2YVCA

Crystal structure of the radixin ferm domain complexed with the nep cytoplasmic tail
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
295
structure length
295
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for type II membrane protein binding by ERM proteins revealed by the radixin-neutral endopeptidase 24.11 (NEP) complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 85
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2yvcA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2yvcA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2yvcA01
1ZM0A 2CHZA 3CXBB 3AU5A 2KKCA 4K1RB 5C5BA 3ULCA 4IWQA 4YONA 2JZZA 5BO4B 2MP2A 5DPWA 2D10A 4EEWA 2VSZA 2C7HA 4G50A 1WXAA 1KI1B 3CSTA 5J17A 1ZW7A 5L83A 4ICUA 1C3TA 3A4RA 1WRDB 2LZ6A 2REXA 4GXBA 1WXSA 3RD2A 4TV3A 2ELAA 4Y94A 2KLCA 4FHKA 1MK7B 2DX5B 5HE2A 2IO1B 1OMWA 4KVGB 2BGFA 2DYNA 1TZ1A 2HD5B 4GMXB 4WJ7A 1WX8A 2KXJA 3S2AA 3PVLA 2RR9A 2Q13A 4E74A 3KRXA 2IBIB 2XEWA 1OEYA 1WF9A 4KIKB 1C1YB 3NOBA 1DDWA 1PLSA 3PP2A 2CRFA 2LYDA 3U7DA 3QX1A 2C5LC 2CKHB 2D9ZA 5E6NA 4B9KA 3VUYA 1MIXA 2KC1A 4WJPA 3ZVRA 1X11A 2GBMA 3FM8C 1M7EA 1P5TA 3L13A 2BYVE 2RSGA 2WYQA 3V60A 5FI1A 1N3HA 3SDLC 2MBQA 3KY9A 2LJ5A 4MY6A 4LJPB 3TL5A 1RAXA 1MG8A 3VTVA 3ML9A 3Q3JA 1I35A 4HPLB 4IM2A 2P0FA 5KCVA 2AWTA 2J7QB 2LUEA 5CLLB 3SUZA 2CU1A 2P0DA 5KHOA 2JUOA 2GBJA 2RD0A 3V5WA 5IA7A 1BWNA 1ZC4B 2DYOA 5AZGA 4B6WA 2KK8A 3N3KB 4IWPA 3DOWA 2CB8A 2MBEA 3O96A 1J0WA 3GYPA 3ZNZB 3VFKA 3BJIA 1KM7A 5DPRA 3WAOA 2G45B 4H8SA 2Z0DB 5E6OA 3BY4B 2MQJA 3PEGA 3K9PB 5DCNA 2COPA 4HXDA 2RUKB 1V81A 4MGZE 3NZUA 2LD9A 1NTIA 4N9F4 2K6DB 1XT9B 2L1CA 1GNUA 1W1GA 4WWNA 4LCDE 2MX2A 3DBSA 2UVMA 2DN6A 3VH4B 2AYOB 2KVRA 3MTNB 1WGRA 4E71A 2CY5A 4F1SA 1WZ0A 5J2RA 3KUZA 4EUTA 3UGBB 3NZSA 2D07B 3VH3B 2DX1A 2BWFA 3L16A 3M3JA 2IYBA 4NNJB 2AL3A 3B0AA 1U4AA 4K7WA 2KCJA 1P9DU 3HQCA 2YSZA 1OEYJ 3ALBA 4TKNA 1UD7A 3QK0A 2YT1A 3L17A 4I6PA 2ZVNA 1OTRB 2CY4A 3PTFC 3L0WB 3ML4A 2R2QA 4CO7A 3PZDA 1WG7A 2DKPA 5GOWB 4DHJB 3DVGX 5FI0A 4CHKA 2DX5A 2BWES 4KHOA 2KWUB 4RM9A 1NVLA 2MRPA 2LRWA 2N1VA 1LQBA 2AL6A 2KOXA 3M95A 5JHGA 1KOTA 2LOZA 2NCNA 2PE6B 4FN2A 1I42A 1UBIA 1U5EA 2HTHB 1WGHA 2N4FA 1WGQA 3SYXA 2ELBA 4KIKA 4KAXB 3HIZA 2M8SA 3O65B 2LULA 4BKSD 3FP5A 4ZRIA 1NTYA 1OY2A 2O2VB 5C23A 2HRJA 3H9DA 3PREA 4HDOA 5C6RA 3AI5A 3A1QB 4KSLC 1MPHA 5LONB 1WGGA 2DHKA 1BTKA 4HK2A 1NDDA 1XR0B 3KVFB 2L0FA 4HAVB 2JZ3B 4FJZA 2KNBA 5G55A 1P98A 2JPHA 2H7DA 2K00A 2KQSA 4NQLB 5LLIA 2G3QB 4K17A 4M0WB 4ANUA 3B08A 1WVHA 2N7EA 2KJ6A 2PJHA 4JIOU 2N0YA 2OQBA 3PT2B 2WDTB 2BCJA 1HB6A 3ENEA 2IZVB 2LASA 4HWIB 4ICVA 2C60A 2LKOA 4D0NB 4GB9A 2C7MB 5LXHA 2LXAA 3D8DA 3VIAA 1XCGA 2KWCA 4PYZA 5JHAA 2PZ1A 3CMMB 4FBJB 4MK0A 1D3ZA 5KQ4A 3ZKJC 4W9GA 1TGZB 2CR5A 3RULA 3JW0X 2KMAA 2NR2A 3PRPB 2G35A 1WR6E 2YS5A 4BVUC 2D9YA 1Y5OA 3CSFA 4HAUB 1X05A 1WE6A 2D9VA 1FXTB 2M17A 5L81A 2D9XA 3W1SA 1EUVB 4YL8A 4WWOA 2K8CA 1V89A 4EZLA 2WWZA 3RUIB 2N7DA 1WI1A 4J6IA 3JSVB 4TYZA 2Z0PA 1U2BA 2MLBA 3P2BA 2DZJA 5EFXA 2KQ7A 4G0NB 3IBEA 2K6QA 1P3QU 1W1HA 4DHZB 2KTRB 1U5DA 4XWXA 1TTNA 3F0WA 4NJ7A 1AARA 1Q1OA 3ZRCA 2MW5A 2LGYA 4EKUA 2MSED 4HVBA 3KZ1A 4HCPB 3APFA 3TFMA 4KV2A 3MJWA 4GU2A 2O6VD 4II2B 2L00B 3EC8A 4IW0A 2ROVA 3DXEA 1U27A 2DKQA 4NQKE 1LW3A 3UIPB 1SGHA 2Y8FA 4EOYA 4F7HA 2FJLA 2ZZPB 5DPTA 2HTHA 2KWVB 3PVWA 2V3SA 4II3B 4GPTB 2Z59B 3WAMA 4MSMB 2QKLA 4W9CA 2KGXB 3WA0A 1X86A 2DFKA 2KFKB 2O2VA 2CAYA 3RCPA 3RCZA 2KZRA 1KZ7A 2W2WA 3VOQA 5EDSA 3OAWA 3APDA 1RLFA 4HAWB 2LRUA 3A1QA 1UNPA 4HB4B 4W9IA 3ZNHB 5JP4A 4HB2B 1LFDA 5JZEB 2H7EA 3X23A 4FADA 2EJ8A 4KZ0A 3ECIA 1Q0WB 1E5WA 3NSUA 2NBUA 2LGXA 3PG7A 2M14A 3GZNI 2L05A 2VRRB 2JRIB 4BBKA 2MWSB 2D11A 5J3QA 2NPTB 4A5KA 4OVVA 2GMIC 4HATB 3P7ZA 4KHAA 2GCJA 2I5FA 1EF5A 3A8QA 1GG3A 4A6KA 2Z0QA 2LVOA 2P8VA 2JWZA 4FHJA 2Y8GA 5AZHA 2GJYA 5JLJB 3QCAA 2IYDB 3HHMA 2GOWA 1WJNA 2DTCA 5D6JB 3W1SC 1XD3B 3AULA 4BFRA 2N9EB 5HE1A 3F5RA 3DVNU 1WJ6A 5E6PA 4BOZB 1XD4A 1E8ZA 4PS8A 3H1UA 2W2XC 1NTVA 4G3XB 1S1QB 5D3WA 4ASWC 1MAIA 2L76A 2I5CA 2DYMA 2MDXA 4OVUA 5HKHA 4M8MA 1QQGA 2HE7A 2R09A 1UH6A 3N30A 1PMSA 2KD0A 3ODXA 1J19A 2M38A 1UNRA 3N32A 4HAYB 1Z5SB 2RVBB 2ZCBA 1UBQA 2GBKA 1UELA 3JSVA 3ZDMC 1R4MI 2BKRB 1P6SA 3A9JB 4JL9A 3KUDB 3HW2B 1YJ1A 2RLOA 3WIMA 4GSWA 4HAXB 3T06A 4FJVB 2KTRA 2KANA 4AUQC 3DBHI 4EZJA 1IYFA 1FHXA 2UYZB 3DCGA 1E8XA 1DDVA 5DHAB 3OJ3A 1L2NA 2ABDA 2KJRA 3VDZA 3U8ZA 3VVWB 1WH3A 1U5FA 1KZGA 1K5DB 3WYFB 1OGWA 3R66C 4NJ6A 3FSSA 3QBVB 4F7GA 3TVVA 2OJRA 2R0DA 4K7UA 2WX0A 3V61A 1YIWA 1JRUA 4URKA 5KQ1A 3A4SC 5JHHA 2KDBA 2DENB 5FR6A 2K25A 1QZEA 2DZIA 1Z87A 2COAA 3TBLD 4IM0A 1WJ4A 3ZTCA 1X1GA 4HJKA 1ZC3B 1V9JA 2RPQA 4PS7A 2QHOA 2G4SA 1WE7A 1WIAA 2KFKA 4Z2MB 1V5MA 4PNKA 3T8MA 3KW5B 4NPNA 2FCNA 4IAPA 1YX5B 5AZFA 4FA6A 1WJ1A 1RRBA 3TJPA 2YVCA 1OQNA 3V6EB 2FUHB 2J0JA 4M8NA 1Z2MA 3MHSD 1X1FA 3VTWA 2DHJA 4C0AA 3QA8A 1EGXA 4LDTB 2PEAA 3IHPC 2J0MA 3AXCA 3D32A 3JYUA 4ANWA 1V86A 2LVPA 1S3SG 4HHVA 1UPRA 4ZRJA 3P6AA 2NPTA 4ZYNA 2Z0OA 2COFA 3ZVVA 1NU2A 5AEKB 4HAZB 1RFAA 3VUWA 3ODOA 5DHFB 4MELA 4MEMA 4IFSA 2MWNB 4PS3A 4TQ1A 2BKFA 3H6NA 5CX3A 2LI5A 4A3PA 1VCBA 1PFJA 5J3YA 3CF6E 2KUPA 1DROA 4MH0E 4EZKA 1ACAA 4WSFA 1IRSA 3ML8A 2GS0A 3WANA 2YS3A 3SHQA 5GMVA 4TUUA 3PPAA 2A4ZA 2M0XA 4KSKC 2DAJA 1T0YA 2KN5A 2ZNVB 2YS1A 2N9PC 2KJHB 2UWQA 4W9DA 5HE3A 1KLVA 1AQCA 4JQWC 1WFYA 1WX9A 4GDLB 1WI0A 2FJ9A 1WM2A 3ULBA 2CHXA 3A9JA 3MDBC 3TIXA 4KHBB 5L95C 1U5GA 4G11A 4K81A 4K7SA 4BBNF 2IO2B 3VQIA 4A20A 1YQBA 3H7PB 4LJOB 4GGQA 4NAWB 1H4RA 1LB1A 2Y7BA 3EECA 2RNRB 1HE8A 2FNJB 2KO3A 1TJ6A 5JH5C 1EO6A 4WQOB 1WYWB 2XK5B 1XQQA 3R7RA 3EPYA 4AOFA 3NY5A 3LJUX 4GDKB 3TW1A 2FCMA 2LXCA 2NZ8B 3N7CA 3OLMD 2DLWA 4K2PA 4IG7B 4BKTA 1WGUA 4IWOA 2VRWB 1UGMA 3U30A 4AWJA 1A5RA 1BT0A 1GC6A 2G4DB 2JP2A 4PYUA 4IOYX 5LXIB 4DHJD 2R2OA 3A98B 3VAWA 1WM3A 1H10A 1HBKA 3V62A 2NBVB 2J0KA 4DX90 3SU8X 1TXDA 3KSYA 3QJZA 2Z0EB 1SHCA 1FGZA 5G2NA 1WXVA 4IC7B 4ZRKA 2QKMA 2JRHA 2KX0A 2DHZA 1WR1A 2YT0A 4W9KA 2O6VA 2ADZA 2I1KA 2OTXA 4F7UP 1MIZB 2KHWB 2BF8B 2LGDA 5KHQA 4W9LA 2EKEC 2Y5BB 4CHMA 3PS6A 3ONSA 2NS5A 3ZLZA 4NSWA 1EF1A 4TQ0A 2MBBB 2LVQA 2HJ8A 3ZRFA 3CIKA 1X1MA 3I3TB 2ASQA 4DHZE 3ZTDA 3DVNV 4FJYA 3PSEB 4AJWA 3L08A 3LJ3A 2M1MA 4WJNA 3DQVA 3M1IB 2YF0A 4HB0B 1ZGUB 2P0HA 3DBRI 2V76A 3DVGY 5JHBA 3PLUA 4DDGD 2ZPYA 1DDMA 1V5OA 1FHOA 2LG1A 1FAOA 3D8EA 4DDID 3G9WA 4HLEA 3HK0A 2NBWB 2K2UA 2FIFA 4MGIE 1FGYA 1BAKA 2LBBA 2BPSA 3EFUA 4MDKE 5HE0A 1NI2A 1VD2A 3FEHA 2KTFA 4F8CB 2L7RA 1LXDA 3DBLI 1WMHA 3QIJA 3GOEA 2EMTA 3D8FA 1U29A 3SNHA 4GDLA 3KYDD 2N23A 3PGEA 4DK5A 2FDQA 1GUAB 4FULA 1DBHA 3PVUA 3RZWC 1UNQA 1I2HA 3KH0A 4BKGA 2V4LA 1G6JA 4W9JA 4HCNB 2DZMA 2EMSA 3H7PA 1V49A 1DYNA 2RGFA 4NAWA 1M7RA 2MCNB 4ANVA 3KUCB 3SV1A 3C0RB 2CS4A 2K39A 5IJMA 3UZTA 4CHJA 2K8HA 1P1AA 3AU4A 3IG3A 4WWPA 1J8CA 4WVFB 1WJMA 1IP9A 1R4NI 1V61A 2CODA 3HM6X 5CHFA 4XX5A 1LM8B 2RGNB 3PSCA 1E8WA 2ZEQA 1V5TA 1V80A 4XZ4A 1K8RB 2NMBA 1H8CA 2XK5A 3GYOA 2KC2A 2E2XA 4EFOA 3K9OB 5C16A 1Q67A 2L3ZA 2YRYA 4MGKE 3R3MA 3QAQA 4W9EA 4BBNC 2CQUA 2GBRA 3NHEB 4GDKA 1NBFC 4DBBA 1GJZA 4DXAB 5D3VA 2BYFA 2IO0B 1Y19B 2N9XA 1ISNA 1UPQA 4A6FB 2W9NA 3PLVA 2V1YA 4A3OA 3KYCD 3BINA 3DXCA 5DI9B 3RZFA 4HPMB 3RYTA 3HM3A 1FHWA 2JVCA 2KDIA 4F7ZA 4I6LB 2I1JA 3QQ8B 3DDCB 2KMCA 3QHTA 1UEFA 2MA9B 1XX0A 5LOPB 2MFQA 3ZNID 1WGDA 4HDQA 1WXMA 2JT4B 2KX3A 1WY8A 2WX1A 3UQBA 1AWEA 2MBOA 3IFWB 3PV1A 3EHVA 5CLQB 1FOEA 4RM8A 5D27A 1E7VA 3L54A 4B95A 1V2YA 4MSQB 3VTUA 2C9WB 1YD8U 2MKRA 4MT7A 2AEHA 5D2MB 4MJSB 5D3XA 2CHWA 4ZDVA 3UINB 2J59M 1OQYA 2PPHA 2KLGA 4GZUA 1WX7A 3TMPB 4ANXA 2YLMA 2EC1A 3DXDA 1F9JA 1SE9A 1MK9B 4XC2A 3VUXA 4EJNA 3OANA 1M94A 1SIFA 4FLHA 3SD5A 3LDZE 3H7SA 5DPSA 2ZNVC 4W9FA 2XQNM 2DZKA 1YX6B 5C1ZA 2VKIA 4DWFA 3ODWA 2C7NB 2N1WA 3QWMA 1TQZA 3A9KB 1GC7A 1ST7A 3VHTC 1FB8A 3B1LX 2O6VB 2IY1B 1P0RA 3WAPA 1V6EA 1UZXB 2NVUI 4L6EA 3PRZA 3QWZB 4Z2NA 2WH5A 1WJUA 3IVFA 2DYQA 2K2JA 5C5BB 1Q5WB 1W1DA 2RSUA 1V88A 1ZSQA 4DBGA 5D3YA 2D2QA 1ZVRA 4HB3B 2MP2B 3Q3FA 3VXWA 3UQAA 2UZRA 3MPXA 4BKSA 4MM3A 4P7IA 1KJTA 2DYBA 4A6HA 2LWPA 4BOSC 1BTNA 1EAZA 4GOCA 3AJ4A 1WGYA 3TCAA 4KDIC 2FIDA 1P3RA 2IO3B 3V6CB 1E8YA 3APCA 5J18A 2ZVOA 4X57B 4DX8A 5D7GA 2RQ1A 2IFSA 2GCLA 3UIOB 2M4NA 1MKEA 1K5GB 1I7AA 5CHWA 1WMHB 4GIVA 3PHXB 2MBHA 4IM3A 2FCQA 2IY0B 2ZCCA 5TR5A 2K8BA 2DHIA 1WZ3A 2LOXA 1IPGA 3T9LA 4MGYE 2JF5A 3TO1A 2COCA 4A6FA 5IAAC 2ROZB 3PRMB 1E7UA 3JVZX 1RRPB 3QC8B 2PE9A 2KDEB 2KFJA 3ZIMA 3PHWB 5CHVC 2BYEA 2L0TA 1CMXB 4GMVA 5D94A 2L2IA 4JLCA 2K1FA 4JGHB 4W9HA 1V5PA 1V5UA 2XBBC 3M62B 2FAZA 2W2XD 3A8PA 1PQSA 3OJ4B 1B55A 4AJYB 3M63B 1L7YA 5DIFB 5C79A 3ZNGC 3R7QA 1QC6A 2A5UA 4I6NB 3ZO5B 4MJSA 3X0WA 4EMOA 2FCSA 5J3TA 3WALA 1XODA 2DA0A 4K2OA 3ZW3A 2JXXA 2ZJDA 4AP4C 1HB8A 3NS8A 2KDFB 2OOBB 1ZKHA 2DAFA 3FLVA 3A33B 4WJOA 4WJQA 1XKEA 1TBEA 4B6HA 2D4QA 3QARA 4CYEA 4LDTD 3DPDA 3ZUNA 3ZDTA 1Y8RC 4WAAA 1EVHA 1J0GA 2UZSA 4E3CA 2JY6A 2ZPNA 4KZCA 3L10B 4RMAA 3RT3B 2D9WA 4IUMB 2D3GA 5DH9B 4NY0A 5CTRC 4KDLB 3A9KA 1RJ2A 2X18A 4PQ0A 1E90A 3W1YA 3KRWA 3SO6A 2GBNA 2L8JA 2B3AA 3UF8A 4GN1A
chains in the Genus database with same CATH superfamily
2GB1A 1SEBD 1ZM0A 2CHZA 3CXBB 3J9CA 4MT5A 3AU5A 3Q8CA 2KKCA 1ET6A 4K1RB 5C5BA 3ULCA 3RFZB 1EU3A 2HDEA 4IWQA 4PT5A 4YONA 2D3BA 2Y5PA 1NEKB 3AV8A 1WSPA 2JZZA 5BO4B 1YQ3B 2MP2A 5DPWA 3P4PB 3RI7C 2D10A 1HXYD 1QF6A 2AQ1B 2IGGA 1JWSD 4EEWA 2VSZA 2NTSA 2V9HA 1VLBA 1F77A 2C7HA 4G50A 1WXAA 1KI1B 3CSTA 2MEKA 5J17A 1ZW7A 5L83A 4ICUA 1C3TA 3A4RA 1WRDB 3E66A 2LZ6A 2REXA 4GXBA 1WXSA 3RD2A 2ACZB 4TV3A 2ELAA 4Y94A 2KLCA 4FHKA 1MK7B 2DX5B 5HE2A 2IO1B 1OMWA 3AE5B 4A9AA 4KVGB 4ACFA 2BGFA 1ZP0B 2JYEA 2DYNA 1TZ1A 2HD5B 1DOYA 4GMXB 4WJ7A 1UNSA 1WX8A 2KXJA 3S2AA 3NUHB 2W3SA 3PVLA 1PGBA 2RR9A 2XN9C 2LGSA 4B0EA 2Q13A 4E74A 3KRXA 2IBIB 2XEWA 1OEYA 1WF9A 4KIKB 1C1YB 3NOBA 1DDWA 2QC8A 1PLSA 3PP2A 2CRFA 2WXLA 4P1CC 4WWMA 1DIKA 2LYDA 3U7DA 3QX1A 2WXHA 2C5LC 2CKHB 2JX5A 1KC7A 2D9ZA 4YSYB 5E6NA 4B9KA 4USAA 1E10A 1PFDA 2KT7A 3VUYA 1MIXA 2KC1A 4WJPA 3ZVRA 1OQRA 3NVZA 2Y5CA 1X11A 2GBMA 2WGSA 3FM8C 1M7EA 1P5TA 3L13A 2BYVE 2RSGA 2WYQA 1RYJA 3V60A 5FI1A 1N3HA 3SDLC 2MBQA 3BK1A 2WDQB 4DXGA 4L1BA 1XXGA 3KY9A 3AEBB 1F2RC 2LJ5A 4MY6A 4LJPB 3TL5A 1TKYA 1RAXA 1MG8A 3VTVA 3ML9A 3Q3JA 4OW0A 1I35A 4HPLB 2JYTA 4IM2A 2P0FA 4JKGB 1KLUD 5KCVA 2AWTA 2J7QB 2LUEA 1V8CA 5CLLB 3SUZA 2CU1A 2P0DA 5KHOA 2JUOA 2GBJA 1FFVA 2RD0A 3V5WA 2I38A 5IA7A 1BWNA 1ZC4B 2DYOA 5AZGA 3SBTA 2KK8A 4B6WA 3N3KB 4IWPA 3DOWA 2CB8A 2MBEA 3O96A 1J0WA 3GYPA 1TKEA 3ZNZB 2I2YA 3VFKA 3BJIA 1KM7A 5DPRA 3WAOA 2G45B 4H8SA 4JPSA 2Z0DB 4WH4A 5E6OA 3BY4B 2MQJA 3PEGA 4QAYA 3K9PB 5DCNA 2COPA 4HXDA 3MC0B 4H2AA 2RUKB 3NVWA 1V81A 2HTME 4KGSA 4MGZE 3NZUA 2WXKA 2LD9A 1NTIA 4N9F4 2K6DB 1XT9B 2L1CA 1QOFA 1GNUA 1LO5D 4ZYSA 4GLSC 3U7ZA 1W1GA 4WWNA 2WDVB 5LNK1 4AQ7A 1I4HA 1MVKA 4LCDE 2MX2A 1YMHE 2UVMA 3E9LA 3DBSA 2PKOA 4P6VF 3TEXA 2DN6A 3VH4B 2AYOB 1ZDVA 1MHHE 2KVRA 3I9V1 3MTNB 1WGRA 2BB5A 3CWIA 1SF0A 4E71A 1QOGA 2ZW0A 4YSZB 5MPOA 2CY5A 3KWLA 4F1SA 1HZ6A 1ZE3D 1WZ0A 5J2RA 3KUZA 1D5XC 4EUTA 3UGBB 4OZBA 3AEGB 3NZSA 1FNVA 2D07B 3VH3B 2DX1A 2W54A 2BWFA 3L16A 2Z59A 3M3JA 4MACA 3SEBA 2IYBA 4NNJB 1XEEA 2AL3A 1FCLA 3B0AA 2BT6A 1U4AA 4K7WA 2KCJA 1P9DU 3HQCA 2KACA 1C4CA 2PVOD 2YSZA 1OEYJ 3ALBA 4TKNA 2V0GA 3NG0A 5C2TB 2AQ2B 4US8A 1UD7A 3SR6A 3QK0A 2YT1A 3L17A 4I6PA 2ZVNA 1OTRB 3RNGC 2CY4A 5E6JA 4HJGE 5BMHA 3PTFC 3L0WB 4D2KA 3ML4A 2R2QA 4CO7A 1IBXB 3PZDA 3E9PA 1WG7A 2DKPA 5GOWB 2LHEA 4DHJB 3DVGX 5FI0A 4CHKA 2DX5A 2BWES 4KHOA 2KWUB 4RM9A 2PW9A 2W82A 1NVLA 2MRPA 4A90A 2LRWA 2N1VA 1LQBA 3IAM1 2AL6A 2KOXA 3M95A 5JHGA 1KOTA 2LOZA 2NCNA 2PE6B 4FN2A 3Q14C 5FR3A 3E9OA 1I42A 1UBIA 3N1YC 1U5EA 1XF5L 2HTHB 4LTUA 1WGHA 4RGTA 3MFGA 2N4FA 1WGQA 3SYXA 2ELBA 2JWUA 2PTLA 4KIKA 1TS2A 1JALA 4KAXB 3HIZA 2M8SA 3O65B 2WLBA 3E56A 2LULA 1T5XD 4Q2JA 4BKSD 3FP5A 1K50A 4ZRIA 1NTYA 1OY2A 2O2VB 5C23A 3IAS1 2HRJA 3H9DA 3NWDA 3PREA 4RGOS 2QIEB 4OHJA 4HDOA 4YXDB 5C6RA 3AI5A 2WS3B 3A1QB 5HFYA 4KSLC 1MPHA 3DWMA 5LONB 1WGGA 3NWFA 4JK8A 1IUEA 4N58A 2DHKA 4ARCA 1BTKA 4HK2A 1NDDA 1XR0B 4M00A 3KVFB 2L0FA 4HAVB 2JZ3B 4JKDA 2INDC 2KNBA 4FJZA 3AEDB 5G55A 1FNUA 5BYQA 4WURA 1P98A 1NENB 1SE3A 1MPEA 2JPHA 2H7DA 2K00A 3W9CB 4OVZA 2KQSA 4NQLB 5LLIA 2G3QB 4K17A 4M0WB 4ANUA 3B08A 3DWGC 1B9RA 1L0XB 4LNOA 2Z4DA 4JKGA 1WVHA 2N7EA 2KJ6A 2WHIA 2PJHA 4JIOU 2N0YA 2OQBA 3PT2B 2WDTB 2BCJA 1HB6A 1ZXHA 3ENEA 1HTQA 2IZVB 2LASA 1GB4A 4HWIB 1P7FA 1N5WA 4ICVA 3GZNB 1K53A 3KQ4A 2C60A 2LKOA 4D0NB 4GB9A 4P16A 2C7MB 5LXHA 1L4ZB 2LXAA 3D8DA 3LYYA 2XNAC 2D3CA 3VIAA 3GE8C 1XCGA 4M01A 2KWCA 1HQRD 4PYZA 5JHAA 2PZ1A 5AUIA 3CMMB 4FBJB 4MK0A 3P42A 1D3ZA 5KQ4A 1D5MC 1GB1A 3ZKJC 2X38A 4W9GA 1F2RI 1TGZB 1PDXA 2GUMA 1PGXA 2CR5A 3RULA 3JW0X 2KMAA 4IDIA 2NR2A 2DLBA 3PRPB 2G35A 1WR6E 2YS5A 2INCC 2D9YA 3ZXVA 4BVUC 1FMAD 2RDGA 1Y5OA 2WXMA 3AE6B 3CSFA 1C79A 4RGMA 4HAUB 1V1OA 2BS4B 1X05A 1JROA 2R82A 1WE6A 2D9VA 2WXQA 1FXTB 3ETRA 1JWBD 2M17A 1QLBB 5L81A 2D9XA 1E0ZA 3W1SA 4OZAA 2V3NA 1EUVB 4KKJA 4YL8A 3TUOA 4WWOA 2RRFA 1DGJA 1CQVA 1HEZE 3ABVB 2K8CA 3EUB2 1V89A 1AWDA 4EZLA 2WWZA 3RUIB 2N7DA 3TEZA 1WI1A 4J6IA 3JSVB 2IGDA 4TYZA 2Z0PA 1U2BA 2MLBA 3Q3MC 3P2BA 4S0RA 2DZJA 5EFXA 2KQ7A 4G0NB 3IBEA 1FRRA 2K6QA 1P3QU 1W1HA 4DHZB 2KTRB 3Q2AC 2J53A 1MJDA 3IT4B 1U5DA 2ON8A 4XWXA 1TTNA 3AEEB 5IRSA 3F0WA 2QMTA 1ZUD2 4NJ7A 1AARA 5FKAC 3EGRA 3Q8FA 1Q1OA 3GS2A 3ZRCA 1TYGB 1T77A 2MW5A 1VZ8A 1R4MB 2LGYA 4JKHA 4EKUA 2MSED 4HVBA 3KZ1A 4IKGA 4ZRPA 3AMZA 4HCPB 3APFA 3TFMA 2MJDA 4KV2A 3MJWA 4GU2A 2O6VD 4JX1C 1SXTA 4II2B 2L00B 3EC8A 4IW0A 2ROVA 3DXEA 1U27A 1IGDA 3DBHB 2DKQA 4NQKE 1LW3A 4KGRA 3UIPB 1SGHA 2ONQA 1FCCC 2Y8FA 4YSXB 4EOYA 3RNAC 3R8BA 4F7HA 1CJEA 2FJLA 2EELA 2ZZPB 2KUQA 3NS1A 5IP4D 3RPFC 1BMLC 5DPTA 2HTHA 1UWXA 2D5GA 2KWVB 1KRHA 3PVWA 2V3SA 4II3B 1KTKA 4GPTB 1YQ4B 2Z59B 3WAMA 4MSMB 2QKLA 2EKIA 4W9CA 2WXIA 2UU7A 2KGXB 3WA0A 1X86A 2FE8A 2DFKA 2KFKB 2O2VA 2CAYA 1JQ4A 3RCPA 3RCZA 2KZRA 3N1XC 1KZ7A 3Q3OC 2W2WA 3VOQA 5EDSA 4YT0B 1J7CA 3HIEA 1EWCA 1ZYIA 3OAWA 3APDA 1RLFA 4HAWB 2LRUA 3WCQA 3A1QA 2WXGA 4ARIA 3B77A 1UNPA 4HB4B 4RCOA 4W9IA 5G5GA 3ZNHB 5JP4A 4HB2B 1LFDA 2KR0A 1JMLA 2CJNA 5JZEB 1T0QC 2H7EA 3X23A 4FADA 2EJ8A 4KZ0A 3ECIA 3HVDA 1Q0WB 1E5WA 3NSUA 1L6UA 2NBUA 2LGXA 3PG7A 3B2FA 1L5PA 2M14A 2YEPB 3GZNI 1C9FA 1ESFA 2L05A 2VRRB 2JRIB 4BBKA 3T3NA 2GRIA 3FILB 5M4YB 1XO3A 2MWSB 2D11A 5J3QA 2E6XA 2WQYB 1Y56A 4M0WA 2NPTB 1C78A 4A5KA 3NW8A 5C3JB 4OVVA 2GMIC 5D3DA 4HATB 3P7ZA 4KHAA 2GCJA 2I5FA 5HHDG 1EF5A 3BVGA 3A8QA 1GG3A 4TMAB 5HI1A 4A6KA 2Z0QA 1I4RA 2LVOA 2KYWA 1N60A 4ZOHC 1AN8A 4NJCA 3U12A 2P8VA 3RNFC 3PO0A 2JWZA 4FHJA 2Y8GA 5AZHA 1BXTA 2GJYA 5H92C 5JLJB 3QCAA 2IYDB 3HHMA 2GOWA 1WJNA 2LGIA 2IGHA 1JRPA 2DTCA 2VZKD 5D6JB 3W1SC 3I63C 1N5XA 1JDEA 1XD3B 3AULA 1JW9D 4BFRA 2H88B 2N9EB 5HE1A 1TT5B 3RNBC 3F5RA 3DVNU 4RF0A 4UDUC 1WJ6A 5E6PA 3VR8B 1C4PA 4BOZB 1F0ZA 3MC9A 1XD4A 1E8ZA 4PS8A 4XWTA 3H1UA 3FVCA 2IPKD 2W2XC 1KBLA 1NTVA 1WYGA 4G3XB 1S1QB 5D3WA 1TJEA 4ASWC 1MAIA 4JWUC 2L76A 2I5CA 3PZ7A 2DYMA 2MDXA 4OVUA 5HKHA 4M8MA 1VBHA 1QQGA 2AX5A 2HE7A 2R09A 1UH6A 2MJ3A 3N30A 5BMGA 1PMSA 2KD0A 3ODXA 1J19A 2M38A 1NI3A 1UNRA 3N32A 4HAYB 1Z5SB 2RVBB 2K8EA 2ZCBA 4CSQA 1UBQA 2GBKA 1UELA 3JSVA 3ZDMC 1R4MI 2BKRB 1P6SA 4YTMB 3A9JB 4JL9A 3KUDB 1MHXA 3HW2B 2JU6X 1J7BA 1YJ1A 2RLOA 3WIMA 4C4VA 4GSWA 4HAXB 1VBGA 3E9SA 3T06A 1JWAD 4FJVB 4JKCA 2KTRA 4YTNB 2KANA 4AUQC 3ZXRA 3DBHI 4EZJA 1IYFA 1FHXA 1SJHD 2BS2B 2UYZB 3DCGA 1E8XA 1DDVA 5DHAB 3OJ3A 1L2NA 2ABDA 4L1RA 2KJRA 3VDZA 3U8ZA 4HRSA 3VVWB 1WH3A 1U5FA 4NAMA 5D3IB 1KZGA 1YJIA 1UWMA 1I4QA 1K5DB 1CK1A 3WYFB 1OGWA 3R66C 2M0AA 2PMVA 1KLGD 3AM9A 4NJ6A 1TS5A 1YJJA 1FIQA 3FAHA 2YEPF 3MP9A 3FSSA 1TY2A 1IGCA 3QBVB 4F7GA 3TVVA 2OJRA 3PZ8A 2R0DA 4K7UA 1K51A 2WX0A 3V61A 4R3DA 2V3PA 1YIWA 3N1ZC 4REZA 2Z13A 1JRUA 1UUPA 4URKA 5KQ1A 3P4SB 2K22A 3A4SC 5JHHA 2KDBA 2DENB 1L0VB 3OWEB 5FR6A 3UI3A 2K25A 1QZEA 2DZIA 4K3CA 1Z87A 2COAA 2WU5B 3TBLD 4IM0A 1WJ4A 3ZTCA 1X1GA 1XCQL 4HJKA 1ZC3B 2WNMA 1PYWD 1V9JA 2RPQA 3AEAB 4PS7A 4DQOC 2QHOA 2KVZA 2G4SA 1WE7A 1WIAA 2KFKA 4Z2MB 4O1NA 1V5MA 4PNKA 3AN1A 3T8MA 3KW5B 4NPNA 4JK9A 2FCNA 4HROA 4IAPA 1YX5B 3NRZA 5AZFA 4FA6A 1WJ1A 4HSIA 1L4DB 4K3BA 1RRBA 2GI9A 5IKCM 4KGTA 3TJPA 1MI0A 2K9XA 2YVCA 1OQNA 4XGAB 3V6EB 2FUHB 2J0JA 4M8NA 1Z2MA 2WP9B 3MHSD 3NVYA 1X1FA 3VTWA 2DHJA 4C0AA 3QA8A 1EGXA 1GAQB 4LDTB 2PEAA 4XWWA 3Q6BA 3IHPC 2J0MA 2QDFA 4NZLB 3AXCA 3D32A 3FILA 3JYUA 4ANWA 1D4BA 1V86A 2LVPA 4XYCA 1S3SG 3AE4B 4HHVA 1UPRA 4ZRJA 3P6AA 2NPTA 4ZYNA 2Z0OA 2COFA 3ZVVA 1WRIA 2JZPA 1HTOA 1AYFA 1NU2A 5AEKB 4HAZB 1RFAA 2K5PA 2LJIA 3VUWA 2ZW1A 2DBYA 4JKBA 3ODOA 5DHFB 5I2MA 4MELA 2V4IB 4US9A 3W2DA 4HEA1 4MEMA 1PUTA 4IFSA 2MWNB 4PS3A 3IXSA 4TQ1A 1MG4A 5IOIA 2BKFA 1N61A 3H6NA 5CX3A 2LI5A 3AE9B 5EE3A 4A3PA 5BYSA 2BTEA 4LK0M 1K52A 1VCBA 1YN4A 1PFJA 5J3YA 3CF6E 2KUPA 1DROA 4MH0E 4EZKA 2KWDA 2BYTA 1ACAA 4WSFA 1IRSA 1XLQA 4DIXA 1EU4A 5TSSA 1HA5A 3ML8A 2MJEA 1TKGA 2GS0A 3WANA 2YS3A 3SHQA 3AECB 5GMVA 2FUG1 3A58A 4TUUA 4C56C 3PPAA 3NZ3A 1NYRA 1KF6B 2A4ZA 2M0XA 4KSKC 3P4RB 2DAJA 1T0YA 2KN5A 1I4PA 4DXFA 2B76B 2ZNVB 2YS1A 3HVZA 3NVVA 1I4XA 2N9PC 3DBRB 1ZOYB 2KJHB 2UWQA 1XLPA 3SFDB 4W9DA 5HE3A 1KLVA 1AQCA 2BW2A 4JQWC 1WFYA 1VRAB 1WX9A 2R61A 4GDLB 1WI0A 2FJ9A 1WM2A 3ULBA 2CHXA 3A9JA 3MDBC 2CJOA 1D5ZC 2WDRB 3TIXA 5G5HA 4KHBB 2KQ4X 1XCTL 2WXPA 5L95C 1U5GA 4G11A 1FXIA 4K81A 4K7SA 4BBNF 4ILGB 2IO2B 3VQIA 2N9LA 2IDYA 4A20A 1YQBA 1JCKB 3H7PB 3GP7A 1N62A 3DHIC 1SB3C 4LJOB 2DIKA 4GGQA 4LNKA 3DBLB 4NAWB 1H4RA 1LB1A 2RDHA 2Y7BA 2W55A 3EECA 1YNTE 2E3TA 2WXOA 2H89B 2RNRB 1J7AA 1I4GA 1HE8A 2YT2A 4PK1A 2FNJB 2Q5WD 2LUMA 2KO3A 1FNWA 3C8YA 5IO9A 1TJ6A 3R2IA 1N63A 3Q8BA 5JH5C 4S17A 1EO6A 1B1ZA 4M02A 4WQOB 4RNAA 1WYWB 2XK5B 1XQQA 3L4PA 3R7RA 2JXTA 5AUKA 4J3OD 1SBBB 3R2TA 1UF0A 3EPYA 4AOFA 5LG4B 3NY5A 4WIPA 1GOZA 3LJUX 4GDKB 3TW1A 1WWTA 4WQMA 2FCMA 2VH2A 3GB1A 2LXCA 2NZ8B 3N7CA 3OLMD 4C4VB 2DLWA 4K2PA 4IG7B 4BKTA 1WGUA 4IWOA 2VRWB 4QJ4B 4XDCA 3ZJUA 1UGMA 1R4NB 3GE3C 3U30A 2CU3A 1FPYA 4AWJA 1A5RA 1BT0A 2Y3AA 4ZHPA 1GC6A 2DWQA 2J4XA 3SFEB 3BVMA 3KWVA 2G4DB 3Q3NC 3AE1B 4YTPB 2N9KA 3TSSA 2JP2A 4PYUA 4IOYX 5LXIB 4B0MA 4DHJD 2R2OA 3A98B 3VAWA 1WM3A 1H10A 1HBKA 1VR9A 2M56B 3H8HA 3V62A 3AE3B 1GGOA 2NBVB 2J0KA 4DX90 3SU8X 1TXDA 3KSYA 3QJZA 4C7ZA 4P1BC 2Z0EB 1SHCA 1FGZA 5G2NA 1WXVA 4IC7B 1NVID 1P7EA 2SAKA 3RN9C 4ZRKA 2BQQA 2QKMA 1TS4A 2JRHA 2KX0A 4QJ3B 4JKAA 3B9JA 1FXAA 2DHZA 1WR1A 2D3AA 3Q8AA 1E9MA 1TZOA 2YT0A 4W9KA 4TSSA 2O6VA 2ADZA 4OZCA 4A6QA 2QCZA 2J42A 2I1KA 2OTXA 4F7UP 1MIZB 2KHWB 2BF8B 2M19A 1ZXIA 2LGDA 5KHQA 4W9LA 2EKEC 3OG5A 1R7SA 5BYRA 2GLSA 3HSAA 2Y5BB 4CHMA 3PS6A 5EE9A 3W5VB 3FKYA 3ONSA 2NS5A 3C19A 3V3XA 3ZLZA 4NSWA 1EF1A 4TQ0A 2MBBB 2LVQA 1OQQA 2HJ8A 2G9HD 4XE0A 2LHDA 3Q69A 3ZRFA 3CIKA 1X1MA 3I3TB 2ASQA 4C00A 4DHZE 3ZTDA 3DVNV 4FJYA 3EA6A 3PSEB 3DHGC 4AJWA 4A55A 3L08A 3LJ3A 2M1MA 1FM0D 1WGKA 4WJNA 3DQVA 3M1IB 2YF0A 3IT6B 4YWGG 4HB0B 3B2GA 1ZGUB 2X8XX 1DOIA 2P0HA 3DBRI 2V76A 1QKZA 2FBWB 3DVGY 3P1MA 5JHBA 2HJ1A 3PLUA 4DDGD 2ZPYA 1DDMA 1V5OA 1FHOA 2LG1A 1QOAA 5EE1A 1FAOA 3D8EA 4DDID 3G9WA 4HLEA 2N7JA 3HK0A 5I4DA 2INPE 2QEJC 2NBWB 2K2UA 2FIFA 3KLSX 4MGIE 5GXGB 1FGYA 1BAKA 3ZJTA 2LBBA 2BPSA 3EFUA 1ROEA 4MDKE 5HE0A 1NI2A 1VD2A 3ZYYX 3FEHA 2PIAA 1AW7A 2KTFA 4F8CB 2L7RA 1LXDA 2L83A 3DBLI 2R2YA 4RH6A 4HPPA 2KAJA 1WMHA 3BWUD 3QIJA 2OHFA 3GOEA 2L32A 2EMTA 3D8FA 1U29A 3SNHA 4GDLA 3KYDD 2N0SB 2N23A 4ILHA 3PGEA 4DK5A 2FDQA 1GUAB 5IN7A 4FULA 4ZRQA 3T3OA 1DBHA 4HKZE 3PVUA 2WXJA 3RZWC 5I2SA 1UNQA 1I2HA 3NJTA 2BS3B 2LEKA 3KH0A 4BKGA 2V4LA 4KHBA 4MM3B 1G6JA 4QJ5B 1T0RC 4W9JA 4HCNB 5FK9C 3MJ5A 1XLOA 3I57A 2DZMA 2ICIA 2EMSA 2KDMA 4N59A 3BVZA 3ENBA 3H7PA 4FXCA 1V49A 1L0YB 1N6ZA 1DYNA 2RGFA 5HG2A 4NAWA 1M7RA 4EE2A 2MCNB 1EM7A 4ANVA 3KUCB 3SV1A 2BBCA 3C0RB 3SBGA 2CS4A 2K39A 2K0PA 1MFWA 5IJMA 1FFUA 3UZTA 2JQRB 3P63A 4CHJA 2K8HA 1P1AA 3AU4A 3IG3A 1C76A 4WWPA 1J8CA 2RMMA 4WVFB 1VZ7A 3U4EG 1WJMA 1IP9A 1R4NI 3ZQ4A 1V61A 2CODA 3HM6X 5CHFA 1GPXA 4XX5A 1LM8B 2RGNB 3PSCA 1E8WA 2ZEQA 1V5TA 1V80A 4XZ4A 1K8RB 2NMBA 1H8CA 2XK5A 3GYOA 2WXRA 2KC2A 2E2XA 4EFOA 3K9OB 5C16A 2IJ0A 1Q67A 2L3ZA 2YRYA 4MGKE 3R3MA 3N20C 3QAQA 1KFYB 4W9EA 2OJWA 4BBNC 2CQUA 1HZ5A 2GBRA 3NHEB 4GDKA 1NBFC 1E6EB 4N6EB 4DBBA 1GJZA 4DXAB 5D3VA 2BYFA 2IO0B 1Y19B 2DNFA 1VDVA 4AS1A 1EWYC 1ISNA 1UPQA 4A6FB 2N9XA 2W9NA 3PLVA 1ACCA 2V1YA 2ZKMX 2X0SA 4A3OA 3KYCD 3BINA 3DXCA 4ILJA 3MHZA 5DI9B 3RZFA 1C77A 1T3QA 4HPMB 3RYTA 4BAXA 3BYTB 3HM3A 1FHWA 2JVCA 1T0SC 1RFKA 2KDIA 4F7ZA 4I6LB 2I1JA 3QQ8B 3DHHC 3DDCB 2KMCA 3QHTA 5BMIA 1UEFA 2MA9B 1XX0A 5LOPB 2MFQA 3ZNID 1WGDA 4HDQA 2JSVX 1LGRA 2NBVA 3U52E 1WXMA 2JT4B 2KX3A 1WY8A 2WX1A 3UQBA 1ENFA 1AWEA 2MBOA 3IFWB 3PV1A 4RFBA 5T8IA 3U2SC 3AEFB 1NYQA 3EHVA 5CLQB 1FOEA 4RM8A 5D27A 1E7VA 2PLPA 3L54A 1V2YA 4JWSC 4B95A 4MSQB 3VTUA 2C9WB 1V1PB 3AB5A 1E7PB 4JE3B 1JWUD 2MKRA 1YD8U 4MT7A 3HUIA 1FRDA 2AEHA 5D2MB 4MJSB 5D3XA 2CHWA 4JK7A 4ZDVA 1T6BX 3UINB 2RDBC 2J59M 4A8XC 4KKIA 1OQYA 2PPHA 3NWAA 1QQRA 2KLGA 4LNNA 2FJUB 4GZUA 1FEHA 1WX7A 4QXAB 1C4AA 3TMPB 4ANXA 1YN3A 5EE0A 2YLMA 2EC1A 2BVCA 1WXQA 3DXDA 3BK2A 1QT9A 1ZPSA 3P4QB 1F9JA 1SE9A 1MK9B 4XC2A 3VUXA 1Q10A 4EJNA 3OANA 3V05A 1M94A 1SIFA 4C80A 4FLHA 4OT1A 4LLGM 1JWMD 3SD5A 3VRAB 3LDZE 4JKEA 3H7SA 2QILA 5DPSA 2ZNVC 1RM6C 1TIFA 4W9FA 2XQNM 2DZKA 1YX6B 4GOUA 3RMKC 5C1ZA 2KMMA 3RNEC 2VKIA 4DWFA 3ODWA 2C7NB 2N1WA 3N9YC 3QWMA 1TQZA 3A9KB 1GC7A 1ST7A 1VJKA 4MH8A 3VHTC 2NTTA 1FB8A 3B1LX 2O6VB 2IY1B 5JXVA 1P0RA 3WAPA 1V6EA 3Q8EA 1UZXB 1V97A 4L6EA 2NVUI 3PRZA 1MI1A 3QWZB 1OFFA 4IOIE 4Z2NA 2WH5A 1WJUA 3IVFA 2DYQA 2K2JA 3URYA 2K49A 1SE4A 2AQ3B 5C5BB 4LNFA 1Q5WB 4JKFA 1W1DA 2RSUA 1V88A 1ZSQA 4DBGA 5D3YA 2J52A 2D2QA 1ZVRA 1SIJA 4HB3B 2MP2B 2KN4A 3AH7A 3Q3FA 3VXWA 3UQAA 1TS3A 2UZRA 3MPXA 1QOBA 1XLNA 1D6EC 4BKSA 4MM3A 2SEBD 4P7IA 1KJTA 3BYYB 2DYBA 2VH1A 4A6HA 3AE8B 2LWPA 4BOSC 1BTNA 1EAZA 5JVLA 4GOCA 3AJ4A 4L2YA 2WXNA 3AE2B 3AE7B 1PGAA 1WGYA 3TCAA 4KDIC 1FD6A 2FIDA 1P3RA 2IO3B 2W3RA 3V6CB 4C7YA 2L52A 2KIGA 1VZ6A 1SSNA 3OHMB 3TEYA 1E8YA 3APCA 5J18A 2ZVOA 4X57B 4DX8A 5D7GA 2RQ1A 2IFSA 3DCXA 2GCLA 1CZPA 3UIOB 2M4NA 1MKEA 3HRDD 1K5GB 1I7AA 1I7HA 4KX6B 5CHWA 3BIID 1WMHB 4GIVA 3PHXB 2MBHA 4IM3A 2FCQA 2IY0B 2MHJA 1YOVB 2ZCCA 1DOXA 5TR5A 4ZHOA 2QJLA 2K8BA 2DHIA 1WZ3A 2LOXA 1IPGA 3T9LA 4MGYE 1DYQA 2JF5A 1RWSA 3RNCC 3TO1A 2COCA 5H8YE 1SE2A 4A6FA 2K3UA 3EFCA 1TY0A 3CIRB 5IAAC 2ROZB 3PRMB 3LB8C 1E7UA 3JVZX 1RRPB 3QC8B 2PE9A 2KDEB 2KFJA 3ZIMA 1L6VA 3BZDB 4BZAA 3PHWB 2TSSA 5CHVC 2BYEA 2G1EA 2L0TA 2WXFA 1F52A 1CMXB 4D6WA 4HKQA 1SJED 4GMVA 2KIEA 2VZKB 5D94A 1FO4A 2L1AA 2L2IA 4JLCA 2K1FA 4JGHB 4W9HA 1V5PA 1V5UA 2XBBC 1F1HA 3M62B 4OSNA 2FAZA 1UGJA 2W2XD 3A8PA 1PQSA 3OJ4B 4RF1A 1B55A 4RGNA 2OEDA 3FC4A 1V1PA 4WAFA 4AJYB 3M63B 1L7YA 1KH0A 5DIFB 5C79A 2LFIA 3ZNGC 3R7QA 1QC6A 2A5UA 4I6NB 3ZO5B 4MJSA 2RPVA 3X0WA 4EMOA 2FCSA 1ZDXA 4ITKA 1A70A 5J3TA 3WALA 1XODA 2DA0A 1STEA 4K2OA 3ZW3A 2JXXA 2ZJDA 4AP4C 1BUIC 1HB8A 3NS8A 2KDFB 2OOBB 1ZKHA 2DAFA 4L23A 3FLVA 3A33B 4WJOA 4WJQA 1ET9A 1XKEA 2NMQA 1TBEA 3TEWA 4XDDA 4B6HA 2D4QA 2WU2B 3QARA 4CYEA 4LDTD 2BB6A 3DPDA 3ZUNA 3MC8A 3ZDTA 1Y8RC 3VRBB 2LMCA 4WAAA 1EVHA 1YN5A 2Z14A 4LNIA 1J0GA 2UZSA 2MH7A 4E3CA 1QILA 2JY6A 2ZPNA 4KZCA 3L10B 4RMAA 3RT3B 2D9WA 2Z8LA 4IUMB 3VR9B 2D3GA 3I5JC 3ZGZA 5DH9B 1IBXA 4NY0A 5CTRC 4KDLB 3A9KA 1RJ2A 2X18A 2PVGC 4CQNA 4GNKB 4PQ0A 3O13A 3ZJVA 1E90A 2INNE 2QSDA 3W1YA 3KRWA 3SO6A 2GBNA 2L8JA 2B3AA 3LXFA 3W5UB 3UF8A 4GN1A 1M4VA
chains in the Genus database with same CATH topology
1ZM0A 2CHZA 3CXBB 3AU5A 2KKCA 4K1RB 5C5BA 3ULCA 4IWQA 4YONA 2JZZA 5BO4B 2MP2A 5DPWA 2D10A 4EEWA 2VSZA 2C7HA 4G50A 1WXAA 1KI1B 3CSTA 5J17A 1ZW7A 5L83A 4ICUA 1C3TA 3A4RA 1WRDB 3E66A 2LZ6A 2REXA 4GXBA 1WXSA 3RD2A 4TV3A 2ELAA 4Y94A 2KLCA 4FHKA 1MK7B 2DX5B 5HE2A 2IO1B 1OMWA 4KVGB 2BGFA 2DYNA 1TZ1A 2HD5B 4GMXB 4WJ7A 1WX8A 2KXJA 3S2AA 3PVLA 2RR9A 2Q13A 4E74A 3KRXA 2IBIB 2XEWA 1OEYA 1WF9A 4KIKB 1C1YB 3NOBA 1DDWA 1PLSA 3PP2A 2CRFA 1DIKA 2LYDA 3U7DA 3QX1A 2C5LC 2CKHB 1KC7A 2D9ZA 5E6NA 4B9KA 3VUYA 1MIXA 2KC1A 4WJPA 3ZVRA 1X11A 2GBMA 3FM8C 1M7EA 1P5TA 3L13A 2BYVE 2RSGA 2WYQA 3V60A 5FI1A 1N3HA 3SDLC 2MBQA 3KY9A 2LJ5A 4MY6A 4LJPB 3TL5A 1RAXA 1MG8A 3VTVA 3ML9A 3Q3JA 1I35A 4HPLB 4IM2A 2P0FA 4JKGB 5KCVA 2AWTA 2J7QB 2LUEA 5CLLB 3SUZA 2CU1A 2P0DA 5KHOA 2JUOA 2GBJA 2RD0A 3V5WA 5IA7A 1BWNA 1ZC4B 2DYOA 5AZGA 3SBTA 2KK8A 4B6WA 3N3KB 4IWPA 3DOWA 2CB8A 2MBEA 3O96A 1J0WA 3GYPA 3ZNZB 3VFKA 3BJIA 1KM7A 5DPRA 3WAOA 2G45B 4H8SA 2Z0DB 5E6OA 3BY4B 2MQJA 3PEGA 3K9PB 5DCNA 2COPA 4HXDA 2RUKB 1V81A 4MGZE 3NZUA 2LD9A 1NTIA 4N9F4 2K6DB 1XT9B 2L1CA 1GNUA 1W1GA 4WWNA 4LCDE 2MX2A 3DBSA 2UVMA 3E9LA 2DN6A 3VH4B 2AYOB 2KVRA 3MTNB 1WGRA 4E71A 2CY5A 4F1SA 1WZ0A 5J2RA 3KUZA 4EUTA 3UGBB 3NZSA 2D07B 3VH3B 2DX1A 2BWFA 3L16A 3M3JA 2IYBA 4NNJB 2AL3A 3B0AA 1U4AA 4K7WA 2KCJA 1P9DU 3HQCA 2YSZA 1OEYJ 3ALBA 4TKNA 1UD7A 3QK0A 2YT1A 3L17A 4I6PA 2ZVNA 1OTRB 2CY4A 3PTFC 3L0WB 3ML4A 2R2QA 4CO7A 3PZDA 3E9PA 1WG7A 2DKPA 5GOWB 4DHJB 3DVGX 5FI0A 4CHKA 2DX5A 2BWES 4KHOA 2KWUB 4RM9A 1NVLA 2MRPA 2LRWA 2N1VA 1LQBA 2AL6A 2KOXA 3M95A 5JHGA 1KOTA 2LOZA 2NCNA 2PE6B 4FN2A 3E9OA 1I42A 1UBIA 1U5EA 2HTHB 1WGHA 2N4FA 1WGQA 3SYXA 2ELBA 4KIKA 4KAXB 3HIZA 2M8SA 3O65B 2LULA 4BKSD 3FP5A 4ZRIA 1NTYA 1OY2A 2O2VB 5C23A 2HRJA 3H9DA 3PREA 4HDOA 5C6RA 3AI5A 3A1QB 4KSLC 1MPHA 5LONB 1WGGA 4JK8A 2DHKA 1BTKA 4HK2A 1NDDA 1XR0B 3KVFB 2L0FA 4HAVB 2JZ3B 4JKDA 4FJZA 2KNBA 5G55A 1P98A 2JPHA 2H7DA 2K00A 2KQSA 4NQLB 5LLIA 2G3QB 4K17A 4M0WB 4ANUA 3B08A 4JKGA 1WVHA 2N7EA 2KJ6A 2PJHA 4JIOU 2N0YA 2OQBA 3PT2B 2WDTB 2BCJA 1HB6A 3ENEA 2IZVB 2LASA 4HWIB 4ICVA 2C60A 2LKOA 4D0NB 4GB9A 2C7MB 5LXHA 2LXAA 3D8DA 3VIAA 1XCGA 2KWCA 4PYZA 5JHAA 2PZ1A 3CMMB 4FBJB 4MK0A 1D3ZA 5KQ4A 3ZKJC 4W9GA 1TGZB 2CR5A 3RULA 3JW0X 2KMAA 2NR2A 3PRPB 2G35A 1WR6E 2YS5A 4BVUC 2D9YA 1Y5OA 3CSFA 4HAUB 1X05A 2R82A 1WE6A 2D9VA 1FXTB 2M17A 5L81A 2D9XA 3W1SA 1EUVB 4YL8A 4WWOA 2K8CA 1V89A 4EZLA 2WWZA 3RUIB 2N7DA 1WI1A 4J6IA 3JSVB 4TYZA 2Z0PA 1U2BA 2MLBA 3P2BA 2DZJA 5EFXA 2KQ7A 4G0NB 3IBEA 2K6QA 1P3QU 1W1HA 4DHZB 2KTRB 1U5DA 4XWXA 1TTNA 3F0WA 4NJ7A 1AARA 1Q1OA 3ZRCA 2MW5A 2LGYA 4JKHA 4EKUA 2MSED 4HVBA 3KZ1A 4HCPB 3APFA 3TFMA 4KV2A 3MJWA 4GU2A 2O6VD 4II2B 2L00B 3EC8A 4IW0A 2ROVA 3DXEA 1U27A 2DKQA 4NQKE 1LW3A 3UIPB 1SGHA 2Y8FA 4EOYA 4F7HA 2FJLA 2ZZPB 5DPTA 2HTHA 2KWVB 3PVWA 2V3SA 4II3B 4GPTB 2Z59B 3WAMA 4MSMB 2QKLA 4W9CA 2KGXB 3WA0A 1X86A 2DFKA 2KFKB 2O2VA 2CAYA 3RCPA 3RCZA 2KZRA 1KZ7A 2W2WA 3VOQA 5EDSA 3OAWA 3APDA 1RLFA 4HAWB 2LRUA 3A1QA 1UNPA 4HB4B 4W9IA 3ZNHB 5JP4A 4HB2B 1LFDA 5JZEB 2H7EA 3X23A 4FADA 2EJ8A 4KZ0A 3ECIA 1Q0WB 1E5WA 3NSUA 2NBUA 2LGXA 3PG7A 2M14A 3GZNI 2L05A 2VRRB 2JRIB 4BBKA 2MWSB 2D11A 5J3QA 2NPTB 4A5KA 4OVVA 2GMIC 4HATB 3P7ZA 4KHAA 2GCJA 2I5FA 1EF5A 3A8QA 1GG3A 4A6KA 2Z0QA 2LVOA 2P8VA 2JWZA 4FHJA 2Y8GA 5AZHA 2GJYA 5JLJB 3QCAA 2IYDB 3HHMA 2GOWA 1WJNA 2DTCA 5D6JB 3W1SC 1JDEA 1XD3B 3AULA 4BFRA 2N9EB 5HE1A 3F5RA 3DVNU 1WJ6A 5E6PA 4BOZB 1XD4A 1E8ZA 4PS8A 3H1UA 2W2XC 1KBLA 1NTVA 4G3XB 1S1QB 5D3WA 4ASWC 1MAIA 2L76A 2I5CA 2DYMA 2MDXA 4OVUA 5HKHA 4M8MA 1VBHA 1QQGA 2HE7A 2R09A 1UH6A 3N30A 1PMSA 2KD0A 3ODXA 1J19A 2M38A 1UNRA 3N32A 4HAYB 1Z5SB 2RVBB 2ZCBA 1UBQA 2GBKA 1UELA 3JSVA 3ZDMC 1R4MI 2BKRB 1P6SA 3A9JB 4JL9A 3KUDB 3HW2B 1YJ1A 2RLOA 3WIMA 4GSWA 4HAXB 1VBGA 3T06A 4FJVB 4JKCA 2KTRA 2KANA 4AUQC 3DBHI 4EZJA 1IYFA 1FHXA 2UYZB 3DCGA 1E8XA 1DDVA 5DHAB 3OJ3A 1L2NA 2ABDA 2KJRA 3VDZA 3U8ZA 3VVWB 1WH3A 1U5FA 1KZGA 1K5DB 3WYFB 1OGWA 3R66C 4NJ6A 3FSSA 3QBVB 4F7GA 3TVVA 2OJRA 2R0DA 4K7UA 2WX0A 3V61A 1YIWA 1JRUA 4URKA 5KQ1A 3A4SC 5JHHA 2KDBA 2DENB 5FR6A 2K25A 1QZEA 2DZIA 1Z87A 2COAA 3TBLD 4IM0A 1WJ4A 3ZTCA 1X1GA 4HJKA 1ZC3B 1V9JA 2RPQA 4PS7A 2QHOA 2G4SA 1WE7A 1WIAA 2KFKA 4Z2MB 1V5MA 4PNKA 3T8MA 3KW5B 4NPNA 4JK9A 2FCNA 4IAPA 1YX5B 5AZFA 4FA6A 1WJ1A 1RRBA 3TJPA 2YVCA 1OQNA 3V6EB 2FUHB 2J0JA 4M8NA 1Z2MA 3MHSD 1X1FA 3VTWA 2DHJA 4C0AA 3QA8A 1EGXA 4LDTB 2PEAA 3IHPC 2J0MA 3AXCA 3D32A 3JYUA 4ANWA 1V86A 2LVPA 1S3SG 4HHVA 1UPRA 4ZRJA 3P6AA 2NPTA 4ZYNA 2Z0OA 2COFA 3ZVVA 1NU2A 5AEKB 4HAZB 1RFAA 3VUWA 4JKBA 3ODOA 5DHFB 4MELA 4MEMA 4IFSA 2MWNB 4PS3A 4TQ1A 2BKFA 3H6NA 5CX3A 2LI5A 4A3PA 1VCBA 1PFJA 5J3YA 3CF6E 2KUPA 1DROA 4MH0E 4EZKA 1ACAA 4WSFA 1IRSA 3ML8A 2GS0A 3WANA 2YS3A 3SHQA 5GMVA 4TUUA 3PPAA 2A4ZA 2M0XA 4KSKC 2DAJA 1T0YA 2KN5A 2ZNVB 2YS1A 2N9PC 2KJHB 2UWQA 4W9DA 5HE3A 1KLVA 1AQCA 4JQWC 1WFYA 1WX9A 4GDLB 1WI0A 2FJ9A 1WM2A 3ULBA 2CHXA 3A9JA 3MDBC 3TIXA 4KHBB 5L95C 1U5GA 4G11A 4K81A 4K7SA 4BBNF 4ILGB 2IO2B 3VQIA 4A20A 1YQBA 3H7PB 4LJOB 2DIKA 4GGQA 4NAWB 1H4RA 1LB1A 2Y7BA 3EECA 2RNRB 1HE8A 2FNJB 2KO3A 1TJ6A 5JH5C 1EO6A 4WQOB 1WYWB 2XK5B 1XQQA 3R7RA 3EPYA 4AOFA 3NY5A 3LJUX 4GDKB 3TW1A 2FCMA 2LXCA 2NZ8B 3N7CA 3OLMD 2DLWA 4K2PA 4IG7B 4BKTA 1WGUA 4IWOA 2VRWB 1UGMA 3U30A 4AWJA 1A5RA 1BT0A 1GC6A 2G4DB 2JP2A 4PYUA 4IOYX 5LXIB 4DHJD 2R2OA 3A98B 3VAWA 1WM3A 1H10A 1HBKA 3V62A 1GGOA 2NBVB 2J0KA 4DX90 3SU8X 1TXDA 3KSYA 3QJZA 2Z0EB 1SHCA 1FGZA 5G2NA 1WXVA 4IC7B 4ZRKA 2QKMA 2JRHA 2KX0A 4JKAA 2DHZA 1WR1A 2YT0A 4W9KA 2O6VA 2ADZA 2I1KA 2OTXA 4F7UP 1MIZB 2KHWB 2BF8B 2LGDA 5KHQA 4W9LA 2EKEC 2Y5BB 4CHMA 3PS6A 3ONSA 2NS5A 3ZLZA 4NSWA 1EF1A 4TQ0A 2MBBB 2LVQA 2HJ8A 3ZRFA 3CIKA 1X1MA 3I3TB 2ASQA 4DHZE 3ZTDA 3DVNV 4FJYA 3PSEB 4AJWA 3L08A 3LJ3A 2M1MA 4WJNA 3DQVA 3M1IB 2YF0A 4HB0B 1ZGUB 2P0HA 3DBRI 2V76A 3DVGY 5JHBA 3PLUA 4DDGD 2ZPYA 1DDMA 1V5OA 1FHOA 2LG1A 1FAOA 3D8EA 4DDID 3G9WA 4HLEA 3HK0A 2NBWB 2K2UA 2FIFA 4MGIE 1FGYA 1BAKA 2LBBA 2BPSA 3EFUA 4MDKE 5HE0A 1NI2A 1VD2A 3FEHA 2KTFA 4F8CB 2L7RA 1LXDA 3DBLI 1WMHA 3QIJA 3GOEA 2EMTA 3D8FA 1U29A 3SNHA 4GDLA 3KYDD 2N23A 4ILHA 3PGEA 4DK5A 2FDQA 1GUAB 4FULA 1DBHA 3PVUA 3RZWC 1UNQA 1I2HA 3KH0A 4BKGA 2V4LA 1G6JA 4W9JA 4HCNB 2DZMA 2EMSA 3ENBA 3H7PA 1V49A 1DYNA 2RGFA 4NAWA 1M7RA 2MCNB 4ANVA 3KUCB 3SV1A 3C0RB 3SBGA 2CS4A 2K39A 5IJMA 3UZTA 4CHJA 2K8HA 1P1AA 3AU4A 3IG3A 4WWPA 1J8CA 4WVFB 1WJMA 1IP9A 1R4NI 1V61A 2CODA 3HM6X 5CHFA 4XX5A 1LM8B 2RGNB 3PSCA 1E8WA 2ZEQA 1V5TA 1V80A 4XZ4A 1K8RB 2NMBA 1H8CA 2XK5A 3GYOA 2KC2A 2E2XA 4EFOA 3K9OB 5C16A 1Q67A 2L3ZA 2YRYA 4MGKE 3R3MA 3QAQA 4W9EA 4BBNC 2CQUA 2GBRA 3NHEB 4GDKA 1NBFC 4DBBA 1GJZA 4DXAB 5D3VA 2BYFA 2IO0B 1Y19B 2N9XA 1ISNA 1UPQA 4A6FB 2W9NA 3PLVA 2V1YA 2X0SA 4A3OA 3KYCD 3BINA 3DXCA 4ILJA 5DI9B 3RZFA 4HPMB 3RYTA 3HM3A 1FHWA 2JVCA 2KDIA 4F7ZA 4I6LB 2I1JA 3QQ8B 3DDCB 2KMCA 3QHTA 1UEFA 2MA9B 1XX0A 5LOPB 2MFQA 3ZNID 1WGDA 4HDQA 1WXMA 2JT4B 2KX3A 1WY8A 2WX1A 3UQBA 1AWEA 2MBOA 3IFWB 3PV1A 3EHVA 5CLQB 1FOEA 4RM8A 5D27A 1E7VA 3L54A 4B95A 1V2YA 4MSQB 3VTUA 2C9WB 1YD8U 2MKRA 4MT7A 2AEHA 5D2MB 4MJSB 5D3XA 2CHWA 4JK7A 4ZDVA 3UINB 2J59M 1OQYA 2PPHA 2KLGA 4GZUA 1WX7A 3TMPB 4ANXA 2YLMA 2EC1A 3DXDA 1F9JA 1SE9A 1MK9B 4XC2A 3VUXA 4EJNA 3OANA 1M94A 1SIFA 4FLHA 3SD5A 3LDZE 4JKEA 3H7SA 5DPSA 2ZNVC 4W9FA 2XQNM 2DZKA 1YX6B 5C1ZA 2VKIA 4DWFA 3ODWA 2C7NB 2N1WA 3QWMA 1TQZA 3A9KB 1GC7A 1ST7A 3VHTC 1FB8A 3B1LX 2O6VB 2IY1B 1P0RA 3WAPA 1V6EA 1UZXB 2NVUI 4L6EA 3PRZA 3QWZB 4Z2NA 2WH5A 1WJUA 3IVFA 2DYQA 2K2JA 5C5BB 1Q5WB 4JKFA 1W1DA 2RSUA 1V88A 1ZSQA 4DBGA 5D3YA 2D2QA 1ZVRA 4HB3B 2MP2B 3Q3FA 3VXWA 3UQAA 2UZRA 3MPXA 4BKSA 4MM3A 4P7IA 1KJTA 2DYBA 4A6HA 2LWPA 4BOSC 1BTNA 1EAZA 5JVLA 4GOCA 3AJ4A 1WGYA 3TCAA 4KDIC 2FIDA 1P3RA 2IO3B 3V6CB 1E8YA 3APCA 5J18A 2ZVOA 4X57B 4DX8A 5D7GA 2RQ1A 2IFSA 2GCLA 3UIOB 2M4NA 1MKEA 1K5GB 1I7AA 5CHWA 1WMHB 4GIVA 3PHXB 2MBHA 4IM3A 2FCQA 2IY0B 2ZCCA 5TR5A 2K8BA 2DHIA 1WZ3A 2LOXA 1IPGA 3T9LA 4MGYE 2JF5A 3TO1A 2COCA 4A6FA 5IAAC 2ROZB 3PRMB 1E7UA 3JVZX 1RRPB 3QC8B 2PE9A 2KDEB 2KFJA 3ZIMA 3PHWB 5CHVC 2BYEA 2L0TA 1CMXB 4GMVA 5D94A 2L2IA 4JLCA 2K1FA 4JGHB 4W9HA 1V5PA 1V5UA 2XBBC 3M62B 2FAZA 2W2XD 3A8PA 1PQSA 3OJ4B 1B55A 4AJYB 3M63B 1L7YA 5DIFB 5C79A 3ZNGC 3R7QA 1QC6A 2A5UA 4I6NB 3ZO5B 4MJSA 3X0WA 4EMOA 2FCSA 5J3TA 3WALA 1XODA 2DA0A 4K2OA 3ZW3A 2JXXA 2ZJDA 4AP4C 1HB8A 3NS8A 2KDFB 2OOBB 1ZKHA 2DAFA 3FLVA 3A33B 4WJOA 4WJQA 1XKEA 1TBEA 4B6HA 2D4QA 3QARA 4CYEA 4LDTD 3DPDA 3ZUNA 3ZDTA 1Y8RC 4WAAA 1EVHA 1J0GA 2UZSA 4E3CA 2JY6A 2ZPNA 4KZCA 3L10B 4RMAA 3RT3B 2D9WA 4IUMB 2D3GA 5DH9B 4NY0A 5CTRC 4KDLB 3A9KA 1RJ2A 2X18A 4PQ0A 1E90A 3W1YA 3KRWA 3SO6A 2GBNA 2L8JA 2B3AA 3UF8A 4GN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM0 A;  2CHZ A;  3CXB B;  3AU5 A;  2KKC A;  4K1R B;  5C5B A;  3ULC A;  4IWQ A;  4YON A;  2JZZ A;  5BO4 B;  2MP2 A;  5DPW A;  2D10 A;  4EEW A;  2VSZ A;  2C7H A;  4G50 A;  1WXA A;  1KI1 B;  3CST A;  5J17 A;  1ZW7 A;  5L83 A;  4ICU A;  1C3T A;  3A4R A;  1WRD B;  2LZ6 A;  2REX A;  4GXB A;  1WXS A;  3RD2 A;  4TV3 A;  2ELA A;  4Y94 A;  2KLC A;  4FHK A;  1MK7 B;  2DX5 B;  5HE2 A;  2IO1 B;  1OMW A;  4KVG B;  2BGF A;  2DYN A;  1TZ1 A;  2HD5 B;  4GMX B;  4WJ7 A;  1WX8 A;  2KXJ A;  3S2A A;  3PVL A;  2RR9 A;  2Q13 A;  4E74 A;  3KRX A;  2IBI B;  2XEW A;  1OEY A;  1WF9 A;  4KIK B;  1C1Y B;  3NOB A;  1DDW A;  1PLS A;  3PP2 A;  2CRF A;  2LYD A;  3U7D A;  3QX1 A;  2C5L C;  2CKH B;  2D9Z A;  5E6N A;  4B9K A;  3VUY A;  1MIX A;  2KC1 A;  4WJP A;  3ZVR A;  1X11 A;  2GBM A;  3FM8 C;  1M7E A;  1P5T A;  3L13 A;  2BYV E;  2RSG A;  2WYQ A;  3V60 A;  5FI1 A;  1N3H A;  3SDL C;  2MBQ A;  3KY9 A;  2LJ5 A;  4MY6 A;  4LJP B;  3TL5 A;  1RAX A;  1MG8 A;  3VTV A;  3ML9 A;  3Q3J A;  1I35 A;  4HPL B;  4IM2 A;  2P0F A;  5KCV A;  2AWT A;  2J7Q B;  2LUE A;  5CLL B;  3SUZ A;  2CU1 A;  2P0D A;  5KHO A;  2JUO A;  2GBJ A;  2RD0 A;  3V5W A;  5IA7 A;  1BWN A;  1ZC4 B;  2DYO A;  5AZG A;  4B6W A;  2KK8 A;  3N3K B;  4IWP A;  3DOW A;  2CB8 A;  2MBE A;  3O96 A;  1J0W A;  3GYP A;  3ZNZ B;  3VFK A;  3BJI A;  1KM7 A;  5DPR A;  3WAO A;  2G45 B;  4H8S A;  2Z0D B;  5E6O A;  3BY4 B;  2MQJ A;  3PEG A;  3K9P B;  5DCN A;  2COP A;  4HXD A;  2RUK B;  1V81 A;  4MGZ E;  3NZU A;  2LD9 A;  1NTI A;  4N9F 4;  2K6D B;  1XT9 B;  2L1C A;  1GNU A;  1W1G A;  4WWN A;  4LCD E;  2MX2 A;  3DBS A;  2UVM A;  2DN6 A;  3VH4 B;  2AYO B;  2KVR A;  3MTN B;  1WGR A;  4E71 A;  2CY5 A;  4F1S A;  1WZ0 A;  5J2R A;  3KUZ A;  4EUT A;  3UGB B;  3NZS A;  2D07 B;  3VH3 B;  2DX1 A;  2BWF A;  3L16 A;  3M3J A;  2IYB A;  4NNJ B;  2AL3 A;  3B0A A;  1U4A A;  4K7W A;  2KCJ A;  1P9D U;  3HQC A;  2YSZ A;  1OEY J;  3ALB A;  4TKN A;  1UD7 A;  3QK0 A;  2YT1 A;  3L17 A;  4I6P A;  2ZVN A;  1OTR B;  2CY4 A;  3PTF C;  3L0W B;  3ML4 A;  2R2Q A;  4CO7 A;  3PZD A;  1WG7 A;  2DKP A;  5GOW B;  4DHJ B;  3DVG X;  5FI0 A;  4CHK A;  2DX5 A;  2BWE S;  4KHO A;  2KWU B;  4RM9 A;  1NVL A;  2MRP A;  2LRW A;  2N1V A;  1LQB A;  2AL6 A;  2KOX A;  3M95 A;  5JHG A;  1KOT A;  2LOZ A;  2NCN A;  2PE6 B;  4FN2 A;  1I42 A;  1UBI A;  1U5E A;  2HTH B;  1WGH A;  2N4F A;  1WGQ A;  3SYX A;  2ELB A;  4KIK A;  4KAX B;  3HIZ A;  2M8S A;  3O65 B;  2LUL A;  4BKS D;  3FP5 A;  4ZRI A;  1NTY A;  1OY2 A;  2O2V B;  5C23 A;  2HRJ A;  3H9D A;  3PRE A;  4HDO A;  5C6R A;  3AI5 A;  3A1Q B;  4KSL C;  1MPH A;  5LON B;  1WGG A;  2DHK A;  1BTK A;  4HK2 A;  1NDD A;  1XR0 B;  3KVF B;  2L0F A;  4HAV B;  2JZ3 B;  4FJZ A;  2KNB A;  5G55 A;  1P98 A;  2JPH A;  2H7D A;  2K00 A;  2KQS A;  4NQL B;  5LLI A;  2G3Q B;  4K17 A;  4M0W B;  4ANU A;  3B08 A;  1WVH A;  2N7E A;  2KJ6 A;  2PJH A;  4JIO U;  2N0Y A;  2OQB A;  3PT2 B;  2WDT B;  2BCJ A;  1HB6 A;  3ENE A;  2IZV B;  2LAS A;  4HWI B;  4ICV A;  2C60 A;  2LKO A;  4D0N B;  4GB9 A;  2C7M B;  5LXH A;  2LXA A;  3D8D A;  3VIA A;  1XCG A;  2KWC A;  4PYZ A;  5JHA A;  2PZ1 A;  3CMM B;  4FBJ B;  4MK0 A;  1D3Z A;  5KQ4 A;  3ZKJ C;  4W9G A;  1TGZ B;  2CR5 A;  3RUL A;  3JW0 X;  2KMA A;  2NR2 A;  3PRP B;  2G35 A;  1WR6 E;  2YS5 A;  4BVU C;  2D9Y A;  1Y5O A;  3CSF A;  4HAU B;  1X05 A;  1WE6 A;  2D9V A;  1FXT B;  2M17 A;  5L81 A;  2D9X A;  3W1S A;  1EUV B;  4YL8 A;  4WWO A;  2K8C A;  1V89 A;  4EZL A;  2WWZ A;  3RUI B;  2N7D A;  1WI1 A;  4J6I A;  3JSV B;  4TYZ A;  2Z0P A;  1U2B A;  2MLB A;  3P2B A;  2DZJ A;  5EFX A;  2KQ7 A;  4G0N B;  3IBE A;  2K6Q A;  1P3Q U;  1W1H A;  4DHZ B;  2KTR B;  1U5D A;  4XWX A;  1TTN A;  3F0W A;  4NJ7 A;  1AAR A;  1Q1O A;  3ZRC A;  2MW5 A;  2LGY A;  4EKU A;  2MSE D;  4HVB A;  3KZ1 A;  4HCP B;  3APF A;  3TFM A;  4KV2 A;  3MJW A;  4GU2 A;  2O6V D;  4II2 B;  2L00 B;  3EC8 A;  4IW0 A;  2ROV A;  3DXE A;  1U27 A;  2DKQ A;  4NQK E;  1LW3 A;  3UIP B;  1SGH A;  2Y8F A;  4EOY A;  4F7H A;  2FJL A;  2ZZP B;  5DPT A;  2HTH A;  2KWV B;  3PVW A;  2V3S A;  4II3 B;  4GPT B;  2Z59 B;  3WAM A;  4MSM B;  2QKL A;  4W9C A;  2KGX B;  3WA0 A;  1X86 A;  2DFK A;  2KFK B;  2O2V A;  2CAY A;  3RCP A;  3RCZ A;  2KZR A;  1KZ7 A;  2W2W A;  3VOQ A;  5EDS A;  3OAW A;  3APD A;  1RLF A;  4HAW B;  2LRU A;  3A1Q A;  1UNP A;  4HB4 B;  4W9I A;  3ZNH B;  5JP4 A;  4HB2 B;  1LFD A;  5JZE B;  2H7E A;  3X23 A;  4FAD A;  2EJ8 A;  4KZ0 A;  3ECI A;  1Q0W B;  1E5W A;  3NSU A;  2NBU A;  2LGX A;  3PG7 A;  2M14 A;  3GZN I;  2L05 A;  2VRR B;  2JRI B;  4BBK A;  2MWS B;  2D11 A;  5J3Q A;  2NPT B;  4A5K A;  4OVV A;  2GMI C;  4HAT B;  3P7Z A;  4KHA A;  2GCJ A;  2I5F A;  1EF5 A;  3A8Q A;  1GG3 A;  4A6K A;  2Z0Q A;  2LVO A;  2P8V A;  2JWZ A;  4FHJ A;  2Y8G A;  5AZH A;  2GJY A;  5JLJ B;  3QCA A;  2IYD B;  3HHM A;  2GOW A;  1WJN A;  2DTC A;  5D6J B;  3W1S C;  1XD3 B;  3AUL A;  4BFR A;  2N9E B;  5HE1 A;  3F5R A;  3DVN U;  1WJ6 A;  5E6P A;  4BOZ B;  1XD4 A;  1E8Z A;  4PS8 A;  3H1U A;  2W2X C;  1NTV A;  4G3X B;  1S1Q B;  5D3W A;  4ASW C;  1MAI A;  2L76 A;  2I5C A;  2DYM A;  2MDX A;  4OVU A;  5HKH A;  4M8M A;  1QQG A;  2HE7 A;  2R09 A;  1UH6 A;  3N30 A;  1PMS A;  2KD0 A;  3ODX A;  1J19 A;  2M38 A;  1UNR A;  3N32 A;  4HAY B;  1Z5S B;  2RVB B;  2ZCB A;  1UBQ A;  2GBK A;  1UEL A;  3JSV A;  3ZDM C;  1R4M I;  2BKR B;  1P6S A;  3A9J B;  4JL9 A;  3KUD B;  3HW2 B;  1YJ1 A;  2RLO A;  3WIM A;  4GSW A;  4HAX B;  3T06 A;  4FJV B;  2KTR A;  2KAN A;  4AUQ C;  3DBH I;  4EZJ A;  1IYF A;  1FHX A;  2UYZ B;  3DCG A;  1E8X A;  1DDV A;  5DHA B;  3OJ3 A;  1L2N A;  2ABD A;  2KJR A;  3VDZ A;  3U8Z A;  3VVW B;  1WH3 A;  1U5F A;  1KZG A;  1K5D B;  3WYF B;  1OGW A;  3R66 C;  4NJ6 A;  3FSS A;  3QBV B;  4F7G A;  3TVV A;  2OJR A;  2R0D A;  4K7U A;  2WX0 A;  3V61 A;  1YIW A;  1JRU A;  4URK A;  5KQ1 A;  3A4S C;  5JHH A;  2KDB A;  2DEN B;  5FR6 A;  2K25 A;  1QZE A;  2DZI A;  1Z87 A;  2COA A;  3TBL D;  4IM0 A;  1WJ4 A;  3ZTC A;  1X1G A;  4HJK A;  1ZC3 B;  1V9J A;  2RPQ A;  4PS7 A;  2QHO A;  2G4S A;  1WE7 A;  1WIA A;  2KFK A;  4Z2M B;  1V5M A;  4PNK A;  3T8M A;  3KW5 B;  4NPN A;  2FCN A;  4IAP A;  1YX5 B;  5AZF A;  4FA6 A;  1WJ1 A;  1RRB A;  3TJP A;  2YVC A;  1OQN A;  3V6E B;  2FUH B;  2J0J A;  4M8N A;  1Z2M A;  3MHS D;  1X1F A;  3VTW A;  2DHJ A;  4C0A A;  3QA8 A;  1EGX A;  4LDT B;  2PEA A;  3IHP C;  2J0M A;  3AXC A;  3D32 A;  3JYU A;  4ANW A;  1V86 A;  2LVP A;  1S3S G;  4HHV A;  1UPR A;  4ZRJ A;  3P6A A;  2NPT A;  4ZYN A;  2Z0O A;  2COF A;  3ZVV A;  1NU2 A;  5AEK B;  4HAZ B;  1RFA A;  3VUW A;  3ODO A;  5DHF B;  4MEL A;  4MEM A;  4IFS A;  2MWN B;  4PS3 A;  4TQ1 A;  2BKF A;  3H6N A;  5CX3 A;  2LI5 A;  4A3P A;  1VCB A;  1PFJ A;  5J3Y A;  3CF6 E;  2KUP A;  1DRO A;  4MH0 E;  4EZK A;  1ACA A;  4WSF A;  1IRS A;  3ML8 A;  2GS0 A;  3WAN A;  2YS3 A;  3SHQ A;  5GMV A;  4TUU A;  3PPA A;  2A4Z A;  2M0X A;  4KSK C;  2DAJ A;  1T0Y A;  2KN5 A;  2ZNV B;  2YS1 A;  2N9P C;  2KJH B;  2UWQ A;  4W9D A;  5HE3 A;  1KLV A;  1AQC A;  4JQW C;  1WFY A;  1WX9 A;  4GDL B;  1WI0 A;  2FJ9 A;  1WM2 A;  3ULB A;  2CHX A;  3A9J A;  3MDB C;  3TIX A;  4KHB B;  5L95 C;  1U5G A;  4G11 A;  4K81 A;  4K7S A;  4BBN F;  2IO2 B;  3VQI A;  4A20 A;  1YQB A;  3H7P B;  4LJO B;  4GGQ A;  4NAW B;  1H4R A;  1LB1 A;  2Y7B A;  3EEC A;  2RNR B;  1HE8 A;  2FNJ B;  2KO3 A;  1TJ6 A;  5JH5 C;  1EO6 A;  4WQO B;  1WYW B;  2XK5 B;  1XQQ A;  3R7R A;  3EPY A;  4AOF A;  3NY5 A;  3LJU X;  4GDK B;  3TW1 A;  2FCM A;  2LXC A;  2NZ8 B;  3N7C A;  3OLM D;  2DLW A;  4K2P A;  4IG7 B;  4BKT A;  1WGU A;  4IWO A;  2VRW B;  1UGM A;  3U30 A;  4AWJ A;  1A5R A;  1BT0 A;  1GC6 A;  2G4D B;  2JP2 A;  4PYU A;  4IOY X;  5LXI B;  4DHJ D;  2R2O A;  3A98 B;  3VAW A;  1WM3 A;  1H10 A;  1HBK A;  3V62 A;  2NBV B;  2J0K A;  4DX9 0;  3SU8 X;  1TXD A;  3KSY A;  3QJZ A;  2Z0E B;  1SHC A;  1FGZ A;  5G2N A;  1WXV A;  4IC7 B;  4ZRK A;  2QKM A;  2JRH A;  2KX0 A;  2DHZ A;  1WR1 A;  2YT0 A;  4W9K A;  2O6V A;  2ADZ A;  2I1K A;  2OTX A;  4F7U P;  1MIZ B;  2KHW B;  2BF8 B;  2LGD A;  5KHQ A;  4W9L A;  2EKE C;  2Y5B B;  4CHM A;  3PS6 A;  3ONS A;  2NS5 A;  3ZLZ A;  4NSW A;  1EF1 A;  4TQ0 A;  2MBB B;  2LVQ A;  2HJ8 A;  3ZRF A;  3CIK A;  1X1M A;  3I3T B;  2ASQ A;  4DHZ E;  3ZTD A;  3DVN V;  4FJY A;  3PSE B;  4AJW A;  3L08 A;  3LJ3 A;  2M1M A;  4WJN A;  3DQV A;  3M1I B;  2YF0 A;  4HB0 B;  1ZGU B;  2P0H A;  3DBR I;  2V76 A;  3DVG Y;  5JHB A;  3PLU A;  4DDG D;  2ZPY A;  1DDM A;  1V5O A;  1FHO A;  2LG1 A;  1FAO A;  3D8E A;  4DDI D;  3G9W A;  4HLE A;  3HK0 A;  2NBW B;  2K2U A;  2FIF A;  4MGI E;  1FGY A;  1BAK A;  2LBB A;  2BPS A;  3EFU A;  4MDK E;  5HE0 A;  1NI2 A;  1VD2 A;  3FEH A;  2KTF A;  4F8C B;  2L7R A;  1LXD A;  3DBL I;  1WMH A;  3QIJ A;  3GOE A;  2EMT A;  3D8F A;  1U29 A;  3SNH A;  4GDL A;  3KYD D;  2N23 A;  3PGE A;  4DK5 A;  2FDQ A;  1GUA B;  4FUL A;  1DBH A;  3PVU A;  3RZW C;  1UNQ A;  1I2H A;  3KH0 A;  4BKG A;  2V4L A;  1G6J A;  4W9J A;  4HCN B;  2DZM A;  2EMS A;  3H7P A;  1V49 A;  1DYN A;  2RGF A;  4NAW A;  1M7R A;  2MCN B;  4ANV A;  3KUC B;  3SV1 A;  3C0R B;  2CS4 A;  2K39 A;  5IJM A;  3UZT A;  4CHJ A;  2K8H A;  1P1A A;  3AU4 A;  3IG3 A;  4WWP A;  1J8C A;  4WVF B;  1WJM A;  1IP9 A;  1R4N I;  1V61 A;  2COD A;  3HM6 X;  5CHF A;  4XX5 A;  1LM8 B;  2RGN B;  3PSC A;  1E8W A;  2ZEQ A;  1V5T A;  1V80 A;  4XZ4 A;  1K8R B;  2NMB A;  1H8C A;  2XK5 A;  3GYO A;  2KC2 A;  2E2X A;  4EFO A;  3K9O B;  5C16 A;  1Q67 A;  2L3Z A;  2YRY A;  4MGK E;  3R3M A;  3QAQ A;  4W9E A;  4BBN C;  2CQU A;  2GBR A;  3NHE B;  4GDK A;  1NBF C;  4DBB A;  1GJZ A;  4DXA B;  5D3V A;  2BYF A;  2IO0 B;  1Y19 B;  2N9X A;  1ISN A;  1UPQ A;  4A6F B;  2W9N A;  3PLV A;  2V1Y A;  4A3O A;  3KYC D;  3BIN A;  3DXC A;  5DI9 B;  3RZF A;  4HPM B;  3RYT A;  3HM3 A;  1FHW A;  2JVC A;  2KDI A;  4F7Z A;  4I6L B;  2I1J A;  3QQ8 B;  3DDC B;  2KMC A;  3QHT A;  1UEF A;  2MA9 B;  1XX0 A;  5LOP B;  2MFQ A;  3ZNI D;  1WGD A;  4HDQ A;  1WXM A;  2JT4 B;  2KX3 A;  1WY8 A;  2WX1 A;  3UQB A;  1AWE A;  2MBO A;  3IFW B;  3PV1 A;  3EHV A;  5CLQ B;  1FOE A;  4RM8 A;  5D27 A;  1E7V A;  3L54 A;  4B95 A;  1V2Y A;  4MSQ B;  3VTU A;  2C9W B;  1YD8 U;  2MKR A;  4MT7 A;  2AEH A;  5D2M B;  4MJS B;  5D3X A;  2CHW A;  4ZDV A;  3UIN B;  2J59 M;  1OQY A;  2PPH A;  2KLG A;  4GZU A;  1WX7 A;  3TMP B;  4ANX A;  2YLM A;  2EC1 A;  3DXD A;  1F9J A;  1SE9 A;  1MK9 B;  4XC2 A;  3VUX A;  4EJN A;  3OAN A;  1M94 A;  1SIF A;  4FLH A;  3SD5 A;  3LDZ E;  3H7S A;  5DPS A;  2ZNV C;  4W9F A;  2XQN M;  2DZK A;  1YX6 B;  5C1Z A;  2VKI A;  4DWF A;  3ODW A;  2C7N B;  2N1W A;  3QWM A;  1TQZ A;  3A9K B;  1GC7 A;  1ST7 A;  3VHT C;  1FB8 A;  3B1L X;  2O6V B;  2IY1 B;  1P0R A;  3WAP A;  1V6E A;  1UZX B;  2NVU I;  4L6E A;  3PRZ A;  3QWZ B;  4Z2N A;  2WH5 A;  1WJU A;  3IVF A;  2DYQ A;  2K2J A;  5C5B B;  1Q5W B;  1W1D A;  2RSU A;  1V88 A;  1ZSQ A;  4DBG A;  5D3Y A;  2D2Q A;  1ZVR A;  4HB3 B;  2MP2 B;  3Q3F A;  3VXW A;  3UQA A;  2UZR A;  3MPX A;  4BKS A;  4MM3 A;  4P7I A;  1KJT A;  2DYB A;  4A6H A;  2LWP A;  4BOS C;  1BTN A;  1EAZ A;  4GOC A;  3AJ4 A;  1WGY A;  3TCA A;  4KDI C;  2FID A;  1P3R A;  2IO3 B;  3V6C B;  1E8Y A;  3APC A;  5J18 A;  2ZVO A;  4X57 B;  4DX8 A;  5D7G A;  2RQ1 A;  2IFS A;  2GCL A;  3UIO B;  2M4N A;  1MKE A;  1K5G B;  1I7A A;  5CHW A;  1WMH B;  4GIV A;  3PHX B;  2MBH A;  4IM3 A;  2FCQ A;  2IY0 B;  2ZCC A;  5TR5 A;  2K8B A;  2DHI A;  1WZ3 A;  2LOX A;  1IPG A;  3T9L A;  4MGY E;  2JF5 A;  3TO1 A;  2COC A;  4A6F A;  5IAA C;  2ROZ B;  3PRM B;  1E7U A;  3JVZ X;  1RRP B;  3QC8 B;  2PE9 A;  2KDE B;  2KFJ A;  3ZIM A;  3PHW B;  5CHV C;  2BYE A;  2L0T A;  1CMX B;  4GMV A;  5D94 A;  2L2I A;  4JLC A;  2K1F A;  4JGH B;  4W9H A;  1V5P A;  1V5U A;  2XBB C;  3M62 B;  2FAZ A;  2W2X D;  3A8P A;  1PQS A;  3OJ4 B;  1B55 A;  4AJY B;  3M63 B;  1L7Y A;  5DIF B;  5C79 A;  3ZNG C;  3R7Q A;  1QC6 A;  2A5U A;  4I6N B;  3ZO5 B;  4MJS A;  3X0W A;  4EMO A;  2FCS A;  5J3T A;  3WAL A;  1XOD A;  2DA0 A;  4K2O A;  3ZW3 A;  2JXX A;  2ZJD A;  4AP4 C;  1HB8 A;  3NS8 A;  2KDF B;  2OOB B;  1ZKH A;  2DAF A;  3FLV A;  3A33 B;  4WJO A;  4WJQ A;  1XKE A;  1TBE A;  4B6H A;  2D4Q A;  3QAR A;  4CYE A;  4LDT D;  3DPD A;  3ZUN A;  3ZDT A;  1Y8R C;  4WAA A;  1EVH A;  1J0G A;  2UZS A;  4E3C A;  2JY6 A;  2ZPN A;  4KZC A;  3L10 B;  4RMA A;  3RT3 B;  2D9W A;  4IUM B;  2D3G A;  5DH9 B;  4NY0 A;  5CTR C;  4KDL B;  3A9K A;  1RJ2 A;  2X18 A;  4PQ0 A;  1E90 A;  3W1Y A;  3KRW A;  3SO6 A;  2GBN A;  2L8J A;  2B3A A;  3UF8 A;  4GN1 A; 
#chains in the Genus database with same CATH topology
 2GB1 A;  1SEB D;  1ZM0 A;  2CHZ A;  3CXB B;  3J9C A;  4MT5 A;  3AU5 A;  3Q8C A;  2KKC A;  1ET6 A;  4K1R B;  5C5B A;  3ULC A;  3RFZ B;  1EU3 A;  2HDE A;  4IWQ A;  4PT5 A;  4YON A;  2D3B A;  2Y5P A;  1NEK B;  3AV8 A;  1WSP A;  2JZZ A;  5BO4 B;  1YQ3 B;  2MP2 A;  5DPW A;  3P4P B;  3RI7 C;  2D10 A;  1HXY D;  1QF6 A;  2AQ1 B;  2IGG A;  1JWS D;  4EEW A;  2VSZ A;  2NTS A;  2V9H A;  1VLB A;  1F77 A;  2C7H A;  4G50 A;  1WXA A;  1KI1 B;  3CST A;  2MEK A;  5J17 A;  1ZW7 A;  5L83 A;  4ICU A;  1C3T A;  3A4R A;  1WRD B;  3E66 A;  2LZ6 A;  2REX A;  4GXB A;  1WXS A;  3RD2 A;  2ACZ B;  4TV3 A;  2ELA A;  4Y94 A;  2KLC A;  4FHK A;  1MK7 B;  2DX5 B;  5HE2 A;  2IO1 B;  1OMW A;  3AE5 B;  4A9A A;  4KVG B;  4ACF A;  2BGF A;  1ZP0 B;  2JYE A;  2DYN A;  1TZ1 A;  2HD5 B;  1DOY A;  4GMX B;  4WJ7 A;  1UNS A;  1WX8 A;  2KXJ A;  3S2A A;  3NUH B;  2W3S A;  3PVL A;  1PGB A;  2RR9 A;  2XN9 C;  2LGS A;  4B0E A;  2Q13 A;  4E74 A;  3KRX A;  2IBI B;  2XEW A;  1OEY A;  1WF9 A;  4KIK B;  1C1Y B;  3NOB A;  1DDW A;  2QC8 A;  1PLS A;  3PP2 A;  2CRF A;  2WXL A;  4P1C C;  4WWM A;  1DIK A;  2LYD A;  3U7D A;  3QX1 A;  2WXH A;  2C5L C;  2CKH B;  2JX5 A;  1KC7 A;  2D9Z A;  4YSY B;  5E6N A;  4B9K A;  4USA A;  1E10 A;  1PFD A;  2KT7 A;  3VUY A;  1MIX A;  2KC1 A;  4WJP A;  3ZVR A;  1OQR A;  3NVZ A;  2Y5C A;  1X11 A;  2GBM A;  2WGS A;  3FM8 C;  1M7E A;  1P5T A;  3L13 A;  2BYV E;  2RSG A;  2WYQ A;  1RYJ A;  3V60 A;  5FI1 A;  1N3H A;  3SDL C;  2MBQ A;  3BK1 A;  2WDQ B;  4DXG A;  4L1B A;  1XXG A;  3KY9 A;  3AEB B;  1F2R C;  2LJ5 A;  4MY6 A;  4LJP B;  3TL5 A;  1TKY A;  1RAX A;  1MG8 A;  3VTV A;  3ML9 A;  3Q3J A;  4OW0 A;  1I35 A;  4HPL B;  2JYT A;  4IM2 A;  2P0F A;  4JKG B;  1KLU D;  5KCV A;  2AWT A;  2J7Q B;  2LUE A;  1V8C A;  5CLL B;  3SUZ A;  2CU1 A;  2P0D A;  5KHO A;  2JUO A;  2GBJ A;  1FFV A;  2RD0 A;  3V5W A;  2I38 A;  5IA7 A;  1BWN A;  1ZC4 B;  2DYO A;  5AZG A;  3SBT A;  2KK8 A;  4B6W A;  3N3K B;  4IWP A;  3DOW A;  2CB8 A;  2MBE A;  3O96 A;  1J0W A;  3GYP A;  1TKE A;  3ZNZ B;  2I2Y A;  3VFK A;  3BJI A;  1KM7 A;  5DPR A;  3WAO A;  2G45 B;  4H8S A;  4JPS A;  2Z0D B;  4WH4 A;  5E6O A;  3BY4 B;  2MQJ A;  3PEG A;  4QAY A;  3K9P B;  5DCN A;  2COP A;  4HXD A;  3MC0 B;  4H2A A;  2RUK B;  3NVW A;  1V81 A;  2HTM E;  4KGS A;  4MGZ E;  3NZU A;  2WXK A;  2LD9 A;  1NTI A;  4N9F 4;  2K6D B;  1XT9 B;  2L1C A;  1QOF A;  1GNU A;  1LO5 D;  4ZYS A;  4GLS C;  3U7Z A;  1W1G A;  4WWN A;  2WDV B;  5LNK 1;  4AQ7 A;  1I4H A;  1MVK A;  4LCD E;  2MX2 A;  1YMH E;  2UVM A;  3E9L A;  3DBS A;  2PKO A;  4P6V F;  3TEX A;  2DN6 A;  3VH4 B;  2AYO B;  1ZDV A;  1MHH E;  2KVR A;  3I9V 1;  3MTN B;  1WGR A;  2BB5 A;  3CWI A;  1SF0 A;  4E71 A;  1QOG A;  2ZW0 A;  4YSZ B;  5MPO A;  2CY5 A;  3KWL A;  4F1S A;  1HZ6 A;  1ZE3 D;  1WZ0 A;  5J2R A;  3KUZ A;  1D5X C;  4EUT A;  3UGB B;  4OZB A;  3AEG B;  3NZS A;  1FNV A;  2D07 B;  3VH3 B;  2DX1 A;  2W54 A;  2BWF A;  3L16 A;  2Z59 A;  3M3J A;  4MAC A;  3SEB A;  2IYB A;  4NNJ B;  1XEE A;  2AL3 A;  1FCL A;  3B0A A;  2BT6 A;  1U4A A;  4K7W A;  2KCJ A;  1P9D U;  3HQC A;  2KAC A;  1C4C A;  2PVO D;  2YSZ A;  1OEY J;  3ALB A;  4TKN A;  2V0G A;  3NG0 A;  5C2T B;  2AQ2 B;  4US8 A;  1UD7 A;  3SR6 A;  3QK0 A;  2YT1 A;  3L17 A;  4I6P A;  2ZVN A;  1OTR B;  3RNG C;  2CY4 A;  5E6J A;  4HJG E;  5BMH A;  3PTF C;  3L0W B;  4D2K A;  3ML4 A;  2R2Q A;  4CO7 A;  1IBX B;  3PZD A;  3E9P A;  1WG7 A;  2DKP A;  5GOW B;  2LHE A;  4DHJ B;  3DVG X;  5FI0 A;  4CHK A;  2DX5 A;  2BWE S;  4KHO A;  2KWU B;  4RM9 A;  2PW9 A;  2W82 A;  1NVL A;  2MRP A;  4A90 A;  2LRW A;  2N1V A;  1LQB A;  3IAM 1;  2AL6 A;  2KOX A;  3M95 A;  5JHG A;  1KOT A;  2LOZ A;  2NCN A;  2PE6 B;  4FN2 A;  3Q14 C;  5FR3 A;  3E9O A;  1I42 A;  1UBI A;  3N1Y C;  1U5E A;  1XF5 L;  2HTH B;  4LTU A;  1WGH A;  4RGT A;  3MFG A;  2N4F A;  1WGQ A;  3SYX A;  2ELB A;  2JWU A;  2PTL A;  4KIK A;  1TS2 A;  1JAL A;  4KAX B;  3HIZ A;  2M8S A;  3O65 B;  2WLB A;  3E56 A;  2LUL A;  1T5X D;  4Q2J A;  4BKS D;  3FP5 A;  1K50 A;  4ZRI A;  1NTY A;  1OY2 A;  2O2V B;  5C23 A;  3IAS 1;  2HRJ A;  3H9D A;  3NWD A;  3PRE A;  4RGO S;  2QIE B;  4OHJ A;  4HDO A;  4YXD B;  5C6R A;  3AI5 A;  2WS3 B;  3A1Q B;  5HFY A;  4KSL C;  1MPH A;  3DWM A;  5LON B;  1WGG A;  3NWF A;  4JK8 A;  1IUE A;  4N58 A;  2DHK A;  4ARC A;  1BTK A;  4HK2 A;  1NDD A;  1XR0 B;  4M00 A;  3KVF B;  2L0F A;  4HAV B;  2JZ3 B;  4JKD A;  2IND C;  2KNB A;  4FJZ A;  3AED B;  5G55 A;  1FNU A;  5BYQ A;  4WUR A;  1P98 A;  1NEN B;  1SE3 A;  1MPE A;  2JPH A;  2H7D A;  2K00 A;  3W9C B;  4OVZ A;  2KQS A;  4NQL B;  5LLI A;  2G3Q B;  4K17 A;  4M0W B;  4ANU A;  3B08 A;  3DWG C;  1B9R A;  1L0X B;  4LNO A;  2Z4D A;  4JKG A;  1WVH A;  2N7E A;  2KJ6 A;  2WHI A;  2PJH A;  4JIO U;  2N0Y A;  2OQB A;  3PT2 B;  2WDT B;  2BCJ A;  1HB6 A;  1ZXH A;  3ENE A;  1HTQ A;  2IZV B;  2LAS A;  1GB4 A;  4HWI B;  1P7F A;  1N5W A;  4ICV A;  3GZN B;  1K53 A;  3KQ4 A;  2C60 A;  2LKO A;  4D0N B;  4GB9 A;  4P16 A;  2C7M B;  5LXH A;  1L4Z B;  2LXA A;  3D8D A;  3LYY A;  2XNA C;  2D3C A;  3VIA A;  3GE8 C;  1XCG A;  4M01 A;  2KWC A;  1HQR D;  4PYZ A;  5JHA A;  2PZ1 A;  5AUI A;  3CMM B;  4FBJ B;  4MK0 A;  3P42 A;  1D3Z A;  5KQ4 A;  1D5M C;  1GB1 A;  3ZKJ C;  2X38 A;  4W9G A;  1F2R I;  1TGZ B;  1PDX A;  2GUM A;  1PGX A;  2CR5 A;  3RUL A;  3JW0 X;  2KMA A;  4IDI A;  2NR2 A;  2DLB A;  3PRP B;  2G35 A;  1WR6 E;  2YS5 A;  2INC C;  2D9Y A;  3ZXV A;  4BVU C;  1FMA D;  2RDG A;  1Y5O A;  2WXM A;  3AE6 B;  3CSF A;  1C79 A;  4RGM A;  4HAU B;  1V1O A;  2BS4 B;  1X05 A;  1JRO A;  2R82 A;  1WE6 A;  2D9V A;  2WXQ A;  1FXT B;  3ETR A;  1JWB D;  2M17 A;  1QLB B;  5L81 A;  2D9X A;  1E0Z A;  3W1S A;  4OZA A;  2V3N A;  1EUV B;  4KKJ A;  4YL8 A;  3TUO A;  4WWO A;  2RRF A;  1DGJ A;  1CQV A;  1HEZ E;  3ABV B;  2K8C A;  3EUB 2;  1V89 A;  1AWD A;  4EZL A;  2WWZ A;  3RUI B;  2N7D A;  3TEZ A;  1WI1 A;  4J6I A;  3JSV B;  2IGD A;  4TYZ A;  2Z0P A;  1U2B A;  2MLB A;  3Q3M C;  3P2B A;  4S0R A;  2DZJ A;  5EFX A;  2KQ7 A;  4G0N B;  3IBE A;  1FRR A;  2K6Q A;  1P3Q U;  1W1H A;  4DHZ B;  2KTR B;  3Q2A C;  2J53 A;  1MJD A;  3IT4 B;  1U5D A;  2ON8 A;  4XWX A;  1TTN A;  3AEE B;  5IRS A;  3F0W A;  2QMT A;  1ZUD 2;  4NJ7 A;  1AAR A;  5FKA C;  3EGR A;  3Q8F A;  1Q1O A;  3GS2 A;  3ZRC A;  1TYG B;  1T77 A;  2MW5 A;  1VZ8 A;  1R4M B;  2LGY A;  4JKH A;  4EKU A;  2MSE D;  4HVB A;  3KZ1 A;  4IKG A;  4ZRP A;  3AMZ A;  4HCP B;  3APF A;  3TFM A;  2MJD A;  4KV2 A;  3MJW A;  4GU2 A;  2O6V D;  4JX1 C;  1SXT A;  4II2 B;  2L00 B;  3EC8 A;  4IW0 A;  2ROV A;  3DXE A;  1U27 A;  1IGD A;  3DBH B;  2DKQ A;  4NQK E;  1LW3 A;  4KGR A;  3UIP B;  1SGH A;  2ONQ A;  1FCC C;  2Y8F A;  4YSX B;  4EOY A;  3RNA C;  3R8B A;  4F7H A;  1CJE A;  2FJL A;  2EEL A;  2ZZP B;  2KUQ A;  3NS1 A;  5IP4 D;  3RPF C;  1BML C;  5DPT A;  2HTH A;  1UWX A;  2D5G A;  2KWV B;  1KRH A;  3PVW A;  2V3S A;  4II3 B;  1KTK A;  4GPT B;  1YQ4 B;  2Z59 B;  3WAM A;  4MSM B;  2QKL A;  2EKI A;  4W9C A;  2WXI A;  2UU7 A;  2KGX B;  3WA0 A;  1X86 A;  2FE8 A;  2DFK A;  2KFK B;  2O2V A;  2CAY A;  1JQ4 A;  3RCP A;  3RCZ A;  2KZR A;  3N1X C;  1KZ7 A;  3Q3O C;  2W2W A;  3VOQ A;  5EDS A;  4YT0 B;  1J7C A;  3HIE A;  1EWC A;  1ZYI A;  3OAW A;  3APD A;  1RLF A;  4HAW B;  2LRU A;  3WCQ A;  3A1Q A;  2WXG A;  4ARI A;  3B77 A;  1UNP A;  4HB4 B;  4RCO A;  4W9I A;  5G5G A;  3ZNH B;  5JP4 A;  4HB2 B;  1LFD A;  2KR0 A;  1JML A;  2CJN A;  5JZE B;  1T0Q C;  2H7E A;  3X23 A;  4FAD A;  2EJ8 A;  4KZ0 A;  3ECI A;  3HVD A;  1Q0W B;  1E5W A;  3NSU A;  1L6U A;  2NBU A;  2LGX A;  3PG7 A;  3B2F A;  1L5P A;  2M14 A;  2YEP B;  3GZN I;  1C9F A;  1ESF A;  2L05 A;  2VRR B;  2JRI B;  4BBK A;  3T3N A;  2GRI A;  3FIL B;  5M4Y B;  1XO3 A;  2MWS B;  2D11 A;  5J3Q A;  2E6X A;  2WQY B;  1Y56 A;  4M0W A;  2NPT B;  1C78 A;  4A5K A;  3NW8 A;  5C3J B;  4OVV A;  2GMI C;  5D3D A;  4HAT B;  3P7Z A;  4KHA A;  2GCJ A;  2I5F A;  5HHD G;  1EF5 A;  3BVG A;  3A8Q A;  1GG3 A;  4TMA B;  5HI1 A;  4A6K A;  2Z0Q A;  1I4R A;  2LVO A;  2KYW A;  1N60 A;  4ZOH C;  1AN8 A;  4NJC A;  3U12 A;  2P8V A;  3RNF C;  3PO0 A;  2JWZ A;  4FHJ A;  2Y8G A;  5AZH A;  1BXT A;  2GJY A;  5H92 C;  5JLJ B;  3QCA A;  2IYD B;  3HHM A;  2GOW A;  1WJN A;  2LGI A;  2IGH A;  1JRP A;  2DTC A;  2VZK D;  5D6J B;  3W1S C;  3I63 C;  1N5X A;  1JDE A;  1XD3 B;  3AUL A;  1JW9 D;  4BFR A;  2H88 B;  2N9E B;  5HE1 A;  1TT5 B;  3RNB C;  3F5R A;  3DVN U;  4RF0 A;  4UDU C;  1WJ6 A;  5E6P A;  3VR8 B;  1C4P A;  4BOZ B;  1F0Z A;  3MC9 A;  1XD4 A;  1E8Z A;  4PS8 A;  4XWT A;  3H1U A;  3FVC A;  2IPK D;  2W2X C;  1KBL A;  1NTV A;  1WYG A;  4G3X B;  1S1Q B;  5D3W A;  1TJE A;  4ASW C;  1MAI A;  4JWU C;  2L76 A;  2I5C A;  3PZ7 A;  2DYM A;  2MDX A;  4OVU A;  5HKH A;  4M8M A;  1VBH A;  1QQG A;  2AX5 A;  2HE7 A;  2R09 A;  1UH6 A;  2MJ3 A;  3N30 A;  5BMG A;  1PMS A;  2KD0 A;  3ODX A;  1J19 A;  2M38 A;  1NI3 A;  1UNR A;  3N32 A;  4HAY B;  1Z5S B;  2RVB B;  2K8E A;  2ZCB A;  4CSQ A;  1UBQ A;  2GBK A;  1UEL A;  3JSV A;  3ZDM C;  1R4M I;  2BKR B;  1P6S A;  4YTM B;  3A9J B;  4JL9 A;  3KUD B;  1MHX A;  3HW2 B;  2JU6 X;  1J7B A;  1YJ1 A;  2RLO A;  3WIM A;  4C4V A;  4GSW A;  4HAX B;  1VBG A;  3E9S A;  3T06 A;  1JWA D;  4FJV B;  4JKC A;  2KTR A;  4YTN B;  2KAN A;  4AUQ C;  3ZXR A;  3DBH I;  4EZJ A;  1IYF A;  1FHX A;  1SJH D;  2BS2 B;  2UYZ B;  3DCG A;  1E8X A;  1DDV A;  5DHA B;  3OJ3 A;  1L2N A;  2ABD A;  4L1R A;  2KJR A;  3VDZ A;  3U8Z A;  4HRS A;  3VVW B;  1WH3 A;  1U5F A;  4NAM A;  5D3I B;  1KZG A;  1YJI A;  1UWM A;  1I4Q A;  1K5D B;  1CK1 A;  3WYF B;  1OGW A;  3R66 C;  2M0A A;  2PMV A;  1KLG D;  3AM9 A;  4NJ6 A;  1TS5 A;  1YJJ A;  1FIQ A;  3FAH A;  2YEP F;  3MP9 A;  3FSS A;  1TY2 A;  1IGC A;  3QBV B;  4F7G A;  3TVV A;  2OJR A;  3PZ8 A;  2R0D A;  4K7U A;  1K51 A;  2WX0 A;  3V61 A;  4R3D A;  2V3P A;  1YIW A;  3N1Z C;  4REZ A;  2Z13 A;  1JRU A;  1UUP A;  4URK A;  5KQ1 A;  3P4S B;  2K22 A;  3A4S C;  5JHH A;  2KDB A;  2DEN B;  1L0V B;  3OWE B;  5FR6 A;  3UI3 A;  2K25 A;  1QZE A;  2DZI A;  4K3C A;  1Z87 A;  2COA A;  2WU5 B;  3TBL D;  4IM0 A;  1WJ4 A;  3ZTC A;  1X1G A;  1XCQ L;  4HJK A;  1ZC3 B;  2WNM A;  1PYW D;  1V9J A;  2RPQ A;  3AEA B;  4PS7 A;  4DQO C;  2QHO A;  2KVZ A;  2G4S A;  1WE7 A;  1WIA A;  2KFK A;  4Z2M B;  4O1N A;  1V5M A;  4PNK A;  3AN1 A;  3T8M A;  3KW5 B;  4NPN A;  4JK9 A;  2FCN A;  4HRO A;  4IAP A;  1YX5 B;  3NRZ A;  5AZF A;  4FA6 A;  1WJ1 A;  4HSI A;  1L4D B;  4K3B A;  1RRB A;  2GI9 A;  5IKC M;  4KGT A;  3TJP A;  1MI0 A;  2K9X A;  2YVC A;  1OQN A;  4XGA B;  3V6E B;  2FUH B;  2J0J A;  4M8N A;  1Z2M A;  2WP9 B;  3MHS D;  3NVY A;  1X1F A;  3VTW A;  2DHJ A;  4C0A A;  3QA8 A;  1EGX A;  1GAQ B;  4LDT B;  2PEA A;  4XWW A;  3Q6B A;  3IHP C;  2J0M A;  2QDF A;  4NZL B;  3AXC A;  3D32 A;  3FIL A;  3JYU A;  4ANW A;  1D4B A;  1V86 A;  2LVP A;  4XYC A;  1S3S G;  3AE4 B;  4HHV A;  1UPR A;  4ZRJ A;  3P6A A;  2NPT A;  4ZYN A;  2Z0O A;  2COF A;  3ZVV A;  1WRI A;  2JZP A;  1HTO A;  1AYF A;  1NU2 A;  5AEK B;  4HAZ B;  1RFA A;  2K5P A;  2LJI A;  3VUW A;  2ZW1 A;  2DBY A;  4JKB A;  3ODO A;  5DHF B;  5I2M A;  4MEL A;  2V4I B;  4US9 A;  3W2D A;  4HEA 1;  4MEM A;  1PUT A;  4IFS A;  2MWN B;  4PS3 A;  3IXS A;  4TQ1 A;  1MG4 A;  5IOI A;  2BKF A;  1N61 A;  3H6N A;  5CX3 A;  2LI5 A;  3AE9 B;  5EE3 A;  4A3P A;  5BYS A;  2BTE A;  4LK0 M;  1K52 A;  1VCB A;  1YN4 A;  1PFJ A;  5J3Y A;  3CF6 E;  2KUP A;  1DRO A;  4MH0 E;  4EZK A;  2KWD A;  2BYT A;  1ACA A;  4WSF A;  1IRS A;  1XLQ A;  4DIX A;  1EU4 A;  5TSS A;  1HA5 A;  3ML8 A;  2MJE A;  1TKG A;  2GS0 A;  3WAN A;  2YS3 A;  3SHQ A;  3AEC B;  5GMV A;  2FUG 1;  3A58 A;  4TUU A;  4C56 C;  3PPA A;  3NZ3 A;  1NYR A;  1KF6 B;  2A4Z A;  2M0X A;  4KSK C;  3P4R B;  2DAJ A;  1T0Y A;  2KN5 A;  1I4P A;  4DXF A;  2B76 B;  2ZNV B;  2YS1 A;  3HVZ A;  3NVV A;  1I4X A;  2N9P C;  3DBR B;  1ZOY B;  2KJH B;  2UWQ A;  1XLP A;  3SFD B;  4W9D A;  5HE3 A;  1KLV A;  1AQC A;  2BW2 A;  4JQW C;  1WFY A;  1VRA B;  1WX9 A;  2R61 A;  4GDL B;  1WI0 A;  2FJ9 A;  1WM2 A;  3ULB A;  2CHX A;  3A9J A;  3MDB C;  2CJO A;  1D5Z C;  2WDR B;  3TIX A;  5G5H A;  4KHB B;  2KQ4 X;  1XCT L;  2WXP A;  5L95 C;  1U5G A;  4G11 A;  1FXI A;  4K81 A;  4K7S A;  4BBN F;  4ILG B;  2IO2 B;  3VQI A;  2N9L A;  2IDY A;  4A20 A;  1YQB A;  1JCK B;  3H7P B;  3GP7 A;  1N62 A;  3DHI C;  1SB3 C;  4LJO B;  2DIK A;  4GGQ A;  4LNK A;  3DBL B;  4NAW B;  1H4R A;  1LB1 A;  2RDH A;  2Y7B A;  2W55 A;  3EEC A;  1YNT E;  2E3T A;  2WXO A;  2H89 B;  2RNR B;  1J7A A;  1I4G A;  1HE8 A;  2YT2 A;  4PK1 A;  2FNJ B;  2Q5W D;  2LUM A;  2KO3 A;  1FNW A;  3C8Y A;  5IO9 A;  1TJ6 A;  3R2I A;  1N63 A;  3Q8B A;  5JH5 C;  4S17 A;  1EO6 A;  1B1Z A;  4M02 A;  4WQO B;  4RNA A;  1WYW B;  2XK5 B;  1XQQ A;  3L4P A;  3R7R A;  2JXT A;  5AUK A;  4J3O D;  1SBB B;  3R2T A;  1UF0 A;  3EPY A;  4AOF A;  5LG4 B;  3NY5 A;  4WIP A;  1GOZ A;  3LJU X;  4GDK B;  3TW1 A;  1WWT A;  4WQM A;  2FCM A;  2VH2 A;  3GB1 A;  2LXC A;  2NZ8 B;  3N7C A;  3OLM D;  4C4V B;  2DLW A;  4K2P A;  4IG7 B;  4BKT A;  1WGU A;  4IWO A;  2VRW B;  4QJ4 B;  4XDC A;  3ZJU A;  1UGM A;  1R4N B;  3GE3 C;  3U30 A;  2CU3 A;  1FPY A;  4AWJ A;  1A5R A;  1BT0 A;  2Y3A A;  4ZHP A;  1GC6 A;  2DWQ A;  2J4X A;  3SFE B;  3BVM A;  3KWV A;  2G4D B;  3Q3N C;  3AE1 B;  4YTP B;  2N9K A;  3TSS A;  2JP2 A;  4PYU A;  4IOY X;  5LXI B;  4B0M A;  4DHJ D;  2R2O A;  3A98 B;  3VAW A;  1WM3 A;  1H10 A;  1HBK A;  1VR9 A;  2M56 B;  3H8H A;  3V62 A;  3AE3 B;  1GGO A;  2NBV B;  2J0K A;  4DX9 0;  3SU8 X;  1TXD A;  3KSY A;  3QJZ A;  4C7Z A;  4P1B C;  2Z0E B;  1SHC A;  1FGZ A;  5G2N A;  1WXV A;  4IC7 B;  1NVI D;  1P7E A;  2SAK A;  3RN9 C;  4ZRK A;  2BQQ A;  2QKM A;  1TS4 A;  2JRH A;  2KX0 A;  4QJ3 B;  4JKA A;  3B9J A;  1FXA A;  2DHZ A;  1WR1 A;  2D3A A;  3Q8A A;  1E9M A;  1TZO A;  2YT0 A;  4W9K A;  4TSS A;  2O6V A;  2ADZ A;  4OZC A;  4A6Q A;  2QCZ A;  2J42 A;  2I1K A;  2OTX A;  4F7U P;  1MIZ B;  2KHW B;  2BF8 B;  2M19 A;  1ZXI A;  2LGD A;  5KHQ A;  4W9L A;  2EKE C;  3OG5 A;  1R7S A;  5BYR A;  2GLS A;  3HSA A;  2Y5B B;  4CHM A;  3PS6 A;  5EE9 A;  3W5V B;  3FKY A;  3ONS A;  2NS5 A;  3C19 A;  3V3X A;  3ZLZ A;  4NSW A;  1EF1 A;  4TQ0 A;  2MBB B;  2LVQ A;  1OQQ A;  2HJ8 A;  2G9H D;  4XE0 A;  2LHD A;  3Q69 A;  3ZRF A;  3CIK A;  1X1M A;  3I3T B;  2ASQ A;  4C00 A;  4DHZ E;  3ZTD A;  3DVN V;  4FJY A;  3EA6 A;  3PSE B;  3DHG C;  4AJW A;  4A55 A;  3L08 A;  3LJ3 A;  2M1M A;  1FM0 D;  1WGK A;  4WJN A;  3DQV A;  3M1I B;  2YF0 A;  3IT6 B;  4YWG G;  4HB0 B;  3B2G A;  1ZGU B;  2X8X X;  1DOI A;  2P0H A;  3DBR I;  2V76 A;  1QKZ A;  2FBW B;  3DVG Y;  3P1M A;  5JHB A;  2HJ1 A;  3PLU A;  4DDG D;  2ZPY A;  1DDM A;  1V5O A;  1FHO A;  2LG1 A;  1QOA A;  5EE1 A;  1FAO A;  3D8E A;  4DDI D;  3G9W A;  4HLE A;  2N7J A;  3HK0 A;  5I4D A;  2INP E;  2QEJ C;  2NBW B;  2K2U A;  2FIF A;  3KLS X;  4MGI E;  5GXG B;  1FGY A;  1BAK A;  3ZJT A;  2LBB A;  2BPS A;  3EFU A;  1ROE A;  4MDK E;  5HE0 A;  1NI2 A;  1VD2 A;  3ZYY X;  3FEH A;  2PIA A;  1AW7 A;  2KTF A;  4F8C B;  2L7R A;  1LXD A;  2L83 A;  3DBL I;  2R2Y A;  4RH6 A;  4HPP A;  2KAJ A;  1WMH A;  3BWU D;  3QIJ A;  2OHF A;  3GOE A;  2L32 A;  2EMT A;  3D8F A;  1U29 A;  3SNH A;  4GDL A;  3KYD D;  2N0S B;  2N23 A;  4ILH A;  3PGE A;  4DK5 A;  2FDQ A;  1GUA B;  5IN7 A;  4FUL A;  4ZRQ A;  3T3O A;  1DBH A;  4HKZ E;  3PVU A;  2WXJ A;  3RZW C;  5I2S A;  1UNQ A;  1I2H A;  3NJT A;  2BS3 B;  2LEK A;  3KH0 A;  4BKG A;  2V4L A;  4KHB A;  4MM3 B;  1G6J A;  4QJ5 B;  1T0R C;  4W9J A;  4HCN B;  5FK9 C;  3MJ5 A;  1XLO A;  3I57 A;  2DZM A;  2ICI A;  2EMS A;  2KDM A;  4N59 A;  3BVZ A;  3ENB A;  3H7P A;  4FXC A;  1V49 A;  1L0Y B;  1N6Z A;  1DYN A;  2RGF A;  5HG2 A;  4NAW A;  1M7R A;  4EE2 A;  2MCN B;  1EM7 A;  4ANV A;  3KUC B;  3SV1 A;  2BBC A;  3C0R B;  3SBG A;  2CS4 A;  2K39 A;  2K0P A;  1MFW A;  5IJM A;  1FFU A;  3UZT A;  2JQR B;  3P63 A;  4CHJ A;  2K8H A;  1P1A A;  3AU4 A;  3IG3 A;  1C76 A;  4WWP A;  1J8C A;  2RMM A;  4WVF B;  1VZ7 A;  3U4E G;  1WJM A;  1IP9 A;  1R4N I;  3ZQ4 A;  1V61 A;  2COD A;  3HM6 X;  5CHF A;  1GPX A;  4XX5 A;  1LM8 B;  2RGN B;  3PSC A;  1E8W A;  2ZEQ A;  1V5T A;  1V80 A;  4XZ4 A;  1K8R B;  2NMB A;  1H8C A;  2XK5 A;  3GYO A;  2WXR A;  2KC2 A;  2E2X A;  4EFO A;  3K9O B;  5C16 A;  2IJ0 A;  1Q67 A;  2L3Z A;  2YRY A;  4MGK E;  3R3M A;  3N20 C;  3QAQ A;  1KFY B;  4W9E A;  2OJW A;  4BBN C;  2CQU A;  1HZ5 A;  2GBR A;  3NHE B;  4GDK A;  1NBF C;  1E6E B;  4N6E B;  4DBB A;  1GJZ A;  4DXA B;  5D3V A;  2BYF A;  2IO0 B;  1Y19 B;  2DNF A;  1VDV A;  4AS1 A;  1EWY C;  1ISN A;  1UPQ A;  4A6F B;  2N9X A;  2W9N A;  3PLV A;  1ACC A;  2V1Y A;  2ZKM X;  2X0S A;  4A3O A;  3KYC D;  3BIN A;  3DXC A;  4ILJ A;  3MHZ A;  5DI9 B;  3RZF A;  1C77 A;  1T3Q A;  4HPM B;  3RYT A;  4BAX A;  3BYT B;  3HM3 A;  1FHW A;  2JVC A;  1T0S C;  1RFK A;  2KDI A;  4F7Z A;  4I6L B;  2I1J A;  3QQ8 B;  3DHH C;  3DDC B;  2KMC A;  3QHT A;  5BMI A;  1UEF A;  2MA9 B;  1XX0 A;  5LOP B;  2MFQ A;  3ZNI D;  1WGD A;  4HDQ A;  2JSV X;  1LGR A;  2NBV A;  3U52 E;  1WXM A;  2JT4 B;  2KX3 A;  1WY8 A;  2WX1 A;  3UQB A;  1ENF A;  1AWE A;  2MBO A;  3IFW B;  3PV1 A;  4RFB A;  5T8I A;  3U2S C;  3AEF B;  1NYQ A;  3EHV A;  5CLQ B;  1FOE A;  4RM8 A;  5D27 A;  1E7V A;  2PLP A;  3L54 A;  1V2Y A;  4JWS C;  4B95 A;  4MSQ B;  3VTU A;  2C9W B;  1V1P B;  3AB5 A;  1E7P B;  4JE3 B;  1JWU D;  2MKR A;  1YD8 U;  4MT7 A;  3HUI A;  1FRD A;  2AEH A;  5D2M B;  4MJS B;  5D3X A;  2CHW A;  4JK7 A;  4ZDV A;  1T6B X;  3UIN B;  2RDB C;  2J59 M;  4A8X C;  4KKI A;  1OQY A;  2PPH A;  3NWA A;  1QQR A;  2KLG A;  4LNN A;  2FJU B;  4GZU A;  1FEH A;  1WX7 A;  4QXA B;  1C4A A;  3TMP B;  4ANX A;  1YN3 A;  5EE0 A;  2YLM A;  2EC1 A;  2BVC A;  1WXQ A;  3DXD A;  3BK2 A;  1QT9 A;  1ZPS A;  3P4Q B;  1F9J A;  1SE9 A;  1MK9 B;  4XC2 A;  3VUX A;  1Q10 A;  4EJN A;  3OAN A;  3V05 A;  1M94 A;  1SIF A;  4C80 A;  4FLH A;  4OT1 A;  4LLG M;  1JWM D;  3SD5 A;  3VRA B;  3LDZ E;  4JKE A;  3H7S A;  2QIL A;  5DPS A;  2ZNV C;  1RM6 C;  1TIF A;  4W9F A;  2XQN M;  2DZK A;  1YX6 B;  4GOU A;  3RMK C;  5C1Z A;  2KMM A;  3RNE C;  2VKI A;  4DWF A;  3ODW A;  2C7N B;  2N1W A;  3N9Y C;  3QWM A;  1TQZ A;  3A9K B;  1GC7 A;  1ST7 A;  1VJK A;  4MH8 A;  3VHT C;  2NTT A;  1FB8 A;  3B1L X;  2O6V B;  2IY1 B;  5JXV A;  1P0R A;  3WAP A;  1V6E A;  3Q8E A;  1UZX B;  1V97 A;  4L6E A;  2NVU I;  3PRZ A;  1MI1 A;  3QWZ B;  1OFF A;  4IOI E;  4Z2N A;  2WH5 A;  1WJU A;  3IVF A;  2DYQ A;  2K2J A;  3URY A;  2K49 A;  1SE4 A;  2AQ3 B;  5C5B B;  4LNF A;  1Q5W B;  4JKF A;  1W1D A;  2RSU A;  1V88 A;  1ZSQ A;  4DBG A;  5D3Y A;  2J52 A;  2D2Q A;  1ZVR A;  1SIJ A;  4HB3 B;  2MP2 B;  2KN4 A;  3AH7 A;  3Q3F A;  3VXW A;  3UQA A;  1TS3 A;  2UZR A;  3MPX A;  1QOB A;  1XLN A;  1D6E C;  4BKS A;  4MM3 A;  2SEB D;  4P7I A;  1KJT A;  3BYY B;  2DYB A;  2VH1 A;  4A6H A;  3AE8 B;  2LWP A;  4BOS C;  1BTN A;  1EAZ A;  5JVL A;  4GOC A;  3AJ4 A;  4L2Y A;  2WXN A;  3AE2 B;  3AE7 B;  1PGA A;  1WGY A;  3TCA A;  4KDI C;  1FD6 A;  2FID A;  1P3R A;  2IO3 B;  2W3R A;  3V6C B;  4C7Y A;  2L52 A;  2KIG A;  1VZ6 A;  1SSN A;  3OHM B;  3TEY A;  1E8Y A;  3APC A;  5J18 A;  2ZVO A;  4X57 B;  4DX8 A;  5D7G A;  2RQ1 A;  2IFS A;  3DCX A;  2GCL A;  1CZP A;  3UIO B;  2M4N A;  1MKE A;  3HRD D;  1K5G B;  1I7A A;  1I7H A;  4KX6 B;  5CHW A;  3BII D;  1WMH B;  4GIV A;  3PHX B;  2MBH A;  4IM3 A;  2FCQ A;  2IY0 B;  2MHJ A;  1YOV B;  2ZCC A;  1DOX A;  5TR5 A;  4ZHO A;  2QJL A;  2K8B A;  2DHI A;  1WZ3 A;  2LOX A;  1IPG A;  3T9L A;  4MGY E;  1DYQ A;  2JF5 A;  1RWS A;  3RNC C;  3TO1 A;  2COC A;  5H8Y E;  1SE2 A;  4A6F A;  2K3U A;  3EFC A;  1TY0 A;  3CIR B;  5IAA C;  2ROZ B;  3PRM B;  3LB8 C;  1E7U A;  3JVZ X;  1RRP B;  3QC8 B;  2PE9 A;  2KDE B;  2KFJ A;  3ZIM A;  1L6V A;  3BZD B;  4BZA A;  3PHW B;  2TSS A;  5CHV C;  2BYE A;  2G1E A;  2L0T A;  2WXF A;  1F52 A;  1CMX B;  4D6W A;  4HKQ A;  1SJE D;  4GMV A;  2KIE A;  2VZK B;  5D94 A;  1FO4 A;  2L1A A;  2L2I A;  4JLC A;  2K1F A;  4JGH B;  4W9H A;  1V5P A;  1V5U A;  2XBB C;  1F1H A;  3M62 B;  4OSN A;  2FAZ A;  1UGJ A;  2W2X D;  3A8P A;  1PQS A;  3OJ4 B;  4RF1 A;  1B55 A;  4RGN A;  2OED A;  3FC4 A;  1V1P A;  4WAF A;  4AJY B;  3M63 B;  1L7Y A;  1KH0 A;  5DIF B;  5C79 A;  2LFI A;  3ZNG C;  3R7Q A;  1QC6 A;  2A5U A;  4I6N B;  3ZO5 B;  4MJS A;  2RPV A;  3X0W A;  4EMO A;  2FCS A;  1ZDX A;  4ITK A;  1A70 A;  5J3T A;  3WAL A;  1XOD A;  2DA0 A;  1STE A;  4K2O A;  3ZW3 A;  2JXX A;  2ZJD A;  4AP4 C;  1BUI C;  1HB8 A;  3NS8 A;  2KDF B;  2OOB B;  1ZKH A;  2DAF A;  4L23 A;  3FLV A;  3A33 B;  4WJO A;  4WJQ A;  1ET9 A;  1XKE A;  2NMQ A;  1TBE A;  3TEW A;  4XDD A;  4B6H A;  2D4Q A;  2WU2 B;  3QAR A;  4CYE A;  4LDT D;  2BB6 A;  3DPD A;  3ZUN A;  3MC8 A;  3ZDT A;  1Y8R C;  3VRB B;  2LMC A;  4WAA A;  1EVH A;  1YN5 A;  2Z14 A;  4LNI A;  1J0G A;  2UZS A;  2MH7 A;  4E3C A;  1QIL A;  2JY6 A;  2ZPN A;  4KZC A;  3L10 B;  4RMA A;  3RT3 B;  2D9W A;  2Z8L A;  4IUM B;  3VR9 B;  2D3G A;  3I5J C;  3ZGZ A;  5DH9 B;  1IBX A;  4NY0 A;  5CTR C;  4KDL B;  3A9K A;  1RJ2 A;  2X18 A;  2PVG C;  4CQN A;  4GNK B;  4PQ0 A;  3O13 A;  3ZJV A;  1E90 A;  2INN E;  2QSD A;  3W1Y A;  3KRW A;  3SO6 A;  2GBN A;  2L8J A;  2B3A A;  3LXF A;  3W5U B;  3UF8 A;  4GN1 A;  1M4V A; 
#chains in the Genus database with same CATH homology
 1ZM0 A;  2CHZ A;  3CXB B;  3AU5 A;  2KKC A;  4K1R B;  5C5B A;  3ULC A;  4IWQ A;  4YON A;  2JZZ A;  5BO4 B;  2MP2 A;  5DPW A;  2D10 A;  4EEW A;  2VSZ A;  2C7H A;  4G50 A;  1WXA A;  1KI1 B;  3CST A;  5J17 A;  1ZW7 A;  5L83 A;  4ICU A;  1C3T A;  3A4R A;  1WRD B;  3E66 A;  2LZ6 A;  2REX A;  4GXB A;  1WXS A;  3RD2 A;  4TV3 A;  2ELA A;  4Y94 A;  2KLC A;  4FHK A;  1MK7 B;  2DX5 B;  5HE2 A;  2IO1 B;  1OMW A;  4KVG B;  2BGF A;  2DYN A;  1TZ1 A;  2HD5 B;  4GMX B;  4WJ7 A;  1WX8 A;  2KXJ A;  3S2A A;  3PVL A;  2RR9 A;  2Q13 A;  4E74 A;  3KRX A;  2IBI B;  2XEW A;  1OEY A;  1WF9 A;  4KIK B;  1C1Y B;  3NOB A;  1DDW A;  1PLS A;  3PP2 A;  2CRF A;  1DIK A;  2LYD A;  3U7D A;  3QX1 A;  2C5L C;  2CKH B;  1KC7 A;  2D9Z A;  5E6N A;  4B9K A;  3VUY A;  1MIX A;  2KC1 A;  4WJP A;  3ZVR A;  1X11 A;  2GBM A;  3FM8 C;  1M7E A;  1P5T A;  3L13 A;  2BYV E;  2RSG A;  2WYQ A;  3V60 A;  5FI1 A;  1N3H A;  3SDL C;  2MBQ A;  3KY9 A;  2LJ5 A;  4MY6 A;  4LJP B;  3TL5 A;  1RAX A;  1MG8 A;  3VTV A;  3ML9 A;  3Q3J A;  1I35 A;  4HPL B;  4IM2 A;  2P0F A;  4JKG B;  5KCV A;  2AWT A;  2J7Q B;  2LUE A;  5CLL B;  3SUZ A;  2CU1 A;  2P0D A;  5KHO A;  2JUO A;  2GBJ A;  2RD0 A;  3V5W A;  5IA7 A;  1BWN A;  1ZC4 B;  2DYO A;  5AZG A;  3SBT A;  2KK8 A;  4B6W A;  3N3K B;  4IWP A;  3DOW A;  2CB8 A;  2MBE A;  3O96 A;  1J0W A;  3GYP A;  3ZNZ B;  3VFK A;  3BJI A;  1KM7 A;  5DPR A;  3WAO A;  2G45 B;  4H8S A;  2Z0D B;  5E6O A;  3BY4 B;  2MQJ A;  3PEG A;  3K9P B;  5DCN A;  2COP A;  4HXD A;  2RUK B;  1V81 A;  4MGZ E;  3NZU A;  2LD9 A;  1NTI A;  4N9F 4;  2K6D B;  1XT9 B;  2L1C A;  1GNU A;  1W1G A;  4WWN A;  4LCD E;  2MX2 A;  3DBS A;  2UVM A;  3E9L A;  2DN6 A;  3VH4 B;  2AYO B;  2KVR A;  3MTN B;  1WGR A;  4E71 A;  2CY5 A;  4F1S A;  1WZ0 A;  5J2R A;  3KUZ A;  4EUT A;  3UGB B;  3NZS A;  2D07 B;  3VH3 B;  2DX1 A;  2BWF A;  3L16 A;  3M3J A;  2IYB A;  4NNJ B;  2AL3 A;  3B0A A;  1U4A A;  4K7W A;  2KCJ A;  1P9D U;  3HQC A;  2YSZ A;  1OEY J;  3ALB A;  4TKN A;  1UD7 A;  3QK0 A;  2YT1 A;  3L17 A;  4I6P A;  2ZVN A;  1OTR B;  2CY4 A;  3PTF C;  3L0W B;  3ML4 A;  2R2Q A;  4CO7 A;  3PZD A;  3E9P A;  1WG7 A;  2DKP A;  5GOW B;  4DHJ B;  3DVG X;  5FI0 A;  4CHK A;  2DX5 A;  2BWE S;  4KHO A;  2KWU B;  4RM9 A;  1NVL A;  2MRP A;  2LRW A;  2N1V A;  1LQB A;  2AL6 A;  2KOX A;  3M95 A;  5JHG A;  1KOT A;  2LOZ A;  2NCN A;  2PE6 B;  4FN2 A;  3E9O A;  1I42 A;  1UBI A;  1U5E A;  2HTH B;  1WGH A;  2N4F A;  1WGQ A;  3SYX A;  2ELB A;  4KIK A;  4KAX B;  3HIZ A;  2M8S A;  3O65 B;  2LUL A;  4BKS D;  3FP5 A;  4ZRI A;  1NTY A;  1OY2 A;  2O2V B;  5C23 A;  2HRJ A;  3H9D A;  3PRE A;  4HDO A;  5C6R A;  3AI5 A;  3A1Q B;  4KSL C;  1MPH A;  5LON B;  1WGG A;  4JK8 A;  2DHK A;  1BTK A;  4HK2 A;  1NDD A;  1XR0 B;  3KVF B;  2L0F A;  4HAV B;  2JZ3 B;  4JKD A;  4FJZ A;  2KNB A;  5G55 A;  1P98 A;  2JPH A;  2H7D A;  2K00 A;  2KQS A;  4NQL B;  5LLI A;  2G3Q B;  4K17 A;  4M0W B;  4ANU A;  3B08 A;  4JKG A;  1WVH A;  2N7E A;  2KJ6 A;  2PJH A;  4JIO U;  2N0Y A;  2OQB A;  3PT2 B;  2WDT B;  2BCJ A;  1HB6 A;  3ENE A;  2IZV B;  2LAS A;  4HWI B;  4ICV A;  2C60 A;  2LKO A;  4D0N B;  4GB9 A;  2C7M B;  5LXH A;  2LXA A;  3D8D A;  3VIA A;  1XCG A;  2KWC A;  4PYZ A;  5JHA A;  2PZ1 A;  3CMM B;  4FBJ B;  4MK0 A;  1D3Z A;  5KQ4 A;  3ZKJ C;  4W9G A;  1TGZ B;  2CR5 A;  3RUL A;  3JW0 X;  2KMA A;  2NR2 A;  3PRP B;  2G35 A;  1WR6 E;  2YS5 A;  4BVU C;  2D9Y A;  1Y5O A;  3CSF A;  4HAU B;  1X05 A;  2R82 A;  1WE6 A;  2D9V A;  1FXT B;  2M17 A;  5L81 A;  2D9X A;  3W1S A;  1EUV B;  4YL8 A;  4WWO A;  2K8C A;  1V89 A;  4EZL A;  2WWZ A;  3RUI B;  2N7D A;  1WI1 A;  4J6I A;  3JSV B;  4TYZ A;  2Z0P A;  1U2B A;  2MLB A;  3P2B A;  2DZJ A;  5EFX A;  2KQ7 A;  4G0N B;  3IBE A;  2K6Q A;  1P3Q U;  1W1H A;  4DHZ B;  2KTR B;  1U5D A;  4XWX A;  1TTN A;  3F0W A;  4NJ7 A;  1AAR A;  1Q1O A;  3ZRC A;  2MW5 A;  2LGY A;  4JKH A;  4EKU A;  2MSE D;  4HVB A;  3KZ1 A;  4HCP B;  3APF A;  3TFM A;  4KV2 A;  3MJW A;  4GU2 A;  2O6V D;  4II2 B;  2L00 B;  3EC8 A;  4IW0 A;  2ROV A;  3DXE A;  1U27 A;  2DKQ A;  4NQK E;  1LW3 A;  3UIP B;  1SGH A;  2Y8F A;  4EOY A;  4F7H A;  2FJL A;  2ZZP B;  5DPT A;  2HTH A;  2KWV B;  3PVW A;  2V3S A;  4II3 B;  4GPT B;  2Z59 B;  3WAM A;  4MSM B;  2QKL A;  4W9C A;  2KGX B;  3WA0 A;  1X86 A;  2DFK A;  2KFK B;  2O2V A;  2CAY A;  3RCP A;  3RCZ A;  2KZR A;  1KZ7 A;  2W2W A;  3VOQ A;  5EDS A;  3OAW A;  3APD A;  1RLF A;  4HAW B;  2LRU A;  3A1Q A;  1UNP A;  4HB4 B;  4W9I A;  3ZNH B;  5JP4 A;  4HB2 B;  1LFD A;  5JZE B;  2H7E A;  3X23 A;  4FAD A;  2EJ8 A;  4KZ0 A;  3ECI A;  1Q0W B;  1E5W A;  3NSU A;  2NBU A;  2LGX A;  3PG7 A;  2M14 A;  3GZN I;  2L05 A;  2VRR B;  2JRI B;  4BBK A;  2MWS B;  2D11 A;  5J3Q A;  2NPT B;  4A5K A;  4OVV A;  2GMI C;  4HAT B;  3P7Z A;  4KHA A;  2GCJ A;  2I5F A;  1EF5 A;  3A8Q A;  1GG3 A;  4A6K A;  2Z0Q A;  2LVO A;  2P8V A;  2JWZ A;  4FHJ A;  2Y8G A;  5AZH A;  2GJY A;  5JLJ B;  3QCA A;  2IYD B;  3HHM A;  2GOW A;  1WJN A;  2DTC A;  5D6J B;  3W1S C;  1JDE A;  1XD3 B;  3AUL A;  4BFR A;  2N9E B;  5HE1 A;  3F5R A;  3DVN U;  1WJ6 A;  5E6P A;  4BOZ B;  1XD4 A;  1E8Z A;  4PS8 A;  3H1U A;  2W2X C;  1KBL A;  1NTV A;  4G3X B;  1S1Q B;  5D3W A;  4ASW C;  1MAI A;  2L76 A;  2I5C A;  2DYM A;  2MDX A;  4OVU A;  5HKH A;  4M8M A;  1VBH A;  1QQG A;  2HE7 A;  2R09 A;  1UH6 A;  3N30 A;  1PMS A;  2KD0 A;  3ODX A;  1J19 A;  2M38 A;  1UNR A;  3N32 A;  4HAY B;  1Z5S B;  2RVB B;  2ZCB A;  1UBQ A;  2GBK A;  1UEL A;  3JSV A;  3ZDM C;  1R4M I;  2BKR B;  1P6S A;  3A9J B;  4JL9 A;  3KUD B;  3HW2 B;  1YJ1 A;  2RLO A;  3WIM A;  4GSW A;  4HAX B;  1VBG A;  3T06 A;  4FJV B;  4JKC A;  2KTR A;  2KAN A;  4AUQ C;  3DBH I;  4EZJ A;  1IYF A;  1FHX A;  2UYZ B;  3DCG A;  1E8X A;  1DDV A;  5DHA B;  3OJ3 A;  1L2N A;  2ABD A;  2KJR A;  3VDZ A;  3U8Z A;  3VVW B;  1WH3 A;  1U5F A;  1KZG A;  1K5D B;  3WYF B;  1OGW A;  3R66 C;  4NJ6 A;  3FSS A;  3QBV B;  4F7G A;  3TVV A;  2OJR A;  2R0D A;  4K7U A;  2WX0 A;  3V61 A;  1YIW A;  1JRU A;  4URK A;  5KQ1 A;  3A4S C;  5JHH A;  2KDB A;  2DEN B;  5FR6 A;  2K25 A;  1QZE A;  2DZI A;  1Z87 A;  2COA A;  3TBL D;  4IM0 A;  1WJ4 A;  3ZTC A;  1X1G A;  4HJK A;  1ZC3 B;  1V9J A;  2RPQ A;  4PS7 A;  2QHO A;  2G4S A;  1WE7 A;  1WIA A;  2KFK A;  4Z2M B;  1V5M A;  4PNK A;  3T8M A;  3KW5 B;  4NPN A;  4JK9 A;  2FCN A;  4IAP A;  1YX5 B;  5AZF A;  4FA6 A;  1WJ1 A;  1RRB A;  3TJP A;  2YVC A;  1OQN A;  3V6E B;  2FUH B;  2J0J A;  4M8N A;  1Z2M A;  3MHS D;  1X1F A;  3VTW A;  2DHJ A;  4C0A A;  3QA8 A;  1EGX A;  4LDT B;  2PEA A;  3IHP C;  2J0M A;  3AXC A;  3D32 A;  3JYU A;  4ANW A;  1V86 A;  2LVP A;  1S3S G;  4HHV A;  1UPR A;  4ZRJ A;  3P6A A;  2NPT A;  4ZYN A;  2Z0O A;  2COF A;  3ZVV A;  1NU2 A;  5AEK B;  4HAZ B;  1RFA A;  3VUW A;  4JKB A;  3ODO A;  5DHF B;  4MEL A;  4MEM A;  4IFS A;  2MWN B;  4PS3 A;  4TQ1 A;  2BKF A;  3H6N A;  5CX3 A;  2LI5 A;  4A3P A;  1VCB A;  1PFJ A;  5J3Y A;  3CF6 E;  2KUP A;  1DRO A;  4MH0 E;  4EZK A;  1ACA A;  4WSF A;  1IRS A;  3ML8 A;  2GS0 A;  3WAN A;  2YS3 A;  3SHQ A;  5GMV A;  4TUU A;  3PPA A;  2A4Z A;  2M0X A;  4KSK C;  2DAJ A;  1T0Y A;  2KN5 A;  2ZNV B;  2YS1 A;  2N9P C;  2KJH B;  2UWQ A;  4W9D A;  5HE3 A;  1KLV A;  1AQC A;  4JQW C;  1WFY A;  1WX9 A;  4GDL B;  1WI0 A;  2FJ9 A;  1WM2 A;  3ULB A;  2CHX A;  3A9J A;  3MDB C;  3TIX A;  4KHB B;  5L95 C;  1U5G A;  4G11 A;  4K81 A;  4K7S A;  4BBN F;  4ILG B;  2IO2 B;  3VQI A;  4A20 A;  1YQB A;  3H7P B;  4LJO B;  2DIK A;  4GGQ A;  4NAW B;  1H4R A;  1LB1 A;  2Y7B A;  3EEC A;  2RNR B;  1HE8 A;  2FNJ B;  2KO3 A;  1TJ6 A;  5JH5 C;  1EO6 A;  4WQO B;  1WYW B;  2XK5 B;  1XQQ A;  3R7R A;  3EPY A;  4AOF A;  3NY5 A;  3LJU X;  4GDK B;  3TW1 A;  2FCM A;  2LXC A;  2NZ8 B;  3N7C A;  3OLM D;  2DLW A;  4K2P A;  4IG7 B;  4BKT A;  1WGU A;  4IWO A;  2VRW B;  1UGM A;  3U30 A;  4AWJ A;  1A5R A;  1BT0 A;  1GC6 A;  2G4D B;  2JP2 A;  4PYU A;  4IOY X;  5LXI B;  4DHJ D;  2R2O A;  3A98 B;  3VAW A;  1WM3 A;  1H10 A;  1HBK A;  3V62 A;  1GGO A;  2NBV B;  2J0K A;  4DX9 0;  3SU8 X;  1TXD A;  3KSY A;  3QJZ A;  2Z0E B;  1SHC A;  1FGZ A;  5G2N A;  1WXV A;  4IC7 B;  4ZRK A;  2QKM A;  2JRH A;  2KX0 A;  4JKA A;  2DHZ A;  1WR1 A;  2YT0 A;  4W9K A;  2O6V A;  2ADZ A;  2I1K A;  2OTX A;  4F7U P;  1MIZ B;  2KHW B;  2BF8 B;  2LGD A;  5KHQ A;  4W9L A;  2EKE C;  2Y5B B;  4CHM A;  3PS6 A;  3ONS A;  2NS5 A;  3ZLZ A;  4NSW A;  1EF1 A;  4TQ0 A;  2MBB B;  2LVQ A;  2HJ8 A;  3ZRF A;  3CIK A;  1X1M A;  3I3T B;  2ASQ A;  4DHZ E;  3ZTD A;  3DVN V;  4FJY A;  3PSE B;  4AJW A;  3L08 A;  3LJ3 A;  2M1M A;  4WJN A;  3DQV A;  3M1I B;  2YF0 A;  4HB0 B;  1ZGU B;  2P0H A;  3DBR I;  2V76 A;  3DVG Y;  5JHB A;  3PLU A;  4DDG D;  2ZPY A;  1DDM A;  1V5O A;  1FHO A;  2LG1 A;  1FAO A;  3D8E A;  4DDI D;  3G9W A;  4HLE A;  3HK0 A;  2NBW B;  2K2U A;  2FIF A;  4MGI E;  1FGY A;  1BAK A;  2LBB A;  2BPS A;  3EFU A;  4MDK E;  5HE0 A;  1NI2 A;  1VD2 A;  3FEH A;  2KTF A;  4F8C B;  2L7R A;  1LXD A;  3DBL I;  1WMH A;  3QIJ A;  3GOE A;  2EMT A;  3D8F A;  1U29 A;  3SNH A;  4GDL A;  3KYD D;  2N23 A;  4ILH A;  3PGE A;  4DK5 A;  2FDQ A;  1GUA B;  4FUL A;  1DBH A;  3PVU A;  3RZW C;  1UNQ A;  1I2H A;  3KH0 A;  4BKG A;  2V4L A;  1G6J A;  4W9J A;  4HCN B;  2DZM A;  2EMS A;  3ENB A;  3H7P A;  1V49 A;  1DYN A;  2RGF A;  4NAW A;  1M7R A;  2MCN B;  4ANV A;  3KUC B;  3SV1 A;  3C0R B;  3SBG A;  2CS4 A;  2K39 A;  5IJM A;  3UZT A;  4CHJ A;  2K8H A;  1P1A A;  3AU4 A;  3IG3 A;  4WWP A;  1J8C A;  4WVF B;  1WJM A;  1IP9 A;  1R4N I;  1V61 A;  2COD A;  3HM6 X;  5CHF A;  4XX5 A;  1LM8 B;  2RGN B;  3PSC A;  1E8W A;  2ZEQ A;  1V5T A;  1V80 A;  4XZ4 A;  1K8R B;  2NMB A;  1H8C A;  2XK5 A;  3GYO A;  2KC2 A;  2E2X A;  4EFO A;  3K9O B;  5C16 A;  1Q67 A;  2L3Z A;  2YRY A;  4MGK E;  3R3M A;  3QAQ A;  4W9E A;  4BBN C;  2CQU A;  2GBR A;  3NHE B;  4GDK A;  1NBF C;  4DBB A;  1GJZ A;  4DXA B;  5D3V A;  2BYF A;  2IO0 B;  1Y19 B;  2N9X A;  1ISN A;  1UPQ A;  4A6F B;  2W9N A;  3PLV A;  2V1Y A;  2X0S A;  4A3O A;  3KYC D;  3BIN A;  3DXC A;  4ILJ A;  5DI9 B;  3RZF A;  4HPM B;  3RYT A;  3HM3 A;  1FHW A;  2JVC A;  2KDI A;  4F7Z A;  4I6L B;  2I1J A;  3QQ8 B;  3DDC B;  2KMC A;  3QHT A;  1UEF A;  2MA9 B;  1XX0 A;  5LOP B;  2MFQ A;  3ZNI D;  1WGD A;  4HDQ A;  1WXM A;  2JT4 B;  2KX3 A;  1WY8 A;  2WX1 A;  3UQB A;  1AWE A;  2MBO A;  3IFW B;  3PV1 A;  3EHV A;  5CLQ B;  1FOE A;  4RM8 A;  5D27 A;  1E7V A;  3L54 A;  4B95 A;  1V2Y A;  4MSQ B;  3VTU A;  2C9W B;  1YD8 U;  2MKR A;  4MT7 A;  2AEH A;  5D2M B;  4MJS B;  5D3X A;  2CHW A;  4JK7 A;  4ZDV A;  3UIN B;  2J59 M;  1OQY A;  2PPH A;  2KLG A;  4GZU A;  1WX7 A;  3TMP B;  4ANX A;  2YLM A;  2EC1 A;  3DXD A;  1F9J A;  1SE9 A;  1MK9 B;  4XC2 A;  3VUX A;  4EJN A;  3OAN A;  1M94 A;  1SIF A;  4FLH A;  3SD5 A;  3LDZ E;  4JKE A;  3H7S A;  5DPS A;  2ZNV C;  4W9F A;  2XQN M;  2DZK A;  1YX6 B;  5C1Z A;  2VKI A;  4DWF A;  3ODW A;  2C7N B;  2N1W A;  3QWM A;  1TQZ A;  3A9K B;  1GC7 A;  1ST7 A;  3VHT C;  1FB8 A;  3B1L X;  2O6V B;  2IY1 B;  1P0R A;  3WAP A;  1V6E A;  1UZX B;  2NVU I;  4L6E A;  3PRZ A;  3QWZ B;  4Z2N A;  2WH5 A;  1WJU A;  3IVF A;  2DYQ A;  2K2J A;  5C5B B;  1Q5W B;  4JKF A;  1W1D A;  2RSU A;  1V88 A;  1ZSQ A;  4DBG A;  5D3Y A;  2D2Q A;  1ZVR A;  4HB3 B;  2MP2 B;  3Q3F A;  3VXW A;  3UQA A;  2UZR A;  3MPX A;  4BKS A;  4MM3 A;  4P7I A;  1KJT A;  2DYB A;  4A6H A;  2LWP A;  4BOS C;  1BTN A;  1EAZ A;  5JVL A;  4GOC A;  3AJ4 A;  1WGY A;  3TCA A;  4KDI C;  2FID A;  1P3R A;  2IO3 B;  3V6C B;  1E8Y A;  3APC A;  5J18 A;  2ZVO A;  4X57 B;  4DX8 A;  5D7G A;  2RQ1 A;  2IFS A;  2GCL A;  3UIO B;  2M4N A;  1MKE A;  1K5G B;  1I7A A;  5CHW A;  1WMH B;  4GIV A;  3PHX B;  2MBH A;  4IM3 A;  2FCQ A;  2IY0 B;  2ZCC A;  5TR5 A;  2K8B A;  2DHI A;  1WZ3 A;  2LOX A;  1IPG A;  3T9L A;  4MGY E;  2JF5 A;  3TO1 A;  2COC A;  4A6F A;  5IAA C;  2ROZ B;  3PRM B;  1E7U A;  3JVZ X;  1RRP B;  3QC8 B;  2PE9 A;  2KDE B;  2KFJ A;  3ZIM A;  3PHW B;  5CHV C;  2BYE A;  2L0T A;  1CMX B;  4GMV A;  5D94 A;  2L2I A;  4JLC A;  2K1F A;  4JGH B;  4W9H A;  1V5P A;  1V5U A;  2XBB C;  3M62 B;  2FAZ A;  2W2X D;  3A8P A;  1PQS A;  3OJ4 B;  1B55 A;  4AJY B;  3M63 B;  1L7Y A;  5DIF B;  5C79 A;  3ZNG C;  3R7Q A;  1QC6 A;  2A5U A;  4I6N B;  3ZO5 B;  4MJS A;  3X0W A;  4EMO A;  2FCS A;  5J3T A;  3WAL A;  1XOD A;  2DA0 A;  4K2O A;  3ZW3 A;  2JXX A;  2ZJD A;  4AP4 C;  1HB8 A;  3NS8 A;  2KDF B;  2OOB B;  1ZKH A;  2DAF A;  3FLV A;  3A33 B;  4WJO A;  4WJQ A;  1XKE A;  1TBE A;  4B6H A;  2D4Q A;  3QAR A;  4CYE A;  4LDT D;  3DPD A;  3ZUN A;  3ZDT A;  1Y8R C;  4WAA A;  1EVH A;  1J0G A;  2UZS A;  4E3C A;  2JY6 A;  2ZPN A;  4KZC A;  3L10 B;  4RMA A;  3RT3 B;  2D9W A;  4IUM B;  2D3G A;  5DH9 B;  4NY0 A;  5CTR C;  4KDL B;  3A9K A;  1RJ2 A;  2X18 A;  4PQ0 A;  1E90 A;  3W1Y A;  3KRW A;  3SO6 A;  2GBN A;  2L8J A;  2B3A A;  3UF8 A;  4GN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...