3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein
molecule keywords Myosin-X
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
1YQBA 4TYZA 3JSVB 2OQBA 1WM2A 3Q3JA 4WJOA 4EZJA 2H7EA 2C7MB 3HHMA 2YT0A 4MELA 2K2JA 3CSTA 2JRHA 4B6WA 2MBOA 2A5UA 4DHJD 4K17A 3RCPA 2PE6B 3PP2A 4HAVB 2COAA 2V76A 2PEAA 1V61A 3VTVA 1PFJA 5KQ1A 3V5WA 2GCLA 1HE8A 2MX2A 2J0KA 4IFSA 2AYOB 2XEWA 2ZPNA 3M95A 3QQ8B 5EDSA 2EJ8A 1KI1B 2MBEA 4HB2B 3PVLA 2MCNB 4IW0A 3PVWA 5AEKB 3AU4A 4KHBB 4IAPA 3GYPA 3RUIB 4IG7B 3DPDA 2KCJA 4FBJB 5AZGA 3TBLD 1SHCA 5D27A 2K25A 1V5OA 4MJSB 1I2HA 2KFJA 5EFXA 4JLCA 2CY5A 4CO7A 2DAJA 3KYDD 4GSWA 1WIAA 4W9HA 4WJNA 4XZ4A 2RLOA 2IZVB 2LI5A 1P6SA 2MWSB 4KDLB 1UBQA 4WWNA 1J0GA 2WH5A 1NTVA 2CHWA 2MW5A 2C60A 5LOPB 3WAPA 2IYDB 2KX3A 1V9JA 2WX0A 3HM3A 1WZ3A 4W9GA 4TQ0A 2DYNA 3W1SC 1H4RA 2K00A 3VOQA 2CR5A 1SGHA 2KJ6A 2UYZB 3ML9A 4MGZE 4W9DA 1MG8A 4B95A 1RRPB 2ADZA 4CHJA 1S1QB 2HD5B 4HB0B 3O65B 5C16A 3APCA 4K1RB 1XX0A 4DBGA 1I35A 4BKTA 2IY1B 1UPQA 1WJ4A 2IO1B 2LGDA 4GIVA 4ZRKA 2W2XC 1V5UA 3VTWA 3QBVB 5D3YA 3ML8A 3IHPC 4FHJA 4RMAA 5D7GA 2MDXA 5J3TA 3PEGA 4NQLB 3BJIA 2LVOA 5G55A 2BYVE 3P6AA 1FB8A 1MIZB 5DPWA 1KZ7A 3N3KB 2FCMA 2D9VA 4GN1A 5J3YA 2KD0A 4IWPA 2I5FA 3MDBC 4NJ6A 3DBSA 2DTCA 1V80A 4BFRA 2KMCA 2DZMA 4MSQB 1X05A 3RZFA 3VUWA 1FHOA 1FXTB 5J2RA 2DLWA 1UELA 1ZVRA 1WMHB 3KYCD 3SU8X 4IM2A 1GC6A 2KX0A 2KWUB 1ACAA 3PVUA 1U5GA 1DDVA 2GMIC 2JRIB 1OGWA 2JUOA 3IFWB 3KVFB 3VH3B 4HXDA 2E2XA 3ZDMC 4HPLB 2DHKA 1TBEA 3ZTDA 1K8RB 2DHZA 2GBJA 1ZC4B 2LOXA 4Y94A 2GOWA 5G2NA 2DKPA 3ML4A 3UZTA 1Z5SB 1X11A 1WRDB 3X0WA 2ELBA 2EC1A 1BAKA 2DAFA 1X1FA 2KTFA 2L8JA 3DVNV 2P0HA 3VIAA 1OEYJ 4GDKB 5DPSA 3TJPA 1V5MA 5C5BA 4AWJA 5J3QA 4WAAA 1UNRA 1RAXA 3A9KA 3DCGA 2KC1A 2VSZA 1Y8RC 1W1GA 3PZDA 1UBIA 2L76A 2QKLA 4K2PA 1RLFA 2MBHA 1FHWA 2GJYA 3OJ4B 5L81A 3PREA 4WWPA 4WJ7A 4GDLA 3EPYA 1TQZA 2KZRA 3MHSD 3JSVA 2RSGA 2LKOA 3H7PA 2KWCA 4G11A 4XX5A 5GMVA 3RZWC 2YLMA 2G45B 1TZ1A 1BTKA 3QWMA 2NBWB 3VXWA 4A3OA 4DDID 4P7IA 3JVZX 2IO3B 2D2QA 4FADA 3SNHA 1GNUA 1FAOA 3M63B 4BKSD 3ONSA 3VQIA 4H8SA 4PYUA 2KDFB 3PRPB 2P0FA 3C0RB 3QCAA 2ZPYA 3OJ3A 5J18A 2ROVA 3SUZA 2FNJB 3BINA 3N32A 4BBNF 2DZKA 1Z87A 1P3RA 5DI9B 2A4ZA 3JYUA 3KH0A 5D2MB 4CHKA 1A5RA 5HE3A 3PG7A 4KV2A 2DHIA 3ULCA 2KOXA 3PPAA 4MGIE 4IOYX 2KHWB 3A1QA 5D6JB 1UPRA 2CS4A 2YS5A 1ZC3B 4FJYA 5KCVA 4E3CA 3G9WA 1TXDA 2KXJA 2DHJA 3DXEA 2FCQA 2MFQA 3RYTA 3A33B 1JRUA 1XD3B 3X23A 3EC8A 4KDIC 3QK0A 4HAZB 1U4AA 4LJOB 3LJ3A 3QWZB 4E74A 4F7GA 4GMXB 2BCJA 2LULA 2RNRB 3FEHA 3B1LX 2ZEQA 3H6NA 2EMSA 3LDZE 4LDTB 3ZRFA 4I6PA 4KSKC 2RSUA 4AJYB 1J19A 3ODWA 4FN2A 4TQ1A 3ZVVA 1P9DU 3D32A 4WSFA 2BYEA 1WR6E 2LXAA 4IM3A 5LONB 4YONA 2CU1A 5L83A 1EAZA 3N7CA 1GJZA 4ZYNA 5D94A 1H10A 1RRBA 2LOZA 1Y19B 1FGZA 1D3ZA 5D3VA 2J59M 4G0NB 3O96A 5CLLB 3U8ZA 1WG7A 2W9NA 1Y5OA 4HWIB 4HAXB 4BOZB 2Y8GA 1EUVB 1NDDA 2GBMA 4J6IA 2UZSA 2N7EA 2KQSA 2LASA 1QZEA 2DZIA 3M62B 3GZNI 1ZGUB 2KFKB 3MJWA 4FLHA 4W9EA 3A98B 1DDWA 2P8VA 2XQNM 2MP2A 2CAYA 2ZNVC 3RT3B 4ANUA 2OOBB 3ZDTA 1KJTA 5LXHA 3PV1A 1PMSA 4MDKE 3AXCA 1WMHA 1WR1A 2CQUA 2YVCA 2IBIB 4ICVA 3UIPB 1TJ6A 4DX8A 4KHOA 2JWZA 2RD0A 1U5DA 4K7UA 3UQBA 3TW1A 4B6HA 3ZLZA 3ZW3A 2K2UA 3WA0A 3U7DA 2M38A 1W1HA 2P0DA 3ULBA 2JT4B 2KO3A 2O2VA 2ZNVB 3K9PB 5E6NA 5AZFA 3DBRI 3NS8A 4GB9A 2ZJDA 2J0JA 4LJPB 2D9XA 2BPSA 1MKEA 1V49A 2ZCBA 3K9OB 2DX5A 1KM7A 2BWFA 1E7VA 2JZ3B 2K39A 3A9JA 1L7YA 4GDKA 1MK7B 2VRRB 2FJLA 3PGEA 3NZSA 4F7UP 5JHBA 2K6QA 2WX1A 2BGFA 1KZGA 3UIOB 1UD7A 1HBKA 4W9IA 2DYOA 1Z2MA 2CHZA 2Y8FA 2KDIA 2EKEC 4MT7A 3L08A 2YT1A 4KAXB 4EJNA 5E6OA 3WAMA 4FA6A 4HB4B 4GDLB 4W9LA 1X86A 3P2BA 4CYEA 2IY0B 1EGXA 1WY8A 3H7PB 3SHQA 4ANXA 4YL8A 2GBNA 2FJ9A 2R09A 2CB8A 2KJRA 2PJHA 1YIWA 4IM0A 4W9FA 2NR2A 4URKA 4A6HA 1WJMA 2HTHB 5JHAA 1Q5WB 2RPQA 4CHMA 1XKEA 3OLMD 2GCJA 3SV1A 4WJPA 4AOFA 4F8CB 1RJ2A 5CHWA 2CODA 2UZRA 3LJUX 4E71A 2KMAA 2JPHA 3HIZA 1YX6B 2V3SA 1WGGA 5IAAC 3V60A 3VH4B 1V2YA 1XQQA 2NBVB 4EMOA 5DHFB 2EMTA 2L05A 1F9JA 1E90A 4EZLA 3D8FA 2D9ZA 2M8SA 3QC8B 3VAWA 3ZO5B 5TR5A 2XBBC 1V86A 2J0MA 4HDOA 1OY2A 3APDA 3PTFC 4AUQC 3UQAA 2DA0A 2BKRB 1BWNA 1ST7A 3DQVA 1DYNA 2FCNA 3PS6A 4HK2A 4ICUA 4EUTA 2AL6A 2M0XA 2RGFA 1DROA 4IC7B 3F0WA 2K1FA 1G6JA 2KGXB 1WI1A 1WVHA 1E8ZA 2HRJA 2O6VB 2G4DB 2MRPA 3KRWA 3KZ1A 2DYQA 1VD2A 1WI0A 4K7WA 2KJHB 1W1DA 4A5KA 1P98A 4NNJB 2O6VD 2M14A 4DHZE 2G35A 3PT2B 5CLQB 3L17A 3AI5A 2NMBA 5CX3A 2B3AA 2XK5B 4C0AA 3H1UA 3TIXA 2WDTB 4WWOA 2D10A 1U5EA 3CF6E 1QC6A 4PQ0A 4D0NB 3R3MA 5DIFB 4LCDE 5E6PA 3DDCB 3ODOA 3QARA 4ZRJA 2LVPA 3AULA 1UNQA 2COCA 4HAWB 2N7DA 3A4RA 4ANVA 3M1IB 3FM8C 2VKIA 2ASQA 1EF5A 1B55A 1XD4A 3PLUA 3EECA 5IA7A 1LW3A 4EOYA 1NTIA 4JQWC 1R4NI 3V61A 2CKHB 4A6KA 3VVWB 5IJMA 2AL3A 4HAYB 2IO0B 2MBQA 1HB6A 4GPTB 1V81A 3DBLI 4HAUB 5AZHA 3L10B 2QHOA 2V1YA 3A8PA 1U27A 4HCPB 4PYZA 5J17A 5LXIB 1WGYA 3TVVA 1XCGA 4MY6A 2WWZA 3NHEB 3W1SA 4KIKA 1VCBA 5KHQA 3EFUA 3KRXA 2IFSA 3DXCA 2M17A 2KDBA 1MAIA 3BY4B 1LXDA 3L0WB 4EZKA 3ZNID 1ZKHA 2IYBA 1V88A 4B9KA 2LJ5A 1WXMA 4NJ7A 4X57B 4KHAA 2NVUI 3KUZA 4NPNA 4ANWA 2CHXA 4DDGD 2R2OA 5CHVC 1NTYA 2X18A 3ZNZB 4XWXA 1V5PA 3WANA 3I3TB 4M0WB 2JZZA 3NZUA 3SDLC 2DX5B 4ZRIA 2COPA 2L1CA 2LYDA 4KZCA 3A9JB 2LUEA 2I1KA 4FJZA 2Z0DB 2Y7BA 2YF0A 4HDQA 1CMXB 2LGYA 4I6NB 3ECIA 4PS8A 2H7DA 5GOWB 1GG3A 2KN5A 4FHKA 4MSMB 1L2NA 3QIJA 1J8CA 3WAOA 5FI1A 1UZXB 1WGRA 2ZVOA 2M4NA 4EEWA 3ZNGC 1KOTA 1Q67A 1WXVA 4W9CA 1ZM0A 1NU2A 5C5BB 2KQ7A 2RGNB 1WE7A 2NZ8B 4NSWA 3W1YA 1WJNA 4DHZB 3KSYA 2Z59B 4MGKE 1T0YA 1LM8B 2NPTA 2OTXA 2FCSA 3R7RA 3PSCA 2IO2B 2K8CA 2VRWB 2LGXA 2M1MA 2RR9A 3F5RA 2D07B 3PHWB 4GOCA 2GBRA 4GZUA 3FLVA 1TTNA 4HJKA 1WX7A 2PZ1A 5KQ4A 3HW2B 2GBKA 3HM6X 4N9F4 2I1JA 1Q1OA 3H7SA 2RQ1A 1E7UA 1WX8A 5DPRA 2D9WA 2RUKB 2LRWA 2KC2A 1ZSQA 2R2QA 1MK9B 1GUAB 2NCNA 1NBFC 1XT9B 2ZVNA 2MBBB 2JF5A 1E8YA 1WXAA 4A20A 1NI2A 1AQCA 1WJ6A 1YJ1A 2GS0A 3A4SC 3VHTC 5D3XA 3NOBA 4LDTD 1WYWB 2UWQA 1I7AA 4II3B 5HE2A 3M3JA 2O6VA 4FJVB 4MEMA 3DVGY 4M8NA 4RM8A 3U30A 3WIMA 1YX5B 3T06A 3TO1A 2LWPA 3SO6A 3SD5A 2BF8B 3HQCA 1DBHA 2ELAA 2REXA 2XK5A 1SIFA 1P1AA 2ZCCA 2NBUA 3DOWA 3EHVA 3NY5A 3PHXB 4A6FB 4WVFB 3FSSA 2L00B 1IP9A 4HPMB 1LQBA 2LD9A 4BOSC 4KZ0A 2KTRA 3VTUA 1YD8U 3FP5A 4HLEA 1OMWA 3PLVA 1ZW7A 3PRZA 2YS1A 2Z0OA 4KVGB 2QKMA 1EVHA 1OQYA 1WGDA 3APFA 2G4SA 1NVLA 2PPHA 3MTNB 4RM9A 1WFYA 2N1VA 4W9KA 2KK8A 2BWES 4MM3A 3D8EA 2D9YA 1OEYA 2I5CA 2FUHB 4DXAB 1UNPA 3AJ4A 4PNKA 1XODA 1U5FA 4G3XB 4MGYE 2YRYA 4HATB 5LLIA 2L3ZA 3RCZA 4HHVA 2AWTA 4A3PA 4PS3A 1QQGA 1N3HA 4AJWA 3AU5A 1MPHA 3IBEA 2HE7A 3ZKJC 2C5LC 2OJRA 2FIFA 1Q0WB 1TGZB 4F7HA 3DVNU 3A9KB 4TV3A 2D3GA 4DX90 4KSLC 3ZTCA 3ZIMA 5JZEB 2LG1A 4TUUA 5C23A 1X1MA 2FDQA 4M8MA 4NAWA 2LBBA 1UEFA 2JP2A 3B0AA 1C3TA 3QX1A 1UH6A 3R66C 3UINB 1S3SG 1FOEA 4I6LB 1K5DB 2CRFA 3ENEA 2V4LA 2DX1A 2K8BA 2BKFA 1E8WA 5KHOA 3L16A 5JP4A 1WGQA 2Q13A 2JXXA 2O2VB 5DCNA 3VUXA 2KUPA 1U2BA 3GYOA 4G50A 2MA9B 2Z0PA 1WH3A 4NQKE 1MIXA 2MWNB 4IUMB 3S2AA 2KDEB 4BBKA 1J0WA 2DKQA 3UGBB 1IPGA 1C1YB 2FIDA 1WJ1A 5JH5C 3VUYA 2COFA 1PQSA 1AARA 2D11A 1AWEA 2C7HA 2UVMA 5DHAB 5FR6A 1M7RA 4BKSA 4DK5A 1DDMA 4PS7A 4JL9A 4ZDVA 2NPTB 2KLGA 4Z2NA 5HKHA 2DENB 2C9WB 1SE9A 5DPTA 3VDZA 1WX9A 2Y5BB 2JY6A 3R7QA 3V62A 3A1QB 2KLCA 3N30A 3KW5B 2L0FA 3PRMB 3A8QA 1WF9A 4EKUA 5C79A 2DZJA 2N1WA 3CSFA 1UGMA 2K8HA 5L95C 3ALBA 2L0TA 2C7NB 2J7QB 3RD2A 2ROZB 5FI0A 4GMVA 1R4MI 1WGUA 2KVRA 4AP4C 5JLJB 4DHJB 3ODXA 4IWQA 2KANA 1E5WA 4MJSA 3DXDA 1BTNA 3B08A 3KUDB 2HJ8A 5CHFA 5BO4B 1I42A 1WE6A 4EFOA 3ZVRA 3DBHI 4BBNC 3PSEB 1P0RA 2MSED 4OVUA 1FGYA 2LZ6A 5CTRC 4Z2MB 2WYQA 1E8XA 2MKRA 3CXBB 1WGHA 4WJQA 4IWOA 4GU2A 1K5GB 1LB1A 4HB3B 1M94A 3GOEA 2KNBA 4L6EA 1V5TA 5C6RA 2PE9A 2G3QB 1XR0B 3VFKA 2Z0QA 3DVGX 3HK0A 1WZ0A 4A6FA 2FAZA 2L7RA 2RVBB 1PLSA 5D3WA 3WYFB 3ZRCA 2KTRB 2BYFA 2LXCA 3V6EB 1RFAA 2KFKA 2CY4A 1WJUA 4W9JA 3UF8A 1HB8A 2KKCA 3ZUNA 2MP2B 1H8CA 3OANA 2Z0EB 4JGHB 2W2WA 3Q3FA 5JHGA 3CMMB 2YSZA 2W2XD 1IRSA 4HVBA 3L54A 4MK0A 5JHHA 3JW0X 2ABDA 3WALA 3T8MA 2N9PC 2YS3A 4F7ZA 3IVFA 3KY9A 1P3QU 3T9LA 2R0DA 4DWFA 1P5TA 5HE1A 4WQOB 4ASWC 3D8DA 1EO6A 2LVQA 2LRUA 2D4QA 2N9EB 4BVUC 1BT0A 4TKNA 1LFDA 2MQJA 1WM3A 3SYXA 1V89A 1IYFA 3IG3A 3QJZA 2DYMA 1FHXA 2JVCA 1OTRB 3TCAA 3CIKA 3NSUA 2KWVB 2DN6A 2N9XA 4FULA 2NS5A 1OQNA 5C1ZA 4DBBA 1WXSA 4NY0A 3V6CB 4NAWB 4K7SA 2N23A 4JIOU 3QA8A 4MH0E 3KUCB 3TFMA 1M7EA 4KIKB 4XC2A 3P7ZA 1U29A 2DYBA 1ISNA 3MPXA 4HCNB 4K2OA 1KLVA 4F1SA 2K6DB 2MLBA 4OVVA 1EF1A 3L13A 4BKGA 3QAQA 2N0YA 4GGQA 3ZNHB 1GC7A 3TMPB 4II2B 2L2IA 5HE0A 3TL5A 3H9DA 4GXBA 2DFKA 4K81A 1V6EA 2ZZPB 2AEHA 5DH9B 2HTHA 3QHTA 3RULA 2N4FA 1X1GA 3OAWA
chains in the Genus database with same CATH superfamily
1YQBA 3TWXA 3PZ2A 4TYZA 3HHMA 2H7EA 4MELA 3TWRA 2LHEA 2MBOA 4K17A 3RCPA 2PE6B 3CVWA 3PP2A 2V76A 1K3ZD 2PEAA 4XE0A 3V5WA 3UI2A 4MKTA 3QQ8B 2EJ8A 3SBSA 3TWQA 4BY6A 3ULEG 2PTLA 3PVWA 2Z59A 4O1OA 4IAPA 3J5PA 1GW6A 2FI7A 4CEMA 2GB1A 5D27A 2H89B 3UMVA 1YQ4B 4FU3A 1WIAA 4J8FA 4DWFA 2IDYA 2KDMA 4KDLB 4C7ZA 3AG2E 1UBQA 1NTVA 4RCOA 5LOPB 4JHJA 2IYDB 2XRZA 3HM3A 4HPPA 4TQ0A 3W1SC 3ML9A 1JWUD 3B7UX 2ADZA 3AJIA 2HD5B 3O65B 1I35A 2P9SG 4DLQA 4HORA 2IO1B 4JKAA 2LGDA 4IDIA 2WXKA 5LOZA 3C5RA 4RVBA 5D3YA 3IHPC 4LNIA 4AXHA 1INZA 3BJIA 5G55A 4M01A 3FUMA 3BZDB 1TS5A 3FC4A 1PGBA 1DYQA 4NJ6A 5CBNA 2DTCA 1V8CA 1WDYA 2NTTA 3VUWA 2L52A 4ILHA 1UELA 1ZBPA 3ABLE 1MG4A 3G2VA 3MJ5A 1GC6A 3CHQA 2KX0A 2KWUB 3PVUA 2JRIB 3EGRA 5C2TB 4HXDA 1N62A 2DHKA 3SO8A 3KSLA 3JXIA 5G2NA 1ZC4B 4Y94A 1YN5A 2GOWA 3UT4A 1DIKA 5D0QD 2M63A 2P9PG 1X11A 2DKPA 1Z5SB 4D2KA 3X0WA 2KTFA 2L8JA 1X1FA 3FKYA 1YJJA 5DPSA 5C5BA 3MV2B 3D3MA 4I2ZA 3FUHA 5C1DA 1VZ8A 3PZDA 1Z3XA 2WQ6A 2GJYA 4WWPA 1RWSA 5L81A 1XLOA 1YN4A 4WJ7A 2RDGA 2KZRA 1K1AA 2H6FA 1WRIA 3JSVA 2RSGA 2LKOA 3H7PA 3TG5A 3QWMA 3V31A 2L1AA 4H2AA 3CVNA 1S0PA 4AP2A 1QBQA 2RPVA 3ONSA 4PYUA 3QCAA 3FILA 3OJ3A 5J18A 3S7JA 3N1XC 4HKQA 4BBNF 3VTYA 1KFYB 3AB5A 5DI9B 5D2MB 4K5BA 4CYMD 3IT4B 1BXTA 2GLSA 3ZXPA 3ZXVA 4MGIE 1C77A 2Y69E 2H88B 5KCVA 1TXDA 1OCRE 2KXJA 3RYTA 1JUQA 3VR8B 3OTNA 5JXVA 2WQ7A 1NVID 1OT8A 3X23A 4KDIC 3ZHEB 1U4AA 3GB1A 1UOHA 1QOGA 1RYJA 3B77A 3LDZE 4A20A 1UUPA 3H6NA 5E6JA 4AJYB 4XGAB 1J19A 5ENTD 2EILE 2R59A 5FR3A 4WSFA 4Y6WA 2LGIA 3RRUA 1HEZE 2CU1A 5L83A 2DIWA 2WXIA 3MYVA 4HI9A 1ZU2A 4ZYNA 3V2XA 1TEZA 2WMOA 1SSNA 2LOZA 2R2YA 5D3VA 1FM0D 3ZGQA 4BESA 1JROA 2K3UA 1NDDA 4KGTA 3B95A 2LASA 4X8QA 4FLHA 1H6OA 4BTAA 1L0XB 3GP7A 3A98B 1DDWA 2P8VA 1FCCC 4JX1C 1GGOA 4WNDA 4ANUA 2OOBB 3RT3B 2X6KA 4NRHB 2RRFA 4ZOHC 4OAUC 2KQ4X 3PV1A 3E66A 3AXCA 5LXHA 1WMHA 4RG6A 3MKQA 1HXYD 2YEPF 3ZXRA 2AXZA 3RN9C 4APOA 3B7SA 4K7UA 4C56C 1J7CA 3ZYKA 2P0DA 1G3NB 2O2VA 3U52E 3K9PB 2GRNB 2WXGA 3UINC 3C72A 3DBRI 5E6NA 5AZFA 4LJPB 2WQHA 1XGWA 3DSUA 3TXNA 4CT4A 1MKEA 3EU9A 3U2SC 2JZ3B 4DXFA 4ARIA 3MFGA 1N5XA 4F7UP 4ZHOA 1UD7A 4W9IA 2KXPC 2DYOA 1MHQA 1Z2MA 2CHZA 3VRAB 2R82A 4KAXB 4OHJA 3WAMA 4HB4B 3E37A 3ULYA 1X86A 1I4HA 3AE6B 4DQOC 4CYEA 2GRRB 1EGXA 1WY8A 4IM0A 1YN3A 4A6HA 2J49A 1WJMA 3PZ7A 1OWPA 3FVCA 4CHMA 4WJPA 3ZYMA 1SA4A 5CHWA 3ZUVB 1N60A 2KMAA 4JKGB 3D9LA 5IAAC 2KATA 2DZOA 2NBVB 2AXVA 1V1PB 3RIBA 4EZLA 3NOGD 5AQ7A 4B0ZA 3ZO5B 5TR5A 2PM7A 1V86A 4HDOA 1OY2A 1N5WA 3EJNA 2VSYA 3DWLG 2BQQA 4HK2A 3DQVA 2WVIA 3PS6A 1DYNA 2FCNA 2AL6A 5T8IA 1L6VA 2R05A 2ETAA 4DX2A 3KWVA 3F0WA 4IC7B 1G6JA 4YT0B 2KGXB 5T4YA 3FTYA 4JK9A 3BYYB 1KT1A 2I2OA 3FUDA 4Y6CA 1W1DA 1P98A 3K9IA 2O6VD 2M14A 2QIEB 4DHZE 2G35A 3UQ3A 4YDEA 3PNTB 5CLQB 1HQRD 2B3AA 3NVWA 1YJIA 2D10A 4LCDE 4AV7A 2J4DA 1OY3D 3GZSA 3ODOA 4DXGA 1C76A 1UNQA 3A4RA 2ASQA 3FM8C 4HLLA 1ENFA 3EECA 1RFKA 4BERA 5D3DA 4EOYA 4G23A 2CKHB 1TNBA 3JUIA 3D9JA 1FIQA 2XEEA 4TSSA 4GPTB 1HFAA 4LG6A 5A7DB 1XLNA 5AZHA 2WLBA 2QHOA 3L10B 3A8PA 1U27A 2YNQA 3AM9A 3WCQA 1XCGA 2V3PA 2WWZA 3W1SA 4WQMA 3EFUA 5I4DA 1KC7A 1ZKHA 1V88A 3PEVB 1WXMA 4KHAA 4DDGD 4UI9K 3CEQA 1X5BA 3Q47B 3WANA 4ZRIA 2COPA 4KZCA 2F8XK 4NZLB 3ZFWA 2I6HA 3LY7A 1ZYIA 2Z0DB 3Q6BA 4HDQA 4ZFHA 3MCXA 4GZ6A 1TS3A 2H7DA 1JWBD 4K3CA 4GZ5A 5IY5E 3OXLA 2LMCA 5JVLA 5FI1A 1UZXB 4EEWA 2M4NA 3NZ3A 4UUCA 2X3MA 2OVBA 1EDUA 4OT1A 5C5BB 1YNTE 2QFCA 1WE7A 3W1YA 2ZGDA 2NPTA 2OTXA 3PSCA 3PHWB 4QFVA 4FA6A 2D07B 4LNGA 1SEBD 4A1SA 1WX7A 2NSZA 3Q4AB 2INDC 5EYPF 2ZXWE 4N3BA 2RQ1A 5KWDA 1WX8A 3EIJA 2NYJA 5H7PA 4ACLA 2D9WA 1WY6A 3ZJTA 3AEFB 4RSYA 1T5XD 4G2VA 1ZSQA 1XT9B 3RFZB 1WXAA 2NTSA 1AQCA 1WJ6A 1YJ1A 4ACFA 3R8BA 5D3XA 4LDTD 2CJNA 1JWAD 4LNKA 1I7AA 3QKYA 2O6VA 5IN7A 3LB8C 4D10C 3ZQ4A 4OSNA 4DX7D 3EHMA 3FP3A 5KJMA 3O4ZA 3LXUX 1D5MC 2ZCCA 2NBUA 3KD7A 3DOWA 3EHVA 1AP7A 4KZ0A 1YD8U 4HLEA 4P16A 3PRZA 4IN3B 4N3CA 5AJDA 4KVGB 4RGTA 3APFA 1OQYA 4HRMB 3DSWA 1NVLA 2KN4A 1AWCB 2VSNA 3U4TA 1OEYA 3URZA 1TJCA 4GTOA 2I5CA 3Q78A 1FRDA 3I9V1 3FWVA 2W82A 4GCOA 2BKGA 1IGCA 1I4QA 5LLIA 5FKAC 4A3PA 3CHSA 2OEWA 3AS8A 2XS1A 4AJWA 4UWLA 3IBEA 1R4MB 3EUB2 2FIFA 1Q0WB 2DLBA 1XCQL 2D3GA 5JZEB 2N7JA 2FDQA 3W9FA 4L1BA 1UEFA 4NAWA 1QNFA 3B7TA 3FUIA 3B0AA 1NI1A 2Y3AA 4JPSA 2J08A 2P9LG 1HG2A 2B6CA 3CVUA 4HSIA 2CRFA 2LAHA 1S3SG 4UDUC 2SAKA 2K8BA 1N94A 3L16A 5JP4A 2O2VB 3GYOA 3AEAB 1QILA 1WH3A 3S2AA 2CFUA 2XHEA 4BBKA 5A23A 3UGBB 1IPGA 1HX8A 1WM5A 5DBKA 2D11A 1AWEA 2UVMA 2P9KG 2JABA 4C48B 3RNCC 2Y5BB 3R7QA 3A1QB 2KLCA 3KW5B 3FEYA 2QCZA 3A8QA 3AAAC 1H0AA 2K8HA 4PK1A 1YA0A 1S64A 2HTME 3E30A 4JKGA 1VBHA 1WE6A 1P0RA 4OVUA 2MSED 1N11A 4ACKA 4CZ2D 4WJQA 3Q79A 5B1BE 3H8HA 3L82A 4GYWA 1K5GB 1LB1A 4HB3B 1QF6A 2XCCA 5AAOA 1FRRA 5ENNA 4L6EA 2IGGA 1LTXA 5C6RA 3P4RB 2PL2A 2RKKA 4MBGA 4REZA 4U07A 4HBDA 4A6FA 1NP7A 3FTVA 1PLSA 5D3WA 2KTRB 2GRIA 1N6ZA 2KFKA 4DPRA 4UWGA 2CY4A 1WJUA 2KKCA 1N4QA 2J53A 2PVGC 3OANA 2WGSA 3NVVA 5JHGA 1W3BA 4HVBA 1F1HA 4N39A 2ETCA 4DLOA 2YS3A 2QSDA 3TWTA 1JPLA 2LVQA 4PDXA 2M19A 2W3SA 3AE3B 5FK9C 3BG1B 1LFDA 4I6EA 4XIFA 3SYXA 1WM3A 2MQJA 3R9MA 3RAUA 1Y6IA 3HVZA 3QJZA 3TEXA 2KWVB 5CCLA 3I5PA 2AX5A 2N9XA 5C1ZA 4BX8A 2LSVA 4K7SA 4JIOU 5FQ8A 1N4RA 3ABKE 3TFMA 1U29A 5MPOA 4XDCA 4F1SA 2INPE 3D9PA 4A55A 1K53A 3P1UA 1T77A 3AG3E 4UI9J 3QHTA 1WWTA 5AQ9A 4HRNA 1X1GA 2JYEA 3P4SB 3JSVB 4RH6A 4WJOA 5CMWA 3Q3JA 1XEEA 5ANLA 4DJAA 2YT0A 1UNSA 3CSTA 2IPKD 2JRHA 3RMKC 3HSAA 1QYMA 5CBOA 1BMLC 1KRHA 4HQDA 2COAA 3VTVA 1V61A 4JKHA 1PFJA 1HE8A 3L22A 5KQ1A 2XEWA 3M95A 2AYOB 5H92C 3BUAA 4J3OD 3TUOA 4XYCA 4US9A 3NBNB 2MBEA 2XEHA 5G04C 3PVLA 2Y1LE 4HB2B 4IW0A 2MCNB 1WYGA 5E76A 3DEPA 2B0OE 1ROEA 1U3CA 2KCJA 1VJKA 4FBJB 5HFYA 4LTUA 1SHCA 1KH0A 2K25A 4S17A 1V5OA 4C80A 5EFXA 5LFAA 4BEPA 4JLCA 2DAJA 4W9HA 2RLOA 2IZVB 2MWSB 1J0GA 3FEXA 2WH5A 3HYMB 2CHWA 3ZJVA 2HJ1A 4N5CA 2C60A 2F37A 3ZHEA 4O1NA 2KX3A 3FH5A 1V9JA 1D9SA 1VZ7A 2DYNA 1H4RA 4JKFA 2CR5A 2MH7A 2UYZB 4UQXA 3GYZA 1MG8A 2RMMA 4CHJA 3Q8CA 3APCA 5C16A 5AQBA 4DBGA 1HZ4A 1UPQA 5BV0A 4ZRKA 2W2XC 2GRPB 4FHJA 3ML8A 3TWWA 3L6AA 3WG7E 4S0RA 5J3TA 4UWKA 2K0PA 3PEGA 2XZDG 4FC8A 4YVQC 2C2LA 4WAFA 3N3KB 2QILA 2I5FA 3Q3OC 3DBSA 3V05A 5AUKA 1V80A 2KMCA 2DZMA 2I38A 3RZFA 3NW8A 1FXTB 2DLWA 3U12A 1WMHB 3KYCD 1KPSB 1BD8A 3B7RL 2KVZA 4MT5A 2PQNA 3ZDMC 1HH8A 4U95D 3C3OA 1TBEA 3TEZA 2GBJA 2DHZA 4DX1A 3ML4A 1PYWD 3UZTA 3DWGC 5HHDG 2DAFA 3QWVA 4G1TA 4JWUC 3N71A 3CVPA 4KXKB 3TJPA 1OEYJ 1D8DA 2ZISA 1E7PB 3V3XA 4BTBA 3A58A 1UBIA 2L76A 1WSPA 2OVFA 3MHSD 1C4CA 5EE3A 2GGFA 3MX3A 1AWDA 3I5JC 2YLMA 4UI9C 1BTKA 2NBWB 1BUIC 4JHRA 3QB2A 3VXWA 4DDID 4EPZA 4P7IA 2MJEA 1JWGA 4FADA 2IO3B 1HZ5A 2Z13A 1GNUA 4GAAA 4CGVA 1QQRA 3I4GA 2P0FA 4CSQA 4PT5A 2XNAC 5KJNA 4YTPB 3D9NA 2NBVA 2ROVA 3EDTB 4RG9A 2WXMA 4KHBA 1GOZA 3G2SA 3KH0A 2A4ZA 5LCWC 4B8CB 2EKIA 4ZRQA 5AQAA 4KV2A 3ULCA 1HG5A 3A1QA 1UPRA 2YS5A 1ZC3B 1K8KG 2HO1A 4HRSA 4FJYA 4A63B 3CHPA 3W9CB 4KBQA 4HOTA 3A33B 3QOUA 3Q73A 3QK0A 4HAZB 3QNKA 3FULA 3AH7A 1MPEA 4GMXB 2K5PA 3B1LX 3RNAC 2ZEQA 4I6PA 4L9PA 4OZCA 2VSXE 4WUYA 4TQ1A 3DXMG 2QYJA 4Q94A 1IQRA 1T0QC 5D94A 2PKOA 4LNNA 1I4XA 2WXQA 1QKZA 5CLLB 4WNGA 5AN8A 1ZOYB 5KCMA 2UZSA 1JCKB 1GPXA 1KZOA 3KEAA 5HI7A 2DZIA 3HDXA 3M62B 3LKUA 3PZ1A 3MJWA 4ATGA 2KFKB 4NQ0A 3BK1A 3FU5A 3OHMB 2OHFA 5HRYA 1EPUA 4DUIA 1BPOA 2QEJC 4MDKE 2ZU6B 2VJ8A 3MV3B 1SJED 3KS2A 4ICVA 1FO4A 1TJ6A 2VZKB 4KHOA 2RD0A 1L4ZB 2K22A 3TW1A 3ZW3A 4M02A 1CK1A 3U7DA 1UGJA 3Q9NC 5JJTA 3CVYA 1FT2A 2ZNVB 1N95A 5EIBE 4JK8A 3NS8A 2ZJDA 2J0JA 3UKRG 4F7AA 2BPSA 3B13A 3K9OB 4GDKA 3KLSX 1VBGA 2FO1E 1TZOA 2FJLA 2L6JA 1TYQG 3FUKA 1L0YB 1R4NB 3TXMA 2K6QA 3DBHB 4ME2A 2KDIA 5ARFA 2YT1A 5BYQA 3ETRA 4GDLB 3P2BA 3AEEB 2TSSA 1MX2A 2IY0B 3SHQA 4GTSA 4YL8A 2M56B 2KJRA 1IBXB 2VGYA 2WXRA 1YIWA 4GTQA 3LXFA 1BLXB 5JHAA 5M4YB 1Q5WB 2RPQA 3EIQC 2X6FA 5BUZA 1FXAA 4JKEA 4AOFA 3AV8A 4F8CB 2CODA 3T5VA 3LJUX 1N52A 4E71A 3HIZA 5ANRA 1YX6B 1WGGA 3V60A 1TNOA 2JLBA 3EU5A 2R03A 3NQPA 5BYRA 1Q2ZA 4ILIA 1F9JA 4N58A 2GUMA 2YINA 4F3VA 2M8SA 3QC8B 4ABNA 2J0MA 1JMLA 1FNWA 3UQAA 3C19A 3NB2A 2BKRB 4LEUA 1BWNA 4ICUA 2L32A 3CLJA 4C0EA 2M0XA 2ETBA 3PO0A 5CEDB 2K1FA 3W2DA 5DIZA 1E8ZA 2O6VB 4HROA 1RM6C 1FEHA 4JK7A 2XENA 3KZ1A 4NNJB 3GE3C 1TYGB 3NWFA 5ITZF 3L17A 3T5XA 4EHMA 2NMBA 3ESKA 4Q2JA 4GMJA 1U5EA 3LPZA 5LG4B 5FT9A 1LGRA 3SEBA 3QARA 4BX9A 4HAWB 2N7DA 5BV1A 4LLGM 3PLUA 1H2VC 1XD4A 1TNYA 3CGHA 2JSVX 2IO2C 4GYOA 1HZ6A 1J7BA 1KLGD 3TSSA 5AARA 4JQWC 3V61A 1TY2A 4BETA 2Y4UA 4A6QA 2UWJG 2AL3A 3IXSA 1HB6A 3DBLB 1V81A 2H6GA 4F6RD 4HAUB 1MVKA 3FU3A 5J17A 3BU8A 3JQ1A 1E0ZA 3TVVA 3IAS1 4MY6A 3NHEB 2KUQA 1F77A 4CDRA 2M17A 2KDBA 3L0WB 1LXDA 3ZNID 2IYBA 4B9KA 4X57B 3CQCB 1MZCA 1OXJA 2CHXA 2R2OA 5CHVC 1NTYA 1WXQA 2X18A 5FZQA 1YQ3B 2G1EA 3ZNZB 4RLYA 4G8KA 5FQ7A 3CK9A 2VYIA 2JZZA 2DX5B 4NAMA 2L1CA 2EQXA 4FJZA 4CDNA 2I1KA 2WPVA 5IP4D 2Y7BA 2LGYA 3Q5MA 2XCBA 2Y5CA 2KN5A 4BSXA 1UJJA 4FHKA 4MSMB 2BTEA 3GE8C 2DIKA 5ENRD 1J8CA 2LHDA 3WAOA 4GU5A 1WGRA 1FT1A 2ZVOA 3DSXA 1SA5A 1D5ZC 2DVWA 4W9CA 1ZM0A 2RGNB 4XDDA 4YTNB 2WU2B 4DHZB 1H2UA 4HOQA 3KSYA 2OJWA 3AG1E 1B89A 3LEWA 5JJ7A 1LM8B 1T0YA 3SR6A 3R7RA 3DHGC 2M1MA 2K8CA 3ASFA 2LGXA 4GOCA 5G5HA 1QZ2A 4HJKA 3BIID 3CHRA 2W3RA 4EQFA 1T3QA 2WQYB 3H7SA 4U63A 1O1SA 5FQ4A 2KMMA 3RRNB 4RF0A 2LUHA 2BT6A 2R2QA 3L4PA 5ENPD 1GUAB 1L0VB 1AW7A 2XGSA 4L23A 5G04J 3VHTC 2E6XA 3A4SC 3VR9B 4A90A 2C0MA 1WYWB 4II3B 4RM8A 4HRLA 4M8NA 3ZYLA 3CV0A 3DVGY 4WURA 3WIMA 4HFGA 2VGEA 3NG0A 2LWPA 3SO6A 1QT9A 4ZRPA 2REXA 1DBHA 5E75A 3PHXB 1P1AA 4E3CA 2XS8A 4GNKB 4A6FB 4YNDA 1VDVA 2KTRA 3FP5A 1TKEA 3J5QB 2FF4A 3MTNB 3KWLA 3I57A 4RM9A 1P7EA 2N1VA 3AE4B 5CRUA 3D8EA 2QC9A 1HTQA 3FUJA 4H7XA 4QQIA 1Q10A 4C7YA 1XODA 2R17C 1EF1C 3EA6A 2WXHA 4HATB 2AWTA 4DI4A 2ZIRA 1KBLA 3AU5A 2HE7A 2WXPA 4TV3A 3E4BA 3HXDA 5BW8C 3A9KB 3J9CA 1OCOE 4GTVA 3ZIMA 4TUUA 5C23A 3VLEA 4ARCA 2N0SB 3IAM1 2I9CA 1OCCE 2JP2A 3NJTA 1MJDA 3DPYA 4AM9A 4I9EA 5EYLA 2BKFA 3WXXA 5KHOA 5KNGA 1HU3A 2KUPA 1U2BA 3FHEA 3KSQA 2Z0PA 3BK2A 1MIXA 2MWNB 1XNFA 3EHNA 3ASGA 2HM8A 2XRYA 4PUCA 1WJ1A 2J4BA 3D9IA 2COFA 1PQSA 2C7HA 3B2GA 1M7RA 3RI7C 1Z6TA 3Q7AA 1TKYA 3D9MA 3FTZA 3FTSA 5TSSA 1QOBA 3VRBB 4R7LA 1SE9A 5DPTA 3ZPJA 1PFDA 1WX9A 3VDZA 1XO3A 2DBYA 1YMPA 3ZXSA 2DZJA 4EKUA 3MGBA 5C79A 1IBXA 3ZU7B 4F1PA 3ALBA 3NVYA 4PH4B 2AQ1B 3MZLB 2J7QB 3E9OA 5AYWD 1TN6A 2QYUA 2WXNA 4GMVA 1R4MI 4DHJB 5JLJB 3Q15A 2KANA 4WH4A 1E5WA 3DXDA 5J90A 5CHFA 3KQ4A 1M4VA 4EFOA 1ZXHA 2AQ2B 4BBNC 2Y0BG 3PSEB 1FGYA 4IRUA 4KKJA 4Z2MB 3RNGC 2WYQA 1VLBA 4YDOA 4RFBA 4GU2A 4BSZB 1B1ZA 3GOEA 1ZPSA 4B94A 1K51A 1YMHE 2Z0QA 3HK0A 1WZ0A 4OW0A 2FAZA 1O1TA 1N54A 2RVBB 3ZRCA 3V6EB 3I4RB 1C4AA 1IHBA 5AJLA 4AVXA 4W9JA 2HE0A 1HB8A 3LS8A 1H8CA 4JGHB 3AE2B 1PDXA 3Q3FA 3HG0D 3DSSA 3CMMB 2W2XD 1IRSA 2BTDA 2IFUA 3P1MA 3PUKA 3IVFA 3KY9A 4L1RA 3T9LA 3AG4E 3ZRHA 1TN8A 1P5TA 5HE1A 4WQOB 3D8DA 1EO6A 3JCKC 1BT0A 4JC8A 2JU6X 4MRUA 1V89A 3P42A 1E6EB 3V62A 1H6KA 1OTRB 4WIPA 3NSUA 4C00A 2ZKMX 2NS5A 2X38A 4DBBA 1WXSA 2BS4B 4N2QA 2Y5PA 4USAA 3KUCB 3IT6B 1M7EA 2V3NA 3P7ZA 1E10A 4LERA 1TY0A 2INNE 1N0RA 4OVVA 2XGOA 2MLBA 3FY4A 3L13A 4HS2A 3P4PB 4BKGA 1ELKA 3TMPB 2L2IA 4GXBA 4A3VA 4YVOA 3HIEA 3T3OA 5FINA 4N3AA 3OAWA 1S63A 2FULA 3HRAA 3IV0A 2C7MB 1PGAA 2KT7A 4B6WA 4DHJD 2OOEA 2A5UA 2FJUB 3AECB 3QDNA 4HAVB 4M00A 4YXDB 2MX2A 2GCLA 4IFSA 2ZPNA 4YDWA 4XWTA 3EFCA 2AW6A 4JB8P 1Z5SC 1SE4A 1KI1B 1ZDVA 5AEKB 4KHBB 4IG7B 3DPDA 2IY0C 5AZGA 1KLXA 1ACCA 4ILJA 2GI9A 2KFJA 4MJSB 2CY5A 2CU3A 2GRQB 3VLFA 4HB5A 4WJNA 2LI5A 3QWWA 2WDVB 3AEBB 3E33A 4QXAB 1DC2A 2XZTG 4W9GA 4B0EA 2OV8A 1L5PA 2K00A 4W9DA 2KJ6A 4U0SA 3LY8A 4MGZE 3NF1A 1RRPB 1S1QB 2JZPA 4K1RB 4HB0B 2DWZA 2IY1B 4GIVA 4J8YA 1V5UA 3VTWA 3QBVB 4RMAA 2MOWA 3LVRE 2R2LA 2MDXA 4JW1A 1EU3A 4NQLB 3PNLB 4ILGB 2E2EA 1HXIA 1SE2A 1FB8A 3ESLA 5DPWA 2P9UG 4DX6D 2AWIA 2FCMA 2D9VA 1O5MA 4GZCA 5T3RA 5J3YA 2KD0A 4IWPA 4R3DA 3RRMB 1IKND 2ILRA 2QDFA 2PQRA 4MSQB 4F53A 3ZEFA 3LDZA 3MP9A 2LNIA 1FHOA 4U0ZA 2K49A 3UM2A 5C3JB 4IM2A 1L5JA 1F52A 1U5GA 1DDVA 3KVFB 3B2FA 3IFWB 4B95A 2INCC 2LOXA 4GZ3A 5D66A 2KC7A 2EC1A 2ELBA 2IF4A 1BAKA 4C4VA 4GDKB 1V5MA 3RU0A 5I2SA 1RAXA 3A9KA 2KC1A 2VSZA 1Y8RC 2MJ3A 3C8YA 2BF0X 5M72A 1RLFA 2MBHA 1FHWA 3OJ4B 1U2VG 3UUXA 4GDLA 3EPYA 1MFWA 3T3NA 3SBTA 4NURA 4XX5A 2KWCA 4G11A 3RZWC 2D3CA 1BI8B 3FTXA 1TZ1A 3SF4A 2I2YA 4A3OA 1TKGA 3HRDD 3JVZX 3MC8A 2D2QA 3Q3MC 3SNXA 4I17A 4BKSD 3M63B 2L6BA 3DBRB 4H8SA 3GS2A 4GTPA 3C0RB 4YTMB 2V5QC 3BWUD 4ATZD 3JYUA 1Z87A 4CHKA 1FCLA 5CMYA 5LCWJ 3G2UA 5HE3A 4LNOA 3E32A 2V9HA 4IOYX 1UN8A 2CS4A 4DRXE 4K3BA 2HDEA 3DXEA 2MFQA 3CVQA 2QC8A 1XD3B 3EC8A 1OUVA 1OFFA 2X8XX 3TEYA 1JCQA 4LJOB 2JQRB 3QWZB 4F7GA 2BCJA 2LULA 2RNRB 3FEHA 2EMSA 1NZNA 2KZTB 4EECA 4LRZA 4WNFA 1SBBB 1ZDXA 3AMZA 2J8SD 3UX4A 4FN2A 3ZVVA 2BYEA 1WR6E 2LXAA 4YONA 1EAZA 3N7CA 1GJZA 5ENQD 3D9KA 4YSYB 2QY7A 1RRBA 4RGMA 1QOFA 4G0NB 2J59M 1D3ZA 3LYYA 3O96A 2W9NA 4HWIB 4BOZB 2FEZA 4HAXB 1STEA 2MRIA 1EUVB 2ZW0A 5BNWA 1QQEA 2GBMA 3FU0A 3N1YC 2J42A 4DI3A 5ENSD 1A70A 1XLPA 4HEA1 3O48A 1GB4A 1ZGUB 4FLBA 5BMGA 4W9EA 1N4SA 2XQNM 2J07A 2ZNVC 3ZDTA 1D8EA 2BW2A 1XLQA 3AN1A 2YVCA 2IBIB 3UIPB 1TJFA 4DX8A 3BYTB 1U5DA 3UQBA 4B6HA 4I1MA 3ZLZA 1I4GA 3WA0A 2PLPA 2M38A 1X81A 3ULBA 5LX8A 1XCTL 2JWUA 4Q96A 4IOIE 4GB9A 1TS2A 3ABVB 3CR3A 1ET6A 2D9XA 3SI5A 1V49A 2ZCBA 2DX5A 2LSUA 2BWFA 5JHBA 1N63A 1BU9A 3NZSA 3UIOB 4MH8A 3CKBA 1HBKA 2Y8FA 4MT7A 1SB3C 3L08A 4G26A 2J09A 1EU4A 2BB5A 1UJKA 2DNFA 4KYOB 2KCKA 5IKCM 4OYSA 2GBNA 2YEPB 2FJ9A 4URKA 2CB8A 2R09A 2PJHA 4W9FA 2NR2A 3B9JA 3BVMA 3HUIA 1XKEA 1FXIA 4XI0A 3SV1A 4Q69A 1RJ2A 2UZRA 2JPHA 2FBNA 1OWMA 1TT5B 1T0SC 4K5AB 4Z68A 4EMOA 5DHFB 2EMTA 4DIXA 5BPPA 3I3NA 3S7BA 3D8FA 3TGOA 2XBBC 4AUQC 3APDA 3PTFC 2DA0A 1K1BA 3C98A 4C0MA 5ENOD 1BI7B 2WXJA 3MC0B 4WWMA 2KBXA 3IXEA 3SGHA 1DROA 3VTXA 4A3TA 1JCRA 2G4DB 2V4IB 3KRWA 2P9NG 2DYQA 1VD2A 2KJHB 4A5KA 4AEZC 2GRMA 2YT2A 1D6EC 2J4XA 3PT2B 3FU6A 3AI5A 4A9AA 3H1UA 3TIXA 4O60A 4JVSA 1T6BX 2WDTB 2BKKB 3CF6E 3R3MA 4D0NB 5E6PA 5DIFB 3DDCB 4RGOS 1H19A 1L4DB 2RDBC 2E0IA 2PZIA 1NFIE 3M1IB 1EF5A 5IA7A 4U96D 1LW3A 3DCXA 1DCQA 2DBAA 4QJ4B 3SBGA 3AEDB 3N9YC 5IJMA 3VVWB 5JMND 2MBQA 2CG2A 3HXEA 2Y4TA 3CHOA 4LCTA 3Q8AA 4PYZA 5LXIB 4TMAB 4LNUD 4ILGA 3HVDA 1VCBA 2IFSA 3DXCA 2GROB 1MAIA 3Q3NC 2F8YA 1NA0A 4NJ7A 4NPNA 4GPMA 3W5VB 1DVPA 4GA0A 1PAQA 1V5PA 4M0WB 2KR0A 4YSXB 3NZUA 3PZ8A 4OZAA 1ESFA 1I4PA 3A9JB 4UQYA 2LEKA 2LUEA 4ZYSA 2WU5B 2YF0A 4I6NB 1KLUD 3R9AB 4PS8A 2JYTA 2GW1A 4RGNA 1L2NA 1K50A 1GB1A 3QIJA 3QC1A 1YCSB 3UIPC 3ZNGC 1WXVA 3RNEC 2PNNA 1XF5L 5JJ6A 4LK0M 3FFLA 2NZ8B 4NSWA 2C0LA 4YWGG 2LAIA 2XN9C 4MGKE 3SHFA 2FCSA 4A8XC 4KVOA 2VRWB 2KM4A 3SBTB 2FO7A 4J8DA 3ZGZA 1YYHA 2PZ1A 3BQOA 2OEVA 5KQ4A 3PUJA 5IRSA 3HW2B 1FVFA 2PM6A 4L7TA 3HM6X 4N9F4 2WDRB 1V1OA 2WMNA 3Q9UC 2CJOA 2LO6A 3MKRA 3BVGA 2KC2A 1MK9B 4XKBA 2MBBB 3JXJA 1E8YA 5KBAA 2BBCA 3NAWA 2UWQA 3M3JA 3U30A 2EIME 2PIAA 1JCSA 2VGXB 4I1OB 1YX5B 4H7YA 3RSEG 4HOSA 4OAVB 2D3BA 4TXQA 3TWSA 3BVZA 4XKCA 3ZKJA 3JUEA 3HQCA 2V0GA 2XK5A 1NYQA 2G9HD 2XPYA 4WVFB 2BUGA 3ASOE 1LQBA 5CHEE 2UY1A 1OMWA 1ZW7A 3N20C 2YS1A 2KZTA 1EVHA 5CECB 3E9PA 4N59A 5LNK1 3PZ4A 5CEAA 2PPHA 2WXLA 3LCAA 4W9KA 3FAHA 1WG0A 2KK8A 2BWES 2D9YA 1N0QA 5FJYA 1UNPA 4PNKA 1IQUA 4FXCA 1U5FA 1ELWA 3UM1A 1SF0A 1T0RC 2VZKD 4G3XB 4MGYE 1RW2A 5H8YE 3U66A 1E96B 2L3ZA 2FE8A 4LNBA 2RFAA 1QQGA 2NC9A 4MS6A 2AJAA 2AVPA 1N3HA 3FUNA 1N61A 1DGJA 2OJRA 2WXOA 4KSLC 1IXVA 3ZTCA 3FH8A 3X2QE 4M8MA 2PMVA 1C3TA 2LBBA 4GCNA 3NWAA 3GZNB 3FUEA 4BT9A 1VZ6A 3UINB 4I6LB 1K5DB 2V4LA 2SEBD 1AN8A 2P9IG 5EKQD 2LXLA 1WGQA 2Q13A 3DEOA 5DCNA 4RNAA 1MQSA 4G50A 4NQKE 4N6EB 3S7DA 1AYFA 2KDEB 1J0WA 2DKQA 4CRWA 2NXPA 4AS1A 2LFIA 3VUYA 5JH5C 5FR6A 1OWNA 5DHAB 2D5GA 4BKSA 1FNVA 3MC9A 4DK5A 4APFA 1FPYA 4DX5D 4ZDVA 2KLGA 4Z2NA 5HKHA 1QLBB 4U8YD 3SFZA 1EYHA 3LY9A 3BEEA 4WNEA 3CVXA 3MHZA 3SQVA 2L0FA 1S70B 2F0YA 3PRMB 3CSFA 2XPZA 2H6HA 5L95C 1P5QA 2L0TA 2MHJA 2WS3B 2C7NB 5FI0A 1KT0A 4K5CA 3F6QA 3UM0A 4IWQA 4MJSA 3B08A 3KUDB 5BO4B 2HJ8A 3DSVA 2WDQB 3DHHC 1JWFA 3TWUA 2LZ6A 3URYA 5CTRC 3ASHA 5C2YA 1MI0A 1WGHA 2MKRA 1TJEA 3FDHA 2ACZB 1UG3A 1M94A 2KNBA 2JX5A 3ASDA 4FP7A 2PE9A 5BXUA 2G3QB 4U0UA 4JD2G 3DVGX 5D2MC 2L7RA 3AE9B 5AIJA 3WYFB 2LXCA 2UU7A 2LUMA 2IOLA 2IONA 4KVMA 3ZUNA 2MP2B 2Z8LA 4JKDA 4RF1A 2W2WA 4JKCA 2IU1A 3E34A 2YSZA 1SVXA 3IHVA 1SIJA 1C9FA 4MM3B 2ABDA 1OQRA 3T8MA 3T8KA 4F7ZA 3UPVA 4OZBA 3PE3A 4P29A 3CVVA 3HVEB 3CVLA 1FMAD 2Z14A 3VLDA 2KWDA 2LRUA 3SFXA 2RDHA 2V4HC 1PGXA 4TKNA 1N9AA 4XEIG 1IYFA 1TIFA 5EE9A 3R2IA 3IG3A 2KYWA 5HG2A 2KACA 2DYMA 2JVCA 5B3SE 3TCAA 3CIKA 4JL0A 5EE1A 4NY0A 3V6CB 4XC2A 3QA8A 3U3WA 1GAQB 4OVZA 3PZ3A 2DYBA 3NUHB 1UN9A 4C4VB 1EF1A 4EBAG 3QAQA 2N0YA 4GGQA 3ZNHB 1V55E 1LF8A 3TL5A 4II2B 3H9DA 1EWCA 2DFKA 4K81A 2EIKE 4M3OA 2AEHA 1V6EA 2HTHA 2N4FA 4AQ7A 2IGHA 5G5GA 2MHKA 1SJHD 4IULA 4JA9A 2OQBA 1WM2A 1FCHA 4EZJA 1B9RA 2N9KA 3Q49B 2K2JA 2BEDA 1MHHE 2DYSE 3P63A 3O13A 3UM3A 4L2LA 1CQVA 2J0KA 1DCEA 3V2OA 4QJ3B 3U4EG 5EIDA 3LYAA 2JEKA 3AU4A 4HKZE 3GYPA 3RUIB 3DRAA 4I6JA 1H6PA 4YDYA 5FZRA 3TBLD 3ABME 2L9BA 4I43A 5CERB 1I2HA 2LJIA 4CO7A 1SE3A 3KYDD 2V5FA 4XZ4A 4GSWA 4N2SA 4WWNA 1IUEA 1LD7A 1P6SA 4XWWA 1J7AA 1Z3YA 2MW5A 2Z4DA 4EBAA 5FQ6A 5BT1A 1YOVB 5FTPA 3D9OA 2WX0A 3UT8A 3FTWA 1WZ3A 3TEWA 3CK8A 3VOQA 1SGHA 1TN7A 2E3TA 2CG3A 3UXGA 1XX0A 3TG4A 4BKTA 1WJ4A 2VGXA 3FTUA 4BAXA 4C9BB 2XQ0A 1VRAB 2LVOA 2BYVE 1MI1A 3P6AA 1MIZB 2M0AA 2W55A 3C3QA 3GZ2A 4HXIA 3GZ1A 2EINE 1KZ7A 4GN1A 1Y56A 3MDBC 4CCAA 3AS5A 4BFRA 3DXKG 1EM7A 1X05A 3V79K 3NOCD 3RK6A 2WP9B 3C3RA 5J2RA 2FBWB 1ZVRA 3SU8X 4CQNA 4MLPA 1ACAA 4L2YA 2GMIC 2JUOA 3E56A 3VH3B 1OGWA 5A6CA 2E2XA 3ZTDA 4HPLB 3Q2AC 1K8RB 3JYSA 1V54E 3SY2A 1IYGA 1WRDB 3OWEB 1C79A 4IKGA 3RD2A 3AEGB 3DVNV 3R2TA 2P0HA 3VIAA 4AWJA 2R5SA 2X6HA 1MYOA 5J3QA 3MEKA 1UNRA 1MJ0A 2WM9A 3DCGA 4WAAA 4JA7A 3PH0C 1W1GA 5EX0A 3HXFA 1UW4B 1KF6B 2QKLA 4K2PA 3KEZA 3PREA 1TQZA 4GLSC 5EE0A 1ZP0B 2VH2A 2WXFA 4I9CA 3FH7A 5GMVA 2VTBA 2G45B 2ON8A 3QWPA 3OG5A 1I4RA 3SFDB 4MACA 5BYSA 4RQIA 2KAJA 2R61A 3SNHA 1QOAA 1KZPA 1L6UA 1FAOA 1IHGA 3VQIA 2KDFB 3PRPB 5G05C 2ZPYA 2V8SE 3RNFC 3SUZA 4GMLA 2FNJB 3BINA 3N32A 2DZKA 1P3RA 4U04A 1K52A 1A5RA 2X6IA 3PG7A 2ONDA 2DHIA 2KOXA 3PPAA 1FNUA 2KHWB 5D6JB 3UIOC 4ZHPA 1NENB 1JDEA 3PEUB 5KHQA 3G9WA 3G2WA 2DHJA 2FCQA 4P1BC 1JRUA 3D9HA 2KCLA 1FD6A 3LJ3A 4E74A 3W9GA 3ZRFA 3ZJUA 4G25A 3P4QB 4LDTB 3B7BA 4O6FA 4KSKC 2RSUA 1ZB1A 3ODWA 4JEHA 1P9DU 3D32A 3RO2A 4IM3A 3PDNA 5LONB 1PC2A 1NL4A 4NIKA 1H10A 4B8AA 1Y19B 1FGZA 3U8ZA 2V0PA 1WG7A 4AY6A 1Y5OA 2Y8GA 3RJVA 4J6IA 3DHIC 2LGSA 1UWXA 2N7EA 1I7HA 2KQSA 1CJEA 1QZEA 4NJCA 3GZNI 3CKCA 3ZYQA 4LUNU 2PW9A 1UWMA 2MP2A 2CAYA 4NACA 4QAYA 1MHXA 3UTMA 2VH1A 1KJTA 3RKVA 1PMSA 1JALA 1WR1A 4E85A 2CQUA 1C4PA 1I42A 1VDYA 2JWZA 1TNUA 2RFMA 2K2UA 5KJKA 2JT4B 1W1HA 4JHKA 2KO3A 1F2RC 3AE5B 4M0WA 2MYOA 1KM7A 2L83A 1E7VA 2K39A 3A9JA 4ITKA 1L7YA 4QJ5B 1MK7B 2VRRB 3PGEA 4LNFA 2IGDA 2WX1A 1JRPA 1KZGA 2BGFA 4KGRA 2DYRE 5EN5D 2WB2A 2EKEC 5IO9A 4D6WA 4EJNA 5E6OA 5HQ8A 3FUFA 4W9LA 5KNHD 2KCVA 2N9LA 1XXGA 2Q5WD 2X6JA 5AENA 3H7PB 4ANXA 5FIOA 3Q8FA 2EIJE 2ZW1A 4KGSA 3PE4A 2BVCA 3UI3A 3DSTA 1TR4A 3ZN3A 2HTHB 4P1CC 3LVQE 1E9MA 1JW9D 3OLMD 2GCJA 1HS6A 5IOIA 2ONQA 4CDMA 3VH4B 2V3SA 1V2YA 1XQQA 2QJLA 4B89A 2L05A 1E90A 1FPPA 2IJ0A 3AE1B 4US8A 2D9ZA 3VAWA 3ONKA 3CK7A 1JWMD 3SFYA 2ZGGA 4EUTA 1ST7A 5EDSA 3NRZA 5BMHA 3E9SA 3ENBA 2DCPA 2RGFA 1NEKB 4EE2A 1WI1A 1WVHA 2HRJA 1A5EA 2MRPA 1WI0A 4K7WA 3NS1A 3AS4A 4UWFA 5CX3A 2XK5B 4JXTA 4C0AA 3SZ7A 4WWOA 4U7EB 4AIFA 1QC6A 4PQ0A 3Q8BA 1H2TC 4ZRJA 2UY1B 2LVPA 2PVOD 3AULA 4ANVA 1TNZA 4ZHBA 2COCA 3CIRB 4YSZB 2VKIA 1B55A 1TS4A 5HS0A 3NWDA 2EELA 1NTIA 1F0ZA 1R4NI 3OXGA 4A6KA 1OCZE 5B1AE 4HAYB 2IO0B 4BT8A 1WGKA 1SZ9A 2V1YA 4HCPB 1DOIA 4O1PA 1WGYA 3Q69A 2K9XA 5KJLA 4KIKA 3KRXA 2ICIA 1NYRA 4EZKA 1OQQA 3BY4B 3MKQB 4V3IA 1Y8MA 1MX4A 5JA4D 2LJ5A 3KUZA 2NVUI 4ANWA 5LP0A 1ELRA 4G24A 2Q7FA 4HI8A 1SQMA 2CFZA 1OWLA 4XWXA 4GPKA 3I3TB 4KT6B 4JEUA 3SDLC 1HO8A 4JZYA 2LYDA 1P7FA 4KKIA 1LD8A 4K0RA 1HTOA 1CMXB 2OCCE 3ECIA 5GOWB 1GG3A 4UQZA 1FFUA 1D5XC 3LJNA 4GOUA 5AUIA 3S7FA 1PY1A 4BZAA 1KOTA 1HA5A 1Q67A 2IOSA 3RNBC 1NU2A 2KQ7A 1WJNA 2FUG1 3U9WA 5FWQA 4B93B 2Z59B 1FFVA 2R02A 1SZAA 1KTKA 1DNPA 5D0OD 2IO2B 5D7GA 2RR9A 3F5RA 2GBRA 4GZUA 3FLVA 1TTNA 4I2WA 2VTBB 4LSZE 1DOXA 1V1PA 2GBKA 1JWSD 2MEKA 2L0TB 2I1JA 3UT7A 1Q1OA 1E7UA 2IEJA 3V30A 5DPRA 1VR9A 2JXTA 2RUKB 2LRWA 5ARGA 1MX6A 2L0IA 2W54A 1O1RA 1CZPA 2ZVNA 3DBLI 2NCNA 3NVZA 1NBFC 3AE7B 2JF5A 1NI2A 3EHRA 2GS0A 3NOBA 1EWYC 1ET9A 3ULQA 5HE2A 4FJVB 4MEMA 2HR2A 5CCMA 3T06A 3TO1A 4J8EA 4K03A 3SD5A 2WNMA 1ZXIA 2BF8B 3BG0B 2ELAA 1SIFA 1LO5D 3NY5A 4JE3B 4G8LA 4TRQA 1IP9A 5I2MA 3FSSA 2L00B 3U7ZA 4HPMB 2LD9A 1KLVA 4BOSC 2YQ8A 3VTUA 3PLVA 2H6IA 3CQGB 1R7SA 2KIEA 2Z0OA 2QKMA 5J08A 1WGDA 2G4SA 4ILHB 1WFYA 5HI1A 4MM3A 4KX6B 2FUHB 4DXAB 2IO3C 4IYPA 3AJ4A 3IEGA 4W9RA 4JKBA 3HVEA 2YRYA 1PUTA 3RCZA 4HHVA 4PS3A 5BMIA 4U8HA 5GXGB 5EILA 1MPHA 4CT0A 3ZKJC 2C5LC 5EX3A 2QZAA 3HXBA 1TGZB 4F7HA 3DVNU 1F2RI 5G05J 4DX90 4J8SA 2LG1A 4CGWA 3OXFA 1X1MA 2KIGA 3QX1A 1JQ4A 1UH6A 3CHMA 3R66C 1FOEA 3ONLA 2OEDA 3ENEA 2DX1A 4GYYA 3HXCA 1E8WA 4GMRA 4GA1A 4HJGE 3KAEA 3Q14C 4JWSC 2JXXA 2P58C 3VUXA 4B0MA 2MA9B 3TWVA 4HNAD 4IUMB 1C1YB 2FIDA 1AARA 2D3AA 2IQCA 3TAXA 1UF0A 2AQ3B 3FILB 5D3IB 1DOYA 1D4BA 3IKOB 4PS7A 1DDMA 4GTRA 3Q8EA 4JL9A 2NPTB 1NI3A 1A17A 4P6VF 3E9LA 2HYZA 2DENB 4E6HA 4M7CA 1N4PA 2C9WB 3EHQA 3DWMA 1C78A 2BS3B 2JY6A 3MA5A 3N30A 4GTTA 2BS2B 2XGMA 1WF9A 2NMQA 2N1WA 3SFEB 3IHYA 1U3DA 3ZNGA 4TXPA 1UGMA 2YHCA 3T9KA 1OWOA 5HKPA 3AE8B 2BYTA 3RPFC 2IJGX 3RO3A 2ROZB 2KVRA 1WGUA 4AP4C 3ODXA 3UKUG 1BTNA 4A1GA 4GTMA 3ASNE 3ZVRA 3DBHI 2J9QA 1V97A 2BB6A 1E8XA 4I6GA 3CXBB 1RZ4A 4U8VD 4IWOA 1WAO1 4TUMA 1SW6A 4AY5A 3L9TA 4TXRA 2WHIA 4I1AA 1V5TA 2B76B 5FZSA 1HF8A 1XR0B 3VFKA 5CRVA 4GZDA 2GRLA 2BYFA 4BWRA 1RFAA 4GA2A 4UWHA 3UF8A 2QMTA 2Z0EB 3Q75A 4XI9A 3L54A 4MK0A 4J0UA 5JHHA 2K8EA 3CIAA 3JW0X 3WALA 3GW4A 2N9PC 3ISMC 1P3QU 2VSOE 2R0DA 5BXOA 1FVHA 4ASWC 2DZNA 2D4QA 2N9EB 3CWIA 4BVUC 4N5QA 4J7WA 1SXTA 4FULA 1FHXA 1ZUD2 2DN6A 1OQNA 3U64A 3ZYYX 3JQ0A 4NAWB 4KMOA 2P2CP 2N23A 1IGDA 4MH0E 2DWQA 3WAPA 3I63C 4KIKB 2AXUA 2LXMA 3G2TA 3Q7FA 1ISNA 3MPXA 4HCNB 2XEVA 4K2OA 2K6DB 2VQ2A 2YHEA 4HOUA 2J52A 1GC7A 1ZE3D 5HE0A 2RG8A 3N1ZC 2ZZPB 5DH9B 2MJDA 3RULA 2A5EA 2X0SA 3EUVA 3W5UB 1NA3A 2XPIA
chains in the Genus database with same CATH topology
1YQBA 4TYZA 3HHMA 2H7EA 4MELA 2MBOA 4K17A 3RCPA 2PE6B 3CVWA 3PP2A 2V76A 2PEAA 4XE0A 3V5WA 4MKTA 3QQ8B 2EJ8A 3SBSA 4BY6A 3PVWA 4IAPA 1GW6A 2FI7A 4CEMA 5D27A 3UMVA 4FU3A 1WIAA 4J8FA 4DWFA 4KDLB 1UBQA 1NTVA 5LOPB 4JHJA 2IYDB 2XRZA 3HM3A 4TQ0A 3W1SC 3ML9A 3B7UX 2ADZA 3O65B 2HD5B 1I35A 4DLQA 4HORA 2IO1B 4JKAA 2LGDA 2WXKA 5LOZA 4RVBA 5D3YA 3IHPC 4AXHA 1INZA 3BJIA 5G55A 3FUMA 4NJ6A 2DTCA 3VUWA 4ILHA 1UELA 1ZBPA 3G2VA 1GC6A 3CHQA 2KX0A 2KWUB 3PVUA 2JRIB 4HXDA 2DHKA 5G2NA 1ZC4B 4Y94A 2GOWA 3UT4A 1DIKA 5D0QD 2M63A 1X11A 2DKPA 1Z5SB 3X0WA 2KTFA 2L8JA 1X1FA 5DPSA 5C5BA 3MV2B 3D3MA 4I2ZA 3FUHA 5C1DA 3PZDA 1Z3XA 2WQ6A 2GJYA 4WWPA 5L81A 4WJ7A 2KZRA 3JSVA 2RSGA 2LKOA 3H7PA 3TG5A 3QWMA 3CVNA 1S0PA 4AP2A 3ONSA 4PYUA 3QCAA 5J18A 3OJ3A 3S7JA 4BBNF 3VTYA 5DI9B 5D2MB 4MGIE 5KCVA 1TXDA 2KXJA 3RYTA 1JUQA 3OTNA 2WQ7A 3X23A 4KDIC 3ZHEB 1U4AA 3LDZE 4A20A 3H6NA 4AJYB 1J19A 2R59A 4WSFA 4Y6WA 3RRUA 2CU1A 5L83A 2DIWA 2WXIA 3MYVA 1ZU2A 4ZYNA 1TEZA 2WMOA 2LOZA 5D3VA 3ZGQA 1NDDA 2LASA 4FLHA 4BTAA 3A98B 1DDWA 2P8VA 1GGOA 4WNDA 4ANUA 2OOBB 3RT3B 2X6KA 4NRHB 5LXHA 3PV1A 3E66A 3AXCA 1WMHA 4RG6A 3MKQA 2AXZA 4APOA 3B7SA 4K7UA 2P0DA 3ZYKA 2O2VA 3K9PB 2WXGA 5E6NA 5AZFA 3DBRI 4LJPB 2WQHA 1XGWA 3TXNA 4CT4A 1MKEA 2JZ3B 4F7UP 1UD7A 4W9IA 2DYOA 1MHQA 1Z2MA 2CHZA 2R82A 4KAXB 3WAMA 4HB4B 1X86A 4CYEA 1EGXA 1WY8A 4IM0A 4A6HA 2J49A 1WJMA 1OWPA 4CHMA 4WJPA 3ZYMA 5CHWA 2KMAA 4JKGB 3D9LA 5IAAC 2KATA 2NBVB 2AXVA 3RIBA 4EZLA 4B0ZA 3ZO5B 5TR5A 2PM7A 1V86A 4HDOA 1OY2A 3EJNA 2VSYA 4HK2A 3DQVA 2WVIA 3PS6A 1DYNA 2FCNA 2AL6A 5T8IA 4IC7B 3F0WA 1G6JA 2KGXB 5T4YA 3FTYA 4JK9A 1KT1A 2I2OA 3FUDA 4Y6CA 1W1DA 1P98A 3K9IA 2O6VD 2M14A 4DHZE 2G35A 3UQ3A 3PNTB 5CLQB 2B3AA 2D10A 4LCDE 4AV7A 2J4DA 3GZSA 3ODOA 1UNQA 3A4RA 2ASQA 3FM8C 3EECA 4EOYA 4G23A 2CKHB 3JUIA 3D9JA 4GPTB 1HFAA 5A7DB 5AZHA 3L10B 2QHOA 3A8PA 1U27A 2YNQA 1XCGA 2WWZA 3W1SA 3EFUA 1KC7A 1ZKHA 1V88A 3PEVB 1WXMA 4KHAA 4DDGD 4UI9K 3CEQA 1X5BA 3Q47B 3WANA 4ZRIA 2COPA 4KZCA 3ZFWA 2I6HA 3LY7A 2Z0DB 4HDQA 3MCXA 4GZ6A 2H7DA 4GZ5A 3OXLA 5JVLA 5FI1A 1UZXB 4EEWA 2M4NA 2X3MA 2OVBA 1EDUA 5C5BB 2QFCA 1WE7A 3W1YA 2NPTA 2OTXA 3PSCA 3PHWB 4QFVA 4FA6A 2D07B 4A1SA 1WX7A 2NSZA 3Q4AB 4N3BA 2RQ1A 1WX8A 3EIJA 2D9WA 4ACLA 1WY6A 4RSYA 4G2VA 1ZSQA 1XT9B 1WXAA 1AQCA 1WJ6A 1YJ1A 5D3XA 4LDTD 1I7AA 3QKYA 2O6VA 4D10C 5KJMA 3EHMA 3FP3A 3O4ZA 3LXUX 2ZCCA 2NBUA 3KD7A 3DOWA 3EHVA 4KZ0A 1YD8U 4HLEA 3PRZA 4IN3B 4N3CA 5AJDA 4KVGB 3APFA 1OQYA 1NVLA 2VSNA 3U4TA 1OEYA 1TJCA 2I5CA 3URZA 3FWVA 4GCOA 5LLIA 4A3PA 3CHSA 3AS8A 4AJWA 4UWLA 3IBEA 2FIFA 1Q0WB 2D3GA 5JZEB 2FDQA 4L1BA 4NAWA 1UEFA 1QNFA 3B7TA 3FUIA 3B0AA 2Y3AA 4JPSA 2J08A 3CVUA 1HG2A 1S3SG 2CRFA 2LAHA 2K8BA 3L16A 5JP4A 2O2VB 3GYOA 1WH3A 3S2AA 2CFUA 2XHEA 4BBKA 5A23A 3UGBB 1IPGA 1HX8A 1WM5A 5DBKA 2D11A 1AWEA 2UVMA 2Y5BB 3R7QA 3A1QB 2KLCA 3KW5B 3FEYA 3A8QA 1H0AA 2K8HA 1YA0A 4JKGA 1VBHA 1WE6A 1P0RA 4OVUA 2MSED 4ACKA 4WJQA 4GYWA 1K5GB 1LB1A 4HB3B 2XCCA 5ENNA 4L6EA 5C6RA 2PL2A 4U07A 4A6FA 1NP7A 3FTVA 1PLSA 5D3WA 2KTRB 2KFKA 4DPRA 4UWGA 2CY4A 1WJUA 2KKCA 3OANA 5JHGA 1W3BA 4HVBA 4N39A 4DLOA 2YS3A 1JPLA 2LVQA 4PDXA 3BG1B 1LFDA 4I6EA 4XIFA 3SYXA 1WM3A 2MQJA 1Y6IA 3QJZA 2KWVB 5CCLA 3I5PA 2N9XA 5C1ZA 4BX8A 2LSVA 4K7SA 4JIOU 5FQ8A 3TFMA 1U29A 4F1SA 3D9PA 4A55A 3P1UA 4UI9J 3QHTA 1X1GA 3JSVB 4WJOA 5CMWA 3Q3JA 5ANLA 4DJAA 2YT0A 3CSTA 2JRHA 2COAA 3VTVA 1V61A 4JKHA 1PFJA 1HE8A 3L22A 5KQ1A 2XEWA 3M95A 2AYOB 2MBEA 5G04C 3PVLA 4HB2B 4IW0A 2MCNB 5E76A 1U3CA 2KCJA 4FBJB 1SHCA 2K25A 1V5OA 5EFXA 5LFAA 4JLCA 2DAJA 4W9HA 2RLOA 2IZVB 2MWSB 1J0GA 3FEXA 2WH5A 3HYMB 2CHWA 4N5CA 2C60A 3ZHEA 2KX3A 3FH5A 1V9JA 2DYNA 1H4RA 4JKFA 2CR5A 2UYZB 4UQXA 3GYZA 1MG8A 4CHJA 3APCA 5C16A 4DBGA 1HZ4A 1UPQA 5BV0A 4ZRKA 2W2XC 4FHJA 3ML8A 3L6AA 5J3TA 4UWKA 3PEGA 4FC8A 4YVQC 2C2LA 4WAFA 3N3KB 2I5FA 3DBSA 1V80A 2KMCA 2DZMA 3RZFA 1FXTB 2DLWA 1WMHB 3KYCD 3B7RL 2PQNA 3ZDMC 1HH8A 1TBEA 2GBJA 2DHZA 3ML4A 3UZTA 2DAFA 3QWVA 4G1TA 3N71A 3CVPA 4KXKB 3TJPA 1OEYJ 4BTBA 1UBIA 2L76A 2OVFA 3MHSD 2GGFA 3MX3A 2YLMA 4UI9C 1BTKA 2NBWB 4JHRA 3QB2A 3VXWA 4DDID 4EPZA 4P7IA 1JWGA 4FADA 2IO3B 1GNUA 4GAAA 3I4GA 2P0FA 5KJNA 3D9NA 2ROVA 3EDTB 4RG9A 2WXMA 3G2SA 3KH0A 2A4ZA 5LCWC 4B8CB 4KV2A 3ULCA 1HG5A 3A1QA 1UPRA 2YS5A 1ZC3B 2HO1A 4FJYA 3CHPA 4KBQA 4HOTA 3A33B 3QOUA 3QK0A 4HAZB 3QNKA 3FULA 4GMXB 3B1LX 2ZEQA 4I6PA 2VSXE 4WUYA 4TQ1A 1IQRA 4Q94A 5D94A 2WXQA 5CLLB 4WNGA 5KCMA 2UZSA 5HI7A 2DZIA 3HDXA 3M62B 3LKUA 2KFKB 3MJWA 4ATGA 4NQ0A 3FU5A 1EPUA 1BPOA 4MDKE 2ZU6B 2VJ8A 3MV3B 3KS2A 4ICVA 1TJ6A 4KHOA 2RD0A 3TW1A 3ZW3A 3U7DA 3CVYA 5JJTA 2ZNVB 4JK8A 3NS8A 2ZJDA 2J0JA 4F7AA 2BPSA 3B13A 3K9OB 4GDKA 1VBGA 2FJLA 2L6JA 3FUKA 2K6QA 3TXMA 4ME2A 2KDIA 5ARFA 2YT1A 4GDLB 3P2BA 2IY0B 3SHQA 4YL8A 2KJRA 2VGYA 2WXRA 1YIWA 5JHAA 1Q5WB 2RPQA 3EIQC 2X6FA 5BUZA 4JKEA 4AOFA 4F8CB 2CODA 3T5VA 3LJUX 1N52A 4E71A 3HIZA 5ANRA 1YX6B 1WGGA 3V60A 2JLBA 3NQPA 4ILIA 1F9JA 2YINA 4F3VA 2M8SA 3QC8B 4ABNA 2J0MA 3UQAA 2BKRB 4LEUA 1BWNA 4ICUA 3CLJA 4C0EA 2M0XA 2K1FA 5DIZA 1E8ZA 2O6VB 4JK7A 3KZ1A 4NNJB 3L17A 3T5XA 2NMBA 3ESKA 4GMJA 1U5EA 3LPZA 5FT9A 3QARA 4BX9A 4HAWB 2N7DA 5BV1A 3PLUA 1H2VC 1XD4A 3CGHA 4GYOA 4JQWC 3V61A 2Y4UA 2UWJG 2AL3A 1HB6A 1V81A 4HAUB 3FU3A 5J17A 3JQ1A 3TVVA 4MY6A 3NHEB 4CDRA 2M17A 2KDBA 3L0WB 1LXDA 3ZNID 2IYBA 4B9KA 4X57B 3CQCB 2CHXA 2R2OA 5CHVC 1NTYA 2X18A 5FZQA 3ZNZB 5FQ7A 3CK9A 2VYIA 2JZZA 2DX5B 2L1CA 2EQXA 4FJZA 4CDNA 2I1KA 2WPVA 2Y7BA 2LGYA 3Q5MA 2XCBA 2KN5A 4BSXA 1UJJA 4FHKA 4MSMB 2DIKA 1J8CA 3WAOA 4GU5A 1WGRA 2ZVOA 4W9CA 1ZM0A 2RGNB 4DHZB 1H2UA 4HOQA 3KSYA 1B89A 3LEWA 5JJ7A 1LM8B 1T0YA 3R7RA 2M1MA 2K8CA 3ASFA 2LGXA 4GOCA 1QZ2A 4HJKA 3CHRA 4EQFA 3H7SA 4U63A 5FQ4A 3RRNB 2R2QA 1GUAB 2XGSA 4L23A 5G04J 3VHTC 3A4SC 2C0MA 1WYWB 4II3B 4RM8A 4M8NA 3ZYLA 3CV0A 3DVGY 3WIMA 4HFGA 2LWPA 3SO6A 2REXA 1DBHA 5E75A 3PHXB 1P1AA 4E3CA 4A6FB 4YNDA 2KTRA 3FP5A 2FF4A 3MTNB 4RM9A 2N1VA 3D8EA 3FUJA 4H7XA 1XODA 2R17C 1EF1C 2WXHA 4HATB 2AWTA 4DI4A 1KBLA 3AU5A 2HE7A 2WXPA 4TV3A 3E4BA 5BW8C 3A9KB 3ZIMA 4TUUA 5C23A 3VLEA 2I9CA 2JP2A 4AM9A 4I9EA 2BKFA 3WXXA 5KHOA 1HU3A 2KUPA 1U2BA 3FHEA 2Z0PA 2MWNB 1MIXA 1XNFA 3EHNA 3ASGA 2HM8A 2XRYA 4PUCA 1WJ1A 2J4BA 3D9IA 2COFA 1PQSA 2C7HA 1M7RA 1Z6TA 3D9MA 3FTZA 3FTSA 4R7LA 1SE9A 5DPTA 3ZPJA 3VDZA 1WX9A 3ZXSA 2DZJA 4EKUA 3MGBA 5C79A 3ALBA 4PH4B 3MZLB 2J7QB 3E9OA 5AYWD 4GMVA 2WXNA 1R4MI 4DHJB 5JLJB 3Q15A 2KANA 1E5WA 3DXDA 5J90A 5CHFA 4EFOA 4BBNC 3PSEB 1FGYA 4IRUA 4Z2MB 2WYQA 4GU2A 3GOEA 4B94A 2Z0QA 3HK0A 1WZ0A 2FAZA 1N54A 2RVBB 3ZRCA 3V6EB 3I4RB 5AJLA 4AVXA 4W9JA 1HB8A 3LS8A 1H8CA 4JGHB 3Q3FA 3CMMB 2W2XD 1IRSA 2BTDA 2IFUA 3PUKA 3IVFA 3KY9A 3T9LA 3ZRHA 1P5TA 5HE1A 4WQOB 3D8DA 1EO6A 3JCKC 1BT0A 4JC8A 4MRUA 1V89A 3V62A 1H6KA 1OTRB 3NSUA 2NS5A 2X38A 4DBBA 1WXSA 4N2QA 3KUCB 1M7EA 3P7ZA 4LERA 2XGOA 4OVVA 2MLBA 3FY4A 3L13A 4HS2A 4BKGA 1ELKA 3TMPB 2L2IA 4GXBA 4A3VA 4YVOA 4N3AA 3OAWA 2FULA 3IV0A 2C7MB 4B6WA 4DHJD 2OOEA 2A5UA 3QDNA 4HAVB 2MX2A 2GCLA 4IFSA 2ZPNA 2AW6A 1KI1B 5AEKB 4KHBB 4IG7B 3DPDA 5AZGA 1KLXA 4MJSB 4ILJA 2KFJA 2CY5A 4WJNA 3VLFA 2LI5A 3QWWA 4W9GA 2OV8A 2K00A 4W9DA 2KJ6A 4U0SA 3LY8A 4MGZE 3NF1A 1RRPB 1S1QB 4K1RB 4HB0B 2IY1B 4GIVA 1V5UA 3VTWA 3QBVB 4RMAA 2MOWA 3LVRE 2MDXA 4JW1A 4NQLB 3PNLB 4ILGB 2E2EA 1HXIA 1FB8A 3ESLA 5DPWA 2AWIA 2FCMA 2D9VA 4GZCA 5T3RA 5J3YA 2KD0A 4IWPA 3RRMB 2ILRA 2PQRA 4MSQB 4F53A 3ZEFA 3LDZA 2LNIA 1FHOA 4U0ZA 4IM2A 1L5JA 1U5GA 1DDVA 3KVFB 3IFWB 4B95A 2LOXA 4GZ3A 2KC7A 2EC1A 2ELBA 2IF4A 1BAKA 4GDKB 1V5MA 3RU0A 1RAXA 3A9KA 2KC1A 2VSZA 1Y8RC 2BF0X 5M72A 1RLFA 2MBHA 1FHWA 3OJ4B 3UUXA 4GDLA 3EPYA 3SBTA 4NURA 4XX5A 2KWCA 4G11A 3RZWC 3FTXA 1TZ1A 3SF4A 4A3OA 3JVZX 2D2QA 3SNXA 4I17A 4BKSD 3M63B 4H8SA 3C0RB 3JYUA 1Z87A 4CHKA 5CMYA 5LCWJ 3G2UA 5HE3A 4IOYX 1UN8A 2CS4A 3DXEA 2MFQA 3CVQA 1XD3B 3EC8A 1OUVA 4LJOB 3QWZB 4F7GA 2BCJA 2LULA 2RNRB 3FEHA 2EMSA 1NZNA 2KZTB 4EECA 4LRZA 4WNFA 3UX4A 4FN2A 3ZVVA 2BYEA 1WR6E 2LXAA 4YONA 1EAZA 3N7CA 1GJZA 3D9KA 2QY7A 1RRBA 1D3ZA 4G0NB 2J59M 3O96A 2W9NA 4HWIB 4BOZB 2FEZA 4HAXB 2MRIA 1EUVB 5BNWA 1QQEA 2GBMA 3FU0A 4DI3A 3O48A 1ZGUB 4FLBA 4W9EA 2XQNM 2J07A 2ZNVC 3ZDTA 2YVCA 2IBIB 3UIPB 1TJFA 4DX8A 1U5DA 3UQBA 4B6HA 4I1MA 3ZLZA 3WA0A 2M38A 3ULBA 5LX8A 4Q96A 4GB9A 3CR3A 2D9XA 3SI5A 1V49A 2ZCBA 2DX5A 2LSUA 2BWFA 5JHBA 3NZSA 3UIOB 3CKBA 1HBKA 2Y8FA 4MT7A 3L08A 4G26A 2J09A 1UJKA 4KYOB 2KCKA 4OYSA 2GBNA 2FJ9A 4URKA 2CB8A 2R09A 2PJHA 4W9FA 2NR2A 1XKEA 4XI0A 3SV1A 4Q69A 1RJ2A 2UZRA 2JPHA 2FBNA 1OWMA 4EMOA 5DHFB 2EMTA 5BPPA 3I3NA 3S7BA 3D8FA 3TGOA 2XBBC 4AUQC 3APDA 3PTFC 2DA0A 3C98A 4C0MA 2WXJA 3SGHA 1DROA 3VTXA 4A3TA 2G4DB 3KRWA 2DYQA 1VD2A 2KJHB 4A5KA 4AEZC 2GRMA 3PT2B 3FU6A 3AI5A 3H1UA 3TIXA 2WDTB 4JVSA 3R3MA 3CF6E 5E6PA 4D0NB 5DIFB 3DDCB 1H19A 2E0IA 2PZIA 3M1IB 1EF5A 5IA7A 1LW3A 2DBAA 3SBGA 3VVWB 5IJMA 2MBQA 2CG2A 2Y4TA 3CHOA 4LCTA 4PYZA 5LXIB 4ILGA 1VCBA 2IFSA 3DXCA 1MAIA 1NA0A 4NJ7A 4NPNA 1DVPA 4GA0A 1PAQA 1V5PA 4M0WB 3NZUA 3A9JB 4UQYA 2LUEA 2YF0A 4I6NB 3R9AB 4PS8A 2GW1A 3QIJA 3QC1A 3ZNGC 1WXVA 5JJ6A 3FFLA 2NZ8B 4NSWA 2C0LA 2LAIA 4MGKE 3SHFA 2FCSA 4KVOA 2VRWB 2KM4A 3SBTB 2FO7A 4J8DA 2PZ1A 5KQ4A 3PUJA 3HW2B 1FVFA 2PM6A 4L7TA 3HM6X 4N9F4 2WMNA 2LO6A 3MKRA 2KC2A 1MK9B 4XKBA 2MBBB 1E8YA 2UWQA 3M3JA 3U30A 2VGXB 4I1OB 1YX5B 4H7YA 4HOSA 4XKCA 3HQCA 2XK5A 2XPYA 4WVFB