3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
3VVWB 2MWSB 3KYCD 4WJQA 3CXBB 2UYZB 3H7PA 4BKTA 4BKSD 3UIPB 1AWEA 3APDA 4NAWA 3R7QA 4BVUC 1HBKA 2KLCA 4MSQB 4II3B 2MKRA 2D9XA 1XR0B 1WMHA 3PV1A 1XKEA 4X57B 4Z2MB 1RJ2A 3FSSA 3BY4B 1X05A 2VSZA 3NOBA 3R7RA 3VHTC 3PVLA 2ELBA 1RRPB 3CF6E 2RPQA 3QWZB 4HAVB 4FA6A 2L0TA 1I35A 5EDSA 2COFA 2ADZA 5JP4A 4HPMB 4KHAA 2UZSA 1DDMA 1PFJA 4HAYB 4EUTA 1DDVA 1V5MA 5AZFA 1WVHA 5J2RA 1JRUA 3A9KB 3SHQA 3I3TB 3AU5A 2V3SA 2HD5B 2WWZA 1V5PA 3VTVA 4C0AA 2KKCA 5CLLB 3PT2B 3TJPA 2N0YA 4LCDE 5GOWB 1C3TA 3A1QB 5IA7A 4EFOA 5DHFB 4G50A 3QAQA 1MK7B 1NTYA 4K81A 3L08A 3X0WA 1P98A 3ULCA 5CLQB 3O65B 2KMAA 4DDGD 4M8MA 5J18A 1XCGA 1E8ZA 4TYZA 1WE6A 1V5OA 1Y8RC 1V5TA 4ICVA 2VRWB 1H10A 3A4SC 4TQ0A 2NPTB 1MAIA 4GZUA 1U4AA 3SU8X 4MJSB 4AUQC 3TIXA 4D0NB 2RSGA 2YT1A 4MGYE 4FN2A 2V76A 1V5UA 1WXMA 2DHIA 1OY2A 2KNBA 2C7NB 3AULA 2P0FA 2L0FA 5D2MB 5GMVA 2LOZA 2H7DA 4WVFB 1XD4A 4CHKA 2IO0B 2M0XA 2LJ5A 3SYXA 2N9EB 2MX2A 2LGYA 1WE7A 2OJRA 3H6NA 4RM9A 4W9EA 4MELA 2AWTA 3HM3A 1FHXA 5C1ZA 3D8DA 1ZKHA 1OEYJ 4HB0B 1TJ6A 3QC8B 4DX8A 3A9JB 3ZTCA 2ZJDA 2ELAA 4F7ZA 1QZEA 2JF5A 1YD8U 4PYUA 1B55A 2LRUA 3KRWA 3TW1A 1H4RA 2O6VB 4BKGA 2PJHA 4DHJD 2BF8B 3H7SA 4LDTD 3V60A 1S1QB 1WI1A 2LVQA 3OJ4B 4MGIE 2ZVNA 2P0HA 2L7RA 5LXIB 2RLOA 1VD2A 3NS8A 3FM8C 2KQ7A 3NHEB 1VCBA 2Y5BB 4NJ6A 1EF1A 4DBGA 3IFWB 2E2XA 3PLUA 2KX3A 2J0JA 4HAWB 3P2BA 4MY6A 4GMVA 2ROZB 5J3QA 2Y7BA 4K7SA 3ML4A 2DZJA 5DHAB 1RRBA 3ZLZA 2IY0B 3ULBA 2K6QA 2M1MA 2RSUA 4FLHA 3NZSA 1BTKA 1UBQA 4B6WA 2QHOA 2JY6A 3SO6A 3KSYA 2YRYA 1WJ4A 2JZ3B 1UEFA 1NVLA 3X23A 4ZRJA 1PLSA 1UNRA 2FNJB 2CB8A 4IWOA 2COAA 3KRXA 1AQCA 1A5RA 1X1GA 5AEKB 1V6EA 1BT0A 3LJUX 2PPHA 2DN6A 3ONSA 3F5RA 2MDXA 2FJ9A 3ODWA 3WA0A 2PEAA 4HB4B 4BOZB 2M4NA 4EZLA 2KLGA 3RD2A 3IG3A 4MGZE 5HE3A 4FJYA 2COCA 3PSCA 2DHJA 1OQNA 3QWMA 3R66C 1W1DA 2Z0DB 2KCJA 2OQBA 1ST7A 3EPYA 2GJYA 2JUOA 3A98B 4PYZA 1S3SG 1WGYA 1R4NI 2D11A 3A33B 2DX1A 5J3YA 1PMSA 2KO3A 2KVRA 1V88A 3PVUA 3SD5A 5CTRC 4ZYNA 1WY8A 3PSEB 3RULA 1UPRA 3RUIB 1FHWA 4HJKA 1WI0A 2BYFA 3ZNZB 5CHWA 4NSWA 1GG3A 1XQQA 4PS3A 2DZMA 4FULA 1TBEA 3L10B 2Z0OA 4DDID 1HB6A 1P1AA 4F7GA 2W9NA 5JHGA 1M94A 1WJ6A 4W9CA 2DYNA 5AZGA 1OQYA 3ENEA 2RUKB 4BFRA 3KW5B 2BPSA 1W1GA 1ZGUB 1Z87A 2I1KA 3GYPA 4CHMA 2FJLA 3DQVA 2NBUA 2CS4A 2MA9B 3D32A 3ECIA 5IJMA 2BKFA 1QC6A 2D4QA 1C1YB 3EC8A 3APFA 1M7RA 1FOEA 1WGQA 4II2B 2O2VA 2D2QA 3QBVB 4KIKB 4Y94A 3HQCA 3HM6X 1U29A 3UQAA 5JHBA 4WJNA 4ANXA 2XBBC 2LVOA 3VUYA 2V4LA 4OVVA 3TMPB 5D6JB 1E8YA 3TVVA 2MP2B 2YS3A 1OGWA 1UZXB 4DHZE 3N30A 1U5GA 3NY5A 2LG1A 1SHCA 2KGXB 2K8BA 5DI9B 5D3VA 1WJUA 2LVPA 3H7PB 1EAZA 2IY1B 4NAWB 2N7DA 2J0MA 2KUPA 1P0RA 1LFDA 1WMHB 2HRJA 2YS5A 3LDZE 3ZIMA 1KLVA 3PREA 2GMIC 4TKNA 2NR2A 2UVMA 2CU1A 4WJOA 3DPDA 1IRSA 3QCAA 4F1SA 3QQ8B 2YVCA 3WAOA 1WXVA 2RR9A 4MEMA 5E6OA 2ASQA 4W9GA 2FUHB 3ZUNA 4B6HA 3FEHA 2DYBA 3TBLD 5LOPB 2NZ8B 2LI5A 2K39A 4HATB 3K9PB 1T0YA 1OEYA 2IBIB 2L3ZA 2RD0A 2ZVOA 4XX5A 3MJWA 3HHMA 4HAXB 1UBIA 1YIWA 2H7EA 2EJ8A 3PZDA 2FAZA 5JLJB 1ISNA 2KJRA 5DIFB 1Z5SB 2XK5A 1WFYA 1L7YA 1WXAA 2MLBA 3RZWC 5EFXA 2KDFB 2DLWA 4JL9A 1V89A 1UNPA 1ZVRA 3UIOB 5TR5A 2MBBB 1EVHA 1ACAA 2GBKA 3LJ3A 5DPTA 2CHZA 4LJOB 3DBSA 2R2OA 2CY5A 4W9LA 4ZRKA 1K5GB 3PVWA 3A4RA 3DXCA 2N4FA 3T8MA 1ZC3B 4K7WA 3KH0A 3V6CB 5HE0A 1NTVA 2D9VA 4K7UA 2KMCA 3ZNID 2JT4B 4HCNB 4XC2A 3KVFB 3KZ1A 4WWPA 2Z0PA 2FIDA 3DVGX 4GXBA 2KDBA 3FP5A 2JPHA 3FLVA 1KZ7A 2JXXA 2O6VD 1HE8A 2R09A 2KWVB 3N3KB 4IC7B 5G2NA 1ZC4B 2G4SA 1P3QU 2KTRA 4WQOB 2KJHB 5DPRA 3K9OB 4I6PA 2DAJA 3PEGA 5D27A 2L76A 1U27A 2MFQA 1I42A 1X11A 1EGXA 3ZRCA 3M62B 4AOFA 1GNUA 3DXEA 2NBWB 1DYNA 1XODA 2G3QB 4KDLB 2L2IA 3KUZA 2Y8FA 4IFSA 2B3AA 2DFKA 2M38A 2GCLA 4FHKA 4A6FA 2EMSA 5D94A 4FJZA 3QIJA 3JSVB 2IO2B 3CSTA 2K8HA 5HKHA 3L54A 4PNKA 2M14A 1M7EA 4CHJA 3ALBA 2WX1A 3WALA 3UF8A 1WZ0A 2DYOA 2FCSA 4FJVB 3ODXA 1J19A 4NNJB 4K2PA 5AZHA 2DHZA 3OLMD 3WAMA 2CR5A 4GGQA 3ZVVA 2CQUA 3RT3B 2YLMA 2Z0QA 3TO1A 4HDQA 3AJ4A 3W1YA 2KWCA 3VUXA 2J0KA 2LBBA 2LASA 4DHZB 4KAXB 1WJ1A 5LLIA 2FIFA 4A5KA 1UPQA 3ZNGC 4ICUA 2YF0A 5KCVA 4GDKA 1WR6E 2KZRA 3JSVA 1BTNA 3N7CA 4F8CB 1P6SA 2G4DB 4MSMB 2YT0A 2DENB 4KDIC 3MDBC 2K2UA 1E8WA 1RFAA 1RLFA 1WH3A 4IG7B 4W9JA 2LRWA 1DROA 4N9F4 3SV1A 1UD7A 1V9JA 1TZ1A 5FI1A 2NCNA 2I5FA 1UGMA 2KQSA 1WIAA 1E7VA 1ZW7A 5KQ1A 3ZNHB 1E7UA 2RNRB 2LWPA 2DKPA 2J7QB 4P7IA 4DWFA 1X1FA 2D9WA 3ML8A 5L83A 2VKIA 2DAFA 2K00A 3ZW3A 2KK8A 5J3TA 3F0WA 5DH9B 2YS1A 2MW5A 2IO3B 2RQ1A 4K17A 2GBMA 3TFMA 2BWFA 2PE9A 1SE9A 3PLVA 1UELA 4ZDVA 1ZSQA 2GBNA 3RCPA 4HAZB 1FGZA 1E5WA 2RGFA 4FBJB 4CO7A 1IPGA 2MBOA 2D10A 3WYFB 4XWXA 2D9ZA 1LXDA 1MKEA 3JVZX 4A6KA 4PS7A 3ML9A 2KD0A 4EJNA 1BWNA 1FXTB 2N1VA 4AWJA 1WM2A 4YL8A 1K5DB 5G55A 3SNHA 3OAWA 1MIZB 4WSFA 2R2QA 4B9KA 3MHSD 4BBKA 3VH3B 2UZRA 2K2JA 3O96A 5C79A 2DA0A 2JRHA 3DXDA 1K8RB 2MBQA 2O2VB 3L16A 3DBRI 2RVBB 2AYOB 4EOYA 1LM8B 2BWES 2IYBA 3UINB 3IHPC 1NTIA 2WDTB 5C16A 4NJ7A 2JVCA 3PPAA 2D3GA 3ODOA 2ZEQA 2FCMA 2DX5A 4F7HA 2G45B 4F7UP 3EFUA 2DHKA 3HW2B 3PP2A 2K8CA 2KOXA 1Y19B 3PGEA 4WAAA 2Z59B 3EHVA 3T9LA 4E71A 4GN1A 3MPXA 4XZ4A 4K2OA 2C5LC 3PRMB 4M0WB 1MPHA 3PS6A 2HTHA 3RYTA 1GJZA 1F9JA 1XT9B 2EMTA 2Z0EB 2ZNVB 3QA8A 1KZGA 2CRFA 5FR6A 2OOBB 3AXCA 5L95C 2DZKA 1Q5WB 3VTUA 3A8PA 2YSZA 1GC7A 5C5BA 4G11A 4Z2NA 2C9WB 4EEWA 4K1RB 4KVGB 1R4MI 3H9DA 4KHBB 4WJ7A 3Q3FA 5D3WA 1TQZA 1WYWB 2P8VA 1I2HA 2JP2A 1J8CA 5DPWA 1FGYA 3D8EA 2GBRA 1WX7A 4CYEA 4H8SA 4KSLC 4B95A 2CHXA 2KXJA 2WYQA 1E90A 4ANWA 1NI2A 1P9DU 3D8FA 4W9DA 4DBBA 3U30A 2DTCA 1WZ3A 2RGNB 1NDDA 4IWPA 1HB8A 1LQBA 3APCA 3JW0X 2XK5B 1Z2MA 2EKEC 2GBJA 4HK2A 3V62A 1X86A 1I7AA 3L13A 1LW3A 4I6LB 2NMBA 4MGKE 3WANA 2N9XA 3B1LX 4G0NB 4JQWC 4DX90 3QHTA 3BJIA 4PQ0A 3V5WA 3OANA 4NY0A 2MCNB 4G3XB 1PQSA 1L2NA 3QJZA 2JZZA 2ABDA 4FHJA 4A3OA 2BCJA 1WXSA 1W1HA 3KUDB 1LB1A 1Q67A 5HE1A 2KJ6A 2W2XC 2MWNB 2LULA 2KC2A 2ZPYA 5JH5C 3VOQA 1WX9A 1YX6B 2NVUI 3OJ3A 3P7ZA 1MK9B 3ZDMC 1J0GA 4M8NA 4EMOA 3ZTDA 3QX1A 4JIOU 5KHQA 1G6JA 2KTRB 3WIMA 4PS8A 2KTFA 4RM8A 3M63B 4GDLA 3VXWA 1SGHA 1U5EA 3T06A 2NS5A 1FAOA 2OTXA 1AARA 4NPNA 4AJWA 2LD9A 4KHOA 2ROVA 5E6PA 1V80A 4AP4C 5C23A 2ZZPB 1X1MA 1V2YA 2KDIA 2CY4A 2IO1B 4A3PA 3DDCB 3H1UA 2QKLA 1GC6A 2ZNVC 1KJTA 2MBHA 4IAPA 5BO4B 4A6FB 3PHWB 1WF9A 2AL6A 4HB2B 1EO6A 5JHHA 1YQBA 3PRZA 2BYEA 3PRPB 4BBNF 1J0WA 4NQLB 2N9PC 4AJYB 3TCAA 4HLEA 2J59M 5FI0A 1UNQA 3Q3JA 1IYFA 2N1WA 2GCJA 3W1SA 3CIKA 4W9FA 2FCQA 2FCNA 4JGHB 2N23A 3HK0A 1MIXA 4ANVA 3ZKJC 5D3XA 2AL3A 3DCGA 3HIZA 2A4ZA 2LYDA 2C60A 4HVBA 3A9KA 2LOXA 4HXDA 2IZVB 2AEHA 2DKQA 4KZCA 1IP9A 3SDLC 2UWQA 5KHOA 2PE6B 2BYVE 1Q0WB 2LKOA 2BKRB 1KOTA 4GDKB 3A1QA 4MDKE 2WX0A 5D3YA 1XX0A 3AI5A 4GOCA 5CX3A 5J17A 1KI1B 1OTRB 3GZNI 3AU4A 3V61A 3VQIA 5JHAA 1TXDA 4IW0A 2MBEA 3CMMB 4HWIB 5C6RA 3ZDTA 4IM2A 3BINA 4MM3A 4WJPA 4IOYX 2NPTA 4HB3B 3KUCB 2NBVB 4BKSA 2BGFA 1V86A 4ZRIA 3R3MA 3QARA 1V49A 4MJSA 4J6IA 2L00B 1MG8A 1E8XA 1V61A 1RAXA 1Y5OA 4KZ0A 2C7HA 2D9YA 2HE7A 4ANUA 3M3JA 3B08A 1EUVB 4W9HA 3U8ZA 3N32A 4HPLB 4IM0A 4GIVA 1U2BA 1WGRA 1SIFA 4DXAB 4MT7A 1U5DA 1NBFC 3JYUA 5DPSA 4HDOA 2L1CA 3DVGY 3W1SC 2LGDA 1U5FA 3ZVRA 2CHWA 5IAAC 2KANA 1WX8A 1H8CA 3VIAA 1D3ZA 5D7GA 4IUMB 4GB9A 2CODA 2K25A 4MH0E 2G35A 3VH4B 3DBHI 4I6NB 1EF5A 3A9JA 4BBNC 4ASWC 1TTNA 4BOSC 5HE2A 5LXHA 3VFKA 1WJMA 2W2WA 4KV2A 1YX5B 1XD3B 2W2XD 2KFJA 3ZO5B 4WWOA 2WH5A 1KM7A 2O6VA 2I5CA 1BAKA 2KFKB 2COPA 1FHOA 1WR1A 2N7EA 3UZTA 2Q13A 2QKMA 3S2AA 2KX0A 2CAYA 2DX5B 3CSFA 3P6AA 4EZJA 3EECA 1OMWA 4GPTB 5CHFA 2MRPA 4DHJB 4LDTB 4TQ1A 4KSKC 4YONA 3DVNU 2IYDB 4HHVA 3MTNB 3UGBB 1NU2A 2R0DA 1CMXB 3VDZA 4HAUB 3UQBA 2CKHB 5KQ4A 1V81A 2HTHB 5CHVC 2KN5A 3IBEA 3QK0A 2XEWA 1WG7A 4NQKE 4MK0A 3NSUA 2KFKA 1P5TA 2GOWA 2HJ8A 3TL5A 2KHWB 4E3CA 4E74A 2EC1A 2REXA 3V6EB 2LUEA 4DK5A 5LONB 2D07B 2XQNM 3DOWA 2K1FA 2LXCA 4IWQA 5C5BB 2V1YA 5L81A 2KWUB 3C0RB 5DCNA 2C7MB 2FDQA 3G9WA 4RMAA 2JWZA 1WM3A 2X18A 3RZFA 3PHXB 4WWNA 3NZUA 4EZKA 1GUAB 3KY9A 4W9IA 2I1JA 1TGZB 4GU2A 4A20A 3IVFA 4W9KA 4JLCA 2MQJA 1WGDA 2KDEB 3VTWA 2DYMA 1FB8A 3U7DA 3A8QA 4TUUA 3L0WB 2GS0A 4EKUA 1DBHA 4GSWA 3PTFC 1QQGA 1ZM0A 3KYDD 4LJPB 3L17A 1YJ1A 2IFSA 2M8SA 1WGGA 3DVNV 3DBLI 2KC1A 1Q1OA 3RCZA 1P3RA 2LZ6A 1WGHA 2LXAA 4HCPB 2DYQA 2ZCBA 4IM3A 2DZIA 3VUWA 1WRDB 3WAPA 2P0DA 1DDWA 2K6DB 4FADA 2M17A 2L05A 5E6NA 1WJNA 3VAWA 5JZEB 1WGUA 3GOEA 1N3HA 4L6EA 3ZRFA 2ZCCA 2ZPNA 3M1IB 4URKA 2VRRB 2JRIB 4TV3A 4OVUA 2LGXA 4KIKA 3M95A 2A5UA 3SUZA 4GDLB 4GMXB 2L8JA 3PG7A 1UH6A 3B0AA 2MP2A 2Y8GA 3GYOA 4A6HA 2PZ1A 2MSED
chains in the Genus database with same CATH superfamily
1C4AA 3FUHA 1NL4A 2PTLA 4KVMA 3VVWB 1WM5A 3ZPJA 4P29A 2RDBC 4UI9J 3UKUG 2MWSB 3RNGC 3KYCD 2WQHA 3AJIA 4AP2A 4GTMA 4WJQA 4P1CC 3CXBB 2UYZB 2WXNA 3H7PA 2Z13A 3R2TA 4BKTA 2WQ7A 1DGJA 3W5UB 4BKSD 3UIPB 1AWEA 1TZOA 1IQRA 2HO1A 3KSQA 4NURA 3APDA 4NAWA 3R7QA 3TEXA 1HBKA 4BVUC 5C3JB 2KLCA 4MSQB 4II3B 4CEMA 2MKRA 2D9XA 3HYMB 2IOLA 4HS2A 2XS1A 4C0EA 1XR0B 1WMHA 3I5JC 4GTPA 5ARGA 1XKEA 1RJ2A 4Z2MB 3FSSA 3BY4B 3PV1A 4P16A 2ZISA 4QAYA 1X05A 3NWAA 3A58A 2VSZA 3FWVA 1HH8A 3NOBA 3R7RA 3VHTC 1FCLA 4YVOA 3PVLA 1F2RC 4QJ3B 2ELBA 1RRPB 1YN5A 3CF6E 2RPQA 3P1MA 3QWZB 4HAVB 4FA6A 2L0TA 1I35A 2I2YA 5EDSA 1QOAA 2COFA 4HBDA 2ADZA 5JP4A 3NW8A 4HPMB 2FJUB 4KHAA 2AXVA 2UZSA 3MYVA 1DDMA 4WNFA 4Y6CA 2K8EA 1PFJA 4HAYB 3WG7E 4NIKA 4EUTA 3EGRA 1PUTA 4BAXA 4C56C 5LG4B 1DDVA 1V5MA 2Y5PA 2R17C 5AZFA 3CK8A 1E10A 1WVHA 5J2RA 1JRUA 3D9KA 3A9KB 1IGCA 5ENRD 2AQ2B 4GMRA 3SHQA 2YHEA 3E56A 2HYZA 3UT7A 3I3TB 3AU5A 1N4RA 2HD5B 2V3SA 2WWZA 5G5HA 4ILJA 3V2OA 2OV8A 1V5PA 2ICIA 3VTVA 3NQPA 4C0AA 4L7TA 5IRSA 2Y5CA 1FT2A 3ZXSA 2KKCA 5CLLB 3PT2B 3TJPA 5D0QD 2N0YA 4M02A 4LCDE 3JCKC 1DVPA 5GOWB 1C3TA 5ANLA 3A1QB 5IA7A 4EFOA 4HB5A 5DHFB 3U12A 3NRZA 4G50A 1Z3XA 3QAQA 1MK7B 1NTYA 5JXVA 4K81A 3L08A 5CEAA 3X0WA 3FUIA 1P98A 2JQRB 5BPPA 3ULCA 3E9PA 5CLQB 3CVUA 3O65B 3E9OA 2KMAA 4DDGD 2ETCA 2INDC 5FR3A 3TG5A 2ETBA 1N61A 4M8MA 1XCGA 4XGAB 1E8ZA 4PK1A 5J18A 1SF0A 2M0AA 4TYZA 4HOSA 1WE6A 4Y6WA 1F1HA 2D3CA 1GB1A 1V5OA 1Y8RC 1V5TA 4ICVA 2ON8A 3PO0A 3C72A 1OUVA 2VRWB 3CQCB 5BV0A 2OJWA 3DWMA 4FC8A 1H10A 3A4SC 3QKYA 4TQ0A 4N3CA 1SXTA 1XCTL 2NPTB 1ZOYB 3RNFC 2OCCE 4NACA 1MAIA 3ZNGA 5T8IA 2X38A 3ZN3A 4GZUA 2H6FA 4HKQA 4RVBA 1U4AA 2VH1A 4D2KA 3SU8X 4JVSA 2WDQB 1I4HA 1A5EA 1TS5A 3MP9A 4MJSB 4AUQC 3PZ1A 2R61A 4P1BC 3TIXA 2TSSA 3FILB 5AAOA 4HROA 4D0NB 1G3NB 2RSGA 2R03A 2YT1A 4MGYE 4DUIA 5KJNA 4FN2A 2DCPA 2V76A 1V5UA 4TXPA 1WXMA 2DHIA 3O13A 1OY2A 3FY4A 4I43A 4JKHA 3ZEFA 4HORA 2C7NB 1FVHA 2GLSA 2KNBA 2N9LA 4ZHOA 3AULA 2BB6A 1NEKB 4FU3A 4QXAB 1N11A 1HG2A 2P0FA 2L0FA 3PNTB 1N0RA 3LJNA 1NFIE 5D2MB 5GMVA 1WSPA 3X2QE 4AXHA 2LOZA 3VR8B 2H7DA 4WVFB 1XD4A 4CHKA 2MH7A 2IO0B 5G05C 4N2SA 2M0XA 1Q10A 2BYTA 2BKGA 1T0SC 1BPOA 3IHVA 3SYXA 2LJ5A 3W5VB 1TNZA 2N9EB 2V0PA 2MX2A 3HXFA 2LGYA 4XIFA 2XCCA 1WE7A 1ZXHA 2OJRA 3H6NA 1FXIA 5EIBE 4GZCA 4RM9A 1D5XC 4W9EA 1YN3A 2LJIA 2WHIA 2WU2B 3KAEA 3VR9B 3MC0B 5GXGB 4MELA 2AWTA 3TWUA 3HM3A 4WWMA 1FHXA 2AQ1B 5C1ZA 2MRIA 3D8DA 2AJAA 4F6RD 5BMGA 1WRIA 4X57B 4EECA 3QDNA 2XQ0A 1ZKHA 4B0ZA 1OEYJ 1JCSA 4HB0B 2LMCA 2BEDA 3R2IA 1TJ6A 2IGHA 4B0MA 1TKEA 3QC8B 3J9CA 3WXXA 3NWDA 4DX8A 5AARA 4I1MA 3W2DA 3MGBA 3A9JB 3GZNB 3URYA 3ZTCA 2ZJDA 4KX6B 4GCNA 2ELAA 2L0IA 4F7ZA 3FILA 5ENTD 3SBSA 3N1XC 4N3AA 3CK9A 4JK9A 3UIPC 3I5PA 1QZEA 2V9HA 2JF5A 1YD8U 1ELRA 1ZDVA 4PYUA 1EWYC 1B55A 4C0MA 2Y0BG 2LRUA 4BETA 1E9MA 3CK7A 5DIZA 3KRWA 4BZAA 2LGIA 2UY1B 3GW4A 2K0PA 3TW1A 1O5MA 4X8QA 4AQ7A 4U7EB 3NVZA 1H4RA 2O6VB 1UJKA 2XS8A 4BKGA 2PJHA 1YCSB 4DHJD 4WUYA 2BF8B 3H7SA 3L4PA 4LDTD 3V60A 4OT1A 1LD7A 2BS3B 2P9KG 1S1QB 3DSWA 1WI1A 2LVQA 4WAFA 2X6HA 3NS1A 4J8DA 2NTSA 1MI1A 4JKCA 4L9PA 1Z5SC 2J49A 3U4EG 3PZ3A 3FU0A 3OJ4B 1UJJA 4KBQA 4MGIE 4OAUC 2D3AA 3P4RB 2ZVNA 1YA0A 3F6QA 2P0HA 2PM7A 5IO9A 4G26A 2L7RA 5LXIB 2RLOA 3W9FA 1VD2A 1JPLA 3NS8A 1FFUA 2X6KA 3CHPA 1KZOA 1I4GA 3FM8C 2KQ7A 3NHEB 1VCBA 2X8XX 2C0MA 5EYPF 1MPEA 2WNMA 2Y5BB 4NJ6A 3EFCA 1OCZE 3E4BA 1JWSD 3CVPA 3RO2A 1EF1A 2FO1E 1ESFA 2W3RA 1S64A 4DBGA 3ZJTA 1F52A 3IFWB 4N5CA 2E2XA 3LB8C 3FTXA 4OYSA 4DX2A 3FUKA 1OWPA 3QWPA 4NRHB 1ENFA 2KX3A 2J0JA 4HAWB 3P2BA 4NQ0A 4MY6A 1QZ2A 4GMVA 3TUOA 4RF1A 2ROZB 3CR3A 5J3QA 4W9RA 2Y7BA 3DCXA 1I4PA 1C4CA 4GTVA 4K7SA 5FK9C 3FH7A 3ML4A 5DHAB 1GOZA 4RQIA 2DZJA 1RRBA 4YWGG 3ZLZA 2IY0B 3UI2A 3RN9C 2UY1A 3ULBA 2K6QA 2M1MA 3T3OA 3N1YC 4YSYB 4FLHA 2RSUA 4XKCA 4A3TA 4AY5A 3NZSA 3FUDA 1OCOE 2WPVA 1BTKA 1UBQA 5I2MA 4B6WA 5HFYA 3UPVA 3Q9UC 4Q94A 4UQZA 5ENNA 1KRHA 2KBXA 2QHOA 1DC2A 2OVFA 2DYRE 2H88B 3D9NA 1Y56A 2JY6A 2WXFA 3Q6BA 2I38A 3TXNA 3SO6A 3KSYA 3U7ZA 4A90A 2YRYA 4OW0A 1WJ4A 2VJ8A 2JZ3B 1UEFA 1NVLA 5HI1A 3X23A 3AEGB 4HRNA 3ZYKA 4J8FA 3B2FA 1EU3A 4ZRJA 4HRMB 1INZA 3CKBA 1DOXA 3Q5MA 2J08A 1PYWD 4I9CA 1PLSA 4U8HA 1UNRA 2FNJB 2CB8A 3PZ2A 4XYCA 3QB2A 4YTNB 4IWOA 2COAA 3KRXA 1AQCA 1A5RA 3AS4A 1X1GA 5AEKB 4UI9K 1V6EA 3JQ1A 1D5ZC 1BT0A 3LJUX 2PPHA 2DN6A 3ONSA 1T0QC 3F5RA 2MDXA 2FJ9A 2WU5B 1N62A 5M4YB 1H2VC 3ODWA 3WA0A 2PEAA 4C4VB 4HB4B 2YEPF 2M4NA 1EDUA 4HJGE 4BOZB 3B13A 4EZLA 2KLGA 3RD2A 1FNWA 1SZAA 3IG3A 4MGZE 2KIGA 4TMAB 4FJYA 5HE3A 4C00A 1HF8A 2E3TA 2KCVA 5D2MC 3UM3A 2WXLA 5LP0A 1AP7A 2COCA 2F8XK 2ZXWE 2RMMA 3EHMA 1MX2A 3UXGA 3PSCA 4J8YA 1NA3A 1GW6A 3GZ2A 1OQNA 2DHJA 3QWMA 3R66C 1W1DA 1ZB1A 2Z0DB 3NVWA 3PLUA 5EE1A 2X6JA 4XE0A 3L6AA 3CVNA 3HVEA 3P1UA 3HVZA 2QC9A 4WURA 2KCJA 5CCMA 2OQBA 1ST7A 3EPYA 2GJYA 2JUOA 3A98B 1OQQA 4PYZA 3MC8A 1TT5B 1VZ8A 2BS4B 1S3SG 5FZSA 4DX5D 5LCWC 1QKZA 1WGYA 2RRFA 3B9JA 4GA0A 3KEZA 1R4NI 2D11A 4OZBA 2X3MA 3A33B 5AQ9A 1SZ9A 2DX1A 5J3YA 1PMSA 1NI3A 4N59A 1JW9D 3Q8CA 3KD7A 5G04J 3AEEB 3U3WA 4WNDA 2KO3A 2KVRA 2YINA 1V88A 2KYWA 1QQRA 1FNUA 1EF1C 4G23A 3PVUA 1ZYIA 5FQ8A 4LNBA 3SD5A 2WXPA 5ENQD 4DLOA 5CTRC 4ZYNA 4PDXA 4YSZB 1SA5A 1WY8A 1S63A 1XGWA 3PSEB 3RULA 1JWBD 3MA5A 1UPRA 3RUIB 2FF4A 3IHYA 1FHWA 4HJKA 3U64A 1X5BA 1WI0A 2BYFA 1WGKA 3ZNZB 2L6BA 3CHOA 5CHWA 1IBXA 4NSWA 1GG3A 4BY6A 1JWAD 1XQQA 4PS3A 2DZMA 3BK2A 4FULA 4OZAA 1N4PA 1TBEA 4B0EA 4U8VD 3L10B 2Z0OA 4LNNA 4C4VA 4C7ZA 2ETAA 4BT8A 3EUB2 4DDID 1HB6A 2OOEA 4F7GA 1EM7A 1P1AA 1HS6A 2W9NA 5JHGA 1JUQA 1M94A 3VLFA 5EX0A 2GW1A 2W54A 1PAQA 1WJ6A 1RW2A 5D66A 5FZRA 2DYNA 4W9CA 5KNGA 2YNQA 2LO6A 5AZGA 4JA7A 3DPYA 1HQRD 2PVGC 2Q7FA 1OQYA 3ENEA 3DHGC 2RUKB 4BFRA 4RSYA 3KW5B 3BQOA 4DIXA 2BUGA 2KCKA 3NOCD 1QLBB 4DX7D 2BPSA 1J7AA 3FVCA 1W1GA 1ZGUB 2ZW1A 4J8SA 1Z87A 3RKVA 3FU6A 2I1KA 3GYPA 4I6EA 4CQNA 2XGSA 4CHMA 2FJLA 3DQVA 4RG6A 4O60A 5KCMA 1T0RC 2NBUA 2OHFA 3NJTA 2CS4A 1SSNA 2MA9B 3D32A 3ECIA 3ZHEA 1N94A 4RLYA 2RG8A 1K52A 5IJMA 3TWSA 5EKQD 4APOA 2BKFA 3SHFA 1QC6A 2D4QA 1C1YB 3EC8A 3APFA 3TWVA 3LYAA 2BVCA 1M7RA 1FOEA 1WGQA 1XCQL 4II2B 3RJVA 2O2VA 3UTMA 2PQRA 1VZ7A 5MPOA 1YOVB 2D2QA 2H6GA 3QBVB 5LX8A 5BMIA 2MJEA 4KIKB 1QBQA 4Y94A 3HQCA 3EU5A 4U0SA 4GYWA 3HM6X 4IN3B 1YMPA 1U29A 3UQAA 4CDMA 5JHBA 1HXYD 3E9LA 4DQOC 3Q8BA 2YQ8A 3IXEA 1UN8A 1STEA 4WJNA 4RF0A 5AQ7A 1GPXA 4LNKA 4ANXA 3ZJVA 2XBBC 2LVOA 3VUYA 2VGXB 2V4LA 2WXGA 3CKCA 4OVVA 1AW7A 3TMPB 2JSVX 5D6JB 2EIME 3FULA 1E8YA 3TVVA 2MP2B 2YS3A 1K53A 1ZE3D 1C77A 3TWWA 1OGWA 1RZ4A 2BT6A 1UZXB 3OTNA 3AB5A 4GTSA 3GB1A 4QFVA 2WMNA 4DHZE 3SGHA 1NI1A 2PVOD 3N30A 1YQ4B 1U5GA 3NY5A 2LG1A 2B76B 3T3NA 1SHCA 5KWDA 2KGXB 5C1DA 1HU3A 1B9RA 2K8BA 5DI9B 4KGSA 1EU4A 4HXIA 1VJKA 4HPPA 4JKBA 5D3VA 2Y3AA 1WJUA 2LVPA 3H7PB 3IXSA 4C7YA 1MHHE 2VSYA 3DBLB 1EAZA 2Z59A 1SB3C 1SE3A 4JXTA 2IY1B 1DIKA 5FZQA 4NAWB 2N7DA 4G2VA 1YNTE 4FLBA 3DWGC 2J0MA 2AXUA 2EILE 2KUPA 1P0RA 2WXQA 1N60A 1UWMA 4Z68A 1LFDA 1RFKA 3PUJA 1WMHB 3IV0A 3MX3A 4UWLA 1YN4A 1K8KG 5IOIA 2HRJA 3BYTB 1Z3YA 2YS5A 1HZ6A 3LDZE 1MFWA 3ZIMA 3ZYLA 4YVQC 1KLVA 3PREA 2CFZA 5H7PA 3I4GA 2GMIC 2KQ4X 4TKNA 3U66A 4M3OA 1N5WA 1S70B 2NR2A 3Q7AA 1BMLC 4UWFA 3CVYA 3NZ3A 2UVMA 5FT9A 2CU1A 4MH8A 3LS8A 3ETRA 4WJOA 3DPDA 2IEJA 1X81A 1IRSA 1P7EA 1MHXA 5HHDG 3S7DA 3QCAA 4F1SA 5B3SE 3QQ8B 2YVCA 2WXKA 2J09A 3PDNA 5D0OD 2RDHA 3C5RA 1K1BA 4EE2A 1L0VB 3ZU7B 1QT9A 3WAOA 4I2ZA 2XRYA 2QDFA 1WXVA 2ZU6B 5BXOA 2RR9A 4MEMA 3VRAB 5E6OA 2LSUA 2ASQA 2SAKA 4AM9A 4W9GA 2FUHB 3ZUNA 3ZXVA 4B6HA 2LXMA 1HA5A 3FEHA 2DYBA 4U63A 5T3RA 1UN9A 3TBLD 4R3DA 3CHSA 4AS1A 4MS6A 5LOPB 3SY2A 2NZ8B 1VR9A 2LI5A 2K39A 1TJFA 4HATB 4JD2G 3P63A 3K9PB 1T0YA 2VZKB 1OEYA 1HXIA 2IBIB 1OY3D 2RD0A 2L3ZA 2ZVOA 4XX5A 4TUMA 3MJWA 3W9CB 5ANRA 1FNVA 1A17A 4GA2A 3HHMA 4UQXA 3UM2A 3RI7C 1D8EA 1FMAD 2FE8A 4HAXB 4YXDB 4LCTA 4KKIA 3AV8A 1UBIA 3JYSA 4CSQA 1YIWA 2H7EA 5EX3A 2EJ8A 3PZDA 2XRZA 2FAZA 1ELWA 2GRRB 3UQ3A 5JLJB 1ISNA 3KWLA 2IONA 2KJRA 5DIFB 5BYSA 2JYEA 3D9LA 5AUKA 1Z5SB 2XK5A 2RFMA 3MZLB 3PEVB 1H19A 1WFYA 4K3BA 2W82A 1L7YA 5BW8C 1WXAA 5A6CA 1PGXA 2HR2A 2MLBA 3L9TA 2MEKA 3AE7B 3RZWC 5EFXA 2KDFB 2WP9B 2V5QC 4GZ3A 2DLWA 2GUMA 3JXIA 1Y8MA 1WDYA 4WNGA 4J0UA 4JL9A 1V89A 4OAVB 1UNPA 4YDYA 1ZVRA 2MBBB 5TR5A 1EVHA 3UIOB 4JWUC 1MYOA 5FQ4A 2X0SA 2XZDG 1ACAA 2GBKA 2R02A 3LJ3A 3ULYA 4N58A 1JQ4A 5DPTA 2CHZA 4JC8A 4LJOB 3DBSA 5IN7A 3LVRE 4JWSC 1LD8A 3FUJA 4LNIA 5B1AE 2R2OA 3RFZB 2L6JA 2CY5A 4W9LA 4ZRKA 1K5GB 3PVWA 3A4RA 1C76A 2BTEA 3DXCA 2N4FA 3T8MA 1ZC3B 4K7WA 4ZHBA 3KH0A 3TWTA 3JXJA 3V6CB 3CVLA 5HE0A 3BG1B 4LERA 1SE2A 4OZCA 3RNEC 1NTVA 3G2UA 3ZUVB 2D9VA 3FDHA 3GYZA 3OWEB 5KJKA 2DIWA 4K7UA 2KMCA 3ZNID 1PGAA 4YSXB 2JT4B 4HCNB 4XC2A 4LSZE 3IT4B 2J52A 3KVFB 4LRZA 3KZ1A 2GRIA 4WWPA 2H89B 2Z0PA 4CDRA 4KXKB 2KN4A 4JKFA 2I9CA 4GXBA 2FIDA 3LY7A 2KDBA 3FP5A 3ASOE 3DVGX 1TY0A 3Q4AB 2JPHA 2KDMA 4K0RA 2VH2A 2AWIA 1ACCA 3FLVA 1KZ7A 4I2WA 2JXXA 5FQ7A 5AIJA 2QFCA 2O6VD 5FKAC 1HE8A 2R09A 4EPZA 2KWVB 5AN8A 3N3KB 4ZOHC 4ILIA 2KWDA 5G2NA 4IC7B 4ABNA 1ZC4B 1L6UA 2G4SA 4JZYA 3VTXA 1P3QU 2KTRA 4I6JA 3SBTB 3AE5B 5LNK1 4WQOB 1UOHA 1C79A 2KJHB 1LO5D 5DPRA 3K9OB 2EIJE 2Y4UA 4I6PA 2P9UG 3AE4B 2WQ6A 2DAJA 2EIKE 3PEGA 5D27A 2QILA 2L76A 3V30A 2P9NG 1IYGA 3SEBA 5M72A 1U27A 2INNE 2MFQA 3V3XA 4U07A 3B77A 1TYGB 4M00A 1I42A 3HG0D 4K03A 3PZ4A 3ULEG 1X11A 1EGXA 3ZRCA 3M62B 4CGWA 4AOFA 1MX4A 1GNUA 2JEKA 3I63C 3DXEA 2F0YA 2WQYB 4GMJA 2NBWB 1DYNA 3Q79A 1XODA 2G3QB 1LTXA 4KDLB 2L2IA 1TJEA 1R7SA 3KUZA 2ONDA 1HZ4A 1UF0A 2Y8FA 2FBWB 2LXLA 4IFSA 3SZ7A 3VLDA 2B3AA 2BS2B 3LVQE 4ACKA 2DFKA 2M38A 1BXTA 1L6VA 2K5PA 2GCLA 4HOTA 4FHKA 4A6FA 4CRWA 2EMSA 5D94A 3ZYMA 4FJZA 3QIJA 4USAA 3JSVB 2IO2B 1NP7A 3CSTA 3KQ4A 2K8HA 4F7AA 3UKRG 4B89A 1TY2A 5HKHA 1TNBA 1SQMA 4BX8A 3L54A 4YTMB 4PNKA 2M14A 3AS5A 1M7EA 1ET6A 4CHJA 3ALBA 4RH6A 2NYJA 2WX1A 3B7BA 3WALA 3UF8A 4ILHA 1WZ0A 2DYOA 2FCSA 4FJVB 3ODXA 1J19A 4I17A 4NNJB 2OVBA 4D10C 4K2PA 5AZHA 2DHZA 3R9MA 3OLMD 3HUIA 3WAMA 3SBTA 2CR5A 3DHIC 4GGQA 5CMYA 2MJ3A 1JWMD 3BK1A 3ZVVA 2DBAA 1LGRA 2CQUA 1KH0A 5D3IB 3RT3B 2YLMA 2AXZA 1FM0D 2Z0QA 3PH0C 3TG4A 4GMLA 3TO1A 3B7TA 4HDQA 3AJ4A 3SFDB 4BERA 2KWCA 1L4DB 3VUXA 3W1YA 1B1ZA 2J0KA 1LF8A 4CT4A 2LBBA 4RGNA 4US8A 3CWIA 2LASA 1PDXA 4DHZB 2XPZA 4YNDA 1WJ1A 2L9BA 4KAXB 3QNKA 1PC2A 4BTAA 1QYMA 1AYFA 4IDIA 3V2XA 5LLIA 3AEFB 4DXGA 5CRVA 1NENB 3ONLA 1D9SA 1OT8A 5G05J 3ESKA 2FIFA 4NJCA 3TEZA 5B1BE 4A5KA 4JKGB 1V54E 1UPQA 3ZNGC 2KR0A 4ICUA 2YF0A 3FTWA 4KMOA 4J3OD 1JMLA 5H8YE 4HOUA 5KCVA 3EIQC 4GDKA 1WR6E 3FTUA 2KZRA 3JSVA 2FI7A 1FXAA 1BTNA 3N7CA 4F8CB 1P6SA 4A63B 2G4DB 1WG0A 5FTPA 4MSMB 2YT0A 3R8BA 5EYLA 4TXQA 2DENB 3MFGA 3UIOC 4MACA 3FUEA 2AW6A 3HDXA 1MJ0A 2C2LA 2VGYA 3AS8A 3C98A 3FTYA 4KDIC 4BX9A 1SE4A 1E8WA 4GTTA 2K2UA 3MDBC 1RFAA 1DOIA 3LCAA 4V3IA 4F3VA 1N4QA 1GAQB 1RLFA 2QIEB 4XDDA 1WH3A 4IG7B 4RG9A 3IAM1 4U0ZA 2QC8A 3P4PB 4W9JA 2LRWA 1DROA 1UG3A 1NYQA 2LFIA 4N9F4 2V5FA 3AM9A 3SV1A 1WY6A 2VSOE 1V1PA 2UU7A 3TGOA 3HIEA 2NBVA 2UWJG 1UD7A 3ABKE 4E6HA 2WGSA 1V1OA 3T8KA 1TZ1A 5FI1A 1V9JA 3ASNE 2NCNA 5I4DA 1HTOA 3PZ8A 2WXIA 2I5FA 1UGMA 2KQSA 2IFUA 1WIAA 1E7VA 2BF0X 1ZW7A 5KQ1A 3ZJUA 3ZNHB 1T3QA 1E7UA 2RNRB 2G1EA 1QOBA 2LWPA 2AQ3B 3Q8AA 3Q14C 4TSSA 2DKPA 2J7QB 4HKZE 4P7IA 3HVEB 3PNLB 5BXUA 4DWFA 1X1FA 2D9WA 3ML8A 4LG6A 4ARCA 2RFAA 2VQ2A 3E32A 5L83A 3DSVA 2VKIA 3SO8A 2DAFA 5CECB 1OWLA 2K00A 3D9IA 3Q9NC 3T5VA 2FULA 3ZW3A 4EBAG 1AN8A 4AIFA 2KK8A 2W55A 5ENOD 5C2YA 5J3TA 2XEVA 3F0WA 5CRUA 4JKGA 2YS1A 5DH9B 3LY8A 1D5MC 2MW5A 4JHJA 2IO3B 4ITKA 5FQ6A 3OXFA 4C9BB 3CHMA 1P5QA 3DEOA 2K9XA 4GAAA 2RQ1A 4K17A 1ET9A 3DSSA 2GBMA 4HI8A 3TFMA 2PL2A 4AVXA 4ATZD 2X6FA 2IF4A 2BWFA 1SE9A 2PE9A 3PLVA 2CU3A 1UELA 4ZDVA 3DRAA 1ZSQA 2YEPB 2GBNA 3RCPA 3LDZA 1EPUA 4DI3A 4H7YA 3CVQA 1T5XD 4D6WA 3L22A 2B0OE 5G04C 1IBXB 2I6HA 4HAZB 1FGZA 1E5WA 5IKCM 2RPVA 2RGFA 3U9WA 1MVKA 2CFUA 4HFGA 2KATA 4BTBA 4FBJB 3OXLA 4CO7A 1IPGA 2MBOA 3AH7A 2D10A 1QILA 3CVXA 3WYFB 4XWXA 3IKOB 1KTKA 1J7BA 2D9ZA 4U0UA 4DX6D 1LXDA 1MKEA 3JVZX 4KGRA 5D3DA 4PS7A 3RO3A 4A6KA 1H6KA 3ML9A 2KD0A 3MC9A 4EJNA 1BWNA 1FXTB 2N1VA 1NYRA 4AWJA 2NXPA 1FVFA 1WM2A 3Q15A 4YL8A 1K5DB 2E0IA 5G55A 2IJ0A 3SNHA 3OAWA 1MIZB 3T9KA 4WSFA 4Q2JA 3UT8A 2R2QA 4B9KA 4CZ2D 3EHQA 3CVWA 2IO2C 3MHSD 4BBKA 1TS4A 1QOGA 3VH3B 2XENA 3S7JA 3ZHEB 2UZRA 2K2JA 3O96A 5C79A 4QQIA 1Z6TA 1BI8B 1U2VG 3IAS1 3D9MA 2DLBA 1EWCA 1ELKA 2DA0A 2JRHA 3ZGQA 3DXDA 1K8RB 2LAIA 2MBQA 5IP4D 3L16A 2O2VB 2K22A 2Y1LE 3DBRI 3QWVA 3FUFA 2QYJA 2RVBB 2DYSE 3ABLE 2AYOB 4EOYA 1F2RI 2R5SA 1LM8B 2FBNA 4BWRA 2BWES 2J4DA 2LEKA 4LK0M 2E2EA 2NSZA 2IYBA 4JPSA 2M56B 2IOSA 3TEYA 3UINB 3IHPC 3Q49B 3CQGB 1NTIA 4MKTA 4L23A 2WDTB 5C16A 4NJ7A 1WYGA 3AAAC 2P9SG 2JVCA 2QCZA 3PPAA 3AEDB 1VDYA 1YYHA 2Y69E 1DNPA 5ARFA 1E96B 1M4VA 2D3GA 3ODOA 2HDEA 1N95A 2SEBD 1V8CA 1C78A 2ZEQA 2FCMA 2DX5A 2CJOA 1H0AA 1R4NB 2IGDA 4F7HA 2KT7A 1FPPA 3ASGA 3I4RB 2G45B 2WXJA 4GYOA 1O1RA 3ENBA 2DIKA 1NVID 3RIBA 4F7UP 1MQSA 1GB4A 1KPSB 4J8EA 2WB2A 3B95A 4IRUA 3EFUA 5FJYA 2DHKA 1FRRA 3SBGA 4XWTA 4A6QA 3HW2B 2KM4A 4UWHA 3PP2A 2K8CA 1MHQA 2KOXA 1Y19B 2Z14A 5BYQA 3GZSA 3PGEA 2HTME 4B8CB 4WAAA 1VZ6A 3AG1E 2Z59B 5EN5D 4KT6B 3EHVA 4JEUA 4F1PA 3T9LA 3RNAC 4GN1A 4GOUA 4E71A 3MPXA 2KXPC 1OWNA 4XZ4A 2X6IA 4K2OA 2C5LC 3AE2B 3B7RL 2BBCA 3PRMB 4M0WB 1MPHA 4HRLA 3PS6A 2N9KA 5HRYA 1KZPA 2HTHA 3FFLA 4JKAA 3G2TA 5CCLA 3QWWA 2XPYA 3JUIA 3RYTA 4A1GA 1GJZA 5E76A 1L0YB 3WCQA 1F9JA 1XT9B 2EMTA 2ZGDA 1TN8A 2Z0EB 1VBGA 2ZNVB 3QA8A 1KZGA 2CRFA 4L2LA 4QJ4B 5FR6A 2A5EA 2OOBB 3AXCA 3FU5A 2JX5A 3E33A 3D9OA 1QOFA 5L95C 2DZKA 2KZTA 5JMND 1A70A 1OWMA 1Q5WB 1TKYA 5ENPD 2IPKD 3VTUA 2P9LG 2VZKD 3A8PA 2YSZA 1GC7A 3J5QB 3FC4A 3GE8C 2VYIA 4G11A 5HS0A 5C5BA 3EDTB 4Z2NA 2C9WB 3PEUB 4EEWA 2VGEA 3BG0B 2KVZA 3V79K 2DWQA 1DYQA 4K1RB 4KVGB 1R4MI 1UWXA 3AEAB 2IU1A 4N5QA 3ZYQA 5J90A 3H9DA 4AEZC 2VTBB 3HXBA 1K3ZD 4KHBB 4WJ7A 2JLBA 4A3VA 1OCCE 4UWKA 5D3WA 3Q3FA 4R7LA 2DZNA 3KEAA 1TQZA 1WYWB 1V97A 2P8VA 3MKQA 1I2HA 2JP2A 3NVYA 3FEXA 3P4QB 1J8CA 3HXCA 2GRNB 1FGYA 2IO3C 5DPWA 3BWUD 5BNWA 5JJTA 3D8EA 2GBRA 1WX7A 1FD6A 2ZGGA 4CYEA 4GCOA 1CZPA 4G8LA 4H8SA 1D8DA 4KSLC 3NWFA 4O1PA 4B95A 2CHXA 2KXJA 2WYQA 1E90A 4ANWA 1NI2A 1ZBPA 4HQDA 3U2SC 1P9DU 3SF4A 4M0WA 3D8FA 4W9DA 4UI9C 1PFDA 4DBBA 5H92C 3U30A 1L5PA 1HTQA 1SBBB 3N9YC 3GP7A 3RAUA 3ISMC 2IQCA 2J4BA 4S17A 1HO8A 4GPKA 4MRUA 2DTCA 1WZ3A 3QC1A 3EHRA 3Q47B 2YHCA 3ZXPA 4H7XA 1T77A 2RGNB 2RDGA 3I57A 3NOGD 1NDDA 4IWPA 3T5XA 2XGOA 1U3CA 1HB8A 1LQBA 3ZXRA 1H2TC 4C48B 2CG3A 2L1AA 1JWGA 2PZIA 3CVVA 2BTDA 3APCA 4BSXA 3AE1B 3JW0X 1TYQG 3ZYYX 4HLLA 2BQQA 2ONQA 2XK5B 1Z2MA 2EKEC 4NZLB 4IULA 5I2SA 1I4XA 2GBJA 3RSEG 3HRDD 4HK2A 3V62A 3AE3B 4EHMA 3S7BA 1X86A 2QY7A 3UM1A 3FKYA 4LNFA 1K1AA 1JCRA 4GTRA 5CMWA 1BD8A 3IEGA 1I7AA 4US9A 4RFBA 2XHEA 1TJCA 3L13A 1LW3A 4RNAA 4I6LB 3RRMB 1TIFA 1KT1A 2VTBA 1UW4B 2NMBA 1I4QA 5FINA 4KHBA 3OXGA 3NB2A 4MGKE 3WANA 3Q3OC 4REZA 2N9XA 3B1LX 1N63A 3C3OA 4G0NB 4JQWC 4DX90 2NMQA 1AWCB 2XCBA 3AE9B 3I3NA 4L1BA 3QHTA 4P6VF 3FHEA 3BJIA 4PQ0A 3V5WA 3OANA 4NY0A 1SEBD 2MCNB 2VSXE 4G3XB 4YDEA 5AYWD 4GNKB 1MZCA 1PQSA 1L2NA 1N54A 2PW9A 1IQUA 3QJZA 2JZZA 3ZKJA 2ABDA 5AQAA 3SFYA 1FFVA 2IGGA 2V3NA 1IKND 4FHJA 1HFAA 1Q2ZA 2Z8LA 4ATGA 4A3OA 2BCJA 3RK6A 3UINC 1WXSA 1W3BA 3SI5A 1W1HA 1QNFA 3KUDB 1PY1A 1LB1A 3AMZA 4RGMA 1ROEA 4O1OA 3DHHC 1Q67A 5HE1A 4U8YD 1ZDXA 2KJ6A 2OEWA 3EIJA 2W2XC 3HRAA 2MWNB 2LULA 2KC2A 2JABA 4DRXE 2ZPYA 1OCRE 5JH5C 4G24A 3FTZA 3VOQA 3D3MA 1TS3A 1WX9A 3CHQA 1YX6B 4JHRA 2NVUI 3OJ3A 4U96D 2MOWA 3B7SA 4WIPA 3P7ZA 1MK9B 1E7PB 3ASDA 3ZDMC 2P2CP 2V4HC 2JU6X 3S7FA 3URZA 1E6EB 2J9QA 1J0GA 4A55A 4M8NA 4Q96A 3EA6A 4EMOA 5EE0A 3ZTDA 3Q78A 1XNFA 3QX1A 4JIOU 5KHQA 1G6JA 2KTRB 1JCQA 2CJNA 3WIMA 1U3DA 2MJDA 4PS8A 2KTFA 4RM8A 3M63B 4M01A 3E37A 4GDLA 1D4BA 3VXWA 1SGHA 1U5EA 3T06A 2WM9A 1I7HA 4HRSA 2WDRB 1L0XB 2R2LA 4XDCA 2R05A 1TN7A 2NS5A 1FAOA 4JKDA 3RU0A 2OTXA 3UI3A 1AARA 4KGTA 4NPNA 4AJWA 2LD9A 4KHOA 5AJDA 2WVIA 2ROVA 5CERB 4N6EB 4WQMA 1J7CA 2DNFA 5E6PA 4I9EA 3Q3MC 1V80A 4AP4C 5C23A 1C4PA 2ZZPB 2EKIA 3KWVA 1X1MA 1V2YA 1FRDA 1OQRA 4N39A 2KDIA 2QYUA 2WXMA 2CY4A 2IO1B 4HI9A 4ILGA 3U4TA 1VRAB 4A3PA 3C3RA 1YJIA 1YMHE 3DDCB 2J8SD 3H1UA 2QKLA 1GC6A 2ZNVC 1KJTA 1QQEA 2MBHA 3ZRHA 4IAPA 2F8YA 4KVOA 3KLSX 5BO4B 1ZUD2 2QZAA 5ITZF 4A6FB 4GTOA 1WF9A 3PHWB 3KSLA 2AL6A 1IHBA 1JWUD 5BMHA 2RKKA 4HB2B 2R2YA 1EO6A 5JHHA 1JCKB 3NF1A 1YQBA 3PRZA 5A23A 1ZU2A 2BKKB 1AWDA 2WDVB 1KLXA 2BYEA 3PRPB 4BBNF 3SFEB 4LNGA 1J0WA 4NQLB 2N9PC 4UUCA 4AJYB 2M63A 3TCAA 4ACFA 4HLEA 4ILHB 1KF6B 2J59M 1PGBA 5FI0A 2XEEA 1UNQA 1CJEA 4XI0A 3Q3JA 4JKEA 4K5BA 1IYFA 3BIID 5LOZA 4G25A 2N1WA 4PUCA 2GCJA 1FO4A 3VRBB 4MM3B 4CGVA 2GRLA 3SR6A 3W1SA 4KKJA 3U52E 3CIKA 4YDOA 4W9FA 2FCQA 3ASHA 2FCNA 1T6BX 2L83A 4JGHB 1QF6A 1BLXB 4LLGM 1XXGA 2N23A 3HK0A 2ACZB 1MIXA 4ANVA 3G2VA 3ZKJC 5D3XA 2AL3A 4DLQA 2LHDA 3DCGA 3HIZA 1SIJA 2A4ZA 3GS2A 4U95D 2LYDA 4CYMD 2C60A 2LAHA 4HVBA 3E30A 3A9KA 2INPE 2WXOA 4E85A 2LOXA 4HXDA 2IZVB 2AEHA 2DKQA 4KZCA 1IP9A 1WXQA 2C0LA 3SDLC 2UWQA 4H2AA 2QMTA 5KHOA 3ZFWA 3H8HA 4L2YA 2PE6B 4JK7A 2BYVE 1Q0WB 2LKOA 1FIQA 4O1NA 3RPFC 4JHKA 4ARIA 2BKRB 3FH8A 1N4SA 1KLUD 4C80A 1KOTA 2GRPB 4GDKB 1SVXA 2ZIRA 3A1QA 3G2WA 5BV1A 4MDKE 3K9IA 1MJDA 5KBAA 3O48A 5D3YA 4JK8A 2WX0A 1XX0A 4I6GA 2PIAA 3AI5A 4GOCA 3D9JA 2GB1A 5CX3A 5J17A 1KI1B 1OTRB 3GZNI 4XKBA 4DXFA 1KC7A 3AU4A 2N7JA 5G5GA 3V61A 1WAO1 2MYOA 3BUAA 5C2TB 3HVDA 2AVPA 3VQIA 5JHAA 1TXDA 2DVWA 4IW0A 2MBEA 3CMMB 2EINE 3ABME 4HWIB 3EJNA 5C6RA 3ZDTA 3FP3A 3FEYA 3AE6B 4IM2A 2BW2A 4LNUD 2WXRA 3BINA 1KLGD 1OFFA 3UMVA 4MM3A 4Q69A 3PE4A 5DBKA 4B94A 4WJPA 2OEDA 4RGTA 4IOYX 1V1PB 2XGMA 2NPTA 4HB3B 3KUCB 2NBVB 2WXHA 3Q8EA 4BKSA 1DOYA 2LUMA 5JJ7A 5HKPA 2BGFA 1K50A 1L5JA 1S0PA 1V86A 1F77A 4DPRA 4NAMA 4ZRIA 4O6FA 3R3MA 3P4SB 2YT2A 3QARA 1V49A 3AECB 4MJSA 4UDUC 1SW6A 4OHJA 4J6IA 2L00B 4S0RA 2NC9A 1MG8A 3BVZA 3CEQA 4JW1A 4GU5A 1E8XA 4XI9A 4A1SA 1NZNA 4K5CA 1FCCC 4FP7A 1V61A 2M19A 4KZ0A 1Y5OA 1RAXA 1O1TA 4GTQA 2C7HA 2D9YA 2HE7A 3NG0A 3BEEA 2WS3B 4ANUA 3BZDB 1XF5L 3M3JA 3E34A 3B08A 1EUVB 1UUPA 4DI4A 4W9HA 3DEPA 4OVZA 3UX4A 3U8ZA 3N32A 4HPLB 2XPIA 4IM0A 3Q7FA 3HXEA 4GIVA 1U2BA 1WGRA 3V31A 2W3SA 5HI7A 1SIFA 4U04A 4DXAB 4MLPA 4MT7A 2GGFA 1U5DA 1NBFC 3JYUA 1TEZA 4XEIG 5JVLA 5DPSA 3LXUX 1BI7B 4HDOA 1KFYB 5EILA 2L1CA 3SFZA 2KMMA 3DVGY 3W1SC 3AE8B 2LGDA 1U5FA 3ZVRA 5EIDA 1JRPA 3ONKA 1N5XA 1H2UA 3DSXA 2CHWA 5IAAC 2ILRA 2PKOA 5FWQA 4FXCA 4GZ6A 1V55E 3N71A 4RGOS 3IT6B 2KANA 4B93B 1WX8A 1O1SA 5E6JA 1H8CA 5A7DB 5KJLA 2IJGX 3VIAA 1SJED 1YJJA 1D3ZA 4KYOB 1MX6A 3C3QA 5D7GA 4IUMB 4GB9A 4M7CA 2Z4DA 3PZ7A 3DSTA 2CODA 2R82A 2H6HA 2J4XA 5CHEE 3PE3A 4CT0A 2K25A 5AQBA 2PQNA 4LTUA 1N52A 4MH0E 2G35A 3VH4B 3UT4A 3DBHI 1N0QA 4I6NB 2DBYA 1IUEA 5AJLA 1EF5A 2IDYA 3OG5A 3A9JA 4BBNC 1CQVA 4ASWC 3G2SA 3GE3C 5J08A 1TTNA 4BOSC 4N3BA 2XNAC 3RRNB 2L52A 3ULQA 5HE2A 5LXHA 3EUVA 3VFKA 2MHJA 1WJMA 2W2WA 4GZ5A 4KV2A 1YX5B 1XD3B 5T4YA 3Q69A 4MBGA 1UGJA 2W2XD 2KFJA 1XEEA 2JZPA 4WNEA 2LHEA 4ZYSA 2PNNA 2AX5A 1FEHA 1TS2A 4WWOA 3ZO5B 3TEWA 2G9HD 4GLSC 1F0ZA 4A9AA 3DWLG 2WH5A 3NBNB 2FEZA 3J5PA 1KM7A 2O6VA 2V4IB 2GROB 2I5CA 1HX8A 1BAKA 2XN9C 3CGHA 1BU9A 2KFKB 2N0SB 2D5GA 2COPA 2LUHA 2ZKMX 3DBHB 1FHOA 1WR1A 4CDNA 2N7EA 3B2GA 3UZTA 1XLQA 2GRQB 2Q13A 2QKMA 4N2QA 3S2AA 4MT5A 4F53A 2KX0A 2EQXA 4ZRQA 1H6PA 5EE9A 2HM8A 3DXKG 2CAYA 2DX5B 3CSFA 3P6AA 3AG3E 3LY9A 2LGSA 2WLBA 3R9AB 4EZJA 3EECA 1IXVA 1OMWA 4EBAA 4QJ5B 4GPTB 5CHFA 2MRPA 3BVGA 4DHJB 4LDTB 2QJLA 4TQ1A 4J7WA 4BSZB 4HEA1 4GYYA 4B8AA 2NTTA 4KSKC 4ZFHA 4YONA 3Q73A 4G1TA 1RM6C 3L82A 3DVNU 2J53A 3D9HA 3MEKA 3ZGZA 2KCLA 2IYDB 4HHVA 3LKUA 3MTNB 2QEJC 4K3CA 3NUHB 4JEHA 3UGBB 1NU2A 2R0DA 3RRUA 3SFXA 5LFAA 1CMXB 3Q3NC 1ZXIA 3CHRA 3DXMG 4JL0A 2R59A 1VLBA 4I1OB 3VDZA 4HAUB 2JXTA 1FT1A 4YT0B 1DCQA 4YTPB 3TSSA 2VSNA 5HG2A 3UQBA 2CKHB 1N6ZA 3CLJA 2V8SE 3TWQA 4DX1A 2P58C 1HEZE 1TKGA 5KQ4A 3TXMA 1V81A 2HTHB 1ZPSA 5CHVC 3D9PA 3E9SA 4LNOA 3QK0A 3IBEA 2KN5A 2XEWA 1WG7A 4NQKE 4GPMA 4MK0A 4L1RA 1L4ZB 3NSUA 3BYYB 4A8XC 2KFKA 1P5TA 4IOIE 4EQFA 2XZTG 1TN6A 2KACA 2HE0A 3I9V1 2GOWA 3TL5A 2HJ8A 2KHWB 4PH4B 4E3CA 3LEWA 4K5AB 1FPYA 5TSSA 4E74A 3TWRA 2P9IG 2EC1A 2REXA 1IGDA 3C8YA 3V6EB 2KZTB 5FIOA 1JDEA 4DK5A 1P7FA 5LONB 2LUEA 1XO3A 3B7UX 3UM0A 2D07B 1I4RA 3RNBC 2XQNM 1ZP0B 3DOWA 2K1FA 2LXCA 3BU8A 4IWQA 4IKGA 5C5BB 3FH5A 4WH4A 2V1YA 5CBOA 2K3UA 5L81A 3FAHA 1E0ZA 1TNYA 2KWUB 3C19A 1EYHA 3VLEA 1JALA 1HZ5A 3C0RB 5KNHD 3DBRB 5DCNA 3ZQ4A 3MV3B 2FO7A 1XLPA 2C7MB 2FDQA 3G9WA 1K51A 4RMAA 2JWZA 1BUIC 1D6EC 2I2OA 2PLPA 3MKQB 1WM3A 1XLOA 1MG4A 2X18A 1UNSA 4BEPA 1GGOA 3RZFA 2WMOA 2V3PA 3PHXB 1MI0A 4WWNA 3NZUA 5BYRA 3LYYA 3BVMA 4LEUA 5CEDB 2ZW0A 1VBHA 3CV0A 4EZKA 3FU3A 1SA4A 3ESLA 3AG4E 5LCWJ 1FCHA 1GUAB 3KY9A 4W9IA 2I1JA 1DCEA 3N1ZC 1TGZB 4GU2A 4A20A 4I1AA 3IVFA 1OWOA 1TNUA 4W9KA 1Y6IA 4XWWA 4JLCA 3W9GA 2MQJA 1WGDA 2KDEB 3VTYA 2MHKA 3AEBB 1OXJA 1B89A 3VTWA 2DYMA 2QSDA 1FB8A 3U7DA 3TWXA 3AG2E 3MJ5A 5AUIA 4TUUA 3A8QA 1RYJA 3L0WB 2BB5A 4RCOA 3FUMA 2GS0A 3NAWA 5BT1A 4JX1C 4EKUA 2D3BA 3UUXA 2Q5WD 1TR4A 2B6CA 2PMVA 2E6XA 3HXDA 2KAJA 2PM6A 1DBHA 1JWFA 3EU9A 4TRQA 4ZRPA 4GSWA 3PTFC 3Q75A 2XEHA 4APFA 1QQGA 1ZM0A 3KYDD 4LJPB 4AV7A 1CK1A 3L17A 1YJ1A 5CBNA 4ME2A 3GZ1A 2IFSA 2M8SA 2P9PG 2H6IA 3PUKA 1WGGA 1WWTA 3DVNV 3DBLI 2KC1A 1Q1OA 3RCZA 1P3RA 1KBLA 5HQ8A 5JJ6A 2LZ6A 2IY0C 5IY5E 1YQ3B 1WGHA 4GZDA 5ENSD 2FUG1 2LXAA 2Y4TA 4ZHPA 3KS2A 4HCPB 1KT0A 2DYQA 3JUEA 2ZCBA 2F37A 1XLNA 4IM3A 2DZIA 3VUWA 1WRDB 3WAPA 2P0DA 4FADA 1DDWA 4UWGA 2K6DB 5EE3A 3FUNA 3RNCC 2M17A 4UQYA 2L05A 5E6NA 1WJNA 2L32A 2LNIA 3FTSA 2HJ1A 3VAWA 5JZEB 3CIRB 3DSUA 4LUNU 1WGUA 4YDWA 2GRMA 1R4MB 5AENA 2JWUA 4BESA 2J42A 3GOEA 2INCC 3JQ0A 1N3HA 3OHMB 4L6EA 3ZRFA 3CIAA 4ACLA 3RMKC 2LSVA 4HNAD 2ZCCA 2ZPNA 3QOUA 1IHGA 1TNOA 3LPZA 2KUQA 3NVVA 2K49A 3M1IB 2JYTA 4URKA 4AY6A 3P42A 2VRRB 4DJAA 1NA0A 3MCXA 3ASFA 2EELA 2JRIB 4TV3A 4OVUA 3Q8FA 4GA1A 4IYPA 3SQVA 5KJMA 2LGXA 4G8KA 3V05A 4KIKA 4CCAA 3M95A 2A5UA 5BUZA 3N20C 2KC7A 2L0TB 4BT9A 1HG5A 3SUZA 3TAXA 3HSAA 3FTVA 4GDLB 2OEVA 4JE3B 3MKRA 4GMXB 1H6OA 2CG2A 4JA9A 4HSIA 4PT5A 2DWZA 2GI9A 1JROA 3ABVB 3LXFA 2KIEA 2L8JA 3PG7A 2V0GA 2VGXA 3O4ZA 2J07A 4HOQA 2DZOA 1UH6A 3SNXA 3MV2B 1N9AA 3AN1A 1RWSA 3B0AA 2MP2A 5E75A 2Y8GA 1SJHD 4TXRA 3Q2AC 3E66A 5JA4D 3GYOA 3EHNA 4JB8P 3MHZA 4A6HA 1C9FA 2PZ1A 4OSNA 2MSED 4ILGB 1VDVA
chains in the Genus database with same CATH topology
3FUHA 4KVMA 3VVWB 1WM5A 3ZPJA 4P29A 4UI9J 2MWSB 3KYCD 2WQHA 4AP2A 4WJQA 3CXBB 2UYZB 2WXNA 3H7PA 4BKTA 2WQ7A 4BKSD 3UIPB 1AWEA 1IQRA 2HO1A 4NURA 3APDA 4NAWA 3R7QA 4BVUC 1HBKA 2KLCA 4MSQB 4II3B 4CEMA 2MKRA 2D9XA 3HYMB 2IOLA 4HS2A 4C0EA 1XR0B 1WMHA 3PV1A 1XKEA 5ARGA 4Z2MB 1RJ2A 4X57B 3FSSA 3BY4B 1X05A 2VSZA 3FWVA 1HH8A 3NOBA 3R7RA 3VHTC 4YVOA 3PVLA 2ELBA 1RRPB 3CF6E 2RPQA 3QWZB 4HAVB 4FA6A 2L0TA 1I35A 5EDSA 2COFA 2ADZA 5JP4A 4HPMB 4KHAA 2AXVA 2UZSA 3MYVA 1DDMA 4WNFA 4Y6CA 1PFJA 4HAYB 4EUTA 1DDVA 1V5MA 2R17C 5AZFA 3CK8A 1WVHA 5J2RA 1JRUA 3D9KA 3A9KB 3SHQA 2YHEA 2HYZA 3UT7A 3I3TB 3AU5A 2V3SA 2HD5B 2WWZA 4ILJA 2OV8A 1V5PA 3VTVA 3NQPA 4C0AA 4L7TA 3ZXSA 2KKCA 5CLLB 3PT2B 3TJPA 5D0QD 2N0YA 4LCDE 3JCKC 1DVPA 5GOWB 1C3TA 5ANLA 3A1QB 5IA7A 4EFOA 5DHFB 4G50A 1Z3XA 3QAQA 1MK7B 1NTYA 4K81A 3L08A 3X0WA 3FUIA 1P98A 5BPPA 3ULCA 3E9PA 5CLQB 3CVUA 3O65B 3E9OA 2KMAA 4DDGD 3TG5A 4M8MA 5J18A 1XCGA 1E8ZA 4TYZA 4HOSA 1WE6A 4Y6WA 1V5OA 1Y8RC 1V5TA 4ICVA 1OUVA 2VRWB 3CQCB 5BV0A 4FC8A 1H10A 3A4SC 3QKYA 4TQ0A 4N3CA 2NPTB 4NACA 1MAIA 5T8IA 2X38A 3ZN3A 4GZUA 4RVBA 1U4AA 3SU8X 4JVSA 4MJSB 4AUQC 3TIXA 4D0NB 2RSGA 2YT1A 4MGYE 5KJNA 4FN2A 2DCPA 2V76A 1V5UA 1WXMA 2DHIA 1OY2A 3FY4A 4I43A 4JKHA 3ZEFA 4HORA 2C7NB 1FVHA 2KNBA 3AULA 4FU3A 1HG2A 2P0FA 2L0FA 3PNTB 5D2MB 5GMVA 4AXHA 2LOZA 2H7DA 4WVFB 1XD4A 4CHKA 2IO0B 5G05C 4N2SA 2M0XA 1BPOA 3IHVA 3SYXA 2LJ5A 2N9EB 2V0PA 2MX2A 2LGYA 4XIFA 2XCCA 1WE7A 2OJRA 3H6NA 4GZCA 4RM9A 4W9EA 3KAEA 4MELA 2AWTA 3HM3A 1FHXA 5C1ZA 2MRIA 3D8DA 4EECA 3QDNA 2XQ0A 1ZKHA 4B0ZA 1OEYJ 4HB0B 1TJ6A 3QC8B 3WXXA 4DX8A 4I1MA 3MGBA 3A9JB 3ZTCA 2ZJDA 4GCNA 2ELAA 2L0IA 4F7ZA 3SBSA 4N3AA 3CK9A 4JK9A 1QZEA 3I5PA 2JF5A 1YD8U 1ELRA 4PYUA 1B55A 4C0MA 2LRUA 3CK7A 5DIZA 3KRWA 2UY1B 3GW4A 3TW1A 1H4RA 2O6VB 1UJKA 4BKGA 2PJHA 4DHJD 4WUYA 2BF8B 3H7SA 4LDTD 3V60A 1S1QB 1WI1A 2LVQA 4WAFA 2X6HA 4J8DA 4JKCA 2J49A 3FU0A 3OJ4B 1UJJA 4KBQA 4MGIE 2ZVNA 1YA0A 2P0HA 2PM7A 4G26A 2L7RA 5LXIB 2RLOA 1VD2A 1JPLA 3NS8A 2X6KA 3CHPA 3FM8C 2KQ7A 3NHEB 1VCBA 2C0MA 2Y5BB 4NJ6A 3E4BA 3CVPA 3RO2A 1EF1A 4DBGA 3IFWB 4N5CA 2E2XA 3FTXA 4OYSA 3FUKA 1OWPA 3QWPA 4NRHB 2KX3A 3PLUA 2J0JA 4HAWB 3P2BA 4NQ0A 4MY6A 1QZ2A 4GMVA 2ROZB 3CR3A 5J3QA 4W9RA 2Y7BA 4K7SA 3FH7A 3ML4A 5DHAB 2DZJA 1RRBA 3ZLZA 2IY0B 2UY1A 3ULBA 2K6QA 2M1MA 4FLHA 2RSUA 4XKCA 4A3TA 4AY5A 3NZSA 3FUDA 2WPVA 1BTKA 1UBQA 4B6WA 3UPVA 4UQZA 4Q94A 5ENNA 2QHOA 2OVFA 3D9NA 2JY6A 2WXFA 3TXNA 3SO6A 3KSYA 2YRYA 1WJ4A 2VJ8A 2JZ3B 1UEFA 1NVLA 3X23A 3ZYKA 4J8FA 4ZRJA 1INZA 3CKBA 3Q5MA 2J08A 4I9CA 1PLSA 4U8HA 1UNRA 2FNJB 2CB8A 3QB2A 4IWOA 2COAA 3KRXA 1AQCA 1A5RA 3AS4A 1X1GA 5AEKB 4UI9K 1V6EA 3JQ1A 1BT0A 3LJUX 2PPHA 2DN6A 3ONSA 3F5RA 2MDXA 2FJ9A 1H2VC 3ODWA 3WA0A 2PEAA 4HB4B 4BOZB 2M4NA 1EDUA 3B13A 4EZLA 2KLGA 3RD2A 1SZAA 3IG3A 4MGZE 4FJYA 5HE3A 1HF8A 2KCVA 5LP0A 2COCA 2WXLA 3EHMA 3PSCA 1NA3A 1GW6A 3GZ2A 1OQNA 2DHJA 3QWMA 3R66C 1W1DA 2Z0DB 2X6JA 3L6AA 4XE0A 3CVNA 3HVEA 3P1UA 2KCJA 5CCMA 2OQBA 1ST7A 3EPYA 2GJYA 2JUOA 3A98B 4PYZA 1S3SG 5FZSA 5LCWC 1WGYA 4GA0A 3KEZA 1R4NI 2D11A 2X3MA 3A33B 1SZ9A 2DX1A 5J3YA 1PMSA 3KD7A 5G04J 3U3WA 4WNDA 2KO3A 2KVRA 2YINA 1V88A 1EF1C 4G23A 3PVUA 5FQ8A 3SD5A 2WXPA 4DLOA 5CTRC 4ZYNA 4PDXA 1WY8A 1XGWA 3PSEB 3RULA 3MA5A 1UPRA 3RUIB 2FF4A 3IHYA 1FHWA 4HJKA 3U64A 1X5BA 1WI0A 2BYFA 3ZNZB 3CHOA 5CHWA 4NSWA 1GG3A 4BY6A 1XQQA 4PS3A 2DZMA 4FULA 1TBEA 3L10B 2Z0OA 4BT8A 4DDID 1HB6A 2OOEA 4F7GA 1P1AA 1HS6A 2W9NA 5JHGA 1JUQA 1M94A 3VLFA 5EX0A 2GW1A 1PAQA 1WJ6A 4W9CA 5FZRA 2DYNA 2YNQA 2LO6A 5AZGA 4JA7A 2Q7FA 1OQYA 3ENEA 2RUKB 4BFRA 4RSYA 3KW5B 2BUGA 2KCKA 2BPSA 1W1GA 1ZGUB 4J8SA 1Z87A 3RKVA 3FU6A 2I1KA 3GYPA 4I6EA 2XGSA 4CHMA 2FJLA 3DQVA 4RG6A 2NBUA 5KCMA 2CS4A 2MA9B 3D32A 3ECIA 3ZHEA 2RG8A 5IJMA 4APOA 5EKQD 2BKFA 3SHFA 1QC6A 2D4QA 1C1YB 3EC8A 3APFA 3LYAA 1M7RA 1FOEA 1WGQA 4II2B 3RJVA 2O2VA 2PQRA 2D2QA 3QBVB 5LX8A 4KIKB 4Y94A 3HQCA 4U0SA 4GYWA 3HM6X 4IN3B 1U29A 3UQAA 4CDMA 5JHBA 3E9LA 2YQ8A 1UN8A 4WJNA 4ANXA 2XBBC 2LVOA 3VUYA 2VGXB 2V4LA 2WXGA 3CKCA 4OVVA 3TMPB 5D6JB 3FULA 1E8YA 3TVVA 2MP2B 2YS3A 1OGWA 1UZXB 3OTNA 4QFVA 2WMNA 4DHZE 3SGHA 3N30A 1U5GA 3NY5A 2LG1A 1SHCA 2KGXB 5C1DA 1HU3A 2K8BA 5DI9B 4HXIA 4JKBA 5D3VA 2Y3AA 1WJUA 2LVPA 3H7PB 2VSYA 1EAZA 4JXTA 2IY1B 1DIKA 5FZQA 4NAWB 2N7DA 4G2VA 4FLBA 2J0MA 2AXUA 2KUPA 1P0RA 2WXQA 1LFDA 3PUJA 1WMHB 3IV0A 3MX3A 4UWLA 2HRJA 1Z3YA 2YS5A 3LDZE 3ZIMA 3ZYLA 4YVQC 1KLVA 3PREA 2CFZA 2GMIC 3I4GA 4TKNA 3U66A 4M3OA 2NR2A 4UWFA 3CVYA 2UVMA 5FT9A 2CU1A 3LS8A 4WJOA 3DPDA 1IRSA 3S7DA 3QCAA 4F1SA 3QQ8B 2YVCA 2WXKA 2J09A 3PDNA 5D0OD 3WAOA 4I2ZA 2XRYA 1WXVA 2ZU6B 2RR9A 4MEMA 5E6OA 2LSUA 2ASQA 4AM9A 4W9GA 2FUHB 3ZUNA 4B6HA 3FEHA 2DYBA 4U63A 5T3RA 1UN9A 3TBLD 3CHSA 4MS6A 5LOPB 2NZ8B 2LI5A 2K39A 1TJFA 4HATB 3K9PB 1T0YA 1OEYA 1HXIA 2IBIB 2RD0A 2L3ZA 2ZVOA 4XX5A 3MJWA 5ANRA 1A17A 4GA2A 3HHMA 4UQXA 4HAXB 4LCTA 1UBIA 3JYSA 1YIWA 2H7EA 5EX3A 2EJ8A 3PZDA 2XRZA 2FAZA 1ELWA 3UQ3A 5JLJB 1ISNA 2IONA 2KJRA 5DIFB 3D9LA 1Z5SB 2XK5A 3MZLB 3PEVB 1H19A 1WFYA 1L7YA 5BW8C 1WXAA 5A6CA 2HR2A 2MLBA 3RZWC 5EFXA 2KDFB 4GZ3A 2DLWA 1Y8MA 4WNGA 4JL9A 4J0UA 1V89A 1UNPA 1ZVRA 3UIOB 5TR5A 2MBBB 1EVHA 5FQ4A 2X0SA 1ACAA 2GBKA 3LJ3A 5DPTA 2CHZA 4JC8A 4LJOB 3DBSA 3LVRE 3FUJA 2R2OA 2L6JA 2CY5A 4W9LA 4ZRKA 1K5GB 3PVWA 3A4RA 3DXCA 2N4FA 3T8MA 1ZC3B 4K7WA 3KH0A 3V6CB 3CVLA 5HE0A 3BG1B 4LERA 1NTVA 3G2UA 2D9VA 3FDHA 3GYZA 5KJKA 2DIWA 4K7UA 2KMCA 3ZNID 2JT4B 4HCNB 4XC2A 3KVFB 4LRZA 3KZ1A 4WWPA 2Z0PA 4CDRA 4KXKB 4JKFA 2I9CA 4GXBA 2FIDA 3LY7A 2KDBA 3FP5A 3DVGX 2JPHA 3Q4AB 4K0RA 2AWIA 3FLVA 1KZ7A 4I2WA 2JXXA 5FQ7A 5AIJA 2QFCA 2O6VD 1HE8A 2R09A 4EPZA 2KWVB 3N3KB 4ILIA 5G2NA 4IC7B 4ABNA 1ZC4B 2G4SA 4JZYA 3VTXA 1P3QU 2KTRA 4I6JA 3SBTB 4WQOB 2KJHB 5DPRA 3K9OB 2Y4UA 4I6PA 2WQ6A 2DAJA 3PEGA 5D27A 2L76A 1IYGA 5M72A 1U27A 2MFQA 4U07A 1I42A 4K03A 1X11A 1EGXA 3ZRCA 3M62B 4CGWA 4AOFA 1GNUA 2JEKA 3DXEA 4GMJA 2NBWB 1DYNA 1XODA 2G3QB 4KDLB 2L2IA 3KUZA 2ONDA 1HZ4A 2Y8FA 4IFSA 3SZ7A 3VLDA 2B3AA 3LVQE 4ACKA 2DFKA 2M38A 2GCLA 4HOTA 4FHKA 4A6FA 4CRWA 2EMSA 5D94A 3ZYMA 4FJZA 3QIJA 3JSVB 2IO2B 1NP7A 3CSTA 2K8HA 4F7AA 4B89A 5HKHA 1SQMA 4BX8A 3L54A 4PNKA 2M14A 3AS5A 1M7EA 4CHJA 3ALBA 2WX1A 3WALA 3UF8A 4ILHA 1WZ0A 2DYOA 2FCSA 4FJVB 3ODXA 1J19A 4I17A 4NNJB 2OVBA 4D10C 4K2PA 5AZHA 2DHZA 3OLMD 3WAMA 3SBTA 2CR5A 4GGQA 5CMYA 3ZVVA 2DBAA 2CQUA 3RT3B 2YLMA 2AXZA 2Z0QA 3PH0C 3TG4A 4GMLA 3TO1A 3B7TA 4HDQA 3AJ4A 3W1YA 2KWCA 3VUXA 2J0KA 1LF8A 4CT4A 2LBBA 2LASA 4DHZB 2XPZA 4YNDA 1WJ1A 2L9BA 4KAXB 3QNKA 1PC2A 4BTAA 5LLIA 3ONLA 5G05J 3ESKA 2FIFA 4A5KA 4JKGB 1UPQA 3ZNGC 4ICUA 2YF0A 3FTWA 4KMOA 4HOUA 5KCVA 3EIQC 4GDKA 1WR6E 3FTUA 2KZRA 3JSVA 2FI7A 1BTNA 3N7CA 4F8CB 1P6SA 2G4DB 5FTPA 4MSMB 2YT0A 2DENB 3FUEA 2AW6A 3AS8A 2C2LA 2VGYA 3HDXA 4KDIC 3C98A 3FTYA 4BX9A 1E8WA 2K2UA 3MDBC 1RFAA 3LCAA 4V3IA 4F3VA 1RLFA 1WH3A 4IG7B 4RG9A 4U0ZA 4W9JA 2LRWA 1DROA 1UG3A 4N9F4 2V5FA 3SV1A 1WY6A 2VSOE 3TGOA 2UWJG 1UD7A 4E6HA 1V9JA 1TZ1A 5FI1A 2NCNA 2WXIA 2I5FA 1UGMA 2KQSA 2IFUA 1WIAA 1E7VA 2BF0X 1ZW7A 5KQ1A 3ZNHB 1E7UA 2RNRB 2LWPA 2DKPA 2J7QB 4P7IA 3HVEB 3PNLB 4DWFA 1X1FA 2D9WA 3ML8A 2VQ2A 5L83A 2VKIA 2DAFA 2K00A 1OWLA 3D9IA 3T5VA 2FULA 3ZW3A 4EBAG 4AIFA 2KK8A 5C2YA 5J3TA 2XEVA 3F0WA 5DH9B 4JKGA 2YS1A 3LY8A 2MW5A 4JHJA 2IO3B 5FQ6A 3OXFA 4C9BB 3CHMA 1P5QA 4GAAA 2RQ1A 4K17A 2GBMA 3TFMA 2PL2A 4AVXA 2BWFA 2X6FA 2IF4A 2PE9A 1SE9A 3PLVA 1UELA 4ZDVA 1ZSQA 2GBNA 3RCPA 3LDZA 1EPUA 4DI3A 4H7YA 3CVQA 3L22A 5G04C 2I6HA 4HAZB 1FGZA 1E5WA 2RGFA 3U9WA 2CFUA 4HFGA 2KATA 4BTBA 4FBJB 3OXLA 4CO7A 1IPGA 2MBOA 2D10A 3CVXA 3WYFB 4XWXA 3IKOB 2D9ZA 4U0UA 1LXDA 1MKEA 3JVZX 4PS7A 3RO3A 4A6KA 1H6KA 3ML9A 2KD0A 4EJNA 1BWNA 1FXTB 2N1VA 4AWJA 2NXPA 1FVFA 1WM2A 3Q15A 4YL8A 1K5DB 2E0IA 5G55A 3SNHA 3OAWA 1MIZB 4WSFA 3UT8A 2R2QA 4B9KA 3CVWA 3MHSD 4BBKA 3VH3B 3S7JA 3ZHEB 2UZRA 2K2JA 3O96A 5C79A 1Z6TA 3D9MA 1ELKA 2DA0A 2JRHA 3ZGQA 3DXDA 1K8RB 2LAIA 2MBQA 3L16A 2O2VB 3DBRI 3QWVA 3FUFA 2RVBB 2AYOB 4EOYA 1LM8B 2R5SA 2FBNA 4BWRA 2BWES 2J4DA 2E2EA 2NSZA 2IYBA 4JPSA 2IOSA 3UINB 3IHPC 3Q49B 3CQGB 1NTIA 4MKTA 4L23A 2WDTB 5C16A 4NJ7A 2JVCA 3PPAA 1VDYA 5ARFA 1DNPA 2D3GA 1E96B 3ODOA 2ZEQA 2FCMA 2DX5A 1H0AA 4F7HA 3ASGA 3I4RB 2G45B 2WXJA 4GYOA 3ENBA 2DIKA 3RIBA 4F7UP 1MQSA 4J8EA 2WB2A 3EFUA 4IRUA 5FJYA 2DHKA 3SBGA 3HW2B 2KM4A 4UWHA 3PP2A 2K8CA 1MHQA 2KOXA 1Y19B 3GZSA 3PGEA 4B8CB 4WAAA 2Z59B 4KT6B 3EHVA 4JEUA 3T9LA 4E71A 4GN1A 3MPXA 1OWNA 4XZ4A 2X6IA 4K2OA 2C5LC 3B7RL 3PRMB 4M0WB 1MPHA 3PS6A 2HTHA 3FFLA 4JKAA 3G2TA 5CCLA 3QWWA 2XPYA 3JUIA 3RYTA 4A1GA 1GJZA 5E76A 1F9JA 1XT9B 2EMTA 2Z0EB 1VBGA 2ZNVB 3QA8A 1KZGA 2CRFA 4L2LA 5FR6A 2OOBB 3AXCA 3FU5A 3D9OA 5L95C 2DZKA 2KZTA 1OWMA 1Q5WB 3VTUA 3A8PA 2YSZA 1GC7A 2VYIA 4G11A 5C5BA 3EDTB 4Z2NA 2C9WB 3PEUB 4EEWA 3BG0B 4K1RB 4KVGB 1R4MI 2IU1A 5J90A 3ZYQA 3H9DA 4AEZC 2VTBB 4KHBB 4WJ7A 2JLBA 4A3VA 3Q3FA 4UWKA 5D3WA 4R7LA 1TQZA 1WYWB 2P8VA 3MKQA 1I2HA 2JP2A 3FEXA 1J8CA 5DPWA 1FGYA 5BNWA 5JJTA 3D8EA 2GBRA 1WX7A 4CYEA 4GCOA 4H8SA 4KSLC 4B95A 2CHXA 2KXJA 2WYQA 1E90A 4ANWA 1NI2A 1ZBPA 1P9DU 3SF4A 3D8FA 4W9DA 4UI9C 4DBBA 3U30A 2IQCA 2J4BA 1HO8A 4GPKA 4MRUA 2DTCA 1WZ3A 3QC1A 3Q47B 2YHCA 4H7XA 2RGNB 1NDDA 4IWPA 3T5XA 2XGOA 1U3CA 1HB8A 1LQBA 1H2TC 2CG3A 1JWGA 2PZIA 3CVVA 2BTDA 3APCA 4BSXA 3JW0X 2XK5B 1Z2MA 2EKEC