2YVCA

Crystal structure of the radixin ferm domain complexed with the nep cytoplasmic tail
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for type II membrane protein binding by ERM proteins revealed by the radixin-neutral endopeptidase 24.11 (NEP) complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 85
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2yvcA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yvcA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2yvcA01
2AL6A 4EEWA 2P0HA 4HATB 3IVFA 1YD8U 5E6PA 1WYWB 2EMTA 3D32A 4WVFB 3QA8A 3VUYA 1MIZB 1BWNA 1E5WA 2PZ1A 5D6JB 1GUAB 4II3B 4KV2A 3M62B 5GOWB 3OJ4B 4WJNA 5DPTA 5C79A 4DHJD 2IYDB 2KDIA 4A3PA 2ZJDA 4YONA 4JLCA 4MM3A 3FEHA 3L54A 3ZTCA 5L95C 5EDSA 3WAMA 1GC6A 2O2VA 1S3SG 3QBVB 1W1GA 4K2PA 2DAJA 2D9WA 1EVHA 2HD5B 2KQ7A 3A33B 2DX1A 1SIFA 3A9KB 2K2UA 2XEWA 2NBUA 4MGZE 5E6OA 3HM6X 3D8DA 1IP9A 4XC2A 2EC1A 2EKEC 1I7AA 1U5GA 3SU8X 3ZDMC 4BKGA 1C3TA 1WMHA 3DVNU 2J0JA 2PE6B 3FSSA 4KHAA 2KWUB 2LZ6A 2XK5B 4LJPB 1EUVB 1V5UA 5CLQB 4BOSC 1V49A 1WM3A 1Z2MA 4G11A 4GXBA 1FB8A 5AZHA 3ZNID 3HW2B 3BINA 3T06A 1Q1OA 4CHKA 3UQAA 5C5BA 5DPSA 1P1AA 1M7EA 3WANA 4HPMB 4G3XB 3AU4A 2NR2A 1PLSA 2ZZPB 3KH0A 2CY5A 4BBKA 3PS6A 3DVNV 4LDTD 2M38A 2M1MA 3QWZB 2D3GA 4LJOB 2ABDA 1GG3A 1RAXA 2KDEB 2M17A 4GMVA 3ZNGC 2KFKA 4MH0E 4N9F4 1MK7B 2QHOA 4NSWA 2BYEA 3KUCB 1QQGA 2LUEA 4K81A 3NS8A 5CX3A 2DZMA 1WJNA 4TV3A 1P3RA 1E8ZA 3H7PB 3ZDTA 1XCGA 4K7SA 4XX5A 1BAKA 5HKHA 4DBGA 2KX0A 2PEAA 2GS0A 2IZVB 2DA0A 3DXDA 1SE9A 1TJ6A 5KQ1A 1I35A 3KVFB 2L76A 4II2B 4DK5A 1LW3A 2CR5A 4WJPA 4A6FB 3LDZE 4EKUA 1RJ2A 3PV1A 5JHHA 5DI9B 3HQCA 1UBQA 1HB8A 5L81A 3ZUNA 3HIZA 3PVUA 2N9XA 2ZNVC 2WH5A 4I6PA 1U5EA 4ZRIA 4IM3A 3WYFB 2K8CA 1NBFC 2BKRB 5HE2A 2N1VA 3ODOA 2DHIA 4AWJA 3MTNB 2D9YA 2HRJA 2A4ZA 4XWXA 5FI0A 1R4MI 3PVLA 2ZPYA 2I1JA 1VCBA 1ZGUB 2BWFA 2GBKA 2RD0A 4FHKA 1Y8RC 3W1SA 4TYZA 4HB4B 4ZRJA 1V5TA 4EFOA 3L16A 3SYXA 3TFMA 1E90A 3AI5A 2MDXA 1LM8B 2Y8FA 1NVLA 4CHJA 1D3ZA 4WSFA 4G0NB 4W9EA 2DZKA 3QQ8B 2LG1A 3UZTA 1OTRB 2BWES 2IY1B 3C0RB 3DPDA 3QHTA 3O65B 4MJSA 1KOTA 1J0GA 2JF5A 3ZVRA 2KMAA 3DVGY 3EFUA 4GDKB 4ASWC 4ANXA 4IWOA 4TQ0A 4PS8A 3RUIB 1WXMA 2DFKA 2KKCA 4GOCA 4HHVA 5C6RA 2NBWB 1WFYA 2DZJA 4ANUA 4KDIC 2EJ8A 1I42A 2C60A 2REXA 3RCZA 1YX5B 5BO4B 4D0NB 1EF5A 3LJ3A 1V61A 3RCPA 1LXDA 2IO0B 3W1YA 1V2YA 1H10A 3AU5A 3JSVB 1FHWA 4IOYX 2VRRB 3SUZA 1UNRA 1ZM0A 2ROZB 3CF6E 3DBLI 4FN2A 4JQWC 4W9GA 5JP4A 3ZW3A 1H8CA 2R2QA 2K25A 4NQLB 3ZTDA 1UD7A 1WVHA 4JL9A 1FOEA 1DROA 3KUZA 3ODWA 2YRYA 3L0WB 4FLHA 4B6WA 2L2IA 4GMXB 4EZKA 2KCJA 1X1MA 4Y94A 3IG3A 4HAYB 3SD5A 1WGYA 2G3QB 2M8SA 3F5RA 4A6HA 4HXDA 1ZVRA 4J6IA 4KAXB 2L7RA 2OJRA 4NAWA 1PFJA 5DPRA 3TL5A 3VQIA 4HWIB 5KHOA 3N30A 1UEFA 2DTCA 3VIAA 2X18A 3T9LA 3G9WA 3F0WA 2LGDA 1J19A 2RR9A 2G45B 4WWNA 4BOZB 4TUUA 2G35A 1XODA 1FGZA 2LOXA 1OMWA 5DHFB 3OJ3A 5E6NA 1KZGA 4YL8A 5LLIA 3ZO5B 1C1YB 1WGDA 2V4LA 4ICVA 5D2MB 1OQYA 2ASQA 4E74A 4DX90 1DDMA 1MKEA 1ZC4B 1WGHA 3W1SC 2FIDA 3ZKJC 1FAOA 4KHOA 4HAWB 2GBMA 3JYUA 1Z87A 2MQJA 4IUMB 4NQKE 2D9VA 1P98A 2NVUI 3EHVA 2YS1A 2DKQA 4IFSA 2LXAA 3KW5B 2Y5BB 4PNKA 3TCAA 2K8HA 1W1HA 4W9CA 4PS7A 4MY6A 1MAIA 2I1KA 2I5CA 1AARA 2C9WB 2VRWB 1V5OA 5D3XA 2RUKB 1V80A 2NZ8B 3KSYA 2LVQA 2NS5A 5TR5A 4F7ZA 2KJHB 4Z2NA 3PT2B 3A8PA 3T8MA 3GOEA 2HTHA 3UGBB 4F8CB 4ZRKA 1A5RA 4FJZA 1OEYJ 4NJ7A 4DHZE 3NHEB 4MGYE 2JZZA 4NJ6A 3I3TB 4LCDE 1WGQA 2KANA 3ML8A 1TQZA 3MHSD 2MFQA 4MSQB 5AEKB 1DYNA 1WR1A 3PPAA 4MT7A 2CHZA 4W9IA 3K9PB 4FULA 5EFXA 1K5DB 2UZRA 2V3SA 2N23A 4NPNA 2QKMA 3FM8C 3ML4A 1XD3B 1K8RB 4KSLC 4EUTA 1NTYA 3ULBA 2KO3A 2XK5A 4GSWA 4NY0A 2J0MA 4P7IA 1UH6A 2DYQA 1MG8A 1RLFA 2A5UA 2MLBA 4NAWB 4ZYNA 1IYFA 5JLJB 3P6AA 2FAZA 2UYZB 2MWNB 3DBHI 3RULA 3ZNHB 2W2XD 2DAFA 4W9FA 1FXTB 2JT4B 2PPHA 3APDA 2KOXA 3PZDA 2YT1A 2ZVOA 3VH4B 2UVMA 1XQQA 5G2NA 3A98B 4A6KA 2L8JA 1WXAA 4B6HA 4HCNB 1UBIA 4MSMB 4WAAA 2LBBA 2YLMA 3HHMA 4HAZB 2K2JA 2HJ8A 1U29A 3SO6A 2KUPA 3L13A 1CMXB 2RSGA 3ENEA 1V5PA 4KDLB 3DCGA 4WWOA 2LGXA 2JWZA 5DCNA 5IAAC 1P5TA 1R4NI 2YS5A 1WZ3A 3PGEA 2Q13A 3M95A 1WXVA 2OQBA 2WWZA 2KTRA 2IYBA 2PJHA 3EECA 4ZDVA 3VTVA 2W2WA 2B3AA 1J0WA 2DHJA 3AJ4A 2JVCA 2G4SA 2LASA 3VFKA 1ZKHA 1V88A 5C23A 2LKOA 4MELA 3PEGA 3VTWA 2KC1A 1X86A 1Y5OA 1P0RA 2G4DB 4NNJB 5J3TA 3M1IB 2KMCA 2KGXB 1HE8A 2IY0B 2I5FA 2DKPA 2ELBA 2DZIA 2WX0A 5FI1A 3KUDB 3KYDD 3PHWB 4A5KA 3AXCA 4IM0A 1WJ4A 4DDID 2LD9A 5D7GA 3PREA 4G50A 4IM2A 1RRPB 3A1QA 1BT0A 1U27A 3EC8A 2FUHB 2L1CA 2IO2B 2MBEA 2KHWB 2MRPA 2MX2A 3M3JA 2FCMA 4RM9A 4BKSD 2ZPNA 3UQBA 2JP2A 3D8FA 1NI2A 5D27A 2PE9A 2R2OA 2ZNVB 3NZUA 1RRBA 1WX7A 2MSED 4M8MA 2CHWA 2FIFA 3SV1A 3A9JA 2YT0A 3NY5A 2O2VB 3RYTA 5JH5C 3ULCA 1P3QU 4EMOA 2Y8GA 2R0DA 1MIXA 1WGUA 1X1GA 2MKRA 3VOQA 1OGWA 1WI0A 1WY8A 2AWTA 3N7CA 2D10A 2Z0QA 2BGFA 3IHPC 3KY9A 2COPA 4IG7B 3KRWA 1PQSA 4FJVB 4DHJB 2K8BA 4HDOA 3X0WA 5LOPB 3R66C 2AEHA 2KC2A 4IWPA 4DWFA 4MEMA 2P0DA 3JSVA 3KZ1A 1Q0WB 5J3QA 2ZVNA 2DX5A 3P2BA 2H7DA 3VTUA 1FGYA 5CHVC 1IRSA 1PMSA 4FHJA 2N9PC 4KHBB 3R3MA 5D94A 1LB1A 4GN1A 2KFKB 2JRIB 2UWQA 4HK2A 1WXSA 5AZGA 4WQOB 1T0YA 3PG7A 2DN6A 2D4QA 2GOWA 3VXWA 5JHBA 3L17A 3TO1A 5J17A 4KIKA 2FDQA 2ZCCA 2LRWA 1XR0B 5C5BB 4FJYA 3P7ZA 3CXBB 2EMSA 1GNUA 4PYZA 1G6JA 2MBOA 2RSUA 4ICUA 4RM8A 3K9OB 3M63B 1WGGA 2J7QB 2FJ9A 4I6LB 4B9KA 3TJPA 1M7RA 2IO3B 2RGNB 2K39A 1U5FA 5DHAB 4Z2MB 2MA9B 4MDKE 3WA0A 2RGFA 3U30A 1E8YA 5FR6A 2KX3A 2LWPA 2KWCA 4DX8A 1AWEA 3H7PA 3QC8B 4KSKC 4GDLA 3A4SC 4IC7B 4GGQA 4XZ4A 5C1ZA 1JRUA 4W9KA 4BBNF 4RMAA 3PSEB 4DXAB 2DHZA 2KK8A 3V61A 2YSZA 4CHMA 1VD2A 2ZCBA 2KXJA 2KDBA 3PLUA 4IWQA 1QZEA 2DYMA 2KWVB 1NDDA 3A4RA 3A1QB 3VAWA 3ALBA 2W2XC 3DQVA 3PVWA 2P8VA 5J3YA 2MP2B 2WYQA 1WJUA 1P9DU 3B08A 4HPLB 2DX5B 1Z5SB 4A20A 4K17A 4BKSA 4C0AA 1NTIA 3VHTC 3AULA 3RZWC 2YS3A 4WJ7A 2GCLA 4IAPA 4E71A 4EZLA 3L08A 1RFAA 2H7EA 3CMMB 3V6EB 3TVVA 2L0TA 1WIAA 1WF9A 4W9LA 4W9HA 5KCVA 1ACAA 1X1FA 2NPTB 1UZXB 2LVPA 2O6VD 2O6VB 1V89A 4KZCA 4BBNC 3A9KA 3QK0A 1WZ0A 1KI1B 4OVUA 4KVGB 3GZNI 3B0AA 4ANVA 4AJYB 2CHXA 1UNQA 1NTVA 2KLCA 2NCNA 3VUXA 2R09A 4DDGD 5IA7A 3VUWA 2UZSA 2KTFA 4BVUC 2DYOA 2KD0A 3ODXA 2V1YA 1J8CA 1WMHB 1V86A 3DBRI 2ZEQA 4AOFA 4X57B 2WDTB 1M94A 2CKHB 3LJUX 4FBJB 1P6SA 5CLLB 5DH9B 3CIKA 3U7DA 2K6DB 2CRFA 2N4FA 3PTFC 1BTKA 2D2QA 3ZVVA 5KHQA 3X23A 1KZ7A 1NU2A 2ROVA 2M0XA 2MBBB 1E8XA 2JUOA 1YQBA 2KDFB 1TTNA 2KN5A 2LXCA 3BY4B 1WJMA 3QIJA 4HDQA 3Q3JA 3PRZA 3MJWA 3IBEA 2OTXA 2AYOB 2KJ6A 4L6EA 3OAWA 2DYBA 4JGHB 1DDWA 3TBLD 4GU2A 4GIVA 2KVRA 2BYFA 3PSCA 4JIOU 5LXIB 2OOBB 4K1RB 1YIWA 4KZ0A 3V60A 2D07B 3WALA 1Q5WB 2JZ3B 1I2HA 2COAA 5DIFB 4F7GA 3SHQA 3Q3FA 2KLGA 3CSTA 1SHCA 2KFJA 4MJSB 1ZC3B 1MPHA 2AL3A 1HB6A 2GMIC 4HAUB 2JPHA 2IFSA 5CTRC 1L2NA 4M8NA 2K6QA 3DXEA 3IFWB 3BJIA 1WX9A 3QARA 5JHAA 1UPQA 3DBSA 4HLEA 3N32A 4K2OA 1N3HA 2RLOA 3H9DA 1FHXA 1Y19B 2ADZA 2L05A 1HBKA 3EPYA 1ZSQA 2J59M 4HB0B 5C16A 3JVZX 1V6EA 3PLVA 1YJ1A 2KQSA 4W9DA 4K7WA 1K5GB 3B1LX 3VVWB 1AQCA 4AJWA 4ANWA 3D8EA 1YX6B 5AZFA 5D3YA 3HK0A 1WRDB 4A6FA 3QAQA 2COFA 4H8SA 4MGIE 4WJQA 5JHGA 2LYDA 2O6VA 3H6NA 1WJ1A 1WM2A 1EO6A 3PHXB 4E3CA 4HB2B 4F7UP 4HJKA 3ZNZB 3UF8A 1KLVA 3TMPB 1BTNA 4HB3B 2BF8B 1OQNA 2MCNB 1KM7A 4EOYA 5LONB 2YF0A 3RT3B 4FA6A 2LULA 4URKA 2FJLA 1W1DA 2GBRA 5IJMA 3O96A 3QJZA 5J2RA 1V81A 5D3WA 3A8QA 3VH3B 1EAZA 1V9JA 5CHWA 2FCSA 4MK0A 2KTRB 2LJ5A 5G55A 2RQ1A 2N9EB 2Z0EB 3KYCD 2DYNA 3R7QA 1Q67A 1XD4A 2K00A 2JY6A 1U5DA 3QX1A 4GB9A 1UGMA 2IBIB 3GYOA 2L0FA 3A9JB 4A3OA 5CHFA 3SDLC 2Z0OA 2YVCA 2VSZA 2JRHA 1U2BA 2MBHA 2RPQA 3ZIMA 3NZSA 3WIMA 3QWMA 1B55A 4W9JA 3TIXA 5LXHA 1EF1A 2XQNM 2N1WA 3RZFA 1WE7A 3ZRFA 2BCJA 2RVBB 2Y7BA 1FHOA 2HE7A 2VKIA 3V62A 3WAPA 3ZLZA 4FADA 4PS3A 5JZEB 1ISNA 1QC6A 3MPXA 3PP2A 4TKNA 1H4RA 1OEYA 2LOZA 2LVOA 2MP2A 3ECIA 3L10B 4IW0A 2Z0PA 2L00B 3ML9A 3DDCB 3UINB 2JXXA 1WE6A 1WGRA 3U8ZA 1XX0A 3APCA 1ZW7A 2CAYA 2BKFA 2FCNA 2Z0DB 4AUQC 1MK9B 5HE0A 1UELA 5DPWA 3ONSA 1OY2A 3FLVA 1XKEA 4GDKA 1LQBA 3KRXA 1X05A 4I6NB 4DHZB 3PRPB 2D9XA 2LRUA 1TXDA 1L7YA 1E7VA 2W9NA 1KJTA 3UIOB 5L83A 3DXCA 2MW5A 2BYVE 3OLMD 3GYPA 3MDBC 4WJOA 4TQ1A 4LDTB 3R7RA 4PQ0A 3H7SA 2CS4A 2KNBA 1WI1A 2NMBA 2D9ZA 2RNRB 4HAVB 2V76A 2GBNA 2E2XA 2K1FA 2M4NA 2N7EA 1WR6E 1UNPA 2C7NB 2KJRA 4K7UA 4PYUA 2COCA 4F1SA 1XT9B 3H1UA 1DDVA 2C5LC 3DVGX 3OANA 1LFDA 1TBEA 1WG7A 1TZ1A 2C7HA 2NBVB 2WX1A 2MBQA 5D3VA 4EJNA 4GDLB 1E7UA 3HM3A 5GMVA 2FCQA 1V5MA 1WX8A 4AP4C 3TW1A 2CQUA 4EZJA 2KZRA 1EGXA 5KQ4A 3PRMB 4KIKB 1S1QB 3V6CB 1IPGA 2CY4A 1F9JA 1E8WA 2DENB 4GPTB 1DBHA 2MWSB 2D11A 4CYEA 1TGZB 3QCAA 3SNHA 3APFA 2HTHB 1SGHA 4MGKE 2C7MB 3NSUA 1ST7A 4M0WB 3UIPB 5HE3A 1UPRA 5J18A 2CB8A 1WJ6A 4HCPB 3VDZA 4CO7A 5HE1A 2L3ZA 3FP5A 3CSFA 3JW0X 1WH3A 4BKTA 2QKLA 2J0KA 2P0FA 4DBBA 4GZUA 3S2AA 2LI5A 2XBBC 2GCJA 2LGYA 3N3KB 3NOBA 2GBJA 2IO1B 2CODA 2BPSA 2DLWA 2CU1A 1GC7A 2NPTA 4WWPA 1X11A 3WAOA 4F7HA 3RD2A 3ZRCA 4HVBA 1U4AA 3DOWA 4BFRA 4HAXB 2Z59B 2M14A 2FNJB 2N7DA 1GJZA 2N0YA 4OVVA 2ELAA 4B95A 3V5WA 2DHKA 2GJYA
chains in the Genus database with same CATH superfamily
2YEPB 2P0HA 2LMCA 1WYWB 2EMTA 3D32A 3J9CA 4J3OD 3VUYA 5D6JB 2RDBC 4DHJD 2SAKA 4A3PA 2ZJDA 4MM3A 3L54A 4QJ5B 1VBHA 2O2VA 4LNFA 4KGTA 1N5XA 1EVHA 2DX1A 2K2UA 1F52A 4CQNA 1I7AA 1U5GA 2AQ1B 1K50A 4LJPB 3AE6B 1EUVB 5AZHA 4CHKA 1MVKA 2BB5A 5DPSA 1C4AA 1JWAD 1QLBB 3P4PB 4NJ6A 3DVNV 4LJOB 2M38A 2M17A 4MH0E 1SJED 2QHOA 2JYTA 2FJUB 4NSWA 3KUCB 1QQGA 4TV3A 1E8ZA 3U52E 3ZDTA 4K7SA 2GS0A 2DA0A 5I4DA 5KQ1A 2L76A 1LW3A 4OHJA 2J4XA 3ZUNA 2N9XA 2ZNVC 3GS2A 4ZRIA 3WYFB 2N1VA 2D9YA 3BVZA 2RD0A 1KH0A 2GBKA 1ZGUB 1JWBD 3W9CB 1V5TA 2Y8FA 4WSFA 2JU6X 3MP9A 2LG1A 1TKGA 1B1ZA 2JZPA 3O65B 2JF5A 3ZVRA 4EE2A 3ZJVA 4PS8A 2DFKA 1I42A 4JKBA 2EJ8A 2C60A 1GB1A 1EF5A 3U7ZA 2WHIA 3RCPA 1QOBA 1LXDA 1H10A 4IOYX 4PS3A 2PTLA 3DBLI 3DWMA 4US8A 4NQLB 1UD7A 1WVHA 1FOEA 1DROA 3L0WB 1V1OA 3IG3A 1IGDA 3F5RA 4A6HA 4HXDA 1PFJA 4HWIB 5KHOA 1SE4A 2DTCA 3SFEB 2E3TA 5TSSA 1J19A 2RR9A 1FNUA 3AE9B 4TUUA 5IP4D 1C1YB 2ASQA 1FD6A 3W1SC 2FIDA 1FAOA 4KHOA 2MQJA 4NQKE 2D9VA 1ZOYB 4IFSA 3RCZA 4WAFA 4UDUC 3FVCA 5D3XA 1WRIA 4F7ZA 2KJHB 3PT2B 2DLBA 3UGBB 1QOAA 2QDFA 4ZRKA 1A5RA 1OEYJ 4NJ7A 1TS5A 4M0WA 3I3TB 3PPAA 4MT7A 4M01A 4W9IA 3SBTA 2LGIA 5EFXA 2SEBD 4P1CC 3ML4A 4KSLC 1NTYA 3W2DA 1VRAB 1UH6A 1VZ8A 2A5UA 5H8YE 1MG8A 4S0RA 4LK0M 4HKQA 4ZYNA 3P6AA 4OSNA 2MWNB 1YN4A 3AN1A 2YT1A 1C79A 3VH4B 1HTQA 4XE0A 5G2NA 3A98B 2HJ8A 2RSGA 1V5PA 3DCGA 2LGXA 2ZKMX 2LHEA 1R4NI 1WZ3A 1JCKB 1F77A 2JVCA 1XLNA 3E9OA 1V88A 1TIFA 1ZKHA 5JVLA 2KC1A 3NRZA 1HE8A 2I5FA 3P4SB 2DZIA 3PHWB 2WX0A 3KUDB 5FI1A 1FM0D 4D2KA 1U27A 3EC8A 2FUHB 2L1CA 2IO2B 2MBEA 3NZUA 2MSED 4M8MA 3RYTA 2FIFA 3IAM1 4S17A 3NY5A 3I9V1 4C80A 1P3QU 2R0DA 3JSVA 2AWTA 3N7CA 2Z0QA 4ZOHC 4DHJB 1PQSA 4FJVB 2KC2A 3Q3OC 4DWFA 4MEMA 1XCQL 1J7CA 3P2BA 3TEWA 4GN1A 2DWQA 3IT4B 4A8XC 3ZJUA 3PG7A 2WDQB 1R4MB 3BVMA 2BVCA 2PW9A 5J17A 1XR0B 4FJYA 1T3QA 2M56B 1I4RA 1CK1A 2MBOA 2RSUA 4ICUA 1VBGA 3M63B 3HVZA 2J7QB 2FJ9A 4I6LB 2IO3B 5IOIA 4Z2MB 1ESFA 2RGFA 1GGOA 2J53A 2KWCA 4ARCA 4XZ4A 4IC7B 4W9KA 2QC8A 3AE2B 3PSEB 2Y3AA 3V61A 2WNMA 4IWQA 2DYMA 1NDDA 3A4RA 3A1QB 1PGXA 1FRRA 3PVWA 4HPLB 5J3YA 2MP2B 4A20A 2DX5B 4WJ7A 2VZKD 2GCLA 4IAPA 2LGSA 1RFAA 2H7EA 4WQMA 1WIAA 5KCVA 1ACAA 2O6VD 1L0YB 1KI1B 3ZJTA 4ANVA 1UNQA 3VUXA 4DDGD 2UZSA 1M4VA 3ODXA 2V1YA 4DIXA 3KLSX 4DQOC 4AOFA 2RMMA 1P6SA 4B0MA 4AS1A 3CIKA 2NMQA 3NVWA 3X23A 1NU2A 4ANWA 3Q3JA 3MJWA 1N6ZA 1EU3A 4L1RA 4GU2A 2N9LA 1OFFA 2WXJA 4K1RB 3WALA 1Q5WB 2JZ3B 2KWDA 2COAA 1SHCA 1ZC3B 1L2NA 2PVGC 4M8NA 3AECB 3IFWB 3QARA 1UPQA 4HLEA 2WXRA 2WXNA 2L05A 3BWUD 3JVZX 4WJPA 4W9DA 1JWUD 3B1LX 5I2SA 3N9YC 1WRDB 3QAQA 4MGIE 5JHGA 1WM2A 4RCOA 3PHXB 1KLVA 2KACA 4HB2B 4HJKA 1UF0A 1JMLA 1OQNA 3OG5A 4LTUA 4FA6A 5BYQA 5G5GA 3Q8BA 5IJMA 3O96A 2M0AA 5J2RA 1YMHE 1EAZA 2WXFA 5G55A 4C7YA 1XD4A 3QX1A 1U5DA 1UGMA 3GYOA 4A3OA 5CHFA 1MHXA 1Q10A 2JRHA 2WLBA 2MBHA 4LLGM 2RPQA 3NZSA 3WIMA 5LXHA 1KC7A 1EF1A 1N60A 2N1WA 4L1BA 1WE7A 3ZRFA 3ZLZA 1J7BA 1FHOA 3WAPA 4ASWC 1OEYA 3ML9A 1SXTA 1XX0A 2Z0DB 1MK9B 5HE0A 1UELA 5DPWA 3Q8EA 4DHZB 2LRUA 1TXDA 1E7VA 1T0SC 3UIOB 5L83A 4BZAA 3AE3B 4JK7A 1I4HA 4LDTB 3KWVA 2EKIA 2G1EA 2H89B 2RNRB 3U2SC 2M4NA 2GBNA 2N7EA 4PYUA 3DWGC 2AQ2B 2W82A 2RPVA 1T6BX 1WG7A 2C7HA 2NBVA 3GE3C 3HM3A 5GMVA 3TW1A 2KZRA 1F9JA 1E8WA 4GPTB 2KYWA 2V4IB 3AH7A 3NVZA 2C7MB 2PKOA 2KIEA 1UPRA 2CB8A 5HE1A 3P1MA 3JW0X 1GPXA 4DXGA 2P0FA 2GCJA 2IO1B 4WWPA 2DLWA 2W3SA 3RD2A 3DOWA 3IT6B 1KFYB 2Z59B 4C56C 2ELAA 1OQQA 3V5WA 3PV1A 2DHKA 2I1JA 4EEWA 3P63A 1FXIA 1MIZB 2INNE 4AQ7A 3M62B 5GOWB 5DPTA 5C79A 1AW7A 3ZTCA 4YONA 1GC6A 4GLSC 4K2PA 2MJ3A 2D9WA 3A33B 5E6OA 4ZRPA 2NBUA 3AE1B 2EC1A 3SU8X 4BKGA 1C3TA 2Y5PA 4KHAA 3R2IA 4HSIA 4GXBA 1L5PA 3UQAA 3HVDA 1M7EA 3ZGZA 2KVZA 1D5ZC 2WXLA 2NR2A 2ZZPB 2CY5A 2IDYA 3ETRA 4LDTD 2D3GA 3OWEB 3NS8A 2DZMA 2X0SA 1DOXA 3H7PB 3V05A 2R61A 2PEAA 1I35A 3TSSA 3KVFB 4DK5A 2CR5A 1RJ2A 5L81A 1U5EA 2PVOD 1UNSA 2A4ZA 3NVVA 1R4MI 2ZPYA 3W1SA 1ENFA 4ZRJA 3L16A 3DCXA 2MDXA 5EE9A 1XLPA 1D3ZA 2DBYA 4NZLB 3QQ8B 1OTRB 2BWES 3C0RB 1KOTA 3EFUA 4IWOA 3RMKC 5BYRA 3RUIB 1WFYA 1JROA 2MJEA 2JX5A 4D0NB 3LJ3A 2GUMA 2E6XA 2FE8A 2WGSA 3W1YA 4LNIA 1V2YA 5LG4B 4OT1A 4I6NB 2D3BA 2VRRB 4WJNA 4JQWC 2ROZB 3CF6E 4W9GA 1E10A 4XYCA 3MFGA 2K25A 3ZTDA 4JKFA 3ODWA 4P6VF 2BW2A 3NW8A 2KCJA 2M8SA 1VZ6A 4J6IA 4QJ3B 4AJYB 2V3NA 3TL5A 4NJCA 1UEFA 1WXQA 3T9LA 2OEDA 3G9WA 2DIKA 1JWSD 2LGDA 2G45B 2LOXA 1SE2A 2J52A 3N1XC 1WGDA 2V4LA 4ICVA 4WH4A 4DX90 1DDMA 1MKEA 3EA6A 5EE3A 2GBMA 1FXAA 1Z87A 1YJIA 4IUMB 4OZBA 3DBHB 1P98A 2Z13A 3EHVA 2DKQA 3TCAA 1MAIA 1T0RC 2MEKA 5G5HA 2I1KA 3RNCC 2C9WB 2NZ8B 2NS5A 4C4VA 3GOEA 1SEBD 4FJZA 4MGYE 4ILGB 5AEKB 4MSQB 4DXFA 2LUMA 4FULA 1K5DB 2J42A 2V3SA 3NWFA 1C77A 1K8RB 4GSWA 2J0MA 4P7IA 2DYQA 5JLJB 2FAZA 3RULA 3EFCA 3ZNHB 5T8IA 2LHDA 2DAFA 4W9FA 2JT4B 3E9SA 4PK1A 4JKCA 2KOXA 3PZDA 2ZVOA 2UVMA 4JKGB 3BZDB 2L8JA 1WXAA 4B6HA 3RN9C 1U29A 4TQ0A 2WU2B 3ENBA 4WWOA 5IAAC 3PGEA 2YS5A 2VH2A 2Q13A 3EECA 3WCQA 1SF0A 2W2WA 2B3AA 1J0WA 2DHJA 2G4SA 5C23A 4MELA 1X86A 1Y5OA 1P0RA 5J3TA 1T5XD 3M1IB 2IY0B 2DKPA 2ELBA 2W55A 3DBLB 4IM0A 1WJ4A 4RGOS 1RRPB 2D3AA 3VTVA 3RNGC 3UQBA 2JP2A 5D27A 2R2OA 2ZNVB 1RRBA 1WX7A 3ZXVA 2CHWA 1YOVB 3A9JA 5JH5C 2YT0A 3LYYA 1PYWD 4EMOA 1MIXA 2MKRA 4OVUA 3VOQA 1WI0A 3IHPC 3KY9A 2JWUA 3VRBB 2ZVNA 2K5PA 4OZAA 3IXSA 1PMSA 4KHBB 5D94A 3RNEC 1LB1A 4HK2A 2K3UA 2DN6A 2D4QA 2GOWA 3VXWA 5AUIA 5JHBA 5JXVA 3V3XA 3VRAB 3HIEA 3FILB 4PYZA 2QILA 3K9OB 4D6WA 4JKAA 1DYQA 3AEDB 1M7RA 2K39A 3AEBB 1NI3A 1KLGD 1P7EA 4IKGA 5FR6A 3H7PA 1HZ6A 3QC8B 3A4SC 5C1ZA 2MH7A 3CIRB 2DHZA 2JXTA 4CHMA 3VR9B 2ZCBA 1XCTL 2KXJA 2KDBA 2KWVB 2D5GA 2P8VA 1WJUA 1DGJA 2I2YA 3NJTA 3AULA 3RZWC 3VHTC 2LFIA 4E71A 4RH6A 3L08A 4W9HA 3BIID 2NPTB 2LVPA 2W54A 4HEA1 2JQRB 2XNAC 1V89A 4ACFA 3A9KA 3QK0A 1WZ0A 1EWCA 4YTPB 2QSDA 4BVUC 1J8CA 3DBRI 2ZEQA 3NZ3A 4RNAA 4YSYB 4FBJB 1K51A 3EUB2 1JDEA 2KN4A 3ZVVA 1BTKA 2D2QA 5KHQA 2M0XA 2R82A 3FILA 5AZFA 2JUOA 4ILJA 2KDFB 4RM8A 2WXHA 1WJMA 3QIJA 4HDQA 1T77A 4LNKA 5C2TB 2OTXA 3BK1A 1TS4A 2KJ6A 1PFDA 4L6EA 4JKDA 4YSXB 1DDWA 4GIVA 2BYFA 4JIOU 5HI1A 4C4VB 3KQ4A 1HTOA 4F7GA 1L0VB 2M19A 3Q3FA 2KLGA 3CSTA 2KFJA 2IFSA 2K6QA 3BJIA 1WX9A 3MC9A 3Q3MC 3FC4A 1WYGA 3N32A 4TSSA 1N3HA 1Y19B 1C9FA 2TSSA 1ZSQA 3B2GA 3BK2A 5C16A 1L6VA 5LLIA 4EFOA 3VVWB 1AQCA 3D8EA 4KGSA 4RGTA 5D3YA 4H8SA 4WJQA 1IGCA 2LYDA 1XXGA 1WJ1A 3MC0B 1EO6A 1EWYC 4F7UP 3UI3A 4YWGG 2GRIA 1BTNA 2WU5B 3AEGB 1I4QA 3RT3B 1ZYIA 3VH3B 2KIGA 5AUKA 2RQ1A 2K00A 2JY6A 4OZCA 1I4GA 2IBIB 4N6EB 3BYTB 2YVCA 2VSZA 1E0ZA 1VDVA 2Z14A 3HSAA 2ONQA 3RZFA 2BCJA 3IAS1 4FADA 2VKIA 2N7JA 3MPXA 1JALA 3NHEB 1ET6A 4IW0A 3L10B 2L1AA 5H92C 1RWSA 2CAYA 2FCNA 1OY2A 1XKEA 1MJDA 4RFBA 4FXCA 1ZDVA 2MW5A 1AN8A 4N59A 3Q8CA 3GYPA 4TQ1A 3H7SA 3ZQ4A 1FCCC 1WI1A 2AQ3B 2K1FA 2V76A 3RI7C 4K7UA 2COCA 3OANA 1TBEA 2NBVB 2WX1A 4EJNA 3GB1A 5BMIA 2FCQA 1V5MA 4K3CA 4AP4C 4EZJA 1I4XA 3BVGA 5KQ4A 4KIKB 4ZYSA 2DENB 2K22A 4MH8A 3SNHA 3NSUA 1VZ7A 4RF0A 4CO7A 3VDZA 1FMAD 3CSFA 3FP5A 1WH3A 4NAMA 4DBBA 4GZUA 4L23A 4A55A 2ZW1A 5LNK1 3WAOA 2CODA 3ZRCA 1FPYA 1F2RC 2M14A 2FNJB 4B95A 3PEGA 2GJYA 1E7PB 3DBRB 2AL6A 4HATB 3B9JA 5E6PA 3QA8A 1PGBA 2KQ4X 1GUAB 2LJIA 2IYDB 2KDIA 5L95C 3N1YC 1SJHD 1S3SG 3AE5B 1W1GA 2K8EA 1FRDA 2KQ7A 1SIFA 3A9KB 2XEWA 4P1BC 4JKHA 3HM6X 3D8DA 2EKEC 3ZDMC 1NENB 1VJKA 2QMTA 3DVNU 2J0JA 3FSSA 2KWUB 2L32A 2LZ6A 1N61A 4BOSC 1WM3A 3RNBC 3ZNID 1FB8A 1ZXHA 1Q1OA 1QQRA 2WDRB 2KMMA 2QCZA 4HPMB 4G3XB 2Q5WD 4C00A 3KH0A 4BAXA 2CU3A 2M1MA 3H8HA 2ABDA 1GG3A 1RAXA 3ZNGC 4N9F4 1MK7B 2PMVA 4M02A 2BYEA 1HXYD 5CX3A 3MJ5A 1P3RA 4C7ZA 1XCGA 1BAKA 5HKHA 2KX0A 2R2YA 1FCLA 3DXDA 4QJ4B 1SE9A 1WSPA 3LDZE 3Q69A 5JHHA 1UBQA 2MJDA 1HB8A 3PVUA 2WH5A 4IM3A 2K8CA 1NBFC 2BKRB 5HE2A 3ODOA 2DHIA 3MTNB 2HRJA 5FI0A 1VCBA 1FNVA 2BWFA 4ZRQA 1Y8RC 4TYZA 4HB4B 1C4PA 3SYXA 3AI5A 1LM8B 4OVZA 2IJ0A 1NVLA 4CHJA 4G0NB 4JKEA 2DZKA 4W9EA 3SBGA 2IY1B 3DPDA 2BYTA 1ROEA 2KMAA 4GDKB 3DVGY 4ANXA 1GB4A 2IGHA 3NG0A 2KKCA 4GOCA 5C6RA 4ANUA 2NBWB 1YN3A 1V61A 2IO0B 1LO5D 3AU5A 3JSVB 4USAA 4RGMA 1UNRA 4FN2A 5JP4A 2R2QA 2KDMA 4JL9A 4B6WA 1VLBA 3KUZA 1D5XC 4EZKA 1WGYA 2G3QB 4KAXB 2L7RA 2OJRA 3VQIA 1KBLA 3N30A 3VIAA 2X18A 1TY0A 1ET9A 3F0WA 4CSQA 4WWNA 5HG2A 3OJ3A 5DHFB 5E6NA 4YL8A 1XLOA 3U12A 2Y5CA 2NTSA 5D2MB 1GOZA 1OQYA 4KGRA 2JYEA 1ZC4B 2D3CA 2GLSA 4HAWB 2MHJA 2NVUI 3AM9A 3KW5B 4W9CA 2Y5BB 4PNKA 1W1HA 4PS7A 1V80A 2VRWB 1V5OA 1KTKA 2LVQA 2WDVB 2KUQA 1RYJA 5TR5A 4Z2NA 2VZKB 5M4YB 1K52A 1ZUD2 2JSVX 4DHZE 2JZZA 3N1ZC 1LGRA 1WGQA 1QOGA 2KANA 1TQZA 1QT9A 1SBBB 1WR1A 3PO0A 1SIJA 3L4PA 2N23A 1XD3B 4ITKA 1FNWA 4EUTA 1FFVA 2XK5A 2KO3A 4NY0A 3HRDD 2MLBA 1IUEA 1RLFA 4WURA 3I63C 4A6KA 4HCNB 1UBIA 4MSMB 4WAAA 2LBBA 3HHMA 4HAZB 3L13A 1RFKA 2KUPA 1CMXB 2ACZB 3ENEA 4KDLB 2JWZA 5DCNA 1P5TA 1CQVA 4PT5A 2OQBA 2PJHA 4ZDVA 3AJ4A 4R3DA 3VFKA 4NNJB 3B2FA 2KGXB 3KYDD 3AXCA 1AWDA 5D7GA 4IM2A 2XN9C 1BT0A 3A1QA 3AEAB 4RM9A 1TYGB 2FCMA 3M3JA 4BKSD 3X0WA 3D8FA 1NI2A 3SV1A 5EE0A 3ULCA 2Y8GA 1X1GA 1J0GA 3PTFC 1WY8A 2BGFA 2X8XX 2D10A 2COPA 4YTNB 3KRWA 4JWUC 1C4CA 2K8BA 5LOPB 2AEHA 4IWPA 3KZ1A 4TMAB 1HQRD 1Q0WB 2DX5A 3VTUA 4XWTA 5CHVC 1IRSA 2KFKB 2JRIB 1T0YA 1KRHA 1L4DB 2GI9A 2L52A 3L17A 3TO1A 4KIKA 2FDQA 3P7ZA 2EMSA 3MC8A 1GNUA 1WGGA 3TJPA 4KX6B 1U5FA 2MA9B 3WA0A 1E8YA 1AWEA 5FK9C 4GGQA 2HTME 1V97A 2KK8A 1TY2A 4US9A 3RFZB 3VAWA 1MHHE 5I2MA 1NTIA 3CMMB 3V6EB 5E6JA 3TVVA 1WF9A 2KR0A 1X1FA 3AMZA 2O6VB 3W5UB 1QKZA 2BB6A 2Z4DA 3E66A 5HFYA 4KVGB 3GZNI 2CHXA 1NTVA 2KLCA 2NCNA 1YNTE 5IA7A 1YQ3B 3TEZA 3Q14C 2DNFA 1TKEA 1WMHB 1V86A 4X57B 1M94A 2CKHB 3LJUX 2HDEA 5DH9B 3C8YA 2IGDA 2K6DB 1K53A 3DHHC 4N58A 2WXMA 2ROVA 2MBBB 3BY4B 1E8XA 4G50A 1DIKA 1YQBA 1MI0A 3OAWA 4JGHB 2OOBB 4KZ0A 2IGGA 1TZOA 1I2HA 5DIFB 3BYYB 1OQRA 3T3OA 1N62A 3R2TA 2JPHA 2GMIC 1TJEA 4WIPA 3DXEA 2ZW0A 4ZHOA 3P4RB 1HZ5A 5JHAA 3DBSA 4YT0B 3PZ7A 3I57A 1AYFA 2RLOA 1FHXA 4YTMB 3EPYA 2J59M 4HB0B 1VR9A 1V1PB 3PLVA 1R7SA 1K5GB 2YT2A 4RF1A 1YX6B 1TS2A 4A6FA 3H6NA 2O6VA 1HEZE 3NWDA 3TMPB 1GAQB 3I5JC 1KM7A 4REZA 5LONB 2YF0A 2BS4B 4URKA 2LULA 3MHZA 2FJLA 1W1DA 3A8QA 4MM3B 3NS1A 4MK0A 3R7QA 3GP7A 1Q67A 4GB9A 3Q8FA 2L0FA 3A9JB 4YXDB 3SDLC 1J7AA 1U2BA 1B55A 2RVBB 5JZEB 4TKNA 3PP2A 2MP2A 1H4RA 2LOZA 2Z0PA 3URYA 4HJGE 2JXXA 2K9XA 1STEA 1WE6A 1TKYA 3U8ZA 1WGRA 3APCA 1ZW7A 4YSZB 2BT6A 3ONSA 4GDKA 3KRXA 2D9XA 4HKZE 1CJEA 3DXCA 2EELA 2I38A 3OLMD 3MDBC 4WJOA 3R7RA 1D4BA 2ON8A 2D9ZA 2NMBA 4HAVB 4B0EA 2E2XA 4F1SA 1XT9B 3H1UA 1DDVA 2NTTA 3DVGX 1LFDA 4KKIA 3Q8AA 5D3VA 2N0SB 1WX8A 2CQUA 3E9LA 2IPKD 3V6CB 1TGZB 4CYEA 4QXAB 2HTHB 1C76A 2CJOA 1SGHA 1TT5B 4MGKE 3U4EG 3OHMB 1ST7A 3GE8C 5HE3A 1NYRA 1WJ6A 4HCPB 3LXFA 2L3ZA 1PGAA 3S2AA 2XBBC 3TUOA 1E6EB 2LGYA 2NPTA 2CU1A 4HVBA 1X11A 1FO4A 1WWTA 4XDDA 1GJZA 4OVVA 2QIEB 3IVFA 1CZPA 1YD8U 4WVFB 3E9PA 1BWNA 1E5WA 2PZ1A 4WWMA 4II3B 4KV2A 3OJ4B 4JLCA 3FEHA 3GZNB 5EDSA 5GXGB 2V9HA 3WAMA 3QBVB 2DAJA 5FR3A 2HD5B 3Q6BA 1C78A 4MGZE 3W5VB 3SEBA 3NUHB 1IP9A 4XC2A 1WMHA 3LB8C 2PE6B 2XK5B 1V5UA 5CLQB 1JW9D 2CJNA 1V49A 3VR8B 1Z2MA 4G11A 5D3IB 3HW2B 3BINA 3T06A 5C5BA 2HJ1A 1P1AA 2X38A 2K49A 3AU4A 1PLSA 3PS6A 4BBKA 2WS3B 3QWZB 5J18A 2KDEB 4GMVA 2KFKA 2BS2B 2LUEA 4K81A 5FKAC 1WJNA 4XX5A 4DBGA 3SFDB 2IZVB 1B9RA 1EM7A 1TJ6A 4II2B 1D6EC 2V3PA 4A90A 4A6FB 4EKUA 5DI9B 3HQCA 4I6PA 4AWJA 3ABVB 4XWXA 3PVLA 3AB5A 4FHKA 4M00A 3TFMA 1E90A 4ILHA 3UZTA 1ZXIA 3QHTA 4MJSA 2WXIA 1UWMA 5IRSA 1WXMA 1ZPSA 1V8CA 4HHVA 2DZJA 4KDIC 4HROA 2REXA 1YX5B 5BO4B 2H88B 1MI1A 3Q2AC 4MDKE 1FHWA 3SUZA 1ZM0A 2OHFA 3ZW3A 1H8CA 3RNAC 1ZDXA 2YRYA 4FLHA 2L2IA 4GMXB 1X1MA 4Y94A 3SD5A 4HAYB 3WANA 4NAWA 1ZVRA 3CWIA 1R4NB 3DHGC 5DPRA 1BMLC 2GB1A 4JWSC 4BOZB 1MG4A 2G35A 1XODA 1FGZA 4MACA 1OMWA 1I7HA 4OW0A 1KZGA 3ZO5B 4E74A 2PLPA 1WGHA 3ZKJC 4KKJA 3JYUA 3T3NA 3RPFC 3DHIC 2WXKA 4L2YA 2YS1A 2LXAA 2K8HA 4MY6A 4ZHPA 4K3BA 2I5CA 1AARA 2RUKB 3KSYA 4GNKB 3A8PA 1F0ZA 3T8MA 2HTHA 1V1PA 4F8CB 1YJJA 4LCDE 1JWMD 1WGKA 3ML8A 3ZYYX 3MHSD 2MFQA 1DYNA 2CHZA 3K9PB 3AE4B 2UZRA 5HHDG 4NPNA 2QKMA 3FM8C 3ULBA 4B9KA 1IYFA 4QAYA 2UYZB 3DBHI 2W2XD 3P4QB 1UUPA 1FXTB 3APDA 2PPHA 1XQQA 5BMGA 1MPEA 1NVID 1XO3A 4P16A 2YLMA 2K2JA 4NAWB 1ZP0B 3SO6A 4AUQC 1XLQA 1ZE3D 5D3DA 3M95A 1WXVA 2WWZA 2KTRA 2IYBA 2INCC 2QEJC 5IKCM 2WP9B 2LASA 2LKOA 3VTWA 2G4DB 3E56A 2KMCA 2Z59A 3AE8B 4DDID 4A5KA 2LD9A 3PREA 2MX2A 2MRPA 2KHWB 2ZPNA 4H2AA 2PE9A 1JQ4A 2YEPF 2BQQA 5BYSA 1PDXA 1OGWA 1WGUA 2O2VB 1XEEA 3B77A 1DOYA 3ZXRA 5EE1A 4HDOA 3R66C 4JKGA 4JK8A 2WXOA 2P0DA 5J3QA 2H7DA 3A58A 1FGYA 2G9HD 4FHJA 2N9PC 1D5MC 3R3MA 2V0GA 4MT5A 2UWQA 1WXSA 5AZGA 4WQOB 4A6QA 2KT7A 5BMHA 3SR6A 2ZCCA 2LRWA 1F2RI 3R8BA 5C5BB 3AE7B 5IO9A 3C19A 1KF6B 2INDC 3CXBB 4JE3B 3TEYA 4KHBA 1EU4A 1G6JA 1T0QC 4IOIE 1PUTA 3NVYA 2RGNB 5DHAB 3NWAA 4A9AA 1BXTA 1QILA 3U30A 2KX3A 2LWPA 4DX8A 1YN5A 4KSKC 2WQYB 4GDLA 1JRUA 3TEXA 4BBNF 1FFUA 4RMAA 2BTEA 4DXAB 2YSZA 4JPSA 1VD2A 4Q2JA 1QOFA 3PLUA 1QZEA 3ALBA 2W2XC 3DQVA 2WYQA 3Q3NC 3B08A 4BBNC 1P9DU 5IN7A 1Z5SB 4BKSA 4K17A 4C0AA 5MPOA 2YS3A 3KWLA 2UU7A 1HA5A 4EZLA 4GOUA 1BUIC 2L0TA 4W9LA 1UZXB 3PZ8A 4KZCA 1FEHA 1F1HA 2L83A 3AEFB 3B0AA 1SE3A 2R09A 3VUWA 2KTFA 2DYOA 2KD0A 4O1NA 2BBCA 3FAHA 2WDTB 4HRSA 5CLLB 1A70A 3U7DA 2CRFA 2N4FA 1XF5L 2VH1A 3EGRA 4IDIA 2PIAA 1KZ7A 1ACCA 2LXCA 4IG7B 1TTNA 2KN5A 3PRZA 1N5WA 3IBEA 1E9MA 1UGJA 2AYOB 2LEKA 2DYBA 3TBLD 2RDGA 2KVRA 3PSCA 5LXIB 1YIWA 3V60A 2D07B 3SHQA 1UWXA 2WXGA 4MJSB 1MPHA 2AL3A 1HB6A 5CTRC 4HAUB 1SSNA 2FUG1 4K2OA 2B76B 3H9DA 2ADZA 2KAJA 1HBKA 4JK9A 1V6EA 2KQSA 1YJ1A 4AJWA 4K7WA 1L0XB 1RM6C 3N20C 2INPE 3HK0A 2RDHA 2COFA 1MFWA 4HPPA 1JRPA 3HUIA 4E3CA 1QF6A 3ZNZB 3UF8A 4HB3B 2BF8B 2ICIA 2MCNB 4EOYA 1KLUD 1L6UA 2GBRA 3QJZA 1L4ZB 1V81A 5D3WA 2BS3B 1V9JA 5CHWA 2FCSA 2RRFA 2LJ5A 2KTRB 2N9EB 2Z0EB 3KYCD 2DYNA 2W3RA 2FBWB 1FIQA 2Z0OA 3ZIMA 2AX5A 2WXPA 4LNNA 3QWMA 4W9JA 3TIXA 2XQNM 2Y7BA 1P7FA 3V62A 2HE7A 3FKYA 1Y56A 1ISNA 1QC6A 2LVOA 3ECIA 3O13A 3RNFC 2L00B 3P42A 4ARIA 3DDCB 3UINB 1SB3C 2Z8LA 2BKFA 1DOIA 3FLVA 1LQBA 1X05A 3PRPB 2OJWA 2W9NA 1L7YA 1NYQA 1KJTA 4XDCA 2BYVE 4XGAB 1YQ4B 5C3JB 4PQ0A 2CS4A 2KNBA 3HIZA 1WR6E 1UNPA 2C7NB 2KJRA 1IBXA 2C5LC 1N63A 1TZ1A 2MBQA 4GDLB 1E7UA 4JX1C 1EGXA 3PRMB 1S1QB 1IPGA 2CY4A 2MWSB 1DBHA 2D11A 3QCAA 1NEKB 3APFA 4M0WB 3UIPB 2WXQA 4BKTA 1IBXB 2QKLA 2J0KA 4LNOA 1TS3A 2LI5A 3AEEB 3N3KB 1I4PA 2GBJA 3NOBA 2BPSA 4XWWA 2K0PA 1GC7A 4F7HA 1U4AA 4RGNA 4BFRA 4HAXB 2N9KA 2N7DA 2N0YA 3AV8A 2QJLA
chains in the Genus database with same CATH topology
2P0HA 1WYWB 2EMTA 3D32A 3VUYA 5D6JB 4DHJD 4A3PA 2ZJDA 4MM3A 3L54A 1VBHA 2O2VA 1EVHA 2DX1A 2K2UA 1I7AA 1U5GA 4LJPB 1EUVB 5AZHA 4CHKA 5DPSA 4NJ6A 3DVNV 4LJOB 2M38A 2M17A 4MH0E 2QHOA 4NSWA 3KUCB 1QQGA 4TV3A 1E8ZA 3ZDTA 4K7SA 2GS0A 2DA0A 5KQ1A 2L76A 1LW3A 3ZUNA 2N9XA 2ZNVC 4ZRIA 3WYFB 2N1VA 2D9YA 2RD0A 2GBKA 1ZGUB 1V5TA 2Y8FA 4WSFA 2LG1A 3O65B 2JF5A 3ZVRA 4PS8A 2DFKA 1I42A 4JKBA 2EJ8A 2C60A 1EF5A 3RCPA 1LXDA 1H10A 4IOYX 4PS3A 3DBLI 4NQLB 1UD7A 1WVHA 1FOEA 1DROA 3L0WB 3IG3A 3F5RA 4A6HA 4HXDA 1PFJA 4HWIB 5KHOA 2DTCA 1J19A 2RR9A 4TUUA 1C1YB 2ASQA 3W1SC 2FIDA 1FAOA 4KHOA 2MQJA 4NQKE 2D9VA 3RCZA 4IFSA 5D3XA 4F7ZA 2KJHB 3PT2B 3UGBB 4ZRKA 1A5RA 1OEYJ 4NJ7A 3I3TB 3PPAA 4MT7A 4W9IA 3SBTA 5EFXA 3ML4A 4KSLC 1NTYA 1UH6A 2A5UA 1MG8A 4ZYNA 3P6AA 2MWNB 2YT1A 3VH4B 5G2NA 3A98B 2HJ8A 2RSGA 1V5PA 3DCGA 2LGXA 1R4NI 1WZ3A 2JVCA 3E9OA 1V88A 1ZKHA 5JVLA 2KC1A 1HE8A 2I5FA 2DZIA 3PHWB 2WX0A 3KUDB 5FI1A 1U27A 3EC8A 2FUHB 2L1CA 2IO2B 2MBEA 3NZUA 2MSED 4M8MA 3RYTA 2FIFA 3NY5A 1P3QU 2R0DA 3JSVA 2AWTA 3N7CA 2Z0QA 4DHJB 1PQSA 4FJVB 2KC2A 4DWFA 4MEMA 3P2BA 4GN1A 3PG7A 5J17A 1XR0B 4FJYA 2MBOA 2RSUA 4ICUA 1VBGA 3M63B 2J7QB 2FJ9A 4I6LB 2IO3B 4Z2MB 2RGFA 1GGOA 2KWCA 4XZ4A 4IC7B 4W9KA 3PSEB 3V61A 4IWQA 2DYMA 1NDDA 3A4RA 3A1QB 3PVWA 4HPLB 5J3YA 2MP2B 4A20A 2DX5B 4WJ7A 2GCLA 4IAPA 1RFAA 2H7EA 1WIAA 5KCVA 1ACAA 2O6VD 1KI1B 4ANVA 1UNQA 3VUXA 4DDGD 2UZSA 3ODXA 2V1YA 4AOFA 1P6SA 3CIKA 3X23A 1NU2A 4ANWA 3Q3JA 3MJWA 4GU2A 4K1RB 3WALA 1Q5WB 2JZ3B 2COAA 1SHCA 1ZC3B 1L2NA 4M8NA 3IFWB 3QARA 1UPQA 4HLEA 2L05A 3JVZX 4WJPA 4W9DA 3B1LX 1WRDB 3QAQA 4MGIE 5JHGA 1WM2A 3PHXB 1KLVA 4HB2B 4HJKA 1OQNA 4FA6A 5IJMA 3O96A 5J2RA 1EAZA 5G55A 1XD4A 3QX1A 1U5DA 1UGMA 3GYOA 4A3OA 5CHFA 2JRHA 2MBHA 2RPQA 3NZSA 3WIMA 5LXHA 1KC7A 1EF1A 2N1WA 3ZRFA 1WE7A 3ZLZA 1FHOA 3WAPA 4ASWC 1OEYA 3ML9A 1XX0A 2Z0DB 1MK9B 5HE0A 1UELA 5DPWA 4DHZB 2LRUA 1TXDA 1E7VA 3UIOB 5L83A 4JK7A 4LDTB 2RNRB 2M4NA 2GBNA 2N7EA 4PYUA 1WG7A 2C7HA 3HM3A 5GMVA 3TW1A 2KZRA 1F9JA 1E8WA 4GPTB 2C7MB 1UPRA 2CB8A 5HE1A 3JW0X 2P0FA 2GCJA 2IO1B 4WWPA 2DLWA 3RD2A 3DOWA 2Z59B 3PV1A 2ELAA 3V5WA 2DHKA 2I1JA 4EEWA 1MIZB 3M62B 5GOWB 5DPTA 5C79A 3ZTCA 4YONA 1GC6A 4K2PA 2D9WA 3A33B 5E6OA 2NBUA 3SU8X 2EC1A 4BKGA 1C3TA 4KHAA 4GXBA 3UQAA 1M7EA 2NR2A 2ZZPB 2CY5A 4LDTD 2D3GA 3NS8A 2DZMA 2X0SA 3H7PB 2PEAA 1I35A 3KVFB 4DK5A 2CR5A 1RJ2A 5L81A 1U5EA 2A4ZA 1R4MI 2ZPYA 3W1SA 4ZRJA 3L16A 2MDXA 1D3ZA 3QQ8B 1OTRB 2BWES 3C0RB 1KOTA 3EFUA 4IWOA 3RUIB 1WFYA 4D0NB 3LJ3A 3W1YA 1V2YA 4I6NB 2VRRB 4WJNA 4JQWC 2ROZB 3CF6E 4W9GA 2K25A 3ZTDA 4JKFA 3ODWA 2KCJA 2M8SA 4J6IA 4AJYB 3TL5A 1UEFA 3T9LA 3G9WA 2DIKA 2LGDA 2G45B 2LOXA 1WGDA 2V4LA 4ICVA 4DX90 1DDMA 1MKEA 2GBMA 1Z87A 4IUMB 1P98A 3EHVA 2DKQA 3TCAA 1MAIA 2I1KA 2C9WB 2NZ8B 2NS5A 3GOEA 4FJZA 4MGYE 4ILGB 5AEKB 4MSQB 4FULA 1K5DB 2V3SA 1K8RB 4GSWA 2J0MA 4P7IA 2DYQA 5JLJB 2FAZA 3RULA 3ZNHB 2DAFA 4W9FA 2JT4B 4JKCA 2KOXA 3PZDA 2ZVOA 2UVMA 4JKGB 2L8JA 1WXAA 4B6HA 1U29A 4TQ0A 3ENBA 4WWOA 5IAAC 3PGEA 2YS5A 2Q13A 3EECA 2W2WA 2B3AA 1J0WA 2DHJA 2G4SA 5C23A 4MELA 1X86A 1Y5OA 1P0RA 5J3TA 3M1IB 2IY0B 2DKPA 2ELBA 4IM0A 1WJ4A 1RRPB 3VTVA 3UQBA 2JP2A 5D27A 2R2OA 2ZNVB 1RRBA 1WX7A 5JH5C 2CHWA 3A9JA 2YT0A 4EMOA 1MIXA 2MKRA 4OVUA 3VOQA 1WI0A 3IHPC 3KY9A 2ZVNA 1PMSA 4KHBB 5D94A 1LB1A 4HK2A 2DN6A 2D4QA 2GOWA 3VXWA 5JHBA 4PYZA 3K9OB 4JKAA 1M7RA 2K39A 5FR6A 3H7PA 3QC8B 3A4SC 5C1ZA 2DHZA 4CHMA 2ZCBA 2KXJA 2KDBA 2KWVB 2P8VA 1WJUA 3VHTC 3AULA 3RZWC 4E71A 3L08A 4W9HA 2NPTB 2LVPA 1V89A 3A9KA 3QK0A 1WZ0A 4BVUC 1J8CA 3DBRI 2ZEQA 4FBJB 1JDEA 3ZVVA 1BTKA 2D2QA 5KHQA 2M0XA 2R82A 5AZFA 2JUOA 4ILJA 2KDFB 4RM8A 1WJMA 3QIJA 4HDQA 2OTXA 2KJ6A 4L6EA 4JKDA 1DDWA 4GIVA 2BYFA 4JIOU 4F7GA 3Q3FA 2KLGA 3CSTA 2KFJA 2IFSA 2K6QA 3BJIA 1WX9A 3N32A 1N3HA 1Y19B 5LLIA 1ZSQA 5C16A 4EFOA 3VVWB 1AQCA 3D8EA 5D3YA 4H8SA 4WJQA 2LYDA 1WJ1A 1EO6A 4F7UP 1BTNA 3RT3B 3VH3B 2RQ1A 2K00A 2JY6A 2IBIB 2YVCA 2VSZA 3RZFA 2BCJA 4FADA 2VKIA 3MPXA 3NHEB 4IW0A 3L10B 2CAYA 2FCNA 1OY2A 1XKEA 2MW5A 3GYPA 4TQ1A 3H7SA 1WI1A 2K1FA 2V76A 4K7UA 2COCA 3OANA 1TBEA 2NBVB 2WX1A 4EJNA 2FCQA 1V5MA 4EZJA 4AP4C 4KIKB 5KQ4A 2DENB 3SNHA 3NSUA 4CO7A 3VDZA 3CSFA 3FP5A 1WH3A 4DBBA 4GZUA 3WAOA 2CODA 3ZRCA 2M14A 2FNJB 4B95A 3PEGA 2GJYA 2AL6A 4HATB 5E6PA 3QA8A 1GUAB 2IYDB 2KDIA 5L95C 1S3SG 1W1GA 2KQ7A 1SIFA 3A9KB 2XEWA 4JKHA 3HM6X 3D8DA 2EKEC 3ZDMC 3DVNU 2J0JA 3FSSA 2KWUB 2LZ6A 4BOSC 1WM3A 3ZNID 1FB8A 1Q1OA 4HPMB 4G3XB 3KH0A 2M1MA 2ABDA 1GG3A 1RAXA 3ZNGC 4N9F4 1MK7B 2BYEA 5CX3A 1P3RA 1XCGA 1BAKA 5HKHA 2KX0A 3DXDA 1SE9A 3LDZE 5JHHA 1UBQA 1HB8A 3PVUA 2WH5A 4IM3A 2K8CA 1NBFC 2BKRB 5HE2A 3ODOA 2DHIA 3MTNB 2HRJA 5FI0A 1VCBA 2BWFA 1Y8RC 4TYZA 4HB4B 3SYXA 3AI5A 1LM8B 1NVLA 4CHJA 4G0NB 4JKEA 2DZKA 4W9EA 3SBGA 2IY1B 3DPDA 2KMAA 4GDKB 3DVGY 4ANXA 2KKCA 4GOCA 5C6RA 4ANUA 2NBWB 1V61A 2IO0B 3AU5A 3JSVB 1UNRA 4FN2A 5JP4A 2R2QA 4JL9A 4B6WA 3KUZA 4EZKA 1WGYA 2G3QB 4KAXB 2L7RA 2OJRA 3VQIA 1KBLA 3N30A 3VIAA 2X18A 3F0WA 4WWNA 3OJ3A 5DHFB 5E6NA 4YL8A 5D2MB 1OQYA 1ZC4B 4HAWB 2NVUI 3KW5B 4W9CA 2Y5BB 4PNKA 1W1HA 4PS7A 2VRWB 1V5OA 1V80A 2LVQA 5TR5A 4Z2NA 4DHZE 2JZZA 1WGQA 2KANA 1TQZA 1WR1A 2N23A 1XD3B 4EUTA 2XK5A 2KO3A 4NY0A 2MLBA 1RLFA 4A6KA 4HCNB 1UBIA 4MSMB 4WAAA 2LBBA 3HHMA 4HAZB 3L13A 2KUPA 1CMXB 3ENEA 4KDLB 2JWZA 5DCNA 1P5TA 2OQBA 2PJHA 4ZDVA 3AJ4A 3VFKA 4NNJB 2KGXB 3KYDD 3AXCA 5D7GA 4IM2A 3A1QA 1BT0A 4RM9A 3M3JA 2FCMA 4BKSD 3X0WA 3D8FA 1NI2A 3SV1A 3ULCA 2Y8GA 1X1GA 1J0GA 3PTFC 1WY8A 2BGFA 2D10A 2COPA 3KRWA 2K8BA 5LOPB 2AEHA 4IWPA 3KZ1A 1Q0WB 2DX5A 3VTUA 5CHVC 1IRSA 2KFKB 2JRIB 1T0YA 3L17A 3TO1A 4KIKA 2FDQA 3P7ZA 2EMSA 1GNUA 1WGGA 3TJPA 1U5FA 2MA9B 3WA0A 1E8YA 1AWEA 4GGQA 2KK8A 3VAWA 1NTIA 3CMMB 3V6EB 3TVVA 1WF9A 1X1FA 2O6VB 3E66A 4KVGB 3GZNI 2CHXA 1NTVA 2KLCA 2NCNA 5IA7A 1WMHB 1V86A 4X57B 1M94A 2CKHB 3LJUX 5DH9B 2K6DB 2ROVA 2MBBB 3BY4B 1E8XA 4G50A 1DIKA 1YQBA 3OAWA 4JGHB 2OOBB 4KZ0A 1I2HA 5DIFB 2JPHA 2GMIC 3DXEA 5JHAA 3DBSA 2RLOA 1FHXA 3EPYA 2J59M 4HB0B 3PLVA 1K5GB 1YX6B 4A6FA 3H6NA 2O6VA 3TMPB 1KM7A 5LONB 2YF0A 4URKA 2LULA 2FJLA 1W1DA 3A8QA 4MK0A 3R7QA 1Q67A 4GB9A 2L0FA 3A9JB 3SDLC 1U2BA 1B55A 2RVBB 5JZEB 4TKNA 3PP2A 2MP2A 1H4RA 2LOZA 2Z0PA 2JXXA 1WE6A 1WGRA 3U8ZA 3APCA 1ZW7A 3ONSA 4GDKA 3KRXA 2D9XA 3DXCA 3OLMD 3MDBC 4WJOA 3R7RA 2D9ZA 2NMBA 4HAVB 2E2XA 4F1SA 1XT9B 3H1UA 1DDVA 3DVGX 1LFDA 5D3VA 1WX8A 2CQUA 3E9LA 3V6CB 1TGZB 4CYEA 2HTHB 1SGHA 4MGKE 1ST7A 5HE3A 1WJ6A 4HCPB 2L3ZA 3S2AA 2XBBC 2LGYA 2NPTA 2CU1A 4HVBA 1X11A 1GJZA 4OVVA 3IVFA 1YD8U 4WVFB 3E9PA 1BWNA 1E5WA 2PZ1A 4II3B 4KV2A 3OJ4B 4JLCA 3FEHA 5EDSA 3WAMA 3QBVB 2DAJA 2HD5B 4MGZE 1IP9A 4XC2A 1WMHA 2PE6B 2XK5B 1V5UA 5CLQB 1V49A 1Z2MA 4G11A 3HW2B 3BINA 3T06A 5C5BA 1P1AA 3AU4A 1PLSA 3PS6A 4BBKA 3QWZB 5J18A 2KDEB 4GMVA 2KFKA 2LUEA 4K81A 1WJNA 4XX5A 4DBGA 2IZVB 1TJ6A 4II2B 4A6FB 4EKUA 5DI9B 3HQCA 4I6PA 4AWJA 4XWXA 3PVLA 4FHKA 3TFMA 1E90A 4ILHA 3UZTA 3QHTA 4MJSA 1WXMA 4HHVA 2DZJA 4KDIC 2REXA 1YX5B 5BO4B 4MDKE 1FHWA 3SUZA 1ZM0A 3ZW3A 1H8CA 2YRYA 4FLHA 2L2IA 4GMXB 1X1MA 4Y94A 3SD5A 4HAYB 3WANA 4NAWA 1ZVRA 5DPRA 4BOZB 2G35A 1XODA 1FGZA 1OMWA 1KZGA 3ZO5B 4E74A 1WGHA 3ZKJC 3JYUA 2YS1A 2LXAA 2K8HA 4MY6A 2I5CA 1AARA 2RUKB 3KSYA 3A8PA 3T8MA 2HTHA 4F8CB 4LCDE 3ML8A 3MHSD 2MFQA 1DYNA 2CHZA 3K9PB 2UZRA 4NPNA 2QKMA 3FM8C 3ULBA 4B9KA 1IYFA 2UYZB 3DBHI 2W2XD 1FXTB 3APDA 2PPHA 1XQQA 2YLMA 4NAWB 2K2JA 4AUQC 3SO6A 3M95A 1WXVA 2WWZA 2KTRA 2IYBA 2LASA 3VTWA 2LKOA 2G4DB 2KMCA 4DDID 4A5KA 2LD9A 3PREA 2MX2A 2MRPA 2KHWB 2ZPNA 2PE9A 1OGWA 1WGUA 2O2VB 4HDOA 3R66C 4JKGA 4JK8A 2P0DA 5J3QA 2H7DA 1FGYA 4FHJA 2N9PC 3R3MA 2UWQA 1WXSA 5AZGA 4WQOB 2ZCCA 2LRWA 5C5BB 3CXBB 1G6JA 2RGNB 5DHAB 3U30A 2KX3A 2LWPA 4DX8A 4KSKC 4GDLA 1JRUA 4BBNF 4RMAA 4DXAB 2YSZA 1VD2A 3PLUA 1QZEA 3ALBA 2W2XC 3DQVA 2WYQA 3B08A 4BBNC 1P9DU 1Z5SB 4BKSA 4K17A 4C0AA 2YS3A 4EZLA 2L0TA 4W9LA 1UZXB 4KZCA 3B0AA 2R09A 3VUWA 2KTFA 2DYOA 2KD0A 2WDTB 5CLLB 3U7DA 2CRFA 2N4FA 1KZ7A 2LXCA 4IG7B 1TTNA 2KN5A 3PRZA 3IBEA 2AYOB 2DYBA 3TBLD 2KVRA 3PSCA 5LXIB 1YIWA 3V60A 2D07B 3SHQA 4MJSB 1MPHA 2AL3A 1HB6A 5CTRC 4HAUB 4K2OA 3H9DA 2ADZA 1HBKA 4JK9A 1V6EA 1YJ1A 2KQSA 4AJWA 4K7WA 3HK0A 2COFA 4E3CA 3ZNZB 3UF8A 4HB3B 2BF8B 2MCNB 4EOYA 2GBRA 3QJZA 1V81A 5D3WA 1V9JA 5CHWA 2FCSA 2LJ5A 2KTRB 2N9EB 2Z0EB 3KYCD 2DYNA 2Z0OA 3ZIMA 3QWMA 4W9JA 3TIXA 2XQNM 2Y7BA 3V62A 2HE7A 1ISNA 1QC6A 2LVOA 3ECIA 2L00B 3DDCB 3UINB 2BKFA 3FLVA 1LQBA 1X05A 3PRPB 1L7YA 2W9NA 1KJTA 2BYVE 4PQ0A 2CS4A 2KNBA 3HIZA 1WR6E 1UNPA 2C7NB 2KJRA 2C5LC 1TZ1A 2MBQA 4GDLB 1E7UA 1EGXA 3PRMB 1S1QB 1IPGA 2CY4A 2MWSB 1DBHA 2D11A 3QCAA 3APFA 4M0WB 3UIPB 4BKTA 2QKLA 2J0KA 2LI5A 3N3KB 3NOBA 2GBJA 2BPSA 1GC7A 4F7HA 1U4AA 4BFRA 4HAXB 2N7DA 2N0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL6 A;  4EEW A;  2P0H A;  4HAT B;  3IVF A;  1YD8 U;  5E6P A;  1WYW B;  2EMT A;  3D32 A;  4WVF B;  3QA8 A;  3VUY A;  1MIZ B;  1BWN A;  1E5W A;  2PZ1 A;  5D6J B;  1GUA B;  4II3 B;  4KV2 A;  3M62 B;  5GOW B;  3OJ4 B;  4WJN A;  5DPT A;  5C79 A;  4DHJ D;  2IYD B;  2KDI A;  4A3P A;  2ZJD A;  4YON A;  4JLC A;  4MM3 A;  3FEH A;  3L54 A;  3ZTC A;  5L95 C;  5EDS A;  3WAM A;  1GC6 A;  2O2V A;  1S3S G;  3QBV B;  1W1G A;  4K2P A;  2DAJ A;  2D9W A;  1EVH A;  2HD5 B;  2KQ7 A;  3A33 B;  2DX1 A;  1SIF A;  3A9K B;  2K2U A;  2XEW A;  2NBU A;  4MGZ E;  5E6O A;  3HM6 X;  3D8D A;  1IP9 A;  4XC2 A;  2EC1 A;  2EKE C;  1I7A A;  1U5G A;  3SU8 X;  3ZDM C;  4BKG A;  1C3T A;  1WMH A;  3DVN U;  2J0J A;  2PE6 B;  3FSS A;  4KHA A;  2KWU B;  2LZ6 A;  2XK5 B;  4LJP B;  1EUV B;  1V5U A;  5CLQ B;  4BOS C;  1V49 A;  1WM3 A;  1Z2M A;  4G11 A;  4GXB A;  1FB8 A;  5AZH A;  3ZNI D;  3HW2 B;  3BIN A;  3T06 A;  1Q1O A;  4CHK A;  3UQA A;  5C5B A;  5DPS A;  1P1A A;  1M7E A;  3WAN A;  4HPM B;  4G3X B;  3AU4 A;  2NR2 A;  1PLS A;  2ZZP B;  3KH0 A;  2CY5 A;  4BBK A;  3PS6 A;  3DVN V;  4LDT D;  2M38 A;  2M1M A;  3QWZ B;  2D3G A;  4LJO B;  2ABD A;  1GG3 A;  1RAX A;  2KDE B;  2M17 A;  4GMV A;  3ZNG C;  2KFK A;  4MH0 E;  4N9F 4;  1MK7 B;  2QHO A;  4NSW A;  2BYE A;  3KUC B;  1QQG A;  2LUE A;  4K81 A;  3NS8 A;  5CX3 A;  2DZM A;  1WJN A;  4TV3 A;  1P3R A;  1E8Z A;  3H7P B;  3ZDT A;  1XCG A;  4K7S A;  4XX5 A;  1BAK A;  5HKH A;  4DBG A;  2KX0 A;  2PEA A;  2GS0 A;  2IZV B;  2DA0 A;  3DXD A;  1SE9 A;  1TJ6 A;  5KQ1 A;  1I35 A;  3KVF B;  2L76 A;  4II2 B;  4DK5 A;  1LW3 A;  2CR5 A;  4WJP A;  4A6F B;  3LDZ E;  4EKU A;  1RJ2 A;  3PV1 A;  5JHH A;  5DI9 B;  3HQC A;  1UBQ A;  1HB8 A;  5L81 A;  3ZUN A;  3HIZ A;  3PVU A;  2N9X A;  2ZNV C;  2WH5 A;  4I6P A;  1U5E A;  4ZRI A;  4IM3 A;  3WYF B;  2K8C A;  1NBF C;  2BKR B;  5HE2 A;  2N1V A;  3ODO A;  2DHI A;  4AWJ A;  3MTN B;  2D9Y A;  2HRJ A;  2A4Z A;  4XWX A;  5FI0 A;  1R4M I;  3PVL A;  2ZPY A;  2I1J A;  1VCB A;  1ZGU B;  2BWF A;  2GBK A;  2RD0 A;  4FHK A;  1Y8R C;  3W1S A;  4TYZ A;  4HB4 B;  4ZRJ A;  1V5T A;  4EFO A;  3L16 A;  3SYX A;  3TFM A;  1E90 A;  3AI5 A;  2MDX A;  1LM8 B;  2Y8F A;  1NVL A;  4CHJ A;  1D3Z A;  4WSF A;  4G0N B;  4W9E A;  2DZK A;  3QQ8 B;  2LG1 A;  3UZT A;  1OTR B;  2BWE S;  2IY1 B;  3C0R B;  3DPD A;  3QHT A;  3O65 B;  4MJS A;  1KOT A;  1J0G A;  2JF5 A;  3ZVR A;  2KMA A;  3DVG Y;  3EFU A;  4GDK B;  4ASW C;  4ANX A;  4IWO A;  4TQ0 A;  4PS8 A;  3RUI B;  1WXM A;  2DFK A;  2KKC A;  4GOC A;  4HHV A;  5C6R A;  2NBW B;  1WFY A;  2DZJ A;  4ANU A;  4KDI C;  2EJ8 A;  1I42 A;  2C60 A;  2REX A;  3RCZ A;  1YX5 B;  5BO4 B;  4D0N B;  1EF5 A;  3LJ3 A;  1V61 A;  3RCP A;  1LXD A;  2IO0 B;  3W1Y A;  1V2Y A;  1H10 A;  3AU5 A;  3JSV B;  1FHW A;  4IOY X;  2VRR B;  3SUZ A;  1UNR A;  1ZM0 A;  2ROZ B;  3CF6 E;  3DBL I;  4FN2 A;  4JQW C;  4W9G A;  5JP4 A;  3ZW3 A;  1H8C A;  2R2Q A;  2K25 A;  4NQL B;  3ZTD A;  1UD7 A;  1WVH A;  4JL9 A;  1FOE A;  1DRO A;  3KUZ A;  3ODW A;  2YRY A;  3L0W B;  4FLH A;  4B6W A;  2L2I A;  4GMX B;  4EZK A;  2KCJ A;  1X1M A;  4Y94 A;  3IG3 A;  4HAY B;  3SD5 A;  1WGY A;  2G3Q B;  2M8S A;  3F5R A;  4A6H A;  4HXD A;  1ZVR A;  4J6I A;  4KAX B;  2L7R A;  2OJR A;  4NAW A;  1PFJ A;  5DPR A;  3TL5 A;  3VQI A;  4HWI B;  5KHO A;  3N30 A;  1UEF A;  2DTC A;  3VIA A;  2X18 A;  3T9L A;  3G9W A;  3F0W A;  2LGD A;  1J19 A;  2RR9 A;  2G45 B;  4WWN A;  4BOZ B;  4TUU A;  2G35 A;  1XOD A;  1FGZ A;  2LOX A;  1OMW A;  5DHF B;  3OJ3 A;  5E6N A;  1KZG A;  4YL8 A;  5LLI A;  3ZO5 B;  1C1Y B;  1WGD A;  2V4L A;  4ICV A;  5D2M B;  1OQY A;  2ASQ A;  4E74 A;  4DX9 0;  1DDM A;  1MKE A;  1ZC4 B;  1WGH A;  3W1S C;  2FID A;  3ZKJ C;  1FAO A;  4KHO A;  4HAW B;  2GBM A;  3JYU A;  1Z87 A;  2MQJ A;  4IUM B;  4NQK E;  2D9V A;  1P98 A;  2NVU I;  3EHV A;  2YS1 A;  2DKQ A;  4IFS A;  2LXA A;  3KW5 B;  2Y5B B;  4PNK A;  3TCA A;  2K8H A;  1W1H A;  4W9C A;  4PS7 A;  4MY6 A;  1MAI A;  2I1K A;  2I5C A;  1AAR A;  2C9W B;  2VRW B;  1V5O A;  5D3X A;  2RUK B;  1V80 A;  2NZ8 B;  3KSY A;  2LVQ A;  2NS5 A;  5TR5 A;  4F7Z A;  2KJH B;  4Z2N A;  3PT2 B;  3A8P A;  3T8M A;  3GOE A;  2HTH A;  3UGB B;  4F8C B;  4ZRK A;  1A5R A;  4FJZ A;  1OEY J;  4NJ7 A;  4DHZ E;  3NHE B;  4MGY E;  2JZZ A;  4NJ6 A;  3I3T B;  4LCD E;  1WGQ A;  2KAN A;  3ML8 A;  1TQZ A;  3MHS D;  2MFQ A;  4MSQ B;  5AEK B;  1DYN A;  1WR1 A;  3PPA A;  4MT7 A;  2CHZ A;  4W9I A;  3K9P B;  4FUL A;  5EFX A;  1K5D B;  2UZR A;  2V3S A;  2N23 A;  4NPN A;  2QKM A;  3FM8 C;  3ML4 A;  1XD3 B;  1K8R B;  4KSL C;  4EUT A;  1NTY A;  3ULB A;  2KO3 A;  2XK5 A;  4GSW A;  4NY0 A;  2J0M A;  4P7I A;  1UH6 A;  2DYQ A;  1MG8 A;  1RLF A;  2A5U A;  2MLB A;  4NAW B;  4ZYN A;  1IYF A;  5JLJ B;  3P6A A;  2FAZ A;  2UYZ B;  2MWN B;  3DBH I;  3RUL A;  3ZNH B;  2W2X D;  2DAF A;  4W9F A;  1FXT B;  2JT4 B;  2PPH A;  3APD A;  2KOX A;  3PZD A;  2YT1 A;  2ZVO A;  3VH4 B;  2UVM A;  1XQQ A;  5G2N A;  3A98 B;  4A6K A;  2L8J A;  1WXA A;  4B6H A;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  2LBB A;  2YLM A;  3HHM A;  4HAZ B;  2K2J A;  2HJ8 A;  1U29 A;  3SO6 A;  2KUP A;  3L13 A;  1CMX B;  2RSG A;  3ENE A;  1V5P A;  4KDL B;  3DCG A;  4WWO A;  2LGX A;  2JWZ A;  5DCN A;  5IAA C;  1P5T A;  1R4N I;  2YS5 A;  1WZ3 A;  3PGE A;  2Q13 A;  3M95 A;  1WXV A;  2OQB A;  2WWZ A;  2KTR A;  2IYB A;  2PJH A;  3EEC A;  4ZDV A;  3VTV A;  2W2W A;  2B3A A;  1J0W A;  2DHJ A;  3AJ4 A;  2JVC A;  2G4S A;  2LAS A;  3VFK A;  1ZKH A;  1V88 A;  5C23 A;  2LKO A;  4MEL A;  3PEG A;  3VTW A;  2KC1 A;  1X86 A;  1Y5O A;  1P0R A;  2G4D B;  4NNJ B;  5J3T A;  3M1I B;  2KMC A;  2KGX B;  1HE8 A;  2IY0 B;  2I5F A;  2DKP A;  2ELB A;  2DZI A;  2WX0 A;  5FI1 A;  3KUD B;  3KYD D;  3PHW B;  4A5K A;  3AXC A;  4IM0 A;  1WJ4 A;  4DDI D;  2LD9 A;  5D7G A;  3PRE A;  4G50 A;  4IM2 A;  1RRP B;  3A1Q A;  1BT0 A;  1U27 A;  3EC8 A;  2FUH B;  2L1C A;  2IO2 B;  2MBE A;  2KHW B;  2MRP A;  2MX2 A;  3M3J A;  2FCM A;  4RM9 A;  4BKS D;  2ZPN A;  3UQB A;  2JP2 A;  3D8F A;  1NI2 A;  5D27 A;  2PE9 A;  2R2O A;  2ZNV B;  3NZU A;  1RRB A;  1WX7 A;  2MSE D;  4M8M A;  2CHW A;  2FIF A;  3SV1 A;  3A9J A;  2YT0 A;  3NY5 A;  2O2V B;  3RYT A;  5JH5 C;  3ULC A;  1P3Q U;  4EMO A;  2Y8G A;  2R0D A;  1MIX A;  1WGU A;  1X1G A;  2MKR A;  3VOQ A;  1OGW A;  1WI0 A;  1WY8 A;  2AWT A;  3N7C A;  2D10 A;  2Z0Q A;  2BGF A;  3IHP C;  3KY9 A;  2COP A;  4IG7 B;  3KRW A;  1PQS A;  4FJV B;  4DHJ B;  2K8B A;  4HDO A;  3X0W A;  5LOP B;  3R66 C;  2AEH A;  2KC2 A;  4IWP A;  4DWF A;  4MEM A;  2P0D A;  3JSV A;  3KZ1 A;  1Q0W B;  5J3Q A;  2ZVN A;  2DX5 A;  3P2B A;  2H7D A;  3VTU A;  1FGY A;  5CHV C;  1IRS A;  1PMS A;  4FHJ A;  2N9P C;  4KHB B;  3R3M A;  5D94 A;  1LB1 A;  4GN1 A;  2KFK B;  2JRI B;  2UWQ A;  4HK2 A;  1WXS A;  5AZG A;  4WQO B;  1T0Y A;  3PG7 A;  2DN6 A;  2D4Q A;  2GOW A;  3VXW A;  5JHB A;  3L17 A;  3TO1 A;  5J17 A;  4KIK A;  2FDQ A;  2ZCC A;  2LRW A;  1XR0 B;  5C5B B;  4FJY A;  3P7Z A;  3CXB B;  2EMS A;  1GNU A;  4PYZ A;  1G6J A;  2MBO A;  2RSU A;  4ICU A;  4RM8 A;  3K9O B;  3M63 B;  1WGG A;  2J7Q B;  2FJ9 A;  4I6L B;  4B9K A;  3TJP A;  1M7R A;  2IO3 B;  2RGN B;  2K39 A;  1U5F A;  5DHA B;  4Z2M B;  2MA9 B;  4MDK E;  3WA0 A;  2RGF A;  3U30 A;  1E8Y A;  5FR6 A;  2KX3 A;  2LWP A;  2KWC A;  4DX8 A;  1AWE A;  3H7P A;  3QC8 B;  4KSK C;  4GDL A;  3A4S C;  4IC7 B;  4GGQ A;  4XZ4 A;  5C1Z A;  1JRU A;  4W9K A;  4BBN F;  4RMA A;  3PSE B;  4DXA B;  2DHZ A;  2KK8 A;  3V61 A;  2YSZ A;  4CHM A;  1VD2 A;  2ZCB A;  2KXJ A;  2KDB A;  3PLU A;  4IWQ A;  1QZE A;  2DYM A;  2KWV B;  1NDD A;  3A4R A;  3A1Q B;  3VAW A;  3ALB A;  2W2X C;  3DQV A;  3PVW A;  2P8V A;  5J3Y A;  2MP2 B;  2WYQ A;  1WJU A;  1P9D U;  3B08 A;  4HPL B;  2DX5 B;  1Z5S B;  4A20 A;  4K17 A;  4BKS A;  4C0A A;  1NTI A;  3VHT C;  3AUL A;  3RZW C;  2YS3 A;  4WJ7 A;  2GCL A;  4IAP A;  4E71 A;  4EZL A;  3L08 A;  1RFA A;  2H7E A;  3CMM B;  3V6E B;  3TVV A;  2L0T A;  1WIA A;  1WF9 A;  4W9L A;  4W9H A;  5KCV A;  1ACA A;  1X1F A;  2NPT B;  1UZX B;  2LVP A;  2O6V D;  2O6V B;  1V89 A;  4KZC A;  4BBN C;  3A9K A;  3QK0 A;  1WZ0 A;  1KI1 B;  4OVU A;  4KVG B;  3GZN I;  3B0A A;  4ANV A;  4AJY B;  2CHX A;  1UNQ A;  1NTV A;  2KLC A;  2NCN A;  3VUX A;  2R09 A;  4DDG D;  5IA7 A;  3VUW A;  2UZS A;  2KTF A;  4BVU C;  2DYO A;  2KD0 A;  3ODX A;  2V1Y A;  1J8C A;  1WMH B;  1V86 A;  3DBR I;  2ZEQ A;  4AOF A;  4X57 B;  2WDT B;  1M94 A;  2CKH B;  3LJU X;  4FBJ B;  1P6S A;  5CLL B;  5DH9 B;  3CIK A;  3U7D A;  2K6D B;  2CRF A;  2N4F A;  3PTF C;  1BTK A;  2D2Q A;  3ZVV A;  5KHQ A;  3X23 A;  1KZ7 A;  1NU2 A;  2ROV A;  2M0X A;  2MBB B;  1E8X A;  2JUO A;  1YQB A;  2KDF B;  1TTN A;  2KN5 A;  2LXC A;  3BY4 B;  1WJM A;  3QIJ A;  4HDQ A;  3Q3J A;  3PRZ A;  3MJW A;  3IBE A;  2OTX A;  2AYO B;  2KJ6 A;  4L6E A;  3OAW A;  2DYB A;  4JGH B;  1DDW A;  3TBL D;  4GU2 A;  4GIV A;  2KVR A;  2BYF A;  3PSC A;  4JIO U;  5LXI B;  2OOB B;  4K1R B;  1YIW A;  4KZ0 A;  3V60 A;  2D07 B;  3WAL A;  1Q5W B;  2JZ3 B;  1I2H A;  2COA A;  5DIF B;  4F7G A;  3SHQ A;  3Q3F A;  2KLG A;  3CST A;  1SHC A;  2KFJ A;  4MJS B;  1ZC3 B;  1MPH A;  2AL3 A;  1HB6 A;  2GMI C;  4HAU B;  2JPH A;  2IFS A;  5CTR C;  1L2N A;  4M8N A;  2K6Q A;  3DXE A;  3IFW B;  3BJI A;  1WX9 A;  3QAR A;  5JHA A;  1UPQ A;  3DBS A;  4HLE A;  3N32 A;  4K2O A;  1N3H A;  2RLO A;  3H9D A;  1FHX A;  1Y19 B;  2ADZ A;  2L05 A;  1HBK A;  3EPY A;  1ZSQ A;  2J59 M;  4HB0 B;  5C16 A;  3JVZ X;  1V6E A;  3PLV A;  1YJ1 A;  2KQS A;  4W9D A;  4K7W A;  1K5G B;  3B1L X;  3VVW B;  1AQC A;  4AJW A;  4ANW A;  3D8E A;  1YX6 B;  5AZF A;  5D3Y A;  3HK0 A;  1WRD B;  4A6F A;  3QAQ A;  2COF A;  4H8S A;  4MGI E;  4WJQ A;  5JHG A;  2LYD A;  2O6V A;  3H6N A;  1WJ1 A;  1WM2 A;  1EO6 A;  3PHX B;  4E3C A;  4HB2 B;  4F7U P;  4HJK A;  3ZNZ B;  3UF8 A;  1KLV A;  3TMP B;  1BTN A;  4HB3 B;  2BF8 B;  1OQN A;  2MCN B;  1KM7 A;  4EOY A;  5LON B;  2YF0 A;  3RT3 B;  4FA6 A;  2LUL A;  4URK A;  2FJL A;  1W1D A;  2GBR A;  5IJM A;  3O96 A;  3QJZ A;  5J2R A;  1V81 A;  5D3W A;  3A8Q A;  3VH3 B;  1EAZ A;  1V9J A;  5CHW A;  2FCS A;  4MK0 A;  2KTR B;  2LJ5 A;  5G55 A;  2RQ1 A;  2N9E B;  2Z0E B;  3KYC D;  2DYN A;  3R7Q A;  1Q67 A;  1XD4 A;  2K00 A;  2JY6 A;  1U5D A;  3QX1 A;  4GB9 A;  1UGM A;  2IBI B;  3GYO A;  2L0F A;  3A9J B;  4A3O A;  5CHF A;  3SDL C;  2Z0O A;  2YVC A;  2VSZ A;  2JRH A;  1U2B A;  2MBH A;  2RPQ A;  3ZIM A;  3NZS A;  3WIM A;  3QWM A;  1B55 A;  4W9J A;  3TIX A;  5LXH A;  1EF1 A;  2XQN M;  2N1W A;  3RZF A;  1WE7 A;  3ZRF A;  2BCJ A;  2RVB B;  2Y7B A;  1FHO A;  2HE7 A;  2VKI A;  3V62 A;  3WAP A;  3ZLZ A;  4FAD A;  4PS3 A;  5JZE B;  1ISN A;  1QC6 A;  3MPX A;  3PP2 A;  4TKN A;  1H4R A;  1OEY A;  2LOZ A;  2LVO A;  2MP2 A;  3ECI A;  3L10 B;  4IW0 A;  2Z0P A;  2L00 B;  3ML9 A;  3DDC B;  3UIN B;  2JXX A;  1WE6 A;  1WGR A;  3U8Z A;  1XX0 A;  3APC A;  1ZW7 A;  2CAY A;  2BKF A;  2FCN A;  2Z0D B;  4AUQ C;  1MK9 B;  5HE0 A;  1UEL A;  5DPW A;  3ONS A;  1OY2 A;  3FLV A;  1XKE A;  4GDK A;  1LQB A;  3KRX A;  1X05 A;  4I6N B;  4DHZ B;  3PRP B;  2D9X A;  2LRU A;  1TXD A;  1L7Y A;  1E7V A;  2W9N A;  1KJT A;  3UIO B;  5L83 A;  3DXC A;  2MW5 A;  2BYV E;  3OLM D;  3GYP A;  3MDB C;  4WJO A;  4TQ1 A;  4LDT B;  3R7R A;  4PQ0 A;  3H7S A;  2CS4 A;  2KNB A;  1WI1 A;  2NMB A;  2D9Z A;  2RNR B;  4HAV B;  2V76 A;  2GBN A;  2E2X A;  2K1F A;  2M4N A;  2N7E A;  1WR6 E;  1UNP A;  2C7N B;  2KJR A;  4K7U A;  4PYU A;  2COC A;  4F1S A;  1XT9 B;  3H1U A;  1DDV A;  2C5L C;  3DVG X;  3OAN A;  1LFD A;  1TBE A;  1WG7 A;  1TZ1 A;  2C7H A;  2NBV B;  2WX1 A;  2MBQ A;  5D3V A;  4EJN A;  4GDL B;  1E7U A;  3HM3 A;  5GMV A;  2FCQ A;  1V5M A;  1WX8 A;  4AP4 C;  3TW1 A;  2CQU A;  4EZJ A;  2KZR A;  1EGX A;  5KQ4 A;  3PRM B;  4KIK B;  1S1Q B;  3V6C B;  1IPG A;  2CY4 A;  1F9J A;  1E8W A;  2DEN B;  4GPT B;  1DBH A;  2MWS B;  2D11 A;  4CYE A;  1TGZ B;  3QCA A;  3SNH A;  3APF A;  2HTH B;  1SGH A;  4MGK E;  2C7M B;  3NSU A;  1ST7 A;  4M0W B;  3UIP B;  5HE3 A;  1UPR A;  5J18 A;  2CB8 A;  1WJ6 A;  4HCP B;  3VDZ A;  4CO7 A;  5HE1 A;  2L3Z A;  3FP5 A;  3CSF A;  3JW0 X;  1WH3 A;  4BKT A;  2QKL A;  2J0K A;  2P0F A;  4DBB A;  4GZU A;  3S2A A;  2LI5 A;  2XBB C;  2GCJ A;  2LGY A;  3N3K B;  3NOB A;  2GBJ A;  2IO1 B;  2COD A;  2BPS A;  2DLW A;  2CU1 A;  1GC7 A;  2NPT A;  4WWP A;  1X11 A;  3WAO A;  4F7H A;  3RD2 A;  3ZRC A;  4HVB A;  1U4A A;  3DOW A;  4BFR A;  4HAX B;  2Z59 B;  2M14 A;  2FNJ B;  2N7D A;  1GJZ A;  2N0Y A;  4OVV A;  2ELA A;  4B95 A;  3V5W A;  2DHK A;  2GJY A; 
#chains in the Genus database with same CATH topology
 2YEP B;  2P0H A;  2LMC A;  1WYW B;  2EMT A;  3D32 A;  3J9C A;  4J3O D;  3VUY A;  5D6J B;  2RDB C;  4DHJ D;  2SAK A;  4A3P A;  2ZJD A;  4MM3 A;  3L54 A;  4QJ5 B;  1VBH A;  2O2V A;  4LNF A;  4KGT A;  1N5X A;  1EVH A;  2DX1 A;  2K2U A;  1F52 A;  4CQN A;  1I7A A;  1U5G A;  2AQ1 B;  1K50 A;  4LJP B;  3AE6 B;  1EUV B;  5AZH A;  4CHK A;  1MVK A;  2BB5 A;  5DPS A;  1C4A A;  1JWA D;  1QLB B;  3P4P B;  4NJ6 A;  3DVN V;  4LJO B;  2M38 A;  2M17 A;  4MH0 E;  1SJE D;  2QHO A;  2JYT A;  2FJU B;  4NSW A;  3KUC B;  1QQG A;  4TV3 A;  1E8Z A;  3U52 E;  3ZDT A;  4K7S A;  2GS0 A;  2DA0 A;  5I4D A;  5KQ1 A;  2L76 A;  1LW3 A;  4OHJ A;  2J4X A;  3ZUN A;  2N9X A;  2ZNV C;  3GS2 A;  4ZRI A;  3WYF B;  2N1V A;  2D9Y A;  3BVZ A;  2RD0 A;  1KH0 A;  2GBK A;  1ZGU B;  1JWB D;  3W9C B;  1V5T A;  2Y8F A;  4WSF A;  2JU6 X;  3MP9 A;  2LG1 A;  1TKG A;  1B1Z A;  2JZP A;  3O65 B;  2JF5 A;  3ZVR A;  4EE2 A;  3ZJV A;  4PS8 A;  2DFK A;  1I42 A;  4JKB A;  2EJ8 A;  2C60 A;  1GB1 A;  1EF5 A;  3U7Z A;  2WHI A;  3RCP A;  1QOB A;  1LXD A;  1H10 A;  4IOY X;  4PS3 A;  2PTL A;  3DBL I;  3DWM A;  4US8 A;  4NQL B;  1UD7 A;  1WVH A;  1FOE A;  1DRO A;  3L0W B;  1V1O A;  3IG3 A;  1IGD A;  3F5R A;  4A6H A;  4HXD A;  1PFJ A;  4HWI B;  5KHO A;  1SE4 A;  2DTC A;  3SFE B;  2E3T A;  5TSS A;  1J19 A;  2RR9 A;  1FNU A;  3AE9 B;  4TUU A;  5IP4 D;  1C1Y B;  2ASQ A;  1FD6 A;  3W1S C;  2FID A;  1FAO A;  4KHO A;  2MQJ A;  4NQK E;  2D9V A;  1ZOY B;  4IFS A;  3RCZ A;  4WAF A;  4UDU C;  3FVC A;  5D3X A;  1WRI A;  4F7Z A;  2KJH B;  3PT2 B;  2DLB A;  3UGB B;  1QOA A;  2QDF A;  4ZRK A;  1A5R A;  1OEY J;  4NJ7 A;  1TS5 A;  4M0W A;  3I3T B;  3PPA A;  4MT7 A;  4M01 A;  4W9I A;  3SBT A;  2LGI A;  5EFX A;  2SEB D;  4P1C C;  3ML4 A;  4KSL C;  1NTY A;  3W2D A;  1VRA B;  1UH6 A;  1VZ8 A;  2A5U A;  5H8Y E;  1MG8 A;  4S0R A;  4LK0 M;  4HKQ A;  4ZYN A;  3P6A A;  4OSN A;  2MWN B;  1YN4 A;  3AN1 A;  2YT1 A;  1C79 A;  3VH4 B;  1HTQ A;  4XE0 A;  5G2N A;  3A98 B;  2HJ8 A;  2RSG A;  1V5P A;  3DCG A;  2LGX A;  2ZKM X;  2LHE A;  1R4N I;  1WZ3 A;  1JCK B;  1F77 A;  2JVC A;  1XLN A;  3E9O A;  1V88 A;  1TIF A;  1ZKH A;  5JVL A;  2KC1 A;  3NRZ A;  1HE8 A;  2I5F A;  3P4S B;  2DZI A;  3PHW B;  2WX0 A;  3KUD B;  5FI1 A;  1FM0 D;  4D2K A;  1U27 A;  3EC8 A;  2FUH B;  2L1C A;  2IO2 B;  2MBE A;  3NZU A;  2MSE D;  4M8M A;  3RYT A;  2FIF A;  3IAM 1;  4S17 A;  3NY5 A;  3I9V 1;  4C80 A;  1P3Q U;  2R0D A;  3JSV A;  2AWT A;  3N7C A;  2Z0Q A;  4ZOH C;  4DHJ B;  1PQS A;  4FJV B;  2KC2 A;  3Q3O C;  4DWF A;  4MEM A;  1XCQ L;  1J7C A;  3P2B A;  3TEW A;  4GN1 A;  2DWQ A;  3IT4 B;  4A8X C;  3ZJU A;  3PG7 A;  2WDQ B;  1R4M B;  3BVM A;  2BVC A;  2PW9 A;  5J17 A;  1XR0 B;  4FJY A;  1T3Q A;  2M56 B;  1I4R A;  1CK1 A;  2MBO A;  2RSU A;  4ICU A;  1VBG A;  3M63 B;  3HVZ A;  2J7Q B;  2FJ9 A;  4I6L B;  2IO3 B;  5IOI A;  4Z2M B;  1ESF A;  2RGF A;  1GGO A;  2J53 A;  2KWC A;  4ARC A;  4XZ4 A;  4IC7 B;  4W9K A;  2QC8 A;  3AE2 B;  3PSE B;  2Y3A A;  3V61 A;  2WNM A;  4IWQ A;  2DYM A;  1NDD A;  3A4R A;  3A1Q B;  1PGX A;  1FRR A;  3PVW A;  4HPL B;  5J3Y A;  2MP2 B;  4A20 A;  2DX5 B;  4WJ7 A;  2VZK D;  2GCL A;  4IAP A;  2LGS A;  1RFA A;  2H7E A;  4WQM A;  1WIA A;  5KCV A;  1ACA A;  2O6V D;  1L0Y B;  1KI1 B;  3ZJT A;  4ANV A;  1UNQ A;  3VUX A;  4DDG D;  2UZS A;  1M4V A;  3ODX A;  2V1Y A;  4DIX A;  3KLS X;  4DQO C;  4AOF A;  2RMM A;  1P6S A;  4B0M A;  4AS1 A;  3CIK A;  2NMQ A;  3NVW A;  3X23 A;  1NU2 A;  4ANW A;  3Q3J A;  3MJW A;  1N6Z A;  1EU3 A;  4L1R A;  4GU2 A;  2N9L A;  1OFF A;  2WXJ A;  4K1R B;  3WAL A;  1Q5W B;  2JZ3 B;  2KWD A;  2COA A;  1SHC A;  1ZC3 B;  1L2N A;  2PVG C;  4M8N A;  3AEC B;  3IFW B;  3QAR A;  1UPQ A;  4HLE A;  2WXR A;  2WXN A;  2L05 A;  3BWU D;  3JVZ X;  4WJP A;  4W9D A;  1JWU D;  3B1L X;  5I2S A;  3N9Y C;  1WRD B;  3QAQ A;  4MGI E;  5JHG A;  1WM2 A;  4RCO A;  3PHX B;  1KLV A;  2KAC A;  4HB2 B;  4HJK A;  1UF0 A;  1JML A;  1OQN A;  3OG5 A;  4LTU A;  4FA6 A;  5BYQ A;  5G5G A;  3Q8B A;  5IJM A;  3O96 A;  2M0A A;  5J2R A;  1YMH E;  1EAZ A;  2WXF A;  5G55 A;  4C7Y A;  1XD4 A;  3QX1 A;  1U5D A;  1UGM A;  3GYO A;  4A3O A;  5CHF A;  1MHX A;  1Q10 A;  2JRH A;  2WLB A;  2MBH A;  4LLG M;  2RPQ A;  3NZS A;  3WIM A;  5LXH A;  1KC7 A;  1EF1 A;  1N60 A;  2N1W A;  4L1B A;  1WE7 A;  3ZRF A;  3ZLZ A;  1J7B A;  1FHO A;  3WAP A;  4ASW C;  1OEY A;  3ML9 A;  1SXT A;  1XX0 A;  2Z0D B;  1MK9 B;  5HE0 A;  1UEL A;  5DPW A;  3Q8E A;  4DHZ B;  2LRU A;  1TXD A;  1E7V A;  1T0S C;  3UIO B;  5L83 A;  4BZA A;  3AE3 B;  4JK7 A;  1I4H A;  4LDT B;  3KWV A;  2EKI A;  2G1E A;  2H89 B;  2RNR B;  3U2S C;  2M4N A;  2GBN A;  2N7E A;  4PYU A;  3DWG C;  2AQ2 B;  2W82 A;  2RPV A;  1T6B X;  1WG7 A;  2C7H A;  2NBV A;  3GE3 C;  3HM3 A;  5GMV A;  3TW1 A;  2KZR A;  1F9J A;  1E8W A;  4GPT B;  2KYW A;  2V4I B;  3AH7 A;  3NVZ A;  2C7M B;  2PKO A;  2KIE A;  1UPR A;  2CB8 A;  5HE1 A;  3P1M A;  3JW0 X;  1GPX A;  4DXG A;  2P0F A;  2GCJ A;  2IO1 B;  4WWP A;  2DLW A;  2W3S A;  3RD2 A;  3DOW A;  3IT6 B;  1KFY B;  2Z59 B;  4C56 C;  2ELA A;  1OQQ A;  3V5W A;  3PV1 A;  2DHK A;  2I1J A;  4EEW A;  3P63 A;  1FXI A;  1MIZ B;  2INN E;  4AQ7 A;  3M62 B;  5GOW B;  5DPT A;  5C79 A;  1AW7 A;  3ZTC A;  4YON A;  1GC6 A;  4GLS C;  4K2P A;  2MJ3 A;  2D9W A;  3A33 B;  5E6O A;  4ZRP A;  2NBU A;  3AE1 B;  2EC1 A;  3SU8 X;  4BKG A;  1C3T A;  2Y5P A;  4KHA A;  3R2I A;  4HSI A;  4GXB A;  1L5P A;  3UQA A;  3HVD A;  1M7E A;  3ZGZ A;  2KVZ A;  1D5Z C;  2WXL A;  2NR2 A;  2ZZP B;  2CY5 A;  2IDY A;  3ETR A;  4LDT D;  2D3G A;  3OWE B;  3NS8 A;  2DZM A;  2X0S A;  1DOX A;  3H7P B;  3V05 A;  2R61 A;  2PEA A;  1I35 A;  3TSS A;  3KVF B;  4DK5 A;  2CR5 A;  1RJ2 A;  5L81 A;  1U5E A;  2PVO D;  1UNS A;  2A4Z A;  3NVV A;  1R4M I;  2ZPY A;  3W1S A;  1ENF A;  4ZRJ A;  3L16 A;  3DCX A;  2MDX A;  5EE9 A;  1XLP A;  1D3Z A;  2DBY A;  4NZL B;  3QQ8 B;  1OTR B;  2BWE S;  3C0R B;  1KOT A;  3EFU A;  4IWO A;  3RMK C;  5BYR A;  3RUI B;  1WFY A;  1JRO A;  2MJE A;  2JX5 A;  4D0N B;  3LJ3 A;  2GUM A;  2E6X A;  2FE8 A;  2WGS A;  3W1Y A;  4LNI A;  1V2Y A;  5LG4 B;  4OT1 A;  4I6N B;  2D3B A;  2VRR B;  4WJN A;  4JQW C;  2ROZ B;  3CF6 E;  4W9G A;  1E10 A;  4XYC A;  3MFG A;  2K25 A;  3ZTD A;  4JKF A;  3ODW A;  4P6V F;  2BW2 A;  3NW8 A;  2KCJ A;  2M8S A;  1VZ6 A;  4J6I A;  4QJ3 B;  4AJY B;  2V3N A;  3TL5 A;  4NJC A;  1UEF A;  1WXQ A;  3T9L A;  2OED A;  3G9W A;  2DIK A;  1JWS D;  2LGD A;  2G45 B;  2LOX A;  1SE2 A;  2J52 A;  3N1X C;  1WGD A;  2V4L A;  4ICV A;  4WH4 A;  4DX9 0;  1DDM A;  1MKE A;  3EA6 A;  5EE3 A;  2GBM A;  1FXA A;  1Z87 A;  1YJI A;  4IUM B;  4OZB A;  3DBH B;  1P98 A;  2Z13 A;  3EHV A;  2DKQ A;  3TCA A;  1MAI A;  1T0R C;  2MEK A;  5G5H A;  2I1K A;  3RNC C;  2C9W B;  2NZ8 B;  2NS5 A;  4C4V A;  3GOE A;  1SEB D;  4FJZ A;  4MGY E;  4ILG B;  5AEK B;  4MSQ B;  4DXF A;  2LUM A;  4FUL A;  1K5D B;  2J42 A;  2V3S A;  3NWF A;  1C77 A;  1K8R B;  4GSW A;  2J0M A;  4P7I A;  2DYQ A;  5JLJ B;  2FAZ A;  3RUL A;  3EFC A;  3ZNH B;  5T8I A;  2LHD A;  2DAF A;  4W9F A;  2JT4 B;  3E9S A;  4PK1 A;  4JKC A;  2KOX A;  3PZD A;  2ZVO A;  2UVM A;  4JKG B;  3BZD B;  2L8J A;  1WXA A;  4B6H A;  3RN9 C;  1U29 A;  4TQ0 A;  2WU2 B;  3ENB A;  4WWO A;  5IAA C;  3PGE A;  2YS5 A;  2VH2 A;  2Q13 A;  3EEC A;  3WCQ A;  1SF0 A;  2W2W A;  2B3A A;  1J0W A;  2DHJ A;  2G4S A;  5C23 A;  4MEL A;  1X86 A;  1Y5O A;  1P0R A;  5J3T A;  1T5X D;  3M1I B;  2IY0 B;  2DKP A;  2ELB A;  2W55 A;  3DBL B;  4IM0 A;  1WJ4 A;  4RGO S;  1RRP B;  2D3A A;  3VTV A;  3RNG C;  3UQB A;  2JP2 A;  5D27 A;  2R2O A;  2ZNV B;  1RRB A;  1WX7 A;  3ZXV A;  2CHW A;  1YOV B;  3A9J A;  5JH5 C;  2YT0 A;  3LYY A;  1PYW D;  4EMO A;  1MIX A;  2MKR A;  4OVU A;  3VOQ A;  1WI0 A;  3IHP C;  3KY9 A;  2JWU A;  3VRB B;  2ZVN A;  2K5P A;  4OZA A;  3IXS A;  1PMS A;  4KHB B;  5D94 A;  3RNE C;  1LB1 A;  4HK2 A;  2K3U A;  2DN6 A;  2D4Q A;  2GOW A;  3VXW A;  5AUI A;  5JHB A;  5JXV A;  3V3X A;  3VRA B;  3HIE A;  3FIL B;  4PYZ A;  2QIL A;  3K9O B;  4D6W A;  4JKA A;  1DYQ A;  3AED B;  1M7R A;  2K39 A;  3AEB B;  1NI3 A;  1KLG D;  1P7E A;  4IKG A;  5FR6 A;  3H7P A;  1HZ6 A;  3QC8 B;  3A4S C;  5C1Z A;  2MH7 A;  3CIR B;  2DHZ A;  2JXT A;  4CHM A;  3VR9 B;  2ZCB A;  1XCT L;  2KXJ A;  2KDB A;  2KWV B;  2D5G A;  2P8V A;  1WJU A;  1DGJ A;  2I2Y A;  3NJT A;  3AUL A;  3RZW C;  3VHT C;  2LFI A;  4E71 A;  4RH6 A;  3L08 A;  4W9H A;  3BII D;  2NPT B;  2LVP A;  2W54 A;  4HEA 1;  2JQR B;  2XNA C;  1V89 A;  4ACF A;  3A9K A;  3QK0 A;  1WZ0 A;  1EWC A;  4YTP B;  2QSD A;  4BVU C;  1J8C A;  3DBR I;  2ZEQ A;  3NZ3 A;  4RNA A;  4YSY B;  4FBJ B;  1K51 A;  3EUB 2;  1JDE A;  2KN4 A;  3ZVV A;  1BTK A;  2D2Q A;  5KHQ A;  2M0X A;  2R82 A;  3FIL A;  5AZF A;  2JUO A;  4ILJ A;  2KDF B;  4RM8 A;  2WXH A;  1WJM A;  3QIJ A;  4HDQ A;  1T77 A;  4LNK A;  5C2T B;  2OTX A;  3BK1 A;  1TS4 A;  2KJ6 A;  1PFD A;  4L6E A;  4JKD A;  4YSX B;  1DDW A;  4GIV A;  2BYF A;  4JIO U;  5HI1 A;  4C4V B;  3KQ4 A;  1HTO A;  4F7G A;  1L0V B;  2M19 A;  3Q3F A;  2KLG A;  3CST A;  2KFJ A;  2IFS A;  2K6Q A;  3BJI A;  1WX9 A;  3MC9 A;  3Q3M C;  3FC4 A;  1WYG A;  3N32 A;  4TSS A;  1N3H A;  1Y19 B;  1C9F A;  2TSS A;  1ZSQ A;  3B2G A;  3BK2 A;  5C16 A;  1L6V A;  5LLI A;  4EFO A;  3VVW B;  1AQC A;  3D8E A;  4KGS A;  4RGT A;  5D3Y A;  4H8S A;  4WJQ A;  1IGC A;  2LYD A;  1XXG A;  1WJ1 A;  3MC0 B;  1EO6 A;  1EWY C;  4F7U P;  3UI3 A;  4YWG G;  2GRI A;  1BTN A;  2WU5 B;  3AEG B;  1I4Q A;  3RT3 B;  1ZYI A;  3VH3 B;  2KIG A;  5AUK A;  2RQ1 A;  2K00 A;  2JY6 A;  4OZC A;  1I4G A;  2IBI B;  4N6E B;  3BYT B;  2YVC A;  2VSZ A;  1E0Z A;  1VDV A;  2Z14 A;  3HSA A;  2ONQ A;  3RZF A;  2BCJ A;  3IAS 1;  4FAD A;  2VKI A;  2N7J A;  3MPX A;  1JAL A;  3NHE B;  1ET6 A;  4IW0 A;  3L10 B;  2L1A A;  5H92 C;  1RWS A;  2CAY A;  2FCN A;  1OY2 A;  1XKE A;  1MJD A;  4RFB A;  4FXC A;  1ZDV A;  2MW5 A;  1AN8 A;  4N59 A;  3Q8C A;  3GYP A;  4TQ1 A;  3H7S A;  3ZQ4 A;  1FCC C;  1WI1 A;  2AQ3 B;  2K1F A;  2V76 A;  3RI7 C;  4K7U A;  2COC A;  3OAN A;  1TBE A;  2NBV B;  2WX1 A;  4EJN A;  3GB1 A;  5BMI A;  2FCQ A;  1V5M A;  4K3C A;  4AP4 C;  4EZJ A;  1I4X A;  3BVG A;  5KQ4 A;  4KIK B;  4ZYS A;  2DEN B;  2K22 A;  4MH8 A;  3SNH A;  3NSU A;  1VZ7 A;  4RF0 A;  4CO7 A;  3VDZ A;  1FMA D;  3CSF A;  3FP5 A;  1WH3 A;  4NAM A;  4DBB A;  4GZU A;  4L23 A;  4A55 A;  2ZW1 A;  5LNK 1;  3WAO A;  2COD A;  3ZRC A;  1FPY A;  1F2R C;  2M14 A;  2FNJ B;  4B95 A;  3PEG A;  2GJY A;  1E7P B;  3DBR B;  2AL6 A;  4HAT B;  3B9J A;  5E6P A;  3QA8 A;  1PGB A;  2KQ4 X;  1GUA B;  2LJI A;  2IYD B;  2KDI A;  5L95 C;  3N1Y C;  1SJH D;  1S3S G;  3AE5 B;  1W1G A;  2K8E A;  1FRD A;  2KQ7 A;  1SIF A;  3A9K B;  2XEW A;  4P1B C;  4JKH A;  3HM6 X;  3D8D A;  2EKE C;  3ZDM C;  1NEN B;  1VJK A;  2QMT A;  3DVN U;  2J0J A;  3FSS A;  2KWU B;  2L32 A;  2LZ6 A;  1N61 A;  4BOS C;  1WM3 A;  3RNB C;  3ZNI D;  1FB8 A;  1ZXH A;  1Q1O A;  1QQR A;  2WDR B;  2KMM A;  2QCZ A;  4HPM B;  4G3X B;  2Q5W D;  4C00 A;  3KH0 A;  4BAX A;  2CU3 A;  2M1M A;  3H8H A;  2ABD A;  1GG3 A;  1RAX A;  3ZNG C;  4N9F 4;  1MK7 B;  2PMV A;  4M02 A;  2BYE A;  1HXY D;  5CX3 A;  3MJ5 A;  1P3R A;  4C7Z A;  1XCG A;  1BAK A;  5HKH A;  2KX0 A;  2R2Y A;  1FCL A;  3DXD A;  4QJ4 B;  1SE9 A;  1WSP A;  3LDZ E;  3Q69 A;  5JHH A;  1UBQ A;  2MJD A;  1HB8 A;  3PVU A;  2WH5 A;  4IM3 A;  2K8C A;  1NBF C;  2BKR B;  5HE2 A;  3ODO A;  2DHI A;  3MTN B;  2HRJ A;  5FI0 A;  1VCB A;  1FNV A;  2BWF A;  4ZRQ A;  1Y8R C;  4TYZ A;  4HB4 B;  1C4P A;  3SYX A;  3AI5 A;  1LM8 B;  4OVZ A;  2IJ0 A;  1NVL A;  4CHJ A;  4G0N B;  4JKE A;  2DZK A;  4W9E A;  3SBG A;  2IY1 B;  3DPD A;  2BYT A;  1ROE A;  2KMA A;  4GDK B;  3DVG Y;  4ANX A;  1GB4 A;  2IGH A;  3NG0 A;  2KKC A;  4GOC A;  5C6R A;  4ANU A;  2NBW B;  1YN3 A;  1V61 A;  2IO0 B;  1LO5 D;  3AU5 A;  3JSV B;  4USA A;  4RGM A;  1UNR A;  4FN2 A;  5JP4 A;  2R2Q A;  2KDM A;  4JL9 A;  4B6W A;  1VLB A;  3KUZ A;  1D5X C;  4EZK A;  1WGY A;  2G3Q B;  4KAX B;  2L7R A;  2OJR A;  3VQI A;  1KBL A;  3N30 A;  3VIA A;  2X18 A;  1TY0 A;  1ET9 A;  3F0W A;  4CSQ A;  4WWN A;  5HG2 A;  3OJ3 A;  5DHF B;  5E6N A;  4YL8 A;  1XLO A;  3U12 A;  2Y5C A;  2NTS A;  5D2M B;  1GOZ A;  1OQY A;  4KGR A;  2JYE A;  1ZC4 B;  2D3C A;  2GLS A;  4HAW B;  2MHJ A;  2NVU I;  3AM9 A;  3KW5 B;  4W9C A;  2Y5B B;  4PNK A;  1W1H A;  4PS7 A;  1V80 A;  2VRW B;  1V5O A;  1KTK A;  2LVQ A;  2WDV B;  2KUQ A;  1RYJ A;  5TR5 A;  4Z2N A;  2VZK B;  5M4Y B;  1K52 A;  1ZUD 2;  2JSV X;  4DHZ E;  2JZZ A;  3N1Z C;  1LGR A;  1WGQ A;  1QOG A;  2KAN A;  1TQZ A;  1QT9 A;  1SBB B;  1WR1 A;  3PO0 A;  1SIJ A;  3L4P A;  2N23 A;  1XD3 B;  4ITK A;  1FNW A;  4EUT A;  1FFV A;  2XK5 A;  2KO3 A;  4NY0 A;  3HRD D;  2MLB A;  1IUE A;  1RLF A;  4WUR A;  3I63 C;  4A6K A;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  2LBB A;  3HHM A;  4HAZ B;  3L13 A;  1RFK A;  2KUP A;  1CMX B;  2ACZ B;  3ENE A;  4KDL B;  2JWZ A;  5DCN A;  1P5T A;  1CQV A;  4PT5 A;  2OQB A;  2PJH A;  4ZDV A;  3AJ4 A;  4R3D A;  3VFK A;  4NNJ B;  3B2F A;  2KGX B;  3KYD D;  3AXC A;  1AWD A;  5D7G A;  4IM2 A;  2XN9 C;  1BT0 A;  3A1Q A;  3AEA B;  4RM9 A;  1TYG B;  2FCM A;  3M3J A;  4BKS D;  3X0W A;  3D8F A;  1NI2 A;  3SV1 A;  5EE0 A;  3ULC A;  2Y8G A;  1X1G A;  1J0G A;  3PTF C;  1WY8 A;  2BGF A;  2X8X X;  2D10 A;  2COP A;  4YTN B;  3KRW A;  4JWU C;  1C4C A;  2K8B A;  5LOP B;  2AEH A;  4IWP A;  3KZ1 A;  4TMA B;  1HQR D;  1Q0W B;  2DX5 A;  3VTU A;  4XWT A;  5CHV C;  1IRS A;  2KFK B;  2JRI B;  1T0Y A;  1KRH A;  1L4D B;  2GI9 A;  2L52 A;  3L17 A;  3TO1 A;  4KIK A;  2FDQ A;  3P7Z A;  2EMS A;  3MC8 A;  1GNU A;  1WGG A;  3TJP A;  4KX6 B;  1U5F A;  2MA9 B;  3WA0 A;  1E8Y A;  1AWE A;  5FK9 C;  4GGQ A;  2HTM E;  1V97 A;  2KK8 A;  1TY2 A;  4US9 A;  3RFZ B;  3VAW A;  1MHH E;  5I2M A;  1NTI A;  3CMM B;  3V6E B;  5E6J A;  3TVV A;  1WF9 A;  2KR0 A;  1X1F A;  3AMZ A;  2O6V B;  3W5U B;  1QKZ A;  2BB6 A;  2Z4D A;  3E66 A;  5HFY A;  4KVG B;  3GZN I;  2CHX A;  1NTV A;  2KLC A;  2NCN A;  1YNT E;  5IA7 A;  1YQ3 B;  3TEZ A;  3Q14 C;  2DNF A;  1TKE A;  1WMH B;  1V86 A;  4X57 B;  1M94 A;  2CKH B;  3LJU X;  2HDE A;  5DH9 B;  3C8Y A;  2IGD A;  2K6D B;  1K53 A;  3DHH C;  4N58 A;  2WXM A;  2ROV A;  2MBB B;  3BY4 B;  1E8X A;  4G50 A;  1DIK A;  1YQB A;  1MI0 A;  3OAW A;  4JGH B;  2OOB B;  4KZ0 A;  2IGG A;  1TZO A;  1I2H A;  5DIF B;  3BYY B;  1OQR A;  3T3O A;  1N62 A;  3R2T A;  2JPH A;  2GMI C;  1TJE A;  4WIP A;  3DXE A;  2ZW0 A;  4ZHO A;  3P4R B;  1HZ5 A;  5JHA A;  3DBS A;  4YT0 B;  3PZ7 A;  3I57 A;  1AYF A;  2RLO A;  1FHX A;  4YTM B;  3EPY A;  2J59 M;  4HB0 B;  1VR9 A;  1V1P B;  3PLV A;  1R7S A;  1K5G B;  2YT2 A;  4RF1 A;  1YX6 B;  1TS2 A;  4A6F A;  3H6N A;  2O6V A;  1HEZ E;  3NWD A;  3TMP B;  1GAQ B;  3I5J C;  1KM7 A;  4REZ A;  5LON B;  2YF0 A;  2BS4 B;  4URK A;  2LUL A;  3MHZ A;  2FJL A;  1W1D A;  3A8Q A;  4MM3 B;  3NS1 A;  4MK0 A;  3R7Q A;  3GP7 A;  1Q67 A;  4GB9 A;  3Q8F A;  2L0F A;  3A9J B;  4YXD B;  3SDL C;  1J7A A;  1U2B A;  1B55 A;  2RVB B;  5JZE B;  4TKN A;  3PP2 A;  2MP2 A;  1H4R A;  2LOZ A;  2Z0P A;  3URY A;  4HJG E;  2JXX A;  2K9X A;  1STE A;  1WE6 A;  1TKY A;  3U8Z A;  1WGR A;  3APC A;  1ZW7 A;  4YSZ B;  2BT6 A;  3ONS A;  4GDK A;  3KRX A;  2D9X A;  4HKZ E;  1CJE A;  3DXC A;  2EEL A;  2I38 A;  3OLM D;  3MDB C;  4WJO A;  3R7R A;  1D4B A;  2ON8 A;  2D9Z A;  2NMB A;  4HAV B;  4B0E A;  2E2X A;  4F1S A;  1XT9 B;  3H1U A;  1DDV A;  2NTT A;  3DVG X;  1LFD A;  4KKI A;  3Q8A A;  5D3V A;  2N0S B;  1WX8 A;  2CQU A;  3E9L A;  2IPK D;  3V6C B;  1TGZ B;  4CYE A;  4QXA B;  2HTH B;  1C76 A;  2CJO A;  1SGH A;  1TT5 B;  4MGK E;  3U4E G;  3OHM B;  1ST7 A;  3GE8 C;  5HE3 A;  1NYR A;  1WJ6 A;  4HCP B;  3LXF A;  2L3Z A;  1PGA A;  3S2A A;  2XBB C;  3TUO A;  1E6E B;  2LGY A;  2NPT A;  2CU1 A;  4HVB A;  1X11 A;  1FO4 A;  1WWT A;  4XDD A;  1GJZ A;  4OVV A;  2QIE B;  3IVF A;  1CZP A;  1YD8 U;  4WVF B;  3E9P A;  1BWN A;  1E5W A;  2PZ1 A;  4WWM A;  4II3 B;  4KV2 A;  3OJ4 B;  4JLC A;  3FEH A;  3GZN B;  5EDS A;  5GXG B;  2V9H A;  3WAM A;  3QBV B;  2DAJ A;  5FR3 A;  2HD5 B;  3Q6B A;  1C78 A;  4MGZ E;  3W5V B;  3SEB A;  3NUH B;  1IP9 A;  4XC2 A;  1WMH A;  3LB8 C;  2PE6 B;  2XK5 B;  1V5U A;  5CLQ B;  1JW9 D;  2CJN A;  1V49 A;  3VR8 B;  1Z2M A;  4G11 A;  5D3I B;  3HW2 B;  3BIN A;  3T06 A;  5C5B A;  2HJ1 A;  1P1A A;  2X38 A;  2K49 A;  3AU4 A;  1PLS A;  3PS6 A;  4BBK A;  2WS3 B;  3QWZ B;  5J18 A;  2KDE B;  4GMV A;  2KFK A;  2BS2 B;  2LUE A;  4K81 A;  5FKA C;  1WJN A;  4XX5 A;  4DBG A;  3SFD B;  2IZV B;  1B9R A;  1EM7 A;  1TJ6 A;  4II2 B;  1D6E C;  2V3P A;  4A90 A;  4A6F B;  4EKU A;  5DI9 B;  3HQC A;  4I6P A;  4AWJ A;  3ABV B;  4XWX A;  3PVL A;  3AB5 A;  4FHK A;  4M00 A;  3TFM A;  1E90 A;  4ILH A;  3UZT A;  1ZXI A;  3QHT A;  4MJS A;  2WXI A;  1UWM A;  5IRS A;  1WXM A;  1ZPS A;  1V8C A;  4HHV A;  2DZJ A;  4KDI C;  4HRO A;  2REX A;  1YX5 B;  5BO4 B;  2H88 B;  1MI1 A;  3Q2A C;  4MDK E;  1FHW A;  3SUZ A;  1ZM0 A;  2OHF A;  3ZW3 A;  1H8C A;  3RNA C;  1ZDX A;  2YRY A;  4FLH A;  2L2I A;  4GMX B;  1X1M A;  4Y94 A;  3SD5 A;  4HAY B;  3WAN A;  4NAW A;  1ZVR A;  3CWI A;  1R4N B;  3DHG C;  5DPR A;  1BML C;  2GB1 A;  4JWS C;  4BOZ B;  1MG4 A;  2G35 A;  1XOD A;  1FGZ A;  4MAC A;  1OMW A;  1I7H A;  4OW0 A;  1KZG A;  3ZO5 B;  4E74 A;  2PLP A;  1WGH A;  3ZKJ C;  4KKJ A;  3JYU A;  3T3N A;  3RPF C;  3DHI C;  2WXK A;  4L2Y A;  2YS1 A;  2LXA A;  2K8H A;  4MY6 A;  4ZHP A;  4K3B A;  2I5C A;  1AAR A;  2RUK B;  3KSY A;  4GNK B;  3A8P A;  1F0Z A;  3T8M A;  2HTH A;  1V1P A;  4F8C B;  1YJJ A;  4LCD E;  1JWM D;  1WGK A;  3ML8 A;  3ZYY X;  3MHS D;  2MFQ A;  1DYN A;  2CHZ A;  3K9P B;  3AE4 B;  2UZR A;  5HHD G;  4NPN A;  2QKM A;  3FM8 C;  3ULB A;  4B9K A;  1IYF A;  4QAY A;  2UYZ B;  3DBH I;  2W2X D;  3P4Q B;  1UUP A;  1FXT B;  3APD A;  2PPH A;  1XQQ A;  5BMG A;  1MPE A;  1NVI D;  1XO3 A;  4P16 A;  2YLM A;  2K2J A;  4NAW B;  1ZP0 B;  3SO6 A;  4AUQ C;  1XLQ A;  1ZE3 D;  5D3D A;  3M95 A;  1WXV A;  2WWZ A;  2KTR A;  2IYB A;  2INC C;  2QEJ C;  5IKC M;  2WP9 B;  2LAS A;  2LKO A;  3VTW A;  2G4D B;  3E56 A;  2KMC A;  2Z59 A;  3AE8 B;  4DDI D;  4A5K A;  2LD9 A;  3PRE A;  2MX2 A;  2MRP A;  2KHW B;  2ZPN A;  4H2A A;  2PE9 A;  1JQ4 A;  2YEP F;  2BQQ A;  5BYS A;  1PDX A;  1OGW A;  1WGU A;  2O2V B;  1XEE A;  3B77 A;  1DOY A;  3ZXR A;  5EE1 A;  4HDO A;  3R66 C;  4JKG A;  4JK8 A;  2WXO A;  2P0D A;  5J3Q A;  2H7D A;  3A58 A;  1FGY A;  2G9H D;  4FHJ A;  2N9P C;  1D5M C;  3R3M A;  2V0G A;  4MT5 A;  2UWQ A;  1WXS A;  5AZG A;  4WQO B;  4A6Q A;  2KT7 A;  5BMH A;  3SR6 A;  2ZCC A;  2LRW A;  1F2R I;  3R8B A;  5C5B B;  3AE7 B;  5IO9 A;  3C19 A;  1KF6 B;  2IND C;  3CXB B;  4JE3 B;  3TEY A;  4KHB A;  1EU4 A;  1G6J A;  1T0Q C;  4IOI E;  1PUT A;  3NVY A;  2RGN B;  5DHA B;  3NWA A;  4A9A A;  1BXT A;  1QIL A;  3U30 A;  2KX3 A;  2LWP A;  4DX8 A;  1YN5 A;  4KSK C;  2WQY B;  4GDL A;  1JRU A;  3TEX A;  4BBN F;  1FFU A;  4RMA A;  2BTE A;  4DXA B;  2YSZ A;  4JPS A;  1VD2 A;  4Q2J A;  1QOF A;  3PLU A;  1QZE A;  3ALB A;  2W2X C;  3DQV A;  2WYQ A;  3Q3N C;  3B08 A;  4BBN C;  1P9D U;  5IN7 A;  1Z5S B;  4BKS A;  4K17 A;  4C0A A;  5MPO A;  2YS3 A;  3KWL A;  2UU7 A;  1HA5 A;  4EZL A;  4GOU A;  1BUI C;  2L0T A;  4W9L A;  1UZX B;  3PZ8 A;  4KZC A;  1FEH A;  1F1H A;  2L83 A;  3AEF B;  3B0A A;  1SE3 A;  2R09 A;  3VUW A;  2KTF A;  2DYO A;  2KD0 A;  4O1N A;  2BBC A;  3FAH A;  2WDT B;  4HRS A;  5CLL B;  1A70 A;  3U7D A;  2CRF A;  2N4F A;  1XF5 L;  2VH1 A;  3EGR A;  4IDI A;  2PIA A;  1KZ7 A;  1ACC A;  2LXC A;  4IG7 B;  1TTN A;  2KN5 A;  3PRZ A;  1N5W A;  3IBE A;  1E9M A;  1UGJ A;  2AYO B;  2LEK A;  2DYB A;  3TBL D;  2RDG A;  2KVR A;  3PSC A;  5LXI B;  1YIW A;  3V60 A;  2D07 B;  3SHQ A;  1UWX A;  2WXG A;  4MJS B;  1MPH A;  2AL3 A;  1HB6 A;  5CTR C;  4HAU B;  1SSN A;  2FUG 1;  4K2O A;  2B76 B;  3H9D A;  2ADZ A;  2KAJ A;  1HBK A;  4JK9 A;  1V6E A;  2KQS A;  1YJ1 A;  4AJW A;  4K7W A;  1L0X B;  1RM6 C;  3N20 C;  2INP E;  3HK0 A;  2RDH A;  2COF A;  1MFW A;  4HPP A;  1JRP A;  3HUI A;  4E3C A;  1QF6 A;  3ZNZ B;  3UF8 A;  4HB3 B;  2BF8 B;  2ICI A;  2MCN B;  4EOY A;  1KLU D;  1L6U A;  2GBR A;  3QJZ A;  1L4Z B;  1V81 A;  5D3W A;  2BS3 B;  1V9J A;  5CHW A;  2FCS A;  2RRF A;  2LJ5 A;  2KTR B;  2N9E B;  2Z0E B;  3KYC D;  2DYN A;  2W3R A;  2FBW B;  1FIQ A;  2Z0O A;  3ZIM A;  2AX5 A;  2WXP A;  4LNN A;  3QWM A;  4W9J A;  3TIX A;  2XQN M;  2Y7B A;  1P7F A;  3V62 A;  2HE7 A;  3FKY A;  1Y56 A;  1ISN A;  1QC6 A;  2LVO A;  3ECI A;  3O13 A;  3RNF C;  2L00 B;  3P42 A;  4ARI A;  3DDC B;  3UIN B;  1SB3 C;  2Z8L A;  2BKF A;  1DOI A;  3FLV A;  1LQB A;  1X05 A;  3PRP B;  2OJW A;  2W9N A;  1L7Y A;  1NYQ A;  1KJT A;  4XDC A;  2BYV E;  4XGA B;  1YQ4 B;  5C3J B;  4PQ0 A;  2CS4 A;  2KNB A;  3HIZ A;  1WR6 E;  1UNP A;  2C7N B;  2KJR A;  1IBX A;  2C5L C;  1N63 A;  1TZ1 A;  2MBQ A;  4GDL B;  1E7U A;  4JX1 C;  1EGX A;  3PRM B;  1S1Q B;  1IPG A;  2CY4 A;  2MWS B;  1DBH A;  2D11 A;  3QCA A;  1NEK B;  3APF A;  4M0W B;  3UIP B;  2WXQ A;  4BKT A;  1IBX B;  2QKL A;  2J0K A;  4LNO A;  1TS3 A;  2LI5 A;  3AEE B;  3N3K B;  1I4P A;  2GBJ A;  3NOB A;  2BPS A;  4XWW A;  2K0P A;  1GC7 A;  4F7H A;  1U4A A;  4RGN A;  4BFR A;  4HAX B;  2N9K A;  2N7D A;  2N0Y A;  3AV8 A;  2QJL A; 
#chains in the Genus database with same CATH homology
 2P0H A;  1WYW B;  2EMT A;  3D32 A;  3VUY A;  5D6J B;  4DHJ D;  4A3P A;  2ZJD A;  4MM3 A;  3L54 A;  1VBH A;  2O2V A;  1EVH A;  2DX1 A;  2K2U A;  1I7A A;  1U5G A;  4LJP B;  1EUV B;  5AZH A;  4CHK A;  5DPS A;  4NJ6 A;  3DVN V;  4LJO B;  2M38 A;  2M17 A;  4MH0 E;  2QHO A;  4NSW A;  3KUC B;  1QQG A;  4TV3 A;  1E8Z A;  3ZDT A;  4K7S A;  2GS0 A;  2DA0 A;  5KQ1 A;  2L76 A;  1LW3 A;  3ZUN A;  2N9X A;  2ZNV C;  4ZRI A;  3WYF B;  2N1V A;  2D9Y A;  2RD0 A;  2GBK A;  1ZGU B;  1V5T A;  2Y8F A;  4WSF A;  2LG1 A;  3O65 B;  2JF5 A;  3ZVR A;  4PS8 A;  2DFK A;  1I42 A;  4JKB A;  2EJ8 A;  2C60 A;  1EF5 A;  3RCP A;  1LXD A;  1H10 A;  4IOY X;  4PS3 A;  3DBL I;  4NQL B;  1UD7 A;  1WVH A;  1FOE A;  1DRO A;  3L0W B;  3IG3 A;  3F5R A;  4A6H A;  4HXD A;  1PFJ A;  4HWI B;  5KHO A;  2DTC A;  1J19 A;  2RR9 A;  4TUU A;  1C1Y B;  2ASQ A;  3W1S C;  2FID A;  1FAO A;  4KHO A;  2MQJ A;  4NQK E;  2D9V A;  3RCZ A;  4IFS A;  5D3X A;  4F7Z A;  2KJH B;  3PT2 B;  3UGB B;  4ZRK A;  1A5R A;  1OEY J;  4NJ7 A;  3I3T B;  3PPA A;  4MT7 A;  4W9I A;  3SBT A;  5EFX A;  3ML4 A;  4KSL C;  1NTY A;  1UH6 A;  2A5U A;  1MG8 A;  4ZYN A;  3P6A A;  2MWN B;  2YT1 A;  3VH4 B;  5G2N A;  3A98 B;  2HJ8 A;  2RSG A;  1V5P A;  3DCG A;  2LGX A;  1R4N I;  1WZ3 A;  2JVC A;  3E9O A;  1V88 A;  1ZKH A;  5JVL A;  2KC1 A;  1HE8 A;  2I5F A;  2DZI A;  3PHW B;  2WX0 A;  3KUD B;  5FI1 A;  1U27 A;  3EC8 A;  2FUH B;  2L1C A;  2IO2 B;  2MBE A;  3NZU A;  2MSE D;  4M8M A;  3RYT A;  2FIF A;  3NY5 A;  1P3Q U;  2R0D A;  3JSV A;  2AWT A;  3N7C A;  2Z0Q A;  4DHJ B;  1PQS A;  4FJV B;  2KC2 A;  4DWF A;  4MEM A;  3P2B A;  4GN1 A;  3PG7 A;  5J17 A;  1XR0 B;  4FJY A;  2MBO A;  2RSU A;  4ICU A;  1VBG A;  3M63 B;  2J7Q B;  2FJ9 A;  4I6L B;  2IO3 B;  4Z2M B;  2RGF A;  1GGO A;  2KWC A;  4XZ4 A;  4IC7 B;  4W9K A;  3PSE B;  3V61 A;  4IWQ A;  2DYM A;  1NDD A;  3A4R A;  3A1Q B;  3PVW A;  4HPL B;  5J3Y A;  2MP2 B;  4A20 A;  2DX5 B;  4WJ7 A;  2GCL A;  4IAP A;  1RFA A;  2H7E A;  1WIA A;  5KCV A;  1ACA A;  2O6V D;  1KI1 B;  4ANV A;  1UNQ A;  3VUX A;  4DDG D;  2UZS A;  3ODX A;  2V1Y A;  4AOF A;  1P6S A;  3CIK A;  3X23 A;  1NU2 A;  4ANW A;  3Q3J A;  3MJW A;  4GU2 A;  4K1R B;  3WAL A;  1Q5W B;  2JZ3 B;  2COA A;  1SHC A;  1ZC3 B;  1L2N A;  4M8N A;  3IFW B;  3QAR A;  1UPQ A;  4HLE A;  2L05 A;  3JVZ X;  4WJP A;  4W9D A;  3B1L X;  1WRD B;  3QAQ A;  4MGI E;  5JHG A;  1WM2 A;  3PHX B;  1KLV A;  4HB2 B;  4HJK A;  1OQN A;  4FA6 A;  5IJM A;  3O96 A;  5J2R A;  1EAZ A;  5G55 A;  1XD4 A;  3QX1 A;  1U5D A;  1UGM A;  3GYO A;  4A3O A;  5CHF A;  2JRH A;  2MBH A;  2RPQ A;  3NZS A;  3WIM A;  5LXH A;  1KC7 A;  1EF1 A;  2N1W A;  3ZRF A;  1WE7 A;  3ZLZ A;  1FHO A;  3WAP A;  4ASW C;  1OEY A;  3ML9 A;  1XX0 A;  2Z0D B;  1MK9 B;  5HE0 A;  1UEL A;  5DPW A;  4DHZ B;  2LRU A;  1TXD A;  1E7V A;  3UIO B;  5L83 A;  4JK7 A;  4LDT B;  2RNR B;  2M4N A;  2GBN A;  2N7E A;  4PYU A;  1WG7 A;  2C7H A;  3HM3 A;  5GMV A;  3TW1 A;  2KZR A;  1F9J A;  1E8W A;  4GPT B;  2C7M B;  1UPR A;  2CB8 A;  5HE1 A;  3JW0 X;  2P0F A;  2GCJ A;  2IO1 B;  4WWP A;  2DLW A;  3RD2 A;  3DOW A;  2Z59 B;  3PV1 A;  2ELA A;  3V5W A;  2DHK A;  2I1J A;  4EEW A;  1MIZ B;  3M62 B;  5GOW B;  5DPT A;  5C79 A;  3ZTC A;  4YON A;  1GC6 A;  4K2P A;  2D9W A;  3A33 B;  5E6O A;  2NBU A;  3SU8 X;  2EC1 A;  4BKG A;  1C3T A;  4KHA A;  4GXB A;  3UQA A;  1M7E A;  2NR2 A;  2ZZP B;  2CY5 A;  4LDT D;  2D3G A;  3NS8 A;  2DZM A;  2X0S A;  3H7P B;  2PEA A;  1I35 A;  3KVF B;  4DK5 A;  2CR5 A;  1RJ2 A;  5L81 A;  1U5E A;  2A4Z A;  1R4M I;  2ZPY A;  3W1S A;  4ZRJ A;  3L16 A;  2MDX A;  1D3Z A;  3QQ8 B;  1OTR B;  2BWE S;  3C0R B;  1KOT A;  3EFU A;  4IWO A;  3RUI B;  1WFY A;  4D0N B;  3LJ3 A;  3W1Y A;  1V2Y A;  4I6N B;  2VRR B;  4WJN A;  4JQW C;  2ROZ B;  3CF6 E;  4W9G A;  2K25 A;  3ZTD A;  4JKF A;  3ODW A;  2KCJ A;  2M8S A;  4J6I A;  4AJY B;  3TL5 A;  1UEF A;  3T9L A;  3G9W A;  2DIK A;  2LGD A;  2G45 B;  2LOX A;  1WGD A;  2V4L A;  4ICV A;  4DX9 0;  1DDM A;  1MKE A;  2GBM A;  1Z87 A;  4IUM B;  1P98 A;  3EHV A;  2DKQ A;  3TCA A;  1MAI A;  2I1K A;  2C9W B;  2NZ8 B;  2NS5 A;  3GOE A;  4FJZ A;  4MGY E;  4ILG B;  5AEK B;  4MSQ B;  4FUL A;  1K5D B;  2V3S A;  1K8R B;  4GSW A;  2J0M A;  4P7I A;  2DYQ A;  5JLJ B;  2FAZ A;  3RUL A;  3ZNH B;  2DAF A;  4W9F A;  2JT4 B;  4JKC A;  2KOX A;  3PZD A;  2ZVO A;  2UVM A;  4JKG B;  2L8J A;  1WXA A;  4B6H A;  1U29 A;  4TQ0 A;  3ENB A;  4WWO A;  5IAA C;  3PGE A;  2YS5 A;  2Q13 A;  3EEC A;  2W2W A;  2B3A A;  1J0W A;  2DHJ A;  2G4S A;  5C23 A;  4MEL A;  1X86 A;  1Y5O A;  1P0R A;  5J3T A;  3M1I B;  2IY0 B;  2DKP A;  2ELB A;  4IM0 A;  1WJ4 A;  1RRP B;  3VTV A;  3UQB A;  2JP2 A;  5D27 A;  2R2O A;  2ZNV B;  1RRB A;  1WX7 A;  5JH5 C;  2CHW A;  3A9J A;  2YT0 A;  4EMO A;  1MIX A;  2MKR A;  4OVU A;  3VOQ A;  1WI0 A;  3IHP C;  3KY9 A;  2ZVN A;  1PMS A;  4KHB B;  5D94 A;  1LB1 A;  4HK2 A;  2DN6 A;  2D4Q A;  2GOW A;  3VXW A;  5JHB A;  4PYZ A;  3K9O B;  4JKA A;  1M7R A;  2K39 A;  5FR6 A;  3H7P A;  3QC8 B;  3A4S C;  5C1Z A;  2DHZ A;  4CHM A;  2ZCB A;  2KXJ A;  2KDB A;  2KWV B;  2P8V A;  1WJU A;  3VHT C;  3AUL A;  3RZW C;  4E71 A;  3L08 A;  4W9H A;  2NPT B;  2LVP A;  1V89 A;  3A9K A;  3QK0 A;  1WZ0 A;  4BVU C;  1J8C A;  3DBR I;  2ZEQ A;  4FBJ B;  1JDE A;  3ZVV A;  1BTK A;  2D2Q A;  5KHQ A;  2M0X A;  2R82 A;  5AZF A;  2JUO A;  4ILJ A;  2KDF B;  4RM8 A;  1WJM A;  3QIJ A;  4HDQ A;  2OTX A;  2KJ6 A;  4L6E A;  4JKD A;  1DDW A;  4GIV A;  2BYF A;  4JIO U;  4F7G A;  3Q3F A;  2KLG A;  3CST A;  2KFJ A;  2IFS A;  2K6Q A;  3BJI A;  1WX9 A;  3N32 A;  1N3H A;  1Y19 B;  5LLI A;  1ZSQ A;  5C16 A;  4EFO A;  3VVW B;  1AQC A;  3D8E A;  5D3Y A;  4H8S A;  4WJQ A;  2LYD A;  1WJ1 A;  1EO6 A;  4F7U P;  1BTN A;  3RT3 B;  3VH3 B;  2RQ1 A;  2K00 A;  2JY6 A;  2IBI B;  2YVC A;  2VSZ A;  3RZF A;  2BCJ A;  4FAD A;  2VKI A;  3MPX A;  3NHE B;  4IW0 A;  3L10 B;  2CAY A;  2FCN A;  1OY2 A;  1XKE A;  2MW5 A;  3GYP A;  4TQ1 A;  3H7S A;  1WI1 A;  2K1F A;  2V76 A;  4K7U A;  2COC A;  3OAN A;  1TBE A;  2NBV B;  2WX1 A;  4EJN A;  2FCQ A;  1V5M A;  4EZJ A;  4AP4 C;  4KIK B;  5KQ4 A;  2DEN B;  3SNH A;  3NSU A;  4CO7 A;  3VDZ A;  3CSF A;  3FP5 A;  1WH3 A;  4DBB A;  4GZU A;  3WAO A;  2COD A;  3ZRC A;  2M14 A;  2FNJ B;  4B95 A;  3PEG A;  2GJY A;  2AL6 A;  4HAT B;  5E6P A;  3QA8 A;  1GUA B;  2IYD B;  2KDI A;  5L95 C;  1S3S G;  1W1G A;  2KQ7 A;  1SIF A;  3A9K B;  2XEW A;  4JKH A;  3HM6 X;  3D8D A;  2EKE C;  3ZDM C;  3DVN U;  2J0J A;  3FSS A;  2KWU B;  2LZ6 A;  4BOS C;  1WM3 A;  3ZNI D;  1FB8 A;  1Q1O A;  4HPM B;  4G3X B;  3KH0 A;  2M1M A;  2ABD A;  1GG3 A;  1RAX A;  3ZNG C;  4N9F 4;  1MK7 B;  2BYE A;  5CX3 A;  1P3R A;  1XCG A;  1BAK A;  5HKH A;  2KX0 A;  3DXD A;  1SE9 A;  3LDZ E;  5JHH A;  1UBQ A;  1HB8 A;  3PVU A;  2WH5 A;  4IM3 A;  2K8C A;  1NBF C;  2BKR B;  5HE2 A;  3ODO A;  2DHI A;  3MTN B;  2HRJ A;  5FI0 A;  1VCB A;  2BWF A;  1Y8R C;  4TYZ A;  4HB4 B;  3SYX A;  3AI5 A;  1LM8 B;  1NVL A;  4CHJ A;  4G0N B;  4JKE A;  2DZK A;  4W9E A;  3SBG A;  2IY1 B;  3DPD A;  2KMA A;  4GDK B;  3DVG Y;  4ANX A;  2KKC A;  4GOC A;  5C6R A;  4ANU A;  2NBW B;  1V61 A;  2IO0 B;  3AU5 A;  3JSV B;  1UNR A;  4FN2 A;  5JP4 A;  2R2Q A;  4JL9 A;  4B6W A;  3KUZ A;  4EZK A;  1WGY A;  2G3Q B;  4KAX B;  2L7R A;  2OJR A;  3VQI A;  1KBL A;  3N30 A;  3VIA A;  2X18 A;  3F0W A;  4WWN A;  3OJ3 A;  5DHF B;  5E6N A;  4YL8 A;  5D2M B;  1OQY A;  1ZC4 B;  4HAW B;  2NVU I;  3KW5 B;  4W9C A;  2Y5B B;  4PNK A;  1W1H A;  4PS7 A;  2VRW B;  1V5O A;  1V80 A;  2LVQ A;  5TR5 A;  4Z2N A;  4DHZ E;  2JZZ A;  1WGQ A;  2KAN A;  1TQZ A;  1WR1 A;  2N23 A;  1XD3 B;  4EUT A;  2XK5 A;  2KO3 A;  4NY0 A;  2MLB A;  1RLF A;  4A6K A;  4HCN B;  1UBI A;  4MSM B;  4WAA A;  2LBB A;  3HHM A;  4HAZ B;  3L13 A;  2KUP A;  1CMX B;  3ENE A;  4KDL B;  2JWZ A;  5DCN A;  1P5T A;  2OQB A;  2PJH A;  4ZDV A;  3AJ4 A;  3VFK A;  4NNJ B;  2KGX B;  3KYD D;  3AXC A;  5D7G A;  4IM2 A;  3A1Q A;  1BT0 A;  4RM9 A;  3M3J A;  2FCM A;  4BKS D;  3X0W A;  3D8F A;  1NI2 A;  3SV1 A;  3ULC A;  2Y8G A;  1X1G A;  1J0G A;  3PTF C;  1WY8 A;  2BGF A;  2D10 A;  2COP A;  3KRW A;  2K8B A;  5LOP B;  2AEH A;  4IWP A;  3KZ1 A;  1Q0W B;  2DX5 A;  3VTU A;  5CHV C;  1IRS A;  2KFK B;  2JRI B;  1T0Y A;  3L17 A;  3TO1 A;  4KIK A;  2FDQ A;  3P7Z A;  2EMS A;  1GNU A;  1WGG A;  3TJP A;  1U5F A;  2MA9 B;  3WA0 A;  1E8Y A;  1AWE A;  4GGQ A;  2KK8 A;  3VAW A;  1NTI A;  3CMM B;  3V6E B;  3TVV A;  1WF9 A;  1X1F A;  2O6V B;  3E66 A;  4KVG B;  3GZN I;  2CHX A;  1NTV A;  2KLC A;  2NCN A;  5IA7 A;  1WMH B;  1V86 A;  4X57 B;  1M94 A;  2CKH B;  3LJU X;  5DH9 B;  2K6D B;  2ROV A;  2MBB B;  3BY4 B;  1E8X A;  4G50 A;  1DIK A;  1YQB A;  3OAW A;  4JGH B;  2OOB B;  4KZ0 A;  1I2H A;  5DIF B;  2JPH A;  2GMI C;  3DXE A;  5JHA A;  3DBS A;  2RLO A;  1FHX A;  3EPY A;  2J59 M;  4HB0 B;  3PLV A;  1K5G B;  1YX6 B;  4A6F A;  3H6N A;  2O6V A;  3TMP B;  1KM7 A;  5LON B;  2YF0 A;  4URK A;  2LUL A;  2FJL A;  1W1D A;  3A8Q A;  4MK0 A;  3R7Q A;  1Q67 A;  4GB9 A;  2L0F A;  3A9J B;  3SDL C;  1U2B A;  1B55 A;  2RVB B;  5JZE B;  4TKN A;  3PP2 A;  2MP2 A;  1H4R A;  2LOZ A;  2Z0P A;  2JXX A;  1WE6 A;  1WGR A;  3U8Z A;  3APC A;  1ZW7 A;  3ONS A;  4GDK A;  3KRX A;  2D9X A;  3DXC A;  3OLM D;  3MDB C;  4WJO A;  3R7R A;  2D9Z A;  2NMB A;  4HAV B;  2E2X A;  4F1S A;  1XT9 B;  3H1U A;  1DDV A;  3DVG X;  1LFD A;  5D3V A;  1WX8 A;  2CQU A;  3E9L A;  3V6C B;  1TGZ B;  4CYE A;  2HTH B;  1SGH A;  4MGK E;  1ST7 A;  5HE3 A;  1WJ6 A;  4HCP B;  2L3Z A;  3S2A A;  2XBB C;  2LGY A;  2NPT A;  2CU1 A;  4HVB A;  1X11 A;  1GJZ A;  4OVV A;  3IVF A;  1YD8 U;  4WVF B;  3E9P A;  1BWN A;  1E5W A;  2PZ1 A;  4II3 B;  4KV2 A;  3OJ4 B;  4JLC A;  3FEH A;  5EDS A;  3WAM A;  3QBV B;  2DAJ A;  2HD5 B;  4MGZ E;  1IP9 A;  4XC2 A;  1WMH A;  2PE6 B;  2XK5 B;  1V5U A;  5CLQ B;  1V49 A;  1Z2M A;  4G11 A;  3HW2 B;  3BIN A;  3T06 A;  5C5B A;  1P1A A;  3AU4 A;  1PLS A;  3PS6 A;  4BBK A;  3QWZ B;  5J18 A;  2KDE B;  4GMV A;  2KFK A;  2LUE A;  4K81 A;  1WJN A;  4XX5 A;  4DBG A;  2IZV B;  1TJ6 A;  4II2 B;  4A6F B;  4EKU A;  5DI9 B;  3HQC A;  4I6P A;  4AWJ A;  4XWX A;  3PVL A;  4FHK A;  3TFM A;  1E90 A;  4ILH A;  3UZT A;  3QHT A;  4MJS A;  1WXM A;  4HHV A;  2DZJ A;  4KDI C;  2REX A;  1YX5 B;  5BO4 B;  4MDK E;  1FHW A;  3SUZ A;  1ZM0 A;  3ZW3 A;  1H8C A;  2YRY A;  4FLH A;  2L2I A;  4GMX B;  1X1M A;  4Y94 A;  3SD5 A;  4HAY B;  3WAN A;  4NAW A;  1ZVR A;  5DPR A;  4BOZ B;  2G35 A;  1XOD A;  1FGZ A;  1OMW A;  1KZG A;  3ZO5 B;  4E74 A;  1WGH A;  3ZKJ C;  3JYU A;  2YS1 A;  2LXA A;  2K8H A;  4MY6 A;  2I5C A;  1AAR A;  2RUK B;  3KSY A;  3A8P A;  3T8M A;  2HTH A;  4F8C B;  4LCD E;  3ML8 A;  3MHS D;  2MFQ A;  1DYN A;  2CHZ A;  3K9P B;  2UZR A;  4NPN A;  2QKM A;  3FM8 C;  3ULB A;  4B9K A;  1IYF A;  2UYZ B;  3DBH I;  2W2X D;  1FXT B;  3APD A;  2PPH A;  1XQQ A;  2YLM A;  4NAW B;  2K2J A;  4AUQ C;  3SO6 A;  3M95 A;  1WXV A;  2WWZ A;  2KTR A;  2IYB A;  2LAS A;  3VTW A;  2LKO A;  2G4D B;  2KMC A;  4DDI D;  4A5K A;  2LD9 A;  3PRE A;  2MX2 A;  2MRP A;  2KHW B;  2ZPN A;  2PE9 A;  1OGW A;  1WGU A;  2O2V B;  4HDO A;  3R66 C;  4JKG A;  4JK8 A;  2P0D A;  5J3Q A;  2H7D A;  1FGY A;  4FHJ A;  2N9P C;  3R3M A;  2UWQ A;  1WXS A;  5AZG A;  4WQO B;  2ZCC A;  2LRW A;  5C5B B;  3CXB B;  1G6J A;  2RGN B;  5DHA B;  3U30 A;  2KX3 A;  2LWP A;  4DX8 A;  4KSK C;  4GDL A;  1JRU A;  4BBN F;  4RMA A;  4DXA B;  2YSZ A;  1VD2 A;  3PLU A;  1QZE A;  3ALB A;  2W2X C;  3DQV A;  2WYQ A;  3B08 A;  4BBN C;  1P9D U;  1Z5S B;  4BKS A;  4K17 A;  4C0A A;  2YS3 A;  4EZL A;  2L0T A;  4W9L A;  1UZX B;  4KZC A;  3B0A A;  2R09 A;  3VUW A;  2KTF A;  2DYO A;  2KD0 A;  2WDT B;  5CLL B;  3U7D A;  2CRF A;  2N4F A;  1KZ7 A;  2LXC A;  4IG7 B;  1TTN A;  2KN5 A;  3PRZ A;  3IBE A;  2AYO B;  2DYB A;  3TBL D;  2KVR A;  3PSC A;  5LXI B;  1YIW A;  3V60 A;  2D07 B;  3SHQ A;  4MJS B;  1MPH A;  2AL3 A;  1HB6 A;  5CTR C;  4HAU B;  4K2O A;  3H9D A;  2ADZ A;  1HBK A;  4JK9 A;  1V6E A;  1YJ1 A;  2KQS A;  4AJW A;  4K7W A;  3HK0 A;  2COF A;  4E3C A;  3ZNZ B;  3UF8 A;  4HB3 B;  2BF8 B;  2MCN B;  4EOY A;  2GBR A;  3QJZ A;  1V81 A;  5D3W A;  1V9J A;  5CHW A;  2FCS A;  2LJ5 A;  2KTR B;  2N9E B;  2Z0E B;  3KYC D;  2DYN A;  2Z0O A;  3ZIM A;  3QWM A;  4W9J A;  3TIX A;  2XQN M;  2Y7B A;  3V62 A;  2HE7 A;  1ISN A;  1QC6 A;  2LVO A;  3ECI A;  2L00 B;  3DDC B;  3UIN B;  2BKF A;  3FLV A;  1LQB A;  1X05 A;  3PRP B;  1L7Y A;  2W9N A;  1KJT A;  2BYV E;  4PQ0 A;  2CS4 A;  2KNB A;  3HIZ A;  1WR6 E;  1UNP A;  2C7N B;  2KJR A;  2C5L C;  1TZ1 A;  2MBQ A;  4GDL B;  1E7U A;  1EGX A;  3PRM B;  1S1Q B;  1IPG A;  2CY4 A;  2MWS B;  1DBH A;  2D11 A;  3QCA A;  3APF A;  4M0W B;  3UIP B;  4BKT A;  2QKL A;  2J0K A;  2LI5 A;  3N3K B;  3NOB A;  2GBJ A;  2BPS A;  1GC7 A;  4F7H A;  1U4A A;  4BFR A;  4HAX B;  2N7D A;  2N0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...