4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
b'VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/cell adhesion
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
1EF5A 3QBVB 1IPGA 2KWCA 4MEMA 2M0XA 2KQSA 4G50A 2NMBA 2RD0A 4CHJA 3TIXA 3DBSA 4GZUA 5JHHA 2CRFA 2NR2A 3A9JA 3ZNID 2DYOA 3M62B 4MDKE 3X0WA 2RSUA 3IBEA 2M38A 4MGZE 1I2HA 4PQ0A 4EOYA 3HHMA 2O6VB 4HB3B 3ZIMA 2DHIA 2LYDA 2NBUA 1MIZB 3ODXA 2Y5BB 5AZHA 3H1UA 3JW0X 2L0TA 1WR6E 2KJRA 5EDSA 1WG7A 1P5TA 2HJ8A 2DTCA 2IY1B 4NJ7A 1Q0WB 3APFA 4RMAA 1W1DA 3KZ1A 4J6IA 2LI5A 5D94A 3M1IB 2LXCA 1LFDA 3BINA 2R0DA 3A8QA 2DYMA 1E90A 2FIFA 2AL3A 3K9PB 1WJ1A 5C16A 2COCA 4XZ4A 1BTNA 2WWZA 1UD7A 4HCPB 3HW2B 5J18A 3PLVA 3FSSA 4WWOA 4E71A 2GBNA 1Y5OA 5CHVC 3QAQA 5CHWA 4K1RB 1E8XA 3NSUA 3LDZE 4LCDE 4XX5A 3VUXA 2JRHA 4HATB 1WXVA 4HXDA 4K2OA 1K8RB 2DFKA 1MG8A 3VOQA 4FBJB 2IFSA 2GJYA 5L83A 3TJPA 5JH5C 2Z0EB 2NPTB 2R2OA 5L81A 2R09A 2NCNA 1W1GA 2N9PC 4DX8A 5C79A 4TQ1A 3LJUX 4F7GA 2KKCA 3EHVA 1WE7A 4MH0E 1WMHA 4WQOB 4BBNF 2IO0B 3PVUA 4DHZB 3L16A 3P7ZA 4LJPB 3KY9A 4NAWA 4HHVA 1L7YA 2REXA 1OEYJ 3DVGY 2X18A 4TYZA 2LVPA 4WWNA 4A6HA 4KIKA 4P7IA 2N9EB 4WJNA 2J0JA 1KM7A 3AULA 4W9LA 3DOWA 1M7EA 1UNRA 4IFSA 4H8SA 5C5BB 3VIAA 4BBKA 4PS8A 3PEGA 4HPLB 2GBKA 3WALA 4DDGD 4RM8A 4HAZB 1NDDA 1VD2A 4AJWA 2GBMA 4HAVB 1EGXA 3A33B 2KJHB 4BOSC 1UNPA 2DAJA 4IG7B 2NZ8B 2MFQA 2J0MA 1MIXA 5DCNA 2CAYA 1U2BA 1R4NI 2FCNA 2JT4B 2OQBA 4ICUA 1ZVRA 4DXAB 1GNUA 1WGGA 3ZO5B 3UIOB 3KVFB 3PHXB 1FOEA 4E3CA 5J2RA 4GMXB 2ROVA 4M0WB 2H7DA 2KWVB 3VDZA 2V4LA 4HB0B 3KRWA 1WI0A 3H6NA 3LJ3A 1RJ2A 4KVGB 4LJOB 2M4NA 1MK7B 2WX0A 3EC8A 3K9OB 3QA8A 5GOWB 1RFAA 3MPXA 3PRMB 3ONSA 4K7UA 2GCJA 1BWNA 4FHKA 1B55A 3HK0A 2YS5A 3KW5B 4DK5A 4PS7A 3R7QA 5HE2A 2OJRA 4GMVA 3UIPB 3VTVA 2UZSA 4IC7B 4HAUB 4MSQB 2MW5A 1JRUA 3IG3A 3WYFB 1W1HA 3TFMA 4DWFA 1X05A 3UF8A 3HQCA 2N7DA 3X23A 2LVOA 2L7RA 3GYPA 5D6JB 2BGFA 2KHWB 1WJ6A 1DDWA 3TCAA 1P0RA 3VH3B 2Z0DB 1NU2A 3VH4B 4MGKE 3PLUA 2HD5B 2K8BA 1P9DU 3Q3JA 5HKHA 3AU4A 1WR1A 3PSEB 3ML8A 1ISNA 2NS5A 4II2B 4BVUC 2DN6A 5BO4B 2KCJA 1GJZA 1I7AA 2M8SA 4ANUA 4TKNA 2KUPA 2ELBA 1XCGA 3ODOA 5LONB 2UWQA 4BBNC 1E8ZA 5JHGA 3L0WB 2DX5B 3ZVVA 1Q5WB 1ZW7A 2CS4A 3BJIA 5E6OA 1WZ3A 1NI2A 5KQ4A 5KHOA 3TMPB 3B1LX 4HJKA 2L76A 3PPAA 5DH9B 4WSFA 3C0RB 3ZUNA 1NBFC 1WF9A 3QWMA 1L2NA 5IA7A 5HE1A 2CR5A 2MSED 3A4SC 4LDTB 3CXBB 1XR0B 1X1MA 1WGDA 2AYOB 2IO1B 2GMIC 2KOXA 2UZRA 2BKFA 2K39A 4JLCA 5C1ZA 3QK0A 5JLJB 1PFJA 4FLHA 1VCBA 2K2JA 4GDLA 2KC2A 4MT7A 2D9VA 1NTVA 4Y94A 1UNQA 4ANWA 1P6SA 1WJMA 1V2YA 2KN5A 4JQWC 4TV3A 1TBEA 2IBIB 4EMOA 2P0DA 2K25A 1WE6A 3SNHA 5D27A 2R2QA 2G4DB 4IM3A 2DZJA 2XQNM 3VVWB 1ZC3B 5C23A 3SU8X 3QCAA 1QQGA 4E74A 2KDBA 3TL5A 3NOBA 3M63B 2PE6B 2G4SA 1SGHA 1V5MA 1E7VA 1U5DA 3B0AA 2MBHA 4NJ6A 5DHFB 4HWIB 3WANA 3ECIA 1M7RA 1T0YA 4NNJB 1FXTB 4DHZE 1UZXB 2LULA 5JHBA 3DCGA 2DHKA 1KOTA 3ZW3A 2BWES 4BFRA 2O2VA 4EJNA 4IOYX 2MP2A 2DYNA 4TUUA 2YT1A 1Z5SB 2KMCA 1V61A 2N23A 3ZTDA 2K00A 4WJPA 2J7QB 2DZMA 5KQ1A 4W9KA 2PEAA 2JVCA 1H4RA 1TJ6A 1UPRA 2KX0A 3B08A 4A6FA 4BKGA 2YF0A 5FI0A 3MTNB 3A9JB 2RR9A 4K7SA 1FHOA 2W9NA 4FHJA 1AQCA 2LD9A 2YS1A 3UZTA 3G9WA 1BT0A 4FA6A 2FIDA 4KZ0A 1CMXB 2D4QA 3PG7A 4XC2A 4MK0A 4A5KA 4MGYE 4IUMB 4W9HA 2LGYA 4PNKA 4GOCA 2RSGA 2KFJA 2Z0QA 2LGDA 3VTWA 1WVHA 1WGHA 1TGZB 2D9ZA 2W2XD 1WFYA 2D9YA 4Z2MB 3DXEA 5DPWA 5JZEB 1Z87A 2I5FA 3ZVRA 3O96A 4W9DA 1V5UA 2YSZA 2O6VD 1WXAA 3A1QB 3I3TB 2XEWA 2G35A 3DXDA 1WM3A 1S1QB 3H7SA 4NPNA 2MQJA 3TO1A 2LRUA 3SUZA 1X1FA 1XD4A 4C0AA 1OGWA 5D2MB 5KCVA 2GBRA 2IY0B 3CIKA 2O6VA 4IAPA 2D9XA 1XQQA 4AUQC 2KTRA 2W2WA 2WDTB 4YONA 4WAAA 3NHEB 4KDIC 2E2XA 1DDMA 2LGXA 3HM3A 4HK2A 5EFXA 5G55A 1V88A 1IRSA 4RM9A 3WAPA 3UINB 2D9WA 1WMHB 1SIFA 4MM3A 1IYFA 3CMMB 3ZNGC 4ANXA 4F8CB 3JSVB 1PLSA 3QC8B 4OVUA 2YS3A 1DYNA 2LG1A 4EZJA 1RAXA 4KIKB 2LOXA 3GYOA 2LVQA 4GIVA 3EECA 2BCJA 2EKEC 3KRXA 4KHBB 3APDA 3OAWA 2MBBB 2B3AA 4K2PA 2YRYA 2MX2A 1P3RA 3FM8C 3OLMD 4ZDVA 3BY4B 4NQKE 2K6QA 1P3QU 2PE9A 4A3OA 2VKIA 3AU5A 4F7UP 1FHWA 3DBRI 2MLBA 2K2UA 1HE8A 3GOEA 1OY2A 3DBLI 2ZZPB 2PJHA 3PVWA 4K81A 2KXJA 3PTFC 4CO7A 4WJ7A 2C7MB 2VRRB 5G2NA 2DA0A 4KSKC 5D3VA 5E6PA 3VHTC 2W2XC 3R7RA 5LXIB 2DYBA 1E5WA 4FADA 2GBJA 4GSWA 2NBWB 1KZ7A 1C3TA 1Y8RC 2V1YA 1UELA 2K8CA 3N30A 3TBLD 4ZYNA 3UQAA 3WA0A 5C5BA 4K17A 3PV1A 2QKLA 3AXCA 4KHAA 3PP2A 4FJVB 3ENEA 2LXAA 2XK5A 1BAKA 2I1JA 2BPSA 2KDEB 1H10A 3NY5A 2CHXA 3SO6A 5CTRC 4MJSA 4HAWB 2ADZA 4IM0A 1J8CA 5GMVA 3VUWA 1P1AA 3WAMA 3A98B 3L17A 2BKRB 1YQBA 3MDBC 3L08A 4GN1A 4B95A 1PQSA 3O65B 3P6AA 3RT3B 4Z2NA 3OJ4B 2JP2A 2MDXA 2KNBA 5D7GA 2KFKA 1KZGA 4JIOU 1OQNA 2KQ7A 4DBGA 2FCQA 2BWFA 4IWOA 1J0WA 1MK9B 5CHFA 4W9IA 1EF1A 3KUZA 1EO6A 4ASWC 2V3SA 1I42A 1XT9B 4KV2A 4KAXB 1LW3A 4BKSD 4G11A 3ZNHB 1SHCA 4ZRIA 2LKOA 1WJ4A 4W9CA 2A5UA 2G45B 2N1VA 2HTHA 1AARA 1MPHA 3FEHA 4FN2A 2FCSA 1SE9A 2M17A 3KYCD 2D07B 3H9DA 1LM8B 2CKHB 3ZLZA 4BKSA 1FHXA 3L54A 1MAIA 3ALBA 4KZCA 1Q1OA 4DHJD 4JGHB 3PHWB 1YIWA 2LUEA 5D3XA 1V49A 1UH6A 2C9WB 4CHKA 1QZEA 3PSCA 4ZRKA 2M1MA 1E8WA 3H7PA 4HCNB 1X11A 2Z0PA 3IVFA 4N9F4 2PZ1A 1K5GB 5TR5A 2EJ8A 3QIJA 4NQLB 2KTFA 3RYTA 3V6EB 1ZC4B 3PS6A 2ROZB 1YJ1A 1GG3A 2Q13A 2GS0A 3WIMA 2C7NB 4MGIE 3A9KA 3PGEA 2L0FA 4GDLB 2DENB 3T8MA 3ZDMC 2YVCA 2KWUB 3VQIA 2ZNVC 4GXBA 4PS3A 1XX0A 2DX5A 4AP4C 2KD0A 5LXHA 4MSMB 2KDIA 2AL6A 2D3GA 4GGQA 4PYZA 3JVZX 2FUHB 3OANA 2G3QB 4KSLC 2DZIA 4TQ0A 3WAOA 2Y8GA 4HAXB 2N4FA 1UGMA 3V61A 4IWPA 4W9EA 1UPQA 1GC6A 5DIFB 4HLEA 3SYXA 3ULCA 3EFUA 2KDFB 4NY0A 1V86A 3HM6X 2D2QA 3RZWC 5D3YA 1J19A 4XWXA 2ZPNA 3D8FA 3VUYA 3W1YA 4GDKB 4II3B 2MP2B 3D8EA 1Z2MA 4HPMB 3N32A 2ZPYA 2KVRA 1NTYA 1X86A 4B6HA 3NZUA 4FJZA 1K5DB 2LWPA 1FGZA 3D8DA 3DPDA 2FJLA 4A6FB 3HIZA 2CY5A 2MBQA 3DVNU 1WGRA 4WJOA 2AEHA 2DHZA 3PRPB 4EKUA 1V89A 2JRIB 3ULBA 5HE0A 3KYDD 2H7EA 3U30A 2IO2B 2KGXB 1IP9A 4G3XB 2Z59B 2KX3A 3SDLC 1TTNA 1I35A 3S2AA 2JZZA 2M14A 2OTXA 3PREA 3DXCA 3F5RA 1GUAB 3RD2A 3V6CB 2D11A 4HVBA 3SV1A 3ZKJC 4FJYA 4B6WA 2JUOA 1Y19B 3RUIB 3SD5A 1WGQA 1YD8U 2Y7BA 2KANA 2Y8FA 1WX8A 1RLFA 4CYEA 2I5CA 1C1YB 5HE3A 3DBHI 5J3TA 1XD3B 4FULA 2MWSB 2ZCCA 5IAAC 3NZSA 4KDLB 1GC7A 2WYQA 1OQYA 1TXDA 3QJZA 1FB8A 1M94A 4X57B 1V5PA 3V60A 4HB4B 2YLMA 2DYQA 3NS8A 2IYBA 3V5WA 2KTRB 4W9JA 1OTRB 3PRZA 1ZSQA 3UGBB 4EFOA 4AJYB 5CLQB 1TQZA 1DBHA 5FI1A 1U5FA 1N3HA 1S3SG 2ELAA 2K8HA 1KLVA 3MJWA 3CSTA 4MELA 5DI9B 3Q3FA 4OVVA 3VXWA 2XBBC 3W1SA 3AJ4A 3RULA 1V81A 1DROA 2Z0OA 2CY4A 2RNRB 2LZ6A 4EEWA 3A1QA 2DLWA 2CHZA 5J3QA 2COAA 4L6EA 4IM2A 1WZ0A 3ZRFA 1XKEA 4HDOA 4ZRJA 2BF8B 2LASA 2MKRA 4NAWB 2ZJDA 1LXDA 3ZNZB 2ASQA 2CODA 4WVFB 5C6RA 2OOBB 1E7UA 1XODA 4B9KA 4BKTA 4I6LB 3DVNV 4URKA 5J17A 3MHSD 2MBEA 3KH0A 2P0HA 3R66C 4IW0A 2L3ZA 2J59M 2RLOA 5CLLB 2N9XA 2DAFA 3QX1A 3PZDA 1TZ1A 1PMSA 1BTKA 1X1GA 4W9FA 3VTUA 3V62A 1V5TA 1WJNA 4G0NB 3ZDTA 2EMTA 2JF5A 3JSVA 3QQ8B 2DX1A 2AWTA 2NPTA 4DBBA 1V6EA 2FCMA 3A8PA 3ML4A 3A4RA 1DDVA 1ZGUB 3M95A 5AEKB 4A6KA 4AWJA 3P2BA 4I6NB 2NVUI 2VRWB 1WXSA 3D32A 2JWZA 2XK5B 2CU1A 4MJSB 3DVGX 2RUKB 3ZTCA 5DPRA 3SHQA 2LJ5A 3UQBA 2ZNVB 1F9JA 2KO3A 2ZVOA 4F1SA 3W1SC 4PYUA 2COFA 1WH3A 4GU2A 1WI1A 4D0NB 4DX90 2KFKB 3T06A 2CHWA 2RGNB 3L13A 2DKQA 2PPHA 2MA9B 5L95C 2GCLA 5J3YA 2MWNB 2K6DB 2ZEQA 5E6NA 2JXXA 1A5RA 1WX9A 5AZGA 4I6PA 4NSWA 4WWPA 3QHTA 3RZFA 1WJUA 4GB9A 1P98A 2L05A 2DKPA 3U7DA 2N0YA 3ODWA 2C7HA 4M8NA 1WY8A 2ZCBA 1G6JA 1WRDB 2EC1A 2HTHB 3M3JA 2KLGA 4K7WA 4EUTA 2J0KA 2VSZA 4YL8A 3IFWB 3ZRCA 4M8MA 1AWEA 2BYEA 4EZKA 4CHMA 1ZKHA 1E8YA 3AI5A 5FR6A 2L8JA 3N3KB 3VFKA 2MRPA 1V5OA 5DPTA 1LQBA 4AOFA 3ML9A 4IWQA 1EUVB 3CSFA 3H7PB 5DPSA 4ICVA 1EVHA 4HAYB 1FGYA 2JY6A 2V76A 4DHJB 3F0WA 2FNJB 2MBOA 1U5EA 3DDCB 3OJ3A 1FAOA 3DQVA 1V9JA 4W9GA 2YT0A 2RPQA 5KHQA 4HDQA 2KJ6A 2LRWA 3A9KB 1U5GA 3VAWA 3T9LA 2D10A 3IHPC 2NBVB 1WIAA 1UBIA 2QKMA 3GZNI 2KC1A 1OEYA 3APCA 1U4AA 3PVLA 2BYVE 1WM2A 1MKEA 2IZVB 2P8VA 2QHOA 2IYDB 1YX6B 2UVMA 2I1KA 2DHJA 4A20A 1U29A 3R3MA 2RGFA 3KSYA 4GPTB 2P0FA 2L00B 1R4MI 4KHOA 3RCPA 5D3WA 1H8CA 1V80A 2A4ZA 5JP4A 4HB2B 1RRPB 1U27A 4LDTD 4WJQA 5LLIA 4EZLA 4ANVA 5AZFA 4F7ZA 1WGUA 1WXMA 1YX5B 3TVVA 2EMSA 1UBQA 5DHAB 3QWZB 1Q67A 2KK8A 1ZM0A 1WGYA 2DZKA 2O2VB 3PT2B 2MCNB 2UYZB 4JL9A 2BYFA 3TW1A 3N7CA 2KLCA 2C5LC 3RCZA 2L1CA 4A3PA 2RVBB 4MY6A 3QARA 1OMWA 3CF6E 2KMAA 2KZRA 1UEFA 2N7EA 4DDID 2JZ3B 3KUDB 3KUCB 3L10B 2ZVNA 1WYWB 1KJTA 2N1WA 3U8ZA 4BOZB 2IO3B 2WX1A 1WX7A 4F7HA 5CX3A 4GDKA 2FAZA 1RRBA 2C60A 2LOZA 2JPHA 5LOPB 1QC6A 2L2IA 1KI1B 1J0GA 1D3ZA 2HE7A 3JYUA 1EAZA 1LB1A 2GOWA 2K1FA 5JHAA
chains in the Genus database with same CATH superfamily
1EF5A 5LG4B 2KDMA 3QBVB 1L0VB 1IPGA 2KWCA 2M56B 2R61A 2JX5A 1IBXA 1XEEA 4MEMA 2M0XA 2VZKB 2KQSA 1ZUD2 2IGGA 1I4HA 3AE3B 5AUKA 2OJWA 3P4RB 4G50A 1FMAD 2NMBA 2RD0A 5I2MA 4CHJA 3TIXA 3DBSA 4GZUA 5JHHA 2CRFA 2NR2A 2FBWB 3A9JA 3ZNID 2DYOA 3M62B 1ESFA 2GRIA 4MDKE 5FK9C 3X0WA 1RM6C 2NTSA 1QLBB 2INDC 2RSUA 3IBEA 2M38A 3BIID 4MGZE 1GB1A 1I2HA 4PQ0A 4EOYA 3HHMA 1ET6A 2O6VB 3KQ4A 4HB3B 3ZIMA 2DHIA 2LYDA 2NBUA 3TEWA 1MIZB 3ODXA 2DNFA 2Y5BB 5AZHA 3H1UA 2GI9A 3JW0X 2PLPA 2L0TA 1WR6E 4LNIA 2KJRA 3ZJTA 1JWAD 4H2AA 5EDSA 1WG7A 1P5TA 2D5GA 2PVGC 4Q2JA 2HJ8A 2DTCA 2IY1B 4NJ7A 1Q0WB 3APFA 4RMAA 4BZAA 1W1DA 4JK9A 3KZ1A 4J6IA 2LI5A 5D94A 1L5PA 2Q5WD 4R3DA 1N6ZA 2J42A 1XLQA 4HKQA 3M1IB 2LXCA 1LFDA 3E9SA 4MM3B 3BINA 4WURA 3RNEC 2R0DA 3A8QA 2DYMA 4N6EB 1E90A 2FIFA 2AL3A 4WIPA 1SXTA 2WXLA 3K9PB 1WJ1A 3OHMB 5C16A 2COCA 4XZ4A 5M4YB 5D3DA 1BTNA 2WWZA 1UD7A 4HCPB 3HW2B 4MACA 5J18A 1MPEA 3PLVA 1ST7A 3FSSA 4WWOA 4E71A 2N9LA 3IT6B 1ZDXA 3AH7A 2GBNA 1DOYA 1Y5OA 1L0XB 3QAQA 5CHVC 1AYFA 2XNAC 5CHWA 3ENBA 4K1RB 1E8XA 3NSUA 1ACCA 3IXSA 3LDZE 4LCDE 2R82A 2JU6X 5C2TB 4XX5A 3VUXA 2JRHA 2MJDA 2DLBA 4HATB 3P42A 1ZXHA 3RNBC 3SFDB 1WXVA 2GB1A 3HSAA 4HXDA 3AE9B 3HRDD 4K2OA 1K8RB 3AM9A 2DFKA 1MG8A 3VOQA 4FBJB 2IFSA 1C9FA 2GJYA 5L83A 4L1RA 3TJPA 5JH5C 3CWIA 5I2SA 1VZ7A 2Z0EB 2NPTB 1MI1A 2R2OA 4RGMA 4JX1C 5L81A 4K3BA 2R09A 2NCNA 1W1GA 1OQRA 5FR3A 2N9PC 4YSXB 4DX8A 5C79A 4TQ1A 3LJUX 1UNSA 4F7GA 2KKCA 3CIRB 3EHVA 1WE7A 1GOZA 4MH0E 4RF0A 1WMHA 4WQOB 1K51A 4JKHA 2RQ1A 4BBNF 2L83A 4L2YA 2IO0B 2WLBA 3PVUA 4DHZB 2JYTA 3L16A 4A55A 3P7ZA 3LYYA 4LJPB 3KY9A 3NVWA 4NAWA 4HHVA 1E0ZA 1L7YA 2REXA 1OEYJ 3AV8A 3DVGY 2X18A 4TYZA 2LVPA 4WWNA 4A6HA 4KIKA 4P7IA 2N9EB 4WJNA 2J0JA 4GOUA 1KM7A 5E6JA 2SEBD 1OQQA 2WP9B 3AULA 4W9LA 3DOWA 1M7EA 1UNRA 4IFSA 4H8SA 4UDUC 5C5BB 3R2TA 3VIAA 4BBKA 1BUIC 3E9PA 4PS8A 2BBCA 3ZXVA 2QILA 3PEGA 1GB4A 4HPLB 2GBKA 3AE8B 3WALA 4DDGD 4RM8A 4HAZB 1NDDA 1VD2A 4EE2A 2HRJA 2GBMA 4AJWA 4HAVB 3NUHB 1EGXA 1R4NB 1TS2A 4ITKA 3A33B 1DOXA 3IT4B 2KJHB 4BOSC 1UNPA 2DAJA 3U2SC 4IG7B 4YTMB 2NZ8B 2MFQA 1HTQA 2J0MA 1MIXA 5DCNA 2CAYA 1U2BA 1R4NI 2FCNA 2JT4B 2WDVB 2OQBA 3MP9A 1ZVRA 4DXAB 4ICUA 1GNUA 1WGGA 3ZO5B 2W3RA 2D3AA 3UIOB 3KVFB 3AEDB 3PHXB 1FOEA 4E3CA 2PMVA 2PVOD 4GMXB 5J2RA 2ROVA 4M0WB 4JKGB 4P6VF 2H7DA 2KWVB 1YN3A 5BMHA 1XLOA 3VDZA 4KGRA 4HRSA 2V4LA 1JMLA 4HB0B 3KRWA 1WI0A 3H6NA 4TSSA 1TS4A 3LJ3A 4M00A 1RJ2A 4KVGB 4LJOB 2M4NA 1MK7B 2W3SA 2WX0A 3EC8A 3K9OB 3RFZB 3QA8A 1VBHA 5GOWB 1RFAA 3MPXA 2IGHA 3PRMB 3ONSA 5H92C 4K7UA 4NJCA 2GCJA 1BWNA 4FHKA 1HB6A 1B55A 3HK0A 2YS5A 3KW5B 1VBGA 2GLSA 4DK5A 1LGRA 4PS7A 3R7QA 5HE2A 2OJRA 3ZQ4A 2HTME 4GMVA 2L32A 1KC7A 3UIPB 3VTVA 1VLBA 2E3TA 2UZSA 4IC7B 4HAUB 4MSQB 2MW5A 1JRUA 1KF6B 3IG3A 3WYFB 1N62A 3KWVA 1W1HA 3TFMA 2JSVX 2JZPA 1WWTA 2CJOA 4D2KA 4DWFA 1BXTA 1X05A 3UF8A 3HQCA 2N7DA 3X23A 2LVOA 1SBBB 2L7RA 2JXTA 3BYTB 1N5XA 2UU7A 3GYPA 5D6JB 2BGFA 2KHWB 2IDYA 3BZDB 1WJ6A 1DDWA 3TCAA 1P0RA 3N1XC 4MT5A 4O1NA 3VH3B 2Z0DB 1NU2A 1YNTE 3VH4B 4MGKE 1FXAA 3PLUA 4S0RA 5FKAC 4HSIA 2HD5B 1DIKA 2K8BA 1P9DU 3Q3JA 2X8XX 5HKHA 3AU4A 1WR1A 3PSEB 3ML8A 3VRBB 1JWSD 3GB1A 3GE3C 1ISNA 2Y3AA 2NS5A 3BWUD 1FXIA 4II2B 1XLNA 1WSPA 2WXPA 4BVUC 1V8CA 2DN6A 5BO4B 4ILJA 1KBLA 2GUMA 2KCJA 4YSZB 1GJZA 1I7AA 1KH0A 2M8SA 1V97A 4ANUA 4TKNA 2KUPA 2ELBA 1PGBA 1C78A 4JKFA 4CQNA 1XCGA 1DOIA 3ODOA 5I4DA 3IAS1 5LONB 2UWQA 4BBNC 3Q69A 1E8ZA 5JHGA 3L0WB 2DX5B 3ZVVA 1Q5WB 1ZW7A 2M0AA 4QJ4B 2CS4A 1FM0D 2WDQB 3BJIA 5E6OA 1WZ3A 2FJ9A 1NI2A 5KQ4A 5KHOA 4OSNA 1FEHA 1MI0A 3AEGB 3I5JC 3TMPB 3B1LX 4HJKA 5H8YE 2L76A 3PPAA 1ZDVA 3U12A 3EGRA 1TY0A 5DH9B 4WSFA 3C0RB 1HZ6A 3ZUNA 2M19A 1NBFC 3AEBB 1WF9A 1CK1A 3QWMA 4YXDB 1L2NA 4P16A 5IA7A 1QOFA 5HE1A 2W82A 1FPYA 2CR5A 2MSED 3A4SC 4LDTB 2LHEA 4LNKA 4IKGA 3CXBB 1F2RC 4XDCA 1XR0B 1X1MA 4AQ7A 1WGDA 2AYOB 1YOVB 2IO1B 3KWLA 2GMIC 1D5XC 2KOXA 2UZRA 2BKFA 1YN5A 2K39A 4JLCA 2KWDA 5C1ZA 3QK0A 5JLJB 1MJDA 1PFJA 4FLHA 4M01A 1VCBA 2K2JA 1WRIA 4GDLA 2RPVA 2KC2A 4MT7A 2D9VA 3FILB 4YT0B 1NTVA 1TT5B 1JWUD 4Y94A 1UNQA 4ANWA 1P6SA 1WJMA 1V2YA 2KN5A 4JQWC 3N1ZC 1DYQA 3ZJUA 2QDFA 4TV3A 1UWXA 1TBEA 2IBIB 2FE8A 4EMOA 2P0DA 2K25A 1WE6A 3SNHA 1ZPSA 3Q8CA 5D27A 2R2QA 1SB3C 2G4DB 4IM3A 2DZJA 2XQNM 3VVWB 2DIKA 1ZC3B 2BQQA 5C23A 4NAMA 3H8HA 3SU8X 3QCAA 1QQGA 1FO4A 4E74A 2KDBA 3TL5A 3NOBA 2YT2A 3EUB2 3SBGA 2LGIA 3M63B 2PE6B 3RNFC 1ET9A 2G4SA 3WCQA 1SGHA 1V5MA 1E7VA 1U5DA 3B0AA 4A6QA 2MBHA 2WXKA 4NJ6A 5DHFB 4HWIB 3RI7C 3WANA 3ECIA 4P1BC 1M7RA 3TEYA 3NWAA 1T0YA 4NNJB 1FXTB 3V05A 4DHZE 3BK2A 1UZXB 2LULA 5JHBA 3DCGA 2DHKA 2WNMA 1KOTA 3ZW3A 2BWES 4BFRA 4RNAA 2O2VA 1FRDA 4EJNA 1C77A 4IOYX 1JROA 2MP2A 2DYNA 4TUUA 1IBXB 2YT1A 1CQVA 1Z5SB 2KMCA 5HHDG 4HEA1 1V61A 1SIJA 1FNVA 2N23A 3ZTDA 2K00A 4WJPA 2J7QB 2DZMA 5KQ1A 4W9KA 2PEAA 5EE0A 1I4XA 1HBKA 2JVCA 4HROA 1J7CA 1H4RA 1TJ6A 1UPRA 2KX0A 3B08A 4A6FA 1UGJA 4BKGA 2G1EA 2YF0A 5IO9A 5FI0A 3MTNB 1D5MC 3A9JB 2RR9A 4K7SA 1FHOA 1D5ZC 2W9NA 2WQYB 2WHIA 4FHJA 1AQCA 2INPE 3EPYA 2LD9A 2YS1A 3IAM1 3UZTA 3G9WA 1BT0A 1VZ8A 4FA6A 1NI3A 2FIDA 4QAYA 1QOBA 4KZ0A 1CMXB 2N0SB 2D4QA 3PG7A 4XC2A 3B77A 4YWGG 4MK0A 4A5KA 4MGYE 2Z59A 4IUMB 4W9HA 2LGYA 2MJ3A 1Y56A 4PNKA 4GOCA 2RSGA 2LHDA 2KFJA 2Z0QA 4LNFA 3FLVA 3U7ZA 2AQ2B 2CU3A 2LGDA 3VTWA 4C4VA 1WVHA 1WGHA 2KT7A 1TGZB 1PUTA 1EU4A 2D9ZA 2W2XD 4OZCA 1WFYA 2D9YA 1VDVA 4Z2MB 1SJHD 3DXEA 5DPWA 2INCC 4BAXA 5JZEB 1Z87A 2I5FA 3ZVRA 1HXYD 5BMIA 5D3IB 1F1HA 3W2DA 3O96A 4W9DA 1V5UA 2YSZA 2R2YA 2Z13A 2O6VD 4C00A 1E6EB 1WXAA 3A1QB 1N61A 3I57A 3I3TB 2XEWA 4REZA 5LNK1 3Q2AC 2G35A 3DXDA 1WM3A 3ZYYX 4JK8A 1S1QB 3H7SA 4NPNA 2MQJA 3TO1A 2LRUA 2INNE 3SUZA 2AX5A 1X1FA 1ROEA 1MG4A 1XD4A 4C0AA 4ARIA 1OGWA 5D2MB 5KCVA 2GBRA 2IY0B 3CIKA 2O6VA 2KYWA 4IAPA 4QXAB 2D9XA 3BVZA 1XQQA 4AUQC 1EU3A 2J4XA 2KTRA 2W2WA 1GAQB 1WYGA 2WDTB 4YONA 2KAJA 1L6VA 4WAAA 3NHEB 4KDIC 2E2XA 1DDMA 2LGXA 3HM3A 2K8EA 4HK2A 1TJEA 4YTNB 1CJEA 5EFXA 5G55A 1V88A 3I9V1 1HEZE 1IRSA 1NYRA 4RM9A 4RH6A 4ARCA 3WAPA 3UINB 2D9WA 1WMHB 1SIFA 4MM3A 1IYFA 2V4IB 3PO0A 2KIEA 3CMMB 2QSDA 3ZNGC 4JKBA 4ANXA 3NG0A 3RMKC 4F8CB 3JSVB 1PLSA 5IRSA 3QC8B 4OVUA 3B9JA 2IJ0A 1KLGD 2YS3A 1DYNA 2LG1A 4EZJA 2W55A 1RAXA 4KIKB 2LOXA 3TUOA 3GYOA 2LVQA 4GIVA 3EECA 2BCJA 2EKEC 3KRXA 1GGOA 4KHBB 1T6BX 3APDA 3OAWA 3AE4B 1I4RA 2MBBB 2CB8A 2B3AA 4K2PA 2YRYA 2MX2A 3DHIC 1P3RA 3FM8C 3OLMD 4ZDVA 3BY4B 3AE5B 3DBRB 4NQKE 1JWMD 3DBLB 1T0SC 3MC8A 2K6QA 1P3QU 2PE9A 4A3OA 2VKIA 3AU5A 1TS5A 1KRHA 4F7UP 1TKGA 3ZXRA 4A9AA 5IP4D 1FHWA 2X38A 3AEAB 3DBRI 2MLBA 2K2UA 1HE8A 3GOEA 1OY2A 3DBLI 3C19A 2ZZPB 3FKYA 2PJHA 3PVWA 4K81A 2KXJA 3PTFC 4CO7A 4WJ7A 2C7MB 2VRRB 2BB5A 5G2NA 1YJIA 2DA0A 1T0QC 4ZYSA 1RFKA 4KSKC 5D3VA 5E6PA 3VHTC 4RF1A 4LLGM 2W2XC 3R7RA 5LXIB 2DYBA 1E5WA 4FADA 2WXRA 2GBJA 4GSWA 2IGDA 1ACAA 2NBWB 1KZ7A 3J9CA 5GXGB 1C3TA 1VR9A 1Y8RC 2V1YA 1UELA 2K8CA 3N30A 3TBLD 4XGAB 4ZYNA 2X0SA 2PKOA 3UQAA 2LEKA 3DHGC 3WA0A 1C76A 5C5BA 4HKZE 1TYGB 3U52E 4DXFA 4K17A 3PV1A 4C80A 2QKLA 3AXCA 4KHAA 3PP2A 2N7JA 4FJVB 3ENEA 3NS1A 3FVCA 4M02A 2LXAA 2XK5A 1BAKA 2I1JA 2K49A 5EE1A 2KDEB 2BPSA 1H10A 1XO3A 2TSSA 3NY5A 2CHXA 3SO6A 5CTRC 4MJSA 4HAWB 2ADZA 1FRRA 1TIFA 4IM0A 1J8CA 5GMVA 3VUWA 2WXOA 1F2RI 1P1AA 3WAMA 2ZW0A 3A98B 4JWSC 3L17A 4OW0A 2RDHA 2BKRB 5BYQA 1P7EA 1YQBA 3MDBC 3L08A 4GN1A 4B95A 1PQSA 3O65B 3P6AA 3HVZA 3RT3B 4Z2NA 3OJ4B 2JP2A 5BYRA 2MDXA 1HA5A 3FP5A 2EELA 3AE7B 1CZPA 1NTIA 2KNBA 3HVDA 5D7GA 3E9LA 2AQ1B 2KFKA 1JQ4A 1KZGA 4JIOU 4JKGA 1OQNA 2KQ7A 3LB8C 4DBGA 4ZOHC 1QOGA 1PGAA 4RGTA 2FCQA 3BVMA 2BWFA 4IWOA 2XN9C 1XXGA 3E9OA 2BS3B 1J0WA 1MK9B 5CHFA 2OEDA 4W9IA 1EF1A 3KUZA 1EO6A 4ASWC 2V3SA 1I42A 3Q3NC 2L1AA 1XT9B 1VZ6A 3OWEB 4KV2A 4KAXB 1MHHE 2BTEA 1LW3A 5T8IA 4BKSD 4G11A 3NVVA 3ZNHB 4ZRIA 1SHCA 1XCQL 2LKOA 1WJ4A 1I4GA 2A5UA 4W9CA 3TEZA 2G45B 4OT1A 1TY2A 2N1VA 2HTHA 1AARA 1MPHA 3FEHA 3R2IA 4FN2A 2FCSA 1SE9A 2M17A 3L4PA 3KYCD 2D07B 3H9DA 1LM8B 2CKHB 3ZLZA 4BKSA 1J7BA 1FHXA 3L54A 2PTLA 2BS2B 1MAIA 3ALBA 4KZCA 4YTPB 1Q1OA 4DHJD 4JGHB 3PHWB 1YIWA 2LUEA 1QILA 5D3XA 1B1ZA 2WH5A 1V49A 4HPPA 1UWMA 2YEPB 1UH6A 2C9WB 4XE0A 4CHKA 1QZEA 3PSCA 4ZRKA 2M1MA 3ETRA 1E8WA 4B0MA 4WH4A 3H7PA 3AE1B 4HCNB 1X11A 2WXIA 3AEEB 4JK7A 3IVFA 2Z0PA 4N9F4 2PZ1A 1K5GB 1HZ5A 5TR5A 2EJ8A 3QIJA 4NQLB 2KTFA 3RYTA 2QCZA 3V6EB 1ZC4B 3PS6A 2WXQA 2ROZB 1YJ1A 1SJED 3N9YC 2V0GA 1GG3A 2Q13A 2GS0A 3WIMA 1SE3A 2C7NB 4MGIE 3A9KA 3PGEA 2L0FA 4GDLB 2DENB 3T8MA 3ZDMC 2NBVA 1JDEA 2YVCA 2KWUB 3VQIA 5AUIA 2ZNVC 2QEJC 4GXBA 4PS3A 5MPOA 2LFIA 1XX0A 1M4VA 2DX5A 4AP4C 2KD0A 1N63A 5LXHA 1YJJA 1ZE3D 4MSMB 2FUG1 1ZP0B 1ZOYB 2KDIA 5JVLA 2AL6A 2D3GA 4GGQA 2Z4DA 4PYZA 5G5HA 2WXHA 3Q8AA 2WGSA 3JVZX 2FUHB 1A70A 1FCCC 1YN4A 3OANA 2G3QB 4KSLC 2DZIA 4A90A 1RYJA 4TQ0A 3WAOA 2Y8GA 2QMTA 5IN7A 4HAXB 2N4FA 3P4SB 3E56A 3FAHA 3RN9C 1UGMA 3V61A 4IWPA 4W9EA 1UPQA 1GC6A 5DIFB 3Q8EA 4HLEA 3SYXA 1QT9A 3SEBA 3ULCA 3EFUA 2ON8A 3GS2A 2BS4B 2KDFB 4XYCA 2DBYA 4NY0A 1V86A 3HM6X 2D2QA 3RZWC 1F52A 5D3YA 3DCXA 1J19A 4XWXA 4GNKB 2ZPNA 1WXQA 3MC9A 3D8FA 3P1MA 3VUYA 3W1YA 4GDKB 1L4DB 4II3B 2MP2B 3D8EA 1Z2MA 3BYYB 4HPMB 3N32A 2ZPYA 2KVRA 2N9KA 1NTYA 1X86A 4B6HA 3NZUA 4FJZA 1FD6A 1K5DB 2LWPA 1FGZA 3D8DA 3DPDA 2FJLA 4A6FB 3HIZA 2CY5A 2ZKMX 1T0RC 2MBQA 2WU5B 3DVNU 1GPXA 1FCLA 1WGRA 2BVCA 2I38A 1D6EC 4WJOA 2AEHA 2DHZA 3PRPB 4EKUA 1V89A 4L1BA 1V1OA 3Q3OC 1C79A 4KKJA 2JRIB 3MFGA 3ULBA 5HE0A 1F77A 3KYDD 4ACFA 2H7EA 1IGCA 3U30A 3BK1A 2IO2B 2KGXB 2LJIA 1IP9A 2J52A 4G3XB 2Z59B 2KX3A 4WQMA 3SDLC 1TTNA 1HQRD 4OHJA 1I35A 3S2AA 4C7YA 2JZZA 2M14A 2QJLA 4XWTA 3GP7A 2OTXA 4LK0M 3PREA 3AEFB 3VRAB 3DXCA 4KGTA 4C56C 3F5RA 2K3UA 4ZHPA 1GUAB 2NTTA 3RD2A 1VJKA 1FIQA 3OG5A 3V6CB 2D11A 4HVBA 4JKCA 4HJGE 1FNUA 3SV1A 3ZKJC 1V1PA 1PFDA 4DXGA 2VH2A 4FJYA 2HDEA 3DBHB 3B2FA 4B6WA 2L52A 2VZKD 2WXFA 2JUOA 2Y5CA 4YSYB 1Y19B 3RUIB 3SD5A 1WGQA 1YD8U 2Y7BA 2KANA 3T3OA 2Y8FA 3PZ7A 3MJ5A 4PK1A 3SBTA 1RLFA 1WX8A 4CYEA 2I5CA 1SSNA 1C1YB 5HE3A 3DBHI 1JW9D 5J3TA 1XD3B 4FULA 2MWSB 2ZCCA 5IAAC 1KTKA 3NZSA 3ZJVA 4KDLB 1GC7A 2WYQA 1K50A 1OQYA 3NVYA 1TXDA 3QJZA 1FB8A 1M94A 4X57B 1V5PA 3UI3A 3V60A 1R7SA 5EE3A 1JWBD 3P4PB 4HB4B 2YLMA 2DYQA 3NS8A 2IYBA 1FNWA 3V5WA 2KTRB 4W9JA 1OTRB 3PRZA 1ZSQA 2RMMA 3UGBB 4EFOA 4AJYB 5CLQB 1TQZA 1QF6A 2QIEB 1DBHA 5FI1A 1I4QA 2LMCA 4RFBA 1U5FA 1N3HA 4RCOA 1S3SG 4OZBA 2ELAA 2K8HA 4C7ZA 1KLVA 3MJWA 3HUIA 1F0ZA 1C4AA 2E6XA 3CSTA 2JYEA 2OHFA 4MELA 5DI9B 3Q3FA 4OVVA 3VXWA 3Q3MC 2WDRB 2XBBC 3W1SA 3ABVB 3AJ4A 3RULA 1V81A 3NW8A 1DROA 2KVZA 2Z0OA 2CY4A 2RNRB 2LZ6A 4EEWA 2H89B 3A1QA 2CHZA 1DGJA 2DLWA 5J3QA 1WGKA 2COAA 3RPFC 4WAFA 4L6EA 4IM2A 1XCTL 1WZ0A 2ONQA 4MH8A 3ZRFA 1XKEA 4HDOA 4ZRJA 2BF8B 2LASA 3NZ3A 2MKRA 5BYSA 2KIGA 1L4ZB 4NAWB 4LNOA 1PYWD 4WWMA 2ZJDA 4PT5A 1LXDA 3ZNZB 2ASQA 4JKDA 2CODA 4KGSA 4WVFB 5C6RA 2OOBB 2ACZB 4S17A 2JWUA 2KR0A 1E7UA 1XODA 4B9KA 4BKTA 4I6LB 3DVNV 1JALA 4URKA 2IPKD 5HG2A 1T5XD 1OFFA 1XF5L 5J17A 3MHSD 5IJMA 2MBEA 3KH0A 2P0HA 3R66C 4IW0A 4QJ3B 3AB5A 2L3ZA 2Z8LA 2J59M 2RLOA 5CLLB 2N9XA 1K53A 1YQ3B 2DAFA 3W5VB 1E7PB 1UUPA 1L6UA 4JPSA 3QX1A 3B2GA 3PZDA 1TZ1A 3NJTA 1PMSA 1BTKA 1X1GA 1NENB 4W9FA 5JXVA 2CQUA 3VTUA 3V62A 3VR8B 2RRFA 1NVID 1V5TA 1WJNA 2D3BA 4G0NB 3ZDTA 3RNAC 2EMTA 2JF5A 1EWYC 3JSVA 3QQ8B 3MC0B 2DX1A 2AWTA 1QOAA 4L23A 2NPTA 4DBBA 2SAKA 1V6EA 2D3CA 2FCMA 3A8PA 2JQRB 1AWDA 3T3NA 3ML4A 1HB8A 4N58A 3A4RA 1DDVA 2B76B 1ZGUB 3M95A 3V3XA 4KKIA 5AEKB 4A6KA 2WXGA 3Q8BA 4AWJA 1AN8A 3LXFA 3BVGA 3P2BA 4KHBA 1P7FA 2BW2A 4I6NB 2NVUI 2QC8A 2VRWB 2Z14A 2ICIA 3N1YC 1JCKB 1WXSA 3D32A 1KLUD 2MEKA 2HJ1A 2JWZA 1UF0A 2XK5B 2CU1A 3A58A 4US9A 1J7AA 3TEXA 4MJSB 1EM7A 2VH1A 3PZ8A 2KQ4X 3DVGX 4OVZA 2RUKB 3RNCC 3ZTCA 4IDIA 5DPRA 3SHQA 1T3QA 5IOIA 2LJ5A 3UQBA 3VR9B 2K22A 2ZNVB 5EE9A 1F9JA 1QQRA 2KO3A 2ZVOA 4F1SA 3W1SC 1YMHE 4PYUA 2COFA 3Q14C 1WH3A 2I2YA 1ZXIA 4J3OD 4GU2A 1WI1A 4D0NB 4DX90 2KFKB 3T06A 1SEBD 2CHWA 2RGNB 3L13A 2DKQA 2PPHA 2MA9B 5L95C 2GCLA 4N59A 3TSSA 5J3YA 2MWNB 2K6DB 2ZEQA 5E6NA 2JXXA 1A5RA 1TKEA 1WX9A 2EKIA 5AZGA 4I6PA 5TSSA 1B9RA 4NSWA 2MJEA 4WWPA 3QHTA 3P4QB 3RZFA 1WJUA 4GB9A 1P98A 2L05A 2DKPA 2ZW1A 3DWGC 2W54A 4LTUA 1NYQA 3GE8C 3DHHC 1FFVA 1QKZA 3U7DA 1MVKA 1E10A 3KLSX 2N0YA 4DIXA 4M0WA 3AN1A 3URYA 3ODWA 2C7HA 4M8NA 3E66A 1WY8A 2ZCBA 2K9XA 1G6JA 1WRDB 2EC1A 2HTHB 3M3JA 1EWCA 1PDXA 1HTOA 2KLGA 2MHJA 1MHXA 3AE6B 4K7WA 3U4EG 3MHZA 4EUTA 4ILHA 2J0KA 2VSZA 4YL8A 4JE3B 3IFWB 3ZRCA 4M8MA 1AWEA 2BYEA 4EZKA 4CHMA 3AE2B 1RWSA 1ZKHA 5HI1A 3NRZA 3NWDA 1E8YA 3AI5A 2PW9A 3EA6A 5FR6A 2L8JA 1VRAB 2WXJA 2BB6A 3N3KB 3VFKA 2MRPA 1V5OA 4P1CC 3NVZA 5DPTA 1LQBA 4AOFA 3ML9A 4IWQA 1EUVB 3CSFA 2BYTA 3H7PB 5C3JB 1TKYA 5DPSA 1XLPA 2G9HD 2YEPF 4GLSC 2AQ3B 2BT6A 4ICVA 1EVHA 4HAYB 3W5UB 1FGYA 2JY6A 2V76A 3SFEB 4DHJB 1E9MA 3F0WA 2FNJB 2MBOA 1U5EA 3DDCB 3FC4A 3OJ3A 1FAOA 3DQVA 4XDDA 1V9JA 4TMAB 2V3PA 5IKCM 2KMMA 4W9GA 2YT0A 3GZNB 2RPQA 5KHQA 4HDQA 2KJ6A 2LRWA 3A9KB 1U5GA 3VAWA 4NZLB 1MFWA 3AECB 2V3NA 3T9LA 2D10A 4ILGB 2NBVB 3IHPC 1WIAA 1UBIA 2QKMA 3Q8FA 2MH7A 1SE2A 4LNNA 3R8BA 3GZNI 2Y5PA 2KC1A 1OEYA 3APCA 4US8A 1U4AA 3PVLA 4ZRQA 1AW7A 2BYVE 1WM2A 1MKEA 3AMZA 2ABDA 4D6WA 2IZVB 2P8VA 2K0PA 4OZAA 3RNGC 2QHOA 2IYDB 1YX6B 1R4MB 2UVMA 2CJNA 2I1KA 4USAA 2FJUB 1PGXA 3N20C 2DHJA 4A20A 1U29A 4IOIE 3R3MA 2KN4A 2RGFA 3KSYA 1Q10A 1K52A 2LGSA 2V9HA 4B0EA 1ENFA 4GPTB 2P0FA 2L00B 1R4MI 4KHOA 3RCPA 1KFYB 5D3WA 4CSQA 1H8CA 1N60A 3W9CB 4K3CA 1V80A 4QJ5B 1NEKB 2A4ZA 5JP4A 3Q6BA 2H88B 4HB2B 4ZRPA 1RRPB 1U27A 4LDTD 4WJQA 5LLIA 4EZLA 4ANVA 5AZFA 2PIAA 4F7ZA 1WGUA 1WXMA 1IUEA 1C4CA 5BMGA 2RDGA 1YX5B 3TVVA 2EMSA 1UBQA 5DHAB 3O13A 2WXMA 3QWZB 1L0YB 2J53A 1Q67A 1N5WA 2KK8A 1ZM0A 1IGDA 1WGYA 1STEA 2DZKA 2O2VB 3PT2B 4KX6B 3I63C 4JKEA 2MCNB 2UYZB 4JL9A 2BYFA 2KACA 4RGOS 2KUQA 4A8XC 3TW1A 1TZOA 3N7CA 2KLCA 2C5LC 3FILA 3SR6A 3RCZA 2L1CA 4A3PA 2RVBB 4MY6A 3QARA 1OMWA 1D4BA 3CF6E 2KMAA 4JKAA 2KZRA 4RGNA 1UEFA 2N7EA 5HFYA 4AS1A 4DDID 2JZ3B 2COPA 3KUDB 3KUCB 2WU2B 2K5PA 1JRPA 3L10B 2ZVNA 2WS3B 3EFCA 3NWFA 2RDBC 4FXCA 3P63A 1WYWB 1KJTA 2LUMA 1ZYIA 2N1WA 3U8ZA 1C4PA 4XWWA 3ZGZA 1NVLA 1FFUA 1TS3A 4BOZB 2IO3B 2WX1A 5G5GA 1WX7A 4F7HA 3C8YA 5CX3A 2WXNA 4GDKA 2FAZA 1LO5D 1RRBA 2C60A 2LOZA 1SE4A 2JPHA 5LOPB 1QC6A 1T77A 1YQ4B 1BMLC 1V1PB 4DQOC 2L2IA 3HIEA 4JWUC 1KI1B 1SF0A 2LBBA 1J0GA 1I7HA 1D3ZA 3DWMA 2HE7A 3JYUA 4ZHOA 2NMQA 1EAZA 1LB1A 2FDQA 2DWQA 2GOWA 2K1FA 5JHAA 4C4VB 1I4PA
chains in the Genus database with same CATH topology
1EF5A 3QBVB 1IPGA 2KWCA 4MEMA 2M0XA 2KQSA 4G50A 2NMBA 2RD0A 4CHJA 3TIXA 3DBSA 4GZUA 5JHHA 2CRFA 2NR2A 3A9JA 3ZNID 2DYOA 3M62B 4MDKE 3X0WA 2RSUA 3IBEA 2M38A 4MGZE 1I2HA 4PQ0A 4EOYA 3HHMA 2O6VB 4HB3B 3ZIMA 2DHIA 2LYDA 2NBUA 1MIZB 3ODXA 2Y5BB 5AZHA 3H1UA 3JW0X 2L0TA 1WR6E 2KJRA 5EDSA 1WG7A 1P5TA 2HJ8A 2DTCA 2IY1B 4NJ7A 1Q0WB 3APFA 4RMAA 1W1DA 4JK9A 3KZ1A 4J6IA 2LI5A 5D94A 3M1IB 2LXCA 1LFDA 3BINA 2R0DA 3A8QA 2DYMA 1E90A 2FIFA 2AL3A 3K9PB 1WJ1A 5C16A 2COCA 4XZ4A 1BTNA 2WWZA 1UD7A 4HCPB 3HW2B 5J18A 3PLVA 1ST7A 3FSSA 4WWOA 4E71A 2GBNA 1Y5OA 5CHVC 3QAQA 5CHWA 3ENBA 4K1RB 1E8XA 3NSUA 3LDZE 4LCDE 2R82A 4XX5A 3VUXA 2JRHA 4HATB 1WXVA 4HXDA 4K2OA 1K8RB 2DFKA 1MG8A 3VOQA 4FBJB 2IFSA 2GJYA 5L83A 3TJPA 5JH5C 2Z0EB 2NPTB 2R2OA 5L81A 2R09A 2NCNA 1W1GA 2N9PC 4DX8A 5C79A 4TQ1A 3LJUX 4F7GA 2KKCA 3EHVA 1WE7A 4MH0E 1WMHA 4WQOB 4JKHA 2RQ1A 4BBNF 2IO0B 3PVUA 4DHZB 3L16A 3P7ZA 4LJPB 3KY9A 4NAWA 4HHVA 1L7YA 2REXA 1OEYJ 3DVGY 2X18A 4TYZA 2LVPA 4WWNA 4A6HA 4KIKA 4P7IA 2N9EB 4WJNA 2J0JA 1KM7A 3AULA 4W9LA 3DOWA 1M7EA 1UNRA 4IFSA 4H8SA 5C5BB 3VIAA 4BBKA 3E9PA 4PS8A 3PEGA 4HPLB 2GBKA 3WALA 4DDGD 4RM8A 4HAZB 1NDDA 1VD2A 2HRJA 2GBMA 4AJWA 4HAVB 1EGXA 3A33B 2KJHB 4BOSC 1UNPA 2DAJA 4IG7B 2NZ8B 2MFQA 2J0MA 1MIXA 5DCNA 2CAYA 1U2BA 1R4NI 2FCNA 2JT4B 2OQBA 4ICUA 1ZVRA 4DXAB 1GNUA 1WGGA 3ZO5B 3UIOB 3KVFB 3PHXB 1FOEA 4E3CA 5J2RA 4GMXB 2ROVA 4M0WB 4JKGB 2H7DA 2KWVB 3VDZA 2V4LA 4HB0B 3KRWA 1WI0A 3H6NA 3LJ3A 1RJ2A 4KVGB 4LJOB 2M4NA 1MK7B 2WX0A 3EC8A 3K9OB 3QA8A 1VBHA 5GOWB 1RFAA 3MPXA 3PRMB 3ONSA 4K7UA 2GCJA 1BWNA 4FHKA 1HB6A 1B55A 3HK0A 2YS5A 3KW5B 1VBGA 4DK5A 4PS7A 3R7QA 5HE2A 2OJRA 4GMVA 1KC7A 3UIPB 3VTVA 2UZSA 4IC7B 4HAUB 4MSQB 2MW5A 1JRUA 3IG3A 3WYFB 1W1HA 3TFMA 4DWFA 1X05A 3UF8A 3HQCA 2N7DA 3X23A 2LVOA 2L7RA 3GYPA 5D6JB 2BGFA 2KHWB 1WJ6A 1DDWA 3TCAA 1P0RA 3VH3B 2Z0DB 1NU2A 3VH4B 4MGKE 3PLUA 2HD5B 1DIKA 2K8BA 1P9DU 3Q3JA 5HKHA 3AU4A 1WR1A 3PSEB 3ML8A 1ISNA 2NS5A 4II2B 4BVUC 2DN6A 5BO4B 4ILJA 1KBLA 2KCJA 1GJZA 1I7AA 2M8SA 4ANUA 4TKNA 2KUPA 2ELBA 4JKFA 1XCGA 3ODOA 5LONB 2UWQA 4BBNC 1E8ZA 5JHGA 3L0WB 2DX5B 3ZVVA 1Q5WB 1ZW7A 2CS4A 3BJIA 5E6OA 1WZ3A 2FJ9A 1NI2A 5KQ4A 5KHOA 3TMPB 3B1LX 4HJKA 2L76A 3PPAA 5DH9B 4WSFA 3C0RB 3ZUNA 1NBFC 1WF9A 3QWMA 1L2NA 5IA7A 5HE1A 2CR5A 2MSED 3A4SC 4LDTB 3CXBB 1XR0B 1X1MA 1WGDA 2AYOB 2IO1B 2GMIC 2KOXA 2UZRA 2BKFA 2K39A 4JLCA 5C1ZA 3QK0A 5JLJB 1PFJA 4FLHA 1VCBA 2K2JA 4GDLA 2KC2A 4MT7A 2D9VA 1NTVA 4Y94A 1UNQA 4ANWA 1P6SA 1WJMA 1V2YA 2KN5A 4JQWC 4TV3A 1TBEA 2IBIB 4EMOA 2P0DA 2K25A 1WE6A 3SNHA 5D27A 2R2QA 2G4DB 4IM3A 2DZJA 2XQNM 3VVWB 2DIKA 1ZC3B 5C23A 3SU8X 3QCAA 1QQGA 4E74A 2KDBA 3TL5A 3NOBA 3SBGA 3M63B 2PE6B 2G4SA 1SGHA 1V5MA 1E7VA 1U5DA 3B0AA 2MBHA 4NJ6A 5DHFB 4HWIB 3WANA 3ECIA 1M7RA 1T0YA 4NNJB 1FXTB 4DHZE 1UZXB 2LULA 5JHBA 3DCGA 2DHKA 1KOTA 3ZW3A 2BWES 4BFRA 2O2VA 4EJNA 4IOYX 2MP2A 2DYNA 4TUUA 2YT1A 1Z5SB 2KMCA 1V61A 2N23A 3ZTDA 2K00A 4WJPA 2J7QB 2DZMA 5KQ1A 4W9KA 2PEAA 1HBKA 2JVCA 1H4RA 1TJ6A 1UPRA 2KX0A 3B08A 4A6FA 4BKGA 2YF0A 5FI0A 3MTNB 3A9JB 2RR9A 4K7SA 1FHOA 2W9NA 4FHJA 1AQCA 3EPYA 2LD9A 2YS1A 3UZTA 3G9WA 1BT0A 4FA6A 2FIDA 4KZ0A 1CMXB 2D4QA 3PG7A 4XC2A 4MK0A 4A5KA 4MGYE 4IUMB 4W9HA 2LGYA 4PNKA 4GOCA 2RSGA 2KFJA 2Z0QA 3FLVA 2LGDA 3VTWA 1WVHA 1WGHA 1TGZB 2D9ZA 2W2XD 1WFYA 2D9YA 4Z2MB 3DXEA 5DPWA 5JZEB 1Z87A 2I5FA 3ZVRA 3O96A 4W9DA 1V5UA 2YSZA 2O6VD 1WXAA 3A1QB 3I3TB 2XEWA 2G35A 3DXDA 1WM3A 4JK8A 1S1QB 3H7SA 4NPNA 2MQJA 3TO1A 2LRUA 3SUZA 1X1FA 1XD4A 4C0AA 1OGWA 5D2MB 5KCVA 2GBRA 2IY0B 3CIKA 2O6VA 4IAPA 2D9XA 1XQQA 4AUQC 2KTRA 2W2WA 2WDTB 4YONA 4WAAA 3NHEB 4KDIC 2E2XA 1DDMA 2LGXA 3HM3A 4HK2A 5EFXA 5G55A 1V88A 1IRSA 4RM9A 3WAPA 3UINB 2D9WA 1WMHB 1SIFA 4MM3A 1IYFA 3CMMB 3ZNGC 4JKBA 4ANXA 4F8CB 3JSVB 1PLSA 3QC8B 4OVUA 2YS3A 1DYNA 2LG1A 4EZJA 1RAXA 4KIKB 2LOXA 3GYOA 2LVQA 4GIVA 3EECA 2BCJA 2EKEC 3KRXA 1GGOA 4KHBB 3APDA 3OAWA 2MBBB 2CB8A 2B3AA 4K2PA 2YRYA 2MX2A 1P3RA 3FM8C 3OLMD 4ZDVA 3BY4B 4NQKE 2K6QA 1P3QU 2PE9A 4A3OA 2VKIA 3AU5A 4F7UP 1FHWA 3DBRI 2MLBA 2K2UA 1HE8A 3GOEA 1OY2A 3DBLI 2ZZPB 2PJHA 3PVWA 4K81A 2KXJA 3PTFC 4CO7A 4WJ7A 2C7MB 2VRRB 5G2NA 2DA0A 4KSKC 5D3VA 5E6PA 3VHTC 2W2XC 3R7RA 5LXIB 2DYBA 1E5WA 4FADA 2GBJA 4GSWA 1ACAA 2NBWB 1KZ7A 1C3TA 1Y8RC 2V1YA 1UELA 2K8CA 3N30A 3TBLD 4ZYNA 2X0SA 3UQAA 3WA0A 5C5BA 4K17A 3PV1A 2QKLA 3AXCA 4KHAA 3PP2A 4FJVB 3ENEA 2LXAA 2XK5A 1BAKA 2I1JA 2BPSA 2KDEB 1H10A 3NY5A 2CHXA 3SO6A 5CTRC 4MJSA 4HAWB 2ADZA 4IM0A 1J8CA 5GMVA 3VUWA 1P1AA 3WAMA 3A98B 3L17A 2BKRB 1YQBA 3MDBC 3L08A 4GN1A 4B95A 1PQSA 3O65B 3P6AA 3RT3B 4Z2NA 3OJ4B 2JP2A 2MDXA 3FP5A 1NTIA 2KNBA 5D7GA 3E9LA 2KFKA 1KZGA 4JIOU 4JKGA 1OQNA 2KQ7A 4DBGA 2FCQA 2BWFA 4IWOA 3E9OA 1J0WA 1MK9B 5CHFA 4W9IA 1EF1A 3KUZA 1EO6A 4ASWC 2V3SA 1I42A 1XT9B 4KV2A 4KAXB 1LW3A 4BKSD 4G11A 3ZNHB 4ZRIA 1SHCA 2LKOA 1WJ4A 4W9CA 2A5UA 2G45B 2N1VA 2HTHA 1AARA 1MPHA 3FEHA 4FN2A 2FCSA 1SE9A 2M17A 3KYCD 2D07B 3H9DA 1LM8B 2CKHB 3ZLZA 4BKSA 1FHXA 3L54A 1MAIA 3ALBA 4KZCA 1Q1OA 4DHJD 4JGHB 3PHWB 1YIWA 2LUEA 5D3XA 2WH5A 1V49A 1UH6A 2C9WB 4CHKA 1QZEA 3PSCA 4ZRKA 2M1MA 1E8WA 3H7PA 4HCNB 1X11A 4JK7A 3IVFA 2Z0PA 4N9F4 2PZ1A 1K5GB 5TR5A 2EJ8A 3QIJA 4NQLB 2KTFA 3RYTA 3V6EB 1ZC4B 3PS6A 2ROZB 1YJ1A 1GG3A 2Q13A 2GS0A 3WIMA 2C7NB 4MGIE 3A9KA 3PGEA 2L0FA 4GDLB 2DENB 3T8MA 3ZDMC 1JDEA 2YVCA 2KWUB 3VQIA 2ZNVC 4GXBA 4PS3A 1XX0A 2DX5A 4AP4C 2KD0A 5LXHA 4MSMB 2KDIA 5JVLA 2AL6A 2D3GA 4GGQA 4PYZA 3JVZX 2FUHB 3OANA 2G3QB 4KSLC 2DZIA 4TQ0A 3WAOA 2Y8GA 4HAXB 2N4FA 1UGMA 3V61A 4IWPA 4W9EA 1UPQA 1GC6A 5DIFB 4HLEA 3SYXA 3ULCA 3EFUA 2KDFB 4NY0A 1V86A 3HM6X 2D2QA 3RZWC 5D3YA 1J19A 4XWXA 2ZPNA 3D8FA 3VUYA 3W1YA 4GDKB 4II3B 2MP2B 3D8EA 1Z2MA 4HPMB 3N32A 2ZPYA 2KVRA 1NTYA 1X86A 4B6HA 3NZUA 4FJZA 1K5DB 2LWPA 1FGZA 3D8DA 3DPDA 2FJLA 4A6FB 3HIZA 2CY5A 2MBQA 3DVNU 1WGRA 4WJOA 2AEHA 2DHZA 3PRPB 4EKUA 1V89A 2JRIB 3ULBA 5HE0A 3KYDD 2H7EA 3U30A 2IO2B 2KGXB 1IP9A 4G3XB 2Z59B 2KX3A 3SDLC 1TTNA 1I35A 3S2AA 2JZZA 2M14A 2OTXA 3PREA 3DXCA 3F5RA 1GUAB 3RD2A 3V6CB 2D11A 4HVBA 4JKCA 3SV1A 3ZKJC 4FJYA 4B6WA 2JUOA 1Y19B 3RUIB 3SD5A 1WGQA 1YD8U 2Y7BA 2KANA 2Y8FA 3SBTA 1RLFA 1WX8A 4CYEA 2I5CA 1C1YB 5HE3A 3DBHI 5J3TA 1XD3B 4FULA 2MWSB 2ZCCA 5IAAC 3NZSA 4KDLB 1GC7A 2WYQA 1OQYA 1TXDA 3QJZA 1FB8A 1M94A 4X57B 1V5PA 3V60A 4HB4B 2YLMA 2DYQA 3NS8A 2IYBA 3V5WA 2KTRB 4W9JA 1OTRB 3PRZA 1ZSQA 3UGBB 4EFOA 4AJYB 5CLQB 1TQZA 1DBHA 5FI1A 1U5FA 1N3HA 1S3SG 2ELAA 2K8HA 1KLVA 3MJWA 3CSTA 4MELA 5DI9B 3Q3FA 4OVVA 3VXWA 2XBBC 3W1SA 3AJ4A 3RULA 1V81A 1DROA 2Z0OA 2CY4A 2RNRB 2LZ6A 4EEWA 3A1QA 2DLWA 2CHZA 5J3QA 2COAA 4L6EA 4IM2A 1WZ0A 3ZRFA 1XKEA 4HDOA 4ZRJA 2BF8B 2LASA 2MKRA 4NAWB 2ZJDA 1LXDA 3ZNZB 2ASQA 4JKDA 2CODA 4WVFB 5C6RA 2OOBB 1E7UA 1XODA 4B9KA 4BKTA 4I6LB 3DVNV 4URKA 5J17A 3MHSD 5IJMA 2MBEA 3KH0A 2P0HA 3R66C 4IW0A 2L3ZA 2J59M 2RLOA 5CLLB 2N9XA 2DAFA 3QX1A 3PZDA 1TZ1A 1PMSA 1BTKA 1X1GA 4W9FA 2CQUA 3VTUA 3V62A 1V5TA 1WJNA 4G0NB 3ZDTA 2EMTA 2JF5A 3JSVA 3QQ8B 2DX1A 2AWTA 2NPTA 4DBBA 1V6EA 2FCMA 3A8PA 3ML4A 1HB8A 3A4RA 1DDVA 1ZGUB 3M95A 5AEKB 4A6KA 4AWJA 3P2BA 4I6NB 2NVUI 2VRWB 1WXSA 3D32A 2JWZA 2XK5B 2CU1A 4MJSB 3DVGX 2RUKB 3ZTCA 5DPRA 3SHQA 2LJ5A 3UQBA 2ZNVB 1F9JA 2KO3A 2ZVOA 4F1SA 3W1SC 4PYUA 2COFA 1WH3A 4GU2A 1WI1A 4D0NB 4DX90 2KFKB 3T06A 2CHWA 2RGNB 3L13A 2DKQA 2PPHA 2MA9B 5L95C 2GCLA 5J3YA 2MWNB 2K6DB 2ZEQA 5E6NA 2JXXA 1A5RA 1WX9A 5AZGA 4I6PA 4NSWA 4WWPA 3QHTA 3RZFA 1WJUA 4GB9A 1P98A 2L05A 2DKPA 3U7DA 2N0YA 3ODWA 2C7HA 4M8NA 3E66A 1WY8A 2ZCBA 1G6JA 1WRDB 2EC1A 2HTHB 3M3JA 2KLGA 4K7WA 4EUTA 4ILHA 2J0KA 2VSZA 4YL8A 3IFWB 3ZRCA 4M8MA 1AWEA 2BYEA 4EZKA 4CHMA 1ZKHA 1E8YA 3AI5A 5FR6A 2L8JA 3N3KB 3VFKA 2MRPA 1V5OA 5DPTA 1LQBA 4AOFA 3ML9A 4IWQA 1EUVB 3CSFA 3H7PB 5DPSA 4ICVA 1EVHA 4HAYB 1FGYA 2JY6A 2V76A 4DHJB 3F0WA 2FNJB 2MBOA 1U5EA 3DDCB 3OJ3A 1FAOA 3DQVA 1V9JA 4W9GA 2YT0A 2RPQA 5KHQA 4HDQA 2KJ6A 2LRWA 3A9KB 1U5GA 3VAWA 3T9LA 2D10A 4ILGB 3IHPC 2NBVB 1WIAA 1UBIA 2QKMA 3GZNI 2KC1A 1OEYA 3APCA 1U4AA 3PVLA 2BYVE 1WM2A 1MKEA 2ABDA 2IZVB 2P8VA 2QHOA 2IYDB 1YX6B 2UVMA 2I1KA 2DHJA 4A20A 1U29A 3R3MA 2RGFA 3KSYA 4GPTB 2P0FA 2L00B 1R4MI 4KHOA 3RCPA 5D3WA 1H8CA 1V80A 2A4ZA 5JP4A 4HB2B 1RRPB 1U27A 4LDTD 4WJQA 5LLIA 4EZLA 4ANVA 5AZFA 4F7ZA 1WGUA 1WXMA 1YX5B 3TVVA 2EMSA 1UBQA 5DHAB 3QWZB 1Q67A 2KK8A 1ZM0A 1WGYA 2DZKA 2O2VB 3PT2B 4JKEA 2MCNB 2UYZB 4JL9A 2BYFA 3TW1A 3N7CA 2KLCA 2C5LC 3RCZA 2L1CA 4A3PA 2RVBB 4MY6A 3QARA 1OMWA 3CF6E 2KMAA 4JKAA 2KZRA 1UEFA 2N7EA 4DDID 2JZ3B 2COPA 3KUDB 3KUCB 3L10B 2ZVNA 1WYWB 1KJTA 2N1WA 3U8ZA 1NVLA 4BOZB 2IO3B 2WX1A 1WX7A 4F7HA 5CX3A 4GDKA 2FAZA 1RRBA 2C60A 2LOZA 2JPHA 5LOPB 1QC6A 2L2IA 1KI1B 2LBBA 1J0GA 1D3ZA 2HE7A 3JYUA 1EAZA 1LB1A 2FDQA 2GOWA 2K1FA 5JHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF5 A;  3QBV B;  1IPG A;  2KWC A;  4MEM A;  2M0X A;  2KQS A;  4G50 A;  2NMB A;  2RD0 A;  4CHJ A;  3TIX A;  3DBS A;  4GZU A;  5JHH A;  2CRF A;  2NR2 A;  3A9J A;  3ZNI D;  2DYO A;  3M62 B;  4MDK E;  3X0W A;  2RSU A;  3IBE A;  2M38 A;  4MGZ E;  1I2H A;  4PQ0 A;  4EOY A;  3HHM A;  2O6V B;  4HB3 B;  3ZIM A;  2DHI A;  2LYD A;  2NBU A;  1MIZ B;  3ODX A;  2Y5B B;  5AZH A;  3H1U A;  3JW0 X;  2L0T A;  1WR6 E;  2KJR A;  5EDS A;  1WG7 A;  1P5T A;  2HJ8 A;  2DTC A;  2IY1 B;  4NJ7 A;  1Q0W B;  3APF A;  4RMA A;  1W1D A;  3KZ1 A;  4J6I A;  2LI5 A;  5D94 A;  3M1I B;  2LXC A;  1LFD A;  3BIN A;  2R0D A;  3A8Q A;  2DYM A;  1E90 A;  2FIF A;  2AL3 A;  3K9P B;  1WJ1 A;  5C16 A;  2COC A;  4XZ4 A;  1BTN A;  2WWZ A;  1UD7 A;  4HCP B;  3HW2 B;  5J18 A;  3PLV A;  3FSS A;  4WWO A;  4E71 A;  2GBN A;  1Y5O A;  5CHV C;  3QAQ A;  5CHW A;  4K1R B;  1E8X A;  3NSU A;  3LDZ E;  4LCD E;  4XX5 A;  3VUX A;  2JRH A;  4HAT B;  1WXV A;  4HXD A;  4K2O A;  1K8R B;  2DFK A;  1MG8 A;  3VOQ A;  4FBJ B;  2IFS A;  2GJY A;  5L83 A;  3TJP A;  5JH5 C;  2Z0E B;  2NPT B;  2R2O A;  5L81 A;  2R09 A;  2NCN A;  1W1G A;  2N9P C;  4DX8 A;  5C79 A;  4TQ1 A;  3LJU X;  4F7G A;  2KKC A;  3EHV A;  1WE7 A;  4MH0 E;  1WMH A;  4WQO B;  4BBN F;  2IO0 B;  3PVU A;  4DHZ B;  3L16 A;  3P7Z A;  4LJP B;  3KY9 A;  4NAW A;  4HHV A;  1L7Y A;  2REX A;  1OEY J;  3DVG Y;  2X18 A;  4TYZ A;  2LVP A;  4WWN A;  4A6H A;  4KIK A;  4P7I A;  2N9E B;  4WJN A;  2J0J A;  1KM7 A;  3AUL A;  4W9L A;  3DOW A;  1M7E A;  1UNR A;  4IFS A;  4H8S A;  5C5B B;  3VIA A;  4BBK A;  4PS8 A;  3PEG A;  4HPL B;  2GBK A;  3WAL A;  4DDG D;  4RM8 A;  4HAZ B;  1NDD A;  1VD2 A;  4AJW A;  2GBM A;  4HAV B;  1EGX A;  3A33 B;  2KJH B;  4BOS C;  1UNP A;  2DAJ A;  4IG7 B;  2NZ8 B;  2MFQ A;  2J0M A;  1MIX A;  5DCN A;  2CAY A;  1U2B A;  1R4N I;  2FCN A;  2JT4 B;  2OQB A;  4ICU A;  1ZVR A;  4DXA B;  1GNU A;  1WGG A;  3ZO5 B;  3UIO B;  3KVF B;  3PHX B;  1FOE A;  4E3C A;  5J2R A;  4GMX B;  2ROV A;  4M0W B;  2H7D A;  2KWV B;  3VDZ A;  2V4L A;  4HB0 B;  3KRW A;  1WI0 A;  3H6N A;  3LJ3 A;  1RJ2 A;  4KVG B;  4LJO B;  2M4N A;  1MK7 B;  2WX0 A;  3EC8 A;  3K9O B;  3QA8 A;  5GOW B;  1RFA A;  3MPX A;  3PRM B;  3ONS A;  4K7U A;  2GCJ A;  1BWN A;  4FHK A;  1B55 A;  3HK0 A;  2YS5 A;  3KW5 B;  4DK5 A;  4PS7 A;  3R7Q A;  5HE2 A;  2OJR A;  4GMV A;  3UIP B;  3VTV A;  2UZS A;  4IC7 B;  4HAU B;  4MSQ B;  2MW5 A;  1JRU A;  3IG3 A;  3WYF B;  1W1H A;  3TFM A;  4DWF A;  1X05 A;  3UF8 A;  3HQC A;  2N7D A;  3X23 A;  2LVO A;  2L7R A;  3GYP A;  5D6J B;  2BGF A;  2KHW B;  1WJ6 A;  1DDW A;  3TCA A;  1P0R A;  3VH3 B;  2Z0D B;  1NU2 A;  3VH4 B;  4MGK E;  3PLU A;  2HD5 B;  2K8B A;  1P9D U;  3Q3J A;  5HKH A;  3AU4 A;  1WR1 A;  3PSE B;  3ML8 A;  1ISN A;  2NS5 A;  4II2 B;  4BVU C;  2DN6 A;  5BO4 B;  2KCJ A;  1GJZ A;  1I7A A;  2M8S A;  4ANU A;  4TKN A;  2KUP A;  2ELB A;  1XCG A;  3ODO A;  5LON B;  2UWQ A;  4BBN C;  1E8Z A;  5JHG A;  3L0W B;  2DX5 B;  3ZVV A;  1Q5W B;  1ZW7 A;  2CS4 A;  3BJI A;  5E6O A;  1WZ3 A;  1NI2 A;  5KQ4 A;  5KHO A;  3TMP B;  3B1L X;  4HJK A;  2L76 A;  3PPA A;  5DH9 B;  4WSF A;  3C0R B;  3ZUN A;  1NBF C;  1WF9 A;  3QWM A;  1L2N A;  5IA7 A;  5HE1 A;  2CR5 A;  2MSE D;  3A4S C;  4LDT B;  3CXB B;  1XR0 B;  1X1M A;  1WGD A;  2AYO B;  2IO1 B;  2GMI C;  2KOX A;  2UZR A;  2BKF A;  2K39 A;  4JLC A;  5C1Z A;  3QK0 A;  5JLJ B;  1PFJ A;  4FLH A;  1VCB A;  2K2J A;  4GDL A;  2KC2 A;  4MT7 A;  2D9V A;  1NTV A;  4Y94 A;  1UNQ A;  4ANW A;  1P6S A;  1WJM A;  1V2Y A;  2KN5 A;  4JQW C;  4TV3 A;  1TBE A;  2IBI B;  4EMO A;  2P0D A;  2K25 A;  1WE6 A;  3SNH A;  5D27 A;  2R2Q A;  2G4D B;  4IM3 A;  2DZJ A;  2XQN M;  3VVW B;  1ZC3 B;  5C23 A;  3SU8 X;  3QCA A;  1QQG A;  4E74 A;  2KDB A;  3TL5 A;  3NOB A;  3M63 B;  2PE6 B;  2G4S A;  1SGH A;  1V5M A;  1E7V A;  1U5D A;  3B0A A;  2MBH A;  4NJ6 A;  5DHF B;  4HWI B;  3WAN A;  3ECI A;  1M7R A;  1T0Y A;  4NNJ B;  1FXT B;  4DHZ E;  1UZX B;  2LUL A;  5JHB A;  3DCG A;  2DHK A;  1KOT A;  3ZW3 A;  2BWE S;  4BFR A;  2O2V A;  4EJN A;  4IOY X;  2MP2 A;  2DYN A;  4TUU A;  2YT1 A;  1Z5S B;  2KMC A;  1V61 A;  2N23 A;  3ZTD A;  2K00 A;  4WJP A;  2J7Q B;  2DZM A;  5KQ1 A;  4W9K A;  2PEA A;  2JVC A;  1H4R A;  1TJ6 A;  1UPR A;  2KX0 A;  3B08 A;  4A6F A;  4BKG A;  2YF0 A;  5FI0 A;  3MTN B;  3A9J B;  2RR9 A;  4K7S A;  1FHO A;  2W9N A;  4FHJ A;  1AQC A;  2LD9 A;  2YS1 A;  3UZT A;  3G9W A;  1BT0 A;  4FA6 A;  2FID A;  4KZ0 A;  1CMX B;  2D4Q A;  3PG7 A;  4XC2 A;  4MK0 A;  4A5K A;  4MGY E;  4IUM B;  4W9H A;  2LGY A;  4PNK A;  4GOC A;  2RSG A;  2KFJ A;  2Z0Q A;  2LGD A;  3VTW A;  1WVH A;  1WGH A;  1TGZ B;  2D9Z A;  2W2X D;  1WFY A;  2D9Y A;  4Z2M B;  3DXE A;  5DPW A;  5JZE B;  1Z87 A;  2I5F A;  3ZVR A;  3O96 A;  4W9D A;  1V5U A;  2YSZ A;  2O6V D;  1WXA A;  3A1Q B;  3I3T B;  2XEW A;  2G35 A;  3DXD A;  1WM3 A;  1S1Q B;  3H7S A;  4NPN A;  2MQJ A;  3TO1 A;  2LRU A;  3SUZ A;  1X1F A;  1XD4 A;  4C0A A;  1OGW A;  5D2M B;  5KCV A;  2GBR A;  2IY0 B;  3CIK A;  2O6V A;  4IAP A;  2D9X A;  1XQQ A;  4AUQ C;  2KTR A;  2W2W A;  2WDT B;  4YON A;  4WAA A;  3NHE B;  4KDI C;  2E2X A;  1DDM A;  2LGX A;  3HM3 A;  4HK2 A;  5EFX A;  5G55 A;  1V88 A;  1IRS A;  4RM9 A;  3WAP A;  3UIN B;  2D9W A;  1WMH B;  1SIF A;  4MM3 A;  1IYF A;  3CMM B;  3ZNG C;  4ANX A;  4F8C B;  3JSV B;  1PLS A;  3QC8 B;  4OVU A;  2YS3 A;  1DYN A;  2LG1 A;  4EZJ A;  1RAX A;  4KIK B;  2LOX A;  3GYO A;  2LVQ A;  4GIV A;  3EEC A;  2BCJ A;  2EKE C;  3KRX A;  4KHB B;  3APD A;  3OAW A;  2MBB B;  2B3A A;  4K2P A;  2YRY A;  2MX2 A;  1P3R A;  3FM8 C;  3OLM D;  4ZDV A;  3BY4 B;  4NQK E;  2K6Q A;  1P3Q U;  2PE9 A;  4A3O A;  2VKI A;  3AU5 A;  4F7U P;  1FHW A;  3DBR I;  2MLB A;  2K2U A;  1HE8 A;  3GOE A;  1OY2 A;  3DBL I;  2ZZP B;  2PJH A;  3PVW A;  4K81 A;  2KXJ A;  3PTF C;  4CO7 A;  4WJ7 A;  2C7M B;  2VRR B;  5G2N A;  2DA0 A;  4KSK C;  5D3V A;  5E6P A;  3VHT C;  2W2X C;  3R7R A;  5LXI B;  2DYB A;  1E5W A;  4FAD A;  2GBJ A;  4GSW A;  2NBW B;  1KZ7 A;  1C3T A;  1Y8R C;  2V1Y A;  1UEL A;  2K8C A;  3N30 A;  3TBL D;  4ZYN A;  3UQA A;  3WA0 A;  5C5B A;  4K17 A;  3PV1 A;  2QKL A;  3AXC A;  4KHA A;  3PP2 A;  4FJV B;  3ENE A;  2LXA A;  2XK5 A;  1BAK A;  2I1J A;  2BPS A;  2KDE B;  1H10 A;  3NY5 A;  2CHX A;  3SO6 A;  5CTR C;  4MJS A;  4HAW B;  2ADZ A;  4IM0 A;  1J8C A;  5GMV A;  3VUW A;  1P1A A;  3WAM A;  3A98 B;  3L17 A;  2BKR B;  1YQB A;  3MDB C;  3L08 A;  4GN1 A;  4B95 A;  1PQS A;  3O65 B;  3P6A A;  3RT3 B;  4Z2N A;  3OJ4 B;  2JP2 A;  2MDX A;  2KNB A;  5D7G A;  2KFK A;  1KZG A;  4JIO U;  1OQN A;  2KQ7 A;  4DBG A;  2FCQ A;  2BWF A;  4IWO A;  1J0W A;  1MK9 B;  5CHF A;  4W9I A;  1EF1 A;  3KUZ A;  1EO6 A;  4ASW C;  2V3S A;  1I42 A;  1XT9 B;  4KV2 A;  4KAX B;  1LW3 A;  4BKS D;  4G11 A;  3ZNH B;  1SHC A;  4ZRI A;  2LKO A;  1WJ4 A;  4W9C A;  2A5U A;  2G45 B;  2N1V A;  2HTH A;  1AAR A;  1MPH A;  3FEH A;  4FN2 A;  2FCS A;  1SE9 A;  2M17 A;  3KYC D;  2D07 B;  3H9D A;  1LM8 B;  2CKH B;  3ZLZ A;  4BKS A;  1FHX A;  3L54 A;  1MAI A;  3ALB A;  4KZC A;  1Q1O A;  4DHJ D;  4JGH B;  3PHW B;  1YIW A;  2LUE A;  5D3X A;  1V49 A;  1UH6 A;  2C9W B;  4CHK A;  1QZE A;  3PSC A;  4ZRK A;  2M1M A;  1E8W A;  3H7P A;  4HCN B;  1X11 A;  2Z0P A;  3IVF A;  4N9F 4;  2PZ1 A;  1K5G B;  5TR5 A;  2EJ8 A;  3QIJ A;  4NQL B;  2KTF A;  3RYT A;  3V6E B;  1ZC4 B;  3PS6 A;  2ROZ B;  1YJ1 A;  1GG3 A;  2Q13 A;  2GS0 A;  3WIM A;  2C7N B;  4MGI E;  3A9K A;  3PGE A;  2L0F A;  4GDL B;  2DEN B;  3T8M A;  3ZDM C;  2YVC A;  2KWU B;  3VQI A;  2ZNV C;  4GXB A;  4PS3 A;  1XX0 A;  2DX5 A;  4AP4 C;  2KD0 A;  5LXH A;  4MSM B;  2KDI A;  2AL6 A;  2D3G A;  4GGQ A;  4PYZ A;  3JVZ X;  2FUH B;  3OAN A;  2G3Q B;  4KSL C;  2DZI A;  4TQ0 A;  3WAO A;  2Y8G A;  4HAX B;  2N4F A;  1UGM A;  3V61 A;  4IWP A;  4W9E A;  1UPQ A;  1GC6 A;  5DIF B;  4HLE A;  3SYX A;  3ULC A;  3EFU A;  2KDF B;  4NY0 A;  1V86 A;  3HM6 X;  2D2Q A;  3RZW C;  5D3Y A;  1J19 A;  4XWX A;  2ZPN A;  3D8F A;  3VUY A;  3W1Y A;  4GDK B;  4II3 B;  2MP2 B;  3D8E A;  1Z2M A;  4HPM B;  3N32 A;  2ZPY A;  2KVR A;  1NTY A;  1X86 A;  4B6H A;  3NZU A;  4FJZ A;  1K5D B;  2LWP A;  1FGZ A;  3D8D A;  3DPD A;  2FJL A;  4A6F B;  3HIZ A;  2CY5 A;  2MBQ A;  3DVN U;  1WGR A;  4WJO A;  2AEH A;  2DHZ A;  3PRP B;  4EKU A;  1V89 A;  2JRI B;  3ULB A;  5HE0 A;  3KYD D;  2H7E A;  3U30 A;  2IO2 B;  2KGX B;  1IP9 A;  4G3X B;  2Z59 B;  2KX3 A;  3SDL C;  1TTN A;  1I35 A;  3S2A A;  2JZZ A;  2M14 A;  2OTX A;  3PRE A;  3DXC A;  3F5R A;  1GUA B;  3RD2 A;  3V6C B;  2D11 A;  4HVB A;  3SV1 A;  3ZKJ C;  4FJY A;  4B6W A;  2JUO A;  1Y19 B;  3RUI B;  3SD5 A;  1WGQ A;  1YD8 U;  2Y7B A;  2KAN A;  2Y8F A;  1WX8 A;  1RLF A;  4CYE A;  2I5C A;  1C1Y B;  5HE3 A;  3DBH I;  5J3T A;  1XD3 B;  4FUL A;  2MWS B;  2ZCC A;  5IAA C;  3NZS A;  4KDL B;  1GC7 A;  2WYQ A;  1OQY A;  1TXD A;  3QJZ A;  1FB8 A;  1M94 A;  4X57 B;  1V5P A;  3V60 A;  4HB4 B;  2YLM A;  2DYQ A;  3NS8 A;  2IYB A;  3V5W A;  2KTR B;  4W9J A;  1OTR B;  3PRZ A;  1ZSQ A;  3UGB B;  4EFO A;  4AJY B;  5CLQ B;  1TQZ A;  1DBH A;  5FI1 A;  1U5F A;  1N3H A;  1S3S G;  2ELA A;  2K8H A;  1KLV A;  3MJW A;  3CST A;  4MEL A;  5DI9 B;  3Q3F A;  4OVV A;  3VXW A;  2XBB C;  3W1S A;  3AJ4 A;  3RUL A;  1V81 A;  1DRO A;  2Z0O A;  2CY4 A;  2RNR B;  2LZ6 A;  4EEW A;  3A1Q A;  2DLW A;  2CHZ A;  5J3Q A;  2COA A;  4L6E A;  4IM2 A;  1WZ0 A;  3ZRF A;  1XKE A;  4HDO A;  4ZRJ A;  2BF8 B;  2LAS A;  2MKR A;  4NAW B;  2ZJD A;  1LXD A;  3ZNZ B;  2ASQ A;  2COD A;  4WVF B;  5C6R A;  2OOB B;  1E7U A;  1XOD A;  4B9K A;  4BKT A;  4I6L B;  3DVN V;  4URK A;  5J17 A;  3MHS D;  2MBE A;  3KH0 A;  2P0H A;  3R66 C;  4IW0 A;  2L3Z A;  2J59 M;  2RLO A;  5CLL B;  2N9X A;  2DAF A;  3QX1 A;  3PZD A;  1TZ1 A;  1PMS A;  1BTK A;  1X1G A;  4W9F A;  3VTU A;  3V62 A;  1V5T A;  1WJN A;  4G0N B;  3ZDT A;  2EMT A;  2JF5 A;  3JSV A;  3QQ8 B;  2DX1 A;  2AWT A;  2NPT A;  4DBB A;  1V6E A;  2FCM A;  3A8P A;  3ML4 A;  3A4R A;  1DDV A;  1ZGU B;  3M95 A;  5AEK B;  4A6K A;  4AWJ A;  3P2B A;  4I6N B;  2NVU I;  2VRW B;  1WXS A;  3D32 A;  2JWZ A;  2XK5 B;  2CU1 A;  4MJS B;  3DVG X;  2RUK B;  3ZTC A;  5DPR A;  3SHQ A;  2LJ5 A;  3UQB A;  2ZNV B;  1F9J A;  2KO3 A;  2ZVO A;  4F1S A;  3W1S C;  4PYU A;  2COF A;  1WH3 A;  4GU2 A;  1WI1 A;  4D0N B;  4DX9 0;  2KFK B;  3T06 A;  2CHW A;  2RGN B;  3L13 A;  2DKQ A;  2PPH A;  2MA9 B;  5L95 C;  2GCL A;  5J3Y A;  2MWN B;  2K6D B;  2ZEQ A;  5E6N A;  2JXX A;  1A5R A;  1WX9 A;  5AZG A;  4I6P A;  4NSW A;  4WWP A;  3QHT A;  3RZF A;  1WJU A;  4GB9 A;  1P98 A;  2L05 A;  2DKP A;  3U7D A;  2N0Y A;  3ODW A;  2C7H A;  4M8N A;  1WY8 A;  2ZCB A;  1G6J A;  1WRD B;  2EC1 A;  2HTH B;  3M3J A;  2KLG A;  4K7W A;  4EUT A;  2J0K A;  2VSZ A;  4YL8 A;  3IFW B;  3ZRC A;  4M8M A;  1AWE A;  2BYE A;  4EZK A;  4CHM A;  1ZKH A;  1E8Y A;  3AI5 A;  5FR6 A;  2L8J A;  3N3K B;  3VFK A;  2MRP A;  1V5O A;  5DPT A;  1LQB A;  4AOF A;  3ML9 A;  4IWQ A;  1EUV B;  3CSF A;  3H7P B;  5DPS A;  4ICV A;  1EVH A;  4HAY B;  1FGY A;  2JY6 A;  2V76 A;  4DHJ B;  3F0W A;  2FNJ B;  2MBO A;  1U5E A;  3DDC B;  3OJ3 A;  1FAO A;  3DQV A;  1V9J A;  4W9G A;  2YT0 A;  2RPQ A;  5KHQ A;  4HDQ A;  2KJ6 A;  2LRW A;  3A9K B;  1U5G A;  3VAW A;  3T9L A;  2D10 A;  3IHP C;  2NBV B;  1WIA A;  1UBI A;  2QKM A;  3GZN I;  2KC1 A;  1OEY A;  3APC A;  1U4A A;  3PVL A;  2BYV E;  1WM2 A;  1MKE A;  2IZV B;  2P8V A;  2QHO A;  2IYD B;  1YX6 B;  2UVM A;  2I1K A;  2DHJ A;  4A20 A;  1U29 A;  3R3M A;  2RGF A;  3KSY A;  4GPT B;  2P0F A;  2L00 B;  1R4M I;  4KHO A;  3RCP A;  5D3W A;  1H8C A;  1V80 A;  2A4Z A;  5JP4 A;  4HB2 B;  1RRP B;  1U27 A;  4LDT D;  4WJQ A;  5LLI A;  4EZL A;  4ANV A;  5AZF A;  4F7Z A;  1WGU A;  1WXM A;  1YX5 B;  3TVV A;  2EMS A;  1UBQ A;  5DHA B;  3QWZ B;  1Q67 A;  2KK8 A;  1ZM0 A;  1WGY A;  2DZK A;  2O2V B;  3PT2 B;  2MCN B;  2UYZ B;  4JL9 A;  2BYF A;  3TW1 A;  3N7C A;  2KLC A;  2C5L C;  3RCZ A;  2L1C A;  4A3P A;  2RVB B;  4MY6 A;  3QAR A;  1OMW A;  3CF6 E;  2KMA A;  2KZR A;  1UEF A;  2N7E A;  4DDI D;  2JZ3 B;  3KUD B;  3KUC B;  3L10 B;  2ZVN A;  1WYW B;  1KJT A;  2N1W A;  3U8Z A;  4BOZ B;  2IO3 B;  2WX1 A;  1WX7 A;  4F7H A;  5CX3 A;  4GDK A;  2FAZ A;  1RRB A;  2C60 A;  2LOZ A;  2JPH A;  5LOP B;  1QC6 A;  2L2I A;  1KI1 B;  1J0G A;  1D3Z A;  2HE7 A;  3JYU A;  1EAZ A;  1LB1 A;  2GOW A;  2K1F A;  5JHA A; 
#chains in the Genus database with same CATH topology
 1EF5 A;  5LG4 B;  2KDM A;  3QBV B;  1L0V B;  1IPG A;  2KWC A;  2M56 B;  2R61 A;  2JX5 A;  1IBX A;  1XEE A;  4MEM A;  2M0X A;  2VZK B;  2KQS A;  1ZUD 2;  2IGG A;  1I4H A;  3AE3 B;  5AUK A;  2OJW A;  3P4R B;  4G50 A;  1FMA D;  2NMB A;  2RD0 A;  5I2M A;  4CHJ A;  3TIX A;  3DBS A;  4GZU A;  5JHH A;  2CRF A;  2NR2 A;  2FBW B;  3A9J A;  3ZNI D;  2DYO A;  3M62 B;  1ESF A;  2GRI A;  4MDK E;  5FK9 C;  3X0W A;  1RM6 C;  2NTS A;  1QLB B;  2IND C;  2RSU A;  3IBE A;  2M38 A;  3BII D;  4MGZ E;  1GB1 A;  1I2H A;  4PQ0 A;  4EOY A;  3HHM A;  1ET6 A;  2O6V B;  3KQ4 A;  4HB3 B;  3ZIM A;  2DHI A;  2LYD A;  2NBU A;  3TEW A;  1MIZ B;  3ODX A;  2DNF A;  2Y5B B;  5AZH A;  3H1U A;  2GI9 A;  3JW0 X;  2PLP A;  2L0T A;  1WR6 E;  4LNI A;  2KJR A;  3ZJT A;  1JWA D;  4H2A A;  5EDS A;  1WG7 A;  1P5T A;  2D5G A;  2PVG C;  4Q2J A;  2HJ8 A;  2DTC A;  2IY1 B;  4NJ7 A;  1Q0W B;  3APF A;  4RMA A;  4BZA A;  1W1D A;  4JK9 A;  3KZ1 A;  4J6I A;  2LI5 A;  5D94 A;  1L5P A;  2Q5W D;  4R3D A;  1N6Z A;  2J42 A;  1XLQ A;  4HKQ A;  3M1I B;  2LXC A;  1LFD A;  3E9S A;  4MM3 B;  3BIN A;  4WUR A;  3RNE C;  2R0D A;  3A8Q A;  2DYM A;  4N6E B;  1E90 A;  2FIF A;  2AL3 A;  4WIP A;  1SXT A;  2WXL A;  3K9P B;  1WJ1 A;  3OHM B;  5C16 A;  2COC A;  4XZ4 A;  5M4Y B;  5D3D A;  1BTN A;  2WWZ A;  1UD7 A;  4HCP B;  3HW2 B;  4MAC A;  5J18 A;  1MPE A;  3PLV A;  1ST7 A;  3FSS A;  4WWO A;  4E71 A;  2N9L A;  3IT6 B;  1ZDX A;  3AH7 A;  2GBN A;  1DOY A;  1Y5O A;  1L0X B;  3QAQ A;  5CHV C;  1AYF A;  2XNA C;  5CHW A;  3ENB A;  4K1R B;  1E8X A;  3NSU A;  1ACC A;  3IXS A;  3LDZ E;  4LCD E;  2R82 A;  2JU6 X;  5C2T B;  4XX5 A;  3VUX A;  2JRH A;  2MJD A;  2DLB A;  4HAT B;  3P42 A;  1ZXH A;  3RNB C;  3SFD B;  1WXV A;  2GB1 A;  3HSA A;  4HXD A;  3AE9 B;  3HRD D;  4K2O A;  1K8R B;  3AM9 A;  2DFK A;  1MG8 A;  3VOQ A;  4FBJ B;  2IFS A;  1C9F A;  2GJY A;  5L83 A;  4L1R A;  3TJP A;  5JH5 C;  3CWI A;  5I2S A;  1VZ7 A;  2Z0E B;  2NPT B;  1MI1 A;  2R2O A;  4RGM A;  4JX1 C;  5L81 A;  4K3B A;  2R09 A;  2NCN A;  1W1G A;  1OQR A;  5FR3 A;  2N9P C;  4YSX B;  4DX8 A;  5C79 A;  4TQ1 A;  3LJU X;  1UNS A;  4F7G A;  2KKC A;  3CIR B;  3EHV A;  1WE7 A;  1GOZ A;  4MH0 E;  4RF0 A;  1WMH A;  4WQO B;  1K51 A;  4JKH A;  2RQ1 A;  4BBN F;  2L83 A;  4L2Y A;  2IO0 B;  2WLB A;  3PVU A;  4DHZ B;  2JYT A;  3L16 A;  4A55 A;  3P7Z A;  3LYY A;  4LJP B;  3KY9 A;  3NVW A;  4NAW A;  4HHV A;  1E0Z A;  1L7Y A;  2REX A;  1OEY J;  3AV8 A;  3DVG Y;  2X18 A;  4TYZ A;  2LVP A;  4WWN A;  4A6H A;  4KIK A;  4P7I A;  2N9E B;  4WJN A;  2J0J A;  4GOU A;  1KM7 A;  5E6J A;  2SEB D;  1OQQ A;  2WP9 B;  3AUL A;  4W9L A;  3DOW A;  1M7E A;  1UNR A;  4IFS A;  4H8S A;  4UDU C;  5C5B B;  3R2T A;  3VIA A;  4BBK A;  1BUI C;  3E9P A;  4PS8 A;  2BBC A;  3ZXV A;  2QIL A;  3PEG A;  1GB4 A;  4HPL B;  2GBK A;  3AE8 B;  3WAL A;  4DDG D;  4RM8 A;  4HAZ B;  1NDD A;  1VD2 A;  4EE2 A;  2HRJ A;  2GBM A;  4AJW A;  4HAV B;  3NUH B;  1EGX A;  1R4N B;  1TS2 A;  4ITK A;  3A33 B;  1DOX A;  3IT4 B;  2KJH B;  4BOS C;  1UNP A;  2DAJ A;  3U2S C;  4IG7 B;  4YTM B;  2NZ8 B;  2MFQ A;  1HTQ A;  2J0M A;  1MIX A;  5DCN A;  2CAY A;  1U2B A;  1R4N I;  2FCN A;  2JT4 B;  2WDV B;  2OQB A;  3MP9 A;  1ZVR A;  4DXA B;  4ICU A;  1GNU A;  1WGG A;  3ZO5 B;  2W3R A;  2D3A A;  3UIO B;  3KVF B;  3AED B;  3PHX B;  1FOE A;  4E3C A;  2PMV A;  2PVO D;  4GMX B;  5J2R A;  2ROV A;  4M0W B;  4JKG B;  4P6V F;  2H7D A;  2KWV B;  1YN3 A;  5BMH A;  1XLO A;  3VDZ A;  4KGR A;  4HRS A;  2V4L A;  1JML A;  4HB0 B;  3KRW A;  1WI0 A;  3H6N A;  4TSS A;  1TS4 A;  3LJ3 A;  4M00 A;  1RJ2 A;  4KVG B;  4LJO B;  2M4N A;  1MK7 B;  2W3S A;  2WX0 A;  3EC8 A;  3K9O B;  3RFZ B;  3QA8 A;  1VBH A;  5GOW B;  1RFA A;  3MPX A;  2IGH A;  3PRM B;  3ONS A;  5H92 C;  4K7U A;  4NJC A;  2GCJ A;  1BWN A;  4FHK A;  1HB6 A;  1B55 A;  3HK0 A;  2YS5 A;  3KW5 B;  1VBG A;  2GLS A;  4DK5 A;  1LGR A;  4PS7 A;  3R7Q A;  5HE2 A;  2OJR A;  3ZQ4 A;  2HTM E;  4GMV A;  2L32 A;  1KC7 A;  3UIP B;  3VTV A;  1VLB A;  2E3T A;  2UZS A;  4IC7 B;  4HAU B;  4MSQ B;  2MW5 A;  1JRU A;  1KF6 B;  3IG3 A;  3WYF B;  1N62 A;  3KWV A;  1W1H A;  3TFM A;  2JSV X;  2JZP A;  1WWT A;  2CJO A;  4D2K A;  4DWF A;  1BXT A;  1X05 A;  3UF8 A;  3HQC A;  2N7D A;  3X23 A;  2LVO A;  1SBB B;  2L7R A;  2JXT A;  3BYT B;  1N5X A;  2UU7 A;  3GYP A;  5D6J B;  2BGF A;  2KHW B;  2IDY A;  3BZD B;  1WJ6 A;  1DDW A;  3TCA A;  1P0R A;  3N1X C;  4MT5 A;  4O1N A;  3VH3 B;  2Z0D B;  1NU2 A;  1YNT E;  3VH4 B;  4MGK E;  1FXA A;  3PLU A;  4S0R A;  5FKA C;  4HSI A;  2HD5 B;  1DIK A;  2K8B A;  1P9D U;  3Q3J A;  2X8X X;  5HKH A;  3AU4 A;  1WR1 A;  3PSE B;  3ML8 A;  3VRB B;  1JWS D;  3GB1 A;  3GE3 C;  1ISN A;  2Y3A A;  2NS5 A;  3BWU D;  1FXI A;  4II2 B;  1XLN A;  1WSP A;  2WXP A;  4BVU C;  1V8C A;  2DN6 A;  5BO4 B;  4ILJ A;  1KBL A;  2GUM A;  2KCJ A;  4YSZ B;  1GJZ A;  1I7A A;  1KH0 A;  2M8S A;  1V97 A;  4ANU A;  4TKN A;  2KUP A;  2ELB A;  1PGB A;  1C78 A;  4JKF A;  4CQN A;  1XCG A;  1DOI A;  3ODO A;  5I4D A;  3IAS 1;  5LON B;  2UWQ A;  4BBN C;  3Q69 A;  1E8Z A;  5JHG A;  3L0W B;  2DX5 B;  3ZVV A;  1Q5W B;  1ZW7 A;  2M0A A;  4QJ4 B;  2CS4 A;  1FM0 D;  2WDQ B;  3BJI A;  5E6O A;  1WZ3 A;  2FJ9 A;  1NI2 A;  5KQ4 A;  5KHO A;  4OSN A;  1FEH A;  1MI0 A;  3AEG B;  3I5J C;  3TMP B;  3B1L X;  4HJK A;  5H8Y E;  2L76 A;  3PPA A;  1ZDV A;  3U12 A;  3EGR A;  1TY0 A;  5DH9 B;  4WSF A;  3C0R B;  1HZ6 A;  3ZUN A;  2M19 A;  1NBF C;  3AEB B;  1WF9 A;  1CK1 A;  3QWM A;  4YXD B;  1L2N A;  4P16 A;  5IA7 A;  1QOF A;  5HE1 A;  2W82 A;  1FPY A;  2CR5 A;  2MSE D;  3A4S C;  4LDT B;  2LHE A;  4LNK A;  4IKG A;  3CXB B;  1F2R C;  4XDC A;  1XR0 B;  1X1M A;  4AQ7 A;  1WGD A;  2AYO B;  1YOV B;  2IO1 B;  3KWL A;  2GMI C;  1D5X C;  2KOX A;  2UZR A;  2BKF A;  1YN5 A;  2K39 A;  4JLC A;  2KWD A;  5C1Z A;  3QK0 A;  5JLJ B;  1MJD A;  1PFJ A;  4FLH A;  4M01 A;  1VCB A;  2K2J A;  1WRI A;  4GDL A;  2RPV A;  2KC2 A;  4MT7 A;  2D9V A;  3FIL B;  4YT0 B;  1NTV A;  1TT5 B;  1JWU D;  4Y94 A;  1UNQ A;  4ANW A;  1P6S A;  1WJM A;  1V2Y A;  2KN5 A;  4JQW C;  3N1Z C;  1DYQ A;  3ZJU A;  2QDF A;  4TV3 A;  1UWX A;  1TBE A;  2IBI B;  2FE8 A;  4EMO A;  2P0D A;  2K25 A;  1WE6 A;  3SNH A;  1ZPS A;  3Q8C A;  5D27 A;  2R2Q A;  1SB3 C;  2G4D B;  4IM3 A;  2DZJ A;  2XQN M;  3VVW B;  2DIK A;  1ZC3 B;  2BQQ A;  5C23 A;  4NAM A;  3H8H A;  3SU8 X;  3QCA A;  1QQG A;  1FO4 A;  4E74 A;  2KDB A;  3TL5 A;  3NOB A;  2YT2 A;  3EUB 2;  3SBG A;  2LGI A;  3M63 B;  2PE6 B;  3RNF C;  1ET9 A;  2G4S A;  3WCQ A;  1SGH A;  1V5M A;  1E7V A;  1U5D A;  3B0A A;  4A6Q A;  2MBH A;  2WXK A;  4NJ6 A;  5DHF B;  4HWI B;  3RI7 C;  3WAN A;  3ECI A;  4P1B C;  1M7R A;  3TEY A;  3NWA A;  1T0Y A;  4NNJ B;  1FXT B;  3V05 A;  4DHZ E;  3BK2 A;  1UZX B;  2LUL A;  5JHB A;  3DCG A;  2DHK A;  2WNM A;  1KOT A;  3ZW3 A;  2BWE S;  4BFR A;  4RNA A;  2O2V A;  1FRD A;  4EJN A;  1C77 A;  4IOY X;  1JRO A;  2MP2 A;  2DYN A;  4TUU A;  1IBX B;  2YT1 A;  1CQV A;  1Z5S B;  2KMC A;  5HHD G;  4HEA 1;  1V61 A;  1SIJ A;  1FNV A;  2N23 A;  3ZTD A;  2K00 A;  4WJP A;  2J7Q B;  2DZM A;  5KQ1 A;  4W9K A;  2PEA A;  5EE0 A;  1I4X A;  1HBK A;  2JVC A;  4HRO A;  1J7C A;  1H4R A;  1TJ6 A;  1UPR A;  2KX0 A;  3B08 A;  4A6F A;  1UGJ A;  4BKG A;  2G1E A;  2YF0 A;  5IO9 A;  5FI0 A;  3MTN B;  1D5M C;  3A9J B;  2RR9 A;  4K7S A;  1FHO A;  1D5Z C;  2W9N A;  2WQY B;  2WHI A;  4FHJ A;  1AQC A;  2INP E;  3EPY A;  2LD9 A;  2YS1 A;  3IAM 1;  3UZT A;  3G9W A;  1BT0 A;  1VZ8 A;  4FA6 A;  1NI3 A;  2FID A;  4QAY A;  1QOB A;  4KZ0 A;  1CMX B;  2N0S B;  2D4Q A;  3PG7 A;  4XC2 A;  3B77 A;  4YWG G;  4MK0 A;  4A5K A;  4MGY E;  2Z59 A;  4IUM B;  4W9H A;  2LGY A;  2MJ3 A;  1Y56 A;  4PNK A;  4GOC A;  2RSG A;  2LHD A;  2KFJ A;  2Z0Q A;  4LNF A;  3FLV A;  3U7Z A;  2AQ2 B;  2CU3 A;  2LGD A;  3VTW A;  4C4V A;  1WVH A;  1WGH A;  2KT7 A;  1TGZ B;  1PUT A;  1EU4 A;  2D9Z A;  2W2X D;  4OZC A;  1WFY A;  2D9Y A;  1VDV A;  4Z2M B;  1SJH D;  3DXE A;  5DPW A;  2INC C;  4BAX A;  5JZE B;  1Z87 A;  2I5F A;  3ZVR A;  1HXY D;  5BMI A;  5D3I B;  1F1H A;  3W2D A;  3O96 A;  4W9D A;  1V5U A;  2YSZ A;  2R2Y A;  2Z13 A;  2O6V D;  4C00 A;  1E6E B;  1WXA A;  3A1Q B;  1N61 A;  3I57 A;  3I3T B;  2XEW A;  4REZ A;  5LNK 1;  3Q2A C;  2G35 A;  3DXD A;  1WM3 A;  3ZYY X;  4JK8 A;  1S1Q B;  3H7S A;  4NPN A;  2MQJ A;  3TO1 A;  2LRU A;  2INN E;  3SUZ A;  2AX5 A;  1X1F A;  1ROE A;  1MG4 A;  1XD4 A;  4C0A A;  4ARI A;  1OGW A;  5D2M B;  5KCV A;  2GBR A;  2IY0 B;  3CIK A;  2O6V A;  2KYW A;  4IAP A;  4QXA B;  2D9X A;  3BVZ A;  1XQQ A;  4AUQ C;  1EU3 A;  2J4X A;  2KTR A;  2W2W A;  1GAQ B;  1WYG A;  2WDT B;  4YON A;  2KAJ A;  1L6V A;  4WAA A;  3NHE B;  4KDI C;  2E2X A;  1DDM A;  2LGX A;  3HM3 A;  2K8E A;  4HK2 A;  1TJE A;  4YTN B;  1CJE A;  5EFX A;  5G55 A;  1V88 A;  3I9V 1;  1HEZ E;  1IRS A;  1NYR A;  4RM9 A;  4RH6 A;  4ARC A;  3WAP A;  3UIN B;  2D9W A;  1WMH B;  1SIF A;  4MM3 A;  1IYF A;  2V4I B;  3PO0 A;  2KIE A;  3CMM B;  2QSD A;  3ZNG C;  4JKB A;  4ANX A;  3NG0 A;  3RMK C;  4F8C B;  3JSV B;  1PLS A;  5IRS A;  3QC8 B;  4OVU A;  3B9J A;  2IJ0 A;  1KLG D;  2YS3 A;  1DYN A;  2LG1 A;  4EZJ A;  2W55 A;  1RAX A;  4KIK B;  2LOX A;  3TUO A;  3GYO A;  2LVQ A;  4GIV A;  3EEC A;  2BCJ A;  2EKE C;  3KRX A;  1GGO A;  4KHB B;  1T6B X;  3APD A;  3OAW A;  3AE4 B;  1I4R A;  2MBB B;  2CB8 A;  2B3A A;  4K2P A;  2YRY A;  2MX2 A;  3DHI C;  1P3R A;  3FM8 C;  3OLM D;  4ZDV A;  3BY4 B;  3AE5 B;  3DBR B;  4NQK E;  1JWM D;  3DBL B;  1T0S C;  3MC8 A;  2K6Q A;  1P3Q U;  2PE9 A;  4A3O A;  2VKI A;  3AU5 A;  1TS5 A;  1KRH A;  4F7U P;  1TKG A;  3ZXR A;  4A9A A;  5IP4 D;  1FHW A;  2X38 A;  3AEA B;  3DBR I;  2MLB A;  2K2U A;  1HE8 A;  3GOE A;  1OY2 A;  3DBL I;  3C19 A;  2ZZP B;  3FKY A;  2PJH A;  3PVW A;  4K81 A;  2KXJ A;  3PTF C;  4CO7 A;  4WJ7 A;  2C7M B;  2VRR B;  2BB5 A;  5G2N A;  1YJI A;  2DA0 A;  1T0Q C;  4ZYS A;  1RFK A;  4KSK C;  5D3V A;  5E6P A;  3VHT C;  4RF1 A;  4LLG M;  2W2X C;  3R7R A;  5LXI B;  2DYB A;  1E5W A;  4FAD A;  2WXR A;  2GBJ A;  4GSW A;  2IGD A;  1ACA A;  2NBW B;  1KZ7 A;  3J9C A;  5GXG B;  1C3T A;  1VR9 A;  1Y8R C;  2V1Y A;  1UEL A;  2K8C A;  3N30 A;  3TBL D;  4XGA B;  4ZYN A;  2X0S A;  2PKO A;  3UQA A;  2LEK A;  3DHG C;  3WA0 A;  1C76 A;  5C5B A;  4HKZ E;  1TYG B;  3U52 E;  4DXF A;  4K17 A;  3PV1 A;  4C80 A;  2QKL A;  3AXC A;  4KHA A;  3PP2 A;  2N7J A;  4FJV B;  3ENE A;  3NS1 A;  3FVC A;  4M02 A;  2LXA A;  2XK5 A;  1BAK A;  2I1J A;  2K49 A;  5EE1 A;  2KDE B;  2BPS A;  1H10 A;  1XO3 A;  2TSS A;  3NY5 A;  2CHX A;  3SO6 A;  5CTR C;  4MJS A;  4HAW B;  2ADZ A;  1FRR A;  1TIF A;  4IM0 A;  1J8C A;  5GMV A;  3VUW A;  2WXO A;  1F2R I;  1P1A A;  3WAM A;  2ZW0 A;  3A98 B;  4JWS C;  3L17 A;  4OW0 A;  2RDH A;  2BKR B;  5BYQ A;  1P7E A;  1YQB A;  3MDB C;  3L08 A;  4GN1 A;  4B95 A;  1PQS A;  3O65 B;  3P6A A;  3HVZ A;  3RT3 B;  4Z2N A;  3OJ4 B;  2JP2 A;  5BYR A;  2MDX A;  1HA5 A;  3FP5 A;  2EEL A;  3AE7 B;  1CZP A;  1NTI A;  2KNB A;  3HVD A;  5D7G A;  3E9L A;  2AQ1 B;  2KFK A;  1JQ4 A;  1KZG A;  4JIO U;  4JKG A;  1OQN A;  2KQ7 A;  3LB8 C;  4DBG A;  4ZOH C;  1QOG A;  1PGA A;  4RGT A;  2FCQ A;  3BVM A;  2BWF A;  4IWO A;  2XN9 C;  1XXG A;  3E9O A;  2BS3 B;  1J0W A;  1MK9 B;  5CHF A;  2OED A;  4W9I A;  1EF1 A;  3KUZ A;  1EO6 A;  4ASW C;  2V3S A;  1I42 A;  3Q3N C;  2L1A A;  1XT9 B;  1VZ6 A;  3OWE B;  4KV2 A;  4KAX B;  1MHH E;  2BTE A;  1LW3 A;  5T8I A;  4BKS D;  4G11 A;  3NVV A;  3ZNH B;  4ZRI A;  1SHC A;  1XCQ L;  2LKO A;  1WJ4 A;  1I4G A;  2A5U A;  4W9C A;  3TEZ A;  2G45 B;  4OT1 A;  1TY2 A;  2N1V A;  2HTH A;  1AAR A;  1MPH A;  3FEH A;  3R2I A;  4FN2 A;  2FCS A;  1SE9 A;  2M17 A;  3L4P A;  3KYC D;  2D07 B;  3H9D A;  1LM8 B;  2CKH B;  3ZLZ A;  4BKS A;  1J7B A;  1FHX A;  3L54 A;  2PTL A;  2BS2 B;  1MAI A;  3ALB A;  4KZC A;  4YTP B;  1Q1O A;  4DHJ D;  4JGH B;  3PHW B;  1YIW A;  2LUE A;  1QIL A;  5D3X A;  1B1Z A;  2WH5 A;  1V49 A;  4HPP A;  1UWM A;  2YEP B;  1UH6 A;  2C9W B;  4XE0 A;  4CHK A;  1QZE A;  3PSC A;  4ZRK A;  2M1M A;  3ETR A;  1E8W A;  4B0M A;  4WH4 A;  3H7P A;  3AE1 B;  4HCN B;  1X11 A;  2WXI A;  3AEE B;  4JK7 A;  3IVF A;  2Z0P A;  4N9F 4;  2PZ1 A;  1K5G B;  1HZ5 A;  5TR5 A;  2EJ8 A;  3QIJ A;  4NQL B;  2KTF A;  3RYT A;  2QCZ A;  3V6E B;  1ZC4 B;  3PS6 A;  2WXQ A;  2ROZ B;  1YJ1 A;  1SJE D;  3N9Y C;  2V0G A;  1GG3 A;  2Q13 A;  2GS0 A;  3WIM A;  1SE3 A;  2C7N B;  4MGI E;  3A9K A;  3PGE A;  2L0F A;  4GDL B;  2DEN B;  3T8M A;  3ZDM C;  2NBV A;  1JDE A;  2YVC A;  2KWU B;  3VQI A;  5AUI A;  2ZNV C;  2QEJ C;  4GXB A;  4PS3 A;  5MPO A;  2LFI A;  1XX0 A;  1M4V A;  2DX5 A;  4AP4 C;  2KD0 A;  1N63 A;  5LXH A;  1YJJ A;  1ZE3 D;  4MSM B;  2FUG 1;  1ZP0 B;  1ZOY B;  2KDI A;  5JVL A;  2AL6 A;  2D3G A;  4GGQ A;  2Z4D A;  4PYZ A;  5G5H A;  2WXH A;  3Q8A A;  2WGS A;  3JVZ X;  2FUH B;  1A70 A;  1FCC C;  1YN4 A;  3OAN A;  2G3Q B;  4KSL C;  2DZI A;  4A90 A;  1RYJ A;  4TQ0 A;  3WAO A;  2Y8G A;  2QMT A;  5IN7 A;  4HAX B;  2N4F A;  3P4S B;  3E56 A;  3FAH A;  3RN9 C;  1UGM A;  3V61 A;  4IWP A;  4W9E A;  1UPQ A;  1GC6 A;  5DIF B;  3Q8E A;  4HLE A;  3SYX A;  1QT9 A;  3SEB A;  3ULC A;  3EFU A;  2ON8 A;  3GS2 A;  2BS4 B;  2KDF B;  4XYC A;  2DBY A;  4NY0 A;  1V86 A;  3HM6 X;  2D2Q A;  3RZW C;  1F52 A;  5D3Y A;  3DCX A;  1J19 A;  4XWX A;  4GNK B;  2ZPN A;  1WXQ A;  3MC9 A;  3D8F A;  3P1M A;  3VUY A;  3W1Y A;  4GDK B;  1L4D B;  4II3 B;  2MP2 B;  3D8E A;  1Z2M A;  3BYY B;  4HPM B;  3N32 A;  2ZPY A;  2KVR A;  2N9K A;  1NTY A;  1X86 A;  4B6H A;  3NZU A;  4FJZ A;  1FD6 A;  1K5D B;  2LWP A;  1FGZ A;  3D8D A;  3DPD A;  2FJL A;  4A6F B;  3HIZ A;  2CY5 A;  2ZKM X;  1T0R C;  2MBQ A;  2WU5 B;  3DVN U;  1GPX A;  1FCL A;  1WGR A;  2BVC A;  2I38 A;  1D6E C;  4WJO A;  2AEH A;  2DHZ A;  3PRP B;  4EKU A;  1V89 A;  4L1B A;  1V1O A;  3Q3O C;  1C79 A;  4KKJ A;  2JRI B;  3MFG A;  3ULB A;  5HE0 A;  1F77 A;  3KYD D;  4ACF A;  2H7E A;  1IGC A;  3U30 A;  3BK1 A;  2IO2 B;  2KGX B;  2LJI A;  1IP9 A;  2J52 A;  4G3X B;  2Z59 B;  2KX3 A;  4WQM A;  3SDL C;  1TTN A;  1HQR D;  4OHJ A;  1I35 A;  3S2A A;  4C7Y A;  2JZZ A;  2M14 A;  2QJL A;  4XWT A;  3GP7 A;  2OTX A;  4LK0 M;  3PRE A;  3AEF B;  3VRA B;  3DXC A;  4KGT A;  4C56 C;  3F5R A;  2K3U A;  4ZHP A;  1GUA B;  2NTT A;  3RD2 A;  1VJK A;  1FIQ A;  3OG5 A;  3V6C B;  2D11 A;  4HVB A;  4JKC A;  4HJG E;  1FNU A;  3SV1 A;  3ZKJ C;  1V1P A;  1PFD A;  4DXG A;  2VH2 A;  4FJY A;  2HDE A;  3DBH B;  3B2F A;  4B6W A;  2L52 A;  2VZK D;  2WXF A;  2JUO A;  2Y5C A;  4YSY B;  1Y19 B;  3RUI B;  3SD5 A;  1WGQ A;  1YD8 U;  2Y7B A;  2KAN A;  3T3O A;  2Y8F A;  3PZ7 A;  3MJ5 A;  4PK1 A;  3SBT A;  1RLF A;  1WX8 A;  4CYE A;  2I5C A;  1SSN A;  1C1Y B;  5HE3 A;  3DBH I;  1JW9 D;  5J3T A;  1XD3 B;  4FUL A;  2MWS B;  2ZCC A;  5IAA C;  1KTK A;  3NZS A;  3ZJV A;  4KDL B;  1GC7 A;  2WYQ A;  1K50 A;  1OQY A;  3NVY A;  1TXD A;  3QJZ A;  1FB8 A;  1M94 A;  4X57 B;  1V5P A;  3UI3 A;  3V60 A;  1R7S A;  5EE3 A;  1JWB D;  3P4P B;  4HB4 B;  2YLM A;  2DYQ A;  3NS8 A;  2IYB A;  1FNW A;  3V5W A;  2KTR B;  4W9J A;  1OTR B;  3PRZ A;  1ZSQ A;  2RMM A;  3UGB B;  4EFO A;  4AJY B;  5CLQ B;  1TQZ A;  1QF6 A;  2QIE B;  1DBH A;  5FI1 A;  1I4Q A;  2LMC A;  4RFB A;  1U5F A;  1N3H A;  4RCO A;  1S3S G;  4OZB A;  2ELA A;  2K8H A;  4C7Z A;  1KLV A;  3MJW A;  3HUI A;  1F0Z A;  1C4A A;  2E6X A;  3CST A;  2JYE A;  2OHF A;  4MEL A;  5DI9 B;  3Q3F A;  4OVV A;  3VXW A;  3Q3M C;  2WDR B;  2XBB C;  3W1S A;  3ABV B;  3AJ4 A;  3RUL A;  1V81 A;  3NW8 A;  1DRO A;  2KVZ A;  2Z0O A;  2CY4 A;  2RNR B;  2LZ6 A;  4EEW A;  2H89 B;  3A1Q A;  2CHZ A;  1DGJ A;  2DLW A;  5J3Q A;  1WGK A;  2COA A;  3RPF C;  4WAF A;  4L6E A;  4IM2 A;  1XCT L;  1WZ0 A;  2ONQ A;  4MH8 A;  3ZRF A;  1XKE A;  4HDO A;  4ZRJ A;  2BF8 B;  2LAS A;  3NZ3 A;  2MKR A;  5BYS A;  2KIG A;  1L4Z B;  4NAW B;  4LNO A;  1PYW D;  4WWM A;  2ZJD A;  4PT5 A;  1LXD A;  3ZNZ B;  2ASQ A;  4JKD A;  2COD A;  4KGS A;  4WVF B;  5C6R A;  2OOB B;  2ACZ B;  4S17 A;  2JWU A;  2KR0 A;  1E7U A;  1XOD A;  4B9K A;  4BKT A;  4I6L B;  3DVN V;  1JAL A;  4URK A;  2IPK D;  5HG2 A;  1T5X D;  1OFF A;  1XF5 L;  5J17 A;  3MHS D;  5IJM A;  2MBE A;  3KH0 A;  2P0H A;  3R66 C;  4IW0 A;  4QJ3 B;  3AB5 A;  2L3Z A;  2Z8L A;  2J59 M;  2RLO A;  5CLL B;  2N9X A;  1K53 A;  1YQ3 B;  2DAF A;  3W5V B;  1E7P B;  1UUP A;  1L6U A;  4JPS A;  3QX1 A;  3B2G A;  3PZD A;  1TZ1 A;  3NJT A;  1PMS A;  1BTK A;  1X1G A;  1NEN B;  4W9F A;  5JXV A;  2CQU A;  3VTU A;  3V62 A;  3VR8 B;  2RRF A;  1NVI D;  1V5T A;  1WJN A;  2D3B A;  4G0N B;  3ZDT A;  3RNA C;  2EMT A;  2JF5 A;  1EWY C;  3JSV A;  3QQ8 B;  3MC0 B;  2DX1 A;  2AWT A;  1QOA A;  4L23 A;  2NPT A;  4DBB A;  2SAK A;  1V6E A;  2D3C A;  2FCM A;  3A8P A;  2JQR B;  1AWD A;  3T3N A;  3ML4 A;  1HB8 A;  4N58 A;  3A4R A;  1DDV A;  2B76 B;  1ZGU B;  3M95 A;  3V3X A;  4KKI A;  5AEK B;  4A6K A;  2WXG A;  3Q8B A;  4AWJ A;  1AN8 A;  3LXF A;  3BVG A;  3P2B A;  4KHB A;  1P7F A;  2BW2 A;  4I6N B;  2NVU I;  2QC8 A;  2VRW B;  2Z14 A;  2ICI A;  3N1Y C;  1JCK B;  1WXS A;  3D32 A;  1KLU D;  2MEK A;  2HJ1 A;  2JWZ A;  1UF0 A;  2XK5 B;  2CU1 A;  3A58 A;  4US9 A;  1J7A A;  3TEX A;  4MJS B;  1EM7 A;  2VH1 A;  3PZ8 A;  2KQ4 X;  3DVG X;  4OVZ A;  2RUK B;  3RNC C;  3ZTC A;  4IDI A;  5DPR A;  3SHQ A;  1T3Q A;  5IOI A;  2LJ5 A;  3UQB A;  3VR9 B;  2K22 A;  2ZNV B;  5EE9 A;  1F9J A;  1QQR A;  2KO3 A;  2ZVO A;  4F1S A;  3W1S C;  1YMH E;  4PYU A;  2COF A;  3Q14 C;  1WH3 A;  2I2Y A;  1ZXI A;  4J3O D;  4GU2 A;  1WI1 A;  4D0N B;  4DX9 0;  2KFK B;  3T06 A;  1SEB D;  2CHW A;  2RGN B;  3L13 A;  2DKQ A;  2PPH A;  2MA9 B;  5L95 C;  2GCL A;  4N59 A;  3TSS A;  5J3Y A;  2MWN B;  2K6D B;  2ZEQ A;  5E6N A;  2JXX A;  1A5R A;  1TKE A;  1WX9 A;  2EKI A;  5AZG A;  4I6P A;  5TSS A;  1B9R A;  4NSW A;  2MJE A;  4WWP A;  3QHT A;  3P4Q B;  3RZF A;  1WJU A;  4GB9 A;  1P98 A;  2L05 A;  2DKP A;  2ZW1 A;  3DWG C;  2W54 A;  4LTU A;  1NYQ A;  3GE8 C;  3DHH C;  1FFV A;  1QKZ A;  3U7D A;  1MVK A;  1E10 A;  3KLS X;  2N0Y A;  4DIX A;  4M0W A;  3AN1 A;  3URY A;  3ODW A;  2C7H A;  4M8N A;  3E66 A;  1WY8 A;  2ZCB A;  2K9X A;  1G6J A;  1WRD B;  2EC1 A;  2HTH B;  3M3J A;  1EWC A;  1PDX A;  1HTO A;  2KLG A;  2MHJ A;  1MHX A;  3AE6 B;  4K7W A;  3U4E G;  3MHZ A;  4EUT A;  4ILH A;  2J0K A;  2VSZ A;  4YL8 A;  4JE3 B;  3IFW B;  3ZRC A;  4M8M A;  1AWE A;  2BYE A;  4EZK A;  4CHM A;  3AE2 B;  1RWS A;  1ZKH A;  5HI1 A;  3NRZ A;  3NWD A;  1E8Y A;  3AI5 A;  2PW9 A;  3EA6 A;  5FR6 A;  2L8J A;  1VRA B;  2WXJ A;  2BB6 A;  3N3K B;  3VFK A;  2MRP A;  1V5O A;  4P1C C;  3NVZ A;  5DPT A;  1LQB A;  4AOF A;  3ML9 A;  4IWQ A;  1EUV B;  3CSF A;  2BYT A;  3H7P B;  5C3J B;  1TKY A;  5DPS A;  1XLP A;  2G9H D;  2YEP F;  4GLS C;  2AQ3 B;  2BT6 A;  4ICV A;  1EVH A;  4HAY B;  3W5U B;  1FGY A;  2JY6 A;  2V76 A;  3SFE B;  4DHJ B;  1E9M A;  3F0W A;  2FNJ B;  2MBO A;  1U5E A;  3DDC B;  3FC4 A;  3OJ3 A;  1FAO A;  3DQV A;  4XDD A;  1V9J A;  4TMA B;  2V3P A;  5IKC M;  2KMM A;  4W9G A;  2YT0 A;  3GZN B;  2RPQ A;  5KHQ A;  4HDQ A;  2KJ6 A;  2LRW A;  3A9K B;  1U5G A;  3VAW A;  4NZL B;  1MFW A;  3AEC B;  2V3N A;  3T9L A;  2D10 A;  4ILG B;  2NBV B;  3IHP C;  1WIA A;  1UBI A;  2QKM A;  3Q8F A;  2MH7 A;  1SE2 A;  4LNN A;  3R8B A;  3GZN I;  2Y5P A;  2KC1 A;  1OEY A;  3APC A;  4US8 A;  1U4A A;  3PVL A;  4ZRQ A;  1AW7 A;  2BYV E;  1WM2 A;  1MKE A;  3AMZ A;  2ABD A;  4D6W A;  2IZV B;  2P8V A;  2K0P A;  4OZA A;  3RNG C;  2QHO A;  2IYD B;  1YX6 B;  1R4M B;  2UVM A;  2CJN A;  2I1K A;  4USA A;  2FJU B;  1PGX A;  3N20 C;  2DHJ A;  4A20 A;  1U29 A;  4IOI E;  3R3M A;  2KN4 A;  2RGF A;  3KSY A;  1Q10 A;  1K52 A;  2LGS A;  2V9H A;  4B0E A;  1ENF A;  4GPT B;  2P0F A;  2L00 B;  1R4M I;  4KHO A;  3RCP A;  1KFY B;  5D3W A;  4CSQ A;  1H8C A;  1N60 A;  3W9C B;  4K3C A;  1V80 A;  4QJ5 B;  1NEK B;  2A4Z A;  5JP4 A;  3Q6B A;  2H88 B;  4HB2 B;  4ZRP A;  1RRP B;  1U27 A;  4LDT D;  4WJQ A;  5LLI A;  4EZL A;  4ANV A;  5AZF A;  2PIA A;  4F7Z A;  1WGU A;  1WXM A;  1IUE A;  1C4C A;  5BMG A;  2RDG A;  1YX5 B;  3TVV A;  2EMS A;  1UBQ A;  5DHA B;  3O13 A;  2WXM A;  3QWZ B;  1L0Y B;  2J53 A;  1Q67 A;  1N5W A;  2KK8 A;  1ZM0 A;  1IGD A;  1WGY A;  1STE A;  2DZK A;  2O2V B;  3PT2 B;  4KX6 B;  3I63 C;  4JKE A;  2MCN B;  2UYZ B;  4JL9 A;  2BYF A;  2KAC A;  4RGO S;  2KUQ A;  4A8X C;  3TW1 A;  1TZO A;  3N7C A;  2KLC A;  2C5L C;  3FIL A;  3SR6 A;  3RCZ A;  2L1C A;  4A3P A;  2RVB B;  4MY6 A;  3QAR A;  1OMW A;  1D4B A;  3CF6 E;  2KMA A;  4JKA A;  2KZR A;  4RGN A;  1UEF A;  2N7E A;  5HFY A;  4AS1 A;  4DDI D;  2JZ3 B;  2COP A;  3KUD B;  3KUC B;  2WU2 B;  2K5P A;  1JRP A;  3L10 B;  2ZVN A;  2WS3 B;  3EFC A;  3NWF A;  2RDB C;  4FXC A;  3P63 A;  1WYW B;  1KJT A;  2LUM A;  1ZYI A;  2N1W A;  3U8Z A;  1C4P A;  4XWW A;  3ZGZ A;  1NVL A;  1FFU A;  1TS3 A;  4BOZ B;  2IO3 B;  2WX1 A;  5G5G A;  1WX7 A;  4F7H A;  3C8Y A;  5CX3 A;  2WXN A;  4GDK A;  2FAZ A;  1LO5 D;  1RRB A;  2C60 A;  2LOZ A;  1SE4 A;  2JPH A;  5LOP B;  1QC6 A;  1T77 A;  1YQ4 B;  1BML C;  1V1P B;  4DQO C;  2L2I A;  3HIE A;  4JWU C;  1KI1 B;  1SF0 A;  2LBB A;  1J0G A;  1I7H A;  1D3Z A;  3DWM A;  2HE7 A;  3JYU A;  4ZHO A;  2NMQ A;  1EAZ A;  1LB1 A;  2FDQ A;  2DWQ A;  2GOW A;  2K1F A;  5JHA A;  4C4V B;  1I4P A; 
#chains in the Genus database with same CATH homology
 1EF5 A;  3QBV B;  1IPG A;  2KWC A;  4MEM A;  2M0X A;  2KQS A;  4G50 A;  2NMB A;  2RD0 A;  4CHJ A;  3TIX A;  3DBS A;  4GZU A;  5JHH A;  2CRF A;  2NR2 A;  3A9J A;  3ZNI D;  2DYO A;  3M62 B;  4MDK E;  3X0W A;  2RSU A;  3IBE A;  2M38 A;  4MGZ E;  1I2H A;  4PQ0 A;  4EOY A;  3HHM A;  2O6V B;  4HB3 B;  3ZIM A;  2DHI A;  2LYD A;  2NBU A;  1MIZ B;  3ODX A;  2Y5B B;  5AZH A;  3H1U A;  3JW0 X;  2L0T A;  1WR6 E;  2KJR A;  5EDS A;  1WG7 A;  1P5T A;  2HJ8 A;  2DTC A;  2IY1 B;  4NJ7 A;  1Q0W B;  3APF A;  4RMA A;  1W1D A;  4JK9 A;  3KZ1 A;  4J6I A;  2LI5 A;  5D94 A;  3M1I B;  2LXC A;  1LFD A;  3BIN A;  2R0D A;  3A8Q A;  2DYM A;  1E90 A;  2FIF A;  2AL3 A;  3K9P B;  1WJ1 A;  5C16 A;  2COC A;  4XZ4 A;  1BTN A;  2WWZ A;  1UD7 A;  4HCP B;  3HW2 B;  5J18 A;  3PLV A;  1ST7 A;  3FSS A;  4WWO A;  4E71 A;  2GBN A;  1Y5O A;  5CHV C;  3QAQ A;  5CHW A;  3ENB A;  4K1R B;  1E8X A;  3NSU A;  3LDZ E;  4LCD E;  2R82 A;  4XX5 A;  3VUX A;  2JRH A;  4HAT B;  1WXV A;  4HXD A;  4K2O A;  1K8R B;  2DFK A;  1MG8 A;  3VOQ A;  4FBJ B;  2IFS A;  2GJY A;  5L83 A;  3TJP A;  5JH5 C;  2Z0E B;  2NPT B;  2R2O A;  5L81 A;  2R09 A;  2NCN A;  1W1G A;  2N9P C;  4DX8 A;  5C79 A;  4TQ1 A;  3LJU X;  4F7G A;  2KKC A;  3EHV A;  1WE7 A;  4MH0 E;  1WMH A;  4WQO B;  4JKH A;  2RQ1 A;  4BBN F;  2IO0 B;  3PVU A;  4DHZ B;  3L16 A;  3P7Z A;  4LJP B;  3KY9 A;  4NAW A;  4HHV A;  1L7Y A;  2REX A;  1OEY J;  3DVG Y;  2X18 A;  4TYZ A;  2LVP A;  4WWN A;  4A6H A;  4KIK A;  4P7I A;  2N9E B;  4WJN A;  2J0J A;  1KM7 A;  3AUL A;  4W9L A;  3DOW A;  1M7E A;  1UNR A;  4IFS A;  4H8S A;  5C5B B;  3VIA A;  4BBK A;  3E9P A;  4PS8 A;  3PEG A;  4HPL B;  2GBK A;  3WAL A;  4DDG D;  4RM8 A;  4HAZ B;  1NDD A;  1VD2 A;  2HRJ A;  2GBM A;  4AJW A;  4HAV B;  1EGX A;  3A33 B;  2KJH B;  4BOS C;  1UNP A;  2DAJ A;  4IG7 B;  2NZ8 B;  2MFQ A;  2J0M A;  1MIX A;  5DCN A;  2CAY A;  1U2B A;  1R4N I;  2FCN A;  2JT4 B;  2OQB A;  4ICU A;  1ZVR A;  4DXA B;  1GNU A;  1WGG A;  3ZO5 B;  3UIO B;  3KVF B;  3PHX B;  1FOE A;  4E3C A;  5J2R A;  4GMX B;  2ROV A;  4M0W B;  4JKG B;  2H7D A;  2KWV B;  3VDZ A;  2V4L A;  4HB0 B;  3KRW A;  1WI0 A;  3H6N A;  3LJ3 A;  1RJ2 A;  4KVG B;  4LJO B;  2M4N A;  1MK7 B;  2WX0 A;  3EC8 A;  3K9O B;  3QA8 A;  1VBH A;  5GOW B;  1RFA A;  3MPX A;  3PRM B;  3ONS A;  4K7U A;  2GCJ A;  1BWN A;  4FHK A;  1HB6 A;  1B55 A;  3HK0 A;  2YS5 A;  3KW5 B;  1VBG A;  4DK5 A;  4PS7 A;  3R7Q A;  5HE2 A;  2OJR A;  4GMV A;  1KC7 A;  3UIP B;  3VTV A;  2UZS A;  4IC7 B;  4HAU B;  4MSQ B;  2MW5 A;  1JRU A;  3IG3 A;  3WYF B;  1W1H A;  3TFM A;  4DWF A;  1X05 A;  3UF8 A;  3HQC A;  2N7D A;  3X23 A;  2LVO A;  2L7R A;  3GYP A;  5D6J B;  2BGF A;  2KHW B;  1WJ6 A;  1DDW A;  3TCA A;  1P0R A;  3VH3 B;  2Z0D B;  1NU2 A;  3VH4 B;  4MGK E;  3PLU A;  2HD5 B;  1DIK A;  2K8B A;  1P9D U;  3Q3J A;  5HKH A;  3AU4 A;  1WR1 A;  3PSE B;  3ML8 A;  1ISN A;  2NS5 A;  4II2 B;  4BVU C;  2DN6 A;  5BO4 B;  4ILJ A;  1KBL A;  2KCJ A;  1GJZ A;  1I7A A;  2M8S A;  4ANU A;  4TKN A;  2KUP A;  2ELB A;  4JKF A;  1XCG A;  3ODO A;  5LON B;  2UWQ A;  4BBN C;  1E8Z A;  5JHG A;  3L0W B;  2DX5 B;  3ZVV A;  1Q5W B;  1ZW7 A;  2CS4 A;  3BJI A;  5E6O A;  1WZ3 A;  2FJ9 A;  1NI2 A;  5KQ4 A;  5KHO A;  3TMP B;  3B1L X;  4HJK A;  2L76 A;  3PPA A;  5DH9 B;  4WSF A;  3C0R B;  3ZUN A;  1NBF C;  1WF9 A;  3QWM A;  1L2N A;  5IA7 A;  5HE1 A;  2CR5 A;  2MSE D;  3A4S C;  4LDT B;  3CXB B;  1XR0 B;  1X1M A;  1WGD A;  2AYO B;  2IO1 B;  2GMI C;  2KOX A;  2UZR A;  2BKF A;  2K39 A;  4JLC A;  5C1Z A;  3QK0 A;  5JLJ B;  1PFJ A;  4FLH A;  1VCB A;  2K2J A;  4GDL A;  2KC2 A;  4MT7 A;  2D9V A;  1NTV A;  4Y94 A;  1UNQ A;  4ANW A;  1P6S A;  1WJM A;  1V2Y A;  2KN5 A;  4JQW C;  4TV3 A;  1TBE A;  2IBI B;  4EMO A;  2P0D A;  2K25 A;  1WE6 A;  3SNH A;  5D27 A;  2R2Q A;  2G4D B;  4IM3 A;  2DZJ A;  2XQN M;  3VVW B;  2DIK A;  1ZC3 B;  5C23 A;  3SU8 X;  3QCA A;  1QQG A;  4E74 A;  2KDB A;  3TL5 A;  3NOB A;  3SBG A;  3M63 B;  2PE6 B;  2G4S A;  1SGH A;  1V5M A;  1E7V A;  1U5D A;  3B0A A;  2MBH A;  4NJ6 A;  5DHF B;  4HWI B;  3WAN A;  3ECI A;  1M7R A;  1T0Y A;  4NNJ B;  1FXT B;  4DHZ E;  1UZX B;  2LUL A;  5JHB A;  3DCG A;  2DHK A;  1KOT A;  3ZW3 A;  2BWE S;  4BFR A;  2O2V A;  4EJN A;  4IOY X;  2MP2 A;  2DYN A;  4TUU A;  2YT1 A;  1Z5S B;  2KMC A;  1V61 A;  2N23 A;  3ZTD A;  2K00 A;  4WJP A;  2J7Q B;  2DZM A;  5KQ1 A;  4W9K A;  2PEA A;  1HBK A;  2JVC A;  1H4R A;  1TJ6 A;  1UPR A;  2KX0 A;  3B08 A;  4A6F A;  4BKG A;  2YF0 A;  5FI0 A;  3MTN B;  3A9J B;  2RR9 A;  4K7S A;  1FHO A;  2W9N A;  4FHJ A;  1AQC A;  3EPY A;  2LD9 A;  2YS1 A;  3UZT A;  3G9W A;  1BT0 A;  4FA6 A;  2FID A;  4KZ0 A;  1CMX B;  2D4Q A;  3PG7 A;  4XC2 A;  4MK0 A;  4A5K A;  4MGY E;  4IUM B;  4W9H A;  2LGY A;  4PNK A;  4GOC A;  2RSG A;  2KFJ A;  2Z0Q A;  3FLV A;  2LGD A;  3VTW A;  1WVH A;  1WGH A;  1TGZ B;  2D9Z A;  2W2X D;  1WFY A;  2D9Y A;  4Z2M B;  3DXE A;  5DPW A;  5JZE B;  1Z87 A;  2I5F A;  3ZVR A;  3O96 A;  4W9D A;  1V5U A;  2YSZ A;  2O6V D;  1WXA A;  3A1Q B;  3I3T B;  2XEW A;  2G35 A;  3DXD A;  1WM3 A;  4JK8 A;  1S1Q B;  3H7S A;  4NPN A;  2MQJ A;  3TO1 A;  2LRU A;  3SUZ A;  1X1F A;  1XD4 A;  4C0A A;  1OGW A;  5D2M B;  5KCV A;  2GBR A;  2IY0 B;  3CIK A;  2O6V A;  4IAP A;  2D9X A;  1XQQ A;  4AUQ C;  2KTR A;  2W2W A;  2WDT B;  4YON A;  4WAA A;  3NHE B;  4KDI C;  2E2X A;  1DDM A;  2LGX A;  3HM3 A;  4HK2 A;  5EFX A;  5G55 A;  1V88 A;  1IRS A;  4RM9 A;  3WAP A;  3UIN B;  2D9W A;  1WMH B;  1SIF A;  4MM3 A;  1IYF A;  3CMM B;  3ZNG C;  4JKB A;  4ANX A;  4F8C B;  3JSV B;  1PLS A;  3QC8 B;  4OVU A;  2YS3 A;  1DYN A;  2LG1 A;  4EZJ A;  1RAX A;  4KIK B;  2LOX A;  3GYO A;  2LVQ A;  4GIV A;  3EEC A;  2BCJ A;  2EKE C;  3KRX A;  1GGO A;  4KHB B;  3APD A;  3OAW A;  2MBB B;  2CB8 A;  2B3A A;  4K2P A;  2YRY A;  2MX2 A;  1P3R A;  3FM8 C;  3OLM D;  4ZDV A;  3BY4 B;  4NQK E;  2K6Q A;  1P3Q U;  2PE9 A;  4A3O A;  2VKI A;  3AU5 A;  4F7U P;  1FHW A;  3DBR I;  2MLB A;  2K2U A;  1HE8 A;  3GOE A;  1OY2 A;  3DBL I;  2ZZP B;  2PJH A;  3PVW A;  4K81 A;  2KXJ A;  3PTF C;  4CO7 A;  4WJ7 A;  2C7M B;  2VRR B;  5G2N A;  2DA0 A;  4KSK C;  5D3V A;  5E6P A;  3VHT C;  2W2X C;  3R7R A;  5LXI B;  2DYB A;  1E5W A;  4FAD A;  2GBJ A;  4GSW A;  1ACA A;  2NBW B;  1KZ7 A;  1C3T A;  1Y8R C;  2V1Y A;  1UEL A;  2K8C A;  3N30 A;  3TBL D;  4ZYN A;  2X0S A;  3UQA A;  3WA0 A;  5C5B A;  4K17 A;  3PV1 A;  2QKL A;  3AXC A;  4KHA A;  3PP2 A;  4FJV B;  3ENE A;  2LXA A;  2XK5 A;  1BAK A;  2I1J A;  2BPS A;  2KDE B;  1H10 A;  3NY5 A;  2CHX A;  3SO6 A;  5CTR C;  4MJS A;  4HAW B;  2ADZ A;  4IM0 A;  1J8C A;  5GMV A;  3VUW A;  1P1A A;  3WAM A;  3A98 B;  3L17 A;  2BKR B;  1YQB A;  3MDB C;  3L08 A;  4GN1 A;  4B95 A;  1PQS A;  3O65 B;  3P6A A;  3RT3 B;  4Z2N A;  3OJ4 B;  2JP2 A;  2MDX A;  3FP5 A;  1NTI A;  2KNB A;  5D7G A;  3E9L A;  2KFK A;  1KZG A;  4JIO U;  4JKG A;  1OQN A;  2KQ7 A;  4DBG A;  2FCQ A;  2BWF A;  4IWO A;  3E9O A;  1J0W A;  1MK9 B;  5CHF A;  4W9I A;  1EF1 A;  3KUZ A;  1EO6 A;  4ASW C;  2V3S A;  1I42 A;  1XT9 B;  4KV2 A;  4KAX B;  1LW3 A;  4BKS D;  4G11 A;  3ZNH B;  4ZRI A;  1SHC A;  2LKO A;  1WJ4 A;  4W9C A;  2A5U A;  2G45 B;  2N1V A;  2HTH A;  1AAR A;  1MPH A;  3FEH A;  4FN2 A;  2FCS A;  1SE9 A;  2M17 A;  3KYC D;  2D07 B;  3H9D A;  1LM8 B;  2CKH B;  3ZLZ A;  4BKS A;  1FHX A;  3L54 A;  1MAI A;  3ALB A;  4KZC A;  1Q1O A;  4DHJ D;  4JGH B;  3PHW B;  1YIW A;  2LUE A;  5D3X A;  2WH5 A;  1V49 A;  1UH6 A;  2C9W B;  4CHK A;  1QZE A;  3PSC A;  4ZRK A;  2M1M A;  1E8W A;  3H7P A;  4HCN B;  1X11 A;  4JK7 A;  3IVF A;  2Z0P A;  4N9F 4;  2PZ1 A;  1K5G B;  5TR5 A;  2EJ8 A;  3QIJ A;  4NQL B;  2KTF A;  3RYT A;  3V6E B;  1ZC4 B;  3PS6 A;  2ROZ B;  1YJ1 A;  1GG3 A;  2Q13 A;  2GS0 A;  3WIM A;  2C7N B;  4MGI E;  3A9K A;  3PGE A;  2L0F A;  4GDL B;  2DEN B;  3T8M A;  3ZDM C;  1JDE A;  2YVC A;  2KWU B;  3VQI A;  2ZNV C;  4GXB A;  4PS3 A;  1XX0 A;  2DX5 A;  4AP4 C;  2KD0 A;  5LXH A;  4MSM B;  2KDI A;  5JVL A;  2AL6 A;  2D3G A;  4GGQ A;  4PYZ A;  3JVZ X;  2FUH B;  3OAN A;  2G3Q B;  4KSL C;  2DZI A;  4TQ0 A;  3WAO A;  2Y8G A;  4HAX B;  2N4F A;  1UGM A;  3V61 A;  4IWP A;  4W9E A;  1UPQ A;  1GC6 A;  5DIF B;  4HLE A;  3SYX A;  3ULC A;  3EFU A;  2KDF B;  4NY0 A;  1V86 A;  3HM6 X;  2D2Q A;  3RZW C;  5D3Y A;  1J19 A;  4XWX A;  2ZPN A;  3D8F A;  3VUY A;  3W1Y A;  4GDK B;  4II3 B;  2MP2 B;  3D8E A;  1Z2M A;  4HPM B;  3N32 A;  2ZPY A;  2KVR A;  1NTY A;  1X86 A;  4B6H A;  3NZU A;  4FJZ A;  1K5D B;  2LWP A;  1FGZ A;  3D8D A;  3DPD A;  2FJL A;  4A6F B;  3HIZ A;  2CY5 A;  2MBQ A;  3DVN U;  1WGR A;  4WJO A;  2AEH A;  2DHZ A;  3PRP B;  4EKU A;  1V89 A;  2JRI B;  3ULB A;  5HE0 A;  3KYD D;  2H7E A;  3U30 A;  2IO2 B;  2KGX B;  1IP9 A;  4G3X B;  2Z59 B;  2KX3 A;  3SDL C;  1TTN A;  1I35 A;  3S2A A;  2JZZ A;  2M14 A;  2OTX A;  3PRE A;  3DXC A;  3F5R A;  1GUA B;  3RD2 A;  3V6C B;  2D11 A;  4HVB A;  4JKC A;  3SV1 A;  3ZKJ C;  4FJY A;  4B6W A;  2JUO A;  1Y19 B;  3RUI B;  3SD5 A;  1WGQ A;  1YD8 U;  2Y7B A;  2KAN A;  2Y8F A;  3SBT A;  1RLF A;  1WX8 A;  4CYE A;  2I5C A;  1C1Y B;  5HE3 A;  3DBH I;  5J3T A;  1XD3 B;  4FUL A;  2MWS B;  2ZCC A;  5IAA C;  3NZS A;  4KDL B;  1GC7 A;  2WYQ A;  1OQY A;  1TXD A;  3QJZ A;  1FB8 A;  1M94 A;  4X57 B;  1V5P A;  3V60 A;  4HB4 B;  2YLM A;  2DYQ A;  3NS8 A;  2IYB A;  3V5W A;  2KTR B;  4W9J A;  1OTR B;  3PRZ A;  1ZSQ A;  3UGB B;  4EFO A;  4AJY B;  5CLQ B;  1TQZ A;  1DBH A;  5FI1 A;  1U5F A;  1N3H A;  1S3S G;  2ELA A;  2K8H A;  1KLV A;  3MJW A;  3CST A;  4MEL A;  5DI9 B;  3Q3F A;  4OVV A;  3VXW A;  2XBB C;  3W1S A;  3AJ4 A;  3RUL A;  1V81 A;  1DRO A;  2Z0O A;  2CY4 A;  2RNR B;  2LZ6 A;  4EEW A;  3A1Q A;  2DLW A;  2CHZ A;  5J3Q A;  2COA A;  4L6E A;  4IM2 A;  1WZ0 A;  3ZRF A;  1XKE A;  4HDO A;  4ZRJ A;  2BF8 B;  2LAS A;  2MKR A;  4NAW B;  2ZJD A;  1LXD A;  3ZNZ B;  2ASQ A;  4JKD A;  2COD A;  4WVF B;  5C6R A;  2OOB B;  1E7U A;  1XOD A;  4B9K A;  4BKT A;  4I6L B;  3DVN V;  4URK A;  5J17 A;  3MHS D;  5IJM A;  2MBE A;  3KH0 A;  2P0H A;  3R66 C;  4IW0 A;  2L3Z A;  2J59 M;  2RLO A;  5CLL B;  2N9X A;  2DAF A;  3QX1 A;  3PZD A;  1TZ1 A;  1PMS A;  1BTK A;  1X1G A;  4W9F A;  2CQU A;  3VTU A;  3V62 A;  1V5T A;  1WJN A;  4G0N B;  3ZDT A;  2EMT A;  2JF5 A;  3JSV A;  3QQ8 B;  2DX1 A;  2AWT A;  2NPT A;  4DBB A;  1V6E A;  2FCM A;  3A8P A;  3ML4 A;  1HB8 A;  3A4R A;  1DDV A;  1ZGU B;  3M95 A;  5AEK B;  4A6K A;  4AWJ A;  3P2B A;  4I6N B;  2NVU I;  2VRW B;  1WXS A;  3D32 A;  2JWZ A;  2XK5 B;  2CU1 A;  4MJS B;  3DVG X;  2RUK B;  3ZTC A;  5DPR A;  3SHQ A;  2LJ5 A;  3UQB A;  2ZNV B;  1F9J A;  2KO3 A;  2ZVO A;  4F1S A;  3W1S C;  4PYU A;  2COF A;  1WH3 A;  4GU2 A;  1WI1 A;  4D0N B;  4DX9 0;  2KFK B;  3T06 A;  2CHW A;  2RGN B;  3L13 A;  2DKQ A;  2PPH A;  2MA9 B;  5L95 C;  2GCL A;  5J3Y A;  2MWN B;  2K6D B;  2ZEQ A;  5E6N A;  2JXX A;  1A5R A;  1WX9 A;  5AZG A;  4I6P A;  4NSW A;  4WWP A;  3QHT A;  3RZF A;  1WJU A;  4GB9 A;  1P98 A;  2L05 A;  2DKP A;  3U7D A;  2N0Y A;  3ODW A;  2C7H A;  4M8N A;  3E66 A;  1WY8 A;  2ZCB A;  1G6J A;  1WRD B;  2EC1 A;  2HTH B;  3M3J A;  2KLG A;  4K7W A;  4EUT A;  4ILH A;  2J0K A;  2VSZ A;  4YL8 A;  3IFW B;  3ZRC A;  4M8M A;  1AWE A;  2BYE A;  4EZK A;  4CHM A;  1ZKH A;  1E8Y A;  3AI5 A;  5FR6 A;  2L8J A;  3N3K B;  3VFK A;  2MRP A;  1V5O A;  5DPT A;  1LQB A;  4AOF A;  3ML9 A;  4IWQ A;  1EUV B;  3CSF A;  3H7P B;  5DPS A;  4ICV A;  1EVH A;  4HAY B;  1FGY A;  2JY6 A;  2V76 A;  4DHJ B;  3F0W A;  2FNJ B;  2MBO A;  1U5E A;  3DDC B;  3OJ3 A;  1FAO A;  3DQV A;  1V9J A;  4W9G A;  2YT0 A;  2RPQ A;  5KHQ A;  4HDQ A;  2KJ6 A;  2LRW A;  3A9K B;  1U5G A;  3VAW A;  3T9L A;  2D10 A;  4ILG B;  3IHP C;  2NBV B;  1WIA A;  1UBI A;  2QKM A;  3GZN I;  2KC1 A;  1OEY A;  3APC A;  1U4A A;  3PVL A;  2BYV E;  1WM2 A;  1MKE A;  2ABD A;  2IZV B;  2P8V A;  2QHO A;  2IYD B;  1YX6 B;  2UVM A;  2I1K A;  2DHJ A;  4A20 A;  1U29 A;  3R3M A;  2RGF A;  3KSY A;  4GPT B;  2P0F A;  2L00 B;  1R4M I;  4KHO A;  3RCP A;  5D3W A;  1H8C A;  1V80 A;  2A4Z A;  5JP4 A;  4HB2 B;  1RRP B;  1U27 A;  4LDT D;  4WJQ A;  5LLI A;  4EZL A;  4ANV A;  5AZF A;  4F7Z A;  1WGU A;  1WXM A;  1YX5 B;  3TVV A;  2EMS A;  1UBQ A;  5DHA B;  3QWZ B;  1Q67 A;  2KK8 A;  1ZM0 A;  1WGY A;  2DZK A;  2O2V B;  3PT2 B;  4JKE A;  2MCN B;  2UYZ B;  4JL9 A;  2BYF A;  3TW1 A;  3N7C A;  2KLC A;  2C5L C;  3RCZ A;  2L1C A;  4A3P A;  2RVB B;  4MY6 A;  3QAR A;  1OMW A;  3CF6 E;  2KMA A;  4JKA A;  2KZR A;  1UEF A;  2N7E A;  4DDI D;  2JZ3 B;  2COP A;  3KUD B;  3KUC B;  3L10 B;  2ZVN A;  1WYW B;  1KJT A;  2N1W A;  3U8Z A;  1NVL A;  4BOZ B;  2IO3 B;  2WX1 A;  1WX7 A;  4F7H A;  5CX3 A;  4GDK A;  2FAZ A;  1RRB A;  2C60 A;  2LOZ A;  2JPH A;  5LOP B;  1QC6 A;  2L2I A;  1KI1 B;  2LBB A;  1J0G A;  1D3Z A;  2HE7 A;  3JYU A;  1EAZ A;  1LB1 A;  2FDQ A;  2GOW A;  2K1F A;  5JHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...