3AU5A

Structure of the human myosin-x myth4-ferm cassette
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
528
structure length
493
Chain Sequence
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARIKEEVSSARASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin-X
publication title Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Motor protein
total genus 163
structure length 493
sequence length 528
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF00784 MyTH4 MyTH4 domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3au5A03
1.25.40.530 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3au5A01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3au5A04
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3au5A02
1Y5OA 1A5RA 3ODXA 5JLJB 3QIJA 2L3ZA 2DYNA 3ALBA 2RNRB 5E6OA 1XCGA 2CQUA 1MIXA 2KDBA 3ULBA 1WRDB 2DX5B 2OTXA 5D7GA 5DPTA 1ZKHA 2KDFB 4KHOA 2RSUA 2GBJA 1MKEA 1XR0B 1H4RA 5J3TA 2RSGA 1WVHA 2LI5A 5JHGA 2N1WA 2MCNB 4J6IA 1T0YA 2KFKA 4HAXB 2MWNB 2JZZA 3T8MA 3V62A 2EKEC 4ZYNA 3PVUA 2CY5A 1U5FA 2MKRA 1FAOA 1OTRB 4NAWB 1GG3A 3M3JA 5DHAB 4E74A 5DHFB 5DPRA 2LJ5A 2JP2A 2DHZA 2PE9A 1UPRA 3SDLC 1SIFA 3A4RA 2DZMA 2Z0PA 2IO0B 5E6PA 3VHTC 2KWCA 4HAZB 3L0WB 5GOWB 2M1MA 4FHJA 1FB8A 3GZNI 2CODA 1Y8RC 4A3OA 3O96A 1W1DA 2COAA 4G3XB 2Z0OA 3VUXA 2BYEA 3WAMA 4A5KA 5EDSA 5KQ1A 1QC6A 4PNKA 3L16A 3QWZB 4FA6A 3JW0X 2C7MB 4LDTB 3DBSA 3FSSA 2RGFA 2J59M 3U30A 5BO4B 1WXMA 1DDWA 1ZSQA 2K00A 2LOZA 2AYOB 4I6NB 2BYVE 3RCPA 4GB9A 3H1UA 4HLEA 2KJ6A 2DHKA 2LBBA 4EFOA 5HE1A 5AZGA 4EZLA 4HWIB 1E8XA 2KCJA 1YQBA 4HHVA 3JYUA 3LDZE 1FGZA 3PLUA 1WYWB 1J0GA 1WZ0A 1V5UA 2G35A 4A6HA 3W1SC 3A33B 4ICUA 3B0AA 4TQ1A 2CB8A 3NSUA 1WR1A 3TJPA 4I6LB 1AARA 2RR9A 4A6KA 2DN6A 1UPQA 2GBNA 2XK5B 3PHXB 3DXDA 1WXVA 2HE7A 1HB8A 1P9DU 4K7SA 1P3RA 1PMSA 1GNUA 3VQIA 2LZ6A 5D3YA 2N9EB 2KNBA 2K8CA 3RT3B 2O2VA 3SUZA 2N9XA 1WGQA 2JWZA 3DCGA 1M7EA 3UINB 1GUAB 4MGYE 1C3TA 5CX3A 2YLMA 4KSLC 2LYDA 3B1LX 3VAWA 1B55A 2LRUA 2ABDA 2N23A 2DYBA 3VTVA 5LLIA 1Q1OA 3WA0A 3RZFA 4IC7B 4IUMB 4DK5A 3CF6E 5C6RA 2RQ1A 5CHVC 4NQLB 1UBIA 2LGYA 2XQNM 2DHIA 2NR2A 1R4MI 1WH3A 2FDQA 5D94A 1EF5A 3NHEB 2FCNA 5JHAA 2UVMA 4WWPA 2FCMA 4LCDE 2P0HA 2LASA 2N1VA 2D3GA 4PS7A 4NJ7A 1UNRA 4HPLB 2HD5B 2ROZB 3FM8C 1X11A 2XEWA 5LXIB 3V6EB 3IBEA 1KZGA 1K5GB 1I2HA 5D3VA 2NPTB 3RD2A 5C1ZA 2LUEA 2IZVB 4DXAB 2L2IA 3JSVA 1OY2A 1K5DB 2JVCA 4EEWA 2MBQA 3APCA 4ZDVA 4HDQA 4ANUA 2R09A 3EC8A 3SO6A 3V5WA 4B95A 3N32A 4ZRKA 3GYOA 3ZNID 3WAOA 2LVPA 4PQ0A 1DDMA 1V88A 3AULA 2KTRB 2KGXB 2ZCBA 2N7DA 4K7UA 1WG7A 4GDLB 3VH4B 4K17A 3HHMA 1NI2A 3MHSD 1WXAA 1OGWA 1MK9B 4IWOA 3PT2B 1U27A 1V61A 1NTVA 1TBEA 2P8VA 2N4FA 1P6SA 1NTIA 3DVNU 2DLWA 1WM3A 2V4LA 3BINA 3SV1A 4MK0A 3MTNB 5KHOA 1U4AA 1ISNA 2G45B 4KZ0A 3UIOB 4MY6A 4PYZA 1V86A 2HJ8A 2EJ8A 3KW5B 4BFRA 2G3QB 4XC2A 4DX8A 4GDKA 5D27A 4BBKA 2KOXA 2RVBB 2LOXA 2GBRA 2DZJA 4A20A 3TO1A 1WGYA 4YL8A 4FLHA 4FJZA 3ZTCA 4ASWC 5C23A 2LGXA 2BCJA 2IYBA 1FHOA 1XX0A 4W9GA 3KZ1A 3R3MA 5IJMA 3F0WA 2WX1A 3DOWA 1P5TA 3K9PB 2FIDA 2FJLA 2K8HA 3DBRI 2CHZA 2J7QB 3KRWA 3IVFA 3APDA 3OANA 3ZVRA 1DDVA 5DIFB 1I35A 3CIKA 2BKRB 2I5CA 2ASQA 2KDEB 2D9XA 2HRJA 2Y7BA 1UELA 2D10A 1KI1B 3TBLD 1KM7A 2MBEA 1CMXB 2LXCA 2G4DB 3PV1A 1OMWA 1XD4A 3KYDD 1WI1A 4F7UP 4ZRJA 3PZDA 1E8WA 1P98A 3VVWB 1U5EA 1FOEA 4IM0A 1XKEA 1WF9A 3ODWA 2ZCCA 2X18A 1Z87A 3H9DA 3NOBA 3DBHI 4EKUA 4IM3A 1EF1A 3PSCA 5JHBA 3MPXA 4NSWA 3N7CA 4GDKB 2KMCA 2I5FA 1V5TA 4XX5A 3RCZA 2VRWB 2MW5A 2GOWA 2W9NA 1UGMA 2Y5BB 1I7AA 2LD9A 2YS1A 2NS5A 1XT9B 1ZC4B 5D3WA 1WFYA 3CMMB 2GJYA 1WJMA 3M62B 1WM2A 1HBKA 3PRPB 3A1QB 2KANA 4DHJD 1L2NA 4MEMA 3OJ3A 3GOEA 1V9JA 1U2BA 4TYZA 4W9LA 2QKMA 3M95A 1R4NI 1EAZA 3G9WA 1WMHB 4ANVA 2JZ3B 1KZ7A 1GJZA 1Q5WB 3S2AA 3SHQA 2YVCA 3Q3FA 3SNHA 2DHJA 2GCJA 4MGKE 3T9LA 4K2OA 3APFA 1EGXA 3TMPB 4N9F4 5J17A 2IBIB 5L95C 4EUTA 1ACAA 1BTKA 1K8RB 4NPNA 1DYNA 3AU4A 4GGQA 2KX3A 2BF8B 2YF0A 3KYCD 2KQ7A 4OVUA 3PRMB 1BAKA 3DXCA 2FCQA 2ZNVC 3ML8A 1U5DA 3QHTA 3HW2B 4W9FA 2NVUI 3JVZX 2N9PC 4RM8A 3CSTA 3VDZA 1HB6A 3IFWB 3RULA 4FJYA 1FXTB 4IAPA 5FI0A 1RAXA 4G0NB 2R0DA 2K25A 4HPMB 2Z0EB 3PRZA 1ZVRA 1WXSA 2CR5A 3OLMD 2O6VA 2UYZB 4IG7B 4IFSA 4A6FA 4EJNA 1Q67A 5J2RA 5DPSA 2UZRA 4CHKA 2WDTB 1YIWA 4OVVA 2K39A 2J0MA 1U5GA 2K6QA 4XWXA 1BWNA 3FP5A 2JUOA 2V3SA 4M8MA 1OQYA 4HVBA 3TCAA 4B6HA 2ZZPB 2WX0A 2KFKB 2DAFA 1V5PA 2E2XA 1EVHA 1RLFA 3VTUA 1DBHA 3PS6A 3QWMA 1YJ1A 4DHZE 1OEYA 2N0YA 2ZNVB 3EFUA 1IRSA 5IAAC 1V80A 2L0TA 1X1FA 4C0AA 1ZW7A 1LM8B 5D6JB 4EMOA 2QKLA 2UZSA 4E3CA 3MJWA 1WGGA 3CXBB 4CHJA 3H7SA 5GMVA 3PHWB 5C16A 4LJPB 1E8ZA 4TUUA 2VRRB 2ZEQA 3QCAA 1LW3A 2Z0QA 2VSZA 3A9KA 2MDXA 2G4SA 1WJ6A 2ZVNA 2L8JA 2DZIA 3SD5A 1IYFA 1PQSA 1WGHA 3WANA 2M8SA 4W9KA 2FIFA 1H8CA 3ZVVA 2JRIB 3A4SC 4WJOA 2FJ9A 3HIZA 2IFSA 5DH9B 3D8FA 4KSKC 5C5BA 1WJ4A 1GC7A 3ZRFA 3KY9A 4FBJB 3UQAA 3A8PA 3UF8A 2D9ZA 4HB2B 1ZC3B 3EPYA 2BWES 4AJYB 4KIKA 5J3QA 3TW1A 3V6CB 3NZUA 5JH5C 2KDIA 3PP2A 4JL9A 4IW0A 2IO3B 2ADZA 4WWOA 2V1YA 3AXCA 1J0WA 2C5LC 3N3KB 2DKPA 3U8ZA 4I6PA 1H10A 2NBWB 2UWQA 2LVQA 2DTCA 1AQCA 4GXBA 5DCNA 1WGRA 4II3B 1I42A 1W1HA 4GMVA 2NBVB 1KLVA 1E5WA 1Z2MA 4P7IA 2CS4A 1WJNA 2VKIA 3LJ3A 4DDGD 4ZRIA 4ANXA 4W9JA 2COFA 4KDIC 4HCNB 5AZHA 2YRYA 2O2VB 2K2JA 2BYFA 3A9KB 2FAZA 3PREA 4PS8A 1BTNA 4HXDA 5AEKB 3D8EA 1QZEA 3A8QA 2NBUA 4GPTB 2LGDA 3ZNZB 4PYUA 1W1GA 5KHQA 2CU1A 5DI9B 1C1YB 2KO3A 2D9WA 1UNPA 3DXEA 3DVGX 4MSMB 3ECIA 2L0FA 1WZ3A 1N3HA 3L10B 4TV3A 4GSWA 3KVFB 5C5BB 2MX2A 3A9JA 4DHJB 2CRFA 2Q13A 5CTRC 3QBVB 4DX90 1V5OA 4K2PA 4LJOB 3H6NA 2JXXA 2NZ8B 2QHOA 2IYDB 3ULCA 1V2YA 2MP2A 1MK7B 4Z2MB 2Y8GA 1WGDA 2ELBA 3UZTA 4KDLB 4HB0B 2GMIC 2GBKA 3CSFA 2BWFA 4B6WA 2KQSA 1S1QB 3ENEA 1XODA 4WJNA 2ZPYA 1OQNA 4CYEA 1U29A 4HDOA 1XD3B 2P0DA 2NMBA 2RUKB 2O6VD 3JSVB 4GOCA 3PVWA 5JZEB 3BJIA 1E8YA 5L83A 2RGNB 3L08A 1NTYA 2D9VA 5HE0A 1WIAA 2OQBA 3ZIMA 3M1IB 1Z5SB 4KVGB 5CLLB 4Z2NA 3R7RA 5J18A 1RRBA 3KUZA 1KOTA 3N30A 2C7NB 1KJTA 1TGZB 3DQVA 3H7PA 5CHWA 5EFXA 4FULA 4HAVB 4IM2A 2JT4B 1BT0A 3TVVA 4BBNF 1NBFC 1J8CA 1TXDA 4W9HA 2BKFA 2KJRA 2KMAA 3QX1A 3BY4B 4A3PA 2KWVB 1EO6A 2CHXA 4KZCA 1VCBA 1DROA 1P1AA 1RFAA 3R7QA 2NCNA 2ZJDA 2KLCA 2KC2A 3OJ4B 2R2OA 2EMSA 2K6DB 2KUPA 1E90A 2AWTA 3VUWA 4W9EA 4WAAA 2LULA 1TZ1A 2HTHA 3B08A 3ZDTA 4GIVA 2D07B 1EUVB 4WVFB 5HE3A 5FI1A 1ST7A 3U7DA 4W9DA 4GU2A 3ONSA 3TIXA 3HK0A 3UQBA 1UH6A 2Z0DB 3IG3A 3HQCA 2JY6A 5JHHA 2LG1A 2MQJA 4B9KA 2H7EA 4HATB 2DZKA 2AL3A 4MJSA 1UZXB 1UNQA 3P7ZA 2C60A 3PEGA 3M63B 3H7PB 4CO7A 3NY5A 2KXJA 3WAPA 4MGIE 2D4QA 2DYMA 3VIAA 1Q0WB 2BGFA 2KTFA 4G11A 1MPHA 2LKOA 4L6EA 4RMAA 2M14A 1M7RA 2DX1A 3K9OB 2K2UA 2AL6A 2FNJB 3QA8A 1F9JA 4DBGA 3AU5A 5G55A 4NY0A 3P2BA 3VUYA 3NZSA 2YSZA 3UIPB 2MBOA 2H7DA 2M0XA 2N7EA 1HE8A 3PLVA 2MFQA 3ZKJC 3WYFB 1FHWA 1FHXA 4HCPB 2HTHB 2XK5A 2K1FA 5LXHA 4BKSD 3IHPC 3D32A 3VFKA 1QQGA 2J0KA 1XQQA 2KC1A 1SHCA 2YS5A 4URKA 4DWFA 5IA7A 4CHMA 5D3XA 4MSQB 4F7GA 2IO1B 4MM3A 4F8CB 3PG7A 3F5RA 2P0FA 3PPAA 4MH0E 4YONA 3QAQA 5DPWA 2W2WA 2PE6B 2BPSA 4AJWA 1ZGUB 2KVRA 3RYTA 4MJSB 2KD0A 3DBLI 1UD7A 4GN1A 1YX6B 4EZJA 2YS3A 4NQKE 1LFDA 4MGZE 3ODOA 4JIOU 2GBMA 4MDKE 1D3ZA 3ZO5B 1SE9A 1JRUA 2RLOA 4F7HA 3W1SA 2YT0A 3AJ4A 1MG8A 2MRPA 1NU2A 4M0WB 2V76A 4KHAA 1RRPB 3TL5A 2COPA 2EMTA 2M38A 4BKGA 2GCLA 3RZWC 2KJHB 5TR5A 2KZRA 4II2B 2JF5A 1PLSA 4GMXB 4WWNA 2PPHA 3P6AA 2L00B 2GS0A 4K1RB 1PFJA 3L17A 2DYQA 4JLCA 4JQWC 4AOFA 2A5UA 2Z59B 3PTFC 1LXDA 2NPTA 2C9WB 3KUCB 3GYPA 3KUDB 3ZW3A 2MLBA 2JPHA 3W1YA 2PEAA 1WR6E 3DDCB 1WY8A 3EHVA 2KX0A 4HAWB 2KHWB 1WJ1A 4DHZB 4WQOB 3RUIB 2AEHA 4WJPA 5J3YA 3V60A 3VXWA 2MSED 4D0NB 3FEHA 2DKQA 2O6VB 2IY0B 3R66C 4WSFA 2D2QA 4HB3B 4A6FB 2KTRA 2L7RA 2I1KA 2D9YA 1E7VA 4GDLA 4NNJB 2A4ZA 5L81A 4K81A 4JGHB 3HM6X 2LWPA 5FR6A 1X1MA 4DDID 4MT7A 3UGBB 1X05A 1FGYA 2PZ1A 2W2XD 2FCSA 2CKHB 3ML9A 2RPQA 4ICVA 5D2MB 4TKNA 3QJZA 3ZUNA 1V89A 3SU8X 2MA9B 5E6NA 2REXA 5AZFA 1WX8A 4G50A 1X1GA 3EECA 2M17A 1UEFA 2JRHA 4FN2A 3VH3B 4MELA 4GZUA 2KN5A 2DFKA 1MIZB 1WE7A 3C0RB 4FHKA 2LVOA 1AWEA 4HB4B 3O65B 4Y94A 2PJHA 3X23A 4BVUC 3TFMA 4X57B 2MWSB 4LDTD 1L7YA 5KQ4A 4IWPA 4HAUB 1WX9A 3PSEB 2K8BA 4BKSA 3OAWA 3VTWA 3T06A 5G2NA 1MAIA 4KAXB 4NJ6A 3V61A 4PS3A 4K7WA 4ANWA 2D11A 2FUHB 5HE2A 4BOZB 2L1CA 3ML4A 4WJ7A 1OEYJ 3ZNHB 3ZLZA 1P0RA 2L76A 4DBBA 3KSYA 1V6EA 1G6JA 1WI0A 3ZTDA 5JP4A 1UBQA 4BBNC 5CLQB 1TTNA 1SGHA 2MBHA 2WYQA 3DPDA 4AWJA 4XZ4A 1V81A 1IPGA 4KIKB 3I3TB 4W9CA 1LB1A 2L05A 3DVNV 4HAYB 4HK2A 4HJKA 1WX7A 4F1SA 3ZDMC 1E7UA 4TQ0A 2EC1A 2IY1B 2XBBC 2DYOA 3AI5A 3NS8A 4FADA 3PVLA 3DVGY 3L54A 1YD8U 4EZKA 4KV2A 3HM3A 3QK0A 1S3SG 1RJ2A 4WJQA 2OJRA 2LRWA 4RM9A 3LJUX 1P3QU 1VD2A 1ZM0A 1IP9A 2CAYA 3PGEA 2CY4A 2DA0A 3MDBC 2Y8FA 2WWZA 5LOPB 5LONB 4IOYX 2KK8A 3D8DA 4KHBB 2ROVA 2DX5A 4H8SA 5HKHA 4F7ZA 4BOSC 2I1JA 2MBBB 1Y19B 2R2QA 1X86A 2YT1A 3QC8B 5C79A 3Q3JA 1WGUA 3A1QA 2DAJA 2C7HA 3L13A 2KWUB 4BKTA 3X0WA 4EOYA 3ZRCA 2KLGA 3SYXA 1WMHA 3QQ8B 3A9JB 2OOBB 2KKCA 1GC6A 2RD0A 2ZVOA 2CHWA 4FJVB 2ZPNA 4AP4C 4NAWA 1LQBA 3KH0A 2WH5A 3A98B 1NVLA 1WE6A 3WALA 1WJUA 2MP2B 3KRXA 2LXAA 4AUQC 2KFJA 5KCVA 1NDDA 3QARA 1V5MA 3FLVA 4IWQA 1M94A 2DENB 1TJ6A 1TQZA 2IO2B 3ZNGC 1YX5B 1J19A 3VOQA 1V49A 4E71A 2M4NA 4W9IA 2ELAA 3WIMA 5CHFA 2COCA 2B3AA 2J0JA 2W2XC 4M8NA
chains in the Genus database with same CATH superfamily
2J4DA 1Y5OA 1A5RA 3ODXA 1SVXA 1E9MA 2AXZA 5JLJB 2ZW1A 3QIJA 3UM0A 4UWKA 2DYNA 2L3ZA 5HI7A 5FQ4A 3ALBA 3CWIA 2XS1A 3IXSA 4I9EA 2RNRB 1MJ0A 2GRQB 2WQHA 5E6OA 1HO8A 2CQUA 1XCGA 1HQRD 1Y56A 1KF6B 1ZDXA 2NMQA 3TWQA 1MIXA 3ASHA 3N1YC 1E96B 2K5PA 3JCKC 3U2SC 2KDBA 3ULBA 1WRDB 2DX5B 3RNBC 2OV8A 2ZIRA 3JUIA 1KT1A 1H2VC 2OTXA 1TY2A 5BMGA 5EIBE 3ZEFA 5D7GA 3ZYYX 4OZCA 5DPTA 2WQYB 1ZKHA 2KDFB 2WXKA 5T4YA 4KHOA 2RSUA 2GBJA 1MKEA 1OWPA 1XR0B 3FFLA 3I57A 2PQRA 1H4RA 4HOTA 1NP7A 2MJEA 2ETCA 1L0XB 5J3TA 3NVVA 4C7YA 4ZHOA 4JWSC 3ZGZA 2RSGA 2J07A 3JUEA 4BY6A 1WVHA 1RZ4A 3LJNA 2VZKD 2LI5A 5JHGA 2N1WA 2MCNB 1U3CA 1K1BA 3PH0C 3U9WA 4A3VA 4OVZA 4J6IA 1JCSA 1T0YA 2KFKA 3B7UX 4HAXB 5CCMA 2MWNB 3DWLG 4B8AA 1V54E 1TN6A 2JZZA 3KLSX 1LF8A 1Z3XA 4BTAA 4OZAA 2CJNA 3T8MA 5ENRD 3V62A 4M3OA 2EKEC 4ZYNA 4LERA 3PEUB 1OT8A 4GMRA 3PVUA 2CY5A 4C0MA 2KWDA 4YXDB 4LCTA 1U5FA 2F8XK 3CK9A 3FUFA 4RVBA 1FAOA 2MKRA 1OTRB 4NAWB 2QIEB 4A1GA 1GG3A 3OTNA 2BKKB 4CT0A 1CZPA 3TWTA 3PZ7A 5B1AE 2AQ3B 5FQ7A 3B2GA 2LGIA 1XXGA 1I4XA 1SB3C 2XPYA 3M3JA 5DHAB 4E74A 5DHFB 2KACA 5DPRA 3SGHA 4LNOA 3HIEA 2LJ5A 3UM3A 3PZ1A 1SE4A 4H7YA 2JP2A 1QBQA 2DHZA 3UUXA 2PE9A 5EILA 1UPRA 3SDLC 1YJJA 1SIFA 3U4EG 3A4RA 4RQIA 2DZMA 2Z4DA 2Z0PA 4A6QA 4AQ7A 1L6UA 2IO0B 3MA5A 4J3OD 3OXGA 5E6PA 2BYTA 4RF1A 2KN4A 2KYWA 3WCQA 3VHTC 3LVRE 4N58A 4UI9C 2KWCA 3URYA 2MEKA 4HAZB 3L0WB 4GZ6A 3DHGC 5GOWB 1F77A 2M1MA 4FHJA 1FB8A 1EWYC 4XWWA 3GZNI 2CODA 1Y8RC 3ZYQA 4TXPA 3LDZA 4BETA 3AE2B 4A3OA 3Q8EA 3O96A 2GRLA 1H6OA 3B13A 5E76A 2WP9B 3GZ2A 1W1DA 3KS2A 2COAA 4G3XB 5D3DA 2Z0OA 2G1EA 3VUXA 2BYEA 3WAMA 1GPXA 4BERA 4A5KA 2IDYA 5EDSA 1FMAD 4IN3B 5KQ1A 1QC6A 3TWRA 4PNKA 3L16A 5ENSD 3RU0A 4C4VA 1NFIE 4QQIA 1N60A 3QWZB 3K9IA 2M56B 1MG4A 1VBGA 1IKND 2BTDA 4JKBA 4FA6A 3JW0X 2C7MB 1ELWA 2L9BA 3EA6A 4LDTB 2TSSA 2YNQA 3DBSA 3FSSA 2BBCA 1FT2A 2RGFA 2Y1LE 2XEHA 2J59M 3HXEA 3DBRB 1HZ6A 3GW4A 3U30A 4TSSA 3N9YC 1HXIA 1SEBD 1WXMA 5BO4B 2KM4A 2IY0C 2K8EA 1DDWA 1ZSQA 5BW8C 2K00A 3TXNA 2LOZA 1ELRA 2AYOB 2GI9A 2IONA 1FVFA 1JCQA 1UNSA 2BYVE 4I6NB 4TRQA 3FVCA 2KQ4X 4GB9A 3RCPA 4J8DA 1F52A 3FKYA 3H1UA 4HLEA 3UINC 2JXTA 3QDNA 4L23A 1TYGB 2P9PG 2KJ6A 2DHKA 5HFYA 2Y5CA 2LBBA 2LSUA 4GA0A 3MC0B 4EFOA 2QZAA 3D9OA 3RNAC 3MYVA 4Q94A 5HE1A 3SFZA 3Q7FA 5AZGA 4EZLA 4FLBA 4HWIB 3VLDA 2D3CA 1E8XA 2KCJA 1VLBA 1BU9A 1YQBA 3V31A 4C48B 4HHVA 3JYUA 3LDZE 3FH5A 3Q3NC 1FGZA 3PLUA 4ME2A 3I5JC 1WYWB 5FTPA 2BEDA 1L5JA 2WS3B 1J0GA 1WZ0A 2GRNB 5FK9C 3PZ8A 1V5UA 2G35A 4A6HA 1JCRA 3W1SC 1WWTA 3P1UA 2K0PA 4GZCA 2GUMA 3A33B 1BD8A 4LSZE 4QJ4B 4ICUA 3B0AA 1E0ZA 1DCQA 3TEYA 5EX3A 4TQ1A 2DZNA 2CB8A 3ULEG 5BV1A 1HZ5A 4L1RA 2ONQA 3NSUA 4HSIA 4TMAB 4F1PA 1WR1A 3FAHA 3BK2A 3TJPA 4I6LB 1AARA 1HS6A 4UQYA 2RR9A 4GTVA 2INNE 1BPOA 3ASOE 4A6KA 2OOEA 2KMMA 1D8DA 4GTQA 2DN6A 1UPQA 4HEA1 3EHNA 2GBNA 2XK5B 4U8VD 3DXDA 3PHXB 1N4SA 2MYOA 4HS2A 4I1MA 2NBVA 1WXVA 2DYSE 2NSZA 4KX6B 3FTUA 3NB2A 2J4XA 3TSSA 2HE7A 1HB8A 2R02A 1FD6A 1P9DU 2LGSA 1VBHA 3DBHB 2Y4UA 2MJDA 3Q8FA 4K7SA 3E9SA 1P3RA 4GCNA 4JKDA 2R2LA 3LCAA 1PMSA 1GNUA 3ZN3A 3VQIA 5BPPA 2BS2B 1OY3D 3BG1B 2LZ6A 2DBYA 3B7BA 4MM3B 3MJ5A 4N59A 5D3YA 2N9EB 2Y5PA 1I4GA 1KRHA 1GB4A 1FNVA 1WM5A 2KNBA 1C9FA 1I7HA 2K8CA 3RT3B 2KCLA 2O2VA 3SUZA 1EWCA 4AS1A 5CEDB 2N9XA 1WGQA 2JWZA 1IBXB 2XPIA 3SBTB 3N1ZC 2IJGX 3DCGA 1XLOA 1AP7A 1M7EA 3UINB 1GUAB 4MGYE 4FXCA 4P1BC 1C3TA 4JL0A 2WXLA 2WXQA 3EU5A 5CX3A 3ZFWA 2YLMA 4AY6A 2QJLA 3I5PA 5D66A 4DXFA 4KSLC 2YT2A 3ZUVB 2LYDA 3B1LX 3VAWA 4P29A 3UT8A 1B55A 4U0SA 2LRUA 2ABDA 2LO6A 2X6IA 1FXAA 3BZDB 3FDHA 1CJEA 2N23A 2CJOA 2DYBA 1D6EC 3VTVA 1OUVA 4UI9J 5LLIA 1Q1OA 3WA0A 3KEZA 3DWMA 3RZFA 3UQ3A 4IC7B 4IUMB 4DK5A 3CF6E 3FU5A 4JKGB 4JEUA 3D9MA 5C6RA 1AN8A 2RQ1A 5CHVC 4OHJA 4NQLB 1R4NB 1UBIA 2LGYA 3EIJA 2BS4B 2ETAA 2XQNM 2DHIA 1UF0A 2NR2A 2EQXA 2WM9A 2ZXWE 3ZYKA 1R4MI 2KAJA 1WH3A 1UJJA 2FDQA 1EF5A 5D94A 3NHEB 5JHAA 2FCNA 2I2YA 3E9OA 2UVMA 4WWPA 2FCMA 4LCDE 2P0HA 2VSNA 3ABKE 2LASA 2N1VA 2D3GA 4PS7A 3RSEG 4NJ7A 1UNRA 4HPLB 1I4RA 1IQUA 3DSXA 1F1HA 2HD5B 2R03A 2ROZB 3D9KA 3FM8C 2INDC 2PTLA 1ACCA 3ZQ4A 5BXOA 1X11A 2XEWA 2Y3AA 4RLYA 2INCC 3SEBA 3SY2A 2YHEA 3I4RB 5LXIB 3V6EB 1N94A 4EQFA 3DSUA 3CVUA 3IBEA 1TNZA 1KZGA 3UTMA 1K5GB 3DRAA 1IYGA 1I2HA 1NENB 5D3VA 1K53A 2NPTB 4KGSA 3RD2A 4ACLA 3ASGA 5I2SA 3FTYA 3FUDA 3R9AB 5C1ZA 2F37A 2LUEA 4YTNB 4UWGA 2IZVB 1EDUA 1DCEA 4DXAB 2DWQA 3C3QA 1WRIA 2L2IA 1A17A 4RGNA 1Y8MA 3JSVA 5C3JB 2I6HA 1OY2A 4QXAB 1W3BA 3QC1A 1K5DB 3PO0A 2JVCA 4EEWA 2MBQA 4AXHA 2JSVX 3APCA 4E85A 4ZDVA 4HDQA 3DSVA 3UIOC 1P7EA 5H7PA 4ANUA 2R09A 3EC8A 3SO6A 1SE2A 3AS8A 2ZGDA 2WMOA 1A70A 3V5WA 4B95A 3N32A 2V0PA 4PT5A 4RGTA 1QF6A 4JKCA 4ZRKA 1JMLA 2AQ1B 4P16A 1XNFA 3AN1A 3N71A 3LPZA 3BYTB 2H89B 4ZRQA 1JPLA 3GYOA 3ZNID 3WAOA 4JPSA 1TNYA 1PGBA 5EE3A 2LVPA 4PQ0A 4EBAA 1DDMA 2W55A 1B89A 1N4PA 2WVIA 1V88A 1MX2A 3AULA 2KTRB 4XI0A 2KGXB 2ZCBA 2N7DA 1AW7A 4QJ3B 1SZ9A 4ACKA 4J7WA 4K7UA 3FUNA 4BX9A 1WSPA 1NEKB 2X6JA 4B94A 1WG7A 4GDLB 2QILA 4IOIE 2PM6A 4JW1A 3W5UB 4WQMA 4WNDA 3VH4B 3TEZA 2KR0A 4K17A 3HHMA 1NI2A 3MHSD 2J42A 1WXAA 1OGWA 1K1AA 1AWDA 3U66A 1MK9B 3ZHEB 1FO4A 4I6JA 1OWLA 3KWLA 4IWOA 5AQ9A 3PT2B 4BAXA 4HLLA 1U27A 1V61A 4RFBA 4IKGA 4P6VF 1NTVA 2FBNA 1TBEA 4HRMB 5CBNA 3E34A 4N3BA 1D8EA 2P8VA 1SZAA 1FFUA 2N4FA 1P6SA 2OVFA 4LUNU 3B9JA 3EFCA 1O1RA 1NTIA 2BB6A 2LXMA 4DI3A 3DVNU 5AQBA 3CHOA 2DLWA 4HROA 5AYWD 3JQ0A 1WM3A 2V4LA 1OCZE 2VZKB 3BINA 3SV1A 4MK0A 3MTNB 3N20C 3FTXA 5KHOA 1U4AA 4CYMD 3IV0A 4RG6A 3ESLA 1ISNA 2WDQB 4YTMB 1K51A 2G45B 4A8XC 3T3OA 5JA4D 3E32A 4KZ0A 4MY6A 1DIKA 2ILRA 1V86A 2Z8LA 3FH8A 2HJ8A 2EJ8A 4PYZA 3UT7A 1NYQA 3KW5B 4BFRA 5M72A 3SO8A 2G3QB 2WDVB 4XC2A 4DX8A 1LTXA 1YNTE 4M7CA 1WAO1 4GDKA 4KKIA 1KBLA 3C3RA 5D27A 4BBKA 4U8HA 4L7TA 2KOXA 1L0YB 2RVBB 2KT7A 2LOXA 2GBRA 2DZJA 4A20A 4UDUC 4GA1A 4HOUA 3UIOB 2VSOE 3RN9C 3FEYA 4XKCA 3TO1A 4F7AA 1WGYA 4YL8A 4HKZE 4FLHA 1YMHE 4FJZA 2QDFA 3ZTCA 4ASWC 3GS2A 4UQZA 5ARFA 2KZTA 2LGXA 5C23A 2BCJA 2IYBA 4HKQA 1FHOA 1TN8A 1XX0A 4W9GA 3BIID 3KZ1A 2JX5A 3R3MA 1OQRA 1YOVB 1TYQG 5IJMA 3F0WA 5CERB 2WX1A 3DOWA 5CECB 1P5TA 2KUQA 3K9PB 1TIFA 2IF4A 4TXRA 3NWDA 3U52E 2FIDA 2FJLA 2K8HA 2GROB 4AEZC 5A23A 3HVDA 3DBRI 4LNFA 2CHZA 2J7QB 3KRWA 2LSVA 3IVFA 2RMMA 2X8XX 3APDA 1FRRA 3OANA 1DGJA 3PEVB 2LAIA 3ZVRA 3BUAA 1DDVA 4B0MA 3SI5A 5DIFB 3NVYA 4LNGA 4GZ3A 1DVPA 4U8YD 3FWVA 3O13A 2LHEA 3VRAB 1HX8A 4HOSA 1I35A 2H6IA 3CIKA 1VZ7A 3B77A 2BKRB 3LEWA 2I5CA 2ASQA 2FBWB 2KDEB 2D9XA 2HRJA 1VJKA 2L1AA 1N0QA 3U64A 2VGYA 2MJ3A 2NTSA 4EECA 2Y7BA 1UELA 2D10A 3CVLA 1HFAA 3EUB2 4NAMA 1AWCB 1QOGA 1UW4B 1ZDVA 1ET9A 1KI1B 2GLSA 3TBLD 3FEXA 1KM7A 4U95D 2R05A 2MBEA 1CMXB 2LXCA 1S64A 2G4DB 3PV1A 3LKUA 1OMWA 1XD4A 2YEPB 1V97A 3RRMB 3LXUX 3KYDD 1J7AA 1WI1A 1DNPA 3PDNA 4F7UP 4ZRJA 3Q79A 5EN5D 2KIEA 2INPE 2UWJG 3PZDA 1E8WA 5C2YA 1N4QA 2V4IB 1NA3A 1P98A 2SEBD 2YQ8A 3VVWB 2Y4TA 4LNUD 1H2TC 1QQEA 1N0RA 2F0YA 1N11A 1WYGA 1U5EA 2XENA 5AENA 1FIQA 4GZ5A 4IRUA 4JVSA 4QFVA 4D10C 4WNGA 1FOEA 2OEWA 4IM0A 5ITZF 1XKEA 3AS5A 5GXGB 2K3UA 1WF9A 3ODWA 2ZCCA 1N95A 1M4VA 2X18A 2KATA 1Z87A 2RG8A 4NACA 5JJTA 3IT6B 4EHMA 3H9DA 3NOBA 3RFZB 3DBHI 4EKUA 4D6WA 4JHKA 2NTTA 2FEZA 4JE3B 1EF1A 4IM3A 4G25A 3MKRA 4UUCA 3PSCA 5M4YB 3C3OA 2MHKA 5JHBA 3MPXA 4NSWA 3N7CA 3IHVA 4IULA 4GDKB 3NBNB 5FT9A 2QYUA 2KMCA 3DWGC 5ENTD 5IN7A 2I5FA 4AIFA 3UMVA 1V5TA 4XX5A 1EPUA 3O48A 5FWQA 4GTMA 4CDMA 4DX1A 2VRWB 3RCZA 4ILGB 4CDRA 1YQ3B 2V4HC 2MW5A 3FU0A 2GOWA 4XEIG 4HB5A 2W9NA 5EKQD 1UGMA 2D3AA 1KZOA 3CVPA 3IXEA 2MHJA 3U12A 3CHPA 2Y5BB 1I7AA 1XCQL 3VR8B 1J7CA 3UM1A 1XO3A 2LD9A 2YS1A 3W9GA 2NS5A 3FUIA 1XT9B 1MI1A 1ZC4B 5D3WA 1C76A 3UI3A 3V2XA 4CT4A 2V3NA 5KBAA 2LHDA 3DCXA 3W9CB 1WFYA 3CMMB 2IU1A 2GJYA 1KFYB 1WJMA 3M62B 1WM2A 1HBKA 1E6EB 3GP7A 3Q9NC 1C79A 3I3NA 3PRPB 4GNKB 3A1QB 2KANA 4M02A 4DHJD 4A3TA 1L2NA 4FC8A 4MEMA 1OWMA 1PFDA 2DYRE 3OJ3A 3GOEA 4GAAA 1V9JA 3UPVA 1SIJA 3SQVA 1T6BX 2IPKD 4O6FA 1U2BA 2PM7A 2XEEA 4TYZA 3NRZA 4W9LA 2QKMA 2ACZB 2ZKMX 3M95A 5JJ7A 1R4NI 1EAZA 2DVWA 3G9WA 1TS4A 2W3RA 4B89A 1WMHB 3T8KA 2R2YA 3NWFA 3AE6B 4ANVA 4YNDA 2JZ3B 3TEWA 1KZ7A 1GJZA 1Q5WB 3S2AA 2XZDG 3SHQA 2YVCA 4N5QA 2HYZA 3Q8BA 5HG2A 4M0WA 4C80A 3NS1A 4WNFA 3LYYA 3Q3FA 3U7ZA 3SNHA 2DHJA 2IOSA 3CQCB 3ZKJA 3W2DA 3E30A 2GCJA 1MQSA 3DXMG 4MGKE 5EE1A 3T5VA 3T9LA 1S70B 4C9BB 4K2OA 2UY1B 1C78A 2X0SA 2XGMA 3APFA 3G2SA 4PUCA 4DUIA 1JALA 1EGXA 2QEJC 4I9CA 1MPEA 3MV3B 3TMPB 2WXFA 3P4SB 1V55E 4RGMA 4N9F4 1YYHA 5J17A 2IBIB 2WXGA 5L95C 4EUTA 1ACAA 2VSXE 4JWUC 3EUVA 4G8KA 1H19A 3RJVA 3RO2A 1BTKA 2VH1A 1OQQA 1RYJA 1K8RB 4NPNA 1DYNA 3AU4A 1VDVA 4GGQA 2KX3A 3QNKA 2BF8B 2OEVA 1PGXA 3FILB 2Z59A 2YF0A 5BV0A 4PH4B 3NJTA 5FIOA 5FQ8A 3KYCD 2KQ7A 3CVVA 2AWIA 1T0QC 4OVUA 3PRMB 2K9XA 4EE2A 1BAKA 3DXCA 3P4RB 1LD7A 2FCQA 3WXXA 1XCTL 5LOZA 1NL4A 2ZNVC 3ML8A 3RIBA 2WQ7A 1U5DA 3HW2B 1SF0A 2NVUI 3JVZX 4UWLA 3QHTA 4W9FA 1TNUA 1ZXIA 3RNCC 4JZYA 2HDEA 1V1PB 2N9PC 4A1SA 1MX6A 4RM8A 4U7EB 3DHHC 3CSTA 3VDZA 1SQMA 5C2TB 2LAHA 1HB6A 2K49A 5CHEE 3IFWB 3RULA 4GYYA 4FJYA 3G2UA 3L4PA 1FXTB 4IAPA 5FI0A 1RAXA 2ON8A 1OXJA 2WU2B 3KWVA 4G0NB 3CHQA 2N9KA 2R0DA 1QLBB 1MZCA 3DEPA 2Q7FA 3HXDA 5B3SE 4ATGA 2KIGA 2J52A 1L4ZB 5LP0A 2Z0EB 3ABME 3PRZA 1ZVRA 1STEA 1WXSA 4L2LA 3VRBB 2H6FA 2CR5A 4BX8A 3OLMD 5MPOA 2O6VA 3VLEA 3DEOA 2DIWA 5CEAA 2WB2A 2UYZB 4BZAA 4JD2G 3IAS1 3FU6A 3ZU7B 4IFSA 4A6FA 4EJNA 4IG7B 4S0RA 2P9NG 1Q67A 2I2OA 5J2RA 3LYAA 5DPSA 3BEEA 2UZRA 1QQRA 4CHKA 3BU8A 4ZFHA 2WDTB 4OVVA 1YIWA 2K39A 3AE7B 2J0MA 1U5GA 2G9HD 3SFXA 4XWXA 2K6QA 1BWNA 1FFVA 3FP5A 2JUOA 2V3SA 3HG0D 4JX1C 1SJED 4ATZD 3AE1B 4M8MA 1OQYA 4HVBA 1QOBA 2P9KG 3TCAA 4B6HA 2ZZPB 2WX0A 2KFKB 3PUKA 2QSDA 2DAFA 2WDRB 3MFGA 4K3BA 4G24A 1PGAA 4NZLB 1V5PA 2E2XA 4L1BA 1EVHA 1RLFA 4BSXA 3J9CA 1C77A 5HS0A 3B7RL 3VTUA 3PS6A 1DBHA 4LEUA 3Q5MA 3QWMA 3AE8B 4DPRA 1YJ1A 4MACA 4DHZE 3RKVA 1HTOA 2N0YA 1OEYA 1XEEA 4JK9A 3KQ4A 2ZNVB 3ASFA 1NVID 5G05C 3UKUG 1PY1A 3EFUA 3FP3A 1GOZA 1NZNA 1IRSA 5LCWC 2WNMA 4US9A 4DLQA 2IGHA 1IXVA 3S7BA 4LNIA 4Z68A 5IAAC 1V80A 2L0TA 4KVMA 4C0EA 1X1FA 1HH8A 4C0AA 1ZW7A 3CVNA 1BLXB 3ENBA 1LM8B 5D6JB 1JROA 4EMOA 2GB1A 2M19A 4US8A 3EHQA 2QKLA 3Q2AC 2B6CA 3EHRA 2UZSA 1JWFA 2IO3C 4E3CA 3MJWA 4YWGG 1WGGA 3MC9A 3CXBB 4G26A 2PVOD 5FZSA 4CHJA 3ZYMA 3QOUA 4NQ0A 3H7SA 1AYFA 1TS5A 4GTRA 5GMVA 2WXOA 5C16A 3PHWB 1E8ZA 4TUUA 4LJPB 5H8YE 4A63B 2IGGA 1TY0A 2FO1E 4HORA 3SFEB 3D9NA 4HI9A 1NI3A 5D0QD 2HM8A 2L6JA 1F2RC 2VRRB 5BYRA 2ZEQA 2V3PA 2ZGGA 3AE3B 3QCAA 1Z3YA 1LW3A 2Z0QA 2VSZA 3A9KA 3AM9A 2DCPA 1TS3A 3SBSA 1H2UA 2MDXA 2G4SA 3J5PA 1WJ6A 4C4VB 2ZVNA 3DSTA 4U0UA 2L8JA 5AQAA 2DZIA 1GGOA 3CLJA 3SD5A 1PQSA 1IYFA 1FCLA 1SXTA 1WGHA 3WANA 4HPMB 4YDOA 2M8SA 3RMKC 4WNEA 4W9KA 2FIFA 4HQDA 1T5XD 1TT5B 1H8CA 3GZSA 3ZVVA 2JRIB 1ET6A 1UG3A 1L5PA 4M00A 3RNFC 1XLQA 2WXHA 3BG0B 4HOQA 3A4SC 4WJOA 3CEQA 3R2IA 2FJ9A 4ILHA 1FCHA 3RAUA 3ZRHA 1EM7A 1P5QA 1CK1A 5B1BE 3HIZA 2IFSA 2NXPA 5DH9B 5EYPF 4Q2JA 3VR9B 3D8FA 3FTSA 4KSKC 4N5CA 4APFA 5C5BA 1WJ4A 1GC7A 3ZRFA 3KY9A 4NJCA 2WXIA 2RRFA 3I9V1 4FBJB 1YCSB 3UQAA 2F8YA 4OZBA 4EBAG 2JWUA 4J8FA 3A8PA 3UF8A 2D9ZA 4ACFA 4HB2B 1TJFA 2B0OE 1ZC3B 3P4PB 3AG2E 3EPYA 1QOFA 2BWES 4AJYB 2J8SD 4KIKA 4F53A 5J3QA 3ZXPA 3TW1A 4XIFA 3NZUA 3V6CB 3V05A 4D2KA 2AJAA 3EDTB 3DXKG 5AUKA 5JH5C 2KDIA 3PP2A 1WXQA 4JL9A 4IW0A 2IO3B 2ADZA 4WWOA 1S63A 2V1YA 3AXCA 1UWXA 1J0WA 2C5LC 2PMVA 2DKPA 3N3KB 3OG5A 3RNGC 3U8ZA 2FF4A 4YT0B 4I6PA 1H10A 2NBWB 2UWQA 5LG4B 3ONKA 3SR6A 4XKBA 2LVQA 5CCLA 4GPMA 4AP2A 3S7JA 1JUQA 1DC2A 1UUPA 2DTCA 1ESFA 3URZA 2W3SA 4GXBA 1AQCA 1I4HA 2CFZA 3C19A 3AG3E 1T3QA 2QFCA 3CVYA 3NVWA 5DCNA 1WGRA 3FULA 4ARCA 4II3B 2P58C 3FTVA 2PQNA 5EYLA 3SHFA 4K5CA 1I42A 1W1HA 3AJIA 4GMVA 2YINA 2KBXA 2NBVB 3G2TA 1KLVA 2MRIA 4LNKA 2C0MA 2KCKA 1E5WA 1LD8A 2LNIA 4P7IA 1Z2MA 1Q2ZA 2EIME 2CS4A 2XEVA 3B95A 1C4PA 2WLBA 5KJKA 4MH8A 1WJNA 2VKIA 2DBAA 2H6HA 1GB1A 3AH7A 3LJ3A 4OYSA 1TR4A 2M0AA 4ZRIA 1ZPSA 2CG3A 4DDGD 4GTTA 4ANXA 4H7XA 1N6ZA 5G5GA 4W9JA 2XS8A 2COFA 1RM6C 1WDYA 3R8BA 4KDIC 5G05J 1YN4A 4HCNB 2I38A 5H92C 3EIQC 5BT1A 2L0IA 5C1DA 1QNFA 5LCWJ 2WHIA 5AZHA 2YRYA 3CVQA 2O2VB 2K2JA 2PKOA 2BYFA 2P2CP 3A9KB 5I2MA 2J09A 4MBGA 2X6FA 5EE9A 1N9AA 5CRVA 2FAZA 3PREA 4PS8A 1JQ4A 1BTNA 3A58A 4ZHPA 5HQ8A 1I4QA 1XGWA 4HXDA 2DIKA 5E6JA 2EKIA 5AEKB 1FNUA 3D8EA 5J90A 1QZEA 4YTPB 3A8QA 1HEZE 2NBUA 4GPTB 2LGDA 3ZNZB 4PYUA 2OEDA 1W1GA 5KHQA 3Q7AA 5CMWA 2FI7A 3BVMA 2CU1A 1Z5SC 5DI9B 3DBLB 3IHYA 5BYSA 3CK7A 4WUYA 1JCKB 1C1YB 3OXFA 2KO3A 4HJGE 2D9WA 1UNPA 3DXEA 1ROEA 3Q6BA 4XWTA 3DVGX 4ABNA 4MSMB 1QZ2A 1HU3A 2Y0BG 3ECIA 2L0FA 1YJIA 2ICIA 3B7TA 1WZ3A 1A5EA 4TV3A 4BT9A 1N3HA 3L10B 4GSWA 3MZLB 3KVFB 5C5BB 2MX2A 3A9JA 4OAVB 3S7FA 2JZPA 4LLGM 4DHJB 4JEHA 2CRFA 3HRDD 3CV0A 2Q13A 5CTRC 3QBVB 3W9FA 4DX90 1V5OA 1IGCA 5ANRA 4K2PA 2ZISA 5LX8A 4RCOA 4LJOB 3TEXA 3H6NA 2JXXA 4PDXA 3AEDB 4K0RA 3D9LA 2AXUA 4Y6CA 1KLUD 2NZ8B 2QHOA 2XNAC 2IYDB 2J53A 3NVZA 4XDDA 2WGSA 3ZYLA 3ULCA 3PNTB 2Z14A 4WAFA 4RG9A 5AARA 2X6KA 5A6CA 1JRPA 3P63A 1BI7B 3E56A 1V2YA 3EGRA 2MP2A 2BTEA 5AJLA 1MK7B 4XI9A 4Z2MB 4JHJA 2Y8GA 1WGDA 2ELBA 4U63A 4JXTA 3UZTA 4KDLB 2XN9C 2X3MA 4HB0B 2GMIC 1FVHA 3CSFA 4V3IA 2GBKA 3QWVA 1O5MA 3UXGA 2BWFA 1ELKA 1KC7A 2KQSA 3C8YA 4B6WA 4HRNA 4K3CA 1SE3A 3ENEA 1HXYD 1XODA 1S1QB 4M8NA 2ZPYA 1OQNA 4WJNA 3QWPA 4CYEA 1TNOA 2VGXA 2LUHA 1U29A 4HDOA 1XD3B 2P0DA 4K5BA 2NMBA 2RUKB 1OCOE 2O6VD 3JSVB 3CKCA 3CIRB 4GOCA 3SF4A 5CMYA 1U3DA 1TKGA 3PVWA 3LY9A 5G5HA 5JZEB 1NA0A 3BJIA 5IOIA 1E8YA 5L83A 1TJEA 2RGNB 3L08A 1E10A 1NTYA 3HYMB 4KBQA 2Q5WD 2EINE 2D9VA 5HE0A 1WIAA 3GE8C 3ZIMA 2OQBA 3M1IB 3EU9A 1Z5SB 3BWUD 4KVGB 3MEKA 5CLLB 4K5AB 3Q75A 2J08A 4Z2NA 4LNNA 3R7RA 5BMIA 1OFFA 3Q3MC 4YDWA 5D0OD 5J18A 1RRBA 3B2FA 3KUZA 2DWZA 1KOTA 3NOGD 5LFAA 2C7NB 3N30A 1KJTA 1TGZB 5HI1A 4G8LA 1YN5A 2MOWA 3DQVA 1SJHD 2E6XA 3H7PA 4HRLA 4CGWA 5CHWA 4TUMA 3RK6A 3AEEB 1WY6A 5EFXA 4FULA 3NOCD 1MX4A 3FTZA 2ZU6B 1EU4A 2XQ0A 4HAVB 4IM2A 2JT4B 1BT0A 1ZB1A 3TVVA 1BMLC 3TXMA 4BBNF 1NBFC 1J8CA 4I1AA 1TXDA 5ANLA 4RF0A 4W9HA 2BKFA 2PIAA 2KJRA 2PLPA 3SNXA 2KMAA 3QX1A 3BY4B 2KC7A 4A3PA 2V0GA 1WGKA 2KWVB 5DBKA 3RO3A 1EO6A 5JMND 2CHXA 4CGVA 1OCRE 1O1TA 3DSSA 2C0LA 2RDHA 4KZCA 1VCBA 3AG1E 1DROA 1P1AA 1X5BA 2JYTA 2GRRB 5AAOA 3ISMC 4HI8A 1RFAA 2OVBA 3C72A 2DLBA 4CQNA 3ZNGA 1ENFA 3R7QA 3LY7A 4GA2A 2NCNA 2ZJDA 2KLCA 3T9KA 4DX6D 3AAAC 4ILJA 1ZU2A 2KC2A 3FU3A 2V9HA 3OJ4B 1JWBD 2R2OA 2EMSA 2K6DB 4A9AA 4LRZA 1XLNA 1K52A 2KUPA 1E90A 2SAKA 3PNLB 3C5RA 2AWTA 1TJCA 3VUWA 4W9EA 4J0UA 3UI2A 4WAAA 4PK1A 2XCBA 2LULA 4LNBA 1TZ1A 2HTHA 1IHGA 3B08A 2OJWA 3ZDTA 4GTSA 4GIVA 2KDMA 5BMHA 2H88B 4GMJA 1TKEA 2D07B 2VJ8A 1EUVB 3AB5A 3AE4B 4WVFB 1QKZA 5HE3A 2L32A 3UIPC 5FI1A 1DYQA 3Q78A 1ST7A 3U7DA 4W9DA 4G2VA 3GYZA 4GYWA 1ZBPA 1P7FA 4GTOA 4GU2A 2P9UG 3ONSA 3G2VA 3BQOA 4WIPA 3TIXA 1Z6TA 3EHMA 3HK0A 5T3RA 3CGHA 1TN7A 2KZTB 4IDIA 4LK0M 3UQBA 3RRNB 1UH6A 4UWFA 4DIXA 3CR3A 2Z0DB 3IG3A 1K50A 3PE3A 3HQCA 1Q10A 1Y6IA 3NWAA 2JY6A 2BB5A 3TAXA 3W5VB 1EF1C 2I9CA 2LG1A 5JHHA 4HXIA 3T3NA 4GU5A 3NF1A 2MQJA 1L0VB 4B9KA 4M01A 1G3NB 1ZYIA 3KEAA 2H7EA 4HATB 2DZKA 2R17C 4KGTA 4RH6A 2AL3A 4MJSA 4N2SA 1UZXB 4OT1A 3V2OA 5AQ7A 2BW2A 1UNQA 3P7ZA 2JQRB 1JWMD 2WXJA 4CCAA 1E7PB 2C60A 2HO1A 2XCCA 2XPZA 3PEGA 5IRSA 3M63B 4HRSA 3T5XA 4GOUA 2R59A 3H7PB 4CO7A 3P1MA 3B7SA 5EE0A 1UN8A 1FCCC 4WURA 3E37A 3NY5A 2KXJA 5ARGA 3WAPA 4MGIE 2D4QA 2DYMA 3HDXA 3VIAA 2R61A 1Q0WB 3Q73A 2VH2A 3CK8A 4J8EA 4APOA 2BGFA 2KTFA 4R3DA 4G11A 3U3WA 4USAA 2E3TA 4AV7A 2IJ0A 1MPHA 2BKGA 4HNAD 2LKOA 4L6EA 4RMAA 4GZDA 2XZTG 2M14A 1M7RA 2DX1A 1B1ZA 1H6PA 3R2TA 3TGOA 2W82A 3L22A 3K9OB 4A55A 3MCXA 1HA5A 2K2UA 5HRYA 2JLBA 2AL6A 2FNJB 4JKAA 3QA8A 3WG7E 1F9JA 2AXVA 4YSXB 2PL2A 1F0ZA 4DBGA 4P1CC 3AU5A 5G55A 2OHFA 4G23A 4L9PA 2BQQA 2W54A 4NY0A 3HVEA 3OXLA 2X38A 2JU6X 4I2ZA 3P2BA 3VUYA 3NZSA 2YSZA 3UIPB 3P42A 2XRZA 2IFUA 3E9PA 4O60A 2MBOA 2H7DA 1F2RI 5CBOA 2M0XA 2HJ1A 2N7EA 1HF8A 3FUHA 4FU3A 1HE8A 3PLVA 2CFUA 3F6QA 1PDXA 2MFQA 3ZKJC 3J5QB 2XGOA 3FUEA 4YDYA 4JKEA 1QYMA 3WYFB 1FHWA 1N5XA 1FHXA 3FY4A 4HCPB 1JDEA 5IKCM 3ZJVA 4JA9A 3ZXSA 1OWOA 3MP9A 3GZ1A 4RSYA 4I43A 2LXLA 2HTHB 2XK5A 2K1FA 5LXHA 4BKSD 3IHPC 3D32A 1DOXA 5BYQA 2MH7A 3VFKA 3OHMB 1QQGA 2J0KA 4MS6A 1XQQA 2KXPC 2KC1A 5FQ6A 4L2YA 1SHCA 4URKA 2YS5A 2CU3A 4DWFA 1L6VA 5IA7A 2Y69E 1V8CA 4CHMA 1UGJA 2AW6A 5D3XA 4MSQB 1LGRA 1C4AA 4F7GA 5AIJA 1TEZA 2IO1B 2D3BA 4MM3A 2ETBA 4F8CB 3PG7A 4N3AA 4X8QA 1ZXHA 2EIKE 3D9PA 4GTPA 3F5RA 2P0FA 5FZQA 3PPAA 4MH0E 3TWVA 4O1OA 4YONA 1RW2A 1O1SA 3Q15A 1FRDA 2E0IA 3QAQA 3U4TA 4KKJA 5DPWA 1IBXA 2DZOA 3JYSA 2W2WA 2PE6B 3SBTA 4XGAB 4XYCA 2BPSA 2NC9A 4O1NA 3TG5A 2V5FA 4AJWA 5DIZA 2N7JA 5IO9A 4EPZA 5LNK1 5BNWA 3AV8A 4JHRA 1ZGUB 2KVRA 3H8HA 3RYTA 4MJSB 2KD0A 3DBLI 1UD7A 4ARIA 4GN1A 4MKTA 5JXVA 1YX6B 4EZJA 2GRIA 2BT6A 1MYOA 3ULYA 2IQCA 2YS3A 4LTUA 4NQKE 3Q8CA 1SSNA 3Q47B 1LFDA 4MGZE 5BUZA 3ODOA 4JIOU 4I2WA 2GBMA 2H6GA 1FPYA 1JW9D 4MDKE 2WQ6A 3CIAA 1D3ZA 3ETRA 1X81A 3ZO5B 2NYJA 1SE9A 1JRUA 4Q69A 2RLOA 4F7HA 3W1SA 3QWWA 2YT0A 2VSYA 3AJ4A 4JKGA 1MG8A 4B0ZA 2MRPA 1NU2A 4YVOA 4M0WB 2V76A 2LEKA 3BK1A 3VLFA 1ZE3D 4KHAA 3TL5A 1RRPB 1BUIC 3SFYA 2COPA 2EMTA 3FTWA 2M38A 4QAYA 2GCLA 3UX4A 4BKGA 1ZUD2 3RZWC 2KJHB 3LS8A 4J8YA 2WU5B 5TR5A 2BVCA 2FUG1 4GCOA 2KZRA 4II2B 4W9RA 2VQ2A 2JF5A 1DOIA 3BVZA 1PLSA 2J4BA 4GMXB 4WWNA 3FUKA 4BTBA 1NI1A 2RFAA 5JVLA 2J9QA 2PPHA 3L6AA 2FO7A 3V79K 1OCCE 4JB8P 4YSYB 2QC9A 3P6AA 5KCMA 2JABA 2L00B 2GS0A 3HVEB 2P9IG 1SBBB 2RKKA 4K03A 1D4BA 1GW6A 4NRHB 1N63A 4K1RB 3UM2A 1PFJA 3HVZA 3L17A 2DYQA 4JLCA 1BI8B 4AOFA 3NW8A 2A5UA 4JQWC 2Z59B 1KTKA 3ZGQA 3TWUA 3CVWA 3IAM1 5KWDA 3PTFC 1LXDA 4DI4A 2NPTA 5D2MC 4YVQC 4N39A 2WXNA 2C9WB 3Q9UC 3KUCB 3GYPA 5HHDG 3KUDB 3ZW3A 2HR2A 2MLBA 2JPHA 3W1YA 4JKFA 2PEAA 3MGBA 1WR6E 3DDCB 3AEGB 4YSZB 1WY8A 4CSQA 3EHVA 3KSQA 2KX0A 4HAWB 2KHWB 1WJ1A 4DHZB 1N54A 4WQOB 1GAQB 1I4PA 2AEHA 3AEFB 3VTXA 3Q14C 4WJPA 3RUIB 3BYYB 5J3YA 3TWWA 2FULA 1MVKA 1OWNA 1IHBA 5AUIA 1QOAA 4U96D 2L83A 5AJDA 5AN8A 4BESA 3ASNE 2RFMA 1QT9A 3V60A 3VXWA 2MSED 4D0NB 4UQXA 4C00A 5ENQD 1EYHA 1JWGA 3GB1A 3FEHA 3FC4A 2DKQA 3KD7A 2O6VB 2WXMA 2IY0B 3PZ3A 3R66C 1J7BA 3IT4B 4I17A 5EX0A 1L4DB 4WSFA 3E4BA 2HTME 3ULQA 2D2QA 2L6BA 3D9HA 1DOYA 1MFWA 4HB3B 4DX7D 3Q49B 4A6FB 1JWSD 1MHHE 2LUMA 2KTRA 2L7RA 1K3ZD 2QYJA 1K8KG 2I1KA 1UJKA 2OCCE 3E9LA 2D9YA 4HPPA 2V8SE 2UU7A 1E7VA 4KMOA 4JK7A 3N1XC 4GDLA 3FUMA 4NNJB 1KH0A 2A4ZA 3UKRG 5L81A 4DJAA 4K81A 2PVGC 4IYPA 4QJ5B 2LWPA 3HM6X 4JGHB 3RPFC 5FR6A 1VZ8A 1X1MA 4DDID 3ZHEA 2VTBA 3ABLE 3G2WA 2V5QC 4DRXE 4MT7A 3Q69A 4F6RD 3UGBB 1X05A 2EILE 2GRMA 5FINA 2WXPA 1FGYA 2PZ1A 2YHCA 2W2XD 3V3XA 2QY7A 3SFDB 4OSNA 2FCSA 5E75A 4ZRPA 4N3CA 4XE0A 3CHMA 2CKHB 3ML9A 1NYRA 2E2EA 2EELA 2JEKA 1T0SC 1MHXA 3FUJA 2RPQA 4ICVA 4KGRA 5D2MB 4TKNA 5HKPA 3PUJA 5A7DB 1FNWA 3QJZA 4GPKA 4FP7A 3EJNA 3FHEA 3ZUNA 4UWHA 5G04C 1FT1A 1V89A 4RGOS 3SU8X 4I6GA 2MA9B 2PZIA 5FR3A 5KNGA 5E6NA 1UN9A 2REXA 5AZFA 2PNNA 3TWSA 1WX8A 4G50A 2L0TB 1X1GA 4GYOA 4LG6A 2ZW0A 4MT5A 4B8CB 2M17A 2FE8A 3EECA 3RI7C 1UEFA 2JRHA 2RDGA 1XF5L 1U2VG 4FN2A 3DSWA 3VH3B 4MELA 3IEGA 4GZUA 1PYWD 2KN5A 2IEJA 4U0ZA 4G1TA 5IY5E 3Q8AA 4F3VA 2DFKA 1MIZB 2GGFA 1WE7A 3C0RB 3SBGA 3MX3A 4FHKA 5EIDA 1D9SA 2B76B 2LVOA 5KJLA 3OWEB 1AWEA 4HB4B 4YDEA 1VZ6A 4Y94A 3O65B 3MKQA 1B9RA 2PJHA 3X23A 4C56C 4BVUC 3TFMA 4X57B 2MWSB 4S17A 2KVZA 3TG4A 3D9JA 4LDTD 1L7YA 1S0PA 4N2QA 1JWUD 4U07A 2BF0X 5KQ4A 1VR9A 4IWPA 4B0EA 4HAUB 1WX9A 3PSEB 5TSSA 2K8BA 4KHBA 4Q96A 4ZHBA 2X6HA 4BKSA 1HG2A 4MRUA 1FEHA 3OAWA 2A5EA 3ASDA 4BSZB 1N5WA 3GZNB 3T06A 3I63C 5G2NA 3MHZA 5D3IB 1WG0A 3VTWA 3CQGB 3LVQE 3V30A 3VTYA 1MAIA 4KAXB 3ZXRA 2R5SA 2JYEA 4A90A 2AX5A 2GW1A 1TNBA 2XRYA 4AM9A 5J08A 4NJ6A 3V61A 4PS3A 4K7WA 3JQ1A 4I6EA 4AY5A 4ANWA 2D11A 2FUHB 5BXUA 2RDBC 5HE2A 3AEBB 2L1CA 4BOZB 2WMNA 3ML4A 1LO5D 4E6HA 1YMPA 4WJ7A 1OEYJ 3Q3OC 3E33A 4JC8A 3ZNHB 3UT4A 3ZLZA 2N0SB 4ILHB 2XGSA 2Z13A 1P0RA 2L76A 4DBBA 3KSYA 5FKAC 3KSLA 3NQPA 1V6EA 5CRUA 4HFGA 4BT8A 5FZRA 3ABVB 1G6JA 1VDYA 1WI0A 4GLSC 1ZP0B 3ZTDA 5JP4A 1UBQA 4BBNC 5CLQB 1TTNA 4DQOC 4OAUC 1SGHA 2MBHA 2WYQA 4OW0A 3DPDA 1N61A 4AWJA 2VTBB 4BEPA 3JXIA 3AE9B 4XZ4A 1T0RC 1V81A 3PZ4A 5T8IA 1IPGA 3HXBA 1XLPA 4KIKB 3I3TB 4N6EB 3TWXA 3BVGA 4W9CA 3RRUA 1LB1A 2CG2A 1KT0A 2L05A 3DVNV 5I4DA 4HAYB 3MC8A 4HK2A 2QCZA 1IQRA 1HTQA 4HJKA 3I4GA 2EIJE 2P9SG 1WX7A 3D3MA 1SA5A 2J49A 4F1SA 1YN3A 3LB8C 3ZDMC 1E7UA 4TQ0A 4NIKA 2EC1A 4U04A 3KAEA 2M63A 3ZPJA 2IY1B 1SA4A 4JA7A 4MLPA 4CDNA 1FM0D 2XBBC 2RPVA 5ENNA 1KLXA 2AVPA 2DYOA 3ONLA 1H0AA 3LY8A 3AI5A 3NS8A 4FADA 4CEMA 5KJMA 3PVLA 3DVGY 3NG0A 3L54A 1YD8U 4EZKA 1PAQA 4KV2A 3QK0A 3HM3A 2FJUB 1S3SG 2P9LG 4O1PA 1RJ2A 2R82A 4WJQA 2OJRA 4HBDA 2LRWA 4RM9A 3CVXA 2BUGA 4CZ2D 4JKHA 3LJUX 1IGDA 1D5ZC 1YA0A 1P3QU 1VD2A 3E66A 1ZM0A 5KJNA 1IP9A 2CAYA 3MKQB 4ILGA 3PGEA 2CY4A 1N52A 2DA0A 4NURA 2VYIA 2Y8FA 3ESKA 3MDBC 5LOPB 1N62A 1TS2A 2WWZA 5LONB 4ILIA 3HXFA 5G04J 4IOYX 4CRWA 2D5GA 4JK8A 2DNFA 2KK8A 3D8DA 2ONDA 4KXKB 3HUIA 2IO2C 2QMTA 3PZ2A 3AG4E 4KHBB 2IOLA 2ROVA 2DX5A 4H8SA 5HKHA 3P4QB 4F7ZA 1IUEA 2HE0A 2I1JA 4BOSC 5FJYA 5ENPD 3PE4A 1Y19B 1N4RA 2K22A 2MBBB 2R2QA 4ZYSA 1X86A 1CQVA 3AE5B 3RNEC 2YT1A 3QC8B 2K25A 3AS4A 4Y6WA 2LMCA 5C79A 3NAWA 3X2QE 3Q3JA 1QILA 3DHIC 1WGUA 5IP4D 2GRPB 3D9IA 3A1QA 1YQ4B 3GE3C 1C4CA 4WWMA 2DAJA 3Q4AB 3JXJA 1RWSA 2C7HA 4DXGA 3L13A 2KWUB 3DPYA 4BKTA 4C7ZA 1BXTA 3AEAB 4TXQA 1HZ4A 3X0WA 2LFIA 4B93B 2AQ2B 3QKYA 4WH4A 1ZOYB 1H6KA 4EOYA 4R7LA 4KVOA 3S7DA 3ZRCA 5JJ6A 3SZ7A 2KLGA 2WPVA 3CHRA 3SYXA 1R7SA 2L52A 1WMHA 2BS3B 1MI0A 3QQ8B 4UI9K 1KPSB 4DX2A 3L9TA 1FXIA 3A9JB 2OOBB 2WXRA 2RD0A 1GC6A 2KKCA 3O4ZA 4KYOB 1MJDA 1MHQA 3ZJTA 3HXCA 4DX5D 2ZVOA 1JWAD 4ITKA 2CHWA 4FJVB 5KNHD 2VGEA 4I1OB 3NUHB 1INZA 2ZPNA 4AP4C 4NAWA 2UY1A 1LQBA 1UWMA 3KH0A 3LXFA 3NZ3A 5ENOD 3FH7A 2WH5A 3A98B 1EU3A 1NVLA 3CKBA 1R4MB 4BWRA 3HRAA 1WE6A 3WALA 2YEPF 1WJUA 2MP2B 4ZOHC 2C2LA 3KRXA 1D5MC 2LXAA 3C98A 4GMLA 2KFJA 4AUQC 5KCVA 1HG5A 4RNAA 3AECB 2XHEA 4KT6B 1UOHA 2IGDA 4J8SA 1NDDA 1SW6A 4DLOA 3QARA 2LJIA 1V5MA 3ZJUA 3FLVA 3ZXVA 4AVXA 3MV2B 1KZPA 1V1OA 3AMZA 4IWQA 1RFKA 3FILA 3R9MA 1M94A 4H2AA 2N9LA 1FPPA 2DENB 1T77A 1TJ6A 2KCVA 1TQZA 2IO2B 3ZNGC 2VGXB 1YX5B 3IKOB 1J19A 3CHSA 3L82A 3VOQA 1VRAB 1V49A 4E71A 4XDCA 1TKYA 3HSAA 2QC8A 3TUOA 1D5XC 2M4NA 2ELAA 2PW9A 4W9IA 3WIMA 5CHFA 1V1PA 4REZA 3QB2A 2B3AA 1PC2A 1KLGD 2J0JA 1PUTA 1TZOA 2W2XC 2COCA
chains in the Genus database with same CATH topology
2J4DA 1Y5OA 1A5RA 3ODXA 2AXZA 5JLJB 3QIJA 2L3ZA 4UWKA 2DYNA 5HI7A 5FQ4A 3ALBA 4I9EA 2RNRB 2WQHA 5E6OA 1HO8A 2CQUA 1XCGA 1MIXA 3ASHA 1E96B 3JCKC 2KDBA 3ULBA 1WRDB 2DX5B 2OV8A 3JUIA 1KT1A 1H2VC 2OTXA 3ZEFA 5D7GA 5DPTA 1ZKHA 2KDFB 2WXKA 5T4YA 4KHOA 2RSUA 2GBJA 1MKEA 1OWPA 1XR0B 3FFLA 2PQRA 1H4RA 4HOTA 1NP7A 5J3TA 2RSGA 2J07A 4BY6A 1WVHA 2LI5A 5JHGA 2N1WA 2MCNB 1U3CA 3PH0C 3U9WA 4A3VA 4J6IA 1T0YA 2KFKA 3B7UX 4HAXB 5CCMA 2MWNB 4B8AA 2JZZA 1LF8A 1Z3XA 4BTAA 3T8MA 3V62A 4M3OA 2EKEC 4ZYNA 4LERA 3PEUB 3PVUA 2CY5A 4C0MA 4LCTA 1U5FA 2MKRA 3CK9A 3FUFA 4RVBA 1FAOA 1OTRB 4NAWB 4A1GA 1GG3A 3OTNA 4CT0A 5FQ7A 2XPYA 3M3JA 5DHAB 4E74A 5DHFB 5DPRA 3SGHA 2LJ5A 4H7YA 2JP2A 2DHZA 3UUXA 2PE9A 1UPRA 3SDLC 1SIFA 3A4RA 2DZMA 2Z0PA 2IO0B 3MA5A 5E6PA 3OXGA 3VHTC 3LVRE 4UI9C 2KWCA 4HAZB 3L0WB 4GZ6A 5GOWB 2M1MA 4FHJA 1FB8A 3GZNI 2CODA 1Y8RC 3ZYQA 3LDZA 4A3OA 3O96A 2GRLA 3B13A 5E76A 3GZ2A 1W1DA 3KS2A 2COAA 4G3XB 2Z0OA 3VUXA 2BYEA 3WAMA 4A5KA 5EDSA 4IN3B 5KQ1A 1QC6A 4PNKA 3L16A 3RU0A 3QWZB 3K9IA 1VBGA 2BTDA 4JKBA 4FA6A 3JW0X 2C7MB 1ELWA 2L9BA 4LDTB 2YNQA 3DBSA 3FSSA 2RGFA 2J59M 3GW4A 3U30A 1HXIA 1WXMA 5BO4B 2KM4A 1DDWA 1ZSQA 5BW8C 2K00A 2LOZA 3TXNA 1ELRA 2AYOB 4I6NB 2IONA 1FVFA 2BYVE 4TRQA 4GB9A 3RCPA 4J8DA 3H1UA 4HLEA 3QDNA 4L23A 2KJ6A 2DHKA 2LBBA 2LSUA 4GA0A 4EFOA 3D9OA 3MYVA 4Q94A 5HE1A 3SFZA 5AZGA 4EZLA 4FLBA 4HWIB 3VLDA 1E8XA 2KCJA 1YQBA 4HHVA 3JYUA 3LDZE 3FH5A 1FGZA 3PLUA 4ME2A 1WYWB 5FTPA 1J0GA 1L5JA 1WZ0A 1V5UA 2G35A 4A6HA 3W1SC 3P1UA 4GZCA 3A33B 4ICUA 3B0AA 5EX3A 4TQ1A 2CB8A 5BV1A 3NSUA 1WR1A 3TJPA 4I6LB 1AARA 1HS6A 4UQYA 2RR9A 1BPOA 4A6KA 2OOEA 2DN6A 1UPQA 3EHNA 2GBNA 2XK5B 3DXDA 3PHXB 4HS2A 4I1MA 1WXVA 2NSZA 3FTUA 2HE7A 1HB8A 1P9DU 1VBHA 2Y4UA 4K7SA 1P3RA 4GCNA 4JKDA 3LCAA 1PMSA 1GNUA 3ZN3A 3VQIA 5BPPA 3BG1B 2LZ6A 5D3YA 2N9EB 1WM5A 2KNBA 2K8CA 3RT3B 2KCLA 2O2VA 3SUZA 2N9XA 1WGQA 2JWZA 2XPIA 3SBTB 2IJGX 3DCGA 1M7EA 3UINB 1GUAB 4MGYE 1C3TA 4JL0A 2WXLA 2WXQA 5CX3A 3ZFWA 2YLMA 4AY6A 3I5PA 4KSLC 2LYDA 3B1LX 3VAWA 4P29A 3UT8A 1B55A 4U0SA 2LRUA 2ABDA 2LO6A 2X6IA 3FDHA 2N23A 2DYBA 3VTVA 1OUVA 4UI9J 5LLIA 1Q1OA 3WA0A 3KEZA 3RZFA 3UQ3A 4IC7B 4IUMB 4DK5A 3CF6E 3FU5A 4JKGB 4JEUA 3D9MA 5C6RA 2RQ1A 5CHVC 4NQLB 1UBIA 2LGYA 3EIJA 2XQNM 2DHIA 2NR2A 2EQXA 2WM9A 3ZYKA 1R4MI 1WH3A 1UJJA 2FDQA 1EF5A 5D94A 3NHEB 5JHAA 2FCNA 3E9OA 2UVMA 4WWPA 2FCMA 4LCDE 2P0HA 2VSNA 2LASA 2N1VA 2D3GA 4PS7A 4NJ7A 1UNRA 4HPLB 1IQUA 2HD5B 2ROZB 3D9KA 3FM8C 1X11A 2XEWA 2Y3AA 2YHEA 3I4RB 5LXIB 3V6EB 4EQFA 3CVUA 3IBEA 1KZGA 1K5GB 1IYGA 1I2HA 5D3VA 2NPTB 3RD2A 4ACLA 3ASGA 3FTYA 3FUDA 3R9AB 5C1ZA 2LUEA 4UWGA 2IZVB 1EDUA 4DXAB 2L2IA 1A17A 1Y8MA 3JSVA 1OY2A 2I6HA 1W3BA 3QC1A 1K5DB 2JVCA 4EEWA 2MBQA 4AXHA 3APCA 4E85A 4ZDVA 4HDQA 4ANUA 2R09A 3EC8A 3SO6A 3AS8A 2WMOA 3V5WA 4B95A 3N32A 2V0PA 4JKCA 4ZRKA 1XNFA 3N71A 3LPZA 1JPLA 3GYOA 3ZNID 3WAOA 4JPSA 2LVPA 4PQ0A 4EBAA 1DDMA 1B89A 2WVIA 1V88A 3AULA 2KTRB 4XI0A 2KGXB 2ZCBA 2N7DA 1SZ9A 4ACKA 4K7UA 3FUNA 4BX9A 2X6JA 4B94A 1WG7A 4GDLB 2PM6A 4JW1A 4WNDA 3VH4B 4K17A 3HHMA 1NI2A 3MHSD 1WXAA 1OGWA 3U66A 1MK9B 3ZHEB 4I6JA 1OWLA 4IWOA 3PT2B 1U27A 1V61A 1NTVA 2FBNA 1TBEA 4N3BA 2P8VA 1SZAA 2N4FA 1P6SA 2OVFA 4LUNU 1NTIA 4DI3A 3DVNU 3CHOA 2DLWA 5AYWD 3JQ0A 1WM3A 2V4LA 3BINA 3SV1A 4MK0A 3MTNB 3FTXA 5KHOA 1U4AA 3IV0A 4RG6A 3ESLA 1ISNA 2G45B 4KZ0A 3UIOB 4MY6A 1DIKA 2ILRA 1V86A 4PYZA 3FH8A 2HJ8A 2EJ8A 3UT7A 3KW5B 4BFRA 5M72A 2G3QB 4XC2A 4DX8A 1WAO1 4GDKA 1KBLA 5D27A 4BBKA 4U8HA 4L7TA 2KOXA 2RVBB 2LOXA 2GBRA 2DZJA 4A20A 4GA1A 4HOUA 2VSOE 3FEYA 4XKCA 3TO1A 4F7AA 1WGYA 4YL8A 4FLHA 4FJZA 3ZTCA 4ASWC 4UQZA 5ARFA 2KZTA 2LGXA 5C23A 2BCJA 2IYBA 1FHOA 1XX0A 4W9GA 3KZ1A 3R3MA 5IJMA 3F0WA 2WX1A 3DOWA 1P5TA 3K9PB 2IF4A 2FIDA 2FJLA 2K8HA 4AEZC 5A23A 3DBRI 2CHZA 2J7QB 3KRWA 2LSVA 3IVFA 3APDA 3OANA 3PEVB 2LAIA 3ZVRA 1DDVA 3SI5A 5DIFB 4GZ3A 1DVPA 3FWVA 1HX8A 4HOSA 1I35A 3CIKA 2BKRB 3LEWA 2I5CA 2ASQA 2KDEB 2D9XA 2HRJA 3U64A 2VGYA 4EECA 2Y7BA 1UELA 2D10A 3CVLA 1HFAA 1UW4B 1KI1B 3TBLD 3FEXA 1KM7A 2MBEA 1CMXB 2LXCA 2G4DB 3PV1A 3LKUA 1OMWA 1XD4A 3RRMB 3LXUX 3KYDD 1WI1A 1DNPA 3PDNA 4F7UP 4ZRJA 2UWJG 3PZDA 1E8WA 5C2YA 1NA3A 1P98A 2YQ8A 3VVWB 2Y4TA 1H2TC 1QQEA 1U5EA 5AENA 4GZ5A 4IRUA 4JVSA 4QFVA 4D10C 4WNGA 1FOEA 4IM0A 1XKEA 3AS5A 1WF9A 3ODWA 2ZCCA 2X18A 2KATA 1Z87A 2RG8A 4NACA 5JJTA 3H9DA 3NOBA 3DBHI 4EKUA 4JHKA 2FEZA 4IM3A 1EF1A 4G25A 3MKRA 3PSCA 2MHKA 5JHBA 3MPXA 4NSWA 3N7CA 3IHVA 4IULA 4GDKB 5FT9A 2KMCA 2I5FA 4AIFA 3UMVA 1V5TA 4XX5A 1EPUA 3O48A 5FWQA 4CDMA 3RCZA 2VRWB 4ILGB 4CDRA 2MW5A 3FU0A 2GOWA 2W9NA 5EKQD 1UGMA 3CVPA 3CHPA 2Y5BB 1I7AA 2LD9A 2YS1A 2NS5A 3FUIA 1XT9B 1ZC4B 5D3WA 4CT4A 1WFYA 3CMMB 2IU1A 2GJYA 1WJMA 3M62B 1WM2A 1HBKA 3I3NA 3PRPB 3A1QB 2KANA 4DHJD 4A3TA 1L2NA 4FC8A 4MEMA 1OWMA 3OJ3A 3GOEA 4GAAA 1V9JA 3UPVA 4O6FA 1U2BA 2PM7A 4TYZA 4W9LA 2QKMA 3M95A 5JJ7A 1R4NI 1EAZA 3G9WA 4B89A 1WMHB 4ANVA 4YNDA 2JZ3B 1KZ7A 1GJZA 1Q5WB 3S2AA 3SHQA 2YVCA 2HYZA 4WNFA 3Q3FA 3SNHA 2DHJA 2IOSA 3CQCB 2GCJA 1MQSA 4MGKE 3T9LA 3T5VA 4C9BB 4K2OA 2UY1B 2X0SA 2XGMA 3APFA 3G2SA 4PUCA 1EGXA 4I9CA 3TMPB 3MV3B 2WXFA 4N9F4 5J17A 2IBIB 2WXGA 5L95C 4EUTA 1ACAA 2VSXE 1H19A 3RJVA 3RO2A 1BTKA 1K8RB 4NPNA 1DYNA 3AU4A 4GGQA 2KX3A 3QNKA 2BF8B 2YF0A 5BV0A 4PH4B 5FQ8A 3KYCD 2KQ7A 3CVVA 2AWIA 4OVUA 3PRMB 1BAKA 3DXCA 2FCQA 3WXXA 5LOZA 2ZNVC 3ML8A 3RIBA 2WQ7A 1U5DA 3HW2B 2NVUI 3QHTA 3JVZX 4UWLA 4W9FA 4JZYA 2N9PC 4A1SA 4RM8A 3CSTA 3VDZA 1SQMA 2LAHA 1HB6A 5CHEE 3IFWB 3RULA 4GYYA 4FJYA 3G2UA 1FXTB 4IAPA 5FI0A 1RAXA 4G0NB 3CHQA 2R0DA 2K25A 4HPMB 2Q7FA 4ATGA 5LP0A 2Z0EB 3PRZA 1ZVRA 1WXSA 4L2LA 2CR5A 4BX8A 3OLMD 2O6VA 3VLEA 2DIWA 2WB2A 2UYZB 4IG7B 3FU6A 4IFSA 4A6FA 4EJNA 1Q67A 2I2OA 5J2RA 3LYAA 5DPSA 3BEEA 2UZRA 4CHKA 2WDTB 4OVVA 1YIWA 2K39A 2J0MA 1U5GA 2K6QA 4XWXA 1BWNA 3FP5A 2JUOA 2V3SA 4M8MA 1OQYA 4HVBA 3TCAA 4B6HA 2ZZPB 2WX0A 2KFKB 3PUKA 2DAFA 4G24A 1V5PA 2E2XA 4L1BA 1EVHA 1RLFA 4BSXA 3B7RL 3VTUA 3PS6A 1DBHA 4LEUA 3Q5MA 3QWMA 4DPRA 1YJ1A 4DHZE 3RKVA 1OEYA 2N0YA 4JK9A 2ZNVB 3ASFA 5G05C 1PY1A 3EFUA 3FP3A 1NZNA 1IRSA 5LCWC 4DLQA 3S7BA 5IAAC 1V80A 2L0TA 4KVMA 4C0EA 1X1FA 1HH8A 4C0AA 1ZW7A 3CVNA 3ENBA 1LM8B 5D6JB 4EMOA 2QKLA 2UZSA 1JWFA 4E3CA 3MJWA 1WGGA 3CXBB 4G26A 5FZSA 4CHJA 3ZYMA 3QOUA 4NQ0A 3H7SA 5GMVA 2WXOA 5C16A 3PHWB 1E8ZA 4TUUA 4LJPB 4HORA 3D9NA 5D0QD 2HM8A 2L6JA 2VRRB 2ZEQA 3QCAA 1Z3YA 1LW3A 2Z0QA 2VSZA 3A9KA 2DCPA 3SBSA 1H2UA 2MDXA 2G4SA 1WJ6A 2ZVNA 4U0UA 2L8JA 2DZIA 1GGOA 3CLJA 3SD5A 1PQSA 1IYFA 1WGHA 3WANA 2M8SA 4WNEA 4W9KA 2FIFA 1H8CA 3GZSA 3ZVVA 2JRIB 1UG3A 2WXHA 3BG0B 4HOQA 3A4SC 4WJOA 3CEQA 2FJ9A 4ILHA 1FCHA 3ZRHA 1P5QA 3HIZA 2IFSA 2NXPA 5DH9B 3D8FA 3FTSA 4KSKC 4N5CA 4APFA 5C5BA 1WJ4A 1GC7A 3ZRFA 3KY9A 2WXIA 4FBJB 3UQAA 4EBAG 4J8FA 3A8PA 3UF8A 2D9ZA 4HB2B 1TJFA 1ZC3B 3EPYA 2BWES 4AJYB 4KIKA 4F53A 5J3QA 3TW1A 4XIFA 3NZUA 3V6CB 3EDTB 5JH5C 2KDIA 3PP2A 4JL9A 4IW0A 2IO3B 2ADZA 4WWOA 2V1YA 3AXCA 1J0WA 2C5LC 3N3KB 2DKPA 3U8ZA 2FF4A 4I6PA 1H10A 2NBWB 2UWQA 3ONKA 4XKBA 2LVQA 5CCLA 4AP2A 3S7JA 1JUQA 2DTCA 3URZA 4GXBA 1AQCA 2CFZA 2QFCA 3CVYA 5DCNA 1WGRA 3FULA 4II3B 2P58C 3FTVA 2PQNA 3SHFA 1I42A 1W1HA 4GMVA 2YINA 2NBVB 3G2TA 1KLVA 2MRIA 2C0MA 2KCKA 1E5WA 2LNIA 4P7IA 1Z2MA 2CS4A 2XEVA 5KJKA 1WJNA 2VKIA 2DBAA 3LJ3A 4OYSA 4DDGD 4ZRIA 2CG3A 4ANXA 4H7XA 4W9JA 2COFA 4KDIC 5G05J 4HCNB 3EIQC 5BT1A 2L0IA 5C1DA 1QNFA 5LCWJ 5AZHA 2YRYA 3CVQA 2O2VB 2K2JA 2BYFA 3A9KB 2J09A 2X6FA 2FAZA 3PREA 4PS8A 1BTNA 5HQ8A 1XGWA 4HXDA 2DIKA 5AEKB 3D8EA 5J90A 1QZEA 3A8QA 2NBUA 4GPTB 2LGDA 3ZNZB 4PYUA 1W1GA 5KHQA 5CMWA 2FI7A 2CU1A 5DI9B 3IHYA 3CK7A 4WUYA 1C1YB 3OXFA 2KO3A 2D9WA 1UNPA 3DXEA 3DVGX 4ABNA 4MSMB 1QZ2A 1HU3A 3ECIA 2L0FA 3B7TA 1WZ3A 4TV3A 4BT9A 1N3HA 3L10B 4GSWA 3MZLB 3KVFB 5C5BB 2MX2A 3A9JA 3S7FA 4DHJB 4JEHA 2CRFA 3CV0A 2Q13A 5CTRC 3QBVB 4DX90 1V5OA 5ANRA 4K2PA 5LX8A 4LJOB 3H6NA 2JXXA 4PDXA 4K0RA 3D9LA 2AXUA 4Y6CA 2NZ8B 2QHOA 2IYDB 3ZYLA 3ULCA 3PNTB 4WAFA 4RG9A 5A6CA 2X6KA 1V2YA 2MP2A 5AJLA 1MK7B 4XI9A 4Z2MB 4JHJA 2Y8GA 1WGDA 2ELBA 4U63A 4JXTA 3UZTA 4KDLB 2X3MA 4HB0B 2GMIC 1FVHA 3CSFA 4V3IA 2GBKA 3QWVA 2BWFA 1ELKA 1KC7A 2KQSA 4B6WA 3ENEA 1S1QB 1XODA 4WJNA 4M8NA 2ZPYA 1OQNA 3QWPA 4CYEA 2VGXA 1U29A 4HDOA 1XD3B 2P0DA 2NMBA 2RUKB 2O6VD 3JSVB 3CKCA 4GOCA 3SF4A 5CMYA 1U3DA 3PVWA 3LY9A 5JZEB 1NA0A 3BJIA 1E8YA 5L83A 2RGNB 3L08A 1NTYA 3HYMB 4KBQA 2D9VA 5HE0A 1WIAA 3ZIMA 2OQBA 3M1IB 1Z5SB 4KVGB 3MEKA 5CLLB 2J08A 4Z2NA 3R7RA 5D0OD 5J18A 1RRBA 3KUZA 1KOTA 3N30A 5LFAA 2C7NB 1KJTA 1TGZB 2MOWA 3DQVA 3H7PA 4CGWA 5CHWA 3RK6A 1WY6A 5EFXA 4FULA 3FTZA 2ZU6B 2XQ0A 4HAVB 4IM2A 2JT4B 1BT0A 3TVVA 4BBNF 3TXMA 1NBFC 1J8CA 4I1AA 1TXDA 5ANLA 4W9HA 2BKFA 2KJRA 3SNXA 2KMAA 3QX1A 3BY4B 2KC7A 4A3PA 2KWVB 5DBKA 3RO3A 1EO6A 2CHXA 4CGVA 2C0LA 4KZCA 1VCBA 1DROA 1P1AA 1X5BA 1RFAA 2OVBA 3R7QA 3LY7A 4GA2A 2NCNA 2ZJDA 2KLCA 2KC2A 4ILJA 1ZU2A 3FU3A 3OJ4B 2R2OA 2EMSA 2K6DB 4LRZA 2KUPA 1E90A 3PNLB 2AWTA 1TJCA 3VUWA 4W9EA 4J0UA 4WAAA 2XCBA 2LULA 1TZ1A 2HTHA 3B08A 1IHGA 3ZDTA 4GIVA 4GMJA 2D07B 2VJ8A 1EUVB 4WVFB 5HE3A 5FI1A 1ST7A 3U7DA 4W9DA 4G2VA 3GYZA 4GYWA 1ZBPA 4GU2A 3ONSA 3G2VA 3TIXA 1Z6TA 3EHMA 3HK0A 5T3RA 3CGHA 2KZTB 3UQBA 3RRNB 1UH6A 4UWFA 3CR3A 2Z0DB 3IG3A 3PE3A 3HQCA 1Y6IA 2JY6A 3TAXA 1EF1C 2I9CA 2LG1A 5JHHA 4HXIA 4GU5A 3NF1A 2MQJA 4B9KA 2H7EA 4HATB 2DZKA 2R17C