4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/cell adhesion
molecule keywords Sorting nexin-17
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
5LOPB 4DWFA 3KYCD 1EF5A 2JXXA 2WX1A 4KHOA 1V6EA 4DXAB 3ODXA 3VOQA 2V76A 1W1HA 2KLCA 3JYUA 2W2XD 3PVUA 3PG7A 1J0GA 1J8CA 4HJKA 2ELBA 3ZNHB 2MRPA 2PZ1A 2OQBA 2KX3A 4CHJA 4BOZB 4G11A 4BKSA 3QQ8B 4EEWA 5CHWA 5EDSA 2NPTB 2BGFA 4EFOA 2FAZA 2KDBA 4NQKE 5J3QA 1XX0A 2QKMA 2LRWA 4WJNA 5CHVC 2COCA 2RNRB 4W9JA 3HIZA 4Y94A 2OTXA 3RT3B 1C1YB 1WX7A 2JY6A 2CHXA 1WE7A 2XK5A 1WFYA 3SU8X 1QZEA 4DHZB 2G4SA 3HM3A 2EJ8A 2NCNA 2MQJA 2M4NA 1L7YA 4I6NB 1V5UA 2DX1A 4WJQA 2J0JA 3ZVRA 4M8MA 2RUKB 3L17A 4MELA 3QHTA 3MJWA 2KQ7A 5L81A 1P98A 3UINB 1OTRB 1YQBA 2YSZA 3D8EA 2D07B 1Q67A 2LOXA 2J7QB 3KUZA 2M17A 1HE8A 3EFUA 3M63B 2KQSA 2GOWA 5HE1A 1K8RB 5J17A 5G55A 4LJPB 5E6OA 4K7SA 4JL9A 2D9VA 2KTRA 2YS5A 3AU4A 1FGZA 2ROZB 2R09A 1SIFA 2LUEA 3KUDB 4MM3A 3ZTCA 2XEWA 4ZRJA 5GMVA 2KC1A 4TYZA 4CYEA 2N9EB 1MIXA 1V61A 2Z0DB 4IAPA 1V89A 1OEYA 4A20A 3DBLI 4FJZA 2MLBA 4ANUA 2DENB 2N1WA 5DCNA 1GJZA 2Q13A 3TJPA 3VTWA 2DYQA 1BWNA 3A1QA 2L7RA 5LXIB 2CHZA 1U5GA 3ULCA 1FHWA 2X18A 4K1RB 2E2XA 2CRFA 2MA9B 1WI1A 5GOWB 3RYTA 4NSWA 3O96A 2DZJA 2JRHA 2MKRA 5JLJB 4EJNA 2JT4B 3ZNID 1UNPA 2Z59B 4DX8A 3DVNV 1MPHA 1YD8U 1KI1B 3M3JA 3B0AA 3SHQA 1PMSA 2UZRA 2KN5A 2XBBC 5KHQA 3QBVB 2G45B 1E8ZA 1E8WA 2REXA 3L13A 1FOEA 4IC7B 4NPNA 2DHIA 1YJ1A 4GMXB 4TKNA 5DHFB 3UZTA 2BKRB 1WGUA 4A6HA 3PV1A 2YS3A 3UQBA 2MBEA 5D2MB 3QAQA 3L0WB 4WWOA 4MY6A 4WJOA 2M1MA 4HDOA 1RLFA 2RR9A 2LGDA 2JVCA 3QJZA 5E6NA 1DDWA 2IY0B 5C1ZA 2YVCA 3MPXA 2K8BA 2VRRB 1M7EA 2IYDB 2LGXA 2UVMA 2RGNB 1UD7A 2NVUI 1OQYA 1XR0B 1WXSA 3CF6E 3S2AA 1PFJA 1WM3A 3VIAA 3VFKA 2HE7A 2KMCA 2EC1A 4X57B 3DVGX 2BYVE 2HD5B 1BTKA 4Z2NA 4IWQA 3RCZA 5D7GA 2K2JA 4A3OA 3M95A 3M1IB 3QA8A 3ML9A 5DIFB 1KM7A 4BFRA 3D32A 2KTFA 2LD9A 3A8PA 3ENEA 3DXDA 4YL8A 1RRBA 4HHVA 4EZKA 5C23A 1IPGA 4MDKE 1VCBA 1E7UA 2LVQA 3TW1A 4I6PA 3KVFB 1U5EA 3RZWC 5AZFA 2KNBA 1WXMA 3KY9A 1SGHA 3ONSA 4MJSB 4DBBA 5G2NA 2W2WA 5FI1A 4G0NB 5C79A 3DXEA 1ZC3B 3PP2A 3P7ZA 5C16A 2H7DA 2C9WB 1MG8A 3NSUA 2RPQA 2I1KA 2N1VA 3IHPC 3PVLA 2H7EA 2LYDA 5IA7A 1V88A 4M0WB 2MP2B 5AZHA 4IOYX 4GXBA 1Q1OA 2Z0OA 1V5PA 4NJ7A 1ZC4B 4MGYE 2P0HA 3ECIA 2LZ6A 4IW0A 2K25A 4GB9A 4I6LB 3UF8A 4XC2A 2AWTA 3GYPA 4IM2A 2MBQA 3VH4B 2KC2A 3BINA 3V61A 1U4AA 3CXBB 4GDKA 4KAXB 2BCJA 1WGGA 2UWQA 3LJUX 1M94A 4KSKC 4GPTB 4F7GA 5HKHA 4PNKA 3V62A 1BTNA 3ZVVA 4CHKA 1A5RA 1YX5B 5D94A 2D9WA 2KFKA 5LONB 2V4LA 2YS1A 3GZNI 3X0WA 2ADZA 2FCSA 4GMVA 3SNHA 3D8FA 1OMWA 3NS8A 2DZKA 2QHOA 4FULA 4W9GA 2FCQA 1TGZB 4MEMA 1KOTA 1WI0A 3MTNB 2CKHB 1XKEA 4ANVA 3W1SA 2YRYA 1JRUA 3WIMA 2JPHA 2FCMA 5CLLB 4AJYB 1LW3A 3DDCB 5JZEB 2DHZA 2DYMA 2IFSA 3UGBB 4W9IA 5JP4A 3RZFA 2GS0A 4HK2A 2LG1A 3OAWA 2DAJA 3KRWA 2YT1A 2UZSA 3VAWA 2D9YA 2KGXB 4YONA 2LVPA 1Z5SB 3APFA 3VTVA 2C7NB 1WJNA 2R2OA 2NPTA 2KDEB 1QC6A 2GBMA 5L95C 2EKEC 1P0RA 1FXTB 1SE9A 2RSGA 3ML4A 1LM8B 3A33B 3TFMA 4WJ7A 2MSED 2DKQA 2DZMA 2CAYA 2O6VB 4RMAA 4KDLB 1UBQA 3APDA 3DCGA 3A9KB 4K2PA 5HE0A 4HAUB 3KSYA 4GIVA 3PVWA 3OLMD 4PYZA 4WVFB 4HB2B 5BO4B 2L2IA 2L00B 2LGYA 2IO1B 2N7EA 1U5DA 2KMAA 2MBBB 2Y5BB 3L08A 2OJRA 4F1SA 4MGZE 5C6RA 2J0MA 3R7RA 3V6CB 2ZPNA 3ZNGC 3PHXB 2N7DA 4HB0B 3ZKJC 1PLSA 2VRWB 1ZSQA 2JWZA 1NI2A 3JW0X 4FA6A 4URKA 3U30A 2D4QA 4XWXA 4CHMA 3PTFC 2PE9A 2DX5B 2AL3A 1WJ6A 3HQCA 3QX1A 3SYXA 2C5LC 4OVVA 2G3QB 5LXHA 3ODOA 1ZVRA 5L83A 4HCPB 2YLMA 2CY5A 4WJPA 2ZPYA 3U8ZA 4IWOA 4RM9A 4A3PA 2KDIA 2LWPA 4BKGA 1TTNA 2K2UA 2WWZA 3O65B 2JZ3B 2D3GA 2GJYA 1C3TA 4AJWA 1YIWA 5FR6A 3K9OB 2NBVB 2FIDA 1WYWB 3P2BA 3V60A 4NY0A 3ZUNA 3DBRI 2D2QA 2IY1B 4JIOU 4BBKA 5J3YA 4KZ0A 3PZDA 1EGXA 4KV2A 3T8MA 1ISNA 2O6VD 5AEKB 4FHKA 1B55A 2MBOA 2WX0A 2RVBB 3PLUA 4FJVB 4D0NB 1I2HA 2KWCA 5DPTA 3JSVB 1Y19B 1ZW7A 1TZ1A 5D27A 1S1QB 1K5DB 4IWPA 2L3ZA 4AP4C 2KZRA 1WR1A 3Q3JA 1BT0A 4HPMB 2FNJB 3R3MA 2GBJA 2DFKA 3C0RB 1P3QU 1G6JA 1DROA 4AOFA 2IBIB 3HK0A 2IO3B 3AJ4A 3NOBA 1FHOA 2L8JA 2HTHB 2JUOA 5HE3A 3QC8B 4BBNF 3M62B 5CHFA 2M8SA 2ZCBA 4II2B 5CX3A 2KO3A 2K8HA 2ELAA 4MSMB 1NU2A 2AYOB 3SDLC 3AXCA 3H9DA 3UIPB 5DPWA 4ZRKA 1BAKA 1DDVA 2ROVA 3A8QA 3N32A 3FM8C 4PYUA 5DI9B 1AWEA 1GC6A 1F9JA 4NJ6A 4DBGA 2KJRA 4BKSD 3N7CA 4EMOA 5JHAA 4HLEA 5JHHA 2M0XA 2MWNB 2VSZA 4DDGD 1UELA 4HB3B 2KDFB 1ZKHA 3U7DA 2IYBA 1RRPB 1WZ3A 4NAWB 3VQIA 2L1CA 2BYFA 2KOXA 3Q3FA 2N9PC 2L76A 4TV3A 3KZ1A 3P6AA 2GBNA 1AQCA 1WM2A 1X1GA 3X23A 4W9CA 3WAMA 3PLVA 3CSTA 3MHSD 4ANXA 2GCLA 1EAZA 4L6EA 3PT2B 4HPLB 1NTVA 4MJSA 3WAPA 2I5CA 3V6EB 4E74A 2K6DB 1RFAA 3QWZB 3G9WA 1NBFC 4DX90 2JP2A 3F0WA 1XT9B 5J3TA 4G50A 1ZM0A 3PHWB 2LASA 2MP2A 5CLQB 3AU5A 4ICVA 3H7PB 4KHAA 2N0YA 3ZTDA 1QQGA 1P3RA 4KDIC 4KHBB 1P1AA 4IUMB 3VUWA 3GOEA 3TIXA 4IFSA 4OVUA 1E5WA 3H7SA 4ZRIA 5LLIA 2J0KA 3HW2B 1T0YA 3DVNU 1WJ4A 4LDTB 1LB1A 5JHBA 3QCAA 4K81A 2PPHA 4F7HA 4HVBA 3F5RA 1LQBA 1WZ0A 3HHMA 1GNUA 4GZUA 3VUYA 1U5FA 4P7IA 3V5WA 1MK9B 2JRIB 1EO6A 3VVWB 2MFQA 1ZGUB 4BVUC 4WWPA 1WGYA 2DLWA 3WALA 3VDZA 1J19A 2KKCA 4KIKB 4GOCA 4II3B 3WANA 1NTYA 3SUZA 3ZIMA 1FAOA 3SD5A 4W9HA 3KH0A 3WYFB 1UPQA 2V1YA 2M14A 3B1LX 3DVGY 4TQ1A 3ZO5B 4EZJA 3WA0A 1UZXB 1KLVA 2L0FA 1V86A 3KUCB 3EECA 1WIAA 5DH9B 1MKEA 1FGYA 2Z0EB 1S3SG 2DZIA 2UYZB 3EHVA 2XQNM 1IRSA 2NBUA 4KVGB 4HXDA 4HAVB 4GN1A 1WMHB 1U29A 1TQZA 2KFJA 2MW5A 3PRPB 2KANA 2DYBA 2IO0B 5DPRA 1WGRA 1TXDA 2COFA 4FN2A 3UIOB 2GBRA 2KCJA 1WJ1A 2O6VA 1MIZB 4FADA 3DBHI 1UEFA 3QIJA 3A9KA 3T9LA 2O2VB 4A6FB 1OEYJ 5KQ1A 4LDTD 2GCJA 4H8SA 1KZ7A 4NQLB 4TUUA 4DK5A 3AI5A 4HAXB 4B6HA 4W9FA 2LOZA 5E6PA 2A5UA 2K1FA 1V5MA 1WGHA 2DAFA 3KW5B 3PSCA 2W2XC 2B3AA 4CO7A 4MGIE 2ZEQA 1XODA 3KRXA 1V80A 2KD0A 4GDLB 3L54A 4WSFA 1W1DA 5C5BA 1K5GB 2MWSB 2L0TA 2DHJA 2ZNVC 1EUVB 2ZJDA 2DN6A 4HWIB 2D9ZA 4K2OA 3TCAA 2Y7BA 2MBHA 4MK0A 1R4NI 2NMBA 3PEGA 2DX5A 4KZCA 4EZLA 2MDXA 1WVHA 3A9JB 1Z2MA 1UGMA 1WJUA 4FBJB 3JVZX 1UNQA 1XQQA 5KHOA 4A6KA 1H10A 4MT7A 1P6SA 1MAIA 3QWMA 4PQ0A 2KX0A 2BYEA 5D3YA 5C5BB 3ZRCA 3OJ4B 2CU1A 1KJTA 1LFDA 5DHAB 4M8NA 3NHEB 3EC8A 2PE6B 4F7UP 4F8CB 1U27A 1XCGA 1XD4A 1GUAB 3KYDD 4GSWA 2ZVNA 1V9JA 2YT0A 4MH0E 2CODA 4DHZE 2CHWA 4HCNB 4K7UA 4XX5A 2IZVB 2C7HA 2LI5A 1UPRA 4NNJB 4W9LA 4E71A 1GG3A 4DHJB 2N9XA 3JSVA 2RD0A 3RD2A 3VTUA 1L2NA 1PQSA 3W1SC 3SO6A 3LJ3A 2XK5B 3K9PB 4AUQC 1WG7A 3ZDMC 2IO2B 1OQNA 4PS7A 1WH3A 4B95A 4IM0A 4HAZB 1D3ZA 5D3WA 2GBKA 2WDTB 4GU2A 2EMSA 1TBEA 1WE6A 1RAXA 3FEHA 3ZDTA 2HTHA 4K7WA 1H8CA 3I3TB 2D11A 1FB8A 3ZRFA 4EOYA 3CMMB 2AL6A 2Z0QA 4HDQA 2BPSA 1DYNA 2KUPA 2LVOA 3PSEB 2NZ8B 3AULA 3BY4B 2P0FA 2BWFA 2AEHA 5FI0A 1RJ2A 4KSLC 4BKTA 3A98B 4W9EA 1WY8A 1UNRA 4WAAA 5D3XA 4W9DA 3ZW3A 1X1MA 2KTRB 3A4SC 1VD2A 3PREA 1M7RA 1WX9A 3TL5A 2HJ8A 4NAWA 4AWJA 2I5FA 2C60A 3NZUA 4JQWC 5TR5A 1V5TA 2DHKA 3UQAA 1OY2A 4FHJA 5J18A 3HM6X 3VUXA 1J0WA 2DKPA 3R66C 1Y8RC 5AZGA 3H6NA 1WGDA 1E8XA 3FSSA 4JGHB 4EKUA 3IVFA 1E8YA 2D10A 3A1QB 2K39A 1WR6E 2R0DA 4F7ZA 4LJOB 1E90A 3RUIB 3ULBA 4ANWA 3R7QA 2K6QA 4DHJD 5D6JB 1IYFA 5J2RA 1WGQA 5KQ4A 3APCA 1W1GA 1Y5OA 3N30A 1R4MI 2CY4A 2BF8B 4K17A 2KWUB 1N3HA 1H4RA 2LULA 4Z2MB 3GYOA 3H7PA 3QK0A 1KZGA 1WF9A 1MK7B 3DXCA 1NDDA 1EVHA 4HATB 2C7MB 2RGFA 2KK8A 3VH3B 2WYQA 3OJ3A 2I1JA 1YX6B 3BJIA 1P5TA 1WXAA 2ZZPB 2K00A 4IM3A 3TMPB 2RSUA 4ICUA 4GGQA 3L16A 4C0AA 1UBIA 3PS6A 3PRMB 2DA0A 2PJHA 3VXWA 4MGKE 1V2YA 1V49A 2FIFA 2G4DB 2Z0PA 4ZDVA 2KWVB 1WRDB 3L10B 2LXCA 3ODWA 5JHGA 2N4FA 1TJ6A 5EFXA 5KCVA 4JLCA 2NR2A 2CS4A 1X1FA 4KIKA 1DBHA 2L05A 4ASWC 2MCNB 2EMTA 3DOWA 1CMXB 4WWNA 3MDBC 2KHWB 3ML8A 1WXVA 2QKLA 2LKOA 5IAAC 2R2QA 3H1UA 2V3SA 2RLOA 4BBNC 1Z87A 3DQVA 1I42A 2NS5A 3CIKA 2PEAA 2P0DA 2J59M 1EF1A 1X86A 2KVRA 3ZNZB 3SV1A 2KJHB 2BKFA 3DPDA 3TVVA 1OGWA 2D9XA 2FJLA 3ZLZA 3NY5A 3CSFA 1Q5WB 4IG7B 3ALBA 4N9F4 1FHXA 4RM8A 5DPSA 2JF5A 1WMHA 5JH5C 1V81A 3WAOA 4B9KA 1WJMA 3PGEA 2FCNA 3NZSA 2GMIC 1U2BA 3TBLD 4HB4B 1P9DU 2G35A 2ZNVB 3VHTC 1X11A 2MX2A 2DTCA 1WX8A 2O2VA 4A6FA 1AARA 3PPAA 4BOSC 1LXDA 1I7AA 2N23A 4WQOB 5D3VA 4ZYNA 2W9NA 5HE2A 4HAYB 2LJ5A 2CR5A 1UH6A 3IBEA 4DDID 4A5KA 3OANA 2ASQA 2ZVOA 1DDMA 4J6IA 2KXJA 2KJ6A 3RULA 2BWES 3D8DA 2LRUA 2DYNA 4G3XB 4GDLA 3LDZE 3DBSA 4XZ4A 1X05A 2VKIA 4GDKB 2A4ZA 2YF0A 2NBWB 4MSQB 2FUHB 3W1YA 3N3KB 1SHCA 3A4RA 3QARA 2Y8FA 2K8CA 3IG3A 4PS3A 2ZCCA 2COAA 2M38A 4LCDE 3RCPA 2P8VA 4TQ0A 4E3CA 4W9KA 2OOBB 1I35A 2DYOA 2LXAA 2Y8GA 4B6WA 2KFKB 1E7VA 4FLHA 1GC7A 3IFWB 3T06A 3A9JA 3TO1A 2JZZA 5CTRC 1XD3B 2KLGA 4HAWB 4PS8A 3B08A 3PRZA 1V5OA 1IP9A 1Q0WB 4EUTA 4FJYA
chains in the Genus database with same CATH superfamily
5LOPB 1I7HA 2ZKMX 3BK2A 4RF0A 1L6VA 4DWFA 3KYCD 2ACZB 1EF5A 3L4PA 2JXXA 3MC8A 1KH0A 2WX1A 2QC8A 4J3OD 4KHOA 1V6EA 1WSPA 4DXAB 3ODXA 3NVYA 3VOQA 2V76A 1W1HA 2KLCA 3JYUA 2W2XD 1WGKA 3PVUA 4XYCA 3PG7A 3SFEB 1J0GA 2WDVB 1J8CA 4HJKA 2ELBA 3ZNHB 1CZPA 2MRPA 1SSNA 2PZ1A 2MJEA 1FM0D 2OQBA 5HI1A 2KMMA 2KX3A 4CHJA 4BOZB 4G11A 3NWFA 2W3RA 4BKSA 1I4XA 1CJEA 3QQ8B 4EEWA 5CHWA 5EDSA 2LUMA 2NPTB 2BGFA 2PVOD 2KIGA 4EFOA 2FAZA 2KDBA 1VRAB 4NQKE 2BB6A 5J3QA 1XX0A 2QKMA 2LRWA 1IGDA 4WJNA 3HRDD 5CHVC 2COCA 3C19A 2RNRB 4W9JA 3HIZA 4Y94A 2OTXA 1AW7A 3RT3B 1C1YB 1WX7A 3AN1A 2JY6A 2CHXA 1WE7A 2XK5A 1WFYA 3SU8X 4L23A 1QZEA 4DHZB 1FNVA 2G4SA 3HM3A 4YTPB 2EJ8A 2NCNA 2MQJA 2M4NA 3P1MA 1L7YA 4I6NB 1V5UA 2DX1A 4WJQA 1T6BX 3DWGC 2J0JA 3ZVRA 3DWMA 3GB1A 4M8MA 4ZRPA 5C3JB 2RUKB 3L17A 4MELA 5AUKA 3N20C 3QHTA 3MJWA 4US8A 2EELA 2KQ7A 1T3QA 1JROA 5L81A 1NTIA 1XO3A 1I4HA 5BMIA 2SAKA 4BAXA 1F77A 1P98A 3UINB 3OWEB 1OTRB 4XDDA 2WXOA 1YQBA 2K22A 2JSVX 2YSZA 3D8EA 2WXGA 2D07B 1B9RA 3NVVA 1QOAA 1ZDXA 1Q67A 3B77A 2IPKD 2LOXA 2J7QB 2JYEA 3KUZA 2M17A 2VZKB 3AEEB 1HE8A 3EFUA 5E6JA 3M63B 2KQSA 1MI1A 2GOWA 1VBHA 5HE1A 4PT5A 3TEYA 2RDHA 2JX5A 1K8RB 1SXTA 3DHIC 1ZP0B 1GGOA 5FR3A 4YSXB 2IGGA 5J17A 5G55A 5BYQA 4WWMA 4LJPB 4QJ3B 5E6OA 4K7SA 4JL9A 2D9VA 1YJJA 5HHDG 2WXFA 2KTRA 2YS5A 3AU4A 1HZ6A 2RDBC 1FGZA 3ZXVA 1F2RC 2ROZB 2R09A 1SIFA 2LUEA 2AX5A 3KUDB 4MM3A 3BK1A 2XEWA 3ZTCA 4ZRJA 5GMVA 1NYRA 3MHZA 3ZQ4A 2KT7A 2KC1A 4CYEA 1JDEA 4TYZA 1ET9A 2N9EB 1MIXA 2CB8A 1V61A 2M56B 3E9SA 2Z0DB 2YT2A 4IAPA 1HTQA 1V89A 1OEYA 3BVGA 4A20A 3DBLI 4FJZA 1VBGA 2MLBA 2OJWA 2V3NA 4ANUA 2DENB 2N1WA 1MI0A 5DCNA 2Q13A 1FEHA 1HB8A 2H88B 3TJPA 1GJZA 3VTWA 2MJDA 2DYQA 1BWNA 2Z4DA 4YSYB 3A1QA 2L7RA 2WXLA 5LXIB 2CHZA 1ZPSA 2INPE 1U5GA 3ULCA 2N0SB 1FHWA 1AWDA 3ZJUA 2MEKA 2X18A 4K1RB 2E2XA 2CRFA 3LB8C 2MA9B 1WI1A 3N9YC 3NWDA 5GOWB 3AE6B 1RM6C 3RYTA 3KWVA 3VR8B 4NSWA 3O96A 2DZJA 2ONQA 3BIID 2JRHA 3TEWA 2MKRA 5JLJB 4EJNA 1FRRA 2JT4B 3ZNID 1UNPA 3H8HA 3U12A 2Z59B 3Q8BA 4DX8A 3DVNV 1MPHA 1YD8U 4PK1A 1KI1B 1BXTA 4JKCA 3M3JA 3B0AA 3N1ZC 5LG4B 2I2YA 1SEBD 5D3DA 1FNUA 3SHQA 1PMSA 2UZRA 2KN5A 2XBBC 4MACA 5KHQA 2E6XA 3QBVB 4LTUA 3E9OA 3SBTA 2QCZA 2G45B 1E8ZA 2COPA 1E8WA 2REXA 3L13A 1FOEA 4IC7B 4NPNA 5EE1A 4HPPA 1T0SC 2DHIA 1YJ1A 4GMXB 3AEBB 1TYGB 4TKNA 5DHFB 1CQVA 4HROA 2JWUA 3UZTA 2BKRB 1WGUA 4A6HA 2OHFA 4JK7A 3PV1A 4GNKB 2YS3A 3UQBA 1DOIA 2MBEA 4EE2A 2VZKD 5D2MB 3AE2B 3QAQA 3L0WB 3E66A 4WWOA 2BBCA 4MY6A 4WJOA 4RFBA 2M1MA 4HDOA 1RLFA 4MT5A 2RR9A 2YEPF 2LGDA 1FO4A 3KLSX 2QJLA 4A9AA 1BMLC 2JVCA 4AS1A 1KLUD 2N9KA 5EE9A 3QJZA 5E6NA 1DDWA 2IY0B 1C4AA 1WWTA 5C1ZA 2YVCA 3MPXA 2K8BA 2VRRB 1M7EA 2IYDB 2LGXA 1E7PB 2UVMA 3DBRB 2RGNB 1D5MC 1UD7A 3U2SC 2NVUI 1OQYA 3P63A 1V1PB 4OVZA 1XR0B 1WXSA 3CF6E 3UI3A 3C8YA 3S2AA 1PFJA 1WM3A 3VIAA 2Y5CA 3VFKA 2HE7A 2KMCA 2EC1A 1TY2A 3TEXA 4X57B 2LGIA 4JK8A 3W5VB 3DVGX 2BYVE 3O13A 2HD5B 3I57A 1BTKA 2RRFA 4Z2NA 3DBLB 4IWQA 5D7GA 2K2JA 3RCZA 4OZCA 4A3OA 2D3BA 3E9PA 3M95A 3M1IB 2OEDA 3QA8A 3ML9A 5DIFB 1KM7A 4BFRA 3D32A 1ZDVA 2KTFA 1RFKA 2LD9A 4C00A 3A8PA 4ILJA 3ENEA 2Q5WD 4DQOC 4YL8A 3DXDA 1RRBA 4ZYSA 3ZJTA 4HHVA 4EZKA 5C23A 1IPGA 4MDKE 1VCBA 1E7UA 2LVQA 3TW1A 4I6PA 3KVFB 2K49A 1U5EA 3RZWC 4TSSA 5AZFA 2KNBA 4N59A 2K9XA 1WXMA 4IOIE 3KY9A 1SGHA 5IJMA 3ONSA 1EU3A 4YT0B 4MJSB 4DBBA 5G2NA 5M4YB 3AE7B 2W2WA 5FI1A 4G0NB 5C79A 3DXEA 1ZC3B 3PP2A 3P7ZA 5C16A 1TY0A 2H7DA 1D4BA 3MC0B 2C9WB 1VLBA 2PIAA 1MG8A 1D6EC 2M19A 3NSUA 4HKQA 2RPQA 2I1KA 2N1VA 3IHPC 3PVLA 2H7EA 4K3BA 2LYDA 5IA7A 1V88A 1SJED 4M0WB 3URYA 2MP2B 5AZHA 4IOYX 4XGAB 4GXBA 4ACFA 1Q1OA 4A6QA 2Z0OA 1V5PA 4NZLB 4NJ7A 1ZC4B 4MGYE 2P0HA 2RMMA 3ECIA 2LZ6A 4IW0A 3RNCC 2XN9C 2K25A 4GB9A 4I6LB 4IDIA 1FMAD 3UF8A 2WH5A 4LNIA 4XC2A 4C7YA 2V0GA 2AWTA 3GYPA 4IM2A 1C79A 2LGSA 3FP5A 1Y56A 2MBQA 3VH4B 2KC2A 2BS2B 3BINA 1KC7A 1FCLA 4H2AA 3V61A 1U4AA 3CXBB 4GDKA 2KR0A 4KAXB 2BCJA 1WGGA 2UWQA 3LJUX 1NI3A 1M94A 4KSKC 4RGTA 1JQ4A 5C2TB 1N6ZA 4GPTB 1N61A 3EUB2 4F7GA 5HKHA 1D5ZC 3U4EG 4C4VB 4ITKA 4PNKA 1QOBA 3V62A 2QEJC 1BTNA 2WXNA 3ZVVA 2BW2A 3RN9C 4CHKA 1A5RA 1YX5B 5D94A 2D9WA 2KFKA 3AECB 1TT5B 5LONB 1P7FA 2V4LA 2YS1A 1QT9A 3GZNI 3P4SB 4YTMB 3X0WA 4RF1A 2ADZA 2FCSA 4GMVA 1XXGA 1RYJA 3SNHA 3D8FA 1OMWA 3NS8A 2DZKA 2QHOA 4FULA 2RDGA 1LGRA 4W9GA 2FCQA 5I4DA 2GLSA 1DYQA 1TGZB 4MEMA 1MG4A 1KOTA 1WI0A 3MTNB 2CKHB 1XKEA 1BUIC 4ANVA 2GB1A 3Q6BA 3W1SA 2YRYA 4WIPA 1JRUA 2HDEA 3WIMA 2JPHA 2FCMA 5CLLB 1ROEA 3Q69A 4AJYB 1LW3A 3IAS1 3DDCB 2MHJA 1F52A 5JZEB 2DHZA 4P1BC 2DYMA 3ZGZA 2GUMA 2IFSA 3Q14C 1NVID 1T77A 3UGBB 1NENB 4W9IA 5JP4A 3RZFA 2GS0A 4HK2A 4WQMA 2LG1A 3OAWA 3RNEC 2DAJA 3KRWA 2GI9A 2PVGC 2YT1A 2UZSA 3VAWA 2D9YA 2KGXB 1FIQA 4YONA 2LVPA 1Z5SB 3APFA 3VTVA 4JKAA 2C7NB 1WJNA 2R2OA 2NPTA 2KDEB 1QC6A 2GBMA 2JYTA 5L95C 2EKEC 3IAM1 1P0RA 3RNFC 4K3CA 1FXTB 5BMHA 1SE9A 1EWYC 2RSGA 2ABDA 1L0XB 4REZA 3AEFB 3ML4A 1LM8B 3A33B 3TFMA 4WJ7A 5HFYA 2E3TA 1ZXIA 4ZRQA 2MSED 2DKQA 2DZMA 2CAYA 1SF0A 2O6VB 2X38A 3PZ7A 4KDLB 4RMAA 1UBQA 3APDA 1HTOA 3DCGA 4QJ5B 3BYYB 3A9KB 4K2PA 3A58A 1IBXB 5HE0A 3Q8CA 4HAUB 3KSYA 4GIVA 3PVWA 3OLMD 4PYZA 1XLQA 4WVFB 3EGRA 4HB2B 4HRSA 2D3CA 5BO4B 5IKCM 2L2IA 4GOUA 3RPFC 2L00B 2LGYA 4JK9A 2IO1B 2N7EA 1U5DA 1FFVA 3NRZA 2KMAA 2MBBB 2Y5BB 4JKEA 3L08A 4JX1C 2NTSA 2Y5PA 1YMHE 1ACAA 3PO0A 4GLSC 4M02A 2OJRA 3V05A 3GZNB 4F1SA 1FXAA 2DNFA 4MGZE 3TUOA 4D2KA 3VRAB 5C6RA 1KBLA 1ZOYB 1KF6B 3FVCA 2J0MA 4CQNA 4S17A 4KKIA 4XWTA 3R7RA 3V6CB 2ZPNA 3ZNGC 3PHXB 2N7DA 4YXDB 4HB0B 3ZKJC 1PLSA 2VRWB 1ZSQA 2JWZA 1TS3A 1NI2A 1YN5A 2WLBA 5BYRA 3FKYA 3VR9B 3JW0X 4FA6A 4URKA 3U30A 2D4QA 3T3NA 4XWXA 4CHMA 3PTFC 2PE9A 5GXGB 2DX5B 2AL3A 1WJ6A 3HQCA 1AYFA 1HXYD 3QX1A 3SYXA 2C5LC 4OVVA 2G3QB 3P4QB 5LXHA 1PGBA 3ABVB 3ODOA 3Q3MC 1ZVRA 5L83A 2Y3AA 3I63C 4HCPB 2YLMA 2CY5A 3DBHB 4WJPA 4JKHA 2ZPYA 3U8ZA 3HVZA 4IWOA 3FILB 2WNMA 4RM9A 4A3PA 2KDIA 2LWPA 4BKGA 1TTNA 2K2UA 3Q8AA 3GE3C 2WWZA 4OW0A 3O65B 2JZ3B 1F0ZA 2D3GA 3SBGA 2GJYA 2KN4A 3IXSA 1C3TA 4L1BA 4O1NA 4AJWA 3RMKC 3RNGC 1YIWA 5FR6A 3K9OB 1I4RA 3BWUD 2NBVB 2FIDA 1WYWB 4QAYA 3P2BA 3V60A 4JKFA 4NY0A 3ZUNA 3AEDB 3DBRI 2D2QA 2IY1B 4JIOU 1QKZA 1EM7A 1HZ5A 4BBKA 5J3YA 4KZ0A 3PZDA 3R8BA 1EGXA 3HVDA 4KV2A 3T8MA 1ISNA 2O6VD 3CIRB 5AEKB 1JWMD 4FHKA 2WDQB 1B55A 3NVZA 1C78A 4YWGG 3LXFA 2MBOA 2WX0A 2RVBB 3PLUA 4FJVB 4JKGB 4D0NB 1I2HA 2KWCA 2WXQA 4HJGE 5DPTA 4P16A 3JSVB 2IGHA 2UU7A 1Y19B 2Z59A 1ACCA 3NZ3A 1ZW7A 3ENBA 1TZ1A 5D27A 4C80A 1S1QB 1K5DB 4IWPA 2L3ZA 5HG2A 4LNOA 4AP4C 2KZRA 1WR1A 3B9JA 4DXFA 3EA6A 1XF5L 2L1AA 3Q3JA 1BT0A 4D6WA 4HPMB 4LNKA 2FNJB 1LO5D 3R3MA 2GBJA 2INNE 2DFKA 3C0RB 4KGSA 1P3QU 1A70A 1G6JA 1JWBD 2FBWB 1DROA 4AOFA 2IBIB 3HK0A 2IO3B 3AJ4A 3NOBA 2LMCA 2J52A 3W5UB 1IUEA 4A90A 1FHOA 1TS5A 2BS4B 2L8JA 4XE0A 2HTHB 4OT1A 2JUOA 5HE3A 3QC8B 4BBNF 3M62B 5CHFA 2ICIA 2M8SA 4KGRA 2ZCBA 5IOIA 4II2B 5CX3A 2KO3A 1JWAD 2K8HA 2ELAA 4MSMB 1NU2A 1FFUA 2AYOB 3SDLC 3N1YC 5MPOA 3AXCA 1C4PA 3H9DA 3B2FA 3UIPB 4LNFA 5DPWA 3AE1B 4ZRKA 1BAKA 1DDVA 1K52A 4ARIA 2ROVA 3A8QA 3N32A 3FM8C 1QOGA 3B2GA 4PYUA 5DI9B 2PLPA 1V1PA 3U52E 2R2YA 1AWEA 1ZUD2 1GC6A 1F9JA 4JE3B 2FUG1 4NJ6A 4DBGA 2KJRA 1YQ3B 4BKSD 2WGSA 3N7CA 4WAFA 4EMOA 5JHAA 4OSNA 4HLEA 2XNAC 5JHHA 1VR9A 2MWNB 2M0XA 2VSZA 4DDGD 1UELA 2MH7A 4HB3B 2KDFB 1L4ZB 1ZKHA 3AE5B 3U7DA 2IYBA 1RRPB 1WZ3A 5EE0A 4NAWB 3VQIA 1MPEA 2L1CA 2BYFA 1UGJA 2KOXA 4ZHOA 2J53A 3Q3FA 2N9PC 4RGMA 1FPYA 2L76A 4TV3A 3KZ1A 3P6AA 1VJKA 2GBNA 1AQCA 1WM2A 1HEZE 2V9HA 1X1GA 3X23A 3J9CA 4W9CA 1MVKA 2CU3A 2W55A 3AE9B 3WAMA 2WDRB 3PLVA 3CSTA 3MHSD 4L2YA 1NEKB 1UUPA 2BB5A 4ANXA 2GCLA 1EAZA 1OQQA 4L6EA 3PT2B 3E9LA 4HPLB 1NTVA 4MJSA 4US9A 5I2SA 3WAPA 3GP7A 1SE4A 2K3UA 2I5CA 5I2MA 2YEPB 3V6EB 4E74A 1XLNA 2K6DB 3V3XA 1RFAA 3ZXRA 3QWZB 3G9WA 1NBFC 4DX90 3OHMB 1VZ6A 4RGOS 3MFGA 1JALA 2JP2A 3F0WA 1XT9B 5J3TA 3GS2A 4G50A 1ZM0A 4NAMA 3PHWB 4M0WA 2LASA 1TZOA 3AEGB 2MP2A 5CLQB 3AU5A 1VZ8A 4ICVA 3Q3NC 3H7PB 4KHAA 3BVZA 1XCTL 2N0YA 3ZTDA 1QQGA 1P3RA 4KDIC 4KHBB 1P1AA 1UF0A 1EWCA 4IUMB 3VUWA 3GOEA 3TIXA 4IFSA 4OVUA 1KFYB 1E5WA 3H7SA 1PFDA 4ZRIA 5LLIA 2J0KA 3HW2B 2K5PA 2WXHA 1ENFA 1T0YA 4MH8A 3DVNU 1D5XC 1L6UA 3MP9A 2Z14A 1WJ4A 3PZ8A 4LDTB 1LB1A 1FD6A 5JHBA 2DIKA 3QCAA 1I4PA 4K81A 2PPHA 4F7HA 2BYTA 4HVBA 3F5RA 1LQBA 4ILGB 5BYSA 1WZ0A 1FRDA 3HHMA 1GNUA 4GZUA 4RNAA 3VUYA 1U5FA 2V4IB 2SEBD 1DOXA 4P7IA 3V5WA 4C4VA 1MK9B 1HBKA 2PKOA 2JRIB 1XLPA 1EO6A 3VVWB 2MFQA 1ZGUB 5TSSA 4M00A 4BVUC 4L1RA 1N5XA 1JW9D 4WWPA 5D3IB 1Q10A 1WGYA 2EKIA 2DLWA 3WALA 2B76B 3VDZA 1J19A 2KKCA 5LNK1 4KIKB 1N63A 4GOCA 1C4CA 2BTEA 4II3B 3WANA 3VRBB 1NTYA 2JXTA 1R4MB 1E9MA 3SUZA 3ZIMA 1GOZA 1KLGD 2L32A 3P42A 1DGJA 3NUHB 2N7JA 1FAOA 3SD5A 4BZAA 1NYQA 4W9HA 3KH0A 4WH4A 3WYFB 1UPQA 2V1YA 2M14A 4LK0M 4S0RA 1F2RI 3B1LX 2TSSA 3DVGY 1B1ZA 4TQ1A 4RH6A 3ZO5B 1VZ7A 4EZJA 1N5WA 3WA0A 1UZXB 1KLVA 2L0FA 1V86A 3KUCB 2AQ2B 3EECA 1WIAA 5DH9B 2PTLA 1MKEA 1FGYA 3NW8A 2Z0EB 1HB6A 1N62A 2MJ3A 1JCKB 1M4VA 1S3SG 2DZIA 2UYZB 4TMAB 1XEEA 1JWUD 3EHVA 2XQNM 1J7AA 1IRSA 2H89B 2NBUA 4KVGB 2HTME 4HXDA 1L0VB 4HAVB 4GN1A 1YN3A 1WMHB 1YQ4B 4XDCA 1U29A 1TQZA 2DWQA 1TJEA 4RGNA 1GB4A 2KFJA 2MW5A 3PRPB 3NG0A 3RFZB 2KANA 2DYBA 2IO0B 2J4XA 3I5JC 4KX6B 5DPRA 1WGRA 1TXDA 2COFA 4FN2A 3UIOB 2GBRA 3EPYA 4JWSC 2K0PA 2KCJA 1WJ1A 1XLOA 2O6VA 1L5PA 1MIZB 4FADA 3RNBC 3DBHI 1UEFA 3QIJA 3A9KA 3T9LA 2O2VB 4A6FB 1IBXA 4B0MA 1OEYJ 5KQ1A 4OHJA 4LDTD 2GCJA 4H8SA 1KZ7A 4NQLB 4TUUA 3FLVA 2Z8LA 4DK5A 3AM9A 3AI5A 4HAXB 4B6HA 4JWUC 4W9FA 5IO9A 2LOZA 5E6PA 2A5UA 3FAHA 2K1FA 1V5MA 1WGHA 2DAFA 3KW5B 3PSCA 3AMZA 3HIEA 4YTNB 2W2XC 2B3AA 4N6EB 4CO7A 1C9FA 3TSSA 3IT4B 4MGIE 2ZEQA 1ZE3D 1XODA 1SB3C 4DIXA 3KRXA 1V80A 3BZDB 2KD0A 4GDLB 3L54A 4WSFA 1C77A 1T0QC 1W1DA 5C5BA 1K5GB 2MWSB 1ST7A 4YSZB 2L0TA 3U7ZA 2DHJA 2ZNVC 1EUVB 1K50A 2HJ1A 2ZJDA 2DN6A 1MHHE 4HWIB 2D9ZA 2QDFA 4K2OA 4KGTA 4R3DA 3TCAA 5JVLA 2Y7BA 1V97A 2MBHA 4MK0A 5AUIA 1J7BA 1QOFA 1R4NI 2NMBA 1GPXA 3PEGA 2DX5A 4KZCA 4EZLA 2MDXA 1WVHA 2IJ0A 5FK9C 3A9JB 1Z2MA 1UGMA 1WJUA 3NS1A 4FBJB 3JVZX 1UNQA 1XQQA 1K53A 5IRSA 5KHOA 4P1CC 4A6KA 1H10A 4MT7A 1P6SA 1MAIA 3QWMA 4PQ0A 2KX0A 3P4PB 1QF6A 3R2IA 3FILA 2BYEA 5D3YA 5IN7A 5C5BB 4LLGM 3ZRCA 3OJ4B 2CU1A 1JWSD 1KJTA 3AE4B 1LFDA 1MFWA 5DHAB 5T8IA 4M8NA 3NHEB 3EC8A 1C76A 2PE6B 4F7UP 1YNTE 3HSAA 4F8CB 1WXQA 1U27A 3E56A 4RCOA 1XCGA 1PDXA 3OG5A 2NBVA 1L4DB 1XD4A 1GUAB 3KYDD 1FNWA 4GSWA 2ZVNA 4CSQA 1V9JA 1I4QA 2YT0A 3SR6A 4MH0E 2KDMA 2WXIA 2CODA 1CK1A 3P4RB 4DHZE 2CHWA 1QQRA 4HCNB 1V8CA 4K7UA 4XX5A 2IZVB 4LNNA 5BMGA 2C7HA 2WXRA 3DCXA 4P6VF 1ESFA 2LI5A 1UPRA 2G9HD 2LFIA 5H8YE 4NNJB 3GE8C 4W9LA 4E71A 1JMLA 4JKGA 1HQRD 4B0EA 1GG3A 4DHJB 2N9XA 3JSVA 2BT6A 3FC4A 2RD0A 3RD2A 3Q8EA 3VTUA 1L2NA 3I9V1 1PQSA 2JZPA 3W1SC 3BVMA 3SO6A 3LJ3A 4USAA 2XK5B 3K9PB 4AUQC 1WG7A 3Q2AC 2WU5B 4HEA1 3ZDMC 1FXIA 2IO2B 3SEBA 4UDUC 1OQNA 4PS7A 1QILA 1WH3A 4B95A 4IM0A 1IGCA 2QSDA 4HAZB 1D3ZA 5D3WA 2GBKA 2WDTB 4GU2A 2RQ1A 2EMSA 1TBEA 1WE6A 1RAXA 3ETRA 1UWXA 2QIEB 2RPVA 2I38A 2WP9B 1RWSA 2BS3B 1SJHD 3FEHA 2PMVA 3ZDTA 1QLBB 2HTHA 4K7WA 1H8CA 3I3TB 2D11A 1FB8A 3Q8FA 3ZRFA 4EOYA 1ET6A 3CMMB 2AL6A 2Z0QA 3BYTB 4HDQA 1R4NB 3AH7A 2BPSA 2KUQA 1DYNA 2DBYA 2KUPA 2LVOA 4KKJA 3PSEB 1E10A 2NZ8B 2ZW0A 3AULA 3BY4B 4WURA 2P0FA 2KQ4X 2NTTA 1R7SA 2BWFA 1MJDA 2AEHA 2FJUB 5FI0A 1KRHA 3W9CB 1RJ2A 4KSLC 1UNSA 4BKTA 3A98B 4W9EA 1WY8A 1UNRA 4WAAA 1P7EA 2VH1A 3W2DA 5D3XA 1KTKA 4W9DA 3ZW3A 1MHXA 1X1MA 3AE8B 3WCQA 2KTRB 3A4SC 1VD2A 3PREA 4N58A 3Q3OC 1M7RA 4C56C 1WX9A 3TL5A 4MM3B 2HJ8A 4NAWA 1SE3A 4AWJA 2WXPA 1TS4A 2I5FA 2C60A 3NZUA 4JQWC 5TR5A 2BVCA 4AQ7A 1V5TA 1YOVB 1GB1A 3SFDB 2DHKA 3UQAA 2WXJA 1OY2A 4FHJA 5J18A 3HM6X 3VUXA 1J0WA 1SE2A 1T0RC 2DKPA 3R66C 1Y8RC 5AZGA 1VDVA 3H6NA 1WGDA 1E8XA 1SBBB 3FSSA 4JGHB 3ZJVA 4EKUA 4A8XC 3IVFA 1E8YA 2WQYB 2D10A 2KVZA 3A1QB 2K39A 1WR6E 2R0DA 4F7ZA 4LJOB 3ZYYX 2WXMA 1E90A 3RUIB 3ULBA 1YN4A 1N60A 4ANWA 3R7QA 2K6QA 4DHJD 4HKZE 2KACA 2W54A 5D6JB 1IYFA 5J2RA 2ON8A 1WGQA 5KQ4A 1ZXHA 1PGAA 2J42A 4OZBA 3APCA 1W1GA 5EE3A 3N1XC 1OQRA 1Y5OA 3N30A 1R4MI 2IDYA 2CY4A 2BF8B 4K17A 2KWUB 5IP4D 1N3HA 1H4RA 2LULA 4Z2MB 1NVLA 2CQUA 3GYOA 3H7PA 5G5GA 3QK0A 1KZGA 1PYWD 1EU4A 4KHBA 1WF9A 1MK7B 3DXCA 1NDDA 1EVHA 4HATB 2C7MB 2RGFA 1GAQB 2KK8A 3VH3B 2WYQA 3OJ3A 2I1JA 1YX6B 4FXCA 3BJIA 1P5TA 1WXAA 2ZZPB 2K00A 4IM3A 3TMPB 2WS3B 1WYGA 1TKGA 4NJCA 2RSUA 4HSIA 4ICUA 4GGQA 3L16A 1TS2A 4C0AA 1UBIA 3PS6A 2R61A 3PRMB 1PGXA 2DA0A 2X8XX 2PJHA 2V3PA 3VXWA 4MGKE 1YJIA 5G5HA 1SIJA 1V2YA 1V49A 2FIFA 2VH2A 2G4DB 2Z0PA 2IGDA 4ZDVA 2KWVB 1WRDB 3L10B 2GRIA 2LXCA 1TKYA 1E0ZA 4JKBA 4OZAA 2DLBA 3ODWA 1UWMA 5JHGA 2N4FA 1TJ6A 2FDQA 4C7ZA 2L83A 5EFXA 2LHEA 5KCVA 1TKEA 4JLCA 1V1OA 2NR2A 2WHIA 2CS4A 2INCC 1X1FA 4KIKA 1DBHA 1E6EB 2Z13A 2R82A 2L05A 1AN8A 4ASWC 2MCNB 1J7CA 2LJIA 2EMTA 2ZW1A 3DOWA 1CMXB 4JKDA 3MDBC 4WWNA 2KHWB 3ML8A 1WXVA 2QKLA 1K51A 2LKOA 2W3SA 5IAAC 1OFFA 3LYYA 3AB5A 2R2QA 3H1UA 2V3SA 2RLOA 2AQ1B 4BBNC 1F1HA 1Z87A 3DQVA 1XCQL 1I42A 2LEKA 1PUTA 2NS5A 3EFCA 3CIKA 2X0SA 4ZHPA 2JQRB 2PEAA 2P0DA 4Q2JA 2J59M 2WXKA 1EF1A 1X86A 1DOYA 2KVRA 3ZNZB 3SV1A 2KJHB 2BKFA 3DPDA 2FE8A 3TVVA 2BQQA 1HA5A 1OGWA 3TEZA 2D9XA 2FJLA 1JRPA 2INDC 2K8EA 3NY5A 3ZLZA 3CSFA 1Q5WB 4IG7B 5JXVA 3ALBA 4N9F4 1DIKA 2G1EA 1FHXA 1L0YB 4RM8A 5DPSA 2WU2B 2JF5A 4QJ4B 1WMHA 5JH5C 2D5GA 1V81A 3WAOA 2NMQA 4B9KA 1TIFA 1WJMA 4QXAB 2LHDA 2HRJA 1I4GA 3PGEA 2KAJA 4DXGA 2FCNA 4ILHA 3NZSA 2GMIC 1U2BA 4HB4B 3TBLD 3RI7C 1P9DU 2G35A 2ZNVB 2QMTA 3VHTC 1X11A 2MX2A 2DTCA 3CWIA 1WX8A 3MJ5A 3MC9A 2O2VA 4A6FA 1AARA 3PPAA 4BOSC 3IT6B 1LXDA 2QILA 1I7AA 2N23A 2PW9A 4WQOB 5D3VA 2LBBA 2L52A 4ZYNA 2W9NA 3DHGC 4ZOHC 3NWAA 5HE2A 4HAYB 3NVWA 3AE3B 1FCCC 2JU6X 5FKAC 3AEAB 2LJ5A 2CR5A 1UH6A 3IBEA 3R2TA 3AV8A 4DDID 2FJ9A 2KIEA 3RNAC 4A5KA 3OANA 2ASQA 2ZVOA 1DDMA 4XWWA 3KQ4A 4J6IA 2D3AA 2KXJA 4JPSA 2KJ6A 3RULA 2KYWA 2BWES 1STEA 3D8DA 2LRUA 2DYNA 4G3XB 2KWDA 4GDLA 1ZYIA 3LDZE 3DBSA 4IKGA 1X05A 4XZ4A 4A55A 2VKIA 4GDKB 2A4ZA 2YF0A 2M0AA 2NBWB 4MSQB 2FUHB 3W1YA 3N3KB 1SHCA 3A4RA 3QARA 2Y8FA 1WRIA 2K8CA 3IG3A 4M01A 4ARCA 4PS3A 2ZCCA 2COAA 3KWLA 2M38A 4LCDE 3RCPA 2P8VA 2CJOA 4TQ0A 4E3CA 4W9KA 2OOBB 3DHHC 3HUIA 1I35A 2DYOA 2LXAA 2Y8GA 4B6WA 2KFKB 1E7VA 4FLHA 1GC7A 3IFWB 3T06A 2W82A 3A9JA 3TO1A 2JZZA 3T3OA 5CTRC 1XD3B 1T5XD 4HAWB 2KLGA 4PS8A 2CJNA 2N9LA 3B08A 3PRZA 3NJTA 5H92C 1V5OA 1IP9A 2AQ3B 1Q0WB 4EUTA 4FJYA
chains in the Genus database with same CATH topology
5LOPB 4DWFA 3KYCD 1EF5A 2JXXA 2WX1A 4KHOA 1V6EA 4DXAB 3ODXA 3VOQA 2V76A 1W1HA 2KLCA 3JYUA 2W2XD 3PVUA 3PG7A 1J0GA 1J8CA 4HJKA 2ELBA 3ZNHB 2MRPA 2PZ1A 2OQBA 2KX3A 4CHJA 4BOZB 4G11A 4BKSA 3QQ8B 4EEWA 5CHWA 5EDSA 2NPTB 2BGFA 4EFOA 2FAZA 2KDBA 4NQKE 5J3QA 1XX0A 2QKMA 2LRWA 4WJNA 5CHVC 2COCA 2RNRB 4W9JA 3HIZA 4Y94A 2OTXA 3RT3B 1C1YB 1WX7A 2JY6A 2CHXA 1WE7A 2XK5A 1WFYA 3SU8X 1QZEA 4DHZB 2G4SA 3HM3A 2EJ8A 2NCNA 2MQJA 2M4NA 1L7YA 4I6NB 1V5UA 2DX1A 4WJQA 2J0JA 3ZVRA 4M8MA 2RUKB 3L17A 4MELA 3QHTA 3MJWA 2KQ7A 5L81A 1NTIA 1P98A 3UINB 1OTRB 1YQBA 2YSZA 3D8EA 2D07B 1Q67A 2LOXA 2J7QB 3KUZA 2M17A 1HE8A 3EFUA 3M63B 2KQSA 2GOWA 1VBHA 5HE1A 1K8RB 1GGOA 5J17A 5G55A 4LJPB 5E6OA 4K7SA 4JL9A 2D9VA 2KTRA 2YS5A 3AU4A 1FGZA 2ROZB 2R09A 1SIFA 2LUEA 3KUDB 4MM3A 3ZTCA 2XEWA 4ZRJA 5GMVA 2KC1A 4CYEA 1JDEA 4TYZA 2N9EB 1MIXA 2CB8A 1V61A 2Z0DB 4IAPA 1V89A 1OEYA 4A20A 3DBLI 4FJZA 1VBGA 2MLBA 4ANUA 2DENB 2N1WA 5DCNA 1GJZA 2Q13A 1HB8A 3TJPA 3VTWA 2DYQA 1BWNA 3A1QA 2L7RA 5LXIB 2CHZA 1U5GA 3ULCA 1FHWA 2X18A 4K1RB 2E2XA 2CRFA 2MA9B 1WI1A 5GOWB 3RYTA 4NSWA 3O96A 2DZJA 2JRHA 2MKRA 5JLJB 4EJNA 2JT4B 3ZNID 1UNPA 2Z59B 4DX8A 3DVNV 1MPHA 1YD8U 1KI1B 4JKCA 3M3JA 3B0AA 3SHQA 1PMSA 2UZRA 2KN5A 2XBBC 5KHQA 3QBVB 3E9OA 3SBTA 2G45B 1E8ZA 2COPA 1E8WA 2REXA 3L13A 1FOEA 4IC7B 4NPNA 2DHIA 1YJ1A 4GMXB 4TKNA 5DHFB 3UZTA 2BKRB 1WGUA 4A6HA 3PV1A 4JK7A 2YS3A 3UQBA 2MBEA 5D2MB 3QAQA 3L0WB 3E66A 4WWOA 4MY6A 4WJOA 2M1MA 4HDOA 1RLFA 2RR9A 2LGDA 2JVCA 3QJZA 5E6NA 1DDWA 2IY0B 5C1ZA 2YVCA 3MPXA 2K8BA 2VRRB 1M7EA 2IYDB 2LGXA 2UVMA 2RGNB 1UD7A 2NVUI 1OQYA 1XR0B 1WXSA 3CF6E 3S2AA 1PFJA 1WM3A 3VIAA 3VFKA 2HE7A 2KMCA 2EC1A 4X57B 4JK8A 3DVGX 2BYVE 2HD5B 1BTKA 4Z2NA 4IWQA 3RCZA 5D7GA 2K2JA 4A3OA 3E9PA 3M95A 3M1IB 3QA8A 3ML9A 5DIFB 1KM7A 4BFRA 3D32A 2KTFA 2LD9A 3A8PA 4ILJA 3ENEA 4YL8A 3DXDA 1RRBA 4HHVA 4EZKA 5C23A 1IPGA 4MDKE 1VCBA 1E7UA 2LVQA 3TW1A 4I6PA 3KVFB 1U5EA 3RZWC 5AZFA 2KNBA 1WXMA 3KY9A 1SGHA 5IJMA 3ONSA 4MJSB 4DBBA 5G2NA 2W2WA 5FI1A 4G0NB 5C79A 3DXEA 1ZC3B 3PP2A 3P7ZA 5C16A 2H7DA 2C9WB 1MG8A 3NSUA 2RPQA 2I1KA 2N1VA 3IHPC 3PVLA 2H7EA 2LYDA 5IA7A 1V88A 4M0WB 2MP2B 5AZHA 4IOYX 4GXBA 1Q1OA 2Z0OA 1V5PA 4NJ7A 1ZC4B 4MGYE 2P0HA 3ECIA 2LZ6A 4IW0A 2K25A 4GB9A 4I6LB 3UF8A 2WH5A 4XC2A 2AWTA 3GYPA 4IM2A 3FP5A 2MBQA 3VH4B 2KC2A 3BINA 1KC7A 3V61A 1U4AA 3CXBB 4GDKA 4KAXB 2BCJA 1WGGA 2UWQA 3LJUX 1M94A 4KSKC 4GPTB 4F7GA 5HKHA 4PNKA 3V62A 1BTNA 3ZVVA 4CHKA 1A5RA 1YX5B 5D94A 2D9WA 2KFKA 5LONB 2V4LA 2YS1A 3GZNI 3X0WA 2ADZA 2FCSA 4GMVA 3SNHA 3D8FA 1OMWA 3NS8A 2DZKA 2QHOA 4FULA 4W9GA 2FCQA 1TGZB 4MEMA 1KOTA 1WI0A 3MTNB 2CKHB 1XKEA 4ANVA 3W1SA 2YRYA 1JRUA 3WIMA 2JPHA 2FCMA 5CLLB 4AJYB 1LW3A 3DDCB 5JZEB 2DHZA 2DYMA 2IFSA 3UGBB 4W9IA 5JP4A 3RZFA 2GS0A 4HK2A 2LG1A 3OAWA 2DAJA 3KRWA 2YT1A 2UZSA 3VAWA 2D9YA 2KGXB 4YONA 2LVPA 1Z5SB 3APFA 3VTVA 4JKAA 2C7NB 1WJNA 2R2OA 2NPTA 2KDEB 1QC6A 2GBMA 5L95C 2EKEC 1P0RA 1FXTB 1SE9A 2RSGA 2ABDA 3ML4A 1LM8B 3A33B 3TFMA 4WJ7A 2MSED 2DKQA 2DZMA 2CAYA 2O6VB 4RMAA 4KDLB 1UBQA 3APDA 3DCGA 3A9KB 4K2PA 5HE0A 4HAUB 3KSYA 4GIVA 3PVWA 3OLMD 4PYZA 4WVFB 4HB2B 5BO4B 2L2IA 2L00B 2LGYA 4JK9A 2IO1B 2N7EA 1U5DA 2KMAA 2MBBB 2Y5BB 4JKEA 3L08A 1ACAA 2OJRA 4F1SA 4MGZE 5C6RA 1KBLA 2J0MA 3R7RA 3V6CB 2ZPNA 3ZNGC 3PHXB 2N7DA 4HB0B 3ZKJC 1PLSA 2VRWB 1ZSQA 2JWZA 1NI2A 3JW0X 4FA6A 4URKA 3U30A 2D4QA 4XWXA 4CHMA 3PTFC 2PE9A 2DX5B 2AL3A 1WJ6A 3HQCA 3QX1A 3SYXA 2C5LC 4OVVA 2G3QB 5LXHA 3ODOA 1ZVRA 5L83A 4HCPB 2YLMA 2CY5A 4WJPA 4JKHA 2ZPYA 3U8ZA 4IWOA 4RM9A 4A3PA 2KDIA 2LWPA 4BKGA 1TTNA 2K2UA 2WWZA 3O65B 2JZ3B 2D3GA 3SBGA 2GJYA 1C3TA 4AJWA 1YIWA 5FR6A 3K9OB 2NBVB 2FIDA 1WYWB 3P2BA 3V60A 4JKFA 4NY0A 3ZUNA 3DBRI 2D2QA 2IY1B 4JIOU 4BBKA 5J3YA 4KZ0A 3PZDA 1EGXA 4KV2A 3T8MA 1ISNA 2O6VD 5AEKB 4FHKA 1B55A 2MBOA 2WX0A 2RVBB 3PLUA 4FJVB 4JKGB 4D0NB 1I2HA 2KWCA 5DPTA 3JSVB 1Y19B 1ZW7A 3ENBA 1TZ1A 5D27A 1S1QB 1K5DB 4IWPA 2L3ZA 4AP4C 2KZRA 1WR1A 3Q3JA 1BT0A 4HPMB 2FNJB 3R3MA 2GBJA 2DFKA 3C0RB 1P3QU 1G6JA 1DROA 4AOFA 2IBIB 3HK0A 2IO3B 3AJ4A 3NOBA 1FHOA 2L8JA 2HTHB 2JUOA 5HE3A 3QC8B 4BBNF 3M62B 5CHFA 2M8SA 2ZCBA 4II2B 5CX3A 2KO3A 2K8HA 2ELAA 4MSMB 1NU2A 2AYOB 3SDLC 3AXCA 3H9DA 3UIPB 5DPWA 4ZRKA 1BAKA 1DDVA 2ROVA 3A8QA 3N32A 3FM8C 4PYUA 5DI9B 1AWEA 1GC6A 1F9JA 4NJ6A 4DBGA 2KJRA 4BKSD 3N7CA 4EMOA 5JHAA 4HLEA 5JHHA 2M0XA 2MWNB 2VSZA 4DDGD 1UELA 4HB3B 2KDFB 1ZKHA 3U7DA 2IYBA 1RRPB 1WZ3A 4NAWB 3VQIA 2L1CA 2BYFA 2KOXA 3Q3FA 2N9PC 2L76A 4TV3A 3KZ1A 3P6AA 2GBNA 1AQCA 1WM2A 1X1GA 3X23A 4W9CA 3WAMA 3PLVA 3CSTA 3MHSD 4ANXA 2GCLA 1EAZA 4L6EA 3PT2B 3E9LA 4HPLB 1NTVA 4MJSA 3WAPA 2I5CA 3V6EB 4E74A 2K6DB 1RFAA 3QWZB 3G9WA 1NBFC 4DX90 2JP2A 3F0WA 1XT9B 5J3TA 4G50A 1ZM0A 3PHWB 2LASA 2MP2A 5CLQB 3AU5A 4ICVA 3H7PB 4KHAA 2N0YA 3ZTDA 1QQGA 1P3RA 4KDIC 4KHBB 1P1AA 4IUMB 3VUWA 3GOEA 3TIXA 4IFSA 4OVUA 1E5WA 3H7SA 4ZRIA 5LLIA 2J0KA 3HW2B 1T0YA 3DVNU 1WJ4A 4LDTB 1LB1A 5JHBA 2DIKA 3QCAA 4K81A 2PPHA 4F7HA 4HVBA 3F5RA 1LQBA 4ILGB 1WZ0A 3HHMA 1GNUA 4GZUA 3VUYA 1U5FA 4P7IA 3V5WA 1MK9B 1HBKA 2JRIB 1EO6A 3VVWB 2MFQA 1ZGUB 4BVUC 4WWPA 1WGYA 2DLWA 3WALA 3VDZA 1J19A 2KKCA 4KIKB 4GOCA 4II3B 3WANA 1NTYA 3SUZA 3ZIMA 1FAOA 3SD5A 4W9HA 3KH0A 3WYFB 1UPQA 2V1YA 2M14A 3B1LX 3DVGY 4TQ1A 3ZO5B 4EZJA 3WA0A 1UZXB 1KLVA 2L0FA 1V86A 3KUCB 3EECA 1WIAA 5DH9B 1MKEA 1FGYA 2Z0EB 1HB6A 1S3SG 2DZIA 2UYZB 3EHVA 2XQNM 1IRSA 2NBUA 4KVGB 4HXDA 4HAVB 4GN1A 1WMHB 1U29A 1TQZA 2KFJA 2MW5A 3PRPB 2KANA 2DYBA 2IO0B 5DPRA 1WGRA 1TXDA 2COFA 4FN2A 3UIOB 2GBRA 3EPYA 2KCJA 1WJ1A 2O6VA 1MIZB 4FADA 3DBHI 1UEFA 3QIJA 3A9KA 3T9LA 2O2VB 4A6FB 1OEYJ 5KQ1A 4LDTD 2GCJA 4H8SA 1KZ7A 4NQLB 4TUUA 3FLVA 4DK5A 3AI5A 4HAXB 4B6HA 4W9FA 2LOZA 5E6PA 2A5UA 2K1FA 1V5MA 1WGHA 2DAFA 3KW5B 3PSCA 2W2XC 2B3AA 4CO7A 4MGIE 2ZEQA 1XODA 3KRXA 1V80A 2KD0A 4GDLB 3L54A 4WSFA 1W1DA 5C5BA 1K5GB 2MWSB 1ST7A 2L0TA 2DHJA 2ZNVC 1EUVB 2ZJDA 2DN6A 4HWIB 2D9ZA 4K2OA 3TCAA 5JVLA 2Y7BA 2MBHA 4MK0A 1R4NI 2NMBA 3PEGA 2DX5A 4KZCA 4EZLA 2MDXA 1WVHA 3A9JB 1Z2MA 1UGMA 1WJUA 4FBJB 3JVZX 1UNQA 1XQQA 5KHOA 4A6KA 1H10A 4MT7A 1P6SA 1MAIA 3QWMA 4PQ0A 2KX0A 2BYEA 5D3YA 5C5BB 3ZRCA 3OJ4B 2CU1A 1KJTA 1LFDA 5DHAB 4M8NA 3NHEB 3EC8A 2PE6B 4F7UP 4F8CB 1U27A 1XCGA 1XD4A 1GUAB 3KYDD 4GSWA 2ZVNA 1V9JA 2YT0A 4MH0E 2CODA 4DHZE 2CHWA 4HCNB 4K7UA 4XX5A 2IZVB 2C7HA 2LI5A 1UPRA 4NNJB 4W9LA 4E71A 4JKGA 1GG3A 4DHJB 2N9XA 3JSVA 2RD0A 3RD2A 3VTUA 1L2NA 1PQSA 3W1SC 3SO6A 3LJ3A 2XK5B 3K9PB 4AUQC 1WG7A 3ZDMC 2IO2B 1OQNA 4PS7A 1WH3A 4B95A 4IM0A 4HAZB 1D3ZA 5D3WA 2GBKA 2WDTB 4GU2A 2RQ1A 2EMSA 1TBEA 1WE6A 1RAXA 3FEHA 3ZDTA 2HTHA 4K7WA 1H8CA 3I3TB 2D11A 1FB8A 3ZRFA 4EOYA 3CMMB 2AL6A 2Z0QA 4HDQA 2BPSA 1DYNA 2KUPA 2LVOA 3PSEB 2NZ8B 3AULA 3BY4B 2P0FA 2BWFA 2AEHA 5FI0A 1RJ2A 4KSLC 4BKTA 3A98B 4W9EA 1WY8A 1UNRA 4WAAA 5D3XA 4W9DA 3ZW3A 1X1MA 2KTRB 3A4SC 1VD2A 3PREA 1M7RA 1WX9A 3TL5A 2HJ8A 4NAWA 4AWJA 2I5FA 2C60A 3NZUA 4JQWC 5TR5A 1V5TA 2DHKA 3UQAA 1OY2A 4FHJA 5J18A 3HM6X 3VUXA 1J0WA 2DKPA 3R66C 1Y8RC 5AZGA 3H6NA 1WGDA 1E8XA 3FSSA 4JGHB 4EKUA 3IVFA 1E8YA 2D10A 3A1QB 2K39A 1WR6E 2R0DA 4F7ZA 4LJOB 1E90A 3RUIB 3ULBA 4ANWA 3R7QA 2K6QA 4DHJD 5D6JB 1IYFA 5J2RA 1WGQA 5KQ4A 3APCA 1W1GA 1Y5OA 3N30A 1R4MI 2CY4A 2BF8B 4K17A 2KWUB 1N3HA 1H4RA 2LULA 4Z2MB 1NVLA 2CQUA 3GYOA 3H7PA 3QK0A 1KZGA 1WF9A 1MK7B 3DXCA 1NDDA 1EVHA 4HATB 2C7MB 2RGFA 2KK8A 3VH3B 2WYQA 3OJ3A 2I1JA 1YX6B 3BJIA 1P5TA 1WXAA 2ZZPB 2K00A 4IM3A 3TMPB 2RSUA 4ICUA 4GGQA 3L16A 4C0AA 1UBIA 3PS6A 3PRMB 2DA0A 2PJHA 3VXWA 4MGKE 1V2YA 1V49A 2FIFA 2G4DB 2Z0PA 4ZDVA 2KWVB 1WRDB 3L10B 2LXCA 4JKBA 3ODWA 5JHGA 2N4FA 1TJ6A 2FDQA 5EFXA 5KCVA 4JLCA 2NR2A 2CS4A 1X1FA 4KIKA 1DBHA 2R82A 2L05A 4ASWC 2MCNB 2EMTA 3DOWA 1CMXB 4JKDA 3MDBC 4WWNA 2KHWB 3ML8A 1WXVA 2QKLA 2LKOA 5IAAC 2R2QA 3H1UA 2V3SA 2RLOA 4BBNC 1Z87A 3DQVA 1I42A 2NS5A 3CIKA 2X0SA 2PEAA 2P0DA 2J59M 1EF1A 1X86A 2KVRA 3ZNZB 3SV1A 2KJHB 2BKFA 3DPDA 3TVVA 1OGWA 2D9XA 2FJLA 3ZLZA 3NY5A 3CSFA 1Q5WB 4IG7B 3ALBA 4N9F4 1DIKA 1FHXA 4RM8A 5DPSA 2JF5A 1WMHA 5JH5C 1V81A 3WAOA 4B9KA 1WJMA 2HRJA 3PGEA 2FCNA 4ILHA 3NZSA 2GMIC 1U2BA 3TBLD 4HB4B 1P9DU 2G35A 2ZNVB 3VHTC 1X11A 2MX2A 2DTCA 1WX8A 2O2VA 4A6FA 1AARA 3PPAA 4BOSC 1LXDA 1I7AA 2N23A 4WQOB 5D3VA 2LBBA 4ZYNA 2W9NA 5HE2A 4HAYB 2LJ5A 2CR5A 1UH6A 3IBEA 4DDID 2FJ9A 4A5KA 3OANA 2ASQA 2ZVOA 1DDMA 4J6IA 2KXJA 2KJ6A 3RULA 2BWES 3D8DA 2LRUA 2DYNA 4G3XB 4GDLA 3LDZE 3DBSA 4XZ4A 1X05A 2VKIA 4GDKB 2A4ZA 2YF0A 2NBWB 4MSQB 2FUHB 3W1YA 3N3KB 1SHCA 3A4RA 3QARA 2Y8FA 2K8CA 3IG3A 4PS3A 2ZCCA 2COAA 2M38A 4LCDE 3RCPA 2P8VA 4TQ0A 4E3CA 4W9KA 2OOBB 1I35A 2DYOA 2LXAA 2Y8GA 4B6WA 2KFKB 1E7VA 4FLHA 1GC7A 3IFWB 3T06A 3A9JA 3TO1A 2JZZA 5CTRC 1XD3B 2KLGA 4HAWB 4PS8A 3B08A 3PRZA 1V5OA 1IP9A 1Q0WB 4EUTA 4FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LOP B;  4DWF A;  3KYC D;  1EF5 A;  2JXX A;  2WX1 A;  4KHO A;  1V6E A;  4DXA B;  3ODX A;  3VOQ A;  2V76 A;  1W1H A;  2KLC A;  3JYU A;  2W2X D;  3PVU A;  3PG7 A;  1J0G A;  1J8C A;  4HJK A;  2ELB A;  3ZNH B;  2MRP A;  2PZ1 A;  2OQB A;  2KX3 A;  4CHJ A;  4BOZ B;  4G11 A;  4BKS A;  3QQ8 B;  4EEW A;  5CHW A;  5EDS A;  2NPT B;  2BGF A;  4EFO A;  2FAZ A;  2KDB A;  4NQK E;  5J3Q A;  1XX0 A;  2QKM A;  2LRW A;  4WJN A;  5CHV C;  2COC A;  2RNR B;  4W9J A;  3HIZ A;  4Y94 A;  2OTX A;  3RT3 B;  1C1Y B;  1WX7 A;  2JY6 A;  2CHX A;  1WE7 A;  2XK5 A;  1WFY A;  3SU8 X;  1QZE A;  4DHZ B;  2G4S A;  3HM3 A;  2EJ8 A;  2NCN A;  2MQJ A;  2M4N A;  1L7Y A;  4I6N B;  1V5U A;  2DX1 A;  4WJQ A;  2J0J A;  3ZVR A;  4M8M A;  2RUK B;  3L17 A;  4MEL A;  3QHT A;  3MJW A;  2KQ7 A;  5L81 A;  1P98 A;  3UIN B;  1OTR B;  1YQB A;  2YSZ A;  3D8E A;  2D07 B;  1Q67 A;  2LOX A;  2J7Q B;  3KUZ A;  2M17 A;  1HE8 A;  3EFU A;  3M63 B;  2KQS A;  2GOW A;  5HE1 A;  1K8R B;  5J17 A;  5G55 A;  4LJP B;  5E6O A;  4K7S A;  4JL9 A;  2D9V A;  2KTR A;  2YS5 A;  3AU4 A;  1FGZ A;  2ROZ B;  2R09 A;  1SIF A;  2LUE A;  3KUD B;  4MM3 A;  3ZTC A;  2XEW A;  4ZRJ A;  5GMV A;  2KC1 A;  4TYZ A;  4CYE A;  2N9E B;  1MIX A;  1V61 A;  2Z0D B;  4IAP A;  1V89 A;  1OEY A;  4A20 A;  3DBL I;  4FJZ A;  2MLB A;  4ANU A;  2DEN B;  2N1W A;  5DCN A;  1GJZ A;  2Q13 A;  3TJP A;  3VTW A;  2DYQ A;  1BWN A;  3A1Q A;  2L7R A;  5LXI B;  2CHZ A;  1U5G A;  3ULC A;  1FHW A;  2X18 A;  4K1R B;  2E2X A;  2CRF A;  2MA9 B;  1WI1 A;  5GOW B;  3RYT A;  4NSW A;  3O96 A;  2DZJ A;  2JRH A;  2MKR A;  5JLJ B;  4EJN A;  2JT4 B;  3ZNI D;  1UNP A;  2Z59 B;  4DX8 A;  3DVN V;  1MPH A;  1YD8 U;  1KI1 B;  3M3J A;  3B0A A;  3SHQ A;  1PMS A;  2UZR A;  2KN5 A;  2XBB C;  5KHQ A;  3QBV B;  2G45 B;  1E8Z A;  1E8W A;  2REX A;  3L13 A;  1FOE A;  4IC7 B;  4NPN A;  2DHI A;  1YJ1 A;  4GMX B;  4TKN A;  5DHF B;  3UZT A;  2BKR B;  1WGU A;  4A6H A;  3PV1 A;  2YS3 A;  3UQB A;  2MBE A;  5D2M B;  3QAQ A;  3L0W B;  4WWO A;  4MY6 A;  4WJO A;  2M1M A;  4HDO A;  1RLF A;  2RR9 A;  2LGD A;  2JVC A;  3QJZ A;  5E6N A;  1DDW A;  2IY0 B;  5C1Z A;  2YVC A;  3MPX A;  2K8B A;  2VRR B;  1M7E A;  2IYD B;  2LGX A;  2UVM A;  2RGN B;  1UD7 A;  2NVU I;  1OQY A;  1XR0 B;  1WXS A;  3CF6 E;  3S2A A;  1PFJ A;  1WM3 A;  3VIA A;  3VFK A;  2HE7 A;  2KMC A;  2EC1 A;  4X57 B;  3DVG X;  2BYV E;  2HD5 B;  1BTK A;  4Z2N A;  4IWQ A;  3RCZ A;  5D7G A;  2K2J A;  4A3O A;  3M95 A;  3M1I B;  3QA8 A;  3ML9 A;  5DIF B;  1KM7 A;  4BFR A;  3D32 A;  2KTF A;  2LD9 A;  3A8P A;  3ENE A;  3DXD A;  4YL8 A;  1RRB A;  4HHV A;  4EZK A;  5C23 A;  1IPG A;  4MDK E;  1VCB A;  1E7U A;  2LVQ A;  3TW1 A;  4I6P A;  3KVF B;  1U5E A;  3RZW C;  5AZF A;  2KNB A;  1WXM A;  3KY9 A;  1SGH A;  3ONS A;  4MJS B;  4DBB A;  5G2N A;  2W2W A;  5FI1 A;  4G0N B;  5C79 A;  3DXE A;  1ZC3 B;  3PP2 A;  3P7Z A;  5C16 A;  2H7D A;  2C9W B;  1MG8 A;  3NSU A;  2RPQ A;  2I1K A;  2N1V A;  3IHP C;  3PVL A;  2H7E A;  2LYD A;  5IA7 A;  1V88 A;  4M0W B;  2MP2 B;  5AZH A;  4IOY X;  4GXB A;  1Q1O A;  2Z0O A;  1V5P A;  4NJ7 A;  1ZC4 B;  4MGY E;  2P0H A;  3ECI A;  2LZ6 A;  4IW0 A;  2K25 A;  4GB9 A;  4I6L B;  3UF8 A;  4XC2 A;  2AWT A;  3GYP A;  4IM2 A;  2MBQ A;  3VH4 B;  2KC2 A;  3BIN A;  3V61 A;  1U4A A;  3CXB B;  4GDK A;  4KAX B;  2BCJ A;  1WGG A;  2UWQ A;  3LJU X;  1M94 A;  4KSK C;  4GPT B;  4F7G A;  5HKH A;  4PNK A;  3V62 A;  1BTN A;  3ZVV A;  4CHK A;  1A5R A;  1YX5 B;  5D94 A;  2D9W A;  2KFK A;  5LON B;  2V4L A;  2YS1 A;  3GZN I;  3X0W A;  2ADZ A;  2FCS A;  4GMV A;  3SNH A;  3D8F A;  1OMW A;  3NS8 A;  2DZK A;  2QHO A;  4FUL A;  4W9G A;  2FCQ A;  1TGZ B;  4MEM A;  1KOT A;  1WI0 A;  3MTN B;  2CKH B;  1XKE A;  4ANV A;  3W1S A;  2YRY A;  1JRU A;  3WIM A;  2JPH A;  2FCM A;  5CLL B;  4AJY B;  1LW3 A;  3DDC B;  5JZE B;  2DHZ A;  2DYM A;  2IFS A;  3UGB B;  4W9I A;  5JP4 A;  3RZF A;  2GS0 A;  4HK2 A;  2LG1 A;  3OAW A;  2DAJ A;  3KRW A;  2YT1 A;  2UZS A;  3VAW A;  2D9Y A;  2KGX B;  4YON A;  2LVP A;  1Z5S B;  3APF A;  3VTV A;  2C7N B;  1WJN A;  2R2O A;  2NPT A;  2KDE B;  1QC6 A;  2GBM A;  5L95 C;  2EKE C;  1P0R A;  1FXT B;  1SE9 A;  2RSG A;  3ML4 A;  1LM8 B;  3A33 B;  3TFM A;  4WJ7 A;  2MSE D;  2DKQ A;  2DZM A;  2CAY A;  2O6V B;  4RMA A;  4KDL B;  1UBQ A;  3APD A;  3DCG A;  3A9K B;  4K2P A;  5HE0 A;  4HAU B;  3KSY A;  4GIV A;  3PVW A;  3OLM D;  4PYZ A;  4WVF B;  4HB2 B;  5BO4 B;  2L2I A;  2L00 B;  2LGY A;  2IO1 B;  2N7E A;  1U5D A;  2KMA A;  2MBB B;  2Y5B B;  3L08 A;  2OJR A;  4F1S A;  4MGZ E;  5C6R A;  2J0M A;  3R7R A;  3V6C B;  2ZPN A;  3ZNG C;  3PHX B;  2N7D A;  4HB0 B;  3ZKJ C;  1PLS A;  2VRW B;  1ZSQ A;  2JWZ A;  1NI2 A;  3JW0 X;  4FA6 A;  4URK A;  3U30 A;  2D4Q A;  4XWX A;  4CHM A;  3PTF C;  2PE9 A;  2DX5 B;  2AL3 A;  1WJ6 A;  3HQC A;  3QX1 A;  3SYX A;  2C5L C;  4OVV A;  2G3Q B;  5LXH A;  3ODO A;  1ZVR A;  5L83 A;  4HCP B;  2YLM A;  2CY5 A;  4WJP A;  2ZPY A;  3U8Z A;  4IWO A;  4RM9 A;  4A3P A;  2KDI A;  2LWP A;  4BKG A;  1TTN A;  2K2U A;  2WWZ A;  3O65 B;  2JZ3 B;  2D3G A;  2GJY A;  1C3T A;  4AJW A;  1YIW A;  5FR6 A;  3K9O B;  2NBV B;  2FID A;  1WYW B;  3P2B A;  3V60 A;  4NY0 A;  3ZUN A;  3DBR I;  2D2Q A;  2IY1 B;  4JIO U;  4BBK A;  5J3Y A;  4KZ0 A;  3PZD A;  1EGX A;  4KV2 A;  3T8M A;  1ISN A;  2O6V D;  5AEK B;  4FHK A;  1B55 A;  2MBO A;  2WX0 A;  2RVB B;  3PLU A;  4FJV B;  4D0N B;  1I2H A;  2KWC A;  5DPT A;  3JSV B;  1Y19 B;  1ZW7 A;  1TZ1 A;  5D27 A;  1S1Q B;  1K5D B;  4IWP A;  2L3Z A;  4AP4 C;  2KZR A;  1WR1 A;  3Q3J A;  1BT0 A;  4HPM B;  2FNJ B;  3R3M A;  2GBJ A;  2DFK A;  3C0R B;  1P3Q U;  1G6J A;  1DRO A;  4AOF A;  2IBI B;  3HK0 A;  2IO3 B;  3AJ4 A;  3NOB A;  1FHO A;  2L8J A;  2HTH B;  2JUO A;  5HE3 A;  3QC8 B;  4BBN F;  3M62 B;  5CHF A;  2M8S A;  2ZCB A;  4II2 B;  5CX3 A;  2KO3 A;  2K8H A;  2ELA A;  4MSM B;  1NU2 A;  2AYO B;  3SDL C;  3AXC A;  3H9D A;  3UIP B;  5DPW A;  4ZRK A;  1BAK A;  1DDV A;  2ROV A;  3A8Q A;  3N32 A;  3FM8 C;  4PYU A;  5DI9 B;  1AWE A;  1GC6 A;  1F9J A;  4NJ6 A;  4DBG A;  2KJR A;  4BKS D;  3N7C A;  4EMO A;  5JHA A;  4HLE A;  5JHH A;  2M0X A;  2MWN B;  2VSZ A;  4DDG D;  1UEL A;  4HB3 B;  2KDF B;  1ZKH A;  3U7D A;  2IYB A;  1RRP B;  1WZ3 A;  4NAW B;  3VQI A;  2L1C A;  2BYF A;  2KOX A;  3Q3F A;  2N9P C;  2L76 A;  4TV3 A;  3KZ1 A;  3P6A A;  2GBN A;  1AQC A;  1WM2 A;  1X1G A;  3X23 A;  4W9C A;  3WAM A;  3PLV A;  3CST A;  3MHS D;  4ANX A;  2GCL A;  1EAZ A;  4L6E A;  3PT2 B;  4HPL B;  1NTV A;  4MJS A;  3WAP A;  2I5C A;  3V6E B;  4E74 A;  2K6D B;  1RFA A;  3QWZ B;  3G9W A;  1NBF C;  4DX9 0;  2JP2 A;  3F0W A;  1XT9 B;  5J3T A;  4G50 A;  1ZM0 A;  3PHW B;  2LAS A;  2MP2 A;  5CLQ B;  3AU5 A;  4ICV A;  3H7P B;  4KHA A;  2N0Y A;  3ZTD A;  1QQG A;  1P3R A;  4KDI C;  4KHB B;  1P1A A;  4IUM B;  3VUW A;  3GOE A;  3TIX A;  4IFS A;  4OVU A;  1E5W A;  3H7S A;  4ZRI A;  5LLI A;  2J0K A;  3HW2 B;  1T0Y A;  3DVN U;  1WJ4 A;  4LDT B;  1LB1 A;  5JHB A;  3QCA A;  4K81 A;  2PPH A;  4F7H A;  4HVB A;  3F5R A;  1LQB A;  1WZ0 A;  3HHM A;  1GNU A;  4GZU A;  3VUY A;  1U5F A;  4P7I A;  3V5W A;  1MK9 B;  2JRI B;  1EO6 A;  3VVW B;  2MFQ A;  1ZGU B;  4BVU C;  4WWP A;  1WGY A;  2DLW A;  3WAL A;  3VDZ A;  1J19 A;  2KKC A;  4KIK B;  4GOC A;  4II3 B;  3WAN A;  1NTY A;  3SUZ A;  3ZIM A;  1FAO A;  3SD5 A;  4W9H A;  3KH0 A;  3WYF B;  1UPQ A;  2V1Y A;  2M14 A;  3B1L X;  3DVG Y;  4TQ1 A;  3ZO5 B;  4EZJ A;  3WA0 A;  1UZX B;  1KLV A;  2L0F A;  1V86 A;  3KUC B;  3EEC A;  1WIA A;  5DH9 B;  1MKE A;  1FGY A;  2Z0E B;  1S3S G;  2DZI A;  2UYZ B;  3EHV A;  2XQN M;  1IRS A;  2NBU A;  4KVG B;  4HXD A;  4HAV B;  4GN1 A;  1WMH B;  1U29 A;  1TQZ A;  2KFJ A;  2MW5 A;  3PRP B;  2KAN A;  2DYB A;  2IO0 B;  5DPR A;  1WGR A;  1TXD A;  2COF A;  4FN2 A;  3UIO B;  2GBR A;  2KCJ A;  1WJ1 A;  2O6V A;  1MIZ B;  4FAD A;  3DBH I;  1UEF A;  3QIJ A;  3A9K A;  3T9L A;  2O2V B;  4A6F B;  1OEY J;  5KQ1 A;  4LDT D;  2GCJ A;  4H8S A;  1KZ7 A;  4NQL B;  4TUU A;  4DK5 A;  3AI5 A;  4HAX B;  4B6H A;  4W9F A;  2LOZ A;  5E6P A;  2A5U A;  2K1F A;  1V5M A;  1WGH A;  2DAF A;  3KW5 B;  3PSC A;  2W2X C;  2B3A A;  4CO7 A;  4MGI E;  2ZEQ A;  1XOD A;  3KRX A;  1V80 A;  2KD0 A;  4GDL B;  3L54 A;  4WSF A;  1W1D A;  5C5B A;  1K5G B;  2MWS B;  2L0T A;  2DHJ A;  2ZNV C;  1EUV B;  2ZJD A;  2DN6 A;  4HWI B;  2D9Z A;  4K2O A;  3TCA A;  2Y7B A;  2MBH A;  4MK0 A;  1R4N I;  2NMB A;  3PEG A;  2DX5 A;  4KZC A;  4EZL A;  2MDX A;  1WVH A;  3A9J B;  1Z2M A;  1UGM A;  1WJU A;  4FBJ B;  3JVZ X;  1UNQ A;  1XQQ A;  5KHO A;  4A6K A;  1H10 A;  4MT7 A;  1P6S A;  1MAI A;  3QWM A;  4PQ0 A;  2KX0 A;  2BYE A;  5D3Y A;  5C5B B;  3ZRC A;  3OJ4 B;  2CU1 A;  1KJT A;  1LFD A;  5DHA B;  4M8N A;  3NHE B;  3EC8 A;  2PE6 B;  4F7U P;  4F8C B;  1U27 A;  1XCG A;  1XD4 A;  1GUA B;  3KYD D;  4GSW A;  2ZVN A;  1V9J A;  2YT0 A;  4MH0 E;  2COD A;  4DHZ E;  2CHW A;  4HCN B;  4K7U A;  4XX5 A;  2IZV B;  2C7H A;  2LI5 A;  1UPR A;  4NNJ B;  4W9L A;  4E71 A;  1GG3 A;  4DHJ B;  2N9X A;  3JSV A;  2RD0 A;  3RD2 A;  3VTU A;  1L2N A;  1PQS A;  3W1S C;  3SO6 A;  3LJ3 A;  2XK5 B;  3K9P B;  4AUQ C;  1WG7 A;  3ZDM C;  2IO2 B;  1OQN A;  4PS7 A;  1WH3 A;  4B95 A;  4IM0 A;  4HAZ B;  1D3Z A;  5D3W A;  2GBK A;  2WDT B;  4GU2 A;  2EMS A;  1TBE A;  1WE6 A;  1RAX A;  3FEH A;  3ZDT A;  2HTH A;  4K7W A;  1H8C A;  3I3T B;  2D11 A;  1FB8 A;  3ZRF A;  4EOY A;  3CMM B;  2AL6 A;  2Z0Q A;  4HDQ A;  2BPS A;  1DYN A;  2KUP A;  2LVO A;  3PSE B;  2NZ8 B;  3AUL A;  3BY4 B;  2P0F A;  2BWF A;  2AEH A;  5FI0 A;  1RJ2 A;  4KSL C;  4BKT A;  3A98 B;  4W9E A;  1WY8 A;  1UNR A;  4WAA A;  5D3X A;  4W9D A;  3ZW3 A;  1X1M A;  2KTR B;  3A4S C;  1VD2 A;  3PRE A;  1M7R A;  1WX9 A;  3TL5 A;  2HJ8 A;  4NAW A;  4AWJ A;  2I5F A;  2C60 A;  3NZU A;  4JQW C;  5TR5 A;  1V5T A;  2DHK A;  3UQA A;  1OY2 A;  4FHJ A;  5J18 A;  3HM6 X;  3VUX A;  1J0W A;  2DKP A;  3R66 C;  1Y8R C;  5AZG A;  3H6N A;  1WGD A;  1E8X A;  3FSS A;  4JGH B;  4EKU A;  3IVF A;  1E8Y A;  2D10 A;  3A1Q B;  2K39 A;  1WR6 E;  2R0D A;  4F7Z A;  4LJO B;  1E90 A;  3RUI B;  3ULB A;  4ANW A;  3R7Q A;  2K6Q A;  4DHJ D;  5D6J B;  1IYF A;  5J2R A;  1WGQ A;  5KQ4 A;  3APC A;  1W1G A;  1Y5O A;  3N30 A;  1R4M I;  2CY4 A;  2BF8 B;  4K17 A;  2KWU B;  1N3H A;  1H4R A;  2LUL A;  4Z2M B;  3GYO A;  3H7P A;  3QK0 A;  1KZG A;  1WF9 A;  1MK7 B;  3DXC A;  1NDD A;  1EVH A;  4HAT B;  2C7M B;  2RGF A;  2KK8 A;  3VH3 B;  2WYQ A;  3OJ3 A;  2I1J A;  1YX6 B;  3BJI A;  1P5T A;  1WXA A;  2ZZP B;  2K00 A;  4IM3 A;  3TMP B;  2RSU A;  4ICU A;  4GGQ A;  3L16 A;  4C0A A;  1UBI A;  3PS6 A;  3PRM B;  2DA0 A;  2PJH A;  3VXW A;  4MGK E;  1V2Y A;  1V49 A;  2FIF A;  2G4D B;  2Z0P A;  4ZDV A;  2KWV B;  1WRD B;  3L10 B;  2LXC A;  3ODW A;  5JHG A;  2N4F A;  1TJ6 A;  5EFX A;  5KCV A;  4JLC A;  2NR2 A;  2CS4 A;  1X1F A;  4KIK A;  1DBH A;  2L05 A;  4ASW C;  2MCN B;  2EMT A;  3DOW A;  1CMX B;  4WWN A;  3MDB C;  2KHW B;  3ML8 A;  1WXV A;  2QKL A;  2LKO A;  5IAA C;  2R2Q A;  3H1U A;  2V3S A;  2RLO A;  4BBN C;  1Z87 A;  3DQV A;  1I42 A;  2NS5 A;  3CIK A;  2PEA A;  2P0D A;  2J59 M;  1EF1 A;  1X86 A;  2KVR A;  3ZNZ B;  3SV1 A;  2KJH B;  2BKF A;  3DPD A;  3TVV A;  1OGW A;  2D9X A;  2FJL A;  3ZLZ A;  3NY5 A;  3CSF A;  1Q5W B;  4IG7 B;  3ALB A;  4N9F 4;  1FHX A;  4RM8 A;  5DPS A;  2JF5 A;  1WMH A;  5JH5 C;  1V81 A;  3WAO A;  4B9K A;  1WJM A;  3PGE A;  2FCN A;  3NZS A;  2GMI C;  1U2B A;  3TBL D;  4HB4 B;  1P9D U;  2G35 A;  2ZNV B;  3VHT C;  1X11 A;  2MX2 A;  2DTC A;  1WX8 A;  2O2V A;  4A6F A;  1AAR A;  3PPA A;  4BOS C;  1LXD A;  1I7A A;  2N23 A;  4WQO B;  5D3V A;  4ZYN A;  2W9N A;  5HE2 A;  4HAY B;  2LJ5 A;  2CR5 A;  1UH6 A;  3IBE A;  4DDI D;  4A5K A;  3OAN A;  2ASQ A;  2ZVO A;  1DDM A;  4J6I A;  2KXJ A;  2KJ6 A;  3RUL A;  2BWE S;  3D8D A;  2LRU A;  2DYN A;  4G3X B;  4GDL A;  3LDZ E;  3DBS A;  4XZ4 A;  1X05 A;  2VKI A;  4GDK B;  2A4Z A;  2YF0 A;  2NBW B;  4MSQ B;  2FUH B;  3W1Y A;  3N3K B;  1SHC A;  3A4R A;  3QAR A;  2Y8F A;  2K8C A;  3IG3 A;  4PS3 A;  2ZCC A;  2COA A;  2M38 A;  4LCD E;  3RCP A;  2P8V A;  4TQ0 A;  4E3C A;  4W9K A;  2OOB B;  1I35 A;  2DYO A;  2LXA A;  2Y8G A;  4B6W A;  2KFK B;  1E7V A;  4FLH A;  1GC7 A;  3IFW B;  3T06 A;  3A9J A;  3TO1 A;  2JZZ A;  5CTR C;  1XD3 B;  2KLG A;  4HAW B;  4PS8 A;  3B08 A;  3PRZ A;  1V5O A;  1IP9 A;  1Q0W B;  4EUT A;  4FJY A; 
#chains in the Genus database with same CATH topology
 5LOP B;  1I7H A;  2ZKM X;  3BK2 A;  4RF0 A;  1L6V A;  4DWF A;  3KYC D;  2ACZ B;  1EF5 A;  3L4P A;  2JXX A;  3MC8 A;  1KH0 A;  2WX1 A;  2QC8 A;  4J3O D;  4KHO A;  1V6E A;  1WSP A;  4DXA B;  3ODX A;  3NVY A;  3VOQ A;  2V76 A;  1W1H A;  2KLC A;  3JYU A;  2W2X D;  1WGK A;  3PVU A;  4XYC A;  3PG7 A;  3SFE B;  1J0G A;  2WDV B;  1J8C A;  4HJK A;  2ELB A;  3ZNH B;  1CZP A;  2MRP A;  1SSN A;  2PZ1 A;  2MJE A;  1FM0 D;  2OQB A;  5HI1 A;  2KMM A;  2KX3 A;  4CHJ A;  4BOZ B;  4G11 A;  3NWF A;  2W3R A;  4BKS A;  1I4X A;  1CJE A;  3QQ8 B;  4EEW A;  5CHW A;  5EDS A;  2LUM A;  2NPT B;  2BGF A;  2PVO D;  2KIG A;  4EFO A;  2FAZ A;  2KDB A;  1VRA B;  4NQK E;  2BB6 A;  5J3Q A;  1XX0 A;  2QKM A;  2LRW A;  1IGD A;  4WJN A;  3HRD D;  5CHV C;  2COC A;  3C19 A;  2RNR B;  4W9J A;  3HIZ A;  4Y94 A;  2OTX A;  1AW7 A;  3RT3 B;  1C1Y B;  1WX7 A;  3AN1 A;  2JY6 A;  2CHX A;  1WE7 A;  2XK5 A;  1WFY A;  3SU8 X;  4L23 A;  1QZE A;  4DHZ B;  1FNV A;  2G4S A;  3HM3 A;  4YTP B;  2EJ8 A;  2NCN A;  2MQJ A;  2M4N A;  3P1M A;  1L7Y A;  4I6N B;  1V5U A;  2DX1 A;  4WJQ A;  1T6B X;  3DWG C;  2J0J A;  3ZVR A;  3DWM A;  3GB1 A;  4M8M A;  4ZRP A;  5C3J B;  2RUK B;  3L17 A;  4MEL A;  5AUK A;  3N20 C;  3QHT A;  3MJW A;  4US8 A;  2EEL A;  2KQ7 A;  1T3Q A;  1JRO A;  5L81 A;  1NTI A;  1XO3 A;  1I4H A;  5BMI A;  2SAK A;  4BAX A;  1F77 A;  1P98 A;  3UIN B;  3OWE B;  1OTR B;  4XDD A;  2WXO A;  1YQB A;  2K22 A;  2JSV X;  2YSZ A;  3D8E A;  2WXG A;  2D07 B;  1B9R A;  3NVV A;  1QOA A;  1ZDX A;  1Q67 A;  3B77 A;  2IPK D;  2LOX A;  2J7Q B;  2JYE A;  3KUZ A;  2M17 A;  2VZK B;  3AEE B;  1HE8 A;  3EFU A;  5E6J A;  3M63 B;  2KQS A;  1MI1 A;  2GOW A;  1VBH A;  5HE1 A;  4PT5 A;  3TEY A;  2RDH A;  2JX5 A;  1K8R B;  1SXT A;  3DHI C;  1ZP0 B;  1GGO A;  5FR3 A;  4YSX B;  2IGG A;  5J17 A;  5G55 A;  5BYQ A;  4WWM A;  4LJP B;  4QJ3 B;  5E6O A;  4K7S A;  4JL9 A;  2D9V A;  1YJJ A;  5HHD G;  2WXF A;  2KTR A;  2YS5 A;  3AU4 A;  1HZ6 A;  2RDB C;  1FGZ A;  3ZXV A;  1F2R C;  2ROZ B;  2R09 A;  1SIF A;  2LUE A;  2AX5 A;  3KUD B;  4MM3 A;  3BK1 A;  2XEW A;  3ZTC A;  4ZRJ A;  5GMV A;  1NYR A;  3MHZ A;  3ZQ4 A;  2KT7 A;  2KC1 A;  4CYE A;  1JDE A;  4TYZ A;  1ET9 A;  2N9E B;  1MIX A;  2CB8 A;  1V61 A;  2M56 B;  3E9S A;  2Z0D B;  2YT2 A;  4IAP A;  1HTQ A;  1V89 A;  1OEY A;  3BVG A;  4A20 A;  3DBL I;  4FJZ A;  1VBG A;  2MLB A;  2OJW A;  2V3N A;  4ANU A;  2DEN B;  2N1W A;  1MI0 A;  5DCN A;  2Q13 A;  1FEH A;  1HB8 A;  2H88 B;  3TJP A;  1GJZ A;  3VTW A;  2MJD A;  2DYQ A;  1BWN A;  2Z4D A;  4YSY B;  3A1Q A;  2L7R A;  2WXL A;  5LXI B;  2CHZ A;  1ZPS A;  2INP E;  1U5G A;  3ULC A;  2N0S B;  1FHW A;  1AWD A;  3ZJU A;  2MEK A;  2X18 A;  4K1R B;  2E2X A;  2CRF A;  3LB8 C;  2MA9 B;  1WI1 A;  3N9Y C;  3NWD A;  5GOW B;  3AE6 B;  1RM6 C;  3RYT A;  3KWV A;  3VR8 B;  4NSW A;  3O96 A;  2DZJ A;  2ONQ A;  3BII D;  2JRH A;  3TEW A;  2MKR A;  5JLJ B;  4EJN A;  1FRR A;  2JT4 B;  3ZNI D;  1UNP A;  3H8H A;  3U12 A;  2Z59 B;  3Q8B A;  4DX8 A;  3DVN V;  1MPH A;  1YD8 U;  4PK1 A;  1KI1 B;  1BXT A;  4JKC A;  3M3J A;  3B0A A;  3N1Z C;  5LG4 B;  2I2Y A;  1SEB D;  5D3D A;  1FNU A;  3SHQ A;  1PMS A;  2UZR A;  2KN5 A;  2XBB C;  4MAC A;  5KHQ A;  2E6X A;  3QBV B;  4LTU A;  3E9O A;  3SBT A;  2QCZ A;  2G45 B;  1E8Z A;  2COP A;  1E8W A;  2REX A;  3L13 A;  1FOE A;  4IC7 B;  4NPN A;  5EE1 A;  4HPP A;  1T0S C;  2DHI A;  1YJ1 A;  4GMX B;  3AEB B;  1TYG B;  4TKN A;  5DHF B;  1CQV A;  4HRO A;  2JWU A;  3UZT A;  2BKR B;  1WGU A;  4A6H A;  2OHF A;  4JK7 A;  3PV1 A;  4GNK B;  2YS3 A;  3UQB A;  1DOI A;  2MBE A;  4EE2 A;  2VZK D;  5D2M B;  3AE2 B;  3QAQ A;  3L0W B;  3E66 A;  4WWO A;  2BBC A;  4MY6 A;  4WJO A;  4RFB A;  2M1M A;  4HDO A;  1RLF A;  4MT5 A;  2RR9 A;  2YEP F;  2LGD A;  1FO4 A;  3KLS X;  2QJL A;  4A9A A;  1BML C;  2JVC A;  4AS1 A;  1KLU D;  2N9K A;  5EE9 A;  3QJZ A;  5E6N A;  1DDW A;  2IY0 B;  1C4A A;  1WWT A;  5C1Z A;  2YVC A;  3MPX A;  2K8B A;  2VRR B;  1M7E A;  2IYD B;  2LGX A;  1E7P B;  2UVM A;  3DBR B;  2RGN B;  1D5M C;  1UD7 A;  3U2S C;  2NVU I;  1OQY A;  3P63 A;  1V1P B;  4OVZ A;  1XR0 B;  1WXS A;  3CF6 E;  3UI3 A;  3C8Y A;  3S2A A;  1PFJ A;  1WM3 A;  3VIA A;  2Y5C A;  3VFK A;  2HE7 A;  2KMC A;  2EC1 A;  1TY2 A;  3TEX A;  4X57 B;  2LGI A;  4JK8 A;  3W5V B;  3DVG X;  2BYV E;  3O13 A;  2HD5 B;  3I57 A;  1BTK A;  2RRF A;  4Z2N A;  3DBL B;  4IWQ A;  5D7G A;  2K2J A;  3RCZ A;  4OZC A;  4A3O A;  2D3B A;  3E9P A;  3M95 A;  3M1I B;  2OED A;  3QA8 A;  3ML9 A;  5DIF B;  1KM7 A;  4BFR A;  3D32 A;  1ZDV A;  2KTF A;  1RFK A;  2LD9 A;  4C00 A;  3A8P A;  4ILJ A;  3ENE A;  2Q5W D;  4DQO C;  4YL8 A;  3DXD A;  1RRB A;  4ZYS A;  3ZJT A;  4HHV A;  4EZK A;  5C23 A;  1IPG A;  4MDK E;  1VCB A;  1E7U A;  2LVQ A;  3TW1 A;  4I6P A;  3KVF B;  2K49 A;  1U5E A;  3RZW C;  4TSS A;  5AZF A;  2KNB A;  4N59 A;  2K9X A;  1WXM A;  4IOI E;  3KY9 A;  1SGH A;  5IJM A;  3ONS A;  1EU3 A;  4YT0 B;  4MJS B;  4DBB A;  5G2N A;  5M4Y B;  3AE7 B;  2W2W A;  5FI1 A;  4G0N B;  5C79 A;  3DXE A;  1ZC3 B;  3PP2 A;  3P7Z A;  5C16 A;  1TY0 A;  2H7D A;  1D4B A;  3MC0 B;  2C9W B;  1VLB A;  2PIA A;  1MG8 A;  1D6E C;  2M19 A;  3NSU A;  4HKQ A;  2RPQ A;  2I1K A;  2N1V A;  3IHP C;  3PVL A;  2H7E A;  4K3B A;  2LYD A;  5IA7 A;  1V88 A;  1SJE D;  4M0W B;  3URY A;  2MP2 B;  5AZH A;  4IOY X;  4XGA B;  4GXB A;  4ACF A;  1Q1O A;  4A6Q A;  2Z0O A;  1V5P A;  4NZL B;  4NJ7 A;  1ZC4 B;  4MGY E;  2P0H A;  2RMM A;  3ECI A;  2LZ6 A;  4IW0 A;  3RNC C;  2XN9 C;  2K25 A;  4GB9 A;  4I6L B;  4IDI A;  1FMA D;  3UF8 A;  2WH5 A;  4LNI A;  4XC2 A;  4C7Y A;  2V0G A;  2AWT A;  3GYP A;  4IM2 A;  1C79 A;  2LGS A;  3FP5 A;  1Y56 A;  2MBQ A;  3VH4 B;  2KC2 A;  2BS2 B;  3BIN A;  1KC7 A;  1FCL A;  4H2A A;  3V61 A;  1U4A A;  3CXB B;  4GDK A;  2KR0 A;  4KAX B;  2BCJ A;  1WGG A;  2UWQ A;  3LJU X;  1NI3 A;  1M94 A;  4KSK C;  4RGT A;  1JQ4 A;  5C2T B;  1N6Z A;  4GPT B;  1N61 A;  3EUB 2;  4F7G A;  5HKH A;  1D5Z C;  3U4E G;  4C4V B;  4ITK A;  4PNK A;  1QOB A;  3V62 A;  2QEJ C;  1BTN A;  2WXN A;  3ZVV A;  2BW2 A;  3RN9 C;  4CHK A;  1A5R A;  1YX5 B;  5D94 A;  2D9W A;  2KFK A;  3AEC B;  1TT5 B;  5LON B;  1P7F A;  2V4L A;  2YS1 A;  1QT9 A;  3GZN I;  3P4S B;  4YTM B;  3X0W A;  4RF1 A;  2ADZ A;  2FCS A;  4GMV A;  1XXG A;  1RYJ A;  3SNH A;  3D8F A;  1OMW A;  3NS8 A;  2DZK A;  2QHO A;  4FUL A;  2RDG A;  1LGR A;  4W9G A;  2FCQ A;  5I4D A;  2GLS A;  1DYQ A;  1TGZ B;  4MEM A;  1MG4 A;  1KOT A;  1WI0 A;  3MTN B;  2CKH B;  1XKE A;  1BUI C;  4ANV A;  2GB1 A;  3Q6B A;  3W1S A;  2YRY A;  4WIP A;  1JRU A;  2HDE A;  3WIM A;  2JPH A;  2FCM A;  5CLL B;  1ROE A;  3Q69 A;  4AJY B;  1LW3 A;  3IAS 1;  3DDC B;  2MHJ A;  1F52 A;  5JZE B;  2DHZ A;  4P1B C;  2DYM A;  3ZGZ A;  2GUM A;  2IFS A;  3Q14 C;  1NVI D;  1T77 A;  3UGB B;  1NEN B;  4W9I A;  5JP4 A;  3RZF A;  2GS0 A;  4HK2 A;  4WQM A;  2LG1 A;  3OAW A;  3RNE C;  2DAJ A;  3KRW A;  2GI9 A;  2PVG C;  2YT1 A;  2UZS A;  3VAW A;  2D9Y A;  2KGX B;  1FIQ A;  4YON A;  2LVP A;  1Z5S B;  3APF A;  3VTV A;  4JKA A;  2C7N B;  1WJN A;  2R2O A;  2NPT A;  2KDE B;  1QC6 A;  2GBM A;  2JYT A;  5L95 C;  2EKE C;  3IAM 1;  1P0R A;  3RNF C;  4K3C A;  1FXT B;  5BMH A;  1SE9 A;  1EWY C;  2RSG A;  2ABD A;  1L0X B;  4REZ A;  3AEF B;  3ML4 A;  1LM8 B;  3A33 B;  3TFM A;  4WJ7 A;  5HFY A;  2E3T A;  1ZXI A;  4ZRQ A;  2MSE D;  2DKQ A;  2DZM A;  2CAY A;  1SF0 A;  2O6V B;  2X38 A;  3PZ7 A;  4KDL B;  4RMA A;  1UBQ A;  3APD A;  1HTO A;  3DCG A;  4QJ5 B;  3BYY B;  3A9K B;  4K2P A;  3A58 A;  1IBX B;  5HE0 A;  3Q8C A;  4HAU B;  3KSY A;  4GIV A;  3PVW A;  3OLM D;  4PYZ A;  1XLQ A;  4WVF B;  3EGR A;  4HB2 B;  4HRS A;  2D3C A;  5BO4 B;  5IKC M;  2L2I A;  4GOU A;  3RPF C;  2L00 B;  2LGY A;  4JK9 A;  2IO1 B;  2N7E A;  1U5D A;  1FFV A;  3NRZ A;  2KMA A;  2MBB B;  2Y5B B;  4JKE A;  3L08 A;  4JX1 C;  2NTS A;  2Y5P A;  1YMH E;  1ACA A;  3PO0 A;  4GLS C;  4M02 A;  2OJR A;  3V05 A;  3GZN B;  4F1S A;  1FXA A;  2DNF A;  4MGZ E;  3TUO A;  4D2K A;  3VRA B;  5C6R A;  1KBL A;  1ZOY B;  1KF6 B;  3FVC A;  2J0M A;  4CQN A;  4S17 A;  4KKI A;  4XWT A;  3R7R A;  3V6C B;  2ZPN A;  3ZNG C;  3PHX B;  2N7D A;  4YXD B;  4HB0 B;  3ZKJ C;  1PLS A;  2VRW B;  1ZSQ A;  2JWZ A;  1TS3 A;  1NI2 A;  1YN5 A;  2WLB A;  5BYR A;  3FKY A;  3VR9 B;  3JW0 X;  4FA6 A;  4URK A;  3U30 A;  2D4Q A;  3T3N A;  4XWX A;  4CHM A;  3PTF C;  2PE9 A;  5GXG B;  2DX5 B;  2AL3 A;  1WJ6 A;  3HQC A;  1AYF A;  1HXY D;  3QX1 A;  3SYX A;  2C5L C;  4OVV A;  2G3Q B;  3P4Q B;  5LXH A;  1PGB A;  3ABV B;  3ODO A;  3Q3M C;  1ZVR A;  5L83 A;  2Y3A A;  3I63 C;  4HCP B;  2YLM A;  2CY5 A;  3DBH B;  4WJP A;  4JKH A;  2ZPY A;  3U8Z A;  3HVZ A;  4IWO A;  3FIL B;  2WNM A;  4RM9 A;  4A3P A;  2KDI A;  2LWP A;  4BKG A;  1TTN A;  2K2U A;  3Q8A A;  3GE3 C;  2WWZ A;  4OW0 A;  3O65 B;  2JZ3 B;  1F0Z A;  2D3G A;  3SBG A;  2GJY A;  2KN4 A;  3IXS A;  1C3T A;  4L1B A;  4O1N A;  4AJW A;  3RMK C;  3RNG C;  1YIW A;  5FR6 A;  3K9O B;  1I4R A;  3BWU D;  2NBV B;  2FID A;  1WYW B;  4QAY A;  3P2B A;  3V60 A;  4JKF A;  4NY0 A;  3ZUN A;  3AED B;  3DBR I;  2D2Q A;  2IY1 B;  4JIO U;  1QKZ A;  1EM7 A;  1HZ5 A;  4BBK A;  5J3Y A;  4KZ0 A;  3PZD A;  3R8B A;  1EGX A;  3HVD A;  4KV2 A;  3T8M A;  1ISN A;  2O6V D;  3CIR B;  5AEK B;  1JWM D;  4FHK A;  2WDQ B;  1B55 A;  3NVZ A;  1C78 A;  4YWG G;  3LXF A;  2MBO A;  2WX0 A;  2RVB B;  3PLU A;  4FJV B;  4JKG B;  4D0N B;  1I2H A;  2KWC A;  2WXQ A;  4HJG E;  5DPT A;  4P16 A;  3JSV B;  2IGH A;  2UU7 A;  1Y19 B;  2Z59 A;  1ACC A;  3NZ3 A;  1ZW7 A;  3ENB A;  1TZ1 A;  5D27 A;  4C80 A;  1S1Q B;  1K5D B;  4IWP A;  2L3Z A;  5HG2 A;  4LNO A;  4AP4 C;  2KZR A;  1WR1 A;  3B9J A;  4DXF A;  3EA6 A;  1XF5 L;  2L1A A;  3Q3J A;  1BT0 A;  4D6W A;  4HPM B;  4LNK A;  2FNJ B;  1LO5 D;  3R3M A;  2GBJ A;  2INN E;  2DFK A;  3C0R B;  4KGS A;  1P3Q U;  1A70 A;  1G6J A;  1JWB D;  2FBW B;  1DRO A;  4AOF A;  2IBI B;  3HK0 A;  2IO3 B;  3AJ4 A;  3NOB A;  2LMC A;  2J52 A;  3W5U B;  1IUE A;  4A90 A;  1FHO A;  1TS5 A;  2BS4 B;  2L8J A;  4XE0 A;  2HTH B;  4OT1 A;  2JUO A;  5HE3 A;  3QC8 B;  4BBN F;  3M62 B;  5CHF A;  2ICI A;  2M8S A;  4KGR A;  2ZCB A;  5IOI A;  4II2 B;  5CX3 A;  2KO3 A;  1JWA D;  2K8H A;  2ELA A;  4MSM B;  1NU2 A;  1FFU A;  2AYO B;  3SDL C;  3N1Y C;  5MPO A;  3AXC A;  1C4P A;  3H9D A;  3B2F A;  3UIP B;  4LNF A;  5DPW A;  3AE1 B;  4ZRK A;  1BAK A;  1DDV A;  1K52 A;  4ARI A;  2ROV A;  3A8Q A;  3N32 A;  3FM8 C;  1QOG A;  3B2G A;  4PYU A;  5DI9 B;  2PLP A;  1V1P A;  3U52 E;  2R2Y A;  1AWE A;  1ZUD 2;  1GC6 A;  1F9J A;  4JE3 B;  2FUG 1;  4NJ6 A;  4DBG A;  2KJR A;  1YQ3 B;  4BKS D;  2WGS A;  3N7C A;  4WAF A;  4EMO A;  5JHA A;  4OSN A;  4HLE A;  2XNA C;  5JHH A;  1VR9 A;  2MWN B;  2M0X A;  2VSZ A;  4DDG D;  1UEL A;  2MH7 A;  4HB3 B;  2KDF B;  1L4Z B;  1ZKH A;  3AE5 B;  3U7D A;  2IYB A;  1RRP B;  1WZ3 A;  5EE0 A;  4NAW B;  3VQI A;  1MPE A;  2L1C A;  2BYF A;  1UGJ A;  2KOX A;  4ZHO A;  2J53 A;  3Q3F A;  2N9P C;  4RGM A;  1FPY A;  2L76 A;  4TV3 A;  3KZ1 A;  3P6A A;  1VJK A;  2GBN A;  1AQC A;  1WM2 A;  1HEZ E;  2V9H A;  1X1G A;  3X23 A;  3J9C A;  4W9C A;  1MVK A;  2CU3 A;  2W55 A;  3AE9 B;  3WAM A;  2WDR B;  3PLV A;  3CST A;  3MHS D;  4L2Y A;  1NEK B;  1UUP A;  2BB5 A;  4ANX A;  2GCL A;  1EAZ A;  1OQQ A;  4L6E A;  3PT2 B;  3E9L A;  4HPL B;  1NTV A;  4MJS A;  4US9 A;  5I2S A;  3WAP A;  3GP7 A;  1SE4 A;  2K3U A;  2I5C A;  5I2M A;  2YEP B;  3V6E B;  4E74 A;  1XLN A;  2K6D B;  3V3X A;  1RFA A;  3ZXR A;  3QWZ B;  3G9W A;  1NBF C;  4DX9 0;  3OHM B;  1VZ6 A;  4RGO S;  3MFG A;  1JAL A;  2JP2 A;  3F0W A;  1XT9 B;  5J3T A;  3GS2 A;  4G50 A;  1ZM0 A;  4NAM A;  3PHW B;  4M0W A;  2LAS A;  1TZO A;  3AEG B;  2MP2 A;  5CLQ B;  3AU5 A;  1VZ8 A;  4ICV A;  3Q3N C;  3H7P B;  4KHA A;  3BVZ A;  1XCT L;  2N0Y A;  3ZTD A;  1QQG A;  1P3R A;  4KDI C;  4KHB B;  1P1A A;  1UF0 A;  1EWC A;  4IUM B;  3VUW A;  3GOE A;  3TIX A;  4IFS A;  4OVU A;  1KFY B;  1E5W A;  3H7S A;  1PFD A;  4ZRI A;  5LLI A;  2J0K A;  3HW2 B;  2K5P A;  2WXH A;  1ENF A;  1T0Y A;  4MH8 A;  3DVN U;  1D5X C;  1L6U A;  3MP9 A;  2Z14 A;  1WJ4 A;  3PZ8 A;  4LDT B;  1LB1 A;  1FD6 A;  5JHB A;  2DIK A;  3QCA A;  1I4P A;  4K81 A;  2PPH A;  4F7H A;  2BYT A;  4HVB A;  3F5R A;  1LQB A;  4ILG B;  5BYS A;  1WZ0 A;  1FRD A;  3HHM A;  1GNU A;  4GZU A;  4RNA A;  3VUY A;  1U5F A;  2V4I B;  2SEB D;  1DOX A;  4P7I A;  3V5W A;  4C4V A;  1MK9 B;  1HBK A;  2PKO A;  2JRI B;  1XLP A;  1EO6 A;  3VVW B;  2MFQ A;  1ZGU B;  5TSS A;  4M00 A;  4BVU C;  4L1R A;  1N5X A;  1JW9 D;  4WWP A;  5D3I B;  1Q10 A;  1WGY A;  2EKI A;  2DLW A;  3WAL A;  2B76 B;  3VDZ A;  1J19 A;  2KKC A;  5LNK 1;  4KIK B;  1N63 A;  4GOC A;  1C4C A;  2BTE A;  4II3 B;  3WAN A;  3VRB B;  1NTY A;  2JXT A;  1R4M B;  1E9M A;  3SUZ A;  3ZIM A;  1GOZ A;  1KLG D;  2L32 A;  3P42 A;  1DGJ A;  3NUH B;  2N7J A;  1FAO A;  3SD5 A;  4BZA A;  1NYQ A;  4W9H A;  3KH0 A;  4WH4 A;  3WYF B;  1UPQ A;  2V1Y A;  2M14 A;  4LK0 M;  4S0R A;  1F2R I;  3B1L X;  2TSS A;  3DVG Y;  1B1Z A;  4TQ1 A;  4RH6 A;  3ZO5 B;  1VZ7 A;  4EZJ A;  1N5W A;  3WA0 A;  1UZX B;  1KLV A;  2L0F A;  1V86 A;  3KUC B;  2AQ2 B;  3EEC A;  1WIA A;  5DH9 B;  2PTL A;  1MKE A;  1FGY A;  3NW8 A;  2Z0E B;  1HB6 A;  1N62 A;  2MJ3 A;  1JCK B;  1M4V A;  1S3S G;  2DZI A;  2UYZ B;  4TMA B;  1XEE A;  1JWU D;  3EHV A;  2XQN M;  1J7A A;  1IRS A;  2H89 B;  2NBU A;  4KVG B;  2HTM E;  4HXD A;  1L0V B;  4HAV B;  4GN1 A;  1YN3 A;  1WMH B;  1YQ4 B;  4XDC A;  1U29 A;  1TQZ A;  2DWQ A;  1TJE A;  4RGN A;  1GB4 A;  2KFJ A;  2MW5 A;  3PRP B;  3NG0 A;  3RFZ B;  2KAN A;  2DYB A;  2IO0 B;  2J4X A;  3I5J C;  4KX6 B;  5DPR A;  1WGR A;  1TXD A;  2COF A;  4FN2 A;  3UIO B;  2GBR A;  3EPY A;  4JWS C;  2K0P A;  2KCJ A;  1WJ1 A;  1XLO A;  2O6V A;  1L5P A;  1MIZ B;  4FAD A;  3RNB C;  3DBH I;  1UEF A;  3QIJ A;  3A9K A;  3T9L A;  2O2V B;  4A6F B;  1IBX A;  4B0M A;  1OEY J;  5KQ1 A;  4OHJ A;  4LDT D;  2GCJ A;  4H8S A;  1KZ7 A;  4NQL B;  4TUU A;  3FLV A;  2Z8L A;  4DK5 A;  3AM9 A;  3AI5 A;  4HAX B;  4B6H A;  4JWU C;  4W9F A;  5IO9 A;  2LOZ A;  5E6P A;  2A5U A;  3FAH A;  2K1F A;  1V5M A;  1WGH A;  2DAF A;  3KW5 B;  3PSC A;  3AMZ A;  3HIE A;  4YTN B;  2W2X C;  2B3A A;  4N6E B;  4CO7 A;  1C9F A;  3TSS A;  3IT4 B;  4MGI E;  2ZEQ A;  1ZE3 D;  1XOD A;  1SB3 C;  4DIX A;  3KRX A;  1V80 A;  3BZD B;  2KD0 A;  4GDL B;  3L54 A;  4WSF A;  1C77 A;  1T0Q C;  1W1D A;  5C5B A;  1K5G B;  2MWS B;  1ST7 A;  4YSZ B;  2L0T A;  3U7Z A;  2DHJ A;  2ZNV C;  1EUV B;  1K50 A;  2HJ1 A;  2ZJD A;  2DN6 A;  1MHH E;  4HWI B;  2D9Z A;  2QDF A;  4K2O A;  4KGT A;  4R3D A;  3TCA A;  5JVL A;  2Y7B A;  1V97 A;  2MBH A;  4MK0 A;  5AUI A;  1J7B A;  1QOF A;  1R4N I;  2NMB A;  1GPX A;  3PEG A;  2DX5 A;  4KZC A;  4EZL A;  2MDX A;  1WVH A;  2IJ0 A;  5FK9 C;  3A9J B;  1Z2M A;  1UGM A;  1WJU A;  3NS1 A;  4FBJ B;  3JVZ X;  1UNQ A;  1XQQ A;  1K53 A;  5IRS A;  5KHO A;  4P1C C;  4A6K A;  1H10 A;  4MT7 A;  1P6S A;  1MAI A;  3QWM A;  4PQ0 A;  2KX0 A;  3P4P B;  1QF6 A;  3R2I A;  3FIL A;  2BYE A;  5D3Y A;  5IN7 A;  5C5B B;  4LLG M;  3ZRC A;  3OJ4 B;  2CU1 A;  1JWS D;  1KJT A;  3AE4 B;  1LFD A;  1MFW A;  5DHA B;  5T8I A;  4M8N A;  3NHE B;  3EC8 A;  1C76 A;  2PE6 B;  4F7U P;  1YNT E;  3HSA A;  4F8C B;  1WXQ A;  1U27 A;  3E56 A;  4RCO A;  1XCG A;  1PDX A;  3OG5 A;  2NBV A;  1L4D B;  1XD4 A;  1GUA B;  3KYD D;  1FNW A;  4GSW A;  2ZVN A;  4CSQ A;  1V9J A;  1I4Q A;  2YT0 A;  3SR6 A;  4MH0 E;  2KDM A;  2WXI A;  2COD A;  1CK1 A;  3P4R B;  4DHZ E;  2CHW A;  1QQR A;  4HCN B;  1V8C A;  4K7U A;  4XX5 A;  2IZV B;  4LNN A;  5BMG A;  2C7H A;  2WXR A;  3DCX A;  4P6V F;  1ESF A;  2LI5 A;  1UPR A;  2G9H D;  2LFI A;  5H8Y E;  4NNJ B;  3GE8 C;  4W9L A;  4E71 A;  1JML A;  4JKG A;  1HQR D;  4B0E A;  1GG3 A;  4DHJ B;  2N9X A;  3JSV A;  2BT6 A;  3FC4 A;  2RD0 A;  3RD2 A;  3Q8E A;  3VTU A;  1L2N A;  3I9V 1;  1PQS A;  2JZP A;  3W1S C;  3BVM A;  3SO6 A;  3LJ3 A;  4USA A;  2XK5 B;  3K9P B;  4AUQ C;  1WG7 A;  3Q2A C;  2WU5 B;  4HEA 1;  3ZDM C;  1FXI A;  2IO2 B;  3SEB A;  4UDU C;  1OQN A;  4PS7 A;  1QIL A;  1WH3 A;  4B95 A;  4IM0 A;  1IGC A;  2QSD A;  4HAZ B;  1D3Z A;  5D3W A;  2GBK A;  2WDT B;  4GU2 A;  2RQ1 A;  2EMS A;  1TBE A;  1WE6 A;  1RAX A;  3ETR A;  1UWX A;  2QIE B;  2RPV A;  2I38 A;  2WP9 B;  1RWS A;  2BS3 B;  1SJH D;  3FEH A;  2PMV A;  3ZDT A;  1QLB B;  2HTH A;  4K7W A;  1H8C A;  3I3T B;  2D11 A;  1FB8 A;  3Q8F A;  3ZRF A;  4EOY A;  1ET6 A;  3CMM B;  2AL6 A;  2Z0Q A;  3BYT B;  4HDQ A;  1R4N B;  3AH7 A;  2BPS A;  2KUQ A;  1DYN A;  2DBY A;  2KUP A;  2LVO A;  4KKJ A;  3PSE B;  1E10 A;  2NZ8 B;  2ZW0 A;  3AUL A;  3BY4 B;  4WUR A;  2P0F A;  2KQ4 X;  2NTT A;  1R7S A;  2BWF A;  1MJD A;  2AEH A;  2FJU B;  5FI0 A;  1KRH A;  3W9C B;  1RJ2 A;  4KSL C;  1UNS A;  4BKT A;  3A98 B;  4W9E A;  1WY8 A;  1UNR A;  4WAA A;  1P7E A;  2VH1 A;  3W2D A;  5D3X A;  1KTK A;  4W9D A;  3ZW3 A;  1MHX A;  1X1M A;  3AE8 B;  3WCQ A;  2KTR B;  3A4S C;  1VD2 A;  3PRE A;  4N58 A;  3Q3O C;  1M7R A;  4C56 C;  1WX9 A;  3TL5 A;  4MM3 B;  2HJ8 A;  4NAW A;  1SE3 A;  4AWJ A;  2WXP A;  1TS4 A;  2I5F A;  2C60 A;  3NZU A;  4JQW C;  5TR5 A;  2BVC A;  4AQ7 A;  1V5T A;  1YOV B;  1GB1 A;  3SFD B;  2DHK A;  3UQA A;  2WXJ A;  1OY2 A;  4FHJ A;  5J18 A;  3HM6 X;  3VUX A;  1J0W A;  1SE2 A;  1T0R C;  2DKP A;  3R66 C;  1Y8R C;  5AZG A;  1VDV A;  3H6N A;  1WGD A;  1E8X A;  1SBB B;  3FSS A;  4JGH B;  3ZJV A;  4EKU A;  4A8X C;  3IVF A;  1E8Y A;  2WQY B;  2D10 A;  2KVZ A;  3A1Q B;  2K39 A;  1WR6 E;  2R0D A;  4F7Z A;  4LJO B;  3ZYY X;  2WXM A;  1E90 A;  3RUI B;  3ULB A;  1YN4 A;  1N60 A;  4ANW A;  3R7Q A;  2K6Q A;  4DHJ D;  4HKZ E;  2KAC A;  2W54 A;  5D6J B;  1IYF A;  5J2R A;  2ON8 A;  1WGQ A;  5KQ4 A;  1ZXH A;  1PGA A;  2J42 A;  4OZB A;  3APC A;  1W1G A;  5EE3 A;  3N1X C;  1OQR A;  1Y5O A;  3N30 A;  1R4M I;  2IDY A;  2CY4 A;  2BF8 B;  4K17 A;  2KWU B;  5IP4 D;  1N3H A;  1H4R A;  2LUL A;  4Z2M B;  1NVL A;  2CQU A;  3GYO A;  3H7P A;  5G5G A;  3QK0 A;  1KZG A;  1PYW D;  1EU4 A;  4KHB A;  1WF9 A;  1MK7 B;  3DXC A;  1NDD A;  1EVH A;  4HAT B;  2C7M B;  2RGF A;  1GAQ B;  2KK8 A;  3VH3 B;  2WYQ A;  3OJ3 A;  2I1J A;  1YX6 B;  4FXC A;  3BJI A;  1P5T A;  1WXA A;  2ZZP B;  2K00 A;  4IM3 A;  3TMP B;  2WS3 B;  1WYG A;  1TKG A;  4NJC A;  2RSU A;  4HSI A;  4ICU A;  4GGQ A;  3L16 A;  1TS2 A;  4C0A A;  1UBI A;  3PS6 A;  2R61 A;  3PRM B;  1PGX A;  2DA0 A;  2X8X X;  2PJH A;  2V3P A;  3VXW A;  4MGK E;  1YJI A;  5G5H A;  1SIJ A;  1V2Y A;  1V49 A;  2FIF A;  2VH2 A;  2G4D B;  2Z0P A;  2IGD A;  4ZDV A;  2KWV B;  1WRD B;  3L10 B;  2GRI A;  2LXC A;  1TKY A;  1E0Z A;  4JKB A;  4OZA A;  2DLB A;  3ODW A;  1UWM A;  5JHG A;  2N4F A;  1TJ6 A;  2FDQ A;  4C7Z A;  2L83 A;  5EFX A;  2LHE A;  5KCV A;  1TKE A;  4JLC A;  1V1O A;  2NR2 A;  2WHI A;  2CS4 A;  2INC C;  1X1F A;  4KIK A;  1DBH A;  1E6E B;  2Z13 A;  2R82 A;  2L05 A;  1AN8 A;  4ASW C;  2MCN B;  1J7C A;  2LJI A;  2EMT A;  2ZW1 A;  3DOW A;  1CMX B;  4JKD A;  3MDB C;  4WWN A;  2KHW B;  3ML8 A;  1WXV A;  2QKL A;  1K51 A;  2LKO A;  2W3S A;  5IAA C;  1OFF A;  3LYY A;  3AB5 A;  2R2Q A;  3H1U A;  2V3S A;  2RLO A;  2AQ1 B;  4BBN C;  1F1H A;  1Z87 A;  3DQV A;  1XCQ L;  1I42 A;  2LEK A;  1PUT A;  2NS5 A;  3EFC A;  3CIK A;  2X0S A;  4ZHP A;  2JQR B;  2PEA A;  2P0D A;  4Q2J A;  2J59 M;  2WXK A;  1EF1 A;  1X86 A;  1DOY A;  2KVR A;  3ZNZ B;  3SV1 A;  2KJH B;  2BKF A;  3DPD A;  2FE8 A;  3TVV A;  2BQQ A;  1HA5 A;  1OGW A;  3TEZ A;  2D9X A;  2FJL A;  1JRP A;  2IND C;  2K8E A;  3NY5 A;  3ZLZ A;  3CSF A;  1Q5W B;  4IG7 B;  5JXV A;  3ALB A;  4N9F 4;  1DIK A;  2G1E A;  1FHX A;  1L0Y B;  4RM8 A;  5DPS A;  2WU2 B;  2JF5 A;  4QJ4 B;  1WMH A;  5JH5 C;  2D5G A;  1V81 A;  3WAO A;  2NMQ A;  4B9K A;  1TIF A;  1WJM A;  4QXA B;  2LHD A;  2HRJ A;  1I4G A;  3PGE A;  2KAJ A;  4DXG A;  2FCN A;  4ILH A;  3NZS A;  2GMI C;  1U2B A;  4HB4 B;  3TBL D;  3RI7 C;  1P9D U;  2G35 A;  2ZNV B;  2QMT A;  3VHT C;  1X11 A;  2MX2 A;  2DTC A;  3CWI A;  1WX8 A;  3MJ5 A;  3MC9 A;  2O2V A;  4A6F A;  1AAR A;  3PPA A;  4BOS C;  3IT6 B;  1LXD A;  2QIL A;  1I7A A;  2N23 A;  2PW9 A;  4WQO B;  5D3V A;  2LBB A;  2L52 A;  4ZYN A;  2W9N A;  3DHG C;  4ZOH C;  3NWA A;  5HE2 A;  4HAY B;  3NVW A;  3AE3 B;  1FCC C;  2JU6 X;  5FKA C;  3AEA B;  2LJ5 A;  2CR5 A;  1UH6 A;  3IBE A;  3R2T A;  3AV8 A;  4DDI D;  2FJ9 A;  2KIE A;  3RNA C;  4A5K A;  3OAN A;  2ASQ A;  2ZVO A;  1DDM A;  4XWW A;  3KQ4 A;  4J6I A;  2D3A A;  2KXJ A;  4JPS A;  2KJ6 A;  3RUL A;  2KYW A;  2BWE S;  1STE A;  3D8D A;  2LRU A;  2DYN A;  4G3X B;  2KWD A;  4GDL A;  1ZYI A;  3LDZ E;  3DBS A;  4IKG A;  1X05 A;  4XZ4 A;  4A55 A;  2VKI A;  4GDK B;  2A4Z A;  2YF0 A;  2M0A A;  2NBW B;  4MSQ B;  2FUH B;  3W1Y A;  3N3K B;  1SHC A;  3A4R A;  3QAR A;  2Y8F A;  1WRI A;  2K8C A;  3IG3 A;  4M01 A;  4ARC A;  4PS3 A;  2ZCC A;  2COA A;  3KWL A;  2M38 A;  4LCD E;  3RCP A;  2P8V A;  2CJO A;  4TQ0 A;  4E3C A;  4W9K A;  2OOB B;  3DHH C;  3HUI A;  1I35 A;  2DYO A;  2LXA A;  2Y8G A;  4B6W A;  2KFK B;  1E7V A;  4FLH A;  1GC7 A;  3IFW B;  3T06 A;  2W82 A;  3A9J A;  3TO1 A;  2JZZ A;  3T3O A;  5CTR C;  1XD3 B;  1T5X D;  4HAW B;  2KLG A;  4PS8 A;  2CJN A;  2N9L A;  3B08 A;  3PRZ A;  3NJT A;  5H92 C;  1V5O A;  1IP9 A;  2AQ3 B;  1Q0W B;  4EUT A;  4FJY A; 
#chains in the Genus database with same CATH homology
 5LOP B;  4DWF A;  3KYC D;  1EF5 A;  2JXX A;  2WX1 A;  4KHO A;  1V6E A;  4DXA B;  3ODX A;  3VOQ A;  2V76 A;  1W1H A;  2KLC A;  3JYU A;  2W2X D;  3PVU A;  3PG7 A;  1J0G A;  1J8C A;  4HJK A;  2ELB A;  3ZNH B;  2MRP A;  2PZ1 A;  2OQB A;  2KX3 A;  4CHJ A;  4BOZ B;  4G11 A;  4BKS A;  3QQ8 B;  4EEW A;  5CHW A;  5EDS A;  2NPT B;  2BGF A;  4EFO A;  2FAZ A;  2KDB A;  4NQK E;  5J3Q A;  1XX0 A;  2QKM A;  2LRW A;  4WJN A;  5CHV C;  2COC A;  2RNR B;  4W9J A;  3HIZ A;  4Y94 A;  2OTX A;  3RT3 B;  1C1Y B;  1WX7 A;  2JY6 A;  2CHX A;  1WE7 A;  2XK5 A;  1WFY A;  3SU8 X;  1QZE A;  4DHZ B;  2G4S A;  3HM3 A;  2EJ8 A;  2NCN A;  2MQJ A;  2M4N A;  1L7Y A;  4I6N B;  1V5U A;  2DX1 A;  4WJQ A;  2J0J A;  3ZVR A;  4M8M A;  2RUK B;  3L17 A;  4MEL A;  3QHT A;  3MJW A;  2KQ7 A;  5L81 A;  1NTI A;  1P98 A;  3UIN B;  1OTR B;  1YQB A;  2YSZ A;  3D8E A;  2D07 B;  1Q67 A;  2LOX A;  2J7Q B;  3KUZ A;  2M17 A;  1HE8 A;  3EFU A;  3M63 B;  2KQS A;  2GOW A;  1VBH A;  5HE1 A;  1K8R B;  1GGO A;  5J17 A;  5G55 A;  4LJP B;  5E6O A;  4K7S A;  4JL9 A;  2D9V A;  2KTR A;  2YS5 A;  3AU4 A;  1FGZ A;  2ROZ B;  2R09 A;  1SIF A;  2LUE A;  3KUD B;  4MM3 A;  3ZTC A;  2XEW A;  4ZRJ A;  5GMV A;  2KC1 A;  4CYE A;  1JDE A;  4TYZ A;  2N9E B;  1MIX A;  2CB8 A;  1V61 A;  2Z0D B;  4IAP A;  1V89 A;  1OEY A;  4A20 A;  3DBL I;  4FJZ A;  1VBG A;  2MLB A;  4ANU A;  2DEN B;  2N1W A;  5DCN A;  1GJZ A;  2Q13 A;  1HB8 A;  3TJP A;  3VTW A;  2DYQ A;  1BWN A;  3A1Q A;  2L7R A;  5LXI B;  2CHZ A;  1U5G A;  3ULC A;  1FHW A;  2X18 A;  4K1R B;  2E2X A;  2CRF A;  2MA9 B;  1WI1 A;  5GOW B;  3RYT A;  4NSW A;  3O96 A;  2DZJ A;  2JRH A;  2MKR A;  5JLJ B;  4EJN A;  2JT4 B;  3ZNI D;  1UNP A;  2Z59 B;  4DX8 A;  3DVN V;  1MPH A;  1YD8 U;  1KI1 B;  4JKC A;  3M3J A;  3B0A A;  3SHQ A;  1PMS A;  2UZR A;  2KN5 A;  2XBB C;  5KHQ A;  3QBV B;  3E9O A;  3SBT A;  2G45 B;  1E8Z A;  2COP A;  1E8W A;  2REX A;  3L13 A;  1FOE A;  4IC7 B;  4NPN A;  2DHI A;  1YJ1 A;  4GMX B;  4TKN A;  5DHF B;  3UZT A;  2BKR B;  1WGU A;  4A6H A;  3PV1 A;  4JK7 A;  2YS3 A;  3UQB A;  2MBE A;  5D2M B;  3QAQ A;  3L0W B;  3E66 A;  4WWO A;  4MY6 A;  4WJO A;  2M1M A;  4HDO A;  1RLF A;  2RR9 A;  2LGD A;  2JVC A;  3QJZ A;  5E6N A;  1DDW A;  2IY0 B;  5C1Z A;  2YVC A;  3MPX A;  2K8B A;  2VRR B;  1M7E A;  2IYD B;  2LGX A;  2UVM A;  2RGN B;  1UD7 A;  2NVU I;  1OQY A;  1XR0 B;  1WXS A;  3CF6 E;  3S2A A;  1PFJ A;  1WM3 A;  3VIA A;  3VFK A;  2HE7 A;  2KMC A;  2EC1 A;  4X57 B;  4JK8 A;  3DVG X;  2BYV E;  2HD5 B;  1BTK A;  4Z2N A;  4IWQ A;  3RCZ A;  5D7G A;  2K2J A;  4A3O A;  3E9P A;  3M95 A;  3M1I B;  3QA8 A;  3ML9 A;  5DIF B;  1KM7 A;  4BFR A;  3D32 A;  2KTF A;  2LD9 A;  3A8P A;  4ILJ A;  3ENE A;  4YL8 A;  3DXD A;  1RRB A;  4HHV A;  4EZK A;  5C23 A;  1IPG A;  4MDK E;  1VCB A;  1E7U A;  2LVQ A;  3TW1 A;  4I6P A;  3KVF B;  1U5E A;  3RZW C;  5AZF A;  2KNB A;  1WXM A;  3KY9 A;  1SGH A;  5IJM A;  3ONS A;  4MJS B;  4DBB A;  5G2N A;  2W2W A;  5FI1 A;  4G0N B;  5C79 A;  3DXE A;  1ZC3 B;  3PP2 A;  3P7Z A;  5C16 A;  2H7D A;  2C9W B;  1MG8 A;  3NSU A;  2RPQ A;  2I1K A;  2N1V A;  3IHP C;  3PVL A;  2H7E A;  2LYD A;  5IA7 A;  1V88 A;  4M0W B;  2MP2 B;  5AZH A;  4IOY X;  4GXB A;  1Q1O A;  2Z0O A;  1V5P A;  4NJ7 A;  1ZC4 B;  4MGY E;  2P0H A;  3ECI A;  2LZ6 A;  4IW0 A;  2K25 A;  4GB9 A;  4I6L B;  3UF8 A;  2WH5 A;  4XC2 A;  2AWT A;  3GYP A;  4IM2 A;  3FP5 A;  2MBQ A;  3VH4 B;  2KC2 A;  3BIN A;  1KC7 A;  3V61 A;  1U4A A;  3CXB B;  4GDK A;  4KAX B;  2BCJ A;  1WGG A;  2UWQ A;  3LJU X;  1M94 A;  4KSK C;  4GPT B;  4F7G A;  5HKH A;  4PNK A;  3V62 A;  1BTN A;  3ZVV A;  4CHK A;  1A5R A;  1YX5 B;  5D94 A;  2D9W A;  2KFK A;  5LON B;  2V4L A;  2YS1 A;  3GZN I;  3X0W A;  2ADZ A;  2FCS A;  4GMV A;  3SNH A;  3D8F A;  1OMW A;  3NS8 A;  2DZK A;  2QHO A;  4FUL A;  4W9G A;  2FCQ A;  1TGZ B;  4MEM A;  1KOT A;  1WI0 A;  3MTN B;  2CKH B;  1XKE A;  4ANV A;  3W1S A;  2YRY A;  1JRU A;  3WIM A;  2JPH A;  2FCM A;  5CLL B;  4AJY B;  1LW3 A;  3DDC B;  5JZE B;  2DHZ A;  2DYM A;  2IFS A;  3UGB B;  4W9I A;  5JP4 A;  3RZF A;  2GS0 A;  4HK2 A;  2LG1 A;  3OAW A;  2DAJ A;  3KRW A;  2YT1 A;  2UZS A;  3VAW A;  2D9Y A;  2KGX B;  4YON A;  2LVP A;  1Z5S B;  3APF A;  3VTV A;  4JKA A;  2C7N B;  1WJN A;  2R2O A;  2NPT A;  2KDE B;  1QC6 A;  2GBM A;  5L95 C;  2EKE C;  1P0R A;  1FXT B;  1SE9 A;  2RSG A;  2ABD A;  3ML4 A;  1LM8 B;  3A33 B;  3TFM A;  4WJ7 A;  2MSE D;  2DKQ A;  2DZM A;  2CAY A;  2O6V B;  4RMA A;  4KDL B;  1UBQ A;  3APD A;  3DCG A;  3A9K B;  4K2P A;  5HE0 A;  4HAU B;  3KSY A;  4GIV A;  3PVW A;  3OLM D;  4PYZ A;  4WVF B;  4HB2 B;  5BO4 B;  2L2I A;  2L00 B;  2LGY A;  4JK9 A;  2IO1 B;  2N7E A;  1U5D A;  2KMA A;  2MBB B;  2Y5B B;  4JKE A;  3L08 A;  1ACA A;  2OJR A;  4F1S A;  4MGZ E;  5C6R A;  1KBL A;  2J0M A;  3R7R A;  3V6C B;  2ZPN A;  3ZNG C;  3PHX B;  2N7D A;  4HB0 B;  3ZKJ C;  1PLS A;  2VRW B;  1ZSQ A;  2JWZ A;  1NI2 A;  3JW0 X;  4FA6 A;  4URK A;  3U30 A;  2D4Q A;  4XWX A;  4CHM A;  3PTF C;  2PE9 A;  2DX5 B;  2AL3 A;  1WJ6 A;  3HQC A;  3QX1 A;  3SYX A;  2C5L C;  4OVV A;  2G3Q B;  5LXH A;  3ODO A;  1ZVR A;  5L83 A;  4HCP B;  2YLM A;  2CY5 A;  4WJP A;  4JKH A;  2ZPY A;  3U8Z A;  4IWO A;  4RM9 A;  4A3P A;  2KDI A;  2LWP A;  4BKG A;  1TTN A;  2K2U A;  2WWZ A;  3O65 B;  2JZ3 B;  2D3G A;  3SBG A;  2GJY A;  1C3T A;  4AJW A;  1YIW A;  5FR6 A;  3K9O B;  2NBV B;  2FID A;  1WYW B;  3P2B A;  3V60 A;  4JKF A;  4NY0 A;  3ZUN A;  3DBR I;  2D2Q A;  2IY1 B;  4JIO U;  4BBK A;  5J3Y A;  4KZ0 A;  3PZD A;  1EGX A;  4KV2 A;  3T8M A;  1ISN A;  2O6V D;  5AEK B;  4FHK A;  1B55 A;  2MBO A;  2WX0 A;  2RVB B;  3PLU A;  4FJV B;  4JKG B;  4D0N B;  1I2H A;  2KWC A;  5DPT A;  3JSV B;  1Y19 B;  1ZW7 A;  3ENB A;  1TZ1 A;  5D27 A;  1S1Q B;  1K5D B;  4IWP A;  2L3Z A;  4AP4 C;  2KZR A;  1WR1 A;  3Q3J A;  1BT0 A;  4HPM B;  2FNJ B;  3R3M A;  2GBJ A;  2DFK A;  3C0R B;  1P3Q U;  1G6J A;  1DRO A;  4AOF A;  2IBI B;  3HK0 A;  2IO3 B;  3AJ4 A;  3NOB A;  1FHO A;  2L8J A;  2HTH B;  2JUO A;  5HE3 A;  3QC8 B;  4BBN F;  3M62 B;  5CHF A;  2M8S A;  2ZCB A;  4II2 B;  5CX3 A;  2KO3 A;  2K8H A;  2ELA A;  4MSM B;  1NU2 A;  2AYO B;  3SDL C;  3AXC A;  3H9D A;  3UIP B;  5DPW A;  4ZRK A;  1BAK A;  1DDV A;  2ROV A;  3A8Q A;  3N32 A;  3FM8 C;  4PYU A;  5DI9 B;  1AWE A;  1GC6 A;  1F9J A;  4NJ6 A;  4DBG A;  2KJR A;  4BKS D;  3N7C A;  4EMO A;  5JHA A;  4HLE A;  5JHH A;  2M0X A;  2MWN B;  2VSZ A;  4DDG D;  1UEL A;  4HB3 B;  2KDF B;  1ZKH A;  3U7D A;  2IYB A;  1RRP B;  1WZ3 A;  4NAW B;  3VQI A;  2L1C A;  2BYF A;  2KOX A;  3Q3F A;  2N9P C;  2L76 A;  4TV3 A;  3KZ1 A;  3P6A A;  2GBN A;  1AQC A;  1WM2 A;  1X1G A;  3X23 A;  4W9C A;  3WAM A;  3PLV A;  3CST A;  3MHS D;  4ANX A;  2GCL A;  1EAZ A;  4L6E A;  3PT2 B;  3E9L A;  4HPL B;  1NTV A;  4MJS A;  3WAP A;  2I5C A;  3V6E B;  4E74 A;  2K6D B;  1RFA A;  3QWZ B;  3G9W A;  1NBF C;  4DX9 0;  2JP2 A;  3F0W A;  1XT9 B;  5J3T A;  4G50 A;  1ZM0 A;  3PHW B;  2LAS A;  2MP2 A;  5CLQ B;  3AU5 A;  4ICV A;  3H7P B;  4KHA A;  2N0Y A;  3ZTD A;  1QQG A;  1P3R A;  4KDI C;  4KHB B;  1P1A A;  4IUM B;  3VUW A;  3GOE A;  3TIX A;  4IFS A;  4OVU A;  1E5W A;  3H7S A;  4ZRI A;  5LLI A;  2J0K A;  3HW2 B;  1T0Y A;  3DVN U;  1WJ4 A;  4LDT B;  1LB1 A;  5JHB A;  2DIK A;  3QCA A;  4K81 A;  2PPH A;  4F7H A;  4HVB A;  3F5R A;  1LQB A;  4ILG B;  1WZ0 A;  3HHM A;  1GNU A;  4GZU A;  3VUY A;  1U5F A;  4P7I A;  3V5W A;  1MK9 B;  1HBK A;  2JRI B;  1EO6 A;  3VVW B;  2MFQ A;  1ZGU B;  4BVU C;  4WWP A;  1WGY A;  2DLW A;  3WAL A;  3VDZ A;  1J19 A;  2KKC A;  4KIK B;  4GOC A;  4II3 B;  3WAN A;  1NTY A;  3SUZ A;  3ZIM A;  1FAO A;  3SD5 A;  4W9H A;  3KH0 A;  3WYF B;  1UPQ A;  2V1Y A;  2M14 A;  3B1L X;  3DVG Y;  4TQ1 A;  3ZO5 B;  4EZJ A;  3WA0 A;  1UZX B;  1KLV A;  2L0F A;  1V86 A;  3KUC B;  3EEC A;  1WIA A;  5DH9 B;  1MKE A;  1FGY A;  2Z0E B;  1HB6 A;  1S3S G;  2DZI A;  2UYZ B;  3EHV A;  2XQN M;  1IRS A;  2NBU A;  4KVG B;  4HXD A;  4HAV B;  4GN1 A;  1WMH B;  1U29 A;  1TQZ A;  2KFJ A;  2MW5 A;  3PRP B;  2KAN A;  2DYB A;  2IO0 B;  5DPR A;  1WGR A;  1TXD A;  2COF A;  4FN2 A;  3UIO B;  2GBR A;  3EPY A;  2KCJ A;  1WJ1 A;  2O6V A;  1MIZ B;  4FAD A;  3DBH I;  1UEF A;  3QIJ A;  3A9K A;  3T9L A;  2O2V B;  4A6F B;  1OEY J;  5KQ1 A;  4LDT D;  2GCJ A;  4H8S A;  1KZ7 A;  4NQL B;  4TUU A;  3FLV A;  4DK5 A;  3AI5 A;  4HAX B;  4B6H A;  4W9F A;  2LOZ A;  5E6P A;  2A5U A;  2K1F A;  1V5M A;  1WGH A;  2DAF A;  3KW5 B;  3PSC A;  2W2X C;  2B3A A;  4CO7 A;  4MGI E;  2ZEQ A;  1XOD A;  3KRX A;  1V80 A;  2KD0 A;  4GDL B;  3L54 A;  4WSF A;  1W1D A;  5C5B A;  1K5G B;  2MWS B;  1ST7 A;  2L0T A;  2DHJ A;  2ZNV C;  1EUV B;  2ZJD A;  2DN6 A;  4HWI B;  2D9Z A;  4K2O A;  3TCA A;  5JVL A;  2Y7B A;  2MBH A;  4MK0 A;  1R4N I;  2NMB A;  3PEG A;  2DX5 A;  4KZC A;  4EZL A;  2MDX A;  1WVH A;  3A9J B;  1Z2M A;  1UGM A;  1WJU A;  4FBJ B;  3JVZ X;  1UNQ A;  1XQQ A;  5KHO A;  4A6K A;  1H10 A;  4MT7 A;  1P6S A;  1MAI A;  3QWM A;  4PQ0 A;  2KX0 A;  2BYE A;  5D3Y A;  5C5B B;  3ZRC A;  3OJ4 B;  2CU1 A;  1KJT A;  1LFD A;  5DHA B;  4M8N A;  3NHE B;  3EC8 A;  2PE6 B;  4F7U P;  4F8C B;  1U27 A;  1XCG A;  1XD4 A;  1GUA B;  3KYD D;  4GSW A;  2ZVN A;  1V9J A;  2YT0 A;  4MH0 E;  2COD A;  4DHZ E;  2CHW A;  4HCN B;  4K7U A;  4XX5 A;  2IZV B;  2C7H A;  2LI5 A;  1UPR A;  4NNJ B;  4W9L A;  4E71 A;  4JKG A;  1GG3 A;  4DHJ B;  2N9X A;  3JSV A;  2RD0 A;  3RD2 A;  3VTU A;  1L2N A;  1PQS A;  3W1S C;  3SO6 A;  3LJ3 A;  2XK5 B;  3K9P B;  4AUQ C;  1WG7 A;  3ZDM C;  2IO2 B;  1OQN A;  4PS7 A;  1WH3 A;  4B95 A;  4IM0 A;  4HAZ B;  1D3Z A;  5D3W A;  2GBK A;  2WDT B;  4GU2 A;  2RQ1 A;  2EMS A;  1TBE A;  1WE6 A;  1RAX A;  3FEH A;  3ZDT A;  2HTH A;  4K7W A;  1H8C A;  3I3T B;  2D11 A;  1FB8 A;  3ZRF A;  4EOY A;  3CMM B;  2AL6 A;  2Z0Q A;  4HDQ A;  2BPS A;  1DYN A;  2KUP A;  2LVO A;  3PSE B;  2NZ8 B;  3AUL A;  3BY4 B;  2P0F A;  2BWF A;  2AEH A;  5FI0 A;  1RJ2 A;  4KSL C;  4BKT A;  3A98 B;  4W9E A;  1WY8 A;  1UNR A;  4WAA A;  5D3X A;  4W9D A;  3ZW3 A;  1X1M A;  2KTR B;  3A4S C;  1VD2 A;  3PRE A;  1M7R A;  1WX9 A;  3TL5 A;  2HJ8 A;  4NAW A;  4AWJ A;  2I5F A;  2C60 A;  3NZU A;  4JQW C;  5TR5 A;  1V5T A;  2DHK A;  3UQA A;  1OY2 A;  4FHJ A;  5J18 A;  3HM6 X;  3VUX A;  1J0W A;  2DKP A;  3R66 C;  1Y8R C;  5AZG A;  3H6N A;  1WGD A;  1E8X A;  3FSS A;  4JGH B;  4EKU A;  3IVF A;  1E8Y A;  2D10 A;  3A1Q B;  2K39 A;  1WR6 E;  2R0D A;  4F7Z A;  4LJO B;  1E90 A;  3RUI B;  3ULB A;  4ANW A;  3R7Q A;  2K6Q A;  4DHJ D;  5D6J B;  1IYF A;  5J2R A;  1WGQ A;  5KQ4 A;  3APC A;  1W1G A;  1Y5O A;  3N30 A;  1R4M I;  2CY4 A;  2BF8 B;  4K17 A;  2KWU B;  1N3H A;  1H4R A;  2LUL A;  4Z2M B;  1NVL A;  2CQU A;  3GYO A;  3H7P A;  3QK0 A;  1KZG A;  1WF9 A;  1MK7 B;  3DXC A;  1NDD A;  1EVH A;  4HAT B;  2C7M B;  2RGF A;  2KK8 A;  3VH3 B;  2WYQ A;  3OJ3 A;  2I1J A;  1YX6 B;  3BJI A;  1P5T A;  1WXA A;  2ZZP B;  2K00 A;  4IM3 A;  3TMP B;  2RSU A;  4ICU A;  4GGQ A;  3L16 A;  4C0A A;  1UBI A;  3PS6 A;  3PRM B;  2DA0 A;  2PJH A;  3VXW A;  4MGK E;  1V2Y A;  1V49 A;  2FIF A;  2G4D B;  2Z0P A;  4ZDV A;  2KWV B;  1WRD B;  3L10 B;  2LXC A;  4JKB A;  3ODW A;  5JHG A;  2N4F A;  1TJ6 A;  2FDQ A;  5EFX A;  5KCV A;  4JLC A;  2NR2 A;  2CS4 A;  1X1F A;  4KIK A;  1DBH A;  2R82 A;  2L05 A;  4ASW C;  2MCN B;  2EMT A;  3DOW A;  1CMX B;  4JKD A;  3MDB C;  4WWN A;  2KHW B;  3ML8 A;  1WXV A;  2QKL A;  2LKO A;  5IAA C;  2R2Q A;  3H1U A;  2V3S A;  2RLO A;  4BBN C;  1Z87 A;  3DQV A;  1I42 A;  2NS5 A;  3CIK A;  2X0S A;  2PEA A;  2P0D A;  2J59 M;  1EF1 A;  1X86 A;  2KVR A;  3ZNZ B;  3SV1 A;  2KJH B;  2BKF A;  3DPD A;  3TVV A;  1OGW A;  2D9X A;  2FJL A;  3ZLZ A;  3NY5 A;  3CSF A;  1Q5W B;  4IG7 B;  3ALB A;  4N9F 4;  1DIK A;  1FHX A;  4RM8 A;  5DPS A;  2JF5 A;  1WMH A;  5JH5 C;  1V81 A;  3WAO A;  4B9K A;  1WJM A;  2HRJ A;  3PGE A;  2FCN A;  4ILH A;  3NZS A;  2GMI C;  1U2B A;  3TBL D;  4HB4 B;  1P9D U;  2G35 A;  2ZNV B;  3VHT C;  1X11 A;  2MX2 A;  2DTC A;  1WX8 A;  2O2V A;  4A6F A;  1AAR A;  3PPA A;  4BOS C;  1LXD A;  1I7A A;  2N23 A;  4WQO B;  5D3V A;  2LBB A;  4ZYN A;  2W9N A;  5HE2 A;  4HAY B;  2LJ5 A;  2CR5 A;  1UH6 A;  3IBE A;  4DDI D;  2FJ9 A;  4A5K A;  3OAN A;  2ASQ A;  2ZVO A;  1DDM A;  4J6I A;  2KXJ A;  2KJ6 A;  3RUL A;  2BWE S;  3D8D A;  2LRU A;  2DYN A;  4G3X B;  4GDL A;  3LDZ E;  3DBS A;  4XZ4 A;  1X05 A;  2VKI A;  4GDK B;  2A4Z A;  2YF0 A;  2NBW B;  4MSQ B;  2FUH B;  3W1Y A;  3N3K B;  1SHC A;  3A4R A;  3QAR A;  2Y8F A;  2K8C A;  3IG3 A;  4PS3 A;  2ZCC A;  2COA A;  2M38 A;  4LCD E;  3RCP A;  2P8V A;  4TQ0 A;  4E3C A;  4W9K A;  2OOB B;  1I35 A;  2DYO A;  2LXA A;  2Y8G A;  4B6W A;  2KFK B;  1E7V A;  4FLH A;  1GC7 A;  3IFW B;  3T06 A;  3A9J A;  3TO1 A;  2JZZ A;  5CTR C;  1XD3 B;  2KLG A;  4HAW B;  4PS8 A;  3B08 A;  3PRZ A;  1V5O A;  1IP9 A;  1Q0W B;  4EUT A;  4FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...