1NVLA

Rdc-refined nmr structure of bovine acyl-coenzyme a binding protein, acbp, in complex with palmitoyl-coenzyme a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Acyl-CoA-binding protein
publication title RDC-refined NMR structure of bovine Acyl-coenzyme A Binding Protein, ACBP, in complex with palmitoyl-coenzyme A
rcsb
source organism Bos taurus
total genus 31
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1nvlA00
4ZRIA 1E5WA 1MIZB 2CB8A 2LBBA 1GC6A 2ZPYA 3PZDA 1HB6A 1MK7B 1ST7A 2D2QA 4ZRKA 2AEHA 3EPYA 1EF1A 2YVCA 2I1JA 1MIXA 2FJ9A 2WH5A 2AL6A 3G9WA 3PVLA 1ACAA 1NI2A 2J0KA 3AU4A 2HRJA 3BINA 2ABDA 3AU5A 1HB8A 3WA0A 1NTIA 4NY0A 1HBKA 1GG3A 2D11A 3QIJA 1MK9B 1Y19B 2EMTA 4YL8A 1GC7A 4ZRJA 4HDOA 2I1KA 2HE7A 2COPA 3FP5A 1ISNA 1H4RA 3IVFA 4EKUA 2J0JA 2D10A 4F7GA 4HDQA 3U7DA 3U8ZA 2J0MA 3FLVA 3ZDTA 1SGHA 4P7IA 2EMSA 4DXAB 5IJMA 2FDQA 1J19A 1NVLA 2RQ1A 4CYEA 3X23A 2CQUA
chains in the Genus database with same CATH superfamily
4ZRIA 1E5WA 4JK9A 1HB6A 1MK7B 3SBTA 3G9WA 1ACAA 1JDEA 3BINA 1VBHA 1HBKA 3QIJA 2EMTA 2X0SA 4ZRJA 4EKUA 1ISNA 3ENBA 4HDQA 4ILHA 3U8ZA 2J0MA 1SGHA 1KBLA 4ILGB 4GXBA 1MIXA 1J19A 2RQ1A 2LBBA 3U7DA 3PZDA 1GC6A 4ZRKA 1ST7A 2YVCA 3AU4A 2HRJA 1DIKA 2ABDA 1HB8A 3WA0A 4NY0A 1MK9B 4JKCA 4JK7A 3FP5A 2J0JA 2D10A 1GG3A 4CYEA 2CB8A 2D2QA 4JKDA 2AEHA 3EPYA 2AL6A 3PVLA 4JKAA 2J0KA 3E9PA 1KC7A 1VBGA 4JKGB 1NTIA 2D11A 4JKFA 1Y19B 4TKNA 5JVLA 4ILJA 4HDOA 3E9OA 2I1KA 3SBGA 4JKBA 4JK8A 2COPA 3IVFA 4F7GA 4DXAB 5IJMA 3E66A 4P7IA 1NVLA 3X23A 1MIZB 2ZPYA 1EF1A 2I1JA 2WH5A 2FJ9A 4JKGA 1NI2A 3AU5A 2DIKA 3E9LA 4YL8A 1GC7A 4JKHA 4JKEA 1GGOA 2HE7A 1H4RA 3ZDTA 3FLVA 2EMSA 2R82A 2FDQA 2CQUA
chains in the Genus database with same CATH topology
4ZRIA 1E5WA 4JK9A 1HB6A 1MK7B 3SBTA 3G9WA 1ACAA 1JDEA 3BINA 1VBHA 1HBKA 3QIJA 2EMTA 2X0SA 4ZRJA 4EKUA 1ISNA 3ENBA 4HDQA 4ILHA 3U8ZA 2J0MA 1SGHA 1KBLA 4ILGB 4GXBA 1MIXA 1J19A 2RQ1A 2LBBA 3U7DA 3PZDA 1GC6A 4ZRKA 1ST7A 2YVCA 3AU4A 2HRJA 1DIKA 2ABDA 1HB8A 3WA0A 4NY0A 1MK9B 4JKCA 4JK7A 3FP5A 2J0JA 2D10A 1GG3A 4CYEA 2CB8A 2D2QA 4JKDA 2AEHA 3EPYA 2AL6A 3PVLA 4JKAA 2J0KA 3E9PA 1KC7A 1VBGA 4JKGB 1NTIA 2D11A 4JKFA 1Y19B 4TKNA 5JVLA 4ILJA 4HDOA 3E9OA 2I1KA 3SBGA 4JKBA 4JK8A 2COPA 3IVFA 4F7GA 4DXAB 5IJMA 3E66A 4P7IA 1NVLA 3X23A 1MIZB 2ZPYA 1EF1A 2I1JA 2WH5A 2FJ9A 4JKGA 1NI2A 3AU5A 2DIKA 3E9LA 4YL8A 1GC7A 4JKHA 4JKEA 1GGOA 2HE7A 1H4RA 3ZDTA 3FLVA 2EMSA 2R82A 2FDQA 2CQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRI A;  1E5W A;  1MIZ B;  2CB8 A;  2LBB A;  1GC6 A;  2ZPY A;  3PZD A;  1HB6 A;  1MK7 B;  1ST7 A;  2D2Q A;  4ZRK A;  2AEH A;  3EPY A;  1EF1 A;  2YVC A;  2I1J A;  1MIX A;  2FJ9 A;  2WH5 A;  2AL6 A;  3G9W A;  3PVL A;  1ACA A;  1NI2 A;  2J0K A;  3AU4 A;  2HRJ A;  3BIN A;  2ABD A;  3AU5 A;  1HB8 A;  3WA0 A;  1NTI A;  4NY0 A;  1HBK A;  1GG3 A;  2D11 A;  3QIJ A;  1MK9 B;  1Y19 B;  2EMT A;  4YL8 A;  1GC7 A;  4ZRJ A;  4HDO A;  2I1K A;  2HE7 A;  2COP A;  3FP5 A;  1ISN A;  1H4R A;  3IVF A;  4EKU A;  2J0J A;  2D10 A;  4F7G A;  4HDQ A;  3U7D A;  3U8Z A;  2J0M A;  3FLV A;  3ZDT A;  1SGH A;  4P7I A;  2EMS A;  4DXA B;  5IJM A;  2FDQ A;  1J19 A;  1NVL A;  2RQ1 A;  4CYE A;  3X23 A;  2CQU A; 
#chains in the Genus database with same CATH topology
 4ZRI A;  1E5W A;  4JK9 A;  1HB6 A;  1MK7 B;  3SBT A;  3G9W A;  1ACA A;  1JDE A;  3BIN A;  1VBH A;  1HBK A;  3QIJ A;  2EMT A;  2X0S A;  4ZRJ A;  4EKU A;  1ISN A;  3ENB A;  4HDQ A;  4ILH A;  3U8Z A;  2J0M A;  1SGH A;  1KBL A;  4ILG B;  4GXB A;  1MIX A;  1J19 A;  2RQ1 A;  2LBB A;  3U7D A;  3PZD A;  1GC6 A;  4ZRK A;  1ST7 A;  2YVC A;  3AU4 A;  2HRJ A;  1DIK A;  2ABD A;  1HB8 A;  3WA0 A;  4NY0 A;  1MK9 B;  4JKC A;  4JK7 A;  3FP5 A;  2J0J A;  2D10 A;  1GG3 A;  4CYE A;  2CB8 A;  2D2Q A;  4JKD A;  2AEH A;  3EPY A;  2AL6 A;  3PVL A;  4JKA A;  2J0K A;  3E9P A;  1KC7 A;  1VBG A;  4JKG B;  1NTI A;  2D11 A;  4JKF A;  1Y19 B;  4TKN A;  5JVL A;  4ILJ A;  4HDO A;  3E9O A;  2I1K A;  3SBG A;  4JKB A;  4JK8 A;  2COP A;  3IVF A;  4F7G A;  4DXA B;  5IJM A;  3E66 A;  4P7I A;  1NVL A;  3X23 A;  1MIZ B;  2ZPY A;  1EF1 A;  2I1J A;  2WH5 A;  2FJ9 A;  4JKG A;  1NI2 A;  3AU5 A;  2DIK A;  3E9L A;  4YL8 A;  1GC7 A;  4JKH A;  4JKE A;  1GGO A;  2HE7 A;  1H4R A;  3ZDT A;  3FLV A;  2EMS A;  2R82 A;  2FDQ A;  2CQU A; 
#chains in the Genus database with same CATH homology
 4ZRI A;  1E5W A;  4JK9 A;  1HB6 A;  1MK7 B;  3SBT A;  3G9W A;  1ACA A;  1JDE A;  3BIN A;  1VBH A;  1HBK A;  3QIJ A;  2EMT A;  2X0S A;  4ZRJ A;  4EKU A;  1ISN A;  3ENB A;  4HDQ A;  4ILH A;  3U8Z A;  2J0M A;  1SGH A;  1KBL A;  4ILG B;  4GXB A;  1MIX A;  1J19 A;  2RQ1 A;  2LBB A;  3U7D A;  3PZD A;  1GC6 A;  4ZRK A;  1ST7 A;  2YVC A;  3AU4 A;  2HRJ A;  1DIK A;  2ABD A;  1HB8 A;  3WA0 A;  4NY0 A;  1MK9 B;  4JKC A;  4JK7 A;  3FP5 A;  2J0J A;  2D10 A;  1GG3 A;  4CYE A;  2CB8 A;  2D2Q A;  4JKD A;  2AEH A;  3EPY A;  2AL6 A;  3PVL A;  4JKA A;  2J0K A;  3E9P A;  1KC7 A;  1VBG A;  4JKG B;  1NTI A;  2D11 A;  4JKF A;  1Y19 B;  4TKN A;  5JVL A;  4ILJ A;  4HDO A;  3E9O A;  2I1K A;  3SBG A;  4JKB A;  4JK8 A;  2COP A;  3IVF A;  4F7G A;  4DXA B;  5IJM A;  3E66 A;  4P7I A;  1NVL A;  3X23 A;  1MIZ B;  2ZPY A;  1EF1 A;  2I1J A;  2WH5 A;  2FJ9 A;  4JKG A;  1NI2 A;  3AU5 A;  2DIK A;  3E9L A;  4YL8 A;  1GC7 A;  4JKH A;  4JKE A;  1GGO A;  2HE7 A;  1H4R A;  3ZDT A;  3FLV A;  2EMS A;  2R82 A;  2FDQ A;  2CQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...