3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein
molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
4NY0A 3X0WA 2YS1A 1BTKA 2BCJA 3KUDB 3T8MA 4CHMA 3IFWB 3IVFA 2K25A 3RCZA 3NZSA 2DKPA 3TJPA 1GC7A 1WX8A 1YIWA 2D9WA 3PLUA 2WH5A 2LOXA 3VH3B 3EHVA 2L1CA 3VUXA 4PS8A 2RUKB 3SHQA 1TGZB 2G4SA 1X1MA 4YONA 2DHKA 3D8EA 3SYXA 3TFMA 5D3XA 2JY6A 1TTNA 1WMHB 2I5FA 3DXEA 4ZRKA 3DVNV 2MBEA 2EC1A 1WI0A 2ABDA 2PZ1A 4KHBB 2KOXA 1X1FA 1WZ3A 3KRWA 1IP9A 5JH5C 1WJUA 4II2B 4FBJB 4HVBA 2IO2B 3PP2A 3SU8X 5D2MB 2R0DA 2D3GA 3K9PB 4TYZA 1UPQA 2D9XA 3PHXB 3L54A 4WVFB 1X1GA 4DX8A 2FCNA 3PPAA 4W9LA 5D3WA 3QK0A 5CTRC 1QQGA 4NJ6A 1RLFA 4EKUA 4WQOB 2BGFA 2DTCA 3HW2B 3PS6A 2K00A 3PSCA 3RULA 3PSEB 2BWES 2CR5A 4WJQA 4GPTB 1MIXA 1RAXA 2ZCBA 2YT1A 3TO1A 3UINB 3NY5A 2KDIA 4B6WA 4CYEA 5CHWA 2GBKA 1WE6A 3ML9A 1Y8RC 2Y8GA 1GNUA 3CSTA 1C1YB 2LI5A 3SV1A 4MDKE 2PEAA 2LRWA 1NBFC 4HAZB 1WR1A 4KSKC 1FB8A 5CX3A 1X11A 4EZKA 3ZO5B 4LCDE 5DPSA 4GSWA 2MFQA 5L95C 2NCNA 1FGYA 4IM0A 2L05A 1DROA 3ZKJC 2LBBA 2N7DA 1S3SG 4MGIE 2Q13A 1OQYA 5D3YA 5KHQA 2XEWA 1WJ4A 3DBSA 2DFKA 5JLJB 3DBHI 5AZGA 3HM3A 3R7RA 1BAKA 4BKGA 2REXA 2LOZA 5C1ZA 2DZJA 4MGYE 2PJHA 3D8FA 3AULA 3DQVA 2D4QA 4I6LB 2KZRA 4KZCA 3BJIA 4ANWA 2KFJA 2AL6A 2AL3A 1YD8U 3M63B 3B0AA 3KY9A 2VRWB 1S1QB 1KOTA 3OAWA 2KWUB 4HB2B 1W1GA 1U27A 1KZGA 4C0AA 1E8XA 5DPTA 3U30A 4ICVA 3PZDA 4G11A 2Y8FA 1V9JA 3QWMA 1WY8A 4DBBA 4ASWC 3NSUA 5DPRA 2ASQA 3GZNI 2PPHA 2AEHA 2CS4A 1UD7A 4IFSA 1ZW7A 4FULA 4BVUC 4NAWB 1BT0A 3V61A 1V61A 2DYQA 4E71A 1ZGUB 2LYDA 3DXDA 4NAWA 1NVLA 2K2JA 3VHTC 4YL8A 4IAPA 3UIPB 2QHOA 2D9YA 2KDEB 3K9OB 2IYDB 2XK5B 3MTNB 4X57B 3MDBC 3MJWA 3JSVB 2ZNVC 3AU4A 2UWQA 1YX6B 3O65B 2XK5A 2GJYA 3PTFC 3DOWA 2BKRB 4HPMB 3JSVA 4NPNA 4BBKA 2FCQA 3FP5A 1OMWA 2MCNB 1UEFA 4WJ7A 1V5MA 3LDZE 2NS5A 1NTIA 3A4RA 2JZ3B 3GOEA 2MWSB 3PRZA 2YVCA 4M8MA 4HATB 3P2BA 4MSQB 2K8HA 2J0JA 1VCBA 2CB8A 2K8BA 3I3TB 4HAWB 1ISNA 5CLLB 2G3QB 1RFAA 1WXVA 1MIZB 2ROZB 5C79A 2K1FA 3ODXA 2IBIB 2VRRB 3QBVB 3ZIMA 3CXBB 2JT4B 4K2OA 4BKTA 1DDMA 4HAVB 1UZXB 2W2WA 2DYBA 4GB9A 1U2BA 1WGRA 1E90A 1WXAA 3ZTCA 5KQ1A 1UNQA 4HCNB 2WWZA 3KUZA 5D94A 3DXCA 4JGHB 3VTUA 2JF5A 3AXCA 2OTXA 3ZDTA 3HM6X 4ZRJA 4G50A 4DHZE 3ZRFA 3NOBA 4A6HA 5DHFB 2P0HA 2JVCA 4URKA 1U5FA 5E6PA 3OLMD 2D11A 4FN2A 1MK9B 4IWQA 2HJ8A 2R2OA 3HQCA 2V3SA 4OVVA 2KN5A 1WRDB 1AQCA 1WGGA 4GMVA 4W9EA 2C9WB 1V5UA 3MHSD 1V5TA 3VXWA 3MPXA 3KW5B 3H1UA 5D27A 3QARA 4IWPA 1M94A 1V81A 2KANA 2FDQA 1WGQA 3VVWB 3F5RA 1FXTB 1GJZA 5HE2A 2ZCCA 3APDA 2C5LC 2MSED 3WAMA 3KYCD 3R3MA 1WYWB 5JP4A 3M1IB 1U5EA 4GOCA 3ZW3A 1B55A 3SNHA 4A3PA 1X86A 2EMSA 2KX3A 3HK0A 4HK2A 2B3AA 4D0NB 2KJ6A 3B1LX 3RUIB 4GZUA 4HWIB 4HDQA 3ULCA 4ANUA 3QWZB 4K2PA 3OJ4B 4LJOB 1M7EA 3ALBA 4MELA 1H8CA 2ADZA 1WG7A 2COPA 2CRFA 2DX1A 2FNJB 2MX2A 2ZZPB 1P0RA 1WGHA 3RZFA 1LW3A 2KX0A 4GDKB 3JW0X 1T0YA 2DKQA 1QC6A 4HAUB 3DPDA 3U7DA 1I2HA 3ZTDA 1WJNA 2M4NA 2KMAA 4GDKA 1WMHA 1ST7A 4K17A 3G9WA 3VTWA 5DCNA 2NBVB 1TBEA 2KK8A 4F7HA 1HB6A 1Q0WB 4EOYA 2Z0EB 4JIOU 4IM3A 4F7ZA 1WI1A 3FLVA 5G2NA 2LXCA 3TL5A 2LGDA 4CHKA 3FM8C 1KM7A 4FJYA 4DXAB 4MEMA 4FHKA 2NZ8B 2RVBB 5DH9B 5J18A 1NTYA 4IWOA 1IYFA 2CQUA 2NR2A 2C7HA 3VUYA 4K7WA 3N30A 1FHXA 4XWXA 4IG7B 4MGZE 1YQBA 2KQSA 3W1YA 3QA8A 2DLWA 2OQBA 2K6DB 1LXDA 2JPHA 4PQ0A 3ML4A 4K7SA 4GN1A 1WGDA 4FA6A 4IOYX 2D2QA 3KZ1A 1WF9A 4IW0A 1NU2A 4TQ0A 1MPHA 5GMVA 2LUEA 1OEYA 3ULBA 5IA7A 2KGXB 4B6HA 2KLGA 4K1RB 4W9CA 2ZPYA 2RSUA 4PYUA 1DBHA 2N23A 2O6VD 4B9KA 1WE7A 4E74A 2FUHB 2CODA 3V6CB 2M14A 4MJSB 5L83A 2LGYA 1KJTA 2DAFA 1C3TA 2G45B 4MJSA 2H7EA 2K6QA 1SGHA 2LJ5A 1N3HA 5E6OA 2NVUI 4BKSA 5L81A 2DZIA 3QAQA 4NJ7A 4NQLB 5DPWA 1OY2A 1Q67A 1P98A 1KLVA 5JHBA 4FLHA 4BBNF 2KCJA 2J0KA 4K81A 5JHGA 2L76A 3W1SC 1GG3A 2FIFA 5FI0A 2BKFA 2JRIB 2N7EA 3ZDMC 4BFRA 4HB4B 2KUPA 3KYDD 3A33B 2FIDA 4HAXB 1XX0A 4GU2A 2RSGA 2D9VA 2RD0A 4F1SA 1XT9B 1P3QU 2GOWA 4M8NA 4DHZB 2KNBA 3EFUA 2KC2A 1PMSA 2IO0B 3QC8B 4CHJA 1XCGA 1V6EA 5HE1A 5C23A 4NNJB 4II3B 2WYQA 2DYNA 3KUCB 2UZSA 2MBQA 5AZHA 4BOZB 1EGXA 1TQZA 1ZVRA 3VOQA 1XQQA 1SE9A 4GGQA 3ENEA 2M8SA 3AU5A 1UBIA 1UBQA 2DN6A 4DX90 1Z87A 4HXDA 3BINA 1V88A 1PQSA 2L8JA 2MDXA 3WANA 1VD2A 2C7MB 2UVMA 4DHJD 1WFYA 2LD9A 1Y5OA 3DVGY 5TR5A 3M95A 5J3TA 3N32A 1XR0B 2KDFB 4N9F4 2DHIA 2N1VA 2P0DA 3GYPA 4ANVA 2RGFA 1E8WA 2IY1B 4HJKA 2JUOA 1H4RA 1NDDA 4WAAA 2HRJA 1Q1OA 2DYOA 3A1QB 4HB0B 2BYFA 5LLIA 2L0FA 3PRMB 3WIMA 2KQ7A 4J6IA 2D07B 3A1QA 2MP2B 4HAYB 1TJ6A 2N9XA 2RGNB 4L6EA 4PNKA 1X05A 1H10A 3QQ8B 1ZM0A 4I6PA 2MP2A 2RPQA 2Y7BA 4JL9A 4AP4C 2XBBC 4GXBA 1P9DU 1BWNA 3A8PA 1V89A 2ELBA 3M3JA 2I1JA 2DX5B 2ZPNA 3WALA 3PVWA 2DZKA 4KHAA 1U4AA 2FJ9A 5AZFA 2CU1A 2DX5A 2CY5A 2E2XA 1V49A 2P8VA 3CSFA 2GBMA 4KZ0A 5LXIB 5IJMA 1U29A 2L0TA 3ECIA 3ZNID 2MKRA 2IY0B 3EECA 5HE3A 2ELAA 2YRYA 3Q3FA 3VIAA 1V5PA 1QZEA 2Z0OA 2BYVE 3L08A 4PS7A 3NHEB 2QKLA 2K39A 1DDWA 1WXMA 2KLCA 5FR6A 1Z5SB 2A5UA 2COFA 4MK0A 2WDTB 2P0FA 3UGBB 1LM8B 4A5KA 5BO4B 3IG3A 2GBNA 3JVZX 4GDLB 1YJ1A 3VAWA 1V86A 5KQ4A 3F0WA 2W2XC 1XD3B 2BF8B 2ZVNA 2W9NA 3NS8A 3QJZA 3APFA 1ZC3B 4GDLA 3N7CA 5JZEB 1WIAA 3V6EB 3L16A 2MBBB 3T06A 2KJRA 1E5WA 4RMAA 1EO6A 3DBRI 3EC8A 1WX9A 2HD5B 3CF6E 5HKHA 2GS0A 4W9KA 3JYUA 2IO3B 3TW1A 3VTVA 1SIFA 1P3RA 1EUVB 5KHOA 2ZNVB 3PT2B 1IPGA 2GBRA 2C7NB 1MK7B 1HE8A 3ODOA 5D6JB 2OJRA 4KDLB 2NBWB 1ZC4B 2CHZA 2R2QA 1CMXB 1EVHA 1J8CA 1L2NA 1TZ1A 2UYZB 4LDTD 5LXHA 3FEHA 3RT3B 4EJNA 3S2AA 1BTNA 1UNRA 2LASA 1AWEA 4DHJB 1GUAB 3ZVRA 2DAJA 4EUTA 5D7GA 3D32A 2L00B 2VSZA 3AJ4A 3AI5A 1F9JA 2EKEC 2KWVB 2FJLA 2EJ8A 2Z0QA 2DHJA 5EDSA 2PE9A 4MH0E 3A4SC 1ACAA 2Y5BB 2H7DA 2KHWB 4IM2A 2N1WA 2YS5A 2LVQA 3TMPB 3PVLA 5DIFB 3KSYA 2YLMA 2FAZA 3IHPC 3SD5A 1Q5WB 3ZUNA 2J0MA 1RRPB 1HBKA 2NBUA 2AYOB 3PREA 4AOFA 3SUZA 4EMOA 2LGXA 3PV1A 2Z0PA 4W9HA 2JRHA 1I42A 4HDOA 2WX0A 1FAOA 2LULA 4TKNA 5E6NA 2QKMA 1FHWA 1WGYA 2EMTA 4F7GA 1I7AA 3HHMA 3T9LA 4B95A 2CY4A 5DI9B 2LVOA 2G35A 2K8CA 4A6FB 2C60A 3A9KB 4OVUA 5C6RA 1L7YA 3ODWA 1MAIA 4A6FA 2O2VB 1WM3A 1ZKHA 3A9KA 2X18A 3KRXA 2RQ1A 2V76A 4MM3A 2ZVOA 1WGUA 2V1YA 3H6NA 2O2VA 3L0WB 4MY6A 2LWPA 1KZ7A 3V60A 3OJ3A 3PLVA 3P6AA 1OQNA 4PS3A 4ANXA 5J3QA 3L13A 3APCA 1V5OA 4JQWC 1I35A 3EPYA 3FSSA 4DDID 5LOPB 4GIVA 1UELA 4WWOA 2KVRA 4MGKE 5IAAC 1MKEA 2D9ZA 1ZSQA 4Z2MB 2DA0A 4FHJA 4BBNC 4Z2NA 1OEYJ 2LXAA 4HCPB 4E3CA 4NSWA 4KV2A 4KIKB 4Y94A 3PVUA 3TVVA 3H7PB 2ZJDA 2I1KA 3ZVVA 2D10A 5C5BB 2GCLA 4KIKA 2MQJA 3KVFB 4FADA 2FCSA 2IYBA 4KVGB 2KDBA 3H7PA 2KO3A 2MW5A 5CHVC 5C5BA 4IUMB 1DYNA 2MBOA 1GC6A 2Z59B 4MT7A 3QX1A 2ROVA 1UGMA 4LDTB 3V62A 3TIXA 4F8CB 1P5TA 3SO6A 2KXJA 5FI1A 3DCGA 5KCVA 1PFJA 3PG7A 2KTFA 2BPSA 4HPLB 5EFXA 1WVHA 1U5GA 2MLBA 4HHVA 4AJWA 5DHAB 2KKCA 2MWNB 2Z0DB 4NQKE 3ZNGC 3DDCB 2AWTA 4LJPB 3CIKA 1RJ2A 2J7QB 4HLEA 1JRUA 3O96A 2CAYA 5JHAA 2N0YA 1UH6A 1FHOA 3UQBA 4BOSC 2MA9B 4F7UP 2HTHB 1K8RB 2PE6B 4W9GA 2BYEA 3R7QA 5HE0A 3UZTA 5LONB 1EF5A 2L2IA 2HTHA 1NTVA 3L17A 3ZLZA 2N9PC 1LQBA 3V5WA 4WSFA 2XQNM 2KFKB 2OOBB 4KAXB 5J17A 4XX5A 5GOWB 2V4LA 2KFKA 2JP2A 2A4ZA 4TUUA 2M0XA 2CHWA 3DBLI 1G6JA 5CHFA 4W9IA 3RD2A 2KWCA 4A6KA 3PHWB 2RR9A 1KI1B 3IBEA 2FCMA 4AUQC 3X23A 1UNPA 3QIJA 3ONSA 1EF1A 2YSZA 3ML8A 4M0WB 2J59M 4KHOA 2WX1A 2HE7A 2DHZA 4EZJA 4WJNA 2UZRA 3A98B 4MSMB 2LVPA 4ICUA 2N9EB 2LRUA 4TQ1A 4RM8A 1E8YA 1WJ1A 2BWFA 4PYZA 3LJ3A 2YT0A 2DENB 3U8ZA 1E8ZA 3N3KB 2IO1B 1V2YA 4FJZA 4DDGD 1WR6E 2COCA 2RNRB 1TXDA 2DZMA 5C16A 2W2XD 3P7ZA 4JLCA 2M17A 1R4MI 1HB8A 1WX7A 2I5CA 4A3OA 3A9JB 4TV3A 4W9JA 4EZLA 3NZUA 3W1SA 5AEKB 3A9JA 1P1AA 2YF0A 1J19A 1DDVA 1XKEA 2MRPA 1FOEA 2KD0A 1E7VA 3QHTA 2LZ6A 4HB3B 4W9DA 2L3ZA 4XZ4A 2ZEQA 3ZRCA 2O6VB 3GYOA 4XC2A 2IZVB 2YS3A 1RRBA 1LFDA 1SHCA 1OGWA 2O6VA 4KDIC 4CO7A 1UPRA 1V80A 4WJOA 2NPTB 4KSLC 4WWNA 3WA0A 4WWPA 1WJMA 3A8QA 3SDLC 3KH0A 4ZDVA 3LJUX 2NPTA 5JHHA 3UF8A 3TCAA 1WXSA 1FGZA 2CKHB 5D3VA 3WYFB 2RLOA 1W1HA 4DK5A 2LG1A 2JXXA 3UIOB 3Q3JA 4RM9A 2KMCA 3VDZA 3M62B 1K5DB 2DYMA 2G4DB 2R09A 5CLQB 1D3ZA 3WAPA 1P6SA 3C0RB 3DVGX 1M7RA 1Z2MA 1LB1A 4G0NB 3VFKA 1EAZA 3ZNZB 2KTRB 2KC1A 5G55A 1WJ6A 2K2UA 4P7IA 4AWJA 1Y19B 2KTRA 1XD4A 3VH4B 3DVNU 2GMIC 3ZNHB 3WAOA 3PEGA 2KJHB 5J2RA 3HIZA 4K7UA 3BY4B 3PGEA 4W9FA 3RYTA 4IC7B 1AARA 1U5DA 1WZ0A 2N4FA 5J3YA 3OANA 1PLSA 4ZRIA 2JWZA 4GMXB 1MG8A 4DWFA 1J0GA 2COAA 4AJYB 3PRPB 4A20A 2CHXA 3H9DA 1YX5B 1NI2A 4EFOA 3H7SA 2L7RA 2M38A 3UQAA 4DBGA 2NMBA 3RZWC 1R4NI 4H8SA 1IRSA 4FJVB 3TBLD 1XODA 2LKOA 3VQIA 1WM2A 3QCAA 3CMMB 4BKSD 4WJPA 2GCJA 3VUWA 1K5GB 4G3XB 1E7UA 2GBJA 3B08A 3D8DA 2IFSA 3R66C 1WH3A 2VKIA 1OTRB 1A5RA 1J0WA 4I6NB 2JZZA 3L10B 3RCPA 2MBHA 4EEWA 1W1DA 4ZYNA 2M1MA
chains in the Genus database with same CATH superfamily
2ETCA 4NY0A 3X0WA 2PKOA 2YS1A 3HXCA 2J08A 4ME2A 5C2YA 1BTKA 2BCJA 4B0EA 2WQ6A 3MCXA 1YN4A 3KUDB 3DWMA 3T8MA 2BW2A 1JROA 4GLSC 4CHMA 4K03A 1IBXB 4LLGM 3IFWB 1ACCA 3IVFA 3AE5B 5KJKA 2K25A 3B7BA 2J49A 4GMLA 5HHDG 5BYSA 4F53A 3RCZA 3ZJVA 5JA4D 1UWMA 2WU5B 3R2IA 3NZSA 1E10A 1OY3D 5JJ6A 1C76A 1IBXA 5EX0A 2R02A 2WP9B 3ZUVB 1T0RC 2DKPA 2P9UG 4HXIA 3TJPA 1GC7A 2DIWA 1N60A 1WX8A 1YIWA 4ABNA 2D9WA 3PLUA 2DYRE 2WH5A 2JLBA 2LOXA 2AQ1B 4JB8P 3ESLA 1UN8A 3VH3B 3EHVA 2L1CA 3VUXA 2G1EA 3OG5A 4PS8A 2ETAA 2RUKB 3SHQA 3Q75A 1TGZB 3HDXA 1O1SA 2G4SA 4K5AB 1X1MA 4J3OD 2DZOA 2ILRA 3B77A 4YONA 5AENA 5TSSA 2DHKA 4NRHB 5CEAA 2JXTA 4U0ZA 4GZ6A 5FR3A 1B9RA 3D8EA 4DRXE 3SYXA 3TFMA 5D3XA 2JY6A 3PE4A 2ZU6B 1TTNA 2XGSA 4HRNA 1WMHB 4WH4A 2I5FA 2L0IA 2VZKD 1QQRA 4JXTA 4N5CA 3DXEA 4ZRKA 3DVNV 4ILIA 2OJWA 3AEAB 2MBEA 1ZPSA 3E9LA 2JSVX 4O6FA 4UUCA 2EC1A 1WI0A 1PGBA 2ABDA 2PZ1A 3SBTB 4B8CB 5KJNA 5CHEE 1N9AA 2F8XK 2GRQB 4KHBB 2KOXA 2P9PG 3E30A 1X1FA 3URYA 1N4QA 2MHKA 3RI7C 1W3BA 1WZ3A 4KKJA 3KRWA 1I7HA 1IP9A 2IPKD 3SFXA 4A1GA 3DBLB 5JH5C 1WJUA 4II2B 1YQ4B 4FBJB 4HVBA 3SBTA 4BEPA 2IO2B 3TWRA 3PP2A 2DIKA 4KHBA 4I2WA 4YDWA 2H88B 2XCBA 3SU8X 5D2MB 3BQOA 2R0DA 2D3GA 4HSIA 3K9PB 4TYZA 1UPQA 2VSYA 3B13A 2BT6A 5C3JB 4WAFA 2Q7FA 1H6OA 2D9XA 3PHXB 3L54A 4WVFB 1SEBD 3N1ZC 3S7JA 4ZFHA 2INPE 2J53A 3AE2B 3GZ2A 3MA5A 4GTPA 3T5XA 4JKFA 1X1GA 1AW7A 2AWIA 4DX8A 1IKND 1HF8A 4US9A 2FCNA 5G5GA 3PPAA 3U7ZA 5LCWJ 5FK9C 2V5FA 4WNFA 4DLQA 4W9LA 1J7BA 2FBWB 5BV1A 5EYLA 4JVSA 2I38A 1D8DA 3HYMB 3RRUA 4A63B 5D3WA 4YTMB 4D2KA 3BVMA 1PY1A 3QK0A 1M4VA 5CTRC 1QQGA 2R5SA 4NJ6A 4GZDA 1RLFA 2D3CA 1RZ4A 4EKUA 3FUKA 3RN9C 4WQOB 2BGFA 1VRAB 1R7SA 3MP9A 3ZJUA 4EHMA 1N4RA 2DTCA 3ABKE 5FQ6A 4RF0A 3HW2B 3CHPA 3Q7FA 3PS6A 4NAMA 3CVQA 2K00A 3D9IA 3PSCA 5KNHD 3RULA 3PSEB 2BWES 2CR5A 4WJQA 4GPTB 1V1OA 2M1MA 1MIXA 1RAXA 2ZCBA 2YT1A 1T0SC 3RNFC 3ASGA 3TO1A 3UINB 5ITZF 3NY5A 2V0GA 2XRYA 1R4MB 4GPMA 5LX8A 3CK7A 5BMHA 2KDIA 4B6WA 4CYEA 5ANRA 4AY5A 5CHWA 2BQQA 3C8YA 2GBKA 3PZ2A 4RLYA 3Q9NC 1FNWA 1WE6A 4ZRPA 3DCXA 3ML9A 1N6ZA 4O1NA 4EBAA 2HM8A 3CHMA 1Y8RC 4BY6A 2Y8GA 4C80A 1GNUA 2RDGA 3ASNE 3CSTA 4LNIA 4GZCA 1C1YB 2LI5A 3SV1A 1Q10A 2ACZB 4MDKE 2PEAA 1JWGA 2LRWA 1TNOA 1WY6A 3S7DA 1NBFC 2VYIA 1T5XD 4LERA 4HAZB 1T6BX 5EILA 1FB8A 1WR1A 4KSKC 1QBQA 5CX3A 1X11A 3CVPA 4EZKA 1GAQB 3QWVA 3ZO5B 4LCDE 5DPSA 5ENTD 4GSWA 2MFQA 2KN4A 5L95C 4K5CA 2NCNA 4QJ4B 1FGYA 3MV3B 4IM0A 2L05A 1DROA 4O1PA 1UN9A 3ZKJC 2LBBA 2N7DA 2NYJA 1JRPA 3ZYMA 1S3SG 4MGIE 2Q13A 3OXGA 4OT1A 1OQYA 1NI1A 5JVLA 3LS8A 5D3YA 3NBNB 5KHQA 2XEWA 2B6CA 4K5BA 3DBSA 1WJ4A 5H92C 2QYJA 3ASDA 2DFKA 5JLJB 2RFMA 3DBHI 3HM3A 5AZGA 3AE6B 1Y6IA 3UM0A 5BUZA 3EUB2 3R7RA 2J52A 1BAKA 4BKGA 2REXA 4L9PA 1MI1A 2AXUA 3VR8B 3AE1B 2LOZA 5C1ZA 3FH5A 4R7LA 2DZJA 4MGYE 4LRZA 2PJHA 3D8FA 2AXVA 3AULA 4A6QA 3DQVA 4H7XA 4U63A 2D4QA 3CLJA 4I6LB 4F1PA 2KZRA 4KZCA 1C77A 4CDMA 3BJIA 4ANWA 4US8A 3KSLA 2KFJA 2M56B 3LJNA 2AL6A 2AL3A 3LB8C 5HFYA 1YD8U 3M63B 3B0AA 5FKAC 3KY9A 1FNVA 2EKIA 2VRWB 4D6WA 1S1QB 2J4BA 1KOTA 3OAWA 2KWUB 4PUCA 4HB2B 3MX3A 2BTDA 1W1GA 2WGSA 3DEOA 1U27A 1KZGA 3DBRB 3TEXA 2X6FA 2IY0C 4C0AA 1E8XA 2CG2A 5FIOA 2WXMA 4GA1A 2ON8A 2GRPB 3NWAA 2OEWA 3P1UA 1E7PB 1HZ4A 2L9BA 1NI3A 5DPTA 3U30A 5AQAA 4LTUA 1MX2A 3ONLA 4HB5A 3CGHA 3AG2E 3AE9B 4ICVA 5AJDA 3RFZB 3EJNA 3Q14C 1V55E 2IOLA 4I6JA 4JKDA 1BLXB 3DPYA 3PZDA 4G11A 4ATGA 2Y8FA 4DPRA 3CVNA 2PQRA 1K1BA 1EU3A 2L6BA 1V9JA 3QWMA 1WY8A 4DBBA 1SE2A 4ASWC 4MS6A 2YEPF 1XCQL 3UQ3A 3NSUA 2JWUA 2WDVB 1VBHA 5DPRA 2ASQA 3GZNI 4RG6A 2X0SA 2AEHA 2PPHA 1GPXA 2CS4A 1UD7A 4RGOS 1H2VC 4IFSA 3HG0D 2KM4A 1ZW7A 3F6QA 2KXPC 1K50A 2ZW0A 3PDNA 3TWXA 2J8SD 4FULA 3WCQA 4BVUC 3GS2A 3P42A 1DCEA 4CGVA 1KF6B 4NAWB 4DX1A 3SF4A 2FF4A 2IOSA 3Q5MA 1V61A 1BT0A 3V61A 1HS6A 1DIKA 4J8YA 2DYQA 2LXMA 2I9CA 4E71A 4HRSA 4KBQA 1ZGUB 3FUNA 1UW4B 4DI3A 4C4VB 2LYDA 2H89B 4GCOA 1C4CA 3DXDA 4NAWA 5IKCM 1NVLA 2VGXB 2K2JA 3VHTC 4HS2A 2L6JA 4YL8A 4IAPA 1NP7A 3UIPB 1H2TC 4I17A 2OVBA 2QHOA 2WQYB 2D9YA 1WRIA 4C4VA 2KDEB 4S0RA 3Q69A 3K9OB 4NJCA 3EGRA 4FU3A 2VGXA 4YVOA 4G26A 3ZNGA 3ZRHA 1YN3A 1FFVA 1Z3XA 2IYDB 2X6IA 1K53A 2WQ7A 1P5QA 3BZDB 4ZHPA 2IO3C 4JE3B 5IY5E 1B89A 2PNNA 1NL4A 2XK5B 3MTNB 4X57B 4CQNA 1GB1A 3MJWA 3MDBC 4JWUC 3JSVB 3BG1B 1QOBA 2ZNVC 4JHRA 3AU4A 2UWQA 1N5WA 3GZSA 1YX6B 3O65B 4N3CA 2XK5A 2GJYA 3PTFC 3C98A 3MC0B 3DOWA 2BKRB 4HPMB 5EE0A 5KJLA 1KC7A 4RH6A 4JK7A 3JSVA 4NPNA 2RKKA 5I2MA 4BBKA 2FCQA 3FP5A 3ZYLA 3FEXA 3K9IA 4JHJA 1OMWA 3U9WA 2MCNB 3ZN3A 1UEFA 4IRUA 4WJ7A 1V5MA 2W3SA 3LDZE 4ZYSA 2NS5A 1NTIA 3A4RA 2LMCA 4MT5A 3MHZA 4XI0A 4JHKA 1F77A 3ZYYX 4OZBA 2JZ3B 3NG0A 3GOEA 1Q2ZA 2MWSB 1OWNA 3PRZA 2YVCA 4M8MA 5FQ8A 3V3XA 1HEZE 2L32A 2MJEA 3IAM1 3UT8A 4HATB 3P2BA 1QF6A 3AEEB 4MSQB 4L7TA 2K8HA 2I2OA 4AXHA 2J0JA 4CEMA 1TS5A 1VCBA 3BG0B 2CB8A 3SFDB 2K8BA 5CERB 3I3TB 2VSXE 4HAWB 2W54A 3IT6B 2R59A 2VQ2A 1O5MA 1ISNA 4L2YA 2M63A 5CLLB 2G3QB 4KT6B 1RFAA 1WXVA 1MIZB 2ROZB 3CVXA 5C79A 3AEBB 5IN7A 2K1FA 2KCLA 5HS0A 3ODXA 2IU1A 3J5PA 5C2TB 1HH8A 2IBIB 2VRRB 5BW8C 4A55A 3EHRA 1N52A 3QBVB 1LGRA 3DEPA 2N9KA 1LTXA 3FU5A 3ZIMA 2WU2B 4RFBA 3CXBB 2NC9A 4YNDA 1PGXA 4JKGB 2JT4B 1I4GA 4YT0B 1YMHE 4K2OA 4BTAA 4BKTA 1DDMA 1RW2A 2OHFA 3TWTA 4HAVB 3JUEA 1UZXB 2KDMA 2W2WA 4HI8A 5FWQA 3CVVA 3DWLG 1K52A 2DYBA 2ONQA 1FNUA 1SZ9A 2FJUB 1LF8A 3V31A 2MEKA 4GB9A 3GB1A 2CFUA 4JKGA 1U2BA 2NTSA 1WGRA 3I4GA 5G04J 1MZCA 2TSSA 2BEDA 1E90A 4K0RA 1SQMA 1WXAA 2KYWA 3ZTCA 4O1OA 5KQ1A 1UNQA 1F52A 3Q4AB 1IYGA 2WWZA 4HCNB 2FULA 1MPEA 3R2TA 3SQVA 1E0ZA 3AE4B 3KUZA 5D94A 3DXCA 3Q3NC 3UT4A 3QKYA 2XEEA 4GMRA 4JGHB 5H7PA 3RIBA 3VTUA 2JF5A 1G3NB 1N0RA 3AXCA 2OTXA 1TIFA 2PL2A 3ZDTA 3HM6X 4ZRJA 3NRZA 4G50A 1JWBD 1HG5A 4DHZE 3NVZA 3ZJTA 5ENPD 2AQ3B 1N61A 1SB3C 3ZRFA 4DQOC 1HQRD 3NOBA 4JX1C 4A6HA 5DHFB 2P0HA 3J5QB 3NB2A 4PH4B 2JVCA 4URKA 1U5FA 2WXKA 4IN3B 5E6PA 4MACA 1N4PA 3OLMD 5T4YA 2D11A 4Y6CA 1ZXIA 1HTQA 2UWJG 4KX6B 4FN2A 1MK9B 2FBNA 1QZ2A 1SF0A 1FT1A 3LVRE 4ATZD 4IWQA 5ARFA 2HJ8A 2R2OA 3T5VA 3HQCA 3LY9A 2V3SA 4OVVA 3T8KA 2KN5A 1KTKA 2KZTB 3P4SB 4UWGA 1JUQA 1WDYA 1WRDB 1AQCA 2ZGGA 1WGGA 1F0ZA 4GMVA 3U3WA 1FD6A 4NACA 1D9SA 4W9EA 2IJGX 3ULEG 2C9WB 1V5UA 3J9CA 4HOTA 2DWQA 5D0QD 3MHSD 1V5TA 3PH0C 3VXWA 4YSXB 3MPXA 5CBOA 2BYTA 4AQ7A 3KW5B 2K8EA 5LOZA 5BPPA 3H1UA 2GI9A 2KZTA 5D27A 3IHVA 3VRBB 1FCLA 2QMTA 3QARA 4IWPA 3KWLA 1M94A 1V81A 2KANA 2KT7A 4DIXA 2FDQA 1A17A 1WGQA 3VVWB 3V2OA 3F5RA 2Y4TA 1FXTB 4N2SA 3FC4A 1DOYA 1GJZA 5HE2A 2V3PA 1YNTE 3LKUA 2ZCCA 2R61A 3APDA 2C5LC 3D3MA 1PAQA 3RK6A 3Q79A 2MSED 3FULA 3BVGA 1B1ZA 2N7JA 1CZPA 3CR3A 3WAMA 3KYCD 3SO8A 2Z4DA 3R3MA 4ILJA 1U2VG 2XCCA 1N0QA 2FUG1 5CMWA 3TXNA 4HOUA 4QQIA 5IRSA 1IGCA 2XQ0A 1WYWB 2F37A 5JP4A 1D8EA 3PZ3A 2V8SE 3M1IB 1FT2A 4NURA 5BT1A 1U5EA 1UNSA 4HRLA 1ROEA 5T3RA 4GOCA 3ZW3A 1B55A 1WWTA 3JCKC 1OWPA 2RDBC 3KS2A 3SNHA 1ELWA 1TY2A 4GZ5A 3E4BA 1FMAD 1MX6A 3ZXSA 3KQ4A 5KJMA 4A3PA 2C0LA 1SSNA 5ENSD 1X86A 3RNCC 2EMSA 2KX3A 1JWUD 3HK0A 2RDHA 4HK2A 4U8HA 2B3AA 3CWIA 1UWXA 4U8YD 4CGWA 5EE9A 3VTXA 3B2GA 1UJKA 1QOFA 4D0NB 2KJ6A 2F0YA 4KMOA 3CK9A 3B1LX 4CDNA 3RUIB 1BPOA 4BZAA 5LCWC 4U96D 3RNEC 3OXFA 1KFYB 1SXTA 4GZUA 4OZAA 4HWIB 2JYEA 4HDQA 2AW6A 2FO1E 3DSXA 1FIQA 4BESA 4ANUA 3ULCA 4F6RD 3QWZB 4MLPA 1JDEA 4K2PA 3OJ4B 4G8KA 4LJOB 1HO8A 4GPKA 1MJDA 4U0SA 3DBHB 3ETRA 2J9QA 2LSUA 1M7EA 2K49A 3ALBA 4MELA 1H8CA 1U3DA 3TWWA 2ADZA 4Q69A 1WG7A 3NOGD 2COPA 2CRFA 2HE0A 2DX1A 2FNJB 1OCCE 3WXXA 4AY6A 2MX2A 2ZZPB 1P0RA 1WGHA 3RZFA 1LW3A 5IO9A 4P16A 3R9AB 4ACFA 2KX0A 4J8DA 4TXRA 4GDKB 1EU4A 3I57A 3JW0X 3FTXA 4YDEA 3DSSA 4GTOA 1RWSA 1T0YA 2DKQA 3ZGQA 3ASFA 3DPDA 1QC6A 4HAUB 3U7DA 2ZIRA 1I2HA 1FFUA 3ZTDA 1WJNA 2M4NA 4LCTA 2KMAA 2XNAC 4C0MA 2WM9A 1BD8A 1GB4A 2KQ4X 3AG3E 2VGEA 4GDKA 3ULYA 1WMHA 2P9NG 1HFAA 4KYOB 1ST7A 4K17A 3G9WA 1XCTL 1OWMA 3VTWA 1L5JA 5DCNA 3ASHA 3SR6A 2NBVB 4JK9A 1TBEA 2L1AA 2KK8A 4LNOA 5JXVA 4F7HA 1V97A 1HB6A 2Y1LE 4B0ZA 1Q0WB 5AUKA 4JKBA 4EOYA 3FH7A 2Z0EB 4JIOU 3FTZA 4TRQA 5A7DB 3FLVA 1WI1A 4XE0A 3N9YC 5G2NA 1NEKB 2LXCA 4F7ZA 2NBVA 1EPUA 4DJAA 1QQEA 1PDXA 3TL5A 2LGDA 2MJ3A 1OQQA 3V79K 4CHKA 3FM8C 2X6HA 1KM7A 1KLXA 4FJYA 4DXAB 1C78A 1NYRA 4XWTA 4MEMA 4S17A 4FHKA 3UUXA 2NZ8B 3NW8A 3EA6A 4WURA 2RVBB 3E9PA 2J4DA 5DH9B 3DSWA 3ONKA 5J18A 1NTYA 1MHHE 4IWOA 3BVZA 1IYFA 2KCVA 5TR5A 2CQUA 4JKCA 2NR2A 3GZNB 2C7HA 1O1RA 2BB5A 3VUYA 4HFGA 4JZYA 1BMLC 1VZ7A 4REZA 4BWRA 1T3QA 2GUMA 4K7WA 3G2SA 3ZPJA 3TUOA 3NZ3A 1STEA 2Y4UA 4WWMA 3AG1E 2BS4B 3N30A 1FHXA 2KIGA 5FT9A 4J8EA 2N0SB 4JW1A 4XWXA 3NJTA 2OEDA 1Y8MA 1XGWA 1A70A 1JALA 4IG7B 5EN5D 4MGZE 3L82A 4AM9A 1YQBA 4GTRA 2KQSA 5AUIA 2LEKA 1TY0A 3W1YA 3QA8A 2DLWA 2OQBA 2K6DB 2LGIA 1LXDA 1NFIE 4DX2A 3E34A 2P58C 3BU8A 2FEZA 3IHYA 2JPHA 5BMIA 2H6HA 4PQ0A 3ML4A 1IHGA 4K7SA 4GN1A 5A6CA 1SA5A 2H6IA 1EF1C 5AQBA 1WGDA 3I63C 4FA6A 2B0OE 2D2QA 4IOYX 3KZ1A 1XO3A 3RNBC 1WF9A 1K8KG 2QZAA 1QYMA 1YJIA 4IW0A 2NMQA 3DHIC 1NU2A 4TQ0A 1MPHA 5GMVA 2RRFA 4KGSA 4USAA 2LUEA 1OEYA 3SFYA 4A9AA 3ULBA 3NOCD 2MH7A 5IA7A 4L1BA 1XLPA 1TR4A 2KGXB 4DUIA 4B6HA 4YSYB 2KLGA 4K1RB 3PZ8A 4W9CA 2ZPYA 3LDZA 2RSUA 1D5MC 4HKZE 4PYUA 1DBHA 2N23A 1BI7B 2O6VD 4B9KA 1C4AA 1WE7A 4E74A 2FUHB 2CODA 3AEGB 3V6CB 1Z6TA 2M14A 4MJSB 3W5UB 1TJCA 4TXPA 2VGYA 5AARA 4JK8A 3LCAA 2CJNA 3C5RA 2H6FA 2KMMA 4LK0M 4GTMA 4HNAD 2C0MA 3MYVA 5L83A 2LGYA 2DBYA 2WDRB 3CHSA 3AH7A 1KJTA 2DAFA 3HVDA 1C3TA 2G45B 1AN8A 4MJSA 2H7EA 2K6QA 1SGHA 1IQUA 2Z14A 1FVHA 1YOVB 2NSZA 3GP7A 2LJ5A 5BMGA 2XPIA 1N3HA 5E6OA 3PEVB 1QT9A 2NVUI 4BKSA 5ARGA 5L81A 2V5QC 2DZIA 1UUPA 2LHDA 3QAQA 2IGHA 4YWGG 3URZA 1L5PA 5BXUA 4NJ7A 5C1DA 4NQLB 1OY2A 2ZISA 1Q67A 5DPWA 1P98A 3AEDB 1KLVA 5G5HA 2VH1A 5JHBA 2V4IB 4FLHA 5AJLA 4BBNF 4I43A 2KCJA 2PM7A 2Y5CA 3AB5A 2Z8LA 2J0KA 4K81A 1MQSA 2KVZA 2GRMA 2X38A 4AIFA 5JHGA 2L76A 1WAO1 1J7CA 4CSQA 3W1SC 1GG3A 2FIFA 5FI0A 2INCC 1H6PA 2FI7A 3B7SA 3CIAA 2BKFA 5IP4D 2JRIB 2N7EA 1WGKA 3ZDMC 1H19A 5EE1A 5G05J 4K3BA 3EUVA 4BFRA 4IDIA 5HG2A 2V9HA 3DSUA 3FTUA 4CYMD 3TEYA 4HB4B 2KUPA 3KYDD 3A33B 1BUIC 2FIDA 5ENOD 2IEJA 4HAXB 1EWYC 1XXGA 1XX0A 4GU2A 2RSGA 2GLSA 4MBGA 5FQ7A 1N94A 3UI3A 3AJIA 2D9VA 3QDNA 3MFGA 2RD0A 4F1SA 4GYYA 1XT9B 1ESFA 1P3QU 3JXJA 4P29A 3NWFA 5E75A 3SY2A 2GOWA 5LFAA 1C4PA 1UG3A 2KNBA 4M8NA 4DHZB 5EX3A 3EFUA 2KC2A 2OCCE 1INZA 1KPSB 3P4QB 1PMSA 1ZYIA 3NF1A 2IO0B 4UQZA 3UXGA 4JA7A 3QC8B 2X3MA 2WVIA 4CHJA 4A8XC 4ITKA 5HQ8A 2XEVA 4D10C 4N6EB 4YVQC 2KATA 1XCGA 4APFA 1V6EA 2HO1A 2WXFA 5HE1A 1YN5A 5C23A 4M01A 3BK2A 1TYGB 4NNJB 4II3B 1SJHD 2KUQA 2WYQA 1FRRA 4BETA 2DYNA 3KUCB 2UZSA 3EFCA 2MBQA 5AZHA 4BOZB 1EGXA 1TQZA 1ZVRA 1YQ3B 2VZKB 1Z5SC 2B76B 3CQGB 4M02A 1HXYD 3VOQA 1XQQA 1SE9A 3GW4A 4GGQA 3ENEA 4MKTA 2M8SA 4U04A 3AU5A 4RF1A 1OFFA 3UPVA 1TNYA 1UBIA 3UMVA 1SW6A 3ZU7B 2DN6A 1UBQA 5EE3A 3RRMB 4HORA 4DX90 2MHJA 4QFVA 1Z87A 4UWHA 3BINA 4BSZB 4HXDA 1NZNA 1PYWD 1V88A 2SAKA 4E85A 2BF0X 3IKOB 1PQSA 2MDXA 2L8JA 2V3NA 3WANA 2K9XA 1N63A 2CU3A 1VD2A 2C7MB 1HG2A 2UVMA 1IQRA 3JYSA 4GTVA 4DHJD 3QOUA 1ZUD2 4RGNA 3U2SC 3N71A 5A23A 4LNFA 1WFYA 2LD9A 3JXIA 1Y5OA 2GB1A 5GXGB 4KGTA 3ZFWA 3DVGY 4B8AA 3M95A 5J3TA 3PNLB 1OWOA 4GAAA 1E6EB 4A3TA 3N32A 3Q3MC 5D3IB 1ENFA 2P2CP 3UIOC 1XR0B 3TWVA 1IXVA 4RG9A 4L23A 2KDFB 4N9F4 2DHIA 5BNWA 4RCOA 2N1VA 3SHFA 4BX8A 1K51A 2P0DA 4ANVA 3GYPA 2KWDA 2Q5WD 2LUHA 3ESKA 2RGFA 4XEIG 4N58A 1ELKA 1E8WA 2UY1B 2IY1B 4HJKA 1FCHA 1WM5A 3FUFA 5KNGA 2JUOA 2QFCA 2YHCA 2JX5A 1H4RA 1NDDA 2QC9A 3PO0A 1MHQA 2BS2B 1MX4A 4NZLB 4B0MA 4WAAA 2VSOE 1EM7A 2HRJA 2GW1A 4OSNA 1Q1OA 2DYOA 3A1QB 3D9OA 2QILA 2UY1A 4HB0B 4E6HA 1SBBB 2YT2A 3L6AA 1TT5B 1L0YB 2BYFA 3R8BA 5LLIA 3TEZA 2L0FA 3PRMB 4BERA 2WXQA 3WIMA 2KQ7A 3Q15A 4J6IA 4GMJA 4Q94A 3ZEFA 5G04C 1R4NB 3PUJA 3D9KA 2D07B 4U07A 2KAJA 2LO6A 3RAUA 4HAYB 1TJ6A 2MP2B 2N9XA 3A1QA 2RGNB 2L83A 2LGSA 3Q8BA 3ZKJA 4L6EA 2R82A 3MJ5A 3FUDA 3NQPA 2KIEA 1VJKA 3SEBA 4DXFA 4PNKA 1X05A 1H10A 3ABME 2KBXA 1L4ZB 3QQ8B 1HZ5A 1ZM0A 2NXPA 4I6PA 2MP2A 2RPQA 2Y7BA 5ANLA 4JL9A 4AP4C 4UQYA 3IEGA 2GRRB 3FU3A 2XBBC 4GXBA 3VLEA 1P9DU 3I5PA 1BWNA 4EPZA 3A8PA 5LP0A 1V89A 2RMMA 4JKEA 2Y5PA 2ELBA 3E33A 1AWCB 2I1JA 1I4RA 2DX5B 3M3JA 5FQ4A 3NUHB 4HEA1 2ZPNA 3HRDD 3PZ1A 3WALA 3E37A 3PVWA 4UWLA 3RPFC 4GOUA 4P1BC 1TKGA 3KWVA 3FUIA 2L0TB 2DZKA 4KHAA 2E2EA 1U4AA 5FZRA 3N1YC 2FJ9A 2ZW1A 1I4PA 5AZFA 4ARIA 2CU1A 2DX5A 2CY5A 3Q47B 3FWVA 2E2XA 2BUGA 1V49A 2K0PA 2P8VA 3CSFA 2GBMA 4KZ0A 4DLOA 1RFKA 3EHQA 3U52E 5IJMA 4G23A 3VLFA 5LXIB 2XPZA 2PLPA 3HSAA 1U29A 4XDDA 3C72A 2EELA 5EKQD 4LG6A 3TSSA 2L0TA 2DNFA 4GNKB 5I2SA 3IXEA 3ECIA 3ZNID 2MKRA 1F2RI 2WXLA 2IY0B 3EECA 5HE3A 2JU6X 5ENQD 2ELAA 2YRYA 3Q3FA 3VIAA 1V5PA 4ZOHC 4N3BA 5B3SE 1PFDA 1QZEA 2Z0OA 3DHGC 4I6EA 2BYVE 3L08A 2J4XA 4PS7A 3S7FA 1C9FA 4I9CA 3NHEB 2QKLA 4BAXA 2K39A 1DDWA 4AEZC 1WXMA 2KLCA 2YQ8A 3PUKA 3FTYA 4N39A 1JCKB 1JWAD 1Z5SB 2E6XA 5FR6A 3DXMG 1VZ6A 2A5UA 3CHQA 4YDOA 3RO2A 2D3AA 1Y56A 3Q6BA 2COFA 4UQXA 4MK0A 2WDTB 3IAS1 2K3UA 1EWCA 4CDRA 2P0FA 3UGBB 1KZPA 1LM8B 4A5KA 5BO4B 4JKHA 3IG3A 4X8QA 2GBNA 3SZ7A 4LUNU 3JVZX 4GDLB 1LD7A 1YJ1A 3VAWA 4GTTA 1OUVA 1V86A 5KQ4A 3PE3A 3CVWA 1TNBA 3F0WA 1T0QC 2W2XC 3HXBA 2WXOA 1XD3B 1TZOA 3C19A 5CRVA 4ZHOA 2BF8B 2ZVNA 4UWFA 3OWEB 4QXAB 1P7FA 2W9NA 3NS8A 3QJZA 3APFA 2XRZA 4I1AA 1ZC3B 4I1MA 4GDLA 3LY7A 5T8IA 1HXIA 2EIME 4L1RA 3G2TA 3N7CA 4KVOA 5JZEB 1S70B 1WIAA 3V6EB 3L16A 1KT1A 2MBBB 3T06A 3B7TA 3CHRA 3DSTA 4UI9J 2KJRA 3RU0A 1AP7A 1E5WA 4RMAA 4CCAA 1EO6A 3BK1A 3DBRI 2WXIA 5BV0A 3EC8A 1WX9A 4MH8A 2HD5B 4GTSA 3FTWA 3D9MA 3CF6E 3WG7E 2EINE 3HXEA 4JKAA 5HKHA 2JEKA 2GS0A 1GOZA 4W9KA 3NVVA 3V05A 3LYAA 1NYQA 3JYUA 4QJ3B 2IO3B 1I4XA 2G9HD 1JCQA 3TXMA 1MYOA 3TW1A 2BTEA 5FZQA 1HA5A 3VTVA 4L2LA 1SIFA 1E96B 3BYTB 1H6KA 1P3RA 1EUVB 1C79A 5KHOA 2ZNVB 5CCLA 1KH0A 3PT2B 1DCQA 1IPGA 4HOQA 2QSDA 4PK1A 2GBRA 2C7NB 3HXDA 1MK7B 1ZB1A 2WDQB 3EHMA 1HE8A 1V8CA 3ODOA 3B7UX 4K3CA 4JPSA 1E9MA 1QILA 5D6JB 2OJRA 4C9BB 3E9SA 2EIJE 3FUJA 4KDLB 4UDUC 2NBWB 1MG4A 4OVZA 1Z3YA 3EIJA 1OCOE 2RFAA 3CV0A 5J90A 2CHZA 1ZC4B 3O48A 1TKYA 2R2QA 1FO4A 4WNDA 3FH8A 5KCMA 3HRAA 1CMXB 1IHBA 5J08A 1EVHA 5H8YE 1J8CA 3Q8EA 1L2NA 3R9MA 1TZ1A 2UYZB 4KKIA 4LDTD 5LXHA 3FEHA 3HUIA 1TNUA 3UX4A 4AV7A 3RT3B 4M00A 4EJNA 3S2AA 1BTNA 1UNRA 2LASA 1AWEA 3FUEA 3LVQE 3B7RL 2LSVA 2RPVA 4DHJB 1GUAB 3ENBA 2IJ0A 3ZVRA 1HX8A 5KBAA 4ACLA 2DAJA 3QNKA 1N4SA 4EUTA 4OYSA 1K3ZD 1JMLA 1SE4A 5D7GA 3D32A 1J7AA 2L00B 2VSZA 1L0XB 1T77A 3AJ4A 1TKEA 3AI5A 1F9JA 2IO2C 5HKPA 2EKEC 2KWVB 2FJLA 3B9JA 1TEZA 3DHHC 2OV8A 3GYZA 2P9IG 2Y3AA 4G24A 1YCSB 4U0UA 3P4PB 2EJ8A 5D2MC 2Z0QA 2DHJA 3P1MA 5EDSA 3QWPA 2PE9A 3PNTB 4XKBA 5AQ9A 2X8XX 4MH0E 2R17C 3A4SC 2ZXWE 1XLNA 1ACAA 2Y5BB 3JUIA 4LNUD 2H7DA 2KHWB 1DOIA 1VR9A 4IM2A 3AE8B 2IFUA 5AYWD 1VDVA 3EDTB 2N1WA 4I9EA 5FZSA 2XZDG 2YS5A 2FO7A 1N5XA 4APOA 2XZTG 4J0UA 2LVQA 3TMPB 3PVLA 2HDEA 5DIFB 3KSYA 3Q78A 5DBKA 4HLLA 1DYQA 2YLMA 2HYZA 4FLBA 1XEEA 2EQXA 2FAZA 1DVPA 5M72A 1A5EA 3OHMB 3IHPC 1TS2A 3SD5A 1Q5WB 3ZUNA 1GGOA 2J0MA 3I9V1 2ZKMX 1RRPB 1HBKA 5CEDB 3D9LA 2NBUA 3AG4E 3B2FA 3HIEA 4HBDA 1PGAA 2WXHA 2WB2A 2AYOB 3RRNB 3PREA 4AOFA 3SUZA 3L4PA 3TWUA 4EMOA 2LGXA 4RGTA 3PV1A 2Z0PA 3FVCA 2JRHA 3OXLA 4W9HA 1I42A 3Q8FA 4LNKA 4HDOA 4DX5D 3CVUA 3FUMA 1BXTA 1UGJA 5ENRD 2WX0A 2Y0BG 1FAOA 2LULA 4TKNA 5E6NA 1K1AA 3FP3A 1ET6A 2QKMA 3P4RB 1FHWA 1WGYA 2EMTA 2OVFA 4F7GA 2OOEA 2KCKA 4GA2A 1I7AA 3HHMA 3T9LA 5CRUA 1AYFA 4B95A 3U64A 3UINC 2CY4A 5DI9B 1FRDA 2LVOA 1P7EA 2G35A 1V54E 2K8CA 4A6FB 2C60A 4P1CC 2JZPA 5FINA 3Q8CA 1TYQG 3A9KB 1TJFA 4OVUA 3FUHA 1JCSA 1DNPA 5C6RA 3AS4A 4I1OB 1SJED 4MM3B 2PIAA 1L7YA 3ODWA 1MAIA 3T9KA 1V1PB 4A6FA 2IGGA 2IF4A 2O2VB 4U95D 3E9OA 4PDXA 1WM3A 1ZKHA 3A9KA 5D3DA 2HTME 2QIEB 4FXCA 3FU6A 2X18A 3KRXA 2RQ1A 1ZBPA 2V76A 3KLSX 4MM3A 2ZVOA 1QOGA 1WGUA 3W9GA 1KZOA 3CVYA 1V1PA 1N95A 2V1YA 3H6NA 2O2VA 3L0WB 4EBAG 5E6JA 3JQ1A 2XPYA 2WXPA 4OAVB 4MY6A 1ZE3D 5FTPA 4YTNB 1VDYA 1YA0A 4BX9A 2LWPA 4TMAB 1KZ7A 1F2RC 1N11A 2YNQA 4GYWA 5HI7A 3V60A 2XS8A 3OJ3A 3AEFB 3PLVA 2P9SG 2GRNB 3MC9A 3P6AA 2AXZA 2PW9A 2PMVA 1KLGD 1OQNA 4PS3A 3DXKG 1ET9A 3SFZA 2F8YA 4M3OA 1S63A 4ANXA 4TUMA 3UKRG 2V0PA 2XS1A 3L13A 5J3QA 4OHJA 3C3RA 3APCA 1V5OA 1BU9A 4NIKA 4JQWC 3GZ1A 3FEYA 3FHEA 1I35A 4JEUA 4Y6WA 3SGHA 3EPYA 3VLDA 3MKRA 3FSSA 4DDID 2GROB 5HRYA 5LOPB 4GIVA 1UELA 4WWOA 4ILHB 4RVBA 2GGFA 2KVRA 2D5GA 2DLBA 2J09A 4MGKE 5IAAC 1PC2A 4UI9K 1NENB 4CZ2D 1MKEA 2QC8A 2D9ZA 4A90A 1ZSQA 4Z2MB 3TGOA 4OAUC 2JQRB 2DA0A 3C3QA 4FHJA 4BBNC 4Z2NA 4ILHA 1OEYJ 2LXAA 2CJOA 1VLBA 5LG4B 4HCPB 4DXGA 4E3CA 3FTVA 4NSWA 2FE8A 4KV2A 2XGMA 4GYOA 4KIKB 4Y94A 5MPOA 2QCZA 3PVUA 2AQ2B 4Z68A 1N54A 2R03A 5G05C 3NS1A 3TVVA 3H7PB 4CT0A 2ZJDA 2M0AA 2I1KA 3ZVVA 2JABA 3LPZA 4JEHA 2D10A 4W9RA 3KSQA 5EIDA 2GCLA 5C5BB 4KIKA 2MQJA 1HTOA 1JWMD 3KVFB 2BKGA 4FADA 3HXFA 3L9TA 2FCSA 1S64A 2IYBA 1GW6A 4KVGB 1XLQA 5AN8A 5BXOA 2KDBA 3BUAA 4G1TA 3H7PA 2HR2A 1CQVA 3PZ4A 2MOWA 1D4BA 3MZLB 2KO3A 2R2LA 2MW5A 3D9NA 5CHVC 2Y69E 5C5BA 5BYQA 4IUMB 3UT7A 1DYNA 2MBOA 1GC6A 2Z59B 4MT7A 3QX1A 2ROVA 1UGMA 1QOAA 4LDTB 3G2VA 3V62A 1OWLA 3TIXA 2P9KG 2WHIA 4EECA 2VTBB 1UF0A 3N20C 4F8CB 4LNGA 2R05A 1OCZE 1P5TA 3C3OA 3SO6A 1PUTA 2Z59A 4F7AA 2KXJA 1ZU2A 4GA0A 4J8FA 2LHEA 5FI1A 3DCGA 2VTBA 5KCVA 1PFJA 3PG7A 3SI5A 2KTFA 2BPSA 2DZNA 4WUYA 4HJGE 4HPLB 1DC2A 5EFXA 4Q2JA 2AVPA 1TN7A 1WVHA 4IM3A 1FM0D 1U5GA 2MLBA 4AJWA 4HHVA 3TWQA 1WG0A 3V2XA 3N1XC 5DHAB 2M19A 4R3DA 1EYHA 2KKCA 2E0IA 2IONA 1KT0A 4HI9A 4QJ5B 2MWNB 2Z0DB 4NQKE 3ZNGC 3DDCB 2AWTA 3SBSA 4LJPB 3CIKA 1RJ2A 3UIPC 2J7QB 4RNAA 4AS1A 2R2YA 4HLEA 1JRUA 3O96A 2CAYA 3ULQA 3KAEA 5JHAA 2PVGC 4YXDB 4GCNA 2K22A 2I6HA 1FPYA 1D6EC 4LSZE 3CHOA 2X6KA 4IOIE 3BYYB 2L52A 2N0YA 3D9HA 3IV0A 4KXKB 1UH6A 2WPVA 1FHOA 2QEJC 3UM2A 1ELRA 3ASOE 3UQBA 4CT4A 4BOSC 2MA9B 3Q8AA 4F7UP 1RYJA 3VR9B 3X2QE 2AJAA 5EIBE 1N62A 2RG8A 2HTHB 1K8RB 1JWFA 2BS3B 2PE6B 4W9GA 2BYEA 3AV8A 3R7QA 1H0AA 1X5BA 3NVWA 5HE0A 3UZTA 4WQMA 4G8LA 4DX7D 4JL0A 2MYOA 5LONB 4YDYA 4FC8A 4MRUA 1EF5A 4I6GA 2L2IA 2HTHA 3DWGC 1NTVA 4IYPA 4NQ0A 3L17A 3UM1A 1DGJA 3ZLZA 2N9PC 1LQBA 2KC7A 3V5WA 3UTMA 4C56C 2WS3B 2CG3A 2XQNM 4WSFA 3AE3B 2KFKB 2OOBB 2NTTA 2XEHA 3AN1A 4KAXB 2IGDA 3D9PA 2LJIA 4BTBA 5J17A 4XX5A 2P9LG 4RSYA 3I3NA 3IT4B 3ABVB 2BKKB 5GOWB 4FP7A 1SZAA 2V4LA 2INDC 3H8HA 3VTYA 2KFKA 2JP2A 2A4ZA 4TUUA 3E66A 2M0XA 3MEKA 3BWUD 2CHWA 2LAIA 4XI9A 2Z13A 1L6UA 5E76A 3DBLI 4XWWA 1G6JA 2YINA 2KACA 3GE8C 5CHFA 4I2ZA 3ZHEB 4W9IA 3RD2A 2KWCA 5AQ7A 3ZXPA 2E3TA 1HZ6A 2LUMA 3CKCA 4A6KA 2BB6A 1NA0A 3PHWB 2RR9A 2LAHA 1KI1B 3IBEA 2X6JA 3ABLE 3FY4A 4BT9A 4N2QA 4M7CA 2FCMA 1OQRA 4AUQC 5AAOA 1WYGA 1I4QA 3X23A 1UNPA 3QIJA 2QDFA 4WNEA 1MFWA 4KGRA 3ONSA 3FFLA 1EF1A 2YSZA 4KVMA 3B95A 4Q96A 3ZHEA 1ZDVA 2N9LA 3PZ7A 2IDYA 3ML8A 3RSEG 4OZCA 3BEEA 4M0WB 1MJ0A 2J59M 4KHOA 1FCCC 2WX1A 3UM3A 2HE7A 4BSXA 2PZIA 1UJJA 1S0PA 2BVCA 4EZJA 2DHZA 4WJNA 3P63A 2UZRA 3A98B 4MSMB 4XKCA 4JC8A 3NAWA 4HPPA 4LNNA 4HKQA 2LVPA 3FDHA 2QYUA 4ICUA 4M0WA 2N9EB 3FILB 2LRUA 3AM9A 2H6GA 4TQ1A 4RM8A 4O60A 4GU5A 4WIPA 5IOIA 4JD2G 1E8YA 3O13A 1WJ1A 2SEBD 5BYRA 2BWFA 4WNGA 3LY8A 2LFIA 3MV2B 4PYZA 3RJVA 3LJ3A 5JMND 2VSNA 2YEPB 4B89A 2ETBA 3NWDA 1TN6A 2YT0A 3EIQC 2DENB 4ILGB 3U8ZA 1E8ZA 1KLUD 3FILA 2IO1B 1LO5D 3N3KB 4XGAB 1V2YA 4FJZA 2EIKE 4DDGD 1FEHA 1WR6E 2COCA 2PVOD 3MGBA 2RNRB 3FKYA 1OCRE 1OXJA 1TXDA 1XLOA 4ILGA 2DZMA 1H2UA 2LNIA 1QLBB 5C16A 3UKUG 2W2XD 3TWSA 4LEUA 3P7ZA 4JLCA 4G2VA 1MI0A 1JQ4A 2PQNA 3U4TA 2M17A 1R4MI 1HB8A 1WX7A 3KEAA 3Q49B 2GRIA 4UI9C 2I5CA 4A3OA 3A9JB 2HJ1A 3T3OA 4TV3A 4W9JA 4EZLA 1NA3A 3VRAB 3CKBA 4A3VA 5AIJA 3SBGA 1VBGA 1ZP0B 3NZUA 4U7EB 3W1SA 2A5EA 5AEKB 4IKGA 3I4RB 3Q7AA 1RM6C 4N3AA 3A9JA 3CK8A 3ZXVA 1P1AA 2ONDA 2YF0A 1J19A 3L22A 1DDVA 3RKVA 1YJJA 1XKEA 3A58A 1I4HA 3G2WA 2CFZA 3AE7B 4F3VA 2MRPA 3Q2AC 1FOEA 2KD0A 1E7VA 2C2LA 3QHTA 2LZ6A 1SA4A 4HB3B 3LEWA 4XZ4A 2L3ZA 4W9DA 3TAXA 3G2UA 3ISMC 4C0EA 2ZEQA 3BIID 2DWZA 5CBNA 2O6VB 3S7BA 3ZRCA 3KD7A 3ZGZA 3GYOA 3OTNA 5LNK1 1KRHA 3HVZA 4CRWA 2D3BA 1U3CA 4XC2A 1IGDA 2IZVB 3AMZA 2YS3A 1MHXA 1RRBA 1LFDA 5FJYA 1SHCA 1TS4A 1OGWA 4HROA 2O6VA 4KDIC 4CO7A 1JPLA 3AS5A 4A1SA 3EU5A 4HRMB 2OEVA 1UPRA 2DBAA 4HOSA 3MC8A 2XENA 2WXRA 1V80A 1ZDXA 4WJOA 2NPTB 2K5PA 4XYCA 4KSLC 2ICIA 4WWNA 3WA0A 2DVWA 4WWPA 4YTPB 1WJMA 3A8QA 3NVYA 3T3NA 3U66A 3SDLC 1SIJA 4OW0A 3KH0A 3LYYA 1BI8B 4BT8A 4ZDVA 3PEUB 3LJUX 4B94A 4ACKA 3FU0A 4UWKA 2NPTA 2J42A 5CCMA 4DX6D 4N59A 5JHHA 1SE3A 3W9CB 3UF8A 2MRIA 3TCAA 1WXSA 4HQDA 5B1AE 4ZHBA 1FGZA 2CKHB 4XIFA 4RQIA 3SNXA 5D3VA 3WYFB 1AWDA 3JQ0A 3U4EG 5HI1A 3QC1A 4V3IA 5DIZA 2RLOA 4TSSA 4C00A 2LXLA 4JA9A 3TG4A 4DK5A 1W1HA 2LG1A 4DI4A 2JXXA 3Q3JA 3UIOB 4RM9A 2KMCA 3VDZA 2XGOA 3M62B 4PT5A 2DYSE 1K5DB 3GE3C 2DYMA 1JWSD 2G4DB 4N5QA 1VZ8A 2R09A 2W55A 2MJDA 5CLQB 2VH2A 1D3ZA 1OT8A 4C7ZA 3WAPA 3RMKC 1FXIA 1QKZA 2J07A 1P6SA 3C0RB 3DVGX 1M7RA 1L4DB 1Z2MA 1LB1A 2INNE 1MVKA 2WXNA 4C48B 4G0NB 3E32A 3VFKA 1EAZA 3ZNZB 1FVFA 3LXFA 1D5ZC 2KTRB 2QJLA 3LXUX 4J7WA 2WXGA 3EU9A 2KC1A 2I2YA 5D0OD 3CIRB 3IXSA 1XNFA 1TJEA 5G55A 1KBLA 3ZYKA 4GZ3A 1WJ6A 2K2UA 2KR0A 4P7IA 1LD8A 1NVID 4AWJA 1Y19B 1WSPA 2KTRA 1XD4A 2JYTA 1IUEA 4EQFA 2BBCA 3AAAC 3DVNU 4H2AA 3VH4B 2GMIC 3FTSA 3ZNHB 3WAOA 1FPPA 5JJTA 5CECB 3PEGA 2V4HC 1TN8A 2KJHB 4AP2A 1SVXA 5J2RA 4TXQA 4RGMA 3HIZA 3Q3OC 4K7UA 2PM6A 3BY4B 3PGEA 1ZOYB 2XN9C 4W9FA 5ENNA 3AECB 1CJEA 3W2DA 3RYTA 4IC7B 2DCPA 2VJ8A 1AARA 3Q9UC 3D9JA 3HVEB 1U5DA 1HU3A 1YMPA 2XHEA 2WNMA 1ZXHA 1FXAA 1WZ0A 4G25A 3FAHA 3RNGC 3CQCB 3U12A 1XF5L 2N4FA 3Q73A 5J3YA 3HVEA 3CEQA 3OANA 3ZQ4A 1PLSA 4ZRIA 5I4DA 4JWSC 4XDCA 1QNFA 2JWZA 4GMXB 2WMOA 3MKQB 2W3RA 1MG8A 1O1TA 3I5JC 4DWFA 3AS8A 2COAA 1J0GA 2GRLA 3V30A 3PRPB 1EDUA 4AJYB 4J8SA 4AVXA 1F1HA 4A20A 3EHNA 3SFEB 2CHXA 2AX5A 4IULA 2UU7A 4P6VF 1UOHA 4U8VD 3H9DA 4YSZB 2WQHA 1YX5B 5CMYA 1JCRA 5EYPF 2WXJA 2PTLA 1NI2A 3MKQA 3TG5A 4EFOA 3H7SA 2W82A 3ZYQA 4GTQA 1TS3A 1CK1A 2L7RA 5D66A 2M38A 3UQAA 3QWWA 4DBGA 2NMBA 3RZWC 5B1BE 1R4NI 1TNZA 3W5VB 4H8SA 3ZXRA 1IRSA 4FJVB 3TBLD 1X81A 1XODA 2LKOA 3KEZA 1WM2A 4ZRQA 3QCAA 3VQIA 4EE2A 2WMNA 2YHEA 3CMMB 4BKSD 3DRAA 1WXQA 2GCJA 4WJPA 2QY7A 3VUWA 5JJ7A 5KWDA 4H7YA 1K5GB 5M4YB 4G3XB 1E7UA 4B93B 2GBJA 3B08A 3D8DA 2IFSA 1JW9D 2ZGDA 3R66C 1WH3A 4QAYA 2VKIA 2WLBA 1DOXA 3RNAC 1OTRB 1A5RA 1J0WA 4I6NB 3E56A 4LNBA 1D5XC 4C7YA 3CVLA 2JZZA 3DSVA 3L10B 3O4ZA 1YYHA 2IQCA 1L6VA 4ARCA 3RCPA 2MBHA 3UI2A 4EEWA 3W9FA 1W1DA 3QB2A 3TEWA 1L0VB 4ZYNA 3RO3A 2EILE
chains in the Genus database with same CATH topology
4NY0A 3X0WA 2YS1A 2J08A 4ME2A 5C2YA 1BTKA 2BCJA 2WQ6A 3MCXA 3KUDB 3T8MA 4CHMA 4K03A 3IFWB 3IVFA 5KJKA 2K25A 2J49A 4GMLA 4F53A 3RCZA 3NZSA 5JJ6A 5EX0A 2DKPA 4HXIA 3TJPA 1GC7A 2DIWA 1WX8A 1YIWA 4ABNA 2D9WA 3PLUA 2WH5A 2JLBA 2LOXA 3ESLA 1UN8A 3VH3B 3EHVA 2L1CA 3VUXA 4PS8A 2RUKB 3SHQA 1TGZB 3HDXA 2G4SA 1X1MA 2ILRA 4YONA 5AENA 2DHKA 4NRHB 4U0ZA 4GZ6A 3D8EA 3SYXA 3TFMA 5D3XA 2JY6A 3PE4A 2ZU6B 1TTNA 2XGSA 1WMHB 2I5FA 2L0IA 4JXTA 4N5CA 3DXEA 4ZRKA 3DVNV 4ILIA 2MBEA 3E9LA 4O6FA 2EC1A 1WI0A 2ABDA 2PZ1A 3SBTB 4B8CB 5KJNA 5CHEE 4KHBB 2KOXA 1X1FA 2MHKA 1W3BA 1WZ3A 3KRWA 1IP9A 4A1GA 5JH5C 1WJUA 4II2B 4FBJB 4HVBA 3SBTA 2IO2B 3PP2A 2DIKA 4I2WA 2XCBA 3SU8X 5D2MB 2R0DA 2D3GA 3K9PB 4TYZA 1UPQA 2VSYA 3B13A 4WAFA 2Q7FA 2D9XA 3PHXB 3L54A 4WVFB 3S7JA 3GZ2A 3MA5A 3T5XA 4JKFA 1X1GA 2AWIA 4DX8A 1HF8A 2FCNA 3PPAA 5LCWJ 2V5FA 4WNFA 4DLQA 4W9LA 5BV1A 4JVSA 3HYMB 3RRUA 5D3WA 1PY1A 3QK0A 5CTRC 1QQGA 2R5SA 4NJ6A 4GZDA 1RLFA 4EKUA 3FUKA 4WQOB 2BGFA 2DTCA 5FQ6A 3HW2B 3CHPA 3PS6A 3CVQA 2K00A 3D9IA 3PSCA 3RULA 3PSEB 2BWES 2CR5A 4WJQA 4GPTB 1MIXA 1RAXA 2ZCBA 2YT1A 3ASGA 3TO1A 3UINB 3NY5A 2XRYA 5LX8A 3CK7A 2KDIA 4B6WA 4CYEA 5ANRA 4AY5A 5CHWA 2GBKA 1WE6A 3ML9A 4EBAA 2HM8A 3CHMA 1Y8RC 4BY6A 2Y8GA 1GNUA 3CSTA 4GZCA 1C1YB 2LI5A 3SV1A 4MDKE 2PEAA 1JWGA 2LRWA 1WY6A 3S7DA 1NBFC 2VYIA 4LERA 4HAZB 1WR1A 4KSKC 1FB8A 5CX3A 1X11A 3CVPA 4EZKA 3QWVA 3ZO5B 4LCDE 5DPSA 4GSWA 2MFQA 5L95C 2NCNA 1FGYA 3MV3B 4IM0A 2L05A 1DROA 3ZKJC 1UN9A 2LBBA 2N7DA 3ZYMA 1S3SG 4MGIE 2Q13A 3OXGA 1OQYA 5JVLA 3LS8A 5D3YA 5KHQA 2XEWA 3DBSA 1WJ4A 3ASDA 2DFKA 5JLJB 3DBHI 5AZGA 3HM3A 1Y6IA 5BUZA 3R7RA 1BAKA 4BKGA 2REXA 2AXUA 2LOZA 5C1ZA 3FH5A 4R7LA 2DZJA 4MGYE 4LRZA 2PJHA 3D8FA 2AXVA 3AULA 3DQVA 4H7XA 4U63A 2D4QA 3CLJA 4I6LB 2KZRA 4KZCA 4CDMA 3BJIA 4ANWA 2KFJA 2AL6A 2AL3A 1YD8U 3M63B 3B0AA 3KY9A 2VRWB 1S1QB 2J4BA 1KOTA 3OAWA 2KWUB 4PUCA 4HB2B 3MX3A 2BTDA 1W1GA 1U27A 1KZGA 2X6FA 4C0AA 1E8XA 2CG2A 2WXMA 4GA1A 3P1UA 1HZ4A 2L9BA 5DPTA 3U30A 3ONLA 3CGHA 4ICVA 5AJDA 3EJNA 2IOLA 4I6JA 4JKDA 3PZDA 4G11A 4ATGA 2Y8FA 4DPRA 3CVNA 2PQRA 1V9JA 3QWMA 1WY8A 4DBBA 4ASWC 4MS6A 3UQ3A 3NSUA 1VBHA 5DPRA 2ASQA 3GZNI 4RG6A 2X0SA 2AEHA 2PPHA 2CS4A 1UD7A 1H2VC 4IFSA 2KM4A 1ZW7A 3PDNA 4FULA 4BVUC 4CGVA 4NAWB 1BT0A 3SF4A 2FF4A 2IOSA 3Q5MA 1V61A 3V61A 1HS6A 1DIKA 2DYQA 2I9CA 4E71A 4KBQA 1ZGUB 3FUNA 1UW4B 4DI3A 2LYDA 4GCOA 3DXDA 4NAWA 1NVLA 2VGXB 2K2JA 3VHTC 4HS2A 2L6JA 4YL8A 4IAPA 1NP7A 3UIPB 1H2TC 4I17A 2OVBA 2QHOA 2D9YA 2KDEB 3K9OB 4FU3A 2VGXA 4YVOA 4G26A 3ZRHA 1Z3XA 2IYDB 2X6IA 2WQ7A 1P5QA 1B89A 2XK5B 3MTNB 4X57B 3MJWA 3MDBC 3JSVB 3BG1B 2ZNVC 4JHRA 3AU4A 2UWQA 3GZSA 1YX6B 3O65B 4N3CA 2XK5A 2GJYA 3PTFC 3C98A 3DOWA 2BKRB 4HPMB 5KJLA 1KC7A 4JK7A 3JSVA 4NPNA 4BBKA 2FCQA 3FP5A 3ZYLA 3FEXA 3K9IA 4JHJA 1OMWA 3U9WA 2MCNB 3ZN3A 1UEFA 4IRUA 4WJ7A 1V5MA 3LDZE 2NS5A 1NTIA 3A4RA 4XI0A 4JHKA 2JZ3B 3GOEA 2MWSB 1OWNA 3PRZA 2YVCA 4M8MA 5FQ8A 3UT8A 4HATB 3P2BA 4MSQB 4L7TA 2K8HA 2I2OA 4AXHA 2J0JA 4CEMA 1VCBA 3BG0B 2CB8A 2K8BA 3I3TB 2VSXE 4HAWB 2R59A 2VQ2A 4L2YA 1ISNA 5CLLB 2M63A 2G3QB 4KT6B 1RFAA 1WXVA 1MIZB 2ROZB 3CVXA 5C79A 2K1FA 2KCLA 3ODXA 2IU1A 1HH8A 2IBIB 2VRRB 5BW8C 4A55A 1N52A 3QBVB 3FU5A 3ZIMA 3CXBB 2NC9A 4YNDA 4JKGB 2JT4B 4K2OA 4BTAA 4BKTA 1DDMA 4HAVB 1UZXB 2W2WA 5FWQA 3CVVA 2DYBA 1SZ9A 1LF8A 4GB9A 2CFUA 4JKGA 1U2BA 1WGRA 3I4GA 5G04J 1E90A 4K0RA 1SQMA 1WXAA 3ZTCA 5KQ1A 1UNQA 3Q4AB 1IYGA 2WWZA 4HCNB 2FULA 3KUZA 5D94A 3DXCA 3UT4A 3QKYA 4JGHB 3RIBA 3VTUA 2JF5A 3AXCA 2OTXA 2PL2A 3ZDTA 3HM6X 4ZRJA 4G50A 1HG5A 4DHZE 3ZRFA 3NOBA 4A6HA 5DHFB 2P0HA 4PH4B 2JVCA 4URKA 1U5FA 2WXKA 4IN3B 5E6PA 3OLMD 5T4YA 2D11A 4Y6CA 2UWJG 4FN2A 1MK9B 2FBNA 1QZ2A 3LVRE 4IWQA 5ARFA 2HJ8A 2R2OA 3T5VA 3HQCA 3LY9A 2V3SA 4OVVA 2KN5A 2KZTB 4UWGA 1JUQA 1WRDB 1AQCA 1WGGA 4GMVA 3U3WA 4NACA 4W9EA 2IJGX 2C9WB 1V5UA 4HOTA 5D0QD 3MHSD 1V5TA 3PH0C 3VXWA 3MPXA 3KW5B 5LOZA 5BPPA 3H1UA 2KZTA 5D27A 3IHVA 3QARA 4IWPA 1M94A 1V81A 2KANA 2FDQA 1A17A 1WGQA 3VVWB 3F5RA 2Y4TA 1FXTB 4N2SA 1GJZA 5HE2A 3LKUA 2ZCCA 3APDA 2C5LC 3D3MA 1PAQA 3RK6A 2MSED 3FULA 3WAMA 3CR3A 3KYCD 3R3MA 4ILJA 2XCCA 5CMWA 3TXNA 4HOUA 2XQ0A 1WYWB 5JP4A 3M1IB 2V8SE 4NURA 5BT1A 1U5EA 5T3RA 4GOCA 3ZW3A 1B55A 3JCKC 1OWPA 3KS2A 3SNHA 1ELWA 4GZ5A 3E4BA 3ZXSA 5KJMA 4A3PA 2C0LA 1X86A 2EMSA 2KX3A 3HK0A 4HK2A 4U8HA 2B3AA 4CGWA 3VTXA 1UJKA 4D0NB 2KJ6A 4KMOA 3CK9A 3B1LX 4CDNA 3RUIB 1BPOA 5LCWC 3OXFA 4GZUA 4HWIB 4HDQA 2AW6A 3ULCA 4ANUA 3QWZB 4MLPA 1JDEA 4K2PA 3OJ4B 4LJOB 1HO8A 4GPKA 4U0SA 2J9QA 2LSUA 1M7EA 3ALBA 4MELA 1H8CA 1U3DA 2ADZA 4Q69A 1WG7A 2COPA 2CRFA 2DX1A 2FNJB 3WXXA 4AY6A 2MX2A 2ZZPB 1P0RA 1WGHA 3RZFA 1LW3A 3R9AB 2KX0A 4J8DA 4GDKB 3JW0X 3FTXA 1T0YA 2DKQA 3ZGQA 3ASFA 3DPDA 1QC6A 4HAUB 3U7DA 1I2HA 3ZTDA 1WJNA 2M4NA 4LCTA 2KMAA 4C0MA 2WM9A 4GDKA 1WMHA 1HFAA 4KYOB 1ST7A 4K17A 3G9WA 1OWMA 3VTWA 1L5JA 5DCNA 3ASHA 2NBVB 4JK9A 1TBEA 2KK8A 4F7HA 1HB6A 4B0ZA 1Q0WB 4JKBA 4EOYA 3FH7A 2Z0EB 4JIOU 3FTZA 4TRQA 5A7DB 3FLVA 1WI1A 4XE0A 4IM3A 5G2NA 2LXCA 4F7ZA 1EPUA 4DJAA 1QQEA 3TL5A 2LGDA 4CHKA 3FM8C 2X6HA 1KM7A 1KLXA 4FJYA 4DXAB 4MEMA 4FHKA 3UUXA 2NZ8B 2RVBB 3E9PA 2J4DA 5DH9B 3ONKA 5J18A 1NTYA 4IWOA 1IYFA 2KCVA 2CQUA 4JKCA 2NR2A 2C7HA 3VUYA 4HFGA 4JZYA 4BWRA 4K7WA 3G2SA 3ZPJA 2Y4UA 3N30A 1FHXA 5FT9A 4J8EA 4JW1A 4XWXA 1Y8MA 1XGWA 4IG7B 4MGZE 4AM9A 1YQBA 2KQSA 3W1YA 3QA8A 2DLWA 2OQBA 2K6DB 1LXDA 2P58C 2FEZA 3IHYA 2JPHA 4PQ0A 3ML4A 1IHGA 4K7SA 4GN1A 5A6CA 1EF1C 1WGDA 4FA6A 4IOYX 2D2QA 3KZ1A 1WF9A 4IW0A 1NU2A 4TQ0A 1MPHA 5GMVA 2LUEA 1OEYA 3ULBA 5IA7A 4L1BA 2KGXB 4B6HA 2KLGA 4K1RB 4W9CA 2ZPYA 3LDZA 2RSUA 4PYUA 1DBHA 2N23A 2O6VD 4B9KA 1WE7A 4E74A 2FUHB 2CODA 3V6CB 1Z6TA 2M14A 4MJSB 1TJCA 2VGYA 4JK8A 3LCAA 2C0MA 3MYVA 5L83A 2LGYA 3CHSA 1KJTA 2DAFA 1C3TA 2G45B 4MJSA 2H7EA 2K6QA 1SGHA 1IQUA 1FVHA 2NSZA 2LJ5A 2XPIA 1N3HA 5E6OA 3PEVB 2NVUI 4BKSA 5ARGA 5L81A 2DZIA 3QAQA 3URZA 4NJ7A 5C1DA 4NQLB 1OY2A 1Q67A 5DPWA 1P98A 1KLVA 5JHBA 4FLHA 5AJLA 4BBNF 4I43A 2KCJA 2PM7A 2J0KA 4K81A 1MQSA 2GRMA 2X38A 4AIFA 5JHGA 2L76A 1WAO1 3W1SC 1GG3A 2FIFA 5FI0A 2FI7A 3B7SA 3CIAA 2BKFA 2JRIB 2N7EA 3ZDMC 1H19A 5G05J 4BFRA 3FTUA 4HB4B 2KUPA 3KYDD 3A33B 2FIDA 4HAXB 1XX0A 4GU2A 2RSGA 5FQ7A 2D9VA 3QDNA 2RD0A 4F1SA 4GYYA 1XT9B 1P3QU 4P29A 5E75A 2GOWA 5LFAA 4M8NA 1UG3A 2KNBA 4DHZB 5EX3A 3EFUA 2KC2A 1INZA 1PMSA 3NF1A 2IO0B 4UQZA 3QC8B 4JA7A 2X3MA 2WVIA 4CHJA 5HQ8A 2XEVA 4D10C 4YVQC 2KATA 1XCGA 4APFA 1V6EA 2HO1A 2WXFA 5HE1A 5C23A 4NNJB 4II3B 2WYQA 2DYNA 3KUCB 2UZSA 2MBQA 5AZHA 4BOZB 1EGXA 1TQZA 1ZVRA 3CQGB 3VOQA 1XQQA 1SE9A 3GW4A 4GGQA 3ENEA 4MKTA 2M8SA 4U04A 3AU5A 3UPVA 1UBIA 3UMVA 1UBQA 2DN6A 3RRMB 4HORA 4DX90 4QFVA 1Z87A 4UWHA 3BINA 4HXDA 1NZNA 1V88A 4E85A 2BF0X 3IKOB 1PQSA 2MDXA 2L8JA 3WANA 1VD2A 2C7MB 1HG2A 2UVMA 1IQRA 3JYSA 4DHJD 3QOUA 3N71A 5A23A 1WFYA 2LD9A 1Y5OA 3ZFWA 3DVGY 4B8AA 3M95A 5J3TA 3PNLB 1OWOA 4GAAA 3N32A 4A3TA 5TR5A 1XR0B 4RG9A 4L23A 2KDFB 4N9F4 2DHIA 5BNWA 2N1VA 3SHFA 4BX8A 2P0DA 4ANVA 3GYPA 3ESKA 2RGFA 1ELKA 1E8WA 2UY1B 2IY1B 4HJKA 1FCHA 1WM5A 3FUFA 2JUOA 2QFCA 2YHCA 1H4RA 1NDDA 1MHQA 4WAAA 2VSOE 2HRJA 2GW1A 1Q1OA 2DYOA 3A1QB 3D9OA 2UY1A 4HB0B 4E6HA 3L6AA 2BYFA 5LLIA 2L0FA 3PRMB 2WXQA 3WIMA 2KQ7A 3Q15A 4J6IA 4GMJA 4Q94A 3ZEFA 5G04C 2D07B 3PUJA 3D9KA 4U07A 3A1QA 2LO6A 4HAYB 2MP2B 1TJ6A 2N9XA 2RGNB 4L6EA 2R82A 3FUDA 3NQPA 4PNKA 1X05A 1H10A 3QQ8B 1ZM0A 2NXPA 4I6PA 2MP2A 2RPQA 2Y7BA 5ANLA 4JL9A 4AP4C 4UQYA 3IEGA 3FU3A 2XBBC 4GXBA 3VLEA 1P9DU 3I5PA 1BWNA 4EPZA 3A8PA 5LP0A 1V89A 4JKEA 2ELBA 3M3JA 2I1JA 2DX5B 5FQ4A 2ZPNA 3WALA 3PVWA 4UWLA 3FUIA 2L0TB 2DZKA 4KHAA 2E2EA 1U4AA 5FZRA 2FJ9A 5AZFA 2CU1A 2DX5A 2CY5A 3Q47B 3FWVA 2E2XA 2BUGA 1V49A 2P8VA 3CSFA 2GBMA 4KZ0A 4DLOA 5LXIB 5IJMA 4G23A 3VLFA 2XPZA 1U29A 5EKQD 2L0TA 3ECIA 3ZNID 2MKRA 2WXLA 2IY0B 3EECA 5HE3A 2ELAA 2YRYA 3Q3FA 3VIAA 1V5PA 4N3BA 1QZEA 2Z0OA 4I6EA 2BYVE 3L08A 4PS7A 3S7FA 4I9CA 3NHEB 2QKLA 2K39A 1DDWA 4AEZC 1WXMA 2KLCA 2YQ8A 3PUKA 3FTYA 4N39A 1Z5SB 5FR6A 2A5UA 3CHQA 3RO2A 2COFA 4UQXA 4MK0A 2WDTB 4CDRA 2P0FA 3UGBB 1LM8B 4A5KA 5BO4B 4JKHA 3IG3A 2GBNA 3JVZX 3SZ7A 4LUNU 4GDLB 1YJ1A 3VAWA 1OUVA 1V86A 5KQ4A 3PE3A 3CVWA 3F0WA 2W2XC 2WXOA 1XD3B 2BF8B 2ZVNA 4UWFA 2W9NA 3NS8A 3QJZA 3APFA 2XRZA 4I1AA 1ZC3B 4I1MA 4GDLA 3LY7A 5T8IA 1HXIA 3G2TA 3N7CA 4KVOA 5JZEB 1WIAA 3V6EB 3L16A 1KT1A 2MBBB 3T06A 3B7TA 3CHRA 4UI9J 2KJRA 3RU0A 1E5WA 4RMAA 4CCAA 1EO6A 3DBRI 2WXIA 5BV0A 3EC8A 1WX9A 2HD5B 3CF6E 3FTWA 3D9MA 4JKAA 5HKHA 2JEKA 2GS0A 4W9KA 3LYAA 3JYUA 2IO3B 3TXMA 3TW1A 5FZQA 3VTVA 4L2LA 1SIFA 1E96B 1H6KA 1P3RA 1EUVB 5KHOA 2ZNVB 5CCLA 3PT2B 1IPGA 4HOQA 2GBRA 2C7NB 1MK7B 3EHMA 1HE8A 3ODOA 3B7UX 4JPSA 5D6JB 2OJRA 4C9BB 3FUJA 4KDLB 2NBWB 1Z3YA 3EIJA 3CV0A 5J90A 2CHZA 1ZC4B 3O48A 2R2QA 4WNDA 3FH8A 5KCMA 1CMXB 1EVHA 5J08A 1J8CA 1L2NA 1TZ1A 2UYZB 4LDTD 5LXHA 3FEHA 3UX4A 4AV7A 3RT3B 4EJNA 3S2AA 1BTNA 1UNRA 2LASA 1AWEA 3FUEA 3LVQE 3B7RL 2LSVA 4DHJB 1GUAB 3ENBA 3ZVRA 1HX8A 4ACLA 2DAJA 3QNKA 4EUTA 4OYSA 5D7GA 3D32A 2L00B 2VSZA 3AJ4A 3AI5A 1F9JA 2EKEC 2KWVB 2FJLA 1TEZA 2OV8A 3GYZA 2Y3AA 4G24A 4U0UA 2EJ8A 2Z0QA 2DHJA 5EDSA 3QWPA 2PE9A 3PNTB 4XKBA 4MH0E 2R17C 3A4SC 1ACAA 2Y5BB 3JUIA 2H7DA 2KHWB 4IM2A 2IFUA 5AYWD 3EDTB 2N1WA 4I9EA 5FZSA 2YS5A 2FO7A 4APOA 4J0UA 2LVQA 3TMPB 3PVLA 5DIFB 3KSYA 5DBKA 2YLMA 2HYZA 4FLBA 2EQXA 2FAZA