  4G3X B;  4GMV A;  3ML8 A;  4HCN B;  1U5G A;  1PMS A;  1H8C A;  2Y3A A;  2ZNV B;  1HXY D;  1GPX A;  4GSW A;  2W2W A;  4G0N B;  5GMV A;  1ZXH A;  1U29 A;  2KIG A;  5D3W A;  2K8C A;  4GDL A;  4P1B C;  2JWZ A;  5DCN A;  2MJE A;  3PRP B;  2MH7 A;  5HE2 A;  4HVB A;  3ZLZ A;  1XD3 B;  1RAX A;  3UI3 A;  4FAD A;  4MSM B;  3WAO A;  1UNP A;  3M63 B;  2GI9 A;  2CY4 A;  3LJU X;  1F9J A;  4JL9 A;  4N59 A;  2K2U A;  5C2T B;  1FM0 D;  4LNK A;  4KZ0 A;  3Q8F A;  1WJM A;  3SNH A;  1TKG A;  1V1O A;  3P63 A;  4HJK A;  4KZC A;  2ELA A;  1TIF A;  4E71 A;  2BBC A;  3IAM 1;  1NEK B;  3Q3O C;  3SU8 X;  3HUI A;  2RQ1 A;  3T3N A;  2O6V D;  3E9L A;  3Q6B A;  2QKL A;  1FMA D;  4QJ3 B;  3M1I B;  3UQB A;  1UBQ A;  2WXJ A;  1L0V B;  2BKR B;  3KVF B;  1JWS D;  2M19 A;  2ZVO A;  3DPD A;  3OHM B;  3AE1 B;  4WWO A;  3W2D A;  4DWF A;  2D3A A;  4WAF A;  1JML A;  4MDK E;  2QDF A;  4URK A;  1FNV A;  2WXM A;  2KDI A;  2EMS A;  4HXD A;  1V6E A;  3TO1 A;  4HAZ B;  2MBB B;  2MBO A;  1YQB A;  1C9F A;  4BBK A;  2G3Q B;  2FCN A;  3NJT A;  2JYT A;  1DBH A;  3BZD B;  2KIE A;  5BYR A;  4KKI A;  3NUH B;  5HHD G;  1I2H A;  3HW2 B;  2JPH A;  2V3P A;  5BYQ A;  3BIN A;  1Y19 B;  1KRH A;  2L00 B;  4HRO A;  1HZ5 A;  2M0A A;  3O13 A;  5D3V A;  4KDI C;  3NW8 A;  5J3T A;  2KO3 A;  4W9C A;  1MI0 A;  3RCZ A;  1WY8 A;  1XLN A;  3U7Z A;  1MJD A;  2IBI B;  4HAU B;  3WAP A;  3L4P A;  3UF8 A;  1I4X A;  1OMW A;  1FEH A;  5M4Y B;  4AJY B;  4WJO A;  3GYO A;  2OHF A;  2C7H A;  2WXR A;  3L13 A;  3NSU A;  2KNB A;  1FGY A;  4PQ0 A;  2KOX A;  5IA7 A;  4C4V A;  1KF6 B;  2KWD A;  2RDB C;  3ZIM A;  2E3T A;  1ZC3 B;  1FRR A;  1WMH A;  3LDZ E;  1I35 A;  1MG8 A;  1RYJ A;  1KZ7 A;  5D3X A;  2KDE B;  4BVU C;  2DZJ A;  1PFJ A;  2W55 A;  2K1F A;  1ZUD 2;  3DDC B;  4IM0 A;  2FJL A;  2A5U A;  4WJ7 A;  3HIE A;  4P1C C;  4MGZ E;  2WDT B;  3H9D A;  1BML C;  1F2R I;  1Q67 A;  3TW1 A;  3H7P A;  4JKG A;  2YT2 A;  2VZK B;  4LLG M;  1DOI A;  4BKG A;  3P2B A;  3CIR B;  2GBM A;  2RSG A;  3UIN B;  3U4E G;  2UVM A;  5HFY A;  1QIL A;  3IVF A;  4W9D A;  2W54 A;  2LUE A;  2LXC A;  4KGR A;  2J59 M;  1C78 A;  1YJI A;  1EGX A;  1TS5 A;  4G11 A;  1VCB A;  4QAY A;  1LO5 D;  2MW5 A;  3QJZ A;  2JZP A;  4BAX A;  5LOP B;  5IRS A;  1P7E A;  2X18 A;  3VVW B;  3Q3M C;  3A33 B;  4GDL B;  3J9C A;  1XX0 A;  4QJ4 B;  2JUO A;  2JVC A;  2WYQ A;  3AH7 A;  3A58 A;  3RT3 B;  2EKI A;  3EFC A;  2WXO A;  2GCJ A;  2DZM A;  2RD0 A;  3AEF B;  4USA A;  1L0Y B;  3NG0 A;  1WJ4 A;  1MPE A;  1L6U A;  2PPH A;  1FCC C;  1Q5W B;  4US8 A;  4MH0 E;  2HJ8 A;  4PK1 A;  1NBF C;  1I4Q A;  1BTK A;  3N3K B;  1VZ7 A;  1XCG A;  3PPA A;  1N6Z A;  2JX5 A;  2MQJ A;  3P1M A;  3Q3J A;  2PW9 A;  1OQY A;  3APD A;  1NTY A;  3D32 A;  1FHW A;  5IOI A;  1XLO A;  3FC4 A;  4AP4 C;  2ASQ A;  1FD6 A;  4RMA A;  2ZCC A;  2FJ9 A;  3PP2 A;  2DX5 A;  3L08 A;  4CQN A;  3BVM A;  3OG5 A;  5CHV C;  3MHS D;  1VJK A;  1BT0 A;  2BB6 A;  5C3J B;  5HKH A;  1ZPS A;  4K1R B;  4XYC A;  1AWE A;  3GE8 C;  2D9Z A;  3VR9 B;  3B9J A;  4GMX B;  4EEW A;  3U12 A;  1EAZ A;  3TMP B;  3V60 A;  3AE5 B;  2JT4 B;  2KZR A;  3DBL I;  2NTS A;  1WGH A;  3CMM B;  1RLF A;  1U5D A;  4AJW A;  3DOW A;  4C00 A;  4NPN A;  2FNJ B;  2LG1 A;  4JGH B;  1QOF A;  2MSE D;  3ODX A;  4WQM A;  1MKE A;  1OEY A;  4KX6 B;  3SBT A;  1NYR A;  4OW0 A;  2BYE A;  2ZW0 A;  2GJY A;  5C1Z A;  4OZA A;  5DHA B;  1RFA A;  2KT7 A;  2D3C A;  4BKS A;  1KLG D;  1WX8 A;  3R2T A;  5HI1 A;  2BB5 A;  1ENF A;  1KZG A;  1KM7 A;  2IYB A;  1JW9 D;  1OQQ A;  1V49 A;  4ICU A;  3P4P B;  2FCS A;  2AL6 A;  1G6J A;  2FDQ A;  3AE3 B;  3PZ8 A;  3PZD A;  1JRP A;  4II2 B;  3SV1 A;  2PVO D;  2V1Y A;  2ZNV C;  3BK2 A;  2K9X A;  1RRP B;  3JSV A;  2DHK A;  2KTF A;  1FAO A;  2LVP A;  4P7I A;  2OJR A;  4C4V B;  3RN9 C;  1U4A A;  2W3S A;  3SHQ A;  3OLM D;  3T06 A;  1WMH B;  4HPP A;  1ZC4 B;  3VUY A;  1KH0 A;  4KDL B;  3DHH C;  2Z0Q A;  2MRP A;  3R7Q A;  1MHX A;  3C19 A;  2G4D B;  1V5O A;  1WXM A;  3BWU D;  3NVY A;  5FR3 A;  4EE2 A;  2L2I A;  5BMG A;  1WRI A;  3H7P B;  4JKG B;  3JW0 X;  4RM9 A;  2WXN A;  1N5W A;  2NPT A;  2J0J A;  3APC A;  4RM8 A;  2ROZ B;  1E7V A;  3AEG B;  2DYQ A;  3L10 B;  1SHC A;  1TJ6 A;  3DXE A;  3FSS A;  4CYE A;  1S3S G;  4RF1 A;  2FUG 1;  3RCP A;  3MJW A;  3DHI C;  4K2P A;  1IBX B;  3L16 A;  3VHT C;  4MAC A;  3NVV A;  1WE7 A;  5LON B;  2WDR B;  1I4R A;  1HA5 A;  1SXT A;  2KN5 A;  2M0X A;  1VZ6 A;  2WHI A;  2E2X A;  5JHG A;  4PT5 A;  1FXA A;  3A9J A;  1K50 A;  2LJI A;  2Y5P A;  3A8P A;  3ZXR A;  5D3I B;  2KMC A;  2B3A A;  3B0A A;  3VFK A;  2ELB A;  3QCA A;  4YSZ B;  4JLC A;  4XWX A;  4OSN A;  3N32 A;  2XNA C;  4F1S A;  2YSZ A;  1UD7 A;  1P5T A;  2LRU A;  2DEN B;  4DBG A;  1WR6 E;  2QKM A;  1TZ1 A;  3LJ3 A;  1VZ8 A;  2MX2 A;  3MDB C;  4YSX B;  2MFQ A;  3ZNG C;  3A4R A;  5T8I A;  4HJG E;  3GZN I;  5HG2 A;  3GP7 A;  3VRB B;  5AEK B;  1WXV A;  4GPT B;  1NU2 A;  1QZE A;  4GB9 A;  1ZP0 B;  3Q14 C;  4YXD B;  3G9W A;  3AU4 A;  2RLO A;  1ZVR A;  1C4A A;  2LGS A;  1JWA D;  4LDT B;  3R66 C;  3TIX A;  5BMH A;  1VBG A;  4M01 A;  1YX5 B;  5EE1 A;  3KYD D;  2MDX A;  2XK5 A;  1I7A A;  4MGY E;  1D5M C;  4F8C B;  4W9K A;  4TYZ A;  1GNU A;  1HTQ A;  2N23 A;  4ANV A;  1MI1 A;  5GOW B;  2IO1 B;  3AE6 B;  2GCL A;  3A4S C;  2K39 A;  2X8X X;  4WQO B;  2KLC A;  2VZK D;  1PQS A;  2FAZ A;  4JKC A;  2I5C A;  4M0W A;  4XWT A;  1M94 A;  1KI1 B;  2MKR A;  1Q1O A;  1B9R A;  2J53 A;  3EHV A;  2KD0 A;  3IAS 1;  3ONS A;  2VKI A;  4JKE A;  1YJ1 A;  4A8X C;  3IT4 B;  3GE3 C;  5IP4 D;  2HJ1 A;  1EM7 A;  4DIX A;  1XKE A;  4K17 A;  4DBB A;  1TQZ A;  2HD5 B;  3O65 B;  2KTR A;  4EFO A;  3D8F A;  5E6J A;  1T0S C;  1K52 A;  1QOG A;  3DVG Y;  1ZM0 A;  5JHA A;  3Q69 A;  4NQL B;  5C6R A;  1F52 A;  1EWC A;  3JSV B;  2K8B A;  5EE3 A;  5HE0 A;  2D07 B;  3R7R A;  3QWM A;  1Z87 A;  5C79 A;  1VR9 A;  4IWP A;  2BYF A;  5EFX A;  3IFW B;  1YX6 B;  3UIP B;  1ZGU B;  1E6E B;  1X1M A;  3P4Q B;  1HZ6 A;  3VTW A;  2VH2 A;  5MPO A;  2M56 B;  2ZPN A;  3N7C A;  2LHD A;  2WX0 A;  2ZW1 A;  4GN1 A;  3PLU A;  1TYG B;  1UNR A;  4DDI D;  3VH3 B;  4A6K A;  4WJQ A;  2HRJ A;  3B2G A;  1ROE A;  2CHZ A;  2REX A;  3Q8E A;  2MEK A;  3UGB B;  3IBE A;  4YTP B;  1V8C A;  4LNN A;  1LB1 A;  2KQ4 X;  2PJH A;  1JQ4 A;  2RSU A;  3ZRF A;  3UIO B;  4NAM A;  1NI2 A;  2FIF A;  3ZRC A;  1V9J A;  4JKD A;  1LQB A;  1J0W A;  1A70 A;  4AWJ A;  2R61 A;  2G9H D;  1UPR A;  3OJ4 B;  2D5G A;  1RJ2 A;  5IN7 A;  1MAI A;  1P3R A;  2G35 A;  1YN3 A;  2KQ7 A;  1XCT L;  1OY2 A;  4GDK A;  2N7E A;  3Q3N C;  4L1R A;  2J4X A;  2MBQ A;  1D5Z C;  2JY6 A;  4GOC A;  4WSF A;  4IDI A;  4DDG D;  4GZU A;  3N9Y C;  1DOX A;  5C23 A;  1WYG A;  5JH5 C;  2YT1 A;  1X11 A;  3IXS A;  3DWM A;  3TJP A;  5DIF B;  3DVN V;  2Z13 A;  2DNF A;  2KN4 A;  4H8S A;  4OHJ A;  5BO4 B;  4DXA B;  5J17 A;  1EVH A;  3MJ5 A;  1EWY C;  1VLB A;  2KR0 A;  3PV1 A;  4KHO A;  1P7F A;  4PS8 A;  5CTR C;  2QCZ A;  2BYT A;  2D9V A;  1N63 A;  3PSC A;  3V6E B;  3MC0 B;  3I3T B;  4Y94 A;  4FUL A;  2NBV A;  4BZA A;  2D9X A;  4A90 A;  3ZJU A;  4PNK A;  1AN8 A;  3GOE A;  4YT0 B;  2ONQ A;  1V80 A;  4ZHP A;  4GGQ A;  4GU2 A;  5C5B B;  5JVL A;  2XK5 B;  3C0R B;  1RWS A;  4PYU A;  3URY A;  2YLM A;  1XT9 B;  3QK0 A;  1TS2 A;  4D0N B;  4BOZ B;  4A6Q A;  2RR9 A;  1SE2 A;  2KFK A;  2LZ6 A;  4ARC A;  4MGK E;  1E0Z A;  2J52 A;  4A9A A;  2D2Q A;  1TXD A;  4W9J A; 
#chains in the Genus database with same CATH homology
 3A9K A;  1KLV A;  2IO3 B;  3MTN B;  2WX1 A;  1WX9 A;  5L95 C;  2KTR B;  3KRW A;  4DX9 0;  5D2M B;  1U5F A;  2BGF A;  2GBR A;  2D9Y A;  2BF8 B;  4M8N A;  2J0M A;  4ZYN A;  2R2O A;  3PVW A;  4PS7 A;  3NOB A;  2UZS A;  1WJ1 A;  4B6W A;  4FN2 A;  2RVB B;  2J0K A;  5IAA C;  4BOS C;  3ECI A;  5DPT A;  1VD2 A;  3SBG A;  1U27 A;  4B95 A;  1WZ3 A;  1UGM A;  1FB8 A;  3PRE A;  3ENB A;  3PVU A;  3WA0 A;  2WH5 A;  4A6F A;  2R2Q A;  3QA8 A;  2XEW A;  3HIZ A;  2KWV B;  3PGE A;  1L2N A;  1LXD A;  3NY5 A;  1Y5O A;  4L6E A;  5KHO A;  2Q13 A;  4W9E A;  4GDK B;  2CQU A;  2Z0D B;  2DKP A;  2LKO A;  4DHJ D;  4HPL B;  2M4N A;  4MSQ B;  5D6J B;  3NZU A;  4C0A A;  5AZF A;  4NJ7 A;  3ODO A;  4EZL A;  3H1U A;  1ZSQ A;  3VDZ A;  1WGR A;  3DXC A;  4G50 A;  1BWN A;  3U7D A;  3E9O A;  1FHO A;  3NZS A;  3PRM B;  3DVG X;  5JLJ B;  2CHW A;  2NR2 A;  1WG7 A;  1XD4 A;  4IAP A;  5G55 A;  2FUH B;  1MK9 B;  2NBV B;  4B6H A;  3PT2 B;  4FHJ A;  1WX7 A;  1QQG A;  3HQC A;  3VTV A;  2R0D A;  1NTV A;  5LLI A;  2NS5 A;  3DVN U;  4M8M A;  4HWI B;  2RGF A;  2KFK B;  2DAJ A;  3PG7 A;  5AZG A;  3O96 A;  2HE7 A;  3A9K B;  4ANX A;  5JHH A;  4FHK A;  1ACA A;  2EKE C;  2KQS A;  1WR1 A;  2KVR A;  4EZJ A;  3RD2 A;  4CO7 A;  1WGG A;  2MA9 B;  1AAR A;  3RYT A;  5JP4 A;  2M1M A;  2C7N B;  1P1A A;  2Z59 B;  2KWC A;  1Y8R C;  4BKT A;  2MWN B;  2VRW B;  2O6V A;  3QWZ B;  1TTN A;  4K2O A;  1ZW7 A;  3VUW A;  3EPY A;  1KOT A;  4W9G A;  2DYM A;  4EZK A;  1WXA A;  3PTF C;  4F7H A;  5CHF A;  2LXA A;  4IC7 B;  2LGX A;  3JYU A;  1IYF A;  2JP2 A;  1WRD B;  2LYD A;  2ZZP B;  4XX5 A;  1B55 A;  3BJI A;  1HB6 A;  1WGD A;  3E66 A;  4HHV A;  5E6N A;  1FHX A;  4A6F B;  5D3Y A;  2BKF A;  2R09 A;  4HB4 B;  4LJO B;  3TL5 A;  1WJN A;  2JXX A;  4WAA A;  3U8Z A;  4NQK E;  2AEH A;  1K5D B;  4NSW A;  1C1Y B;  3TCA A;  1D3Z A;  4IOY X;  3SYX A;  3AUL A;  4HDO A;  3F0W A;  4EJN A;  4ILH A;  3RZW C;  3K9P B;  2DYN A;  3ML9 A;  3HHM A;  2NCN A;  4E3C A;  4F7Z A;  2KX0 A;  3PS6 A;  2GBK A;  5JZE B;  3MPX A;  2GBJ A;  4KHB B;  2N7D A;  2RGN B;  1FXT B;  1JRU A;  3ZKJ C;  3KRX A;  1NVL A;  1W1D A;  2KDF B;  1WJ6 A;  3T8M A;  5FR6 A;  1IP9 A;  1ST7 A;  3CF6 E;  1DDV A;  3M3J A;  3PVL A;  4DHZ B;  4HDQ A;  2Y7B A;  2GMI C;  2N1V A;  3ULB A;  2YF0 A;  2KHW B;  4ILJ A;  1XR0 B;  1UEF A;  2IY1 B;  3ZO5 B;  2Z0P A;  3ZDT A;  1OEY J;  3DXD A;  3DBR I;  2C60 A;  2CY5 A;  3AXC A;  2K00 A;  2AWT A;  2DHI A;  4IG7 B;  1UEL A;  1ZKH A;  5IJM A;  2Z0O A;  3V61 A;  4PYZ A;  1MPH A;  3JVZ X;  3ZVV A;  4OVV A;  5LXH A;  1P98 A;  2O6V B;  4JKH A;  3A8Q A;  4J6I A;  3S2A A;  1KC7 A;  2N4F A;  2M14 A;  1WYW B;  3HM3 A;  2DX5 B;  1S1Q B;  4CHK A;  2BWF A;  3B1L X;  3VXW A;  4EKU A;  2LGD A;  3ZTD A;  1P6S A;  4HAX B;  3ZNI D;  3KUD B;  5CX3 A;  2CB8 A;  1UPQ A;  3IG3 A;  5KHQ A;  1W1G A;  3KZ1 A;  4WJN A;  3W1S C;  5FI1 A;  3A98 B;  2HTH A;  4F7U P;  2R82 A;  2YT0 A;  5DPS A;  2LBB A;  1V61 A;  1E8Z A;  3ZVR A;  2KKC A;  5LXI B;  3EEC A;  1YD8 U;  2JZ3 B;  2COC A;  2N1W A;  4CHJ A;  2NBU A;  2CRF A;  3WAM A;  1V81 A;  2A4Z A;  2MBE A;  4HAW B;  4IUM B;  3TBL D;  2N0Y A;  2YS1 A;  1WI1 A;  3HK0 A;  5DPR A;  5HE1 A;  2C7M B;  3N30 A;  4MEM A;  3RZF A;  4MM3 A;  1U2B A;  5DH9 B;  3WAL A;  4WWN A;  3K9O B;  1P3Q U;  4I6N B;  3M62 B;  1FGZ A;  1H10 A;  2C5L C;  4IWQ A;  2PE9 A;  1LM8 B;  1NDD A;  4KV2 A;  1MIZ B;  2NPT B;  3OJ3 A;  2NZ8 B;  3M95 A;  2L8J A;  2JZZ A;  1I42 A;  2ABD A;  1T0Y A;  1E8W A;  1WXS A;  2KWU B;  1X86 A;  2DZI A;  5KQ4 A;  2BWE S;  2N9P C;  2DTC A;  2EC1 A;  3KUC B;  2P0F A;  2MWS B;  2COD A;  4HB2 B;  4KSK C;  3H7S A;  1EF1 A;  1K5G B;  2KDB A;  2KX3 A;  2MCN B;  3RUI B;  1N3H A;  1SIF A;  3A9J B;  2AL3 A;  4MY6 A;  2GS0 A;  2CAY A;  3SDL C;  2W2X D;  3PSE B;  4AUQ C;  2ZEQ A;  3VUX A;  4BBN F;  4LJP B;  2COF A;  2L1C A;  2QHO A;  4N9F 4;  4WWP A;  2W2X C;  2DYO A;  2MBH A;  3ZW3 A;  2O2V A;  3VH4 B;  1WGY A;  2ZJD A;  2ROV A;  2NVU I;  4JKB A;  4DX8 A;  2IY0 B;  1HB8 A;  2NMB A;  2LWP A;  3ML4 A;  1E8X A;  3D8D A;  2KJR A;  2Y8F A;  4JK7 A;  1E90 A;  4IM3 A;  2LUL A;  4Z2N A;  3ULC A;  2LRW A;  4TQ1 A;  3VTU A;  4A20 A;  3VIA A;  2HTH B;  3PHW B;  2L0F A;  4M0W B;  1H4R A;  5E6O A;  5CLL B;  3V62 A;  4FJV B;  1NTI A;  1VBH A;  4GIV A;  1K8R B;  3QAQ A;  3OAW A;  4NJ6 A;  2DHZ A;  3EFU A;  3QIJ A;  3L0W B;  4JK8 A;  2K25 A;  3QHT A;  4EOY A;  3TVV A;  2KXJ A;  2I5F A;  2N9X A;  1J8C A;  3Q3F A;  4MJS A;  4JKA A;  2K6D B;  3PRZ A;  2LI5 A;  1DIK A;  1E8Y A;  4TUU A;  3KSY A;  3L54 A;  4HCP B;  2C9W B;  3TFM A;  2V76 A;  4LDT D;  4A3P A;  4ZRK A;  4ZRJ A;  4DHZ E;  4OVU A;  2CKH B;  2YVC A;  3DCG A;  1WE6 A;  1UBI A;  2AYO B;  2IO0 B;  1IPG A;  3CIK A;  3GYP A;  1R4N I;  1V88 A;  3SO6 A;  5D27 A;  2N9E B;  2W9N A;  1WIA A;  4HAV B;  3ZUN A;  3QC8 B;  3P6A A;  2KJ6 A;  1M7E A;  4BKS D;  2CHX A;  4FJY A;  1E7U A;  2L3Z A;  4ICV A;  4A3O A;  2O2V B;  1J19 A;  1Z2M A;  2M8S A;  4KHA A;  5KCV A;  2KGX B;  3X0W A;  1Q0W B;  2DYB A;  2UYZ B;  4W9L A;  4X57 B;  3ZTC A;  5CHW A;  1DDM A;  4EUT A;  2NBW B;  1V2Y A;  1JDE A;  3WYF B;  4TQ0 A;  2ZVN A;  1R4M I;  5L83 A;  3WIM A;  4XC2 A;  3KW5 B;  4W9H A;  2P0D A;  2RUK B;  2L7R A;  3ZNH B;  3OAN A;  3FM8 C;  1WM2 A;  3PHX B;  5DI9 B;  3KH0 A;  5G2N A;  3PEG A;  2PZ1 A;  1Z5S B;  2IYD B;  3ZDM C;  4KVG B;  5CLQ B;  3QX1 A;  4ASW C;  2OOB B;  2K8H A;  3FP5 A;  1GGO A;  1DRO A;  1SGH A;  3HM6 X;  2MP2 A;  3NHE B;  2DX1 A;  4ANW A;  5FI0 A;  4HAY B;  4A5K A;  5TR5 A;  2DAF A;  2EMT A;  1UNQ A;  3DBS A;  1MK7 B;  4BFR A;  1WZ0 A;  4B9K A;  4WVF B;  2OQB A;  1W1H A;  2IFS A;  3ODW A;  4MT7 A;  2D4Q A;  4MJS B;  2DFK A;  4II3 B;  2VSZ A;  4HLE A;  3V6C B;  2DLW A;  4FA6 A;  1OGW A;  1U5E A;  2DIK A;  4K7W A;  1P0R A;  2DN6 A;  3FEH A;  4GXB A;  1KBL A;  3WAN A;  2D3G A;  2BPS A;  3SD5 A;  5J3Q A;  1PLS A;  2JRI B;  3PLV A;  2GOW A;  1V5U A;  4IFS A;  1WGU A;  2CU1 A;  2VRR B;  1M7R A;  3VAW A;  1AQC A;  4AOF A;  1TBE A;  1WI0 A;  2EJ8 A;  2D9W A;  1UH6 A;  3B08 A;  5L81 A;  4NNJ B;  1IRS A;  3KYC D;  3SUZ A;  2M38 A;  5DHF B;  4ZDV A;  5E6P A;  1X1G A;  2LD9 A;  1LFD A;  1EF5 A;  3D8E A;  1QC6 A;  2L05 A;  5C16 A;  4FJZ A;  4TKN A;  3NS8 A;  4MEL A;  3QBV B;  2LOZ A;  4JK9 A;  4CHM A;  2DHJ A;  2KJH B;  2V4L A;  2XBB C;  4WJP A;  4JIO U;  1DDW A;  3F5R A;  2KMA A;  4JQW C;  3APF A;  2WWZ A;  2LOX A;  2L0T A;  3FLV A;  1CMX B;  2V3S A;  4HB3 B;  3VQI A;  5EDS A;  3P7Z A;  4XZ4 A;  3DQV A;  3R3M A;  4YL8 A;  1MIX A;  2LVQ A;  3H6N A;  2LAS A;  3AU5 A;  3ZNZ B;  3V5W A;  3U30 A;  4E74 A;  1WGQ A;  3ENE A;  2KK8 A;  3IHP C;  2RPQ A;  2COA A;  2LJ5 A;  2FCM A;  2IZV B;  1WM3 A;  2KFJ A;  5J18 A;  5J3Y A;  5JHB A;  2MP2 B;  1EO6 A;  3BY4 B;  3AI5 A;  2GBN A;  4NAW A;  3KUZ A;  1LW3 A;  2LVO A;  4TV3 A;  5D7G A;  3UZT A;  2BCJ A;  4KIK A;  4ZRI A;  4K7U A;  4ILG B;  2H7E A;  1E5W A;  1FOE A;  2P0H A;  2Y8G A;  3ALB A;  2FCQ A;  2IO2 B;  1J0G A;  1WF9 A;  2K6Q A;  2XQN M;  4FBJ B;  1KJT A;  2CS4 A;  1ISN A;  3A1Q A;  2H7D A;  1L7Y A;  2KCJ A;  4NY0 A;  2MLB A;  2DA0 A;  3L17 A;  5C5B A;  2DZK A;  1V86 A;  2YS3 A;  1C3T A;  5KQ1 A;  1XQQ A;  3E9P A;  1GG3 A;  3RUL A;  5D94 A;  3AJ4 A;  1GJZ A;  4DHJ B;  2I1K A;  1OTR B;  2OTX A;  2G4S A;  2P8V A;  4YON A;  3CST A;  5AZH A;  2G45 B;  1XOD A;  3X23 A;  4F7G A;  1RRB A;  4EMO A;  2YRY A;  1TGZ B;  2KC1 A;  1BTN A;  1DYN A;  2KAN A;  1GC7 A;  3DBH I;  5J2R A;  1WVH A;  4PS3 A;  3T9L A;  1X05 A;  2M17 A;  3CXB B;  1WJU A;  2ZCB A;  2DKQ A;  1V5P A;  1V5T A;  2BYV E;  2I1J A;  1WH3 A;  4KSL C;  1P9D U;  3W1Y A;  4HK2 A;  5HE3 A;  4HB0 B;  2L76 A;  2CR5 A;  2Z0E B;  4HAT B;  2UWQ A;  2FID A;  2Y5B B;  2KLG A;  1X1F A;  4Z2M B;  3VOQ A;  1SE9 A;  4LCD E;  4DK5 A;  4I6L B;  2X0S A;  4I6P A;  1GC6 A;  1V5M A;  4A6H A;  2JF5 A;  1A5R A;  2RNR B;  1WFY A;  4W9I A;  4MGI E;  1GUA B;  4BBN C;  2COP A;  1UZX B;  1BAK A;  4NAW B;  2D11 A;  2D10 A;  1HE8 A;  1OQN A;  1EUV B;  2JRH A;  3QQ8 B;  3KY9 A;  2ADZ A;  4KIK B;  5DPW A;  3QAR A;  1HBK A;  4KAX B;  4K7S A;  4IWO A;  2KC2 A;  4MK0 A;  4HPM B;  4JKF A;  1YIW A;  2PEA A;  3W1S A;  2J7Q B;  4W9F A;  3CSF A;  4IM2 A;  4FLH A;  2K2J A;  4K81 A;  2ZPY A;  2LGY A;  3A1Q B;  2PE6 B;  2KUP A;  2UZR A;  3UQA A;  4IW0 A;  1V89 A;  2YS5 A;  4ANU A;  3EC8 A;  4G3X B;  4GMV A;  3ML8 A;  4HCN B;  1U5G A;  1PMS A;  1H8C A;  2ZNV B;  4GSW A;  2W2W A;  4G0N B;  5GMV A;  4GDL A;  1U29 A;  5D3W A;  2K8C A;  2JWZ A;  5DCN A;  3PRP B;  5HE2 A;  4HVB A;  3ZLZ A;  1XD3 B;  1RAX A;  4FAD A;  4MSM B;  3WAO A;  1UNP A;  3M63 B;  2CY4 A;  3LJU X;  1F9J A;  4JL9 A;  2K2U A;  4KZ0 A;  1WJM A;  3SNH A;  4HJK A;  4KZC A;  2ELA A;  4E71 A;  3SU8 X;  2RQ1 A;  2O6V D;  3E9L A;  2QKL A;  3M1I B;  3UQB A;  1UBQ A;  2BKR B;  3KVF B;  2ZVO A;  3DPD A;  4WWO A;  4DWF A;  4MDK E;  4URK A;  4HXD A;  2KDI A;  2EMS A;  1V6E A;  3TO1 A;  4HAZ B;  2MBB B;  2MBO A;  1YQB A;  4BBK A;  2G3Q B;  2FCN A;  1DBH A;  1I2H A;  3HW2 B;  2JPH A;  3BIN A;  1Y19 B;  2L00 B;  5D3V A;  4KDI C;  5J3T A;  2KO3 A;  4W9C A;  3RCZ A;  1WY8 A;  2IBI B;  4HAU B;  3WAP A;  3UF8 A;  1OMW A;  4AJY B;  4WJO A;  3GYO A;  2C7H A;  3L13 A;  5IA7 A;  3NSU A;  2KNB A;  1FGY A;  4PQ0 A;  2KOX A;  3ZIM A;  1ZC3 B;  3LDZ E;  1WMH A;  1I35 A;  1MG8 A;  1KZ7 A;  5D3X A;  2KDE B;  4BVU C;  2DZJ A;  1PFJ A;  2K1F A;  4IM0 A;  3DDC B;  2FJL A;  2A5U A;  4WJ7 A;  4MGZ E;  2WDT B;  3H9D A;  1Q67 A;  3TW1 A;  3H7P A;  4JKG A;  4BKG A;  3P2B A;  2GBM A;  2RSG A;  3UIN B;  2UVM A;  3IVF A;  4W9D A;  2LUE A;  2LXC A;  2J59 M;  1EGX A;  4G11 A;  1VCB A;  2MW5 A;  3QJZ A;  5LOP B;  2X18 A;  3VVW B;  3A33 B;  4GDL B;  1XX0 A;  2JUO A;  2JVC A;  2WYQ A;  3RT3 B;  2GCJ A;  2DZM A;  2RD0 A;  1WJ4 A;  2PPH A;  1Q5W B;  4MH0 E;  2HJ8 A;  1NBF C;  1BTK A;  3N3K B;  1XCG A;  3PPA A;  2MQJ A;  3Q3J A;  1OQY A;  3APD A;  1NTY A;  3D32 A;  1FHW A;  4AP4 C;  2ASQ A;  4RMA A;  2ZCC A;  2FJ9 A;  3PP2 A;  2DX5 A;  3L08 A;  5CHV C;  3MHS D;  1BT0 A;  5HKH A;  4K1R B;  1AWE A;  2D9Z A;  4GMX B;  4EEW A;  1EAZ A;  3TMP B;  3V60 A;  2JT4 B;  2KZR A;  3DBL I;  1WGH A;  3CMM B;  1RLF A;  1U5D A;  4AJW A;  3DOW A;  4NPN A;  2FNJ B;  2LG1 A;  4JGH B;  2MSE D;  3ODX A;  1MKE A;  1OEY A;  3SBT A;  2BYE A;  2GJY A;  5C1Z A;  5DHA B;  1RFA A;  4BKS A;  1WX8 A;  1KZG A;  1KM7 A;  2IYB A;  1V49 A;  4ICU A;  2FCS A;  2AL6 A;  1G6J A;  2FDQ A;  3PZD A;  4II2 B;  3SV1 A;  2V1Y A;  2ZNV C;  1RRP B;  3JSV A;  2DHK A;  2KTF A;  1FAO A;  2LVP A;  4P7I A;  2OJR A;  1U4A A;  3SHQ A;  3OLM D;  3T06 A;  1WMH B;  3VUY A;  1ZC4 B;  4KDL B;  2Z0Q A;  2MRP A;  3R7Q A;  2G4D B;  1V5O A;  1WXM A;  2L2I A;  3H7P B;  4JKG B;  3JW0 X;  4RM9 A;  2NPT A;  2J0J A;  3APC A;  4RM8 A;  2ROZ B;  1E7V A;  2DYQ A;  3L10 B;  1SHC A;  1TJ6 A;  3DXE A;  3FSS A;  4CYE A;  1S3S G;  3RCP A;  3MJW A;  4K2P A;  3L16 A;  3VHT C;  1WE7 A;  5LON B;  2KN5 A;  2M0X A;  2E2X A;  5JHG A;  3A9J A;  3A8P A;  2KMC A;  2B3A A;  3B0A A;  3VFK A;  2ELB A;  3QCA A;  4JLC A;  4XWX A;  4F1S A;  3N32 A;  2YSZ A;  1UD7 A;  1P5T A;  2LRU A;  2DEN B;  4DBG A;  1WR6 E;  2QKM A;  1TZ1 A;  3LJ3 A;  2MX2 A;  3MDB C;  2MFQ A;  3ZNG C;  3A4R A;  3GZN I;  5AEK B;  1WXV A;  4GPT B;  1NU2 A;  1QZE A;  4GB9 A;  3G9W A;  3AU4 A;  2RLO A;  1ZVR A;  4LDT B;  3R66 C;  3TIX A;  1VBG A;  1YX5 B;  3KYD D;  2MDX A;  2XK5 A;  1I7A A;  4MGY E;  4F8C B;  4W9K A;  4TYZ A;  1GNU A;  2N23 A;  4ANV A;  5GOW B;  2IO1 B;  2GCL A;  3A4S C;  2K39 A;  4WQO B;  2KLC A;  1PQS A;  2FAZ A;  4JKC A;  2I5C A;  1M94 A;  1KI1 B;  2MKR A;  1Q1O A;  3EHV A;  2KD0 A;  3ONS A;  2VKI A;  4JKE A;  1YJ1 A;  1XKE A;  4K17 A;  4DBB A;  1TQZ A;  2HD5 B;  3O65 B;  2KTR A;  4EFO A;  3D8F A;  5JHA A;  3DVG Y;  1ZM0 A;  4NQL B;  5C6R A;  3JSV B;  2K8B A;  5HE0 A;  2D07 B;  3R7R A;  3QWM A;  1Z87 A;  5C79 A;  4IWP A;  2BYF A;  5EFX A;  3IFW B;  1YX6 B;  3UIP B;  1ZGU B;  1X1M A;  3VTW A;  2ZPN A;  3N7C A;  2WX0 A;  4GN1 A;  3PLU A;  1UNR A;  4DDI D;  3VH3 B;  4A6K A;  4WJQ A;  2HRJ A;  2CHZ A;  2REX A;  3UGB B;  3IBE A;  1LB1 A;  2PJH A;  2RSU A;  3ZRF A;  3UIO B;  1NI2 A;  2FIF A;  3ZRC A;  1V9J A;  4JKD A;  1LQB A;  1J0W A;  4AWJ A;  1UPR A;  3OJ4 B;  1RJ2 A;  1MAI A;  1P3R A;  2G35 A;  2KQ7 A;  1OY2 A;  4GDK A;  2N7E A;  2MBQ A;  2JY6 A;  4GOC A;  4WSF A;  4DDG D;  4GZU A;  5C23 A;  5JH5 C;  2YT1 A;  1X11 A;  3TJP A;  5DIF B;  3DVN V;  4H8S A;  5BO4 B;  4DXA B;  5J17 A;  1EVH A;  3PV1 A;  4PS8 A;  4KHO A;  5CTR C;  2D9V A;  3PSC A;  3V6E B;  3I3T B;  4Y94 A;  4FUL A;  2D9X A;  4PNK A;  3GOE A;  1V80 A;  4GGQ A;  4GU2 A;  5C5B B;  5JVL A;  2XK5 B;  3C0R B;  4PYU A;  2YLM A;  1XT9 B;  3QK0 A;  4D0N B;  4BOZ B;  2RR9 A;  2KFK A;  2LZ6 A;  4MGK E;  2D2Q A;  1TXD A;  4W9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...