3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
b'PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
1P3QU 2RD0A 3RULA 4NNJB 4F8CB 4MY6A 4DHJB 4EFOA 3PV1A 4KHAA 3PVLA 5HE0A 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 3A98B 3FP5A 4OVUA 4W9LA 3D8DA 5L81A 2FJ9A 3CMMB 1XD4A 1WJ6A 2MBHA 4URKA 3VIAA 5J18A 1HE8A 3UF8A 3PVUA 2J0KA 3NZSA 1U29A 2DENB 2N9PC 4YONA 3WANA 1E7UA 1BTNA 3A33B 5FI0A 4AOFA 2KANA 2RPQA 3V5WA 1TJ6A 4EUTA 1P3RA 4MJSA 4JQWC 3BINA 4LJOB 3TIXA 2JRIB 3VTVA 4GMVA 2ZCCA 2KFJA 3F0WA 3TBLD 4IWPA 3OAWA 2P0HA 3HM3A 3ZKJC 2NR2A 4AP4C 3QCAA 4HWIB 4HB3B 3H7SA 1WYWB 2C7NB 3QWZB 2BYEA 4A6HA 2LVQA 3PLUA 1M94A 2B3AA 2MBQA 4K7UA 2ROZB 1WGHA 2J7QB 3VXWA 1HB8A 4AWJA 4BBNC 4NSWA 4OVVA 2ZJDA 5D6JB 2MQJA 2L2IA 4WWOA 5D3YA 3VAWA 4XZ4A 4EEWA 4Z2MB 1I7AA 2KWCA 3QA8A 3PLVA 3ML8A 3B08A 4LJPB 4HHVA 5J3QA 2M17A 3JW0X 3P6AA 3TJPA 2G3QB 1E90A 1TTNA 4IWOA 1KJTA 2CRFA 3MHSD 4FJVB 1V5TA 5DCNA 4BKTA 2PPHA 1ZSQA 3ULBA 1Y8RC 2Z0DB 4MK0A 3NS8A 1V86A 2MBOA 4L6EA 1ZKHA 1WXMA 3A8QA 2MCNB 3PGEA 2V3SA 3VQIA 2IYDB 3ZRFA 2DZJA 1RRPB 1N3HA 4MDKE 2ROVA 5E6OA 2COFA 3QIJA 2RGFA 2LYDA 4E74A 1BWNA 1J19A 3KVFB 3H6NA 2KNBA 2MWNB 4BBNF 1WMHB 4NPNA 5C16A 2LGXA 3DXDA 4GB9A 2P0FA 2DHZA 2FCMA 2KDFB 3DDCB 1F9JA 2IY1B 1RLFA 3FEHA 3FM8C 3APCA 2GBRA 2C5LC 1EF1A 5DPWA 3QHTA 3APDA 3UIPB 1JRUA 2I5FA 1LQBA 2KK8A 1S1QB 2N23A 1U5DA 2KMCA 1OGWA 1EGXA 3LDZE 2HD5B 4ICUA 2W2WA 4G50A 1WGUA 4GSWA 2KC2A 2MWSB 3SHQA 4ANUA 2NBUA 3AU5A 3IFWB 2O6VA 4ZRJA 1J0WA 2DYNA 2XK5B 5J17A 1OQYA 2EMSA 3ZW3A 1LXDA 4AJWA 4EZJA 3GOEA 2ELBA 1RRBA 3M63B 2YLMA 2MLBA 3TL5A 2BYVE 1V61A 2D9ZA 2GBMA 1IRSA 2DYQA 5AZFA 3L08A 4KZCA 4H8SA 2IO3B 4A20A 1MIXA 2AEHA 1MPHA 3HK0A 4DX8A 1U5EA 3DVGX 2BF8B 4HB2B 3WALA 1OQNA 1Q67A 3CIKA 2RR9A 4HDOA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 2YS1A 4MM3A 1V2YA 3UIOB 5DHFB 3O65B 2CHZA 1WF9A 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 2MA9B 1RJ2A 4BFRA 1Q5WB 3A9JB 3PREA 2CHWA 3H7PA 2N1VA 2KTFA 2NMBA 2D11A 2KCJA 4WJNA 2Q13A 3N32A 4NAWB 3SU8X 4YL8A 2DTCA 4HK2A 3ZNGC 2LGYA 4PS3A 4XWXA 2ZPYA 1UGMA 1FHOA 4FADA 4FJZA 1P0RA 5J3YA 5D94A 1H4RA 4I6NB 5AZHA 4MSMB 2RQ1A 5KQ4A 5D3VA 5C79A 1K8RB 2JWZA 4TKNA 4M8MA 2JRHA 4Z2NA 2K8BA 1E7VA 4LDTB 2KLCA 1WGDA 4HPLB 1MG8A 3KH0A 3ECIA 3CXBB 3NHEB 5LONB 4K2OA 1WE7A 2OJRA 4P7IA 1C1YB 2D2QA 1YX5B 5KQ1A 4CO7A 5C5BA 2LWPA 4KHBB 2Z0QA 4TQ1A 1AWEA 3V6CB 2N1WA 2LD9A 3N30A 4GMXB 2K6QA 1P9DU 3N3KB 2RVBB 5L95C 3TW1A 2KTRB 2DKPA 1L2NA 1FGYA 2KFKB 3SDLC 1V5MA 2G35A 1WJ4A 2O6VB 2COCA 4MT7A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 5CLLB 1OY2A 1HBKA 4F7HA 3A4SC 2KOXA 1KOTA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 2W9NA 4IM2A 4G0NB 2KWVB 5D3XA 3TVVA 3PG7A 5D27A 1XODA 2DHIA 4BKSA 4GDLB 4DDID 2BWFA 3AI5A 3VOQA 2MRPA 2IBIB 1U2BA 1M7RA 5DPTA 4HAWB 1S3SG 1WFYA 1C3TA 4IC7B 1G6JA 3C0RB 3JSVA 1WGYA 4PS7A 3ZNHB 2CODA 1KLVA 3SNHA 2LOXA 2ZVNA 2KXJA 4XC2A 2HTHB 4GXBA 2D9YA 2L0TA 4KV2A 3FLVA 4B95A 4BOSC 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 1GG3A 4GDKB 2ZCBA 2L1CA 1WZ3A 2K25A 1U4AA 4II2B 1V6EA 4FBJB 2MBBB 2UZRA 4B6HA 2FJLA 3MPXA 2R0DA 4WJOA 1RFAA 3A1QB 2KN5A 4IM0A 1UNRA 4TQ0A 4EKUA 4GZUA 2LGDA 2MKRA 1X1MA 3VUYA 4A6FA 2FAZA 5J3TA 3DBLI 1XQQA 1KZ7A 1EO6A 3WIMA 5DHAB 1WX7A 1IP9A 3HM6X 2MDXA 4NY0A 4JL9A 1X1GA 2D9WA 2AL3A 2ZZPB 4GN1A 2WX0A 2LVOA 1Q0WB 3VUWA 4A5KA 3ML4A 5G2NA 4FJYA 2PEAA 3VVWB 4XX5A 2NZ8B 4JLCA 1XCGA 3L16A 2OOBB 1WI0A 4DBGA 2YF0A 3VDZA 5CX3A 4MSQB 2C60A 1MK9B 1WJMA 1UELA 1UBQA 2MP2B 3A9KB 3RUIB 4DX90 3VTUA 1WX8A 3KY9A 4B6WA 1BT0A 2ASQA 2LUEA 1U5GA 1TGZB 3JYUA 2M14A 2BWES 3NZUA 2GS0A 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 3HW2B 3NSUA 4HJKA 2ABDA 4A6KA 3SYXA 2DKQA 2HRJA 3UQAA 1WR1A 5CTRC 4IWQA 2BKFA 2K6DB 4EZLA 3PVWA 3IHPC 1AARA 2VKIA 2DLWA 2VSZA 2E2XA 2UWQA 1PFJA 2FCNA 4DK5A 5HKHA 3HHMA 4MGKE 2ZVOA 3MDBC 2I1KA 4ANWA 4TV3A 4HAYB 4WJ7A 4WAAA 1V89A 2RGNB 4KSLC 5HE3A 1V80A 3AXCA 5EFXA 4W9JA 4I6PA 1E8WA 1W1DA 4HB0B 3W1SC 2J59M 1Y5OA 1MK7B 4LDTD 3M3JA 4G3XB 4E71A 3T9LA 2HE7A 3KUDB 3UQBA 3DBRI 1OEYA 3SO6A 3VH4B 1V88A 1Z2MA 4HAZB 5C6RA 2NPTA 3B0AA 1LB1A 4FN2A 2Z0PA 1WXVA 2IZVB 2LXAA 1TBEA 1UPQA 1WG7A 2N9XA 5AEKB 3RT3B 1GJZA 1X05A 2FUHB 4W9CA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 4KSKC 3PP2A 3P7ZA 1SIFA 1XR0B 3HQCA 4FHJA 2KJRA 1L7YA 3PHXB 3KW5B 4K7SA 4EMOA 3ZDMC 3ZIMA 4MGIE 3L13A 3R3MA 3UINB 4HLEA 2DX5A 2DX1A 5KHQA 2HJ8A 4BBKA 1WM3A 5CHWA 3ZO5B 3WA0A 2M8SA 5KCVA 2JT4B 1WH3A 1NVLA 5D7GA 1HB6A 3P2BA 5E6NA 4DHZE 2JY6A 2VRWB 1WZ0A 2C7MB 1VD2A 2G4SA 3QK0A 1SE9A 3ZDTA 2BKRB 4K17A 1B55A 1WXSA 4WQOB 2BYFA 3OJ3A 5JP4A 4HDQA 1D3ZA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 3ALBA 3EECA 1I42A 1EAZA 2WYQA 3JVZX 1J8CA 2NS5A 3A8PA 2XQNM 1Y19B 2Y7BA 2LJ5A 3RZFA 3EHVA 2YVCA 3R66C 1IYFA 2LOZA 3QQ8B 2KZRA 4M8NA 2IO1B 1WR6E 1Z87A 4IAPA 4NJ6A 3K9PB 1UNPA 3WAPA 3D8EA 2CU1A 5GOWB 1V9JA 2FIDA 3PRZA 1WVHA 1YX6B 2H7DA 5JHBA 2AL6A 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3ZTCA 3BY4B 2IO2B 5CHVC 1LW3A 1MKEA 1OEYJ 3ZTDA 1A5RA 1H8CA 2V1YA 4GIVA 2COAA 4ZYNA 2OQBA 3ZVVA 2REXA 2FIFA 1KM7A 2DYOA 3L10B 3ODOA 3PSEB 2N7DA 2BGFA 3EPYA 3ENEA 2K2UA 4WWNA 1WJNA 2COPA 3SD5A 2CR5A 1X86A 4HAUB 2JPHA 3DVNV 1QC6A 2IYBA 1FB8A 1R4NI 3BJIA 2RNRB 2YT0A 1MAIA 3KRWA 1WX9A 5DH9B 2WWZA 1LFDA 1I35A 4W9FA 3PT2B 1Z5SB 3N7CA 1RAXA 5E6PA 4CHMA 2CB8A 1BAKA 1WGGA 3VH3B 1NTIA 2D07B 1P98A 4DXAB 3M1IB 1UBIA 2PZ1A 2UZSA 5EDSA 2KDEB 2KVRA 2KLGA 2KO3A 3MTNB 3PHWB 2FNJB 2D10A 4CYEA 5LLIA 4ICVA 4MH0E 1WRDB 2DN6A 1I2HA 2I1JA 3ML9A 1WY8A 4MGYE 1YD8U 3OJ4B 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 1WJ1A 2R09A 2FCSA 5JLJB 2X18A 2D9VA 2Y8GA 2K39A 1GC7A 4F7ZA 2KMAA 2RUKB 3PRMB 1UD7A 2I5CA 4K81A 3TO1A 3KRXA 3DOWA 1SGHA 2FCQA 1CMXB 2EC1A 2YS3A 2KHWB 4LCDE 2RLOA 1W1HA 1P1AA 1WMHA 4HAXB 5LXIB 3PPAA 2Z0OA 2KX0A 3UZTA 5JZEB 3DVNU 1V81A 2LRUA 2M4NA 3H7PB 4KZ0A 2WDTB 1U5FA 1Q1OA 4K2PA 5JHGA 3M62B 4MELA 4EZKA 4G11A 2PE6B 4ANXA 3KSYA 2CS4A 4N9F4 3X23A 3V62A 3IVFA 2A5UA 2C7HA 1NU2A 1V5OA 5IJMA 1ZW7A 3TMPB 5DIFB 3MJWA 2MFQA 4ZRIA 1WE6A 3PEGA 4MGZE 1H10A 2KJ6A 3U8ZA 3G9WA 4GOCA 2K8HA 2GBJA 4BOZB 1IPGA 2K2JA 3OANA 2XK5A 2LVPA 2C9WB 3WYFB 5BO4B 5GMVA 2YS5A 3DBSA 1EF5A 4DDGD 5C5BB 4M0WB 1PMSA 1ZC4B 2KWUB 5D2MB 4ASWC 5DI9B 2MX2A 4ZRKA 1XD3B 3R7RA 3L17A 2LZ6A 3AULA 4PYUA 3RD2A 4KDLB 2CKHB 2L8JA 4A3OA 3D8FA 2AYOB 1BTKA 1E5WA 2LASA 3VUXA 1EVHA 4PNKA 4TYZA 2QKLA 2JF5A 1DDWA 2CHXA 4F1SA 2Z59B 4KVGB 4HCNB 3LJUX 2NBVB 3KUCB 2GJYA 1VCBA 4HATB 1ZVRA 2ADZA 4NQLB 2DZIA 4NQKE 2N4FA 5AZGA 4HXDA 3H9DA 1U27A 1WJUA 1WXAA 1YIWA 1ISNA 4DBBA 3Q3FA 4GPTB 2M38A 1E8ZA 3T8MA 2R2QA 3QWMA 5LOPB 4A3PA 2O2VA 4NJ7A 3L0WB 5KHOA 4FULA 2N9EB 4RMAA 3A9JA 2M0XA 3W1YA 2D4QA 3JSVB 5JHAA 3B1LX 3F5RA 3HIZA 4K1RB 4FA6A 2DA0A 1MIZB 2L76A 3H1UA 4NAWA 3WAMA 3GYPA 2KKCA 3NY5A 5FI1A 4K7WA 5CLQB 4W9IA 3IBEA 4F7UP 2QKMA 2EKEC 4HCPB 3QAQA 2DFKA 2MSED 4PS8A 2DAJA 2Z0EB 5L83A 4IG7B 2JP2A 3DPDA 2BCJA 2N0YA 2XEWA 2JZ3B 4IOYX 2PE9A 3ZLZA 3OLMD 3CSFA 2GBKA 1FHXA 3V60A 4MEMA 2KDBA 4WJPA 4KDIC 3AU4A 4FHKA 4AUQC 1DDMA 5IA7A 3DXCA 2A4ZA 1YQBA 3CF6E 3PRPB 3QJZA 2P8VA 2G4DB 2NCNA 3PSCA 1QQGA 4A6FB 2YT1A 3RCPA 2DZMA 4WJQA 4HAVB 2DYBA 4IM3A 2LI5A 3ODXA 2ZPNA 5JH5C 2CQUA 4J6IA 3RCZA 4B9KA 1PLSA 2KTRA 1KZGA 3TFMA 2KFKA 2ZNVB 2CAYA 3SUZA 3ONSA 2L05A 2BPSA 4PYZA 1YJ1A 3K9OB 2UYZB 3U7DA 2MBEA 2K8CA 2KUPA 2YSZA 1GNUA 1P5TA 5HE1A 2IO0B 3W1SA 4FLHA 1TQZA 3U30A 3S2AA 4KAXB 2GOWA 1NBFC 1V5UA 3PS6A 3X0WA 1UNQA 4GDLA 2MW5A 5TR5A 2DHKA 3DBHI 4BKGA 1V49A 2EJ8A 1V5PA 1FAOA 3IG3A 4WSFA 2FDQA 3AJ4A 2LRWA 3TCAA 1SHCA 3ZNZB 2DHJA 2LG1A 4DWFA 5IAAC 1XT9B 4KHOA 2CY4A 2HTHA 1PQSA 4W9DA 4RM8A 4W9GA 2CY5A 1XKEA 1FOEA 3UGBB 2NBWB 1UZXB 1FGZA 2LULA 3WAOA 4II3B 4ZDVA 3GYOA 1NTYA 1WM2A 4CHKA 4TUUA 3ZVRA 2NVUI 4GGQA 5FR6A 4GDKA 2L0FA 1DYNA 1E8YA 4IW0A 1DROA 3EFUA 3ZRCA 2KJHB 2ELAA 1TXDA 2AWTA 5DPRA 2YRYA 2W2XC 3RYTA 3A1QA 3DVGY 2GCLA 4BVUC 4E3CA 2KD0A 2V76A 3CSTA 4HVBA 1WGRA 4JIOU 1UPRA 2DYMA 4RM9A 2QHOA 4I6LB 4DHZB 4W9HA 1W1GA 1NDDA 3PTFC 2PJHA 3V61A 4AJYB 3O96A 2L00B 3KYCD 3L54A 2K1FA 1DDVA 3RZWC 2J0MA 2KQ7A 1P6SA 1ST7A 5LXHA 2JZZA 3I3TB 2UVMA 1ACAA 2P0DA 4EJNA 2LXCA 3KYDD 2D9XA 4F7GA 1NI2A 2K00A 2N7EA 3SV1A 3DQVA 3KUZA 5G55A 1ZM0A 1E8XA 3ODWA 2NPTB 2LBBA 2WX1A 1GC6A 3KZ1A 2DZKA 2KQSA 1DBHA 1TZ1A 1K5GB 4X57B 2JVCA 2W2XD 2Y8FA 1X1FA 2MP2A 3A9KA 3ZUNA 1EUVB 3QC8B 2KC1A 1M7EA 4KIKB 2IFSA 3A4RA 5C23A 1AQCA 1X11A 5CHFA 2G45B 4GU2A 5D3WA 4WWPA 2EMTA 1NTVA 3ULCA 2DX5B 5HE2A 2JXXA 4HPMB 2ZEQA 3QBVB 4PQ0A 2GMIC 3FSSA 3T06A 2JUOA 2R2OA 5C1ZA 4JGHB 1XX0A 2KDIA 1K5DB 2GCJA 2L7RA 1WIAA 1ZGUB 3QARA 4ANVA 2KX3A 1UH6A 1QZEA 2H7EA 2V4LA 3LJ3A 2RSGA 1OMWA 2ZNVC 3R7QA 4HB4B 1FXTB 4Y94A 3PZDA
chains in the Genus database with same CATH superfamily
3D9KA 4I6EA 4IULA 1P3QU 2RD0A 2WNMA 1ELKA 4GYYA 4Q94A 3W2DA 3RULA 3DEOA 4DX7D 4EECA 4NNJB 4F8CB 3DWLG 1LGRA 4MY6A 3J5QB 1OT8A 4DHJB 4EFOA 2R02A 3RRMB 3PV1A 3HXBA 2IEJA 2J08A 2JWUA 4KHAA 1Y8MA 3RSEG 4KT6B 1MHQA 3PVLA 5HE0A 5JXVA 2K3UA 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 3KSLA 2XZDG 4GMJA 4GMLA 3A98B 3FP5A 4IRUA 4OVUA 5EKQD 5EYLA 4W9LA 1FT2A 3D8DA 1PGXA 2ZU6B 5L81A 3ZXVA 4GTOA 2FJ9A 4AXHA 1JQ4A 3CMMB 3FY4A 3NWAA 1XD4A 3E34A 1HF8A 1WJ6A 2MBHA 4URKA 4L7TA 1TR4A 4JC8A 3DSWA 3ULEG 1HE8A 4XI0A 5LCWC 3VIAA 1MI1A 3UF8A 4RG9A 1SJED 3AN1A 3PVUA 2J0KA 2MOWA 3NZSA 4A9AA 2VGEA 4YSXB 3PZ3A 1U29A 3ONLA 2Q5WD 2DENB 3P4PB 3SFYA 4JHKA 2N9PC 3L6AA 4YONA 2J07A 3WANA 5FZSA 3U2SC 1E7UA 1MYOA 3V2OA 4LTUA 3QWWA 2H6HA 1BTNA 3I63C 2P9SG 4K0RA 3ZUVB 3A33B 5FI0A 2BBCA 4AOFA 2YEPB 2KANA 3L22A 3HRDD 2RPQA 2RMMA 4JHJA 3V5WA 1TJ6A 4JVSA 3Q2AC 1P3RA 4EUTA 2HE0A 1L5JA 4JQWC 3BINA 4MJSA 1C79A 2EILE 4GYWA 4LJOB 3TIXA 1ROEA 2JRIB 3VTVA 3AE1B 4GMVA 2ZCCA 2NXPA 3ZYYX 2KFJA 4P16A 3F0WA 1NI1A 4G24A 2Y4TA 3WG7E 5FJYA 3TBLD 3IKOB 4IWPA 1F2RI 2Q7FA 3OAWA 4N6EB 2P0HA 2UWJG 4M00A 3HM3A 3ZKJC 2NR2A 4QJ3B 4AP4C 4MKTA 1DOIA 3QCAA 4FC8A 3TEYA 5T8IA 5BPPA 4C56C 5EX0A 2K49A 1KT0A 4HWIB 4HB3B 1L4DB 3H7SA 1YJJA 4WNFA 2PZIA 1WYWB 2GI9A 3ZYQA 5AIJA 4HOSA 2C7NB 3QWZB 2L6JA 4G8KA 2BYEA 2E6XA 5CRVA 4A6HA 1RZ4A 1TN7A 2LVQA 1MVKA 2XPYA 3PLUA 1M94A 2L9BA 4YDWA 2M0AA 3SY2A 5DIZA 2B3AA 2MBQA 4UWLA 4K7UA 2ROZB 3FDHA 1WGHA 3U7ZA 4MRUA 4ILIA 3ESKA 4AQ7A 3DSUA 3LXFA 2J7QB 1E7PB 3FWVA 5G5HA 1HB8A 3VXWA 4AWJA 3CWIA 3IAS1 4BBNC 4EBAG 4NSWA 1S70B 4OVVA 2ZJDA 4UQXA 5D6JB 5JJ7A 2MQJA 2L2IA 3JXJA 4WWOA 5D3YA 1ZXIA 3MKQA 3VAWA 4XZ4A 4EEWA 4Z2MB 1XLOA 1I7AA 1SQMA 1KTKA 3D9OA 4ILHA 3KQ4A 5FINA 2KWCA 2OEWA 3QA8A 2WXRA 3PLVA 2GROB 3ML8A 2V3PA 1TYQG 2PMVA 3B08A 4A63B 4DPRA 1VZ8A 4LJPB 2EIME 4HHVA 5J3QA 2M17A 2PVOD 3TJPA 3P6AA 3AE3B 3JW0X 2G3QB 1E90A 1TTNA 4IWOA 5ANLA 1KJTA 2AQ2B 3MC0B 3N20C 4K5CA 3BWUD 2CRFA 3MHSD 2INPE 5ENTD 1TY2A 1GB1A 4FJVB 4GTVA 3V05A 3PNTB 4HS2A 5BXUA 2V9HA 1D6EC 1V5TA 2R82A 5DCNA 3G2UA 4BKTA 2PPHA 1ZSQA 3ULBA 2WXGA 1Y8RC 4XKCA 2Z0DB 4MK0A 3SBGA 3NS8A 1V86A 2KUQA 2MH7A 2MBOA 4DQOC 4L6EA 1G3NB 2XGOA 3RO2A 1ZKHA 1WXMA 3A8QA 2MCNB 3LS8A 5E6JA 2X0SA 4HI9A 2BTDA 4CDNA 1D8EA 4E85A 3PGEA 3FH5A 2V3SA 3VQIA 1F0ZA 2VSYA 2IYDB 2WXJA 3ZRFA 2DZJA 4KYOB 2AWIA 3D9JA 1RRPB 2RKKA 4GA1A 1N3HA 1N6ZA 4MDKE 2IU1A 3ZYLA 3FKYA 4N3BA 2ROVA 5E6OA 2COFA 1HA5A 3ASGA 3QIJA 2RGFA 2LYDA 5D3DA 4E74A 4K3CA 2LO6A 1BWNA 5AQ9A 1ACCA 3SI5A 1XXGA 1J19A 1O1RA 3G2WA 3KVFB 3BVMA 1A70A 3C19A 4OW0A 4HROA 2IOLA 3DBHB 3ZXPA 3Q8AA 1K51A 4H2AA 3Q47B 4RGNA 3H6NA 1N0RA 2KNBA 2MWNB 4BBNF 3RFZB 1UJJA 1WMHB 2KZTB 4HOUA 2Z14A 4NPNA 4JX1C 3AG4E 4HRNA 5C16A 3CVXA 5LG4B 2LGXA 2KATA 3DXDA 2PLPA 4GB9A 3EFCA 2P0FA 2FO1E 2DHZA 2FCMA 2CFUA 2KDFB 3DDCB 5ARGA 1T77A 4WH4A 1FCLA 1F9JA 2B0OE 2IY1B 1RLFA 3FEHA 5CEDB 3FM8C 3APCA 1YN5A 1HTQA 2GBRA 2C5LC 1EF1A 4GPKA 5DPWA 3PUJA 2P9UG 2CG3A 1W3BA 4TXPA 5B3SE 2QJLA 4GLSC 3QHTA 4HBDA 3Q69A 5FQ7A 3APDA 5EE1A 2WXHA 1BD8A 5I2MA 2GRMA 3I5JC 4GTMA 2DWQA 4IDIA 3UIPB 3VTYA 2LXMA 4N39A 1XO3A 1JRUA 2I5FA 1NVID 1I4PA 2QMTA 2E3TA 2GGFA 1LQBA 3S7FA 3KSQA 2KK8A 1S1QB 4BWRA 3NJTA 2N23A 1U5DA 3DSTA 1BU9A 2KMCA 5FTPA 1OGWA 1EGXA 5D0OD 3G2VA 3LDZE 2GLSA 3RI7C 1OY3D 2HD5B 4ICUA 2W2WA 2KIGA 2ZGDA 4G50A 1WGUA 1ZUD2 4GSWA 2KC2A 2MWSB 4RNAA 1HXYD 3SHQA 5KJMA 2EQXA 4ANUA 2NBUA 2Z8LA 3AU5A 2RPVA 3IFWB 3HXCA 2O6VA 3CVNA 2BW2A 4ZRJA 3TEWA 1J0WA 2DYNA 4CGVA 2BB6A 3FILA 2I38A 2XK5B 4US8A 3TWRA 5J17A 1OQYA 4GZ6A 3CHOA 2EMSA 3NVVA 3ZW3A 1FXIA 5AENA 1LXDA 4AJWA 4UQZA 4EZJA 3GE8C 4CEMA 2ONDA 3GOEA 2ELBA 2GRQB 1RRBA 3CIRB 3M63B 3RNGC 3CHPA 1FXAA 4J0UA 1SB3C 2YLMA 2MLBA 3TL5A 1I4HA 5FQ6A 3QB2A 2BYVE 2FJUB 2WXPA 1EPUA 2KCLA 1V61A 1JW9D 1TJCA 3CVWA 5FZRA 3BVGA 2D9ZA 2GBMA 2R61A 3KAEA 2D5GA 1I7HA 4GCNA 1CQVA 3QDNA 4KVMA 1IRSA 2DYQA 2G1EA 3Q75A 3UPVA 1JWBD 5AZFA 3HVEB 2B76B 3FU5A 3L08A 4AV7A 3ABVB 4K5AB 4KZCA 3GP7A 4H8SA 2KC7A 5KNGA 2YNQA 5HI7A 3Q3MC 2IO3B 3E9LA 4A20A 3AEFB 1MIXA 2AEHA 5ENSD 2KBXA 3Q78A 4J3OD 2X6JA 1MPHA 3HK0A 1SEBD 1XGWA 3T3NA 5AAOA 4DX8A 1U5EA 2QFCA 1TKEA 3EU9A 1DGJA 3DVGX 3AEBB 2K8EA 2BS2B 3RNBC 1PYWD 3L9TA 2BF8B 4HB2B 3WALA 3CHRA 1OQNA 1Q67A 2VYIA 3CIKA 2RR9A 2XS8A 4L1RA 3KS2A 4EE2A 3MJ5A 4HDOA 3FTZA 3CKCA 2PQNA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 1UW4B 3AJIA 1VZ7A 2YS1A 4MM3A 1V2YA 3UIOB 4W9RA 2OCCE 3UT7A 4HRSA 3DSVA 5DHFB 4LCTA 3O65B 2CHZA 5H92C 1GW6A 4C4VA 1WF9A 4UWHA 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 4GTTA 2ZIRA 2F8XK 2KN4A 1RJ2A 2X3MA 2JU6X 4A55A 2MA9B 2VH1A 3DEPA 1FRRA 3V3XA 4BFRA 1Q5WB 2WXQA 3PREA 2KACA 2CHWA 3FTYA 5CCMA 3A9JB 3H7PA 2N1VA 1A17A 3MGBA 4JEHA 2KTFA 2L83A 4GZ3A 2ZKMX 2KCJA 2D11A 4NQ0A 2NMBA 4N2QA 3NRZA 4WJNA 2Q13A 3AG2E 1LF8A 1OQQA 3N32A 3EHRA 3HIEA 4NAWB 3ZGZA 3SU8X 4YL8A 2DTCA 4G23A 4HK2A 1NI3A 3LY7A 4M02A 3HVZA 3C3RA 3ZNGC 3Q9UC 4PS3A 1VLBA 2LGYA 5IN7A 1L6UA 1JRPA 4XWXA 1GB4A 1QLBB 2WQ7A 3MFGA 5HRYA 2ZPYA 1UGMA 3TG5A 2XGMA 3ABME 4ZFHA 3CHSA 4UI9J 1FHOA 4FADA 1YOVB 3LVRE 5HFYA 3MV2B 3EUVA 4FJZA 2V5QC 3UMVA 1P0RA 4L9PA 2AQ1B 5J3YA 5D94A 4EQFA 2VZKB 1H4RA 4I6NB 5AZHA 3W9FA 4IYPA 2JX5A 4MSMB 2RQ1A 5TSSA 4XKBA 5KQ4A 1IBXA 4ACKA 4JA9A 1UN8A 1FCCC 3C5RA 5D3VA 3PZ2A 5AQAA 5C79A 1K8RB 2PQRA 3TGOA 1SA4A 1J7BA 1WM5A 1YMPA 4BY6A 4TKNA 2JWZA 5DBKA 4M8MA 2JRHA 2LUMA 4Z2NA 3W9GA 3FC4A 2K8BA 1QNFA 4S0RA 1E7VA 4RGTA 3SO8A 4LNKA 4LDTB 4ZRQA 4BSZB 3X2QE 2KLCA 3ZYKA 1KZOA 3C3OA 1J7CA 1AWCB 1WGDA 4HPLB 4CQNA 1MG8A 3KH0A 3Q6BA 5BYSA 3ECIA 5AJDA 3CXBB 3NHEB 1N94A 2RFMA 4I9CA 5LONB 4K2OA 1WE7A 2INCC 2OJRA 4GA2A 1JWUD 1JCRA 4P7IA 1C1YB 2D2QA 1YX5B 1INZA 5KQ1A 3H8HA 4CO7A 5C5BA 1NYRA 2LWPA 4C48B 3V79K 3NVYA 4M0WA 4KHBB 1IHGA 2Z0QA 1MX6A 2L6BA 2IGHA 4TQ1A 3T5VA 1AWEA 3V6CB 1HZ4A 2N1WA 5AQBA 1TS4A 2J53A 2WXOA 3E56A 2PVGC 1K1BA 2LD9A 2BVCA 5KWDA 3SBSA 4B8AA 4DX6D 1T5XD 2VGXA 2OVFA 3N30A 2UY1B 4GMXB 3GZNB 4JWSC 2K6QA 4XGAB 3BQOA 4DIXA 1P9DU 1UF0A 3N3KB 4LNNA 2RVBB 5L95C 3UT8A 3EDTB 3TW1A 1YN3A 2I2YA 2VJ8A 1UOHA 2KTRB 2DKPA 2X38A 1VJKA 1AW7A 1L2NA 1FGYA 2KFKB 5FIOA 3FAHA 4JWUC 3SDLC 3NB2A 1V5MA 3ESLA 2G35A 1WJ4A 2O6VB 2COCA 4LEUA 4MT7A 5H8YE 2Z59A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 2WMOA 4H7YA 1CK1A 1L5PA 2NBVA 5CLLB 1MHHE 5T4YA 1OY2A 1HBKA 3HYMB 5G04J 4F7HA 3A4SC 3LB8C 2KOXA 4WIPA 3CVUA 1E6EB 3UM1A 1SA5A 2JLBA 1KOTA 3QOUA 2Y69E 4CDMA 1Q2ZA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 4F7AA 1C78A 3Q5MA 4ZHOA 2LMCA 5CEAA 3IV0A 3P1UA 2W9NA 3KLSX 4IM2A 4G0NB 2KWVB 3J9CA 1LO5D 4HQDA 5D3XA 2MJ3A 3TVVA 1WGKA 3PG7A 5D27A 2H89B 1XODA 1NENB 3TUOA 4I2ZA 1QT9A 2DHIA 3LY8A 1TJEA 4BKSA 3D9HA 1JCKB 4GDLB 2WXKA 4XI9A 3UM0A 4ACLA 4DDID 2EIKE 3BYYB 2BWFA 3AI5A 3VOQA 3MZLB 2MRPA 2IBIB 4K5BA 5CHEE 1U2BA 1M7RA 2IPKD 2ONQA 5DPTA 4HAWB 3SGHA 1S3SG 1WFYA 5CMYA 5CCLA 1C3TA 1DOXA 4IC7B 4XDCA 1G6JA 3C0RB 1U3DA 3JSVA 2OHFA 2DYSE 4UWFA 5C3JB 4JKHA 4LNUD 1C77A 4AIFA 1WGYA 4PS7A 3LEWA 3ZNHB 4U8HA 1S64A 4I43A 3E32A 3DSSA 2CODA 3UI3A 5IKCM 1QOBA 1KLVA 1H2VC 3SNHA 2LOXA 1P7FA 2ZVNA 1UWMA 2BF0X 5C2TB 2KXJA 4XC2A 1YA0A 2HTHB 2WGSA 4GXBA 2ON8A 2D9YA 4CGWA 1L6VA 2L0TA 4ATGA 3Q7AA 2WXFA 1E9MA 2QYUA 3FUJA 4KV2A 1EWYC 4JK9A 3FLVA 4B95A 4WQMA 4LERA 3VLDA 4US9A 4BOSC 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 3D3MA 5BW8C 4A1GA 1OXJA 4O6FA 1GG3A 4AM9A 1STEA 4M01A 4GDKB 2WXIA 2OEDA 2WDRB 1EU3A 4Q2JA 2ZCBA 4JE3B 2L1CA 4RG6A 1CJEA 4UDUC 1WZ3A 5CBNA 2K25A 1U4AA 3HUIA 4II2B 1V6EA 4JB8P 4FBJB 2MBBB 3U12A 2UZRA 1IKND 4B6HA 4F53A 4C7ZA 2FJLA 5FT9A 1L0XB 3MPXA 4B0ZA 1KFYB 2YQ8A 2R0DA 4WJOA 1RFAA 3A1QB 3D9NA 3QNKA 5E75A 2KN5A 2PM6A 5AJLA 2IO3C 4IM0A 3KEZA 1UNRA 2J42A 4TQ0A 4EKUA 3NWDA 1TS2A 4RSYA 3KWLA 4GZUA 3JCKC 2LGDA 2MKRA 2LAIA 2WXMA 1NEKB 4B0EA 1X1MA 4D2KA 4J8YA 3VUYA 4XEIG 4A6FA 2FAZA 3E9OA 5A7DB 5CECB 5J3TA 3DBLI 4HJGE 2CJOA 1H2UA 3ZN3A 1H0AA 1XQQA 5M4YB 2UU7A 2K5PA 3NVWA 1KZ7A 1EO6A 1V1PA 3WIMA 5DHAB 1WX7A 1FD6A 1X5BA 3ENBA 4JKBA 3I57A 3ULQA 2KR0A 2VQ2A 4DX1A 3SFDB 1IP9A 1N4SA 2I6HA 3AE8B 3FTXA 3HM6X 4XE0A 3E4BA 2MDXA 4NY0A 4JL9A 2ETAA 2HM8A 5ENNA 3UIOC 4DI3A 1X1GA 4A8XC 1F1HA 2D9WA 2AL3A 2ZZPB 3R8BA 4WNDA 1TNZA 4GN1A 1HG2A 2WX0A 2GW1A 3U64A 2C0MA 2LVOA 3E9SA 2QYJA 3L4PA 1Q0WB 4XWWA 3VUWA 5EIDA 1MZCA 4A5KA 3ZFWA 3BG1B 3ML4A 5G2NA 4TXRA 2WQHA 3P4RB 4FJYA 4S17A 2MJDA 5G05J 1UUPA 1WDYA 3BG0B 2PEAA 3FTWA 3GE3C 1JPLA 2LXLA 3VVWB 2R59A 4XX5A 2NZ8B 4JLCA 3JQ0A 4B93B 1XCGA 3L16A 3WCQA 2OOBB 2P58C 1WI0A 3I4RB 4DBGA 4HOQA 2YF0A 3VDZA 1FFVA 5B1BE 4LSZE 5CX3A 2V0PA 1MX4A 4C7YA 1D5XC 4MSQB 4OZCA 3JYSA 4GYOA 3Q79A 4CT4A 2C60A 1MK9B 1WJMA 1UELA 1EWCA 1UBQA 1OWPA 2MP2B 3A9KB 3RUIB 3FUEA 4DX90 3VTUA 2GB1A 3N71A 1WX8A 3KY9A 2RG8A 3UM3A 4B6WA 3LPZA 2ETBA 5BMGA 4ZRPA 2WS3B 3HXEA 4V3IA 1BT0A 3ULYA 1MG4A 2ASQA 3HVDA 2LUEA 2AJAA 1U5GA 3BEEA 5KCMA 1L0YB 1NYQA 1TGZB 3JYUA 3ZJTA 4JK7A 2M14A 2BYTA 1P5QA 2BWES 5ENRD 4LNIA 4NZLB 4I1MA 3P63A 4RGMA 3NZUA 2GS0A 3Q49B 4EPZA 1U3CA 3P4QB 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 1BI8B 3HW2B 3NSUA 4U8VD 4HJKA 4ITKA 1RYJA 2ABDA 3NOCD 4Q96A 4A6KA 2V3NA 2BTEA 3SYXA 2DKQA 2MRIA 3LDZA 3GS2A 3O4ZA 2HRJA 3UQAA 3SFZA 4GMRA 4DLOA 3EGRA 3AEGB 2PTLA 1WR1A 5CTRC 4O1OA 3DHHC 4RF0A 4IWQA 3VRBB 2BKFA 2ZW1A 2K6DB 3ZQ4A 4EZLA 3PVWA 4FLBA 1HG5A 3DWGC 1B1ZA 3IHPC 1AARA 3EHNA 4N5CA 1WWTA 2QC9A 2VKIA 1E10A 2DLWA 1QILA 2BKGA 4J8FA 4APOA 2VSZA 1HH8A 2E2XA 2UWQA 1PFJA 2FCNA 2M63A 2NC9A 3PH0C 4DK5A 5J18A 5HKHA 1JUQA 5E76A 4DI4A 2VSXE 2Y4UA 3JUIA 2WB2A 2XZTG 3HHMA 4WNGA 4ILGA 3ZKJA 4MGKE 2ZVOA 4D10C 1V54E 1ELRA 3MDBC 2XNAC 2OV8A 2I1KA 4ANWA 4TSSA 3TWSA 4TV3A 3T3OA 5BV1A 1SBBB 1H6KA 3TXMA 3U4TA 1K3ZD 3E33A 4YVOA 3VR9B 3HSAA 2FO7A 1N4PA 4HAYB 4WJ7A 4WAAA 4PH4B 1V89A 1Z3YA 3BK1A 4K3BA 3B77A 1ZE3D 4OYSA 3AS4A 2RGNB 1HTOA 4KSLC 5HE3A 4BSXA 2W3SA 2VZKD 2KQ4X 4BTAA 1V80A 2RDBC 3CK9A 3AXCA 5EFXA 4W9JA 4I6PA 4F3VA 1H19A 3WXXA 2P9IG 1N61A 1PGAA 3TWUA 1E8WA 3R2IA 1W1DA 4HB0B 3LJNA 3W1SC 2J59M 3OG5A 4JKGA 3HRAA 3RNEC 2IGGA 1Y5OA 3Q4AB 2FEZA 3AE9B 4LNOA 2KIEA 2IGDA 3MC8A 1HO8A 2NSZA 1MK7B 1PAQA 4LDTD 2AXZA 4U0SA 3AMZA 3SHFA 3ABLE 3KEAA 4CSQA 3M3JA 1D9SA 4G3XB 4TUMA 5I2SA 1FPPA 4E71A 1PUTA 3T9LA 3SBTA 5BMIA 1KPSB 5AARA 4N3AA 2INNE 2HE7A 3AS5A 1MFWA 4QFVA 3KUDB 5ARFA 3UQBA 3DBRI 3ETRA 3ZYMA 3HXFA 1DCEA 1N5WA 3BU8A 1OEYA 3FFLA 3G2SA 3SO6A 3VH4B 2IFUA 4HLLA 1V88A 1PGBA 4ARIA 2IJGX 1Z2MA 4HAZB 3B7SA 1YJIA 4WURA 4CYMD 1F2RC 5C6RA 2NPTA 3B0AA 3P1MA 2XPIA 4F1PA 1LB1A 4HB5A 4FN2A 2Z0PA 1WXVA 3TWXA 2IZVB 3SZ7A 4RGOS 2LXAA 1TIFA 1O1SA 5AQ7A 1TBEA 4BT9A 1UPQA 2EELA 3JUEA 3DHIC 1WG7A 2N9XA 3NG0A 4JKEA 5AEKB 2P2CP 4JA7A 1K8KG 2XQ0A 3RT3B 1GJZA 1K50A 1X05A 5LOZA 4KX6B 4JHRA 5EE0A 2FUHB 4W9CA 3CQCB 4M3OA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 1N52A 4KSKC 3PP2A 3N1XC 3RPFC 3P7ZA 1SIFA 3ZHEA 1XR0B 3HQCA 2QCZA 3NQPA 4FHJA 2JZPA 3BYTB 2KJRA 3URYA 3OHMB 1L7YA 3PHXB 1TNBA 2EIJE 3KW5B 4K7SA 3ZIMA 4EMOA 3ZDMC 4L2LA 2X6KA 4MGIE 5EE3A 5HG2A 4HOTA 3L13A 1ENFA 1H6OA 3R3MA 5LCWJ 4APFA 2Y5CA 1N4RA 4C80A 3UINB 3T9KA 3RNCC 3TAXA 4HLEA 4C0EA 2JYEA 3MKRA 2OEVA 2DX5A 4U07A 2DX1A 1SF0A 5KHQA 3Q8CA 5C2YA 3GW4A 2HJ8A 1TKGA 4BBKA 4JPSA 1WM3A 5CHWA 3ZO5B 3WA0A 2M8SA 4F6RD 4JEUA 5KCVA 3DRAA 2JT4B 1Q10A 1RW2A 1FRDA 1WH3A 5FR3A 4RFBA 1NVLA 5D7GA 1HB6A 1RM6C 2LHDA 4LG6A 4HORA 3P2BA 1JWSD 1ZDXA 2JY6A 5E6NA 4DHZE 1XCQL 4Y6WA 2VRWB 4LLGM 1FVFA 1WZ0A 2C7MB 1VD2A 2J4XA 1OWLA 2G4SA 3QK0A 3LYAA 4L2YA 3RNAC 4LNGA 1SE9A 3ZDTA 2X6HA 3Q3OC 2VTBA 3R9MA 2BKRB 4K17A 2SEBD 4QJ5B 1B55A 3NAWA 1WXSA 2BYFA 2W3RA 3OJ3A 3P4SB 4WQOB 3BK2A 5JP4A 2KMMA 3VLEA 4HDQA 1D3ZA 3SQVA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 2I9CA 3ALBA 3EECA 5BMHA 5KJKA 1EAZA 1BXTA 2LHEA 1I42A 4FU3A 2WYQA 1ZPSA 3JVZX 1J8CA 2NS5A 4LK0M 1JDEA 1LTXA 2HO1A 3CVLA 3MKQB 4MBGA 3A8PA 1EU4A 1JWGA 2XQNM 1Y19B 2J8SD 4ILHB 2Y7BA 2LJ5A 5BYRA 3RZFA 4BZAA 3CGHA 3URZA 3EHVA 1I4GA 2YVCA 1KH0A 3MC9A 3R66C 5FZQA 1NA3A 1IYFA 1DCQA 1YNTE 3ABKE 2LOZA 3QQ8B 1N62A 2KZRA 4M8NA 3OXLA 1Z6TA 1CZPA 5C1DA 2IO1B 4XIFA 1WR6E 2G9HD 5ENQD 1N95A 3FUHA 1KT1A 1Z87A 4IAPA 4NJ6A 4TXQA 1J7AA 3K9PB 2Z4DA 1IYGA 1UNPA 5HKPA 3D8EA 3WAPA 4GZ5A 3RIBA 2CU1A 2DZNA 4E6HA 3DCXA 4GNKB 5GOWB 4CCAA 3AE4B 1V9JA 2XCBA 3PRZA 2FIDA 5EILA 5J90A 5AN8A 4J8DA 4MH8A 4K03A 3B2FA 3RN9C 3PZ7A 1JWFA 3QWPA 1E0ZA 1WVHA 4YTMB 4MACA 1YX6B 2YINA 4KXKB 4OT1A 4HFGA 2H7DA 2CU3A 5JHBA 1SE4A 1R7SA 4NRHB 4LNFA 4O60A 3G2TA 2K9XA 4N59A 2ILRA 1TS5A 3MHZA 3ZU7B 2LUHA 2AL6A 3Q15A 4BEPA 1N9AA 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3TEXA 3ASFA 3ZTCA 3BY4B 4NJCA 2IO2B 3CR3A 3HG0D 5CHVC 2YEPF 5IY5E 1N0QA 1LW3A 1XEEA 1QBQA 1MKEA 1OEYJ 4DX5D 3ZTDA 1A5RA 1H8CA 1OWNA 5CBOA 1HZ5A 2QEJC 2WLBA 2V1YA 3AEAB 3TXNA 2BT6A 3AM9A 4GIVA 5LNK1 2COAA 4ZYNA 3ZVVA 2OQBA 3C8YA 2REXA 1DVPA 2FIFA 3AS8A 1KM7A 2JQRB 2H6IA 2DYOA 3L10B 3ODOA 3PSEB 1SE2A 2N7DA 2DIWA 2KM4A 4GTRA 5KJLA 4N2SA 2BGFA 3EPYA 2E0IA 3ENEA 4B89A 3FUFA 3UKRG 2JSVX 3OXGA 1UN9A 2R17C 4U04A 4WWNA 2K2UA 1JCSA 3CVPA 1WJNA 3O13A 2COPA 3W5UB 3SD5A 4YWGG 2K0PA 2CR5A 5A23A 3CK8A 3QWVA 1X86A 4NURA 2D3BA 1FFUA 2R2LA 3C98A 1D4BA 4HAUB 2JPHA 1ELWA 3DVNV 1R4MB 1QC6A 2IYBA 4D6WA 1FB8A 1R4NI 2AQ3B 1ET9A 4C00A 1LD7A 2XS1A 4UWGA 4DRXE 3NUHB 3BJIA 4R3DA 1M4VA 1QOAA 4KKJA 4I17A 4G1TA 4IN3B 3LY9A 4L1BA 4JL0A 2BEDA 2RNRB 2YT0A 1MAIA 4HEA1 1FMAD 1YQ4B 3KRWA 1WX9A 5DH9B 1FNWA 2X8XX 4GTSA 3UQ3A 2WQ6A 2WWZA 3EUB2 1LFDA 2L0IA 1I35A 1K52A 3SFXA 4W9FA 3B2GA 3SFEB 3PT2B 1Z5SB 3UI2A 3N7CA 5I4DA 1RAXA 5E6PA 4CHMA 2CB8A 3ZNGA 3D9IA 1OCOE 1BAKA 2RRFA 1WGGA 3VH3B 3SF4A 1NTIA 5CMWA 2AXUA 3OTNA 4OAUC 2D07B 3BVZA 3U3WA 2LNIA 1TEZA 1BI7B 1P98A 3FILB 5HI1A 4G25A 1WSPA 2R5SA 4DXAB 3IT4B 4I6GA 2YHEA 3M1IB 1UBIA 3FP3A 5H7PA 2PZ1A 2PIAA 3DHGC 3P42A 3UT4A 2LGIA 3RJVA 2WU5B 2UZSA 5EDSA 2KDEB 4HRMB 3R2TA 2KVRA 2KLGA 2KO3A 2VSNA 5JVLA 2MYOA 2X6IA 4RCOA 3MTNB 2A5EA 4U95D 3DBLB 3PHWB 2FNJB 3Q8BA 4RH6A 2DWZA 3KD7A 2FUG1 1NL4A 4YSYB 3BIID 2D10A 4A90A 4CYEA 5LLIA 1C4CA 3QC1A 4YSZB 5BUZA 4ICVA 4MH0E 1C4AA 4YDOA 3DSXA 1MQSA 5FQ8A 1WRDB 2KWDA 2DN6A 1I2HA 2I1JA 2CG2A 3ML9A 4GAAA 1WY8A 4MGYE 4ACFA 1B89A 3NW8A 3F6QA 1YD8U 4UQYA 3OJ4B 1OQRA 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 2J09A 5JA4D 4USAA 1N11A 3ZXSA 3ZXRA 1WJ1A 2R09A 3LCAA 2FCSA 1TN8A 2V5FA 1Y56A 3S7BA 3OXFA 2OJWA 3DWMA 5JLJB 4I2WA 1I4QA 1FNVA 2X18A 1U2VG 2D9VA 4RQIA 3UTMA 2Y8GA 2FBWB 4XYCA 2K39A 1GC7A 3EHQA 2C0LA 3N1ZC 4F7ZA 2V4IB 4BTBA 4G2VA 2KMAA 2RUKB 3PRMB 3UX4A 2MJEA 5BNWA 1KC7A 1KZPA 2EKIA 4ABNA 2PM7A 4KGRA 1UD7A 2NYJA 2I5CA 1KF6B 1KLXA 3FHEA 4DX2A 1IGCA 4LRZA 4K81A 3TO1A 4YTNB 3KRXA 3DOWA 1SGHA 2FCQA 4YT0B 4G26A 4MM3B 5J08A 5D3IB 4ATZD 2EC1A 5KJNA 2YS3A 1CMXB 1EDUA 2KHWB 4LCDE 1QF6A 4HPPA 4WWMA 1QOGA 2RLOA 1WXQA 1W1HA 1P1AA 2K22A 3A58A 4C4VB 5JJTA 4HAXB 2KZTA 1WMHA 5LXIB 3UXGA 3PPAA 3ZEFA 1YMHE 2DYRE 2Z0OA 3FU0A 2RFAA 3ASNE 3UINC 3UZTA 2KX0A 2Y0BG 5A6CA 5JZEB 3PE4A 2L1AA 3BZDB 3DVNU 3FULA 1V81A 1C76A 2LRUA 4KGSA 2M4NA 3H7PB 3JQ1A 3CIAA 4KZ0A 3AE7B 3TSSA 2WDTB 1DOYA 1U5FA 4A3VA 1Q1OA 1TJFA 3FH7A 1SJHD 2QILA 2WU2B 3FU3A 4I1OB 5BXOA 4EZKA 4K2PA 5JHGA 3M62B 4MELA 4R7LA 4L23A 4DUIA 4NIKA 5KNHD 3OWEB 1BPOA 1IGDA 5EE9A 4ILJA 4G11A 4HRLA 2J9QA 2PE6B 1PC2A 3MCXA 4ANXA 3KSYA 1V97A 2CS4A 4N9F4 3PNLB 4CDRA 4G8LA 3SEBA 3X23A 2Y5PA 3V62A 3KWVA 3FUIA 4JD2G 1TZOA 3IVFA 2V4HC 3TWVA 1TT5B 3ZJVA 2AX5A 4GTPA 4MT5A 2A5UA 2B6CA 2C7HA 3GB1A 2WPVA 1NU2A 3E66A 2GRLA 2W54A 3TEZA 4N5QA 1V5OA 5IJMA 2IY0C 3TWTA 1A5EA 1K53A 1ZW7A 3TMPB 1IBXB 1T0QC 3Q8FA 3MV3B 4M7CA 3MJWA 5DIFB 2MFQA 4ZHBA 4ZRIA 1WE6A 3PEGA 1ZOYB 4MGZE 1O5MA 2VSOE 1HZ6A 1N4QA 3Q7FA 3Q9NC 1H10A 1UGJA 1KRHA 2KJ6A 4BESA 3AH7A 3U8ZA 3G9WA 5G5GA 5HS0A 4GOCA 2K8HA 2H6FA 2GBJA 4AP2A 4BOZB 1WAO1 4DJAA 1HEZE 2LGSA 2JXTA 3VR8B 3RRUA 1NFIE 3FTSA 2J49A 1IPGA 3B13A 4RF1A 1VZ6A 1IXVA 2K2JA 3OANA 2ACZB 3CVQA 2LJIA 2XK5A 1FCHA 2L32A 5IOIA 2LVPA 5FK9C 2C9WB 3WYFB 5BO4B 3CVYA 5GMVA 2J52A 2YS5A 3DBSA 3Q3NC 3T8KA 1EF5A 2IJ0A 4DDGD 5C5BB 4HSIA 4GTQA 1FM0D 1XCTL 4M0WB 1PMSA 1ZC4B 3MP9A 1X81A 2KWUB 3CK7A 5D2MB 3NWFA 3T5XA 3UM2A 3EIJA 1KLGD 3PZ8A 5D0QD 3FEYA 5LP0A 3I4GA 3K9IA 2MHJA 4ASWC 5DI9B 2MX2A 2J4DA 4ZRKA 4OZBA 4BERA 1XD3B 1OCZE 3L17A 3R7RA 4PT5A 5IO9A 2LZ6A 3AULA 2VGXB 4PYUA 3RD2A 2P9NG 4KDLB 2CKHB 2L8JA 2BS3B 4A3OA 2LFIA 1D8DA 1VBHA 3D8FA 3VRAB 2Y1LE 2AYOB 4XDDA 1BTKA 3AAAC 4KMOA 1E5WA 3HVEA 1N54A 2LASA 4CT0A 2BUGA 3VUXA 1EVHA 3DBRB 1UWXA 4PNKA 1FO4A 2IO2C 5BV0A 4TYZA 2QKLA 2JF5A 2CHXA 4F1SA 1DDWA 4P6VF 3ZJUA 3B9JA 1QZ2A 1Y6IA 2Z59B 4BT8A 4KVGB 2NTSA 4B8CB 3U66A 2N9LA 2KDMA 4HCNB 3LJUX 1JMLA 4JKDA 2P9LG 2NBVB 3KUCB 4JKFA 2GJYA 1VCBA 2X6FA 3AEEB 3TG4A 5JJ6A 1IQUA 1ZVRA 2ADZA 4HATB 4NQLB 2DZIA 3HXDA 4NQKE 1HFAA 1RFKA 1Z3XA 2VGYA 2XENA 2N4FA 5AZGA 2F0YA 2MHKA 4ZYSA 1E96B 4HXDA 3H9DA 3CV0A 2DNFA 1U27A 3FUKA 1WJUA 1WXAA 1YIWA 1EF1C 4UI9C 1ISNA 3I9V1 1S63A 3D9PA 2XN9C 4A6QA 2NMQA 4DBBA 3Q3FA 1OWOA 4GPTB 2M38A 1E8ZA 1GGOA 3NZ3A 3ISMC 1NA0A 5CERB 5FKAC 3EHMA 3FVCA 2XEVA 1KBLA 1HXIA 4YXDB 3GZ1A 3T8MA 2VH2A 2R2QA 3QWMA 5EIBE 2F37A 5LOPB 4A3PA 2O2VA 4YNDA 4NJ7A 2ZXWE 3L0WB 4N3CA 1S0PA 1ZB1A 5MPOA 5KHOA 4AVXA 4FULA 2FE8A 1TNYA 2N9EB 3A9JA 4KKIA 2M0XA 4RMAA 3W1YA 4GA0A 2D4QA 4LNBA 5JHAA 2RDGA 3JSVB 2XRYA 3B1LX 4JZYA 3F5RA 3HIZA 1NZNA 3CKBA 4FA6A 2DA0A 1ESFA 4K1RB 4OZAA 1MIZB 4C0MA 1VDVA 5CRUA 1L4ZB 5JMND 2HYZA 2L76A 3H1UA 4NAWA 3WAMA 3GYPA 1Z5SC 2KAJA 3ZRHA 2KKCA 3DXMG 3NY5A 1BMLC 5FI1A 2DLBA 4K7WA 5CLQB 2XEEA 2GRPB 4W9IA 5IRSA 2GRRB 3IBEA 3PZ1A 2IQCA 4F7UP 1HX8A 2QKMA 2XPZA 5BT1A 3CVVA 1D5MC 4PUCA 2L0TB 2EKEC 3PDNA 3PE3A 4HCPB 1H2TC 3QAQA 2DFKA 3ASOE 1FEHA 2MSED 1T0SC 5EYPF 3S7DA 3IT6B 1TNOA 4X8QA 2M19A 1XNFA 4PS8A 1T6BX 2DAJA 4J8EA 2Z0EB 4YVQC 4YDYA 4YTPB 3W5VB 5L83A 2N0SB 4UUCA 3AE2B 2JEKA 1TS3A 4AEZC 4IG7B 1YCSB 1FPYA 1PY1A 4HKQA 4UWKA 2JP2A 5KBAA 2EINE 3DPDA 2QC8A 3AB5A 2W82A 3U52E 3U4EG 2BCJA 3EJNA 3LXUX 2N0YA 2XEWA 2JZ3B 4IOYX 2ICIA 2PE9A 5FWQA 2AVPA 2ETCA 4GPMA 5ITZF 3ZLZA 3E9PA 4H7XA 3OLMD 1AWDA 4KBQA 5T3RA 3CSFA 2BQQA 2GBKA 1FHXA 3GZSA 4U0ZA 4OAVB 1KLUD 3LYYA 2DBAA 3C3QA 4MEMA 3V60A 2KDBA 4WJPA 5ANRA 5HQ8A 4ME2A 2D3CA 4KDIC 3AU4A 4FHKA 3FEXA 4AUQC 5G04C 1LD8A 1DDMA 1T3QA 5IA7A 2A4ZA 3DXCA 4U8YD 2IONA 3RMKC 2R2YA 1YQBA 2AW6A 2WDVB 3CF6E 3PRPB 3QJZA 2XCCA 3MEKA 4WAFA 3R9AB 4KHBA 4KVOA 2P8VA 2G4DB 1AYFA 2NCNA 5FQ4A 1D5ZC 3B7RL 3NOGD 4Y6CA 3PSCA 2PKOA 4RVBA 2IDYA 2SAKA 1QQGA 4A6FB 4P1BC 2YT1A 3LVQE 3RCPA 2DZMA 4WJQA 4HAVB 2DYBA 5GXGB 4AY5A 3UUXA 4IM3A 1V8CA 2LI5A 3ODXA 1VR9A 2ZPNA 3Q14C 5JH5C 1V1PB 2UY1A 2CQUA 4J6IA 1OCCE 3RCZA 2YHCA 4B9KA 2Y3AA 3FH8A 1ZYIA 1PLSA 3N9YC 3AG1E 4FP7A 2KTRA 3IXEA 3AECB 1KZGA 3TFMA 3B7TA 2KFKA 2ZNVB 3IAM1 2XGSA 2CAYA 3J5PA 3SUZA 1NP7A 2OVBA 3ONSA 2I2OA 2DIKA 2L05A 2R05A 1TKYA 3FU6A 2BPSA 4PYZA 4UI9K 2HR2A 2WXNA 1UG3A 1YJ1A 3K9OB 4XWTA 2UYZB 4IOIE 3U7DA 2MBEA 2K8CA 3RKVA 2KUPA 2DZOA 3C72A 3RO3A 2YSZA 4ARCA 1GNUA 1P5TA 2WQYB 5HE1A 1JWMD 4IKGA 1MHXA 2IO0B 3W1SA 1I4RA 4ZHPA 1AP7A 1XLPA 3CHMA 1HS6A 4FLHA 1TQZA 3U30A 1MX2A 2YT2A 3S2AA 4QAYA 1N60A 4KAXB 3ONKA 2GOWA 1B9RA 2ZISA 1NBFC 4U0UA 1V5UA 4AY6A 5LX8A 2BB5A 4CZ2D 4Z68A 4JW1A 3PS6A 1VBGA 5AYWD 3VTXA 3ZPJA 3B7UX 4MLPA 2OOEA 3B7BA 2N7JA 4U7EB 1VRAB 3CQGB 3X0WA 1UNQA 4GDLA 3L82A 4BETA 2MW5A 1P7EA 5TR5A 3DPYA 3I5PA 3EA6A 2HTME 2DHKA 3DBHI 4HXIA 3RNFC 4BKGA 1V49A 2EJ8A 1V5PA 1QYMA 2IOSA 1SVXA 1SW6A 2C2LA 1XLNA 1FAOA 4PDXA 3D9LA 2KYWA 4WSFA 3IG3A 2FDQA 3AJ4A 1OCRE 2LRWA 3TCAA 1SHCA 1TYGB 1R4NB 4LUNU 1AN8A 2FF4A 3RK6A 1F77A 1MPEA 1XF5L 2DHJA 2LG1A 2XHEA 1YN4A 4FXCA 3ZNZB 3BUAA 3HDXA 4DWFA 5IAAC 1V55E 2FI7A 1V1OA 2WHIA 3NVZA 4CRWA 3EU5A 1XT9B 1MI0A 3IEGA 2LSUA 3E30A 4KHOA 2CY4A 3IHVA 2HTHA 1PQSA 4W9DA 1O1TA 2D3AA 4RM8A 4W9GA 4I6JA 2CY5A 4B94A 1FOEA 1XKEA 3UGBB 1OUVA 4DLQA 3PO0A 1JROA 2NBWB 2V0GA 1UZXB 3FTVA 1FNUA 1FGZA 2WDQB 4U96D 2LULA 1L0VB 3WAOA 4II3B 4ZDVA 3GYOA 3D9MA 1NTYA 1WM2A 4CHKA 1DNPA 4TUUA 3SR6A 5D2MC 3TWQA 3ZVRA 5AUKA 3PEUB 1BLXB 2R03A 2NVUI 4GGQA 3W9CB 5FR6A 2DVWA 4GDKA 3RAUA 2L0FA 2XEHA 4A1SA 1DYNA 3NS1A 2P9KG 3AG3E 3IHYA 1E8YA 2QY7A 2WXLA 1IHBA 4HI8A 4RLYA 4IW0A 4ILGB 2P9PG 1DROA 3EFUA 1GOZA 3ZRCA 2MEKA 3GZ2A 1IUEA 3FUMA 2JYTA 2ELAA 4GCOA 1TXDA 2AWTA 2KJHB 5DPRA 5BYQA 1N63A 4JKAA 3QKYA 2YRYA 4REZA 4MS6A 4EBAA 4TMAB 4P1CC 2W2XC 3RYTA 1UJKA 4BX9A 1C4PA 3A1QA 3DVGY 1EM7A 2GCLA 4BVUC 2GUMA 5G05C 2INDC 4A3TA 4BX8A 1DC2A 4E3CA 1YQ3B 2KD0A 3FUDA 3FUNA 1WY6A 2V76A 1EYHA 1FIQA 3CSTA 4J7WA 1VDYA 2ZGGA 4QQIA 1ZP0B 2RDHA 4HVBA 2PW9A 1WGRA 4JIOU 2IF4A 4B0MA 1FVHA 2J4BA 2H6GA 4J8SA 1UPRA 4JK8A 4WUYA 2DYMA 4KGTA 4RM9A 2CJNA 4JKGB 1DYQA 2QHOA 4I6LB 1C9FA 4DHZB 1HU3A 1QQEA 4EHMA 4QJ4B 4W9HA 1XLQA 1W1GA 1NDDA 3PTFC 2PJHA 3V61A 1T0RC 1SZAA 1F52A 2V8SE 4AJYB 2WVIA 4Q69A 1GAQB 5B1AE 3O96A 2L00B 1JWAD 3TWWA 3L54A 3KYCD 2K1FA 1DDVA 3RZWC 2J0MA 3SBTB 3NF1A 2KT7A 4OVZA 3RRNB 2QIEB 1QOFA 2KQ7A 1H6PA 1P6SA 1ST7A 3PEVB 3V30A 3MX3A 5LXHA 2LEKA 2JZZA 4I1AA 3I3TB 5IP4D 4AS1A 2UVMA 4OSNA 1ACAA 2P0DA 4EJNA 2LXCA 3KYDD 2D9XA 4DXGA 4O1NA 4F7GA 1UNSA 5HHDG 2M56B 1NI2A 2K00A 3MYVA 2N7EA 3E37A 2BKKB 3EIQC 1QKZA 2QSDA 3SV1A 3DQVA 3KUZA 5G55A 1ZM0A 1E8XA 3S7JA 3ODWA 2NPTB 2W55A 5LFAA 2LBBA 1SZ9A 2WX1A 3U9WA 1JALA 4P29A 2H88B 1GC6A 3KZ1A 2DZKA 1MJ0A 3AE5B 2KQSA 1DBHA 2F8YA 1TZ1A 3FTUA 1K5GB 2KXPC 2FULA 3B95A 2KCKA 1WG0A 2N9KA 3NBNB 5ENPD 3V2XA 4X57B 3MA5A 2JVCA 1FT1A 2HDEA 4N58A 3O48A 1MJDA 1IQRA 2PL2A 3GYZA 2W2XD 2Y8FA 5EX3A 1X1FA 2MP2A 3A9KA 4GU5A 3ZUNA 1JCQA 3SNXA 1EUVB 2Z13A 4C9BB 3CEQA 2WMNA 1SSNA 1N5XA 2KC1A 3QC8B 3PUKA 2TSSA 1M7EA 4KIKB 1WYGA 4DXFA 1SIJA 2L52A 3ZHEB 3AEDB 2GRIA 2IFSA 3A4RA 5C23A 1TN6A 4I9EA 1AQCA 2AXVA 2DCPA 1X11A 5CHFA 1OWMA 4TRQA 2G45B 4O1PA 4GU2A 1PDXA 5D3WA 1RWSA 2CFZA 3PZ4A 4WWPA 3ZGQA 1QQRA 5AUIA 2EMTA 1NTVA 3ULCA 2DX5B 2KVZA 5HE2A 1TY0A 2JXXA 4HPMB 4HKZE 2XRZA 4GZCA 2ZEQA 3QBVB 5M72A 4GZDA 4PQ0A 3DXKG 3ASHA 3VLFA 2GMIC 2HJ1A 2QDFA 1I4XA 3Q8EA 3FSSA 3T06A 1SE3A 3I3NA 2GRNB 1ET6A 4QXAB 2LSVA 2E2EA 3JXIA 2DBYA 2JUOA 3CHQA 4ZOHC 2R2OA 5C1ZA 4JGHB 1XX0A 3CLJA 2KDIA 1K5DB 1ZU2A 2GCJA 4BAXA 2LAHA 2L7RA 1YYHA 2KCVA 2ZW0A 3UIPC 1WIAA 2VTBB 1TNUA 3IXSA 3QARA 5EN5D 1ZGUB 3LKUA 4ANVA 2KX3A 4GOUA 4JXTA 2NTTA 3ASDA 1UH6A 1QZEA 2BS4B 3N1YC 1ZBPA 5D66A 4HNAD 1HQRD 2WM9A 1WRIA 3AV8A 4PK1A 3AE6B 2H7EA 2JABA 4JKCA 4NAMA 2V4LA 3LJ3A 1BUIC 2RSGA 1OMWA 1SXTA 4WNEA 2QZAA 4U63A 1ZXHA 1K1AA 5ENOD 1OFFA 3R7QA 2ZNVC 2PNNA 3Q73A 1DIKA 3V31A 2FBNA 4HB4B 4NACA 4YDEA 1FXTB 1GPXA 1PFDA 2WP9B 4OHJA 4Y94A 3UKUG 1ZDVA 3PZDA 3RU0A
chains in the Genus database with same CATH topology
3D9KA 4I6EA 4IULA 1P3QU 2RD0A 1ELKA 4GYYA 4Q94A 3RULA 4EECA 4NNJB 4F8CB 4MY6A 4DHJB 4EFOA 3PV1A 3RRMB 2J08A 4KHAA 1Y8MA 4KT6B 1MHQA 3PVLA 5HE0A 3V6EB 2DAFA 3Q3JA 2VRRB 3GZNI 4GMJA 4GMLA 3A98B 3FP5A 4IRUA 4OVUA 5EKQD 4W9LA 3D8DA 2ZU6B 5L81A 2FJ9A 4AXHA 3CMMB 3FY4A 1XD4A 1HF8A 1WJ6A 2MBHA 4URKA 4L7TA 4JC8A 5LCWC 3VIAA 5J18A 1HE8A 4XI0A 3UF8A 4RG9A 3PVUA 2J0KA 2MOWA 3NZSA 1U29A 3ONLA 2DENB 4JHKA 2N9PC 3L6AA 4YONA 2J07A 3WANA 5FZSA 1E7UA 3QWWA 1BTNA 4K0RA 3A33B 5FI0A 4AOFA 2KANA 3L22A 2RPQA 4JHJA 3V5WA 1TJ6A 4JVSA 4EUTA 1P3RA 1L5JA 4JQWC 3BINA 4MJSA 4GYWA 4LJOB 3TIXA 2JRIB 3VTVA 4GMVA 2ZCCA 2NXPA 2KFJA 3F0WA 4G24A 2Y4TA 5FJYA 3TBLD 3IKOB 4IWPA 2Q7FA 3OAWA 2P0HA 2UWJG 3HM3A 3ZKJC 2NR2A 4AP4C 4MKTA 3QCAA 4FC8A 5T8IA 5BPPA 5EX0A 1KT0A 4HWIB 4HB3B 3H7SA 4WNFA 2PZIA 1WYWB 3ZYQA 5AIJA 4HOSA 2C7NB 3QWZB 2L6JA 2BYEA 4A6HA 2LVQA 2XPYA 3PLUA 1M94A 2L9BA 2B3AA 5DIZA 2MBQA 4K7UA 4UWLA 2ROZB 3FDHA 1WGHA 4MRUA 4ILIA 3ESKA 2J7QB 3VXWA 3FWVA 1HB8A 4AWJA 4BBNC 4EBAG 4NSWA 4OVVA 2ZJDA 4UQXA 5D6JB 5JJ7A 2MQJA 2L2IA 4WWOA 5D3YA 3VAWA 3MKQA 4XZ4A 4EEWA 4Z2MB 1I7AA 1SQMA 3D9OA 4ILHA 2KWCA 3QA8A 2WXRA 3PLVA 3ML8A 3B08A 4DPRA 4LJPB 4HHVA 5J3QA 2M17A 3JW0X 3TJPA 3P6AA 2G3QB 1E90A 1TTNA 4IWOA 5ANLA 1KJTA 2CRFA 3MHSD 4FJVB 3PNTB 4HS2A 1V5TA 2R82A 5DCNA 3G2UA 4BKTA 2PPHA 1ZSQA 3ULBA 2WXGA 1Y8RC 4XKCA 2Z0DB 4MK0A 3SBGA 3NS8A 1V86A 2MBOA 4L6EA 2XGOA 3RO2A 1ZKHA 1WXMA 3A8QA 2MCNB 3LS8A 2X0SA 2BTDA 4CDNA 3PGEA 4E85A 3FH5A 2V3SA 3VQIA 2VSYA 2IYDB 2WXJA 3ZRFA 2DZJA 4KYOB 2AWIA 3D9JA 1RRPB 4GA1A 1N3HA 4MDKE 2IU1A 3ZYLA 4N3BA 2ROVA 5E6OA 2COFA 3ASGA 3QIJA 2RGFA 2LYDA 4E74A 2LO6A 1BWNA 3SI5A 1J19A 3G2WA 3KVFB 2IOLA 3Q47B 3H6NA 2KNBA 2MWNB 4BBNF 1UJJA 1WMHB 2KZTB 4HOUA 4NPNA 5C16A 3CVXA 2LGXA 2KATA 3DXDA 4GB9A 2P0FA 2DHZA 2FCMA 2CFUA 2KDFB 3DDCB 5ARGA 1F9JA 2IY1B 1RLFA 3FEHA 3FM8C 3APCA 2GBRA 2C5LC 1EF1A 4GPKA 5DPWA 3PUJA 2CG3A 1W3BA 3QHTA 5FQ7A 3APDA 2WXHA 2GRMA 3UIPB 3VTYA 4N39A 1JRUA 2I5FA 2GGFA 1LQBA 3S7FA 2KK8A 1S1QB 4BWRA 2N23A 1U5DA 2KMCA 5FTPA 1OGWA 1EGXA 5D0OD 3G2VA 3LDZE 2HD5B 4ICUA 2W2WA 4G50A 1WGUA 4GSWA 2KC2A 2MWSB 3SHQA 5KJMA 2EQXA 4ANUA 2NBUA 3AU5A 3IFWB 2O6VA 3CVNA 4ZRJA 1J0WA 2DYNA 4CGVA 2XK5B 5J17A 1OQYA 4GZ6A 3CHOA 2EMSA 3ZW3A 5AENA 1LXDA 4AJWA 4UQZA 4EZJA 4CEMA 2ONDA 3GOEA 2ELBA 1RRBA 3M63B 3CHPA 4J0UA 2YLMA 2MLBA 3TL5A 5FQ6A 3QB2A 2BYVE 2WXPA 1EPUA 2KCLA 1V61A 1TJCA 3CVWA 5FZRA 2D9ZA 2GBMA 3KAEA 4GCNA 3QDNA 4KVMA 1IRSA 2DYQA 3UPVA 5AZFA 3HVEB 3FU5A 3L08A 4AV7A 4KZCA 4H8SA 2KC7A 2YNQA 5HI7A 2IO3B 3E9LA 4A20A 1MIXA 2AEHA 2X6JA 1MPHA 3HK0A 1XGWA 4DX8A 1U5EA 2QFCA 3DVGX 2BF8B 4HB2B 3WALA 3CHRA 1OQNA 1Q67A 2VYIA 3CIKA 2RR9A 3KS2A 4HDOA 3FTZA 3CKCA 2PQNA 2WH5A 4C0AA 2J0JA 3QX1A 1WGQA 1UW4B 2YS1A 4MM3A 1V2YA 3UIOB 4W9RA 3UT7A 5DHFB 4LCTA 3O65B 2CHZA 1GW6A 1WF9A 4UWHA 1WI1A 4DHJD 2O2VB 4WVFB 4EOYA 2MA9B 1RJ2A 2X3MA 4A55A 4BFRA 1Q5WB 2WXQA 3PREA 3A9JB 2CHWA 3FTYA 5CCMA 3H7PA 2N1VA 1A17A 3MGBA 4JEHA 2KTFA 4GZ3A 2NMBA 2D11A 4NQ0A 2KCJA 4N2QA 4WJNA 2Q13A 1LF8A 3N32A 4NAWB 3SU8X 4YL8A 2DTCA 4G23A 4HK2A 3LY7A 3ZNGC 4PS3A 2LGYA 4XWXA 2WQ7A 2ZPYA 1UGMA 3TG5A 2XGMA 3CHSA 4UI9J 1FHOA 4FADA 3LVRE 3MV2B 4FJZA 3UMVA 1P0RA 5J3YA 5D94A 4EQFA 1H4RA 4I6NB 5AZHA 4IYPA 4MSMB 2RQ1A 4XKBA 5KQ4A 4ACKA 4JA9A 1UN8A 5D3VA 5C79A 1K8RB 2PQRA 3TGOA 1WM5A 4BY6A 2JWZA 4TKNA 5DBKA 4M8MA 2JRHA 4Z2NA 2K8BA 1QNFA 1E7VA 4LDTB 2KLCA 3ZYKA 1WGDA 4HPLB 1MG8A 3KH0A 3ECIA 5AJDA 3CXBB 3NHEB 5LONB 4I9CA 4K2OA 1WE7A 2OJRA 4GA2A 4P7IA 1C1YB 2D2QA 1YX5B 1INZA 5KQ1A 4CO7A 5C5BA 2LWPA 4KHBB 1IHGA 2Z0QA 4TQ1A 3T5VA 1AWEA 3V6CB 1HZ4A 2N1WA 2WXOA 2LD9A 3SBSA 4B8AA 2VGXA 2OVFA 3N30A 2UY1B 4GMXB 2K6QA 1P9DU 3N3KB 2RVBB 5L95C 3UT8A 3EDTB 3TW1A 2VJ8A 2KTRB 2DKPA 2X38A 1L2NA 1FGYA 2KFKB 3SDLC 1V5MA 3ESLA 2G35A 1WJ4A 2O6VB 2COCA 4LEUA 4MT7A 1UEFA 2XBBC 4CHJA 4IUMB 3VFKA 2WMOA 4H7YA 5CLLB 5T4YA 1OY2A 1HBKA 3HYMB 5G04J 4F7HA 3A4SC 2KOXA 3CVUA 2JLBA 1KOTA 3QOUA 4CDMA 3D32A 2OTXA 1LM8B 3VTWA 4D0NB 4F7AA 3Q5MA 3IV0A 3P1UA 2W9NA 4IM2A 4G0NB 2KWVB 5D3XA 3TVVA 3PG7A 5D27A 1XODA 4I2ZA 2DHIA 3LY8A 4BKSA 4GDLB 2WXKA 4XI9A 4ACLA 4DDID 2BWFA 3AI5A 3VOQA 3MZLB 2MRPA 2IBIB 5CHEE 1U2BA 1M7RA 5DPTA 4HAWB 3SGHA 1S3SG 1WFYA 5CMYA 5CCLA 1C3TA 4IC7B 1G6JA 3C0RB 1U3DA 3JSVA 4UWFA 4JKHA 4AIFA 1WGYA 4PS7A 3LEWA 3ZNHB 4U8HA 4I43A 2CODA 1KLVA 1H2VC 3SNHA 2LOXA 2ZVNA 2BF0X 2KXJA 4XC2A 1YA0A 2HTHB 4GXBA 2D9YA 4CGWA 2L0TA 4ATGA 2WXFA 4KV2A 3FUJA 4JK9A 3FLVA 4B95A 4LERA 3VLDA 4BOSC 1R4MI 1KI1B 4W9KA 2L3ZA 3DXEA 3D3MA 5BW8C 4A1GA 4O6FA 1GG3A 4AM9A 4GDKB 2WXIA 2ZCBA 2L1CA 4RG6A 1WZ3A 2K25A 1U4AA 4II2B 1V6EA 4FBJB 2MBBB 2UZRA 4B6HA 4F53A 2FJLA 5FT9A 3MPXA 4B0ZA 2YQ8A 2R0DA 4WJOA 1RFAA 3A1QB 3D9NA 3QNKA 5E75A 2KN5A 2PM6A 5AJLA 4IM0A 3KEZA 1UNRA 4TQ0A 4EKUA 4RSYA 4GZUA 3JCKC 2LGDA 2MKRA 2LAIA 2WXMA 1X1MA 3VUYA 4A6FA 2FAZA 3E9OA 5A7DB 5J3TA 3DBLI 1H2UA 3ZN3A 1H0AA 1XQQA 1KZ7A 1EO6A 3WIMA 5DHAB 1WX7A 1X5BA 3ENBA 4JKBA 3ULQA 2VQ2A 1IP9A 3HM6X 2I6HA 3FTXA 4XE0A 3E4BA 2MDXA 4NY0A 4JL9A 2HM8A 5ENNA 4DI3A 1X1GA 2D9WA 2AL3A 2ZZPB 4WNDA 4GN1A 1HG2A 2WX0A 2GW1A 3U64A 2C0MA 2LVOA 1Q0WB 3VUWA 4A5KA 3ZFWA 3BG1B 3ML4A 5G2NA 2WQHA 4FJYA 5G05J 3BG0B 2PEAA 3FTWA 1JPLA 3VVWB 2R59A 4XX5A 2NZ8B 4JLCA 3JQ0A 1XCGA 3L16A 2OOBB 2P58C 1WI0A 3I4RB 4DBGA 4HOQA 2YF0A 3VDZA 5CX3A 2V0PA 4MSQB 3JYSA 4GYOA 4CT4A 2C60A 1MK9B 1WJMA 1UELA 1UBQA 1OWPA 2MP2B 3A9KB 3RUIB 3FUEA 4DX90 3VTUA 3N71A 1WX8A 3KY9A 2RG8A 4B6WA 3LPZA 4V3IA 1BT0A 2ASQA 2LUEA 1U5GA 3BEEA 5KCMA 1TGZB 3JYUA 4JK7A 2M14A 1P5QA 2BWES 4I1MA 3NZUA 2GS0A 3Q49B 4EPZA 1U3CA 4W9EA 1J0GA 1FHWA 1OTRB 2Y5BB 3HW2B 3NSUA 4HJKA 2ABDA 4Q96A 4A6KA 3SYXA 2DKQA 2MRIA 3LDZA 3O4ZA 2HRJA 3UQAA 3SFZA 4DLOA 1WR1A 5CTRC 4IWQA 2BKFA 2K6DB 4EZLA 3PVWA 4FLBA 1HG5A 3IHPC 1AARA 3EHNA 4N5CA 2VKIA 2DLWA 4J8FA 4APOA 2VSZA 1HH8A 2E2XA 2UWQA 1PFJA 2FCNA 2M63A 2NC9A 3PH0C 4DK5A 5HKHA 1JUQA 5E76A 4DI4A 2VSXE 2Y4UA 3JUIA 2WB2A 3HHMA 4WNGA 4ILGA 4MGKE 2ZVOA 4D10C 1ELRA 3MDBC 2OV8A 2I1KA 4ANWA 4TV3A 5BV1A 1H6KA 3TXMA 3U4TA 4YVOA 2FO7A 4HAYB 4WJ7A 4WAAA 4PH4B 1V89A 1Z3YA 4OYSA 3AS4A 2RGNB 4KSLC 5HE3A 4BSXA 4BTAA 1V80A 3AXCA 3CK9A 5EFXA 4W9JA 4I6PA 4F3VA 1H19A 3WXXA 1E8WA 1W1DA 4HB0B 3W1SC 2J59M 4JKGA 1Y5OA 3Q4AB 2FEZA 1HO8A 2NSZA 1MK7B 1PAQA 4LDTD 2AXZA 4U0SA 3SHFA 3M3JA 4G3XB 4E71A 3T9LA 3SBTA 4N3AA 2HE7A 3AS5A 4QFVA 3KUDB 5ARFA 3UQBA 3DBRI 3ZYMA 1OEYA 3FFLA 3G2SA 3SO6A 3VH4B 2IFUA 1V88A 2IJGX 1Z2MA 4HAZB 3B7SA 5C6RA 2NPTA 3B0AA 2XPIA 1LB1A 4FN2A 2Z0PA 1WXVA 2IZVB 3SZ7A 2LXAA 1TBEA 4BT9A 1UPQA 1WG7A 2N9XA 4JKEA 5AEKB 4JA7A 2XQ0A 3RT3B 1GJZA 1X05A 5LOZA 4JHRA 2FUHB 4W9CA 3CQCB 4M3OA 4MJSB 2LKOA 5JHHA 2O6VD 2GBNA 3DCGA 2M1MA 4KIKA 1N52A 4KSKC 3PP2A 3P7ZA 1SIFA 3ZHEA 1XR0B 3HQCA 3NQPA 4FHJA 2KJRA 1L7YA 3PHXB 3KW5B 4K7SA 3ZIMA 4EMOA 3ZDMC 4L2LA 2X6KA 4MGIE 4HOTA 3L13A 3R3MA 5LCWJ 4APFA 3UINB 3TAXA 4HLEA 4C0EA 3MKRA 2DX5A 4U07A 2DX1A 5KHQA 5C2YA 3GW4A 2HJ8A 4BBKA 4JPSA 1WM3A 5CHWA 3ZO5B 3WA0A 2M8SA 4JEUA 5KCVA 2JT4B 1WH3A 1NVLA 5D7GA 1HB6A 4HORA 3P2BA 5E6NA 4DHZE 2JY6A 4Y6WA 2VRWB 1FVFA 1WZ0A 2C7MB 1VD2A 1OWLA 2G4SA 3QK0A 3LYAA 4L2YA 1SE9A 3ZDTA 2X6HA 2VTBA 2BKRB 4K17A 1B55A 1WXSA 4WQOB 2BYFA 3OJ3A 5JP4A 3VLEA 4HDQA 1D3ZA 3VHTC 4IFSA 3M95A 2IY0B 3EC8A 2I9CA 3ALBA 3EECA 5KJKA 1EAZA 1I42A 4FU3A 2WYQA 3JVZX 1J8CA 2NS5A 1JDEA 3MKQB 2HO1A 3CVLA 3A8PA 1JWGA 2XQNM 1Y19B 4ILHB 2Y7BA 2LJ5A 3RZFA 3CGHA 3URZA 3EHVA 2YVCA 3R66C 5FZQA 1NA3A 1IYFA 2LOZA 3QQ8B 2KZRA 4M8NA 3OXLA 1Z6TA 5C1DA 2IO1B 4XIFA 1WR6E 3FUHA 1KT1A 1Z87A 4IAPA 4NJ6A 3K9PB 1IYGA 1UNPA 3WAPA 3D8EA 4GZ5A 3RIBA 2CU1A 4E6HA 5GOWB 4CCAA 1V9JA 2XCBA 3PRZA 2FIDA 5J90A 4J8DA 4K03A 1JWFA 3QWPA 1WVHA 1YX6B 2YINA 4KXKB 4HFGA 2H7DA 5JHBA 4NRHB 3G2TA 2ILRA 2AL6A 3Q15A 3ZNID 3APFA 3NOBA 1ZC3B 5DPSA 2KGXB 3ASFA 3ZTCA 3BY4B 2IO2B 3CR3A 5CHVC 1LW3A 1MKEA 1OEYJ 3ZTDA 1A5RA 1H8CA 1OWNA 2V1YA 3TXNA 4GIVA 2COAA 4ZYNA 3ZVVA 2OQBA 2REXA 1DVPA 2FIFA 3AS8A 1KM7A 2DYOA 3L10B 3ODOA 3PSEB 2N7DA 2DIWA 2KM4A 5KJLA 4N2SA 2BGFA 3EPYA 2E0IA 3ENEA 4B89A 3FUFA 3OXGA 1UN9A 2R17C 4U04A 4WWNA 2K2UA 1WJNA 3CVPA 2COPA 3SD5A 2CR5A 5A23A 3CK8A 3QWVA 1X86A 4NURA 3C98A 4HAUB 2JPHA 1ELWA 3DVNV 1QC6A 2IYBA 1FB8A 1R4NI 4UWGA 3BJIA 4I17A 4G1TA 4IN3B 3LY9A 4L1BA 4JL0A 2RNRB 2YT0A 1MAIA 3KRWA 1WX9A 5DH9B 3UQ3A 2WQ6A 2WWZA 1LFDA 2L0IA 1I35A 4W9FA 3PT2B 1Z5SB 3N7CA 1RAXA 5E6PA 4CHMA 2CB8A 3D9IA 1BAKA 1WGGA 3VH3B 3SF4A 1NTIA 5CMWA 2AXUA 3OTNA 2D07B 3U3WA 2LNIA 1TEZA 1P98A 4G25A 2R5SA 4DXAB 4I6GA 2YHEA 3M1IB 1UBIA 3FP3A 2PZ1A 3UT4A 3RJVA 2UZSA 5EDSA 2KDEB 2KVRA 2KLGA 2KO3A 2VSNA 5JVLA 2X6IA 3MTNB 3PHWB 2FNJB 3KD7A 2D10A 4CYEA 5LLIA 3QC1A 5BUZA 4ICVA 4MH0E 1MQSA 5FQ8A 1WRDB 2DN6A 1I2HA 2I1JA 2CG2A 3ML9A 4GAAA 1WY8A 4MGYE 1B89A 1YD8U 4UQYA 3OJ4B 5J2RA 1GUAB 4BKSD 2D3GA 2RSUA 1T0YA 2J09A 3ZXSA 1WJ1A 2R09A 3LCAA 2FCSA 2V5FA 3S7BA 3OXFA 5JLJB 4I2WA 2X18A 2D9VA 2Y8GA 2K39A 1GC7A 2C0LA 4F7ZA 4BTBA 4G2VA 2KMAA 2RUKB 3PRMB 3UX4A 5BNWA 1KC7A 4ABNA 2PM7A 1UD7A 2I5CA 1KLXA 3FHEA 4LRZA 4K81A 3TO1A 3KRXA 3DOWA 1SGHA 2FCQA 4G26A 5J08A 1CMXB 2EC1A 5KJNA 2YS3A 1EDUA 2KHWB 4LCDE 2RLOA 1W1HA 1P1AA 5JJTA 4HAXB 2KZTA 1WMHA 5LXIB 3PPAA 3ZEFA 2Z0OA 3FU0A 2KX0A 3UZTA 5JZEB 5A6CA 3PE4A 3DVNU 3FULA 1V81A 2LRUA 2M4NA 3H7PB 3JQ1A 3CIAA 4KZ0A 2WDTB 1U5FA 4A3VA 1Q1OA