1NVLA

Rdc-refined nmr structure of bovine acyl-coenzyme a binding protein, acbp, in complex with palmitoyl-coenzyme a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding protein
publication title RDC-refined NMR structure of bovine Acyl-coenzyme A Binding Protein, ACBP, in complex with palmitoyl-coenzyme A
rcsb
source organism Bos taurus
molecule tags Ligand binding protein
total genus 31
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1nvlA00
1ISNA 4ZRJA 2ZPYA 3FLVA 2LBBA 4F7GA 2J0MA 5IJMA 2FJ9A 2WH5A 1NVLA 1MK7B 2CQUA 2J0JA 3AU5A 1Y19B 2FDQA 4ZRIA 3PVLA 1MK9B 1HBKA 1ST7A 3ZDTA 1GG3A 2I1KA 3EPYA 4HDQA 4P7IA 3U7DA 1H4RA 1MIXA 3IVFA 2CB8A 3WA0A 2I1JA 3AU4A 4NY0A 1HB8A 2ABDA 2AEHA 2YVCA 3G9WA 2D11A 1GC7A 1SGHA 2AL6A 4HDOA 2D10A 4YL8A 2EMTA 2EMSA 3PZDA 1ACAA 1J19A 1NI2A 3X23A 4EKUA 2HE7A 2HRJA 2J0KA 3BINA 4ZRKA 1MIZB 2RQ1A 2D2QA 1EF1A 2COPA 4CYEA 1HB6A 1NTIA 3U8ZA 1GC6A 4DXAB 3QIJA 3FP5A 1E5WA
chains in the Genus database with same CATH superfamily
1ISNA 3FLVA 2FJ9A 1NVLA 2J0JA 4JKAA 4JKGB 1GGOA 3E9LA 3WA0A 3AU4A 1GC7A 4GXBA 4YL8A 2EMSA 5JVLA 1ACAA 1NI2A 3X23A 2DIKA 2HRJA 2RQ1A 2COPA 1HB6A 1NTIA 1E5WA 4F7GA 2WH5A 3AU5A 4ZRIA 1Y19B 1MK9B 1HBKA 4P7IA 1MIXA 2CB8A 3E9PA 1HB8A 1KBLA 2AEHA 2YVCA 4JK8A 4HDOA 4JKGA 3PZDA 1J19A 4EKUA 1VBHA 1VBGA 2J0KA 3SBGA 2D2QA 3E9OA 3ENBA 4CYEA 4JKHA 4DXAB 2ZPYA 4ILHA 1MK7B 2CQUA 3PVLA 1ST7A 1GG3A 2I1KA 3EPYA 4HDQA 3U7DA 1H4RA 1SGHA 4ILJA 2D10A 2EMTA 4JKCA 2HE7A 3E66A 3U8ZA 4JK9A 2D11A 1GC6A 3QIJA 3FP5A 4ZRJA 2LBBA 2J0MA 5IJMA 4JKDA 2FDQA 3ZDTA 4TKNA 4JKFA 3SBTA 1DIKA 3IVFA 2I1JA 4NY0A 1JDEA 4ILGB 2ABDA 3G9WA 4JK7A 2AL6A 4JKBA 2R82A 4JKEA 3BINA 4ZRKA 1MIZB 2X0SA 1EF1A 1KC7A
chains in the Genus database with same CATH topology
1ISNA 3FLVA 2FJ9A 1NVLA 2J0JA 4JKAA 4JKGB 1GGOA 3E9LA 3WA0A 3AU4A 1GC7A 4GXBA 4YL8A 2EMSA 5JVLA 1ACAA 1NI2A 3X23A 2DIKA 2HRJA 2RQ1A 2COPA 1HB6A 1NTIA 1E5WA 4F7GA 2WH5A 3AU5A 4ZRIA 1Y19B 1MK9B 1HBKA 4P7IA 1MIXA 2CB8A 3E9PA 1HB8A 1KBLA 2AEHA 2YVCA 4JK8A 4HDOA 4JKGA 3PZDA 1J19A 4EKUA 1VBHA 1VBGA 2J0KA 3SBGA 2D2QA 3E9OA 3ENBA 4CYEA 4JKHA 4DXAB 2ZPYA 4ILHA 1MK7B 2CQUA 3PVLA 1ST7A 1GG3A 2I1KA 3EPYA 4HDQA 3U7DA 1H4RA 1SGHA 4ILJA 2D10A 2EMTA 4JKCA 2HE7A 3E66A 3U8ZA 4JK9A 2D11A 1GC6A 3QIJA 3FP5A 4ZRJA 2LBBA 2J0MA 5IJMA 4JKDA 2FDQA 3ZDTA 4TKNA 4JKFA 3SBTA 1DIKA 3IVFA 2I1JA 4NY0A 1JDEA 4ILGB 2ABDA 3G9WA 4JK7A 2AL6A 4JKBA 2R82A 4JKEA 3BINA 4ZRKA 1MIZB 2X0SA 1EF1A 1KC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISN A;  4ZRJ A;  2ZPY A;  3FLV A;  2LBB A;  4F7G A;  2J0M A;  5IJM A;  2FJ9 A;  2WH5 A;  1NVL A;  1MK7 B;  2CQU A;  2J0J A;  3AU5 A;  1Y19 B;  2FDQ A;  4ZRI A;  3PVL A;  1MK9 B;  1HBK A;  1ST7 A;  3ZDT A;  1GG3 A;  2I1K A;  3EPY A;  4HDQ A;  4P7I A;  3U7D A;  1H4R A;  1MIX A;  3IVF A;  2CB8 A;  3WA0 A;  2I1J A;  3AU4 A;  4NY0 A;  1HB8 A;  2ABD A;  2AEH A;  2YVC A;  3G9W A;  2D11 A;  1GC7 A;  1SGH A;  2AL6 A;  4HDO A;  2D10 A;  4YL8 A;  2EMT A;  2EMS A;  3PZD A;  1ACA A;  1J19 A;  1NI2 A;  3X23 A;  4EKU A;  2HE7 A;  2HRJ A;  2J0K A;  3BIN A;  4ZRK A;  1MIZ B;  2RQ1 A;  2D2Q A;  1EF1 A;  2COP A;  4CYE A;  1HB6 A;  1NTI A;  3U8Z A;  1GC6 A;  4DXA B;  3QIJ A;  3FP5 A;  1E5W A; 
#chains in the Genus database with same CATH topology
 1ISN A;  3FLV A;  2FJ9 A;  1NVL A;  2J0J A;  4JKA A;  4JKG B;  1GGO A;  3E9L A;  3WA0 A;  3AU4 A;  1GC7 A;  4GXB A;  4YL8 A;  2EMS A;  5JVL A;  1ACA A;  1NI2 A;  3X23 A;  2DIK A;  2HRJ A;  2RQ1 A;  2COP A;  1HB6 A;  1NTI A;  1E5W A;  4F7G A;  2WH5 A;  3AU5 A;  4ZRI A;  1Y19 B;  1MK9 B;  1HBK A;  4P7I A;  1MIX A;  2CB8 A;  3E9P A;  1HB8 A;  1KBL A;  2AEH A;  2YVC A;  4JK8 A;  4HDO A;  4JKG A;  3PZD A;  1J19 A;  4EKU A;  1VBH A;  1VBG A;  2J0K A;  3SBG A;  2D2Q A;  3E9O A;  3ENB A;  4CYE A;  4JKH A;  4DXA B;  2ZPY A;  4ILH A;  1MK7 B;  2CQU A;  3PVL A;  1ST7 A;  1GG3 A;  2I1K A;  3EPY A;  4HDQ A;  3U7D A;  1H4R A;  1SGH A;  4ILJ A;  2D10 A;  2EMT A;  4JKC A;  2HE7 A;  3E66 A;  3U8Z A;  4JK9 A;  2D11 A;  1GC6 A;  3QIJ A;  3FP5 A;  4ZRJ A;  2LBB A;  2J0M A;  5IJM A;  4JKD A;  2FDQ A;  3ZDT A;  4TKN A;  4JKF A;  3SBT A;  1DIK A;  3IVF A;  2I1J A;  4NY0 A;  1JDE A;  4ILG B;  2ABD A;  3G9W A;  4JK7 A;  2AL6 A;  4JKB A;  2R82 A;  4JKE A;  3BIN A;  4ZRK A;  1MIZ B;  2X0S A;  1EF1 A;  1KC7 A; 
#chains in the Genus database with same CATH homology
 1ISN A;  3FLV A;  2FJ9 A;  1NVL A;  2J0J A;  4JKA A;  4JKG B;  1GGO A;  3E9L A;  3WA0 A;  3AU4 A;  1GC7 A;  4GXB A;  4YL8 A;  2EMS A;  5JVL A;  1ACA A;  1NI2 A;  3X23 A;  2DIK A;  2HRJ A;  2RQ1 A;  2COP A;  1HB6 A;  1NTI A;  1E5W A;  4F7G A;  2WH5 A;  3AU5 A;  4ZRI A;  1Y19 B;  1MK9 B;  1HBK A;  4P7I A;  1MIX A;  2CB8 A;  3E9P A;  1HB8 A;  1KBL A;  2AEH A;  2YVC A;  4JK8 A;  4HDO A;  4JKG A;  3PZD A;  1J19 A;  4EKU A;  1VBH A;  1VBG A;  2J0K A;  3SBG A;  2D2Q A;  3E9O A;  3ENB A;  4CYE A;  4JKH A;  4DXA B;  2ZPY A;  4ILH A;  1MK7 B;  2CQU A;  3PVL A;  1ST7 A;  1GG3 A;  2I1K A;  3EPY A;  4HDQ A;  3U7D A;  1H4R A;  1SGH A;  4ILJ A;  2D10 A;  2EMT A;  4JKC A;  2HE7 A;  3E66 A;  3U8Z A;  4JK9 A;  2D11 A;  1GC6 A;  3QIJ A;  3FP5 A;  4ZRJ A;  2LBB A;  2J0M A;  5IJM A;  4JKD A;  2FDQ A;  3ZDT A;  4TKN A;  4JKF A;  3SBT A;  1DIK A;  3IVF A;  2I1J A;  4NY0 A;  1JDE A;  4ILG B;  2ABD A;  3G9W A;  4JK7 A;  2AL6 A;  4JKB A;  2R82 A;  4JKE A;  3BIN A;  4ZRK A;  1MIZ B;  2X0S A;  1EF1 A;  1KC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...