3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein
molecule keywords Myosin-X
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
1EGXA 2LRUA 1NTVA 1BT0A 3B08A 1X11A 3PPAA 4EKUA 2N0YA 1FHWA 4GZUA 4IM0A 3ZUNA 1IRSA 1V5PA 5D6JB 5JZEB 2ROVA 1EVHA 5AZHA 3ULBA 5DIFB 1WGGA 3PSCA 5C16A 4HCPB 1V89A 2UZRA 2LGYA 3H6NA 3NZSA 4FHJA 5D94A 2C60A 1V5UA 2PZ1A 5HKHA 2R0DA 1FGZA 2KFKA 1AWEA 4HB4B 1YD8U 1I35A 3A98B 2KJ6A 1WJ4A 3VUXA 3UINB 4NQKE 3APDA 4ZDVA 3M95A 1XT9B 2PJHA 3LDZE 3DVNV 1P1AA 4XC2A 3VHTC 1XD3B 2K2JA 5G55A 4NY0A 4WJQA 3RYTA 2GS0A 1WXVA 2P0FA 2KKCA 4IOYX 2D9VA 3SNHA 2ZEQA 3T8MA 1TXDA 3ULCA 2KXJA 2LXAA 1WJUA 3A8QA 4CYEA 2LKOA 1S1QB 3D8DA 2NPTB 2R2OA 1SHCA 4A20A 5J18A 2YS1A 4HAYB 4AP4C 3EPYA 2WH5A 1TTNA 2MLBA 3BJIA 1FOEA 4GMVA 1RLFA 1HB6A 2CHWA 2K39A 3QK0A 2M0XA 2WX0A 4F7ZA 3DBRI 3PVWA 3NOBA 4MH0E 1WX9A 1NTYA 1U5GA 3OLMD 4IWQA 2C5LC 2DHIA 3KRWA 2RR9A 4MSMB 4W9FA 3HIZA 4F1SA 2UWQA 2MP2A 3D32A 1UPQA 2N4FA 4MGYE 2ZVOA 1VCBA 3IG3A 2JPHA 1E8XA 3RCZA 4KHAA 1E8WA 4TKNA 1LM8B 2DAJA 2REXA 3V61A 4AUQC 1XR0B 4ZRJA 4J6IA 3MDBC 1UGMA 1WFYA 4ICVA 3VAWA 3KH0A 2J59M 3FSSA 3G9WA 5C79A 2G45B 4PS7A 2KMCA 3VOQA 4HAWB 2GBJA 2PEAA 3DCGA 2MDXA 3DXCA 3W1SC 1EF1A 2DZKA 2N7DA 1BTNA 3WA0A 3MJWA 5CHWA 3DXDA 2M8SA 4DBGA 1WM2A 4W9DA 2NBUA 3ZRCA 3I3TB 1Q67A 4PS3A 4FLHA 5AZGA 2D2QA 1ZC4B 2KFJA 3QJZA 4WJNA 1WYWB 4W9LA 3KUDB 2ADZA 4TUUA 4M8MA 1YX6B 3FM8C 4K2PA 2KC1A 3TO1A 2KO3A 4WQOB 4FBJB 3TCAA 2ZJDA 2FCNA 4H8SA 2DYBA 4HXDA 2KTRB 1EO6A 2L8JA 2ZPYA 1P9DU 2L1CA 4BFRA 5IAAC 2DHZA 4C0AA 3N3KB 1AQCA 2N7EA 3AXCA 2ROZB 1GC7A 2O6VB 1J0WA 1LQBA 1MG8A 2CKHB 2KDFB 2ZCBA 4WWNA 2KVRA 1WJMA 2KWVB 2NCNA 2HTHB 4L6EA 3N7CA 1E90A 5DH9B 3M62B 3MTNB 3RZFA 5LXIB 2ZPNA 2KDBA 4IWOA 4LJOB 2WWZA 4A5KA 2KJRA 2KN5A 1OMWA 3SDLC 5C1ZA 4WJ7A 1KI1B 4WSFA 1YQBA 3L54A 4BOSC 2IO3B 2MBQA 1Y19B 2ELAA 1WJ6A 4NJ7A 2VKIA 5EFXA 5D27A 2P0DA 2EC1A 2G4SA 2MBBB 2K8HA 3PS6A 4GDKA 2P8VA 1OQYA 1W1GA 2MX2A 3SD5A 4W9CA 2LUEA 2MCNB 2GBKA 1HBKA 4MSQB 4DHZE 4HK2A 1E5WA 1E7UA 1WZ0A 1LFDA 3APCA 4GGQA 2FIFA 2KD0A 2XBBC 3N30A 5E6PA 2KGXB 3PEGA 4A6HA 5D2MB 5GMVA 2N9EB 4B9KA 4ANUA 2KCJA 3RCPA 2GBNA 3VQIA 5GOWB 1WM3A 3GOEA 5FI0A 1RAXA 2YT0A 3QWMA 1X1MA 1TZ1A 2LVQA 5HE3A 2C7HA 2RGFA 4WVFB 2RPQA 4PYZA 4BBNF 5CHVC 2G3QB 2FDQA 3T06A 5HE2A 4MK0A 2GJYA 4HHVA 1E7VA 1KJTA 4EZKA 4K2OA 5J3QA 1UNQA 1WJNA 2MW5A 3SO6A 3TBLD 4ANXA 4G3XB 1BTKA 1WI0A 3A9JA 3ZDTA 3AU5A 2KX3A 4K81A 2LI5A 3C0RB 4K7UA 1MK9B 2L2IA 3PRPB 1WE7A 2N1VA 2Z0DB 3VFKA 3HQCA 1DDMA 2YT1A 4Z2MB 2CB8A 3FEHA 1XD4A 2LWPA 3JVZX 1Y5OA 2O2VB 2W2WA 5G2NA 3O65B 2LYDA 2HTHA 1P3RA 3K9PB 4NJ6A 2VSZA 4A3PA 1OEYA 2L0FA 4MGIE 2EMTA 3W1SA 1TGZB 3KY9A 5IA7A 3PVLA 2ZZPB 2K1FA 3V5WA 1V5OA 1A5RA 2NZ8B 3TFMA 3H7SA 4ASWC 5DCNA 1I2HA 4B95A 4HATB 4XX5A 3VH3B 1ZVRA 1V49A 4LDTB 4PNKA 2KX0A 3D8FA 4IFSA 3KSYA 1QC6A 2KOXA 4HPLB 4JL9A 4KZ0A 4NNJB 5BO4B 5L95C 4K17A 2NBVB 3H1UA 4AOFA 3QQ8B 2I1JA 3H9DA 2O6VD 3TMPB 2M38A 2V3SA 1KZ7A 3RUIB 2V1YA 3VUWA 2FCMA 1I7AA 2KNBA 1V2YA 3WIMA 4MDKE 1L7YA 1V6EA 1WGUA 2FIDA 4WWOA 5CX3A 3VVWB 1Z87A 2XK5A 1QQGA 1MIZB 2YF0A 3ALBA 1TBEA 2K2UA 3KRXA 2BF8B 2C9WB 2KK8A 2HE7A 2L00B 4Y94A 3CSFA 4KHOA 1Z5SB 3IVFA 3L0WB 3TIXA 1TJ6A 3F0WA 2DKPA 3ML8A 4IC7B 4B6HA 3QHTA 2LZ6A 4ANVA 3FLVA 5HE0A 4EJNA 4DDID 3A9KA 3JW0X 1W1DA 3LJUX 2HRJA 2UYZB 4DBBA 3HM3A 1WGDA 2LVPA 4IUMB 1BWNA 1XODA 4KDIC 2FJLA 3CMMB 1ZSQA 1FB8A 5KHQA 1WGRA 2N1WA 2L3ZA 3OJ3A 3ECIA 2DA0A 4YL8A 2I5CA 1U5EA 2GCJA 3HK0A 1SE9A 3WALA 2LGXA 2JY6A 1Q0WB 4KSKC 3P2BA 2JP2A 4GOCA 2DN6A 3D8EA 3ZVRA 4EZLA 3GYOA 1WZ3A 4NAWA 3R66C 2DFKA 2M4NA 4EOYA 1OY2A 2BYEA 1U5DA 2IYDB 2BKRB 1V86A 2DX5B 3UIPB 1TQZA 3CIKA 3M1IB 2Y8GA 1UELA 3SUZA 1WX8A 3DVGY 4HAXB 2GBMA 3U8ZA 3PV1A 1EUVB 4NAWB 3PG7A 3QC8B 2FCSA 1I42A 1FGYA 1WI1A 3CXBB 2KLGA 2ZNVB 2YS5A 4DDGD 2D9XA 4GXBA 1PLSA 4IAPA 2C7NB 2EKEC 2GBRA 1WE6A 2DZMA 3ODOA 4G0NB 4ICUA 4RM9A 1D3ZA 2LD9A 3RD2A 4FJYA 3ZIMA 5DHFB 2MFQA 3TVVA 4Z2NA 2K00A 3SV1A 2AL3A 2D9YA 2MA9B 4LDTD 3V62A 4GN1A 4HB3B 2W2XC 3A9KB 2K8BA 4KIKA 2MQJA 2PPHA 1NI2A 1X1GA 3SYXA 1ST7A 3PTFC 3HM6X 1EF5A 1P5TA 2H7DA 2X18A 2Q13A 3IBEA 3QAQA 3ZNID 2LVOA 4EMOA 1V61A 1KOTA 3DOWA 1WMHA 2LRWA 4BOZB 2KC2A 1X1FA 4HVBA 2JZZA 3B1LX 2LOZA 1KZGA 2MBHA 3KUCB 4KZCA 2QKLA 4FJZA 4PS8A 4URKA 4TV3A 5JHHA 2I5FA 4DHZB 4WJOA 3PVUA 4DX8A 3KYDD 1Q1OA 2G35A 2MBEA 2WYQA 3HHMA 4RM8A 2LULA 3EFUA 3U30A 3ZTCA 5AEKB 3CF6E 2MWSB 1UBQA 2NVUI 3A4SC 4FA6A 3VTVA 3ENEA 4HLEA 1WF9A 1ZGUB 2OTXA 2BWES 4CO7A 4DWFA 3IFWB 1DDWA 2QKMA 4NPNA 1UH6A 2J7QB 2N9XA 3PSEB 5JHBA 4NSWA 1WMHB 5CHFA 1P0RA 3APFA 1RFAA 3ZNHB 1OQNA 3DQVA 4DHJD 1YX5B 3PLUA 4HAUB 3KYCD 3A8PA 5D3XA 5DI9B 2KFKB 2R2QA 4I6LB 2MWNB 2WX1A 4EZJA 2ZVNA 3ODWA 3PZDA 2DYOA 2IY0B 1C3TA 4DX90 2JXXA 3WAOA 2CQUA 2D3GA 1EAZA 2GCLA 2FNJB 3VUYA 5L81A 2KHWB 3NZUA 2D4QA 3VDZA 4FADA 2LXCA 2GMIC 2HD5B 2JF5A 1CMXB 2J0KA 3W1YA 2AEHA 4WJPA 2BCJA 5DPTA 1Y8RC 2KJHB 1WG7A 5J17A 1K8RB 1U29A 2KZRA 2LG1A 3R7QA 1U2BA 1WRDB 3PRMB 3QCAA 3CSTA 3FP5A 1P6SA 2VRWB 2KWUB 2Y8FA 3PT2B 4W9KA 1HE8A 4EEWA 1PQSA 3SHQA 4F8CB 5J2RA 2LASA 1WXAA 2DHKA 3QWZB 1U4AA 1UPRA 3NY5A 3R3MA 1UZXB 4FULA 3P7ZA 1OGWA 2Z0EB 2MP2B 3WYFB 3DPDA 1XCGA 5J3YA 2XEWA 1K5DB 4A3OA 1E8ZA 4JGHB 2YLMA 3AU4A 1IPGA 2CHZA 2FUHB 4ZYNA 3ZRFA 4TQ1A 4CHKA 5L83A 4WAAA 4XZ4A 3NS8A 3UQAA 1GUAB 2OQBA 4BBKA 1F9JA 2FAZA 2L7RA 2D9WA 2W9NA 3UIOB 2CAYA 2DTCA 5CLLB 5JP4A 3AJ4A 1WIAA 1WX7A 3QARA 1H10A 4A6KA 4K7WA 4X57B 4WWPA 3GYPA 3DBHI 4JIOU 1AARA 4KDLB 3A33B 1JRUA 2D9ZA 3PP2A 2IZVB 2JRIB 2JUOA 2KTFA 3H7PA 4IG7B 4PYUA 5JH5C 4HDOA 2DZIA 4BBNC 5IJMA 1LB1A 5KQ4A 3TJPA 2KLCA 5D3VA 5C5BA 5DPWA 3TW1A 4EFOA 4IWPA 3KVFB 1GG3A 1DROA 3L10B 4ZRIA 5FR6A 4HB2B 1U27A 1V5TA 3EC8A 4BKSA 2KMAA 3R7RA 2CRFA 3HW2B 2IYBA 1L2NA 1XX0A 1MAIA 1V80A 2YVCA 2XK5B 5EDSA 3UQBA 2YRYA 2RGNB 2N9PC 1NU2A 3V6EB 2RD0A 2LBBA 2LOXA 2KWCA 3N32A 2KTRA 2Z59B 4W9IA 4YONA 1DBHA 1WGYA 3EECA 4G50A 1S3SG 1OEYJ 2CR5A 1N3HA 2L05A 2M1MA 2DYNA 2NBWB 2CY5A 3IHPC 4HCNB 4BKGA 2EMSA 4DHJB 3VH4B 1H8CA 2D10A 2ZCCA 3DVNU 4F7UP 4GU2A 2OJRA 5CLQB 3M3JA 2K6DB 4AJYB 4II3B 3OAWA 1WH3A 4MT7A 1PFJA 3M63B 2JRHA 3V6CB 1YIWA 1RJ2A 4KAXB 3NHEB 4GDLB 4LJPB 4NQLB 5D7GA 5DHAB 2JZ3B 2G4DB 2K8CA 2RLOA 3RULA 3A4RA 1KLVA 2RUKB 3ODXA 2MRPA 2IO1B 4BKTA 1XKEA 3P6AA 2KQ7A 2IFSA 2FCQA 4XWXA 3BINA 1HB8A 1ACAA 3Q3FA 1ZW7A 3ZO5B 1J0GA 2GOWA 4W9JA 2AYOB 3K9OB 2DKQA 5LLIA 2YS3A 3O96A 1J19A 3U7DA 3VIAA 1WR6E 3ZNZB 1IYFA 1FAOA 3WANA 4F7GA 3PLVA 2Z0OA 1XQQA 2CS4A 2CODA 1V81A 2CU1A 1X86A 1M7RA 2PE6B 3JSVB 4I6PA 5LONB 2XQNM 4CHMA 4KVGB 1WJ1A 1PMSA 1WXMA 4K1RB 4D0NB 4MEMA 1MIXA 2H7EA 3SU8X 2I1KA 1K5GB 1NVLA 2KQSA 5C23A 4ANWA 1B55A 5TR5A 2DX1A 4BVUC 3ZLZA 3PGEA 3PRZA 3X0WA 4CHJA 2FJ9A 3ZNGC 4MJSB 2W2XD 3A9JB 2KUPA 5HE1A 3T9LA 3QX1A 1NTIA 2IO0B 1WY8A 3F5RA 2V76A 2BKFA 1UBIA 2ZNVC 3GZNI 3PREA 4GIVA 4IM2A 1QZEA 3V60A 3LJ3A 4PQ0A 3MPXA 2DYMA 2BYVE 1Q5WB 3A1QA 2O2VA 4B6WA 4KIKB 4E3CA 1LXDA 2CY4A 2LJ5A 3L08A 3RZWC 2DZJA 3JSVA 1WVHA 5CTRC 2KDIA 2Y5BB 3PHWB 2L76A 4W9EA 2COPA 1WGHA 2DAFA 4HWIB 2JT4B 2IY1B 4HPMB 4MELA 4GDLA 1UEFA 1RRPB 2Z0QA 1M7EA 1YJ1A 2JVCA 3L16A 2KANA 4I6NB 4AWJA 4HDQA 2ELBA 4JLCA 3ZTDA 2R09A 1SGHA 2D11A 3DXEA 5D3YA 1ISNA 5LOPB 3DVGX 4EUTA 2RNRB 1WXSA 2QHOA 3AI5A 1WGQA 1BAKA 2A5UA 5KQ1A 2KDEB 3BY4B 3DBLI 3EHVA 2VRRB 5J3TA 3ZKJC 2P0HA 2O6VA 4BKSD 2J0MA 5KCVA 1FHOA 3VTUA 4KHBB 1UNRA 3UZTA 2MSED 1FHXA 4JQWC 4RMAA 1MPHA 1ZM0A 3VTWA 3OANA 3Q3JA 5LXHA 2COAA 2NR2A 1V88A 2RSUA 1GNUA 5DPRA 4TQ0A 3KZ1A 2OOBB 5JLJB 3ONSA 2NS5A 3UF8A 1J8CA 1C1YB 1T0YA 2DYQA 4ZRKA 2BYFA 2K25A 3AULA 5C6RA 1Z2MA 3ZW3A 1G6JA 4GDKB 3X23A 4HJKA 4FJVB 1MKEA 4GMXB 2BWFA 4A6FB 3DBSA 2B3AA 2C7MB 4G11A 3QBVB 1R4NI 4GSWA 1GJZA 1R4MI 2RSGA 5FI1A 4FHKA 2DLWA 4E71A 2IO2B 2DX5A 4K7SA 4TYZA 4MY6A 2AWTA 4GB9A 4P7IA 4LCDE 3S2AA 3UGBB 1KM7A 4HB0B 3ZVVA 2COCA 5D3WA 2J0JA 1IP9A 3PHXB 2AL6A 1MK7B 2RVBB 3DDCB 3L13A 2BGFA 2BPSA 4II2B 4KSLC 2ASQA 4MJSA 3NSUA 2PE9A 1E8YA 2M17A 5AZFA 2WDTB 1ZKHA 4M8NA 3RT3B 2K6QA 2JWZA 2E2XA 2V4LA 2MKRA 1V9JA 1VD2A 4IM3A 4MM3A 4OVUA 4W9HA 4E74A 3OJ4B 3KW5B 2YSZA 1U5FA 3QIJA 4F7HA 1DDVA 3A1QB 1ZC3B 1UNPA 2UVMA 4A6FA 1P98A 2M14A 4DXAB 1DYNA 2UZSA 5E6OA 1H4RA 5C5BB 1OTRB 3ML4A 2L0TA 2MBOA 4KV2A 1NBFC 4M0WB 4N9F4 3MHSD 3ZDMC 4DK5A 2EJ8A 3WAPA 1RRBA 4MGZE 2COFA 1NDDA 5JHGA 2DENB 1SIFA 1UD7A 4HAZB 1LW3A 1GC6A 2NPTA 3VXWA 3KUZA 2RQ1A 2Y7BA 4GPTB 1WR1A 4W9GA 3JYUA 3L17A 4IW0A 2Z0PA 1V5MA 5KHOA 4HAVB 1M94A 4FN2A 5JHAA 2HJ8A 3ML9A 2CHXA 2NMBA 2D07B 3H7PB 5DPSA 3B0AA 1P3QU 5E6NA 3TL5A 2N23A 4AJWA 2IBIB 4OVVA 1W1HA 1FXTB 1X05A 2ABDA 2DHJA 4MGKE 3WAMA 3QA8A 2A4ZA 2LGDA
chains in the Genus database with same CATH superfamily
5BUZA 2ZW1A 2WPVA 4UQZA 3Q69A 2N0YA 4NRHB 1FHWA 4GZUA 5AYWD 5LP0A 4UWHA 5ENRD 3AE4B 3HVZA 2IO3C 2ROVA 3JXIA 3PSCA 1WYGA 1IBXB 3AEDB 2UZRA 2LGYA 2WVIA 1C79A 4FHJA 4Y6CA 5D94A 1V5UA 2PZ1A 4CZ2D 1FGZA 1YD8U 4ILHB 4A6QA 4DXFA 4CT0A 2WXIA 2D5GA 5AQ7A 4KMOA 2IGDA 3LDZE 5ENQD 4WQMA 2YT2A 4NY0A 3RYTA 3FDHA 2P0FA 1E6EB 3SNHA 2D9VA 1WXVA 2KKCA 1TXDA 2R2OA 1WJUA 4GZDA 3D8DA 2NPTB 3RAUA 1SHCA 4HAYB 3EPYA 4PYZA 1FD6A 2H6HA 3BJIA 4GMVA 1RLFA 3CR3A 1HB6A 2K39A 2LJIA 3FEXA 4HOTA 2K22A 3DBRI 3OLMD 4M0WA 4E85A 4JKBA 2DHIA 1NI3A 2RR9A 1C4PA 3Q2AC 2UWQA 2VSXE 2X6HA 3D32A 3UT7A 2ZVOA 4UWGA 1VCBA 2V3PA 2JPHA 1E8XA 1LM8B 2PMVA 2W3SA 4O1NA 4C7YA 2KR0A 2XGMA 4ICVA 3CVNA 3EU5A 2DYSE 3KH0A 5C79A 4L2LA 1E7PB 4Q2JA 2SEBD 4F1PA 2N9KA 4HAWB 2V8SE 4R3DA 1NVID 1O1SA 1EF1A 1MHQA 2NTSA 1XGWA 3ZKJA 3MP9A 1UG3A 2WQYB 3DSXA 3FVCA 2D2QA 3DSWA 2KFJA 3AEBB 1WYWB 2ADZA 3P4RB 3FM8C 2KC1A 4A1SA 2ZJDA 3CHSA 1AWCB 2FCNA 3BYYB 4H8SA 1N9AA 2ZPYA 4ILJA 1QF6A 3D9LA 3FWVA 4BFRA 1J7BA 1DVPA 3BVGA 4C0AA 1AQCA 2N7EA 3LXFA 5FTPA 3FKYA 2KVRA 3AE3B 4U63A 3MTNB 2IGHA 4JVSA 5LXIB 2KDBA 2KWDA 4A5KA 3SDLC 1MHHE 2BB5A 1KI1B 3MKRA 3L54A 5CRVA 1D8EA 3RSEG 2MBQA 3KWVA 3GZNB 3QC1A 1KLGD 4GA2A 3PS6A 2BB6A 4HKZE 1HG5A 3EIJA 2GBKA 2W54A 4DHZE 4G26A 4GGQA 1SZ9A 1XLOA 3JUEA 3S7BA 4O6FA 5GMVA 4BX9A 4ANUA 5FQ4A 4I1OB 2KUQA 3RCPA 3GOEA 1DOYA 2RPQA 4HORA 4WVFB 3ZJTA 3ASDA 2G3QB 2FDQA 5HE2A 4MK0A 3SBTA 4EZKA 5J3QA 2MW5A 1UNQA 2YHCA 2YINA 5FQ8A 1BTKA 2KX3A 2LI5A 3ABLE 5FT9A 3PRPB 2ZXWE 1SQMA 5H8YE 1DDMA 2D3CA 3JVZX 3FHEA 2W2WA 2C0MA 2EKIA 2LYDA 4GYWA 1P3RA 1FCCC 2XCCA 3NUHB 4MLPA 2L0FA 3FUIA 4MGIE 2EMTA 3QWWA 3TWXA 3V5WA 1V5OA 3B2FA 3H7SA 5CMWA 3U4TA 4HLLA 2Y4UA 4B95A 4C0MA 1KT1A 3VH3B 2YEPB 3FFLA 3OTNA 4ACKA 1L6UA 4IFSA 1G3NB 1QC6A 1QILA 1IQUA 4RF1A 2VGXA 1L5PA 3MKQA 4K17A 3ESKA 1TNYA 3I4RB 4FC8A 3TMPB 3ONKA 2V3SA 3BYTB 2QYUA 3B2GA 3BWUD 3ZGZA 4KGRA 5G5HA 4UUCA 1J7CA 3IT6B 4WWOA 1WGUA 2FIDA 1MIZB 4JK7A 1C76A 3V2OA 3D9IA 2P58C 3TIXA 3IVFA 1GW6A 1TJ6A 3D3MA 4ANVA 2L6JA 3QHTA 3OXFA 4DDID 3FLVA 3ZXVA 3JW0X 2UYZB 3LJUX 3HM3A 3W9CB 1A5EA 4DBBA 1MX2A 1WGDA 4KDIC 3HXBA 1I4XA 5KHQA 5G05J 2KCLA 4EECA 4L1BA 4GAAA 3ECIA 1U5EA 1FXAA 3DEOA 2GCJA 3HK0A 4RF0A 4ILGA 4B8AA 2JY6A 3UT8A 1Q0WB 1ELWA 4GOCA 3D8EA 2WXJA 4EZLA 1JCKB 4US9A 3VTXA 4KGTA 3RNFC 5IO9A 3UIPB 4FU3A 1PUTA 1TKYA 3SUZA 1N63A 3E9SA 4HAXB 5D2MC 3LB8C 1I42A 2BTDA 4D2KA 1FGYA 4O60A 3CXBB 2WMNA 3AMZA 2LXMA 4DDGD 4MM3B 4RM9A 2GBRA 2DZMA 3ODOA 1XCTL 2N0SB 1KBLA 2LD9A 2R03A 1JWSD 3TWRA 4LNGA 5B3SE 1INZA 2J07A 2XHEA 3SV1A 2IEJA 3AG3E 3ZYYX 1ZYIA 3S7FA 4AY6A 2AWIA 2K8BA 2ETAA 3SYXA 2Q13A 4LNBA 4EMOA 1V61A 3DOWA 2LRWA 2X0SA 3DSSA 4BOZB 1PC2A 2JZZA 4HXIA 4KBQA 2LOZA 3SF4A 5JHHA 2I5FA 4DX8A 3KYDD 5E6JA 2MBEA 2WB2A 2WYQA 3ZTCA 3NWFA 2BTEA 3MA5A 3CV0A 1N4PA 2C0LA 1Y8MA 2J08A 1KLUD 1N5XA 4J3OD 1WF9A 3FTXA 3FH5A 2OTXA 2BWES 3GE8C 3IFWB 4CSQA 2ZISA 1ACCA 1EM7A 1JMLA 4UQXA 4DX1A 1WMHB 3TGOA 1CJEA 3R9MA 4ITKA 3A8PA 1QT9A 5D3XA 3U7ZA 3CVUA 1YN5A 2R2QA 5IY5E 2XCBA 3ODWA 3PZDA 3R2TA 3WAOA 2JXXA 1EAZA 2FNJB 5L83A 4AY5A 3TEYA 3NZUA 3LPZA 4FADA 2GMIC 3AG2E 5EX3A 5EYPF 1Y8RC 1O1TA 1D5ZC 4JB8P 4JEUA 4PUCA 1K8RB 2LG1A 4NJCA 3ZUVB 4A63B 3PRMB 4AJYB 3CSTA 3ZYKA 4EEWA 1K51A 3Q14C 5J2RA 1WXAA 4WUYA 4NPNA 1UPRA 3FULA 4FULA 1UZXB 4WNDA 1OGWA 4BSZB 2NYJA 3DPDA 2W3RA 2Z0EB 2ONQA 3AS4A 4RVBA 4YTNB 3KLSX 1JQ4A 5AUIA 2CHZA 1IPGA 2FUHB 1K1BA 3ZFWA 2J53A 2K5PA 3GP7A 2OQBA 4S0RA 1FNUA 2WDVB 5CLLB 2MOWA 3AJ4A 1WIAA 4X57B 3CK8A 2IF4A 4JIOU 2BBCA 3PZ3A 3A33B 1N52A 2IZVB 2KTFA 2JRIB 4PYUA 5JH5C 4HDOA 3Q78A 3TJPA 3WCQA 4IWPA 3EUB2 4WNEA 1GG3A 1YQ3B 4ZRIA 1V5TA 4JPSA 3IV0A 1L2NA 2NTTA 2PM6A 1XX0A 5HI7A 2WP9B 3UQBA 4I6EA 3V6EB 2LBBA 2XZTG 4JHKA 3FUNA 2LOXA 1S70B 3QWPA 3N32A 3RNGC 4YONA 2NSZA 3BVZA 1VJKA 3N1YC 3NOCD 1OEYJ 2L05A 4EHMA 4DHJB 2VH1A 3VH4B 5KCMA 2KZTB 2ZCCA 3DVNU 4GU2A 5CLQB 2GRPB 1E0ZA 3UPVA 1WH3A 4MT7A 3EFCA 4LNOA 3M63B 1E96B 1WXQA 1SSNA 4HSIA 4GDLB 3NHEB 5E75A 4NQLB 1KLVA 1MJDA 3RULA 1QBQA 4ZHBA 3Q8EA 3P6AA 1OY3D 3Q3FA 1ACAA 3ZO5B 2GOWA 4CCAA 1OWLA 3BK2A 5LLIA 1J19A 2GRNB 2WU5B 1ZOYB 3ZXRA 2FBWB 3ASHA 4B94A 2CS4A 1V81A 1BPOA 1X86A 1K53A 4EE2A 4CHMA 1NFIE 4MEMA 1MYOA 1B89A 1GPXA 1K5GB 5C23A 2FULA 1YN4A 3E33A 2A5EA 1KPSB 3A9JB 2ILRA 3Q73A 3T9LA 2BKGA 1C4CA 4LK0M 1WY8A 3CGHA 3Q9UC 3F5RA 2BKFA 2OEWA 3UINC 3GZSA 3TWVA 4JKFA 1VRAB 2PIAA 1QZEA 4L1RA 3LJ3A 1JWMD 1DOXA 3AH7A 4YDWA 3LY9A 3LYYA 4KIKB 4RG9A 1LXDA 2LJ5A 5LCWJ 4BESA 2ZU6B 2DZJA 3NF1A 1C9FA 3GS2A 1OUVA 1HH8A 3OXGA 4AEZC 4N39A 2WQ6A 2L76A 1WGHA 1HTQA 4F6RD 2JT4B 2LHEA 1JPLA 4CEMA 4BERA 5KJMA 1M7EA 1RRPB 1UEFA 2Z0QA 2QDFA 4I6NB 4CQNA 2WXFA 2WXOA 2LUMA 3PE4A 2D11A 5LOPB 5D3YA 3DEPA 3PZ1A 4APFA 2P9UG 4HOSA 5KNHD 2RNRB 2QHOA 3BY4B 3EHVA 3DBLI 3ZKJC 1UGJA 2BS3B 1L4DB 4QFVA 1I4GA 3VTUA 3T3NA 4JK9A 3UI2A 1FHXA 3VTWA 2NR2A 1V88A 3KZ1A 3UF8A 1TR4A 2Q5WD 4ACFA 3HVEB 1IKND 2K25A 3ISMC 1Z2MA 3ZW3A 3U66A 4OZAA 3SHFA 1YNTE 1MKEA 5JHAA 3DBSA 4A6FB 4FJVB 2B3AA 2C7MB 1R4MI 1MFWA 3B7BA 2DLWA 2IO2B 2DX5A 3UGBB 1KM7A 2MRIA 4HB0B 4ZYSA 1IP9A 1JWUD 3L13A 3FILB 5AENA 3ESLA 4N2QA 5AJLA 4MJSA 1HFAA 4Z68A 1SF0A 3U2SC 1V1OA 4IM3A 1MX6A 5HG2A 3QIJA 1DDVA 2LMCA 4AVXA 4RQIA 1YOVB 1ZC3B 1UNPA 2UVMA 2ON8A 1S0PA 3ABKE 1DYNA 2M14A 2K0PA 3J5PA 5C5BB 2MBOA 1IXVA 3MHSD 4C00A 3WAPA 4P1BC 2QZAA 3NVYA 1VLBA 4XKCA 2H89B 1MVKA 4GPTB 4DI3A 4W9GA 5FKAC 1AN8A 2W82A 1DOIA 3V05A 1V55E 2D07B 2IPKD 5LFAA 1HS6A 1EPUA 3JCKC 4YDOA 1BMLC 1FXTB 2V3NA 3G2SA 4MGKE 3KQ4A 4QJ4B 3QA8A 1EWYC 3Q8AA 1EGXA 3ABME 1NTVA 1BT0A 3B08A 4YDEA 5KNGA 4M01A 4WURA 1IRSA 4LNFA 1V5PA 2J8SD 5HI1A 1A17A 1NP7A 3ZYMA 4H7XA 1N6ZA 2QILA 2C60A 5B1BE 2R0DA 3B7TA 5CBNA 3ZPJA 1FEHA 1JALA 4HB4B 3A98B 2KJ6A 2BW2A 2RDGA 2ETCA 1FM0D 3TG4A 4QXAB 4NQKE 5I4DA 2PJHA 4XC2A 1P1AA 2ZIRA 3SFEB 4WJQA 2WS3B 4IOYX 3PUJA 2KXJA 3E9LA 1KOTA 3A8QA 5J18A 4A20A 4YTPB 2V9HA 4MACA 4BWRA 1WY6A 4GCNA 2MLBA 2QYJA 4IN3B 3BUAA 4F7ZA 2CHWA 3TWTA 1FPYA 2EINE 1JROA 2M0XA 3TEZA 3PVWA 3NOBA 3ASNE 2XPYA 4XIFA 1YA0A 1U5GA 1H6OA 4HRLA 2PQNA 3RKVA 5CCLA 4W9FA 3Q8FA 2ZGGA 4J0UA 2YNQA 1UPQA 2N4FA 1L0YB 2OEDA 4XWTA 3QKYA 5AJDA 4KHAA 1E8WA 4TKNA 4REZA 3V61A 2REXA 2R5SA 1XR0B 1N5WA 3W9GA 3VAWA 1NA0A 1SEBD 3G9WA 3DHIC 3DXMG 1TS5A 4AS1A 2N9LA 1HZ5A 2WU2B 3UM3A 1FMAD 2PEAA 3MJWA 2DZKA 5MPOA 1VBGA 2M8SA 3LY8A 1IGCA 1W3BA 3ZRCA 2WXMA 4GYOA 4PS3A 1Q67A 1FCHA 3QJZA 1MG4A 3MYVA 3AE8B 2I2YA 5CBOA 2DCPA 2VYIA 3TO1A 1N94A 3U64A 3TCAA 5ENNA 4IYPA 2Z59A 2INPE 2L1CA 5IAAC 4J8EA 3N3KB 4U07A 3CK7A 4K5AB 2ROZB 2RDHA 2TSSA 1GC7A 1XCQL 1MG8A 1JCSA 2KDFB 1ELKA 1WJMA 2HO1A 2NCNA 2HTHB 1K52A 3N7CA 2J4XA 5DH9B 2BQQA 2Z8LA 4LJOB 4RFBA 1KLXA 4UQYA 4WJ7A 1BI8B 2FI7A 1FNVA 1V97A 1V54E 3ZU7B 4BOSC 2IO3B 2ELAA 1WJ6A 4I1MA 1P5QA 2EC1A 2P0DA 3V3XA 3Q7AA 4CDRA 1OQYA 1R4NB 1SJHD 2Z4DA 3SD5A 3ZGQA 4XWWA 1HZ6A 2MCNB 5CEDB 4MSQB 4KGSA 1KC7A 3DSUA 1E5WA 3FTVA 1LFDA 3SR6A 3N30A 3FU3A 4DLOA 4DI4A 5BPPA 4A6HA 4FXCA 1CZPA 3RNBC 4B0ZA 2GBNA 5GOWB 3B95A 5FI0A 3KSQA 2YT0A 1RAXA 4EBAA 5FZRA 1TZ1A 4JKAA 4WNGA 3B77A 4BBNF 1TEZA 5CHVC 1D5XC 1JCRA 2WGSA 2GJYA 5HQ8A 1C78A 1WJNA 3CVLA 1I4HA 2QC9A 3NWAA 1WI0A 2MEKA 3A9JA 3ZDTA 4K81A 3E9PA 3L10B 3RNEC 1MK9B 1EDUA 1TS4A 1WE7A 2N1VA 3Q15A 2Z0DB 2VSOE 1L4ZB 3NZ3A 2LWPA 1Y5OA 4C56C 4GTQA 2HTHA 4NJ6A 2VSZA 1DCQA 1OEYA 4FLBA 3W1SA 1S63A 2K1FA 2QEJC 3TFMA 5I2SA 4ASWC 2L6BA 5DCNA 2WXKA 3Q8CA 1ZVRA 1KF6B 2KX0A 2RFMA 4KZ0A 2KOXA 4HPLB 2MH7A 5BO4B 4JEHA 3D9OA 1FXIA 2QCZA 3MFGA 5L95C 3LDZA 2L9BA 5KBAA 2M38A 2PTLA 2BVCA 1PGBA 1WSPA 2FCMA 2ZGDA 2R02A 3WIMA 1Y6IA 1L7YA 5CX3A 1ZDVA 1OXJA 2KT7A 2XK5A 5T3RA 2YF0A 3ALBA 4HRMB 3KRXA 2FJUB 2KK8A 2HE7A 2L00B 3MCXA 1TNZA 2VJ8A 3RI7C 4JW1A 5LG4B 4M02A 4DPRA 1X81A 1T0QC 4C48B 2H6IA 3SI5A 4DXGA 3BIID 1WGRA 1H6PA 3OJ3A 2WXQA 4R7LA 2I5CA 3Q4AB 4JC8A 4L9PA 4RGTA 5BYSA 4GYYA 4NQ0A 4KSKC 2JP2A 1N11A 3BZDB 2DN6A 3GYOA 1WZ3A 2XEEA 3I5PA 2DFKA 2FBNA 1TNOA 3GW4A 3WG7E 1U5DA 2IYDB 2BKRB 5D0QD 1VR9A 1TQZA 2QSDA 3AS8A 4A3TA 3CIKA 3RN9C 2GRRB 1M4VA 4UWFA 3UIOC 3CVQA 5EKQD 1UN9A 2B6CA 3EU9A 4BTAA 2YS5A 3NVWA 2D9XA 4GXBA 1PLSA 4GPKA 4U04A 1DGJA 4K5CA 3ZIMA 3LS8A 1SE4A 3HRAA 1IHGA 2Q7FA 4RLYA 3V62A 4GN1A 4HB3B 2W2XC 1NEKB 2QFCA 2J52A 3D9PA 3QAQA 4AM9A 1EF5A 1NL4A 3ZNID 2LVOA 4GTOA 1X1FA 1KZGA 2MBHA 3KUCB 4HI8A 2VSYA 3RU0A 2KQ4X 2WXPA 4EQFA 3IXSA 4GPMA 2G35A 3HHMA 4RM8A 3U30A 5FQ7A 3DBLB 5AEKB 3CF6E 4QQIA 5ANRA 2MWSB 1FVFA 1ROEA 4YDYA 2XRZA 2GB1A 3HXCA 2CG3A 2UWJG 4ILHA 4DWFA 1TJCA 3PE3A 4I2ZA 2J7QB 3FU0A 5JHBA 2N9XA 1YJIA 1T0SC 5CHFA 1P0RA 1RFAA 1TJEA 2CFZA 4BSXA 3PLUA 4JWSC 1L0VB 4HAUB 3R9AB 4G8KA 4N3BA 2RDBC 4I9EA 2DIWA 2KFKB 3D9MA 2GRQB 2ZVNA 4NACA 4BEPA 3NS1A 3FUKA 1R4MB 2CQUA 2D3GA 4OSNA 3CVYA 3NJTA 5L81A 2KHWB 1Z6TA 2D4QA 2LXCA 2YQ8A 4WJPA 3TEXA 1HZ4A 2BCJA 5DPTA 2DLBA 3HRDD 3C98A 3PZ7A 2M19A 1SE2A 3JXJA 1U2BA 3P42A 4ZYNA 4FBJB 4G24A 2P9NG 3ASGA 3PT2B 1SZAA 1E10A 2LASA 1F77A 5EILA 5D0OD 5FWQA 2DHKA 3QWZB 4I43A 1J7AA 1U4AA 4HCNB 4S17A 3P7ZA 2MP2B 1QKZA 4HRSA 1V8CA 2JU6X 3FEYA 2XEWA 3P4PB 5ARGA 2Y5CA 1TN7A 3TSSA 1MI0A 3FILA 4RG6A 3NS8A 1SE3A 4YNDA 1FFUA 1GUAB 3UIOB 2W9NA 2D9WA 2DTCA 4XI9A 1WX7A 2XPIA 4A6KA 3W5VB 1KZOA 1IUEA 1AARA 2UU7A 2AJAA 1BUIC 4BT8A 5B1AE 3CHMA 2D9ZA 1JRUA 2R59A 4U8HA 1LB1A 1N4SA 1Z3YA 3U3WA 5D3VA 1PYWD 4PT5A 1HXIA 3TW1A 1AWDA 4EFOA 5DPWA 2KXPC 2KMAA 3R7RA 3PZ8A 2AVPA 2YRYA 2R61A 1D5MC 2PLPA 2D3BA 2RD0A 1KH0A 2Z59B 5KJNA 1VBHA 5A7DB 1S3SG 3FUFA 2CR5A 1N3HA 5AAOA 2M1MA 2DYNA 2YEPF 2CY5A 4BKGA 1L0XB 1DNPA 3QDNA 3ETRA 4HFGA 4XI0A 2GRIA 3M3JA 2K6DB 1Z5SC 3CHRA 4RSYA 3S7DA 2JRHA 1YIWA 4ZHOA 3SFZA 1RJ2A 5EE1A 4JKEA 1WRIA 1XLPA 4RCOA 3ODXA 4NIKA 2IO1B 1D8DA 1BLXB 5C3JB 2IFSA 1HB8A 4G8LA 4BX8A 3DSTA 4QJ3B 4W9JA 4TXQA 2AYOB 1HQRD 4KXKB 2IOLA 2EELA 1WR6E 4ATGA 2Z0OA 1N60A 1XQQA 2CU1A 3JSVB 2PE6B 3B13A 5H7PA 5LONB 4YSXB 4A9AA 1N0RA 3MGBA 1I4RA 1JWFA 2H7EA 2GW1A 2KQSA 4ANWA 1NVLA 3ASFA 1MZCA 1B55A 3DXKG 2DX1A 2KACA 4H2AA 1QQRA 4YWGG 2X38A 4P6VF 1N0QA 3PRZA 4JXTA 4DJAA 3ZNGC 2LSUA 3AE6B 4EBAG 5HE1A 4B93B 1LD8A 2DZOA 1NTIA 2IO0B 2ZNVC 1UBIA 3PREA 4PH4B 3W5UB 3MPXA 3A1QA 2BYVE 1HEZE 1Q5WB 1MPEA 1OWMA 2BS4B 2CY4A 3L08A 3RZWC 3KWLA 5CTRC 2F8XK 2Y5BB 2AW6A 3GB1A 4W9EA 4HWIB 4P16A 3U4EG 4HPMB 4B89A 2JVCA 2XGOA 2AXZA 1JW9D 1N61A 4HDQA 2ELBA 2BUGA 3DXEA 3ENBA 1ZPSA 3TWSA 3DWLG 2HE0A 2DVWA 3AI5A 1BAKA 5FJYA 2WQHA 4MKTA 1E9MA 4JKCA 2O6VA 3Q8BA 1UNRA 3UZTA 1Z3XA 1ZDXA 2MSED 2YHEA 2DBYA 4RMAA 2OHFA 5CMYA 1ZM0A 3TAXA 3OANA 2X6KA 2Y1LE 1WG0A 2IFUA 5DPRA 4G1TA 2OOBB 4W9RA 3IEGA 3ZHEB 2NS5A 1J8CA 4CRWA 1F0ZA 3H8HA 1IYGA 3AULA 1G6JA 1ZBPA 3X23A 4HJKA 4GMXB 2BWFA 1UF0A 3AE2B 4ZRPA 5AUKA 1TJFA 1GJZA 3QBVB 1T77A 2IOSA 4FHKA 4HS2A 4E71A 3E56A 3EHMA 2AWTA 2PL2A 1BXTA 3FTYA 4TRQA 3ZVVA 2JEKA 2AL6A 5AARA 4A1GA 3DDCB 2UY1A 2BPSA 1GOZA 2ACZB 3TXNA 3W2DA 3CVXA 1SJED 2M17A 4HI9A 2H6FA 2WDTB 3AE9B 4M8NA 2K6QA 2V4LA 2LAIA 3CVWA 2E2XA 2DBAA 4OVUA 1V9JA 1VD2A 3PO0A 4K3BA 4MM3A 4W9HA 3KW5B 2YSZA 4RNAA 2R2LA 4F7HA 5FZQA 3SBTB 1P98A 2HDEA 3VR9B 3FUMA 5KWDA 2XEHA 1NBFC 1UUPA 3ZDMC 2KDMA 1UW4B 3MX3A 1RRBA 3CQCB 3UM0A 2COFA 2WHIA 1NDDA 4MGZE 1UD7A 3FUHA 1SBBB 3CIRB 2Z14A 2INNE 3L17A 3JYUA 4U0ZA 3DHGC 1QLBB 3AN1A 1BD8A 1N4QA 2E0IA 3ML9A 4DRXE 2HJ8A 2P9KG 2NMBA 1YQ4B 5D3IB 1P3QU 5E6NA 3PNLB 3GZ2A 2QC8A 3SZ7A 1X05A 1ET6A 3WAMA 2A4ZA 4E3CA 3ASOE 2LRUA 2VGXB 4GTRA 3PPAA 3C3QA 3ZHEA 5E76A 2CFUA 4IM0A 2P9LG 4OVZA 4WIPA 3ZUNA 3FTSA 2QIEB 5D6JB 4LNUD 1EVHA 3ULBA 1N95A 4XKBA 5ANLA 1WGGA 1C77A 1V89A 2L1AA 4O1OA 1MJ0A 4HPPA 2KFKA 2LXLA 3NVZA 1I35A 5CRUA 4GMLA 1WJ4A 3VUXA 3O4ZA 4N3CA 3M95A 1XT9B 3HUIA 2MYOA 1STEA 3I57A 5AN8A 4A3OA 2GS0A 1EU4A 4HOUA 2KN4A 3C3OA 2CU3A 2B0OE 1U2VG 4HEA1 4CYEA 2WXNA 2LKOA 3V31A 4AP4C 2DYRE 1FOEA 4I2WA 1JRPA 4CGWA 1WX9A 1NTYA 4IWQA 2F8YA 4C80A 5BYRA 4ARCA 2C5LC 3KRWA 2K49A 3U12A 4F1SA 4MSMB 3HIZA 3ZJVA 2MP2A 3NVVA 4MGYE 3I4GA 3IG3A 1TYGB 3RCZA 4AUQC 3AAAC 1LD7A 2GRLA 3VRBB 4JD2G 3MDBC 4PS7A 1BU9A 1NA3A 4WH4A 2K8EA 2KYWA 2QJLA 2KC7A 3FAHA 2KMCA 2GBJA 2PVOD 1T5XD 2MHJA 3DXCA 3W1SC 4K3CA 2N7DA 4PK1A 3DXDA 3D9JA 4DBGA 1WM2A 2NBUA 3V30A 3I3TB 2Y4TA 1UJKA 3KUDB 4TUUA 1ZP0B 4M8MA 1YX6B 4J8FA 4K2PA 4WQOB 5LNK1 3OWEB 4US8A 4I1AA 2XN9C 3ONLA 2WMOA 4XEIG 5D3DA 1EO6A 2L8JA 3Q9NC 4ILIA 2DHZA 3C19A 3RK6A 3HYMB 3VLFA 3FY4A 2O6VB 3LVRE 4WWNA 4J7WA 4JZYA 2ZCBA 2J9QA 2WDQB 2P9PG 3TG5A 4L6EA 1E90A 4JHRA 3RO2A 3M62B 4IWOA 4JA7A 2AQ1B 5A23A 3IXEA 4AIFA 1OMWA 2KJRA 2KN5A 4OHJA 3URYA 4F53A 4WSFA 3BU8A 4YT0B 4NJ7A 2VKIA 5D27A 2G4SA 2KATA 2MBBB 3DBHB 4GDKA 4GTMA 2P8VA 1W1GA 1NYQA 4GU5A 2MX2A 4IOIE 4ARIA 1N54A 3SY2A 1F2RC 5EE3A 2I38A 5CERB 1E7UA 4CGVA 4K03A 1JDEA 2KGXB 5E6PA 3EIQC 3O48A 2N9EB 3CK9A 4B9KA 2KCJA 2P9SG 4C4VA 3CHOA 2ZW0A 2RGFA 2E3TA 3OG5A 3W9FA 5HE3A 2VTBA 3UM2A 1BI7B 1TS3A 3T06A 2I6HA 1KRHA 3AECB 4HHVA 1E7VA 3HIEA 3DWMA 1YYHA 1H2TC 3PNTB 3FTWA 3SO6A 3TBLD 4G3XB 2Y69E 5FQ6A 1XO3A 1JWGA 3C0RB 3TEWA 4K7UA 1YN3A 2OEVA 4ZRQA 2L2IA 1UNSA 3HQCA 4TSSA 2CB8A 3L22A 5G2NA 3QWVA 3O65B 3K9IA 1HG2A 4GZ6A 3K9PB 4OAVB 4A3PA 3TWQA 3SO8A 1PFDA 5IA7A 1TGZB 4ABNA 3E4BA 3PVLA 1TY0A 5HHDG 2NZ8B 3P63A 3CHPA 3IHYA 1I2HA 1PGAA 4LERA 4HATB 4XX5A 1OWOA 2KIGA 1FRDA 1V49A 4LDTB 4KKJA 4N3AA 3KSYA 3LJNA 4HKQA 1QOAA 3CVVA 3UKUG 2XNAC 4AOFA 4JKDA 3H1UA 3QQ8B 3H9DA 3JQ1A 3C72A 3MV3B 4N6EB 3VUWA 3NG0A 3FTUA 1V2YA 4MDKE 3N20C 3VVWB 4RGNA 3AG4E 1Z87A 1QQGA 1N4RA 3AEAB 2AQ3B 1FFVA 3CSFA 4ME2A 3JYSA 1JWBD 1TBEA 3HVEA 3L0WB 2OOEA 1Z5SB 3F0WA 2DKPA 2WNMA 5BW8C 4B6HA 2F0YA 5ARFA 2INCC 1HO8A 1VZ8A 2HRJA 1Y56A 3KEAA 2LVPA 3CVPA 1BWNA 2N7JA 4USAA 1FPPA 1K3ZD 1ZSQA 1HX8A 3DPYA 2VGYA 3UX4A 1FCLA 2N1WA 3ULEG 4MRUA 3AV8A 3FUEA 3UQ3A 3WALA 4I6JA 3AG1E 4K0RA 5AQAA 4IULA 1QZ2A 1KT0A 1OCOE 4CT4A 3MZLB 3ZVRA 4YXDB 3RRNB 2KM4A 3R66C 4IRUA 4C0EA 1OY2A 4GLSC 1V86A 2DX5B 4RGMA 2JLBA 4KX6B 2Y8GA 1UELA 4GZCA 1WX8A 4AP2A 4LNIA 3U8ZA 3Q79A 3PV1A 4L23A 3CIAA 3QC8B 4UI9C 5FIOA 2ZNVB 2L32A 2E2EA 1N62A 2EKEC 4DX5D 1D3ZA 3LEWA 4C7ZA 4FJYA 5M4YB 5IOIA 4Z2NA 3E34A 2K00A 1YCSB 2LGSA 4DIXA 3E66A 2D9YA 2ICIA 3AE7B 3CWIA 4KIKA 1GGOA 2MQJA 1NI2A 1X1GA 2PPHA 1ST7A 2LUHA 1P5TA 4UDUC 2KC2A 1KTKA 4URKA 1UJJA 2P2CP 3MEKA 1HF8A 2QKLA 2IGGA 1FVHA 3J9CA 4GA1A 4XE0A 4WJOA 3PVUA 2FF4A 1Q1OA 5BYQA 1IGDA 3PEVB 1OQQA 1TT5B 2NVUI 3UI3A 3KSLA 3Q49B 5J90A 1RFKA 4HLEA 1QOFA 3A4SC 2X6IA 3KD7A 2XQ0A 1UH6A 3PSEB 4I17A 4NSWA 3APFA 1OQNA 4ZHPA 4OYSA 4I6GA 1YX5B 2BS2B 1K8KG 3KYCD 3Q5MA 4GOUA 5DI9B 4EZJA 2V5FA 2LSVA 4U8YD 2WX1A 4I6LB 2DYOA 2IY0B 2VZKB 2INDC 2GCLA 1XLQA 3VUYA 4C4VB 2HD5B 2M56B 4LCTA 4N58A 1MX4A 1PAQA 2KZRA 1WRDB 4M7CA 3QCAA 2Y8FA 1HE8A 1PQSA 3SHQA 4F8CB 2I9CA 3V6CB 1SVXA 2JYEA 4YSYB 3ZN3A 3R3MA 3LVQE 5CHEE 1XCGA 1E8ZA 5JJ7A 2JYTA 3AU4A 2YLMA 2C2LA 4GZ5A 4JGHB 3UT4A 3RMKC 3ZRFA 2WDRB 4XZ4A 3UQAA 5C2YA 4RH6A 2FO7A 1F9JA 2ONDA 5EIBE 2FAZA 3U52E 3EJNA 2CAYA 5FK9C 5JMND 3UKRG 4K7WA 4WWPA 5C2TB 3DBHI 3AS5A 4TXPA 3X2QE 3ZNGA 3H7PA 4DQOC 2DZIA 4BBNC 2R82A 2KLCA 5C5BA 4DLQA 3JQ0A 1I4PA 3AE5B 1VZ6A 4GCOA 5EN5D 4HB2B 4ACLA 1U27A 3IKOB 2CJNA 5FR6A 1FRRA 2CRFA 3HW2B 3P4QB 4P1CC 5IP4D 1UWMA 5BT1A 1MAIA 3GZ1A 1TY2A 2YVCA 1YJJA 2XK5B 3T9KA 3RNCC 3KAEA 4L2YA 1ENFA 1WGYA 3EECA 4G50A 4HROA 4U96D 2NBWB 4J8DA 1P7FA 1FNWA 2EMSA 1H8CA 3ZYQA 1FT2A 5CEAA 4F7UP 2OJRA 3MC0B 4DX7D 4B0MA 2F37A 4II3B 1PFJA 2QY7A 5D7GA 4G25A 5DHAB 2JZ3B 2G4DB 2K8CA 4XDCA 1OWPA 1Q2ZA 4OW0A 3RRMB 3LCAA 4GTVA 2VTBB 4LSZE 3SFYA 2MRPA 1B1ZA 4BKTA 1XKEA 1PGXA 1TS2A 1ELRA 5JA4D 2AQ2B 2FCQA 2KQ7A 1ZW7A 5EIDA 1WAO1 1UOHA 1DIKA 4A55A 2DKQA 3FUDA 1F2RI 2PZIA 1U3CA 1IYFA 1FAOA 4GNKB 2PQRA 1XXGA 4F7GA 1OT8A 2RFAA 3PLVA 3WANA 2CODA 4I6PA 1M7RA 5I2MA 4NAWA 4KVGB 1GB1A 3SBSA 5ENOD 1PMSA 4D0NB 1MIXA 3IAS1 1TN8A 3SU8X 3WXXA 4GTTA 3ZLZA 2FJ9A 1IHBA 4MJSB 2W2XD 4N5QA 5DIZA 3TWWA 4LEUA 5G5GA 4EPZA 4GIVA 2LAHA 4IM2A 3QOUA 4GMRA 3V60A 1AW7A 4LG6A 2O2VA 3A58A 1T0RC 2J42A 1RYJA 1WVHA 5EX0A 2KDIA 4A90A 2DAFA 1T3QA 1H6KA 3L16A 2KANA 3RPFC 4AWJA 4JLCA 5JZEB 2R09A 3DVGX 2LNIA 1ISNA 1TIFA 1WXSA 5KQ1A 2KDEB 2VRRB 2P0HA 3PZ2A 4BETA 4B8CB 5C1DA 3D9NA 4DUIA 1FHOA 4YVQC 5JVLA 4JQWC 5IN7A 1MPHA 4F7AA 3Q3NC 2RSUA 3DWGC 1D9SA 4TQ0A 5JLJB 5JJ6A 3C3RA 2QMTA 1T0YA 2DYQA 1FT1A 2E6XA 2BYFA 3RFZB 5C6RA 1KZPA 5FZSA 3VLEA 4GDKB 2XZDG 3G2VA 5TSSA 4GSWA 3F6QA 5J17A 4LCDE 4K7SA 3S2AA 4MY6A 4TYZA 4P7IA 1K50A 3TXMA 1X5BA 2VSNA 3LY7A 4E6HA 2COCA 5D3WA 4P29A 2L83A 3PHXB 1MK7B 2RVBB 2M63A 2LGIA 2XRYA 2IQCA 2BGFA 2NMQA 2I2OA 2IONA 2OJWA 4KSLC 1FO4A 3BG0B 3PH0C 4ILGB 2KVZA 3P1UA 1ZKHA 3RT3B 3LXUX 1LF8A 2MKRA 4E74A 4L7TA 4UWLA 3AEFB 4WNFA 3OJ4B 5IKCM 3T5XA 4UI9K 4X8QA 3GYZA 2ZKMX 5HFYA 5H92C 5BMHA 3R2IA 3HXFA 5E6OA 2FUG1 1H4RA 3HXEA 5BV0A 1OTRB 4U8VD 3PDNA 1NZNA 3Q75A 2EJ8A 5JXVA 4KHBA 3B9JA 1SIFA 2R17C 1GC6A 5LOZA 1LO5D 2IJ0A 1L5JA 1WR1A 2B76B 5KHOA 3J5QB 1V5MA 1M94A 3B7SA 4FN2A 3H7PB 3TL5A 3B0AA 4AJWA 2BEDA 2JABA 1C4AA 2NBVA 1ZXIA 4IDIA 3L4PA 3G2UA 1X11A 3SEBA 4EKUA 4Q69A 2J4DA 3E30A 3PZ4A 5AZHA 5DIFB 3R8BA 4MS6A 5C16A 5KJKA 4HCPB 3H6NA 3NZSA 3MC9A 2MHKA 3BG1B 1VDVA 5HKHA 2JZPA 5HKPA 3V79K 4M3OA 3TUOA 1AWEA 3LYAA 2H6GA 3NW8A 1EU3A 1HTOA 3UINB 3APDA 2DWZA 2V4HC 4BY6A 3ZYLA 3DVNV 3VHTC 2L0IA 1XD3B 5G55A 2HR2A 3FU5A 3C5RA 2K2JA 3PUKA 2HYZA 3T8MA 5BXOA 2LHDA 4V3IA 2ZEQA 5GXGB 3ULCA 2LXAA 3TWUA 1S1QB 1TYQG 3T3OA 2WXLA 1QNFA 2YS1A 3NWDA 1EF1C 2WH5A 1TTNA 4NAMA 3QK0A 2WX0A 2VH2A 2LEKA 4MH0E 1RZ4A 5DBKA 3VR8B 1WGKA 4CDNA 2V5QC 2FE8A 2DAJA 1MI1A 2VZKD 1ZUD2 2HM8A 3D9KA 4ZRJA 4J6IA 1TKEA 3FH7A 1UGMA 1WFYA 2J59M 3FSSA 2G45B 4JK8A 2V0GA 2XS8A 4TXRA 1QOGA 3UM1A 3VOQA 3DCGA 3I5JC 2MDXA 1BTNA 3WA0A 2G1EA 5CHWA 1OQRA 4W9DA 2AXVA 1H0AA 1WWTA 3CEQA 5EYLA 3O13A 4FLHA 5AZGA 2V0PA 3KEZA 1ZC4B 1HU3A 2PM7A 4WJNA 4G2VA 4W9LA 5JJTA 1Q10A 3NRZA 1H2VC 3NB2A 2KO3A 2GROB 3EDTB 4MH8A 5AQBA 4WWMA 3UTMA 1AYFA 2DYBA 3FC4A 2KTRB 4HXDA 4OZCA 3VLDA 4APOA 2FEZA 1P9DU 3CLJA 3BQOA 4AV7A 3AXCA 2J4BA 4Q96A 2RKKA 4D10C 2JWUA 1V1PB 1J0WA 1LQBA 4ZFHA 2CKHB 2KWVB 2GRMA 3RZFA 1PY1A 2ZPNA 4LTUA 2WWZA 5LX8A 5C1ZA 2Z13A 5BXUA 3SQVA 4H7YA 5T4YA 2IO2C 1YQBA 5M72A 1JWAD 3BK1A 1Y19B 2X8XX 2EIJE 2P9IG 5EFXA 3ZRHA 3Q3OC 2K8HA 1LGRA 5G04J 1I4QA 4W9CA 2PNNA 2LUEA 3VRAB 3BEEA 3UIPC 2XENA 3AB5A 1HBKA 4LLGM 4HK2A 3APCA 3DRAA 1WZ0A 3V2XA 2FIFA 2KD0A 2XBBC 3PEGA 5D2MB 4GA0A 3SFXA 2G9HD 3ULQA 2RMMA 3VQIA 2VQ2A 1WM3A 4RGOS 3QWMA 3URZA 1X1MA 2LVQA 4JKGB 2C7HA 4KVOA 4JHJA 2AXUA 2RG8A 1MHXA 3ZEFA 1KJTA 4N2SA 4K2OA 1I7HA 4ANXA 3AU5A 1XEEA 3MV2B 4U0UA 3VFKA 2YT1A 2DZNA 4Z2MB 3FEHA 2MJDA 1XD4A 2IU1A 1GB4A 2O2VB 1TKGA 4AQ7A 4O1PA 3SBGA 3KY9A 2ZZPB 1NENB 1A5RA 5J08A 2ETBA 2KCKA 2KCVA 3EHNA 1XNFA 2IDYA 4PNKA 3D8FA 3ZXSA 4U7EB 4JL9A 4NNJB 1LTXA 3I3NA 2BT6A 3RNAC 3T8KA 3FP3A 2NBVB 2L52A 1ET9A 1XLNA 2I1JA 2O6VD 3RUIB 4HNAD 1KZ7A 3N1ZC 1MQSA 2V1YA 3ZXPA 1I7AA 3FUJA 2KNBA 2V4IB 3E9OA 4YVOA 1V6EA 2IJGX 2NXPA 2K3UA 1T6BX 3P4SB 2K2UA 4BKSA 2BF8B 2C9WB 4ZDVA 5A6CA 2FO1E 4KHOA 4Y94A 3ZJUA 4HJGE 3SNXA 3ML8A 3CKCA 4IC7B 2LZ6A 5HE0A 4EJNA 3A9KA 1W1DA 4IUMB 1XODA 2FJLA 3CMMB 1FB8A 3JUIA 3N1XC 4BZAA 3DCXA 1CK1A 2L3ZA 4JX1C 1ZU2A 2UY1B 2DA0A 4YL8A 3NQPA 2Y5PA 5ITZF 1RW2A 2WXGA 1SE9A 2LGXA 2KIEA 1QQEA 3N71A 3P2BA 4KVMA 5D66A 3RO3A 3B7RL 4MBGA 4WAFA 2M0AA 3N9YC 2M4NA 5FINA 1H19A 2LO6A 4EOYA 2BYEA 2HJ1A 1VZ7A 2JQRB 3DSVA 3M1IB 2PW9A 3MKQB 3U9WA 2SAKA 3DVGY 2GBMA 1OCCE 1EUVB 2RPVA 3ABVB 3EA6A 4NAWB 3PG7A 2FCSA 1WI1A 1XF5L 2KLGA 1R7SA 4LNKA 4BTBA 2C7NB 4IAPA 4G0NB 1WE6A 4ICUA 1AP7A 3I9V1 3RD2A 4AXHA 3AE1B 3NOGD 1SA4A 5DHFB 2MFQA 3TVVA 3MJ5A 4JL0A 1ZB1A 2EILE 2AL3A 3T5VA 2J49A 1OFFA 2MA9B 4LDTD 3A9KB 2X6FA 3PTFC 1KFYB 3HM6X 3L9TA 3IBEA 2H7DA 4U95D 2X18A 2MJEA 5BMIA 4TMAB 1WMHA 3AEEB 4HVBA 3B1LX 4PS8A 4KZCA 1YMPA 4FJZA 4TV3A 1TN6A 3DBRB 3QNKA 3Q7FA 4J8SA 3S7JA 4DHZB 5LCWC 2LULA 3EFUA 5AIJA 3EHQA 5CCMA 4MT5A 4I9CA 1UBQA 4FA6A 3VTVA 3ENEA 2KMMA 1ZGUB 4CO7A 1DDWA 3L6AA 2QKMA 1OCRE 2GGFA 2PVGC 4JKGA 1FIQA 1SA5A 2AX5A 3MC8A 3MHZA 4HOQA 3ZNHB 4C9BB 3DQVA 4DHJD 4KT6B 1QYMA 4HB5A 1D6EC 1DYQA 2MWNB 5AQ9A 1C3TA 1OCZE 4DX90 5ENSD 2BKKB 1O5MA 2WM9A 2GI9A 3VDZA 2JF5A 3W1YA 1CMXB 2J0KA 2AEHA 1ESFA 2KJHB 1WG7A 1U29A 4BAXA 3R7QA 1NYRA 3IT4B 5EE0A 3FP5A 4HRNA 1P6SA 2VRWB 2KWUB 4W9KA 2OVFA 5HRYA 1SW6A 3GE3C 3NY5A 3Q3MC 4JA9A 3UUXA 3WYFB 4LUNU 5J3YA 4D6WA 5CECB 1K5DB 4CDMA 4TQ1A 4CHKA 4WAAA 5BV1A 4BBKA 3VTYA 2L7RA 4NURA 2K9XA 5JP4A 2CG2A 3QARA 1H10A 1IQRA 3GYPA 4KDLB 1ZXHA 3SGHA 1SIJA 2JUOA 3PP2A 1UWXA 4IG7B 3NAWA 3LKUA 1RM6C 1OWNA 1JUQA 1P7EA 5IJMA 1O1RA 5KQ4A 2L0TB 3KVFB 1YMHE 1DROA 1F52A 3RIBA 2KAJA 3EC8A 2XPZA 2IYBA 2RRFA 1V1PA 3BVMA 3P1MA 1TZOA 1B9RA 4XDDA 1V80A 5G05C 5EDSA 2N9PC 2RGNB 1NU2A 1SB3C 2KWCA 2KTRA 3IAM1 2KBXA 3RJVA 1CQVA 4W9IA 4LRZA 1DBHA 3HVDA 2DNFA 2EQXA 1F1HA 1S64A 3OXLA 3IHPC 1RWSA 4YTMB 2Y3AA 5EE9A 4JKHA 2D10A 2GLSA 4JWUC 2OCCE 3HXDA 4HBDA 3OAWA 3SFDB 2BYTA 1TNBA 4ZOHC 4M00A 4LJPB 4KAXB 3AM9A 1U3DA 4KKIA 2D3AA 2RLOA 2EIKE 3A4RA 4NZLB 4CYMD 2RUKB 3ZQ4A 4Q94A 3UMVA 2XS1A 1IBXA 1WM5A 3CKBA 4XWXA 3BINA 5IRSA 1J0GA 4LNNA 5KJLA 3E37A 3K9OB 2MJ3A 2YS3A 3U7DA 3O96A 4A8XC 3VIAA 2GUMA 3ZNZB 2J09A 3Q6BA 4GTSA 3OHMB 2H88B 2XQNM 1WXMA 4GMJA 1WJ1A 1ZE3D 2PKOA 4K1RB 1EYHA 3CQGB 2I1KA 1H2UA 4G23A 3KS2A 5TR5A 1PDXA 4BVUC 3PGEA 4F3VA 4A3VA 3X0WA 4CHJA 5T8IA 2KUPA 1SXTA 4DX6D 4QAYA 2JXTA 3QX1A 2V76A 3GZNI 3NBNB 4PQ0A 2DYMA 5FR3A 4JE3B 4B6WA 3PEUB 1EWCA 2DIKA 4XYCA 3D9HA 3JSVA 2WXHA 4HQDA 3RRUA 3PHWB 3IHVA 4OT1A 1A70A 2COPA 3DHHC 2R2YA 2IY1B 4MELA 4GDLA 1L6VA 3EHRA 1YJ1A 5HS0A 4FP7A 3VXWA 3CHQA 1QOBA 3B7UX 4TUMA 3ZTDA 1SGHA 4EUTA 4Y6WA 2KZTA 2A5UA 3QB2A 4KYOB 4K5BA 1WGQA 4XGAB 2BF0X 1K1AA 2XEVA 1UN8A 5J3TA 2LFIA 4UI9J 4BKSD 2J0MA 3UXGA 5KCVA 5BNWA 4KHBB 3E32A 1HXYD 3FU6A 4B0EA 5LXHA 3Q3JA 2COAA 1GNUA 3AEGB 3ONSA 3HG0D 2XGSA 1C1YB 3G2TA 4ZRKA 2JX5A 4BT9A 3HSAA 5BMGA 2X6JA 4OZBA 3AJIA 1VDYA 1DC2A 2Y0BG 1GAQB 3I63C 1D4BA 4G11A 2JSVX 4YSZB 1R4NI 4PDXA 4U0SA 2RSGA 5FI1A 4N5CA 3Q47B 4IKGA 4J8YA 4GB9A 3L82A 2OVBA 4N59A 2J0JA 2VGEA 4GZ3A 1JCQA 4OAUC 4UWKA 4II2B 3HDXA 2ASQA 3NSUA 2PE9A 1E8YA 5AZFA 3FTZA 2JWZA 5ENTD 3G2WA 2W55A 1U5FA 1HA5A 3A1QB 2R05A 4A6FA 2WXRA 4DXAB 2UZSA 3FH8A 2L0TA 3ML4A 4KV2A 4M0WB 4N9F4 4DK5A 4DX2A 2DWQA 2HTME 4ATZD 1NI1A 2DENB 1TNUA 5JHGA 4HAZB 1LW3A 3EGRA 2NPTA 2IY0C 2WQ7A 2CJOA 2EIME 2WLBA 3KUZA 2RQ1A 2Y7BA 4IW0A 2Z0PA 5G04C 2X3MA 4HAVB 3ULYA 4QJ5B 2CHXA 2OV8A 5DPSA 1DCEA 2N23A 5ENPD 3C8YA 2IBIB 1WDYA 2NC9A 4GTPA 4OVVA 2ABDA 3EUVA 1W1HA 2DHJA 2LGDA
chains in the Genus database with same CATH topology
5BUZA 2WPVA 4UQZA 2N0YA 4NRHB 1FHWA 4GZUA 5AYWD 5LP0A 4UWHA 2ROVA 3PSCA 2UZRA 2LGYA 2WVIA 4FHJA 4Y6CA 5D94A 1V5UA 2PZ1A 1FGZA 1YD8U 4ILHB 4CT0A 2WXIA 4KMOA 3LDZE 4NY0A 3RYTA 3FDHA 2P0FA 1WXVA 3SNHA 2D9VA 2KKCA 1TXDA 2R2OA 1WJUA 4GZDA 3D8DA 2NPTB 1SHCA 4HAYB 3EPYA 4PYZA 3BJIA 4GMVA 1RLFA 3CR3A 1HB6A 2K39A 3FEXA 4HOTA 3DBRI 3OLMD 4E85A 4JKBA 2DHIA 2RR9A 2UWQA 2VSXE 2X6HA 3D32A 3UT7A 2ZVOA 4UWGA 1VCBA 2JPHA 1E8XA 1LM8B 2XGMA 4ICVA 3CVNA 3KH0A 5C79A 4L2LA 4HAWB 2V8SE 1EF1A 1MHQA 1XGWA 1UG3A 2D2QA 2KFJA 1WYWB 2ADZA 3FM8C 2KC1A 4A1SA 2ZJDA 3CHSA 2FCNA 4H8SA 2ZPYA 4ILJA 3D9LA 3FWVA 4BFRA 1DVPA 4C0AA 1AQCA 2N7EA 5FTPA 2KVRA 4U63A 3MTNB 4JVSA 5LXIB 2KDBA 4A5KA 3SDLC 1KI1B 3MKRA 3L54A 2MBQA 3QC1A 4GA2A 3PS6A 1HG5A 3EIJA 2GBKA 4DHZE 4G26A 4GGQA 1SZ9A 3S7BA 4O6FA 5GMVA 4BX9A 4ANUA 5FQ4A 4I1OB 3RCPA 3GOEA 2RPQA 4HORA 4WVFB 3ASDA 2G3QB 2FDQA 5HE2A 4MK0A 3SBTA 4EZKA 5J3QA 2MW5A 1UNQA 2YHCA 2YINA 5FQ8A 1BTKA 2KX3A 2LI5A 5FT9A 3PRPB 1SQMA 1DDMA 3JVZX 3FHEA 2W2WA 2C0MA 2LYDA 4GYWA 1P3RA 2XCCA 4MLPA 2L0FA 3FUIA 4MGIE 2EMTA 3QWWA 3V5WA 1V5OA 3H7SA 5CMWA 3U4TA 2Y4UA 4B95A 4C0MA 1KT1A 3VH3B 3FFLA 3OTNA 4ACKA 4IFSA 1QC6A 1IQUA 2VGXA 3MKQA 4K17A 3ESKA 3I4RB 4FC8A 3TMPB 3ONKA 2V3SA 4WWOA 1WGUA 2FIDA 1MIZB 4JK7A 3D9IA 2P58C 3TIXA 3IVFA 1GW6A 1TJ6A 3D3MA 2L6JA 4ANVA 3QHTA 3OXFA 4DDID 3FLVA 3JW0X 2UYZB 3LJUX 3HM3A 4DBBA 4KDIC 1WGDA 5KHQA 5G05J 2KCLA 4EECA 4L1BA 4GAAA 3ECIA 1U5EA 2GCJA 3HK0A 4ILGA 4B8AA 2JY6A 3UT8A 1Q0WB 1ELWA 4GOCA 3D8EA 2WXJA 4EZLA 3VTXA 3UIPB 4FU3A 3SUZA 4HAXB 1I42A 2BTDA 1FGYA 3CXBB 2WMNA 4DDGD 4RM9A 2GBRA 2DZMA 3ODOA 1KBLA 2LD9A 1INZA 2J07A 2XHEA 3SV1A 3S7FA 4AY6A 2AWIA 2K8BA 3SYXA 2Q13A 4EMOA 1V61A 3DOWA 2LRWA 2X0SA 4BOZB 1PC2A 2JZZA 4HXIA 4KBQA 2LOZA 3SF4A 5JHHA 2I5FA 4DX8A 3KYDD 2MBEA 2WB2A 2WYQA 3ZTCA 3MA5A 3CV0A 2C0LA 1Y8MA 2J08A 1WF9A 3FTXA 3FH5A 2OTXA 2BWES 3IFWB 4UQXA 1WMHB 3TGOA 3A8PA 5D3XA 3CVUA 2R2QA 2XCBA 3ODWA 3PZDA 3WAOA 2JXXA 1EAZA 2FNJB 5L83A 4AY5A 3NZUA 3LPZA 4FADA 2GMIC 5EX3A 1Y8RC 4JEUA 4PUCA 1K8RB 2LG1A 3PRMB 4AJYB 3CSTA 3ZYKA 4EEWA 5J2RA 1WXAA 4WUYA 4NPNA 1UPRA 3FULA 4FULA 1UZXB 4WNDA 1OGWA 2Z0EB 3DPDA 3AS4A 4RVBA 2CHZA 1IPGA 2FUHB 3ZFWA 2OQBA 5CLLB 2MOWA 3AJ4A 1WIAA 4X57B 3CK8A 2IF4A 4JIOU 3A33B 1N52A 2IZVB 2KTFA 2JRIB 4PYUA 5JH5C 4HDOA 3TJPA 4IWPA 4WNEA 1GG3A 4ZRIA 1V5TA 4JPSA 3IV0A 1L2NA 2PM6A 1XX0A 5HI7A 3UQBA 4I6EA 3V6EB 2LBBA 4JHKA 2LOXA 3FUNA 3QWPA 3N32A 4YONA 2NSZA 1OEYJ 2L05A 4DHJB 3VH4B 5KCMA 2KZTB 2ZCCA 3DVNU 4GU2A 5CLQB 3UPVA 1WH3A 4MT7A 3M63B 1E96B 4GDLB 3NHEB 5E75A 4NQLB 1KLVA 3RULA 3P6AA 3Q3FA 1ACAA 3ZO5B 2GOWA 4CCAA 1OWLA 5LLIA 1J19A 3ASHA 4B94A 2CS4A 1V81A 1BPOA 1X86A 4CHMA 4MEMA 1B89A 1K5GB 5C23A 2FULA 3A9JB 2ILRA 3T9LA 1WY8A 3CGHA 3F5RA 2BKFA 3GZSA 4JKFA 1QZEA 3LJ3A 3LY9A 4KIKB 4RG9A 1LXDA 2LJ5A 5LCWJ 2ZU6B 2DZJA 3NF1A 1OUVA 1HH8A 3OXGA 4AEZC 4N39A 2WQ6A 2L76A 1WGHA 2JT4B 1UEFA 2Z0QA 1JPLA 4CEMA 1RRPB 5KJMA 1M7EA 4I6NB 2WXFA 2WXOA 3PE4A 2D11A 5LOPB 5D3YA 4HOSA 4APFA 2RNRB 2QHOA 3BY4B 3EHVA 3DBLI 3ZKJC 4QFVA 3VTUA 4JK9A 1FHXA 3VTWA 2NR2A 1V88A 3KZ1A 3UF8A 3HVEB 2K25A 1Z2MA 3ZW3A 3U66A 3SHFA 4FJVB 1MKEA 5JHAA 3DBSA 4A6FB 2B3AA 2C7MB 1R4MI 2DLWA 2IO2B 2DX5A 3UGBB 1KM7A 4HB0B 2MRIA 1IP9A 3L13A 5AENA 3ESLA 4N2QA 5AJLA 4MJSA 1HFAA 4IM3A 3QIJA 1DDVA 4AVXA 1ZC3B 1UNPA 2UVMA 1S0PA 1DYNA 2M14A 5C5BB 2MBOA 3MHSD 3WAPA 4XKCA 4GPTB 4DI3A 4W9GA 2D07B 5LFAA 1HS6A 1EPUA 3JCKC 1FXTB 3G2SA 4MGKE 3QA8A 1EGXA 1NTVA 1BT0A 3B08A 1IRSA 1V5PA 1A17A 1NP7A 3ZYMA 4H7XA 2C60A 2R0DA 3B7TA 3ZPJA 4HB4B 3A98B 2KJ6A 3TG4A 4NQKE 2PJHA 4XC2A 1P1AA 4WJQA 4IOYX 3PUJA 2KXJA 3E9LA 1KOTA 3A8QA 5J18A 4A20A 4BWRA 1WY6A 4GCNA 2MLBA 4IN3B 4F7ZA 2CHWA 2M0XA 3PVWA 3NOBA 2XPYA 4XIFA 1YA0A 1U5GA 2PQNA 3RKVA 5CCLA 4W9FA 4J0UA 2YNQA 1UPQA 2N4FA 3V61A 3QKYA 5AJDA 4KHAA 1E8WA 4TKNA 2REXA 2R5SA 1XR0B 3VAWA 1NA0A 3G9WA 2PEAA 3MJWA 2DZKA 1VBGA 2M8SA 3LY8A 1W3BA 3ZRCA 2WXMA 4GYOA 4PS3A 1Q67A 1FCHA 3QJZA 3MYVA 2DCPA 2VYIA 3TO1A 3U64A 3TCAA 5ENNA 4IYPA 2L1CA 5IAAC 4J8EA 3N3KB 4U07A 3CK7A 2ROZB 1GC7A 1MG8A 2KDFB 1ELKA 1WJMA 2HO1A 2NCNA 2HTHB 3N7CA 5DH9B 4LJOB 1KLXA 4UQYA 4WJ7A 2FI7A 4BOSC 2IO3B 2ELAA 1WJ6A 4I1MA 1P5QA 2EC1A 2P0DA 4CDRA 1OQYA 3SD5A 3ZGQA 2MCNB 4MSQB 1KC7A 1E5WA 3FTVA 1LFDA 3N30A 3FU3A 4DLOA 4DI4A 5BPPA 4A6HA 4B0ZA 2GBNA 5GOWB 5FI0A 1RAXA 2YT0A 4EBAA 5FZRA 1TZ1A 4JKAA 4WNGA 4BBNF 1TEZA 5CHVC 2GJYA 5HQ8A 1WJNA 3CVLA 1WI0A 3A9JA 3ZDTA 4K81A 3E9PA 1MK9B 1EDUA 1WE7A 2N1VA 3Q15A 2Z0DB 2VSOE 2LWPA 1Y5OA 2HTHA 4NJ6A 2VSZA 1OEYA 4FLBA 3W1SA 2K1FA 3TFMA 4ASWC 5DCNA 2WXKA 1ZVRA 2KX0A 4HPLB 4KZ0A 2KOXA 5BO4B 4JEHA 3D9OA 5L95C 3LDZA 2L9BA 2M38A 2FCMA 3WIMA 1Y6IA 1L7YA 5CX3A 2XK5A 5T3RA 2YF0A 3ALBA 3KRXA 2KK8A 2HE7A 2L00B 3MCXA 2VJ8A 4JW1A 4DPRA 3SI5A 1WGRA 3OJ3A 2WXQA 4R7LA 2I5CA 3Q4AB 4JC8A 4GYYA 4NQ0A 4KSKC 2JP2A 2DN6A 3GYOA 1WZ3A 3I5PA 2DFKA 2FBNA 3GW4A 1U5DA 2IYDB 2BKRB 5D0QD 1TQZA 3AS8A 4A3TA 3CIKA 4UWFA 3CVQA 5EKQD 1UN9A 4BTAA 2YS5A 2D9XA 4GXBA 1PLSA 4GPKA 4U04A 3ZIMA 3LS8A 1IHGA 2Q7FA 3V62A 4GN1A 4HB3B 2W2XC 2QFCA 3D9PA 3QAQA 4AM9A 1EF5A 3ZNID 2LVOA 1X1FA 1KZGA 2MBHA 3KUCB 2VSYA 3RU0A 2WXPA 4EQFA 2G35A 3HHMA 4RM8A 3U30A 5FQ7A 5AEKB 3CF6E 5ANRA 2MWSB 1FVFA 2XRZA 2CG3A 2UWJG 4ILHA 4DWFA 1TJCA 3PE3A 4I2ZA 2J7QB 3FU0A 5JHBA 2N9XA 5CHFA 1P0RA 1RFAA 2CFZA 4BSXA 3PLUA 4HAUB 3R9AB 4N3BA 4I9EA 2DIWA 2KFKB 3D9MA 2ZVNA 4NACA 3FUKA 2CQUA 2D3GA 3CVYA 5L81A 2KHWB 1Z6TA 2D4QA 2LXCA 2YQ8A 4WJPA 1HZ4A 2BCJA 5DPTA 3C98A 1U2BA 4ZYNA 4FBJB 4G24A 3ASGA 3PT2B 1SZAA 2LASA 5D0OD 5FWQA 2DHKA 3QWZB 4I43A 1U4AA 4HCNB 3P7ZA 2MP2B 3FEYA 2XEWA 5ARGA 4RG6A 3NS8A 4YNDA 1GUAB 3UIOB 2W9NA 2D9WA 2DTCA 4XI9A 1WX7A 2XPIA 4A6KA 1AARA 4BT8A 2D9ZA 3CHMA 1JRUA 2R59A 4U8HA 1LB1A 3U3WA 1Z3YA 5D3VA 5DPWA 1HXIA 3TW1A 4EFOA 2KMAA 3R7RA 2AVPA 2YRYA 2RD0A 2Z59B 5KJNA 1VBHA 5A7DB 1S3SG 3FUFA 2CR5A 1N3HA 2M1MA 2DYNA 4BKGA 2CY5A 1DNPA 3QDNA 4HFGA 4XI0A 3M3JA 2K6DB 3CHRA 4RSYA 3S7DA 2JRHA 1YIWA 3SFZA 1RJ2A 4JKEA 3ODXA 2IO1B 2IFSA 1HB8A 4BX8A 4W9JA 2AYOB 4KXKB 2IOLA 1WR6E 4ATGA 2Z0OA 1XQQA 2CU1A 3JSVB 2PE6B 3B13A 5LONB 3MGBA 1JWFA 2H7EA 2GW1A 2KQSA 4ANWA 1NVLA 3ASFA 1B55A 2DX1A 2X38A 3PRZA 4JXTA 4DJAA 3ZNGC 2LSUA 4EBAG 5HE1A 1NTIA 2IO0B 2ZNVC 1UBIA 3PREA 4PH4B 3MPXA 3A1QA 2BYVE 1Q5WB 1OWMA 2CY4A 3L08A 3RZWC 5CTRC 2Y5BB 2AW6A 4W9EA 4HWIB 4HPMB 4B89A 2JVCA 2XGOA 2AXZA 4HDQA 2ELBA 2BUGA 3DXEA 3ENBA 3AI5A 1BAKA 5FJYA 2WQHA 4MKTA 4JKCA 2O6VA 1UNRA 3UZTA 1Z3XA 2MSED 2YHEA 4RMAA 5CMYA 1ZM0A 3TAXA 3OANA 2X6KA 2IFUA 5DPRA 4G1TA 2OOBB 4W9RA 3IEGA 3ZHEB 2NS5A 1J8CA 4CRWA 1IYGA 3AULA 1G6JA 1ZBPA 3X23A 4HJKA 4GMXB 2BWFA 1GJZA 1TJFA 3QBVB 2IOSA 4FHKA 4HS2A 4E71A 3EHMA 2AWTA 2PL2A 3FTYA 4TRQA 3ZVVA 2JEKA 2AL6A 4A1GA 3DDCB 2UY1A 2BPSA 3TXNA 3CVXA 2M17A 2WDTB 4M8NA 2K6QA 2V4LA 2LAIA 3CVWA 2E2XA 2DBAA 4OVUA 1V9JA 1VD2A 4MM3A 4W9HA 3KW5B 2YSZA 4F7HA 5FZQA 3SBTB 1P98A 3FUMA 1NBFC 3ZDMC 1UW4B 3MX3A 1RRBA 3CQCB 4MGZE 2COFA 1NDDA 1UD7A 3FUHA 3L17A 3JYUA 4U0ZA 2E0IA 2HJ8A 3ML9A 2NMBA 1P3QU 5E6NA 3PNLB 3GZ2A 3SZ7A 1X05A 3WAMA 2A4ZA 4E3CA 2LRUA 2VGXB 3PPAA 3ZHEA 5E76A 2CFUA 4IM0A 3ZUNA 3FTSA 5D6JB 1EVHA 3ULBA 4XKBA 5ANLA 1WGGA 1V89A 2KFKA 1I35A 4GMLA 1WJ4A 3VUXA 3O4ZA 4N3CA 3M95A 1XT9B 4A3OA 2GS0A 4HOUA 4CYEA 2WXNA 2LKOA 4AP4C 1FOEA 4I2WA 4CGWA 1WX9A 1NTYA 4IWQA 2C5LC 3KRWA 4MSMB 4F1SA 3HIZA 2MP2A 4MGYE 3I4GA 3IG3A 3RCZA 4AUQC 2GRLA 3MDBC 4PS7A 1NA3A 2KC7A 2KMCA 2GBJA 3DXCA 3W1SC 2N7DA 3DXDA 3D9JA 4DBGA 1WM2A 2NBUA 3I3TB 2Y4TA 1UJKA 3KUDB 4TUUA 4M8MA 1YX6B 4J8FA 4K2PA 4WQOB 4I1AA 3ONLA 2WMOA 1EO6A 2L8JA 4ILIA 2DHZA 3RK6A 3HYMB 3VLFA 3FY4A 2O6VB 3LVRE 4WWNA 4JZYA 2ZCBA 2J9QA 3TG5A 4L6EA 1E90A 4JHRA 3RO2A 3M62B 4IWOA 4JA7A 5A23A 4AIFA 2KJRA 1OMWA 2KN5A 4F53A 4WSFA 4NJ7A 2VKIA 5D27A 2G4SA 2KATA 2MBBB 4GDKA 2P8VA 1W1GA 2MX2A 4GU5A 1N54A 1E7UA 4CGVA 4K03A 1JDEA 2KGXB 5E6PA 3EIQC 3O48A 2N9EB 3CK9A 4B9KA 2KCJA 3CHOA 2RGFA 5HE3A 2VTBA 3T06A 2I6HA 4HHVA 1E7VA 1H2TC 3PNTB 3FTWA 3SO6A 3TBLD 4G3XB 5FQ6A 1JWGA 3C0RB 4K7UA 2L2IA 3HQCA 2CB8A 3L22A 5G2NA 3QWVA 3O65B 3K9IA 1HG2A 4GZ6A 3K9PB 4A3PA 5IA7A 1TGZB 4ABNA 3E4BA 3PVLA 2NZ8B 3CHPA 3IHYA 1I2HA 4LERA 4HATB 4XX5A 1OWOA 1V49A 4LDTB 4N3AA 3KSYA 3CVVA 4AOFA 4JKDA 3H1UA 3QQ8B 3H9DA 3JQ1A 3MV3B 3VUWA 3FTUA 1V2YA 4MDKE 3VVWB 1Z87A 1QQGA 1TBEA 3CSFA 4ME2A 3JYSA 3L0WB 3HVEA 2OOEA 1Z5SB 3F0WA 2DKPA 5BW8C 4B6HA 5ARFA 1HO8A 2HRJA 2LVPA 3CVPA 1BWNA 1ZSQA 1HX8A 2VGYA 3UX4A 2N1WA 4MRUA 3FUEA 3UQ3A 3WALA 4I6JA 4K0RA 4IULA 1QZ2A 1KT0A 4CT4A 3MZLB 3ZVRA 3RRNB 2KM4A 3R66C 4IRUA 4C0EA 1OY2A 1V86A 2DX5B 2JLBA 2Y8GA 1UELA 4GZCA 1WX8A 4AP2A 3U8ZA 3PV1A 4L23A 3CIAA 3QC8B 4UI9C 2ZNVB 2E2EA 2EKEC 1D3ZA 3LEWA 4FJYA 4Z2NA 2K00A 3E66A 2D9YA 4KIKA 1GGOA 2MQJA 1NI2A 1X1GA 2PPHA 1ST7A 1P5TA 2KC2A 4URKA 1UJJA 3MEKA 1HF8A 2QKLA 1FVHA 4GA1A 4XE0A 4WJOA 3PVUA 2FF4A 1Q1OA 3PEVB 2NVUI 5J90A 3Q49B 3A4SC 4HLEA 2X6IA 3KD7A 2XQ0A 1UH6A 3PSEB 4I17A 4NSWA 3APFA 1OQNA 4OYSA 4I6GA 1YX5B 3KYCD 3Q5MA 5DI9B 4EZJA 2V5FA 2LSVA 2WX1A 4I6LB 2DYOA 2IY0B 2GCLA 3VUYA 2HD5B 4LCTA 1PAQA 2KZRA 1WRDB 3QCAA 2Y8FA 1HE8A 1PQSA 3SHQA 4F8CB 2I9CA 3V6CB 3ZN3A 3R3MA 3LVQE 5CHEE 1XCGA 1E8ZA 5JJ7A 2YLMA 3AU4A 4JGHB 2C2LA 4GZ5A 3UT4A 3ZRFA 4XZ4A 3UQAA 5C2YA 2FO7A 1F9JA 2ONDA 2FAZA 3EJNA 2CAYA 4K7WA 4WWPA 3DBHI 3AS5A 3H7PA 2DZIA 4BBNC 2R82A