4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/cell adhesion
molecule keywords Sorting nexin-17
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
3K9OB 2XK5A 4ICUA 5C23A 4LCDE 5LOPB 3VVWB 2NPTA 1T0YA 1KJTA 1NTVA 2L2IA 1GNUA 2LVOA 3JW0X 3TCAA 2MBEA 1ZKHA 2G4SA 4W9KA 4BBNC 3APCA 3ODOA 1WXAA 2G3QB 4BBNF 3CSTA 3DXCA 4MELA 5HE0A 2J7QB 1E8XA 4AJWA 4KIKB 3VAWA 3ZVVA 1P1AA 2LYDA 1L7YA 2M0XA 3DBLI 3MJWA 2LKOA 4G11A 1J8CA 4NY0A 3TMPB 4LJOB 4HHVA 1WGRA 2BWES 3PRZA 4F7ZA 5FI0A 1U2BA 2GBJA 2W2XD 2MRPA 1UZXB 2DYOA 3WALA 4AOFA 5GOWB 4IWPA 3UINB 4GPTB 1WJ6A 2DZMA 4ANXA 2LG1A 3PGEA 2DKQA 2CR5A 4GZUA 2O2VA 3PTFC 4MK0A 4ZDVA 3D8FA 2KN5A 5D3WA 3TBLD 3QJZA 2C7MB 2D9YA 3KY9A 2GBNA 1M94A 2DYNA 2KFKA 3VXWA 3OAWA 1SGHA 1VCBA 2YS3A 1DDWA 2M14A 3EC8A 5D7GA 1HE8A 1V49A 4CHKA 3HW2B 1NBFC 1R4MI 1BT0A 1UNRA 2ZVOA 3OANA 3WA0A 2Q13A 1NDDA 1OEYJ 3DBRI 4WJ7A 5AZFA 4DDGD 2FIDA 3B1LX 4EFOA 3L08A 5J17A 3VOQA 4EEWA 5D6JB 3SV1A 2DTCA 1RFAA 2C60A 4MJSA 2ZNVC 1WJNA 2PJHA 3ML9A 3IG3A 2KXJA 5FR6A 1ZW7A 1EVHA 2GJYA 3ZDMC 2JRIB 4MGYE 1U4AA 1WJMA 1EF1A 3WYFB 4W9EA 1A5RA 2GBMA 1ZVRA 3JSVB 4NPNA 2LOXA 1OMWA 2FCQA 4XZ4A 4GN1A 1XD3B 1S3SG 4FA6A 1WGQA 3A98B 2DN6A 3PV1A 2GCJA 2IZVB 3A33B 3CSFA 5D3XA 4HAYB 5L81A 2IO0B 3QA8A 4A3OA 5DPTA 4GDKA 1V80A 4DDID 5CHFA 4PS3A 5CHVC 1WI1A 4YONA 1DBHA 3H7PA 2AL3A 3NS8A 3KW5B 2DFKA 3PPAA 3QAQA 2EMTA 4GDKB 4B95A 1WJ4A 2AWTA 2KZRA 1EAZA 4YL8A 1YX6B 2C5LC 2WX0A 1OEYA 4J6IA 3WAMA 2FCNA 3VFKA 3Q3FA 2C7NB 1MIXA 1P3RA 3TO1A 3RD2A 4K17A 3JYUA 2ADZA 3QWZB 5KHQA 2Z0PA 1WGDA 2J59M 1SHCA 4KVGB 2C7HA 4EZJA 2K39A 3M1IB 3VUXA 1PLSA 2W2XC 1WRDB 3KZ1A 1WYWB 2LXAA 1K8RB 4B6HA 2DX5B 1NI2A 3U7DA 2MP2B 5DCNA 2KJRA 4GU2A 5HKHA 3AU5A 4EZLA 5D3YA 3H6NA 2NS5A 5DPSA 3CXBB 2KK8A 5KHOA 2C9WB 2M38A 4HAUB 4M8NA 4IFSA 2M8SA 5L95C 5G2NA 3ZKJC 4A20A 1V5OA 3ZDTA 1N3HA 2IFSA 3PHWB 3CF6E 2D9XA 2L3ZA 4FJVB 5E6NA 1I2HA 2O6VA 3PLUA 1BTNA 2ROZB 2H7EA 3W1SC 1LW3A 2W9NA 2WYQA 1IYFA 4EJNA 1XT9B 2RGNB 3P6AA 4HATB 2KFKB 4II3B 1V81A 5TR5A 1RJ2A 5J3QA 3QHTA 3RYTA 3UF8A 3PVWA 2NCNA 2KJ6A 3O65B 4G0NB 4B6WA 4MGKE 2BYEA 4Z2NA 4W9LA 2BF8B 2MWNB 3A1QA 3KUCB 3L54A 3ML8A 2OOBB 4MM3A 2KC1A 1GJZA 3RULA 2G4DB 2MBOA 1XKEA 3F0WA 3ZLZA 1UGMA 1XX0A 2Y7BA 5C16A 4KDIC 5C1ZA 3FSSA 2D9WA 3AXCA 1WZ0A 2IBIB 3ZNHB 2DYMA 4BVUC 2ELAA 5KQ4A 2FNJB 3NSUA 2NBWB 3RZWC 4FBJB 4WJQA 3ONSA 2MW5A 3UQBA 2H7DA 5J3YA 2KQSA 3NY5A 4WJNA 1C3TA 1KZGA 1QC6A 1WJUA 2CHWA 3HM3A 4JLCA 1W1HA 4KHAA 1MK9B 2K8HA 2KOXA 3KUDB 4WJOA 2V1YA 4WJPA 3V62A 2AEHA 3PHXB 4RMAA 4LDTB 2J0MA 3VH4B 2L8JA 3M62B 1FGYA 1X05A 2OTXA 3DQVA 1GUAB 3PREA 4ICVA 4W9HA 4W9IA 3UGBB 1AARA 2KTRB 2N9PC 4WWPA 5C79A 1GC7A 2KCJA 3D8DA 1P98A 1R4NI 1E7UA 2JUOA 3UZTA 4WQOB 5CHWA 4URKA 2OJRA 4IOYX 1MK7B 1LXDA 2DAFA 1EF5A 2LGXA 2O6VB 3EFUA 3OJ4B 4MH0E 2CU1A 1FXTB 4X57B 5J3TA 2N9EB 3H7PB 2YF0A 2CKHB 1PQSA 1PMSA 1UELA 1K5DB 4WVFB 1V6EA 1V5UA 2K25A 2ZZPB 3X23A 1IRSA 2L0FA 3MTNB 4OVVA 4OVUA 2KUPA 5D2MB 5GMVA 1XODA 3NZUA 4WWNA 3T8MA 3FM8C 1MIZB 3DVNU 1ZC3B 1FHWA 2LOZA 2X18A 1X1MA 1SE9A 5JZEB 4TQ1A 1TGZB 2MBHA 3LJUX 2JT4B 1LFDA 2ZJDA 3QWMA 4DXAB 2PE6B 4FJYA 3VDZA 2NBUA 4DX8A 1E8ZA 2L05A 1Y19B 1ZGUB 4AWJA 1U5FA 1YD8U 2ELBA 2NZ8B 1P9DU 2BYFA 1RRBA 4HPLB 2YT1A 3IFWB 2LRWA 3UIOB 3VTWA 2A4ZA 3JSVA 4LJPB 3WAPA 1UBQA 2GOWA 1W1GA 2BCJA 2CY5A 2DX1A 4ZRJA 1WE7A 4ANUA 1Z2MA 3RT3B 4E74A 1Y8RC 2RGFA 4ZYNA 4MDKE 2Z0DB 1WVHA 2ZCBA 5D3VA 5DI9B 5BO4B 3A9JA 4IWQA 2BPSA 2K6DB 3KSYA 4PQ0A 1GC6A 1OQNA 2KC2A 3W1YA 3GYOA 1BAKA 1WH3A 2RPQA 3M95A 2YT0A 1WF9A 4NSWA 2K8BA 4F7GA 3HIZA 4KIKA 2HD5B 4FJZA 3DXEA 1TBEA 2Y8GA 1WXMA 4KZ0A 5HE2A 3B08A 1TXDA 2CY4A 1WX7A 2RSUA 1LM8B 5CTRC 2NBVB 4C0AA 1X1GA 3OJ3A 4AJYB 5CLQB 4JGHB 2I1KA 4DHZE 3D32A 3KH0A 3HQCA 3N7CA 4HAVB 4GMXB 1OGWA 2Z59B 4DWFA 4K7WA 1AWEA 1U5EA 3VH3B 5AEKB 1WR6E 2DKPA 1MKEA 2P0HA 3SO6A 1Q5WB 2DZJA 4KAXB 2JRHA 4GSWA 2I1JA 2OQBA 2VRWB 2KX3A 4GDLA 4W9CA 4CHMA 1DROA 2W2WA 5J18A 3PVUA 2YS1A 2ZVNA 2LASA 4NQLB 3ZRCA 5JLJB 2WWZA 1X86A 5JH5C 2V76A 2L0TA 4IAPA 4MGIE 2KHWB 2MCNB 3ZUNA 1U27A 1M7EA 1H4RA 2BKRB 3PLVA 1SIFA 4FN2A 4F1SA 2HTHB 3TJPA 3PT2B 3SYXA 3ZNZB 1I35A 3ZIMA 1UEFA 2LVQA 1FHXA 5AZGA 1FHOA 5HE3A 4HB4B 2K8CA 3AJ4A 3ENEA 1DDVA 2VKIA 4BBKA 4MJSB 2V4LA 2I5CA 2DHKA 4MSMB 5LXIB 2COAA 2UZRA 5HE1A 5JHHA 4RM8A 5DPWA 4ZRIA 2KVRA 2Z0EB 2DA0A 2EKEC 4JIOU 3ZW3A 3ML4A 3N30A 4I6NB 2LWPA 3QQ8B 4TV3A 2PE9A 4W9GA 3VUWA 4HAWB 4HB3B 4MSQB 3RCZA 4N9F4 2KTRA 1XD4A 4KDLB 3HM6X 4IW0A 4E3CA 5CLLB 1D3ZA 2AL6A 2KGXB 3GYPA 2JZ3B 2DHZA 4II2B 2LJ5A 2P0DA 4A6KA 1WGYA 1UD7A 3L16A 1FOEA 4CHJA 4HPMB 2EJ8A 1H10A 4GDLB 3ZNGC 3ZRFA 2LGYA 2MKRA 1RLFA 1AQCA 3P2BA 2KDFB 2QKMA 4F7HA 1V86A 1KI1B 3PSEB 1WX8A 2YS5A 4CYEA 3R66C 2NR2A 3DOWA 4FLHA 4Y94A 2BYVE 3A9JB 3KYCD 4HJKA 4IWOA 2CODA 2N1WA 4ANWA 5EFXA 2MFQA 1FB8A 5D27A 3PVLA 2L7RA 1W1DA 2M4NA 4G3XB 2Z0QA 2O6VD 3D8EA 2IYBA 1XQQA 4NAWB 4PYZA 2DLWA 2UYZB 1E7VA 2YRYA 4Z2MB 2RNRB 1IPGA 1Q0WB 3A9KB 2KLGA 3S2AA 3Q3JA 3AU4A 3QCAA 2A5UA 3DXDA 2K6QA 2LVPA 4K7SA 2VRRB 4MEMA 2P0FA 3ZTDA 2JPHA 4LDTD 3DCGA 5E6OA 2JY6A 3H1UA 1Y5OA 3QBVB 1Z5SB 3V6CB 5C5BB 1I7AA 2DZIA 3V61A 3VTUA 2EC1A 4TQ0A 3A8QA 4K2OA 4W9FA 1V5PA 1V5TA 4TUUA 1CMXB 1WM2A 4A6HA 2FAZA 2YLMA 3CMMB 3RUIB 4A6FB 2J0JA 2ZEQA 2NVUI 5JHBA 5L83A 4HWIB 2IY0B 4GB9A 1WJ1A 4GGQA 3NOBA 2KKCA 2IO2B 2LXCA 1ZC4B 3QIJA 3OLMD 4IUMB 2N0YA 2XQNM 5CX3A 2XK5B 4HDOA 1YJ1A 2DAJA 1OY2A 2ROVA 1LB1A 2RR9A 3EHVA 3IBEA 1UPRA 1C1YB 2LRUA 2NPTB 3ECIA 4GOCA 3L0WB 2GS0A 4DX90 2R09A 1M7RA 2BGFA 2D07B 4DHZB 4MGZE 2R2OA 5JHGA 4FHJA 3ZTCA 3A4SC 4HDQA 3L10B 1NU2A 2MA9B 3KVFB 2V3SA 3C0RB 3WANA 2ZCCA 3NZSA 2LZ6A 2XEWA 4WSFA 1WM3A 4K2PA 2DYBA 2FUHB 2REXA 3DDCB 1V5MA 3M3JA 1B55A 3FEHA 2D9VA 1OTRB 3DVNV 1UPQA 1U5DA 3TFMA 5DPRA 2MBQA 3DPDA 4GXBA 2JWZA 3BINA 1WZ3A 3ZVRA 2GBRA 1UNQA 2MQJA 4K1RB 2QKLA 3SDLC 1V9JA 2YSZA 1E90A 2FIFA 4HVBA 1BTKA 4FADA 3PEGA 2MBBB 1WMHA 2Z0OA 3AI5A 1P6SA 3KUZA 1ISNA 4G50A 1QZEA 3V6EB 2G35A 2LULA 1G6JA 5FI1A 2VSZA 1DDMA 2KNBA 5JHAA 3IHPC 1E8YA 4KV2A 3VUYA 5J2RA 2BWFA 1OQYA 3ALBA 1MPHA 3DVGX 2RVBB 5AZHA 4A5KA 2UWQA 1TZ1A 3JVZX 4PS7A 2KDEB 5G55A 4ASWC 2KDBA 1WFYA 1MAIA 2ASQA 3T9LA 1V88A 5KQ1A 1P3QU 2CHXA 2CS4A 2HJ8A 5E6PA 4BKTA 2JXXA 1WI0A 1TJ6A 4D0NB 2R2QA 4KSLC 3SHQA 2KWVB 3BJIA 1Z87A 1X11A 2KQ7A 4HB2B 1KOTA 1WXVA 2DX5A 2K2JA 4KHOA 5DHFB 3T06A 4MY6A 2MP2A 3NHEB 2N7DA 3VTVA 1V89A 4AP4C 4BKGA 2RSGA 2COFA 1UNPA 2IY1B 1VD2A 4FHKA 3L17A 4EKUA 1J19A 1X1FA 3R3MA 3G9WA 2ZNVB 2KD0A 3GOEA 4EZKA 3PRPB 4K7UA 5JP4A 4NNJB 2LUEA 5LLIA 3W1SA 4AUQC 3ODWA 2COCA 2I5FA 2AYOB 4FULA 2M17A 2RD0A 4L6EA 2WDTB 3UQAA 4B9KA 2KX0A 1WIAA 2N23A 3ODXA 1P0RA 1WE6A 2G45B 1WY8A 2HE7A 2M1MA 2D10A 2JVCA 3PS6A 3TIXA 3U30A 2CHZA 2ZPYA 2L76A 3A1QB 4M0WB 4HCPB 4HK2A 3TL5A 4M8MA 3TW1A 3V5WA 2IO3B 5DIFB 5IAAC 2KWUB 3PSCA 4H8SA 1YIWA 3QX1A 5C5BA 3HHMA 2CAYA 3K9PB 1MG8A 2GMIC 4JL9A 1J0WA 1K5GB 1WXSA 4HLEA 2GBKA 4KZCA 3HK0A 5LONB 1RAXA 4EMOA 2FCSA 3DBHI 3R7RA 2Y5BB 2D3GA 1V61A 4NJ7A 4ANVA 2PZ1A 2WX1A 1NTYA 3SUZA 2XBBC 2MLBA 3LJ3A 1WG7A 1Q1OA 4XX5A 4A3PA 3IVFA 4KHBB 3H9DA 2KO3A 4BOSC 1KM7A 3F5RA 4HCNB 4IM2A 2LGDA 3WIMA 3WAOA 1KZ7A 2LI5A 2PPHA 1GG3A 2HTHA 4A6FA 1WMHB 2MDXA 3U8ZA 1WR1A 4BKSD 2QHOA 2J0KA 4TYZA 3MPXA 1L2NA 4W9JA 4I6PA 3DBSA 2MWSB 1E8WA 1XR0B 3SU8X 3O96A 4HB0B 2DHJA 2UVMA 3KRWA 5DHAB 4PNKA 2FCMA 2L00B 2N9XA 1EO6A 3PRMB 4BOZB 3VHTC 4GIVA 1WGGA 4DHJB 3M63B 1H8CA 2K2UA 2JZZA 5EDSA 3H7SA 2LD9A 3VIAA 3RZFA 4GMVA 5LXHA 2KLCA 1RRPB 2N7EA 4NQKE 2Y8FA 1U5GA 5DH9B 4IM3A 1BWNA 1TQZA 1EUVB 1YX5B 2JF5A 4NJ6A 4DK5A 4EUTA 3ULCA 1F9JA 4F7UP 4BFRA 3PZDA 3DVGY 1EGXA 1KLVA 3V60A 3L13A 5C6RA 4E71A 3KRXA 2D2QA 4XWXA 1FGZA 1Q67A 2FJLA 2R0DA 4P7IA 1WX9A 1YQBA 2CRFA 4EOYA 3X0WA 4DBBA 3ZNID 2KDIA 4HAZB 2KWCA 4WAAA 3PG7A 2E2XA 3KYDD 4PYUA 1V2YA 4IG7B 2B3AA 2YVCA 3SNHA 4KSKC 5IA7A 2UZSA 1QQGA 1XCGA 2NMBA 2K1FA 2MX2A 2KFJA 2IYDB 2N1VA 3N3KB 3PP2A 4IC7B 2KMCA 2MSED 1ZSQA 4NAWA 1WGUA 1FAOA 2KTFA 2PEAA 2IO1B 5D94A 2D4QA 4DHJD 3MDBC 4RM9A 1DYNA 2DENB 4CO7A 1LQBA 3QARA 1JRUA 1IP9A 2D9ZA 3ULBA 4BKSA 1WGHA 3GZNI 1J0GA 2EMSA 3I3TB 1TTNA 3LDZE 1I42A 3VQIA 2DYQA 2L1CA 4K81A 4ZRKA 4PS8A 1UBIA 2JP2A 2P8VA 3N32A 1E5WA 4HAXB 3A4RA 3A9KA 3BY4B 5KCVA 3EECA 3MHSD 4JQWC 3SD5A 2BKFA 2KANA 3APFA 3APDA 1P5TA 1PFJA 3CIKA 4W9DA 3P7ZA 2N4FA 2DZKA 4DBGA 2O2VB 3QK0A 4IM0A 4WWOA 2KJHB 1S1QB 3AULA 4HXDA 3R7QA 2DHIA 3ZO5B 4MT7A 1UH6A 1U29A 2D11A 2KMAA 2K00A 3TVVA 3B0AA 2ZPNA 3QC8B 4XC2A 4I6LB 3UIPB 1ZM0A 4TKNA 2RUKB 3RCPA 2RLOA 2GCLA 3A8PA 4F8CB
chains in the Genus database with same CATH superfamily
5C23A 3DHHC 3ZJUA 3JW0X 2LVOA 3U52E 1TY2A 4BBNC 5TSSA 3TEXA 4MELA 1TY0A 5HE0A 1E8XA 4AJWA 1KTKA 1L7YA 3TMPB 4LJOB 4F7ZA 1ZUD2 3IXSA 2W82A 2CJNA 5GOWB 4GPTB 2DZMA 1QOFA 2LG1A 4IKGA 2R61A 4MK0A 3QJZA 2D9YA 3KY9A 3VXWA 1DDWA 3EC8A 5D7GA 3HW2B 1R4MI 3AE1B 4ILGB 3WA0A 1NDDA 4DDGD 3B1LX 3C8YA 4RGNA 2C60A 2RMMA 3IG3A 3ZDMC 1FNUA 2GBMA 1ZVRA 3JSVB 1F77A 4WURA 3OWEB 4GN1A 1XD3B 2WXJA 2LUMA 1MJDA 2D3BA 3PV1A 2GCJA 2BVCA 2IZVB 3A33B 5L81A 4HAYB 3CSFA 4A3OA 5DPTA 4GDKA 4DDID 4PS3A 4YONA 1C76A 1J7CA 3B2FA 4YL8A 2C5LC 4J6IA 3WAMA 2FCNA 2BTEA 3QWZB 1ZXHA 1GGOA 5KHQA 4ZRQA 2C7HA 3VUXA 2W2XC 3FC4A 4BZAA 3AU5A 5KHOA 1JWAD 4M8NA 5L95C 1WSPA 5G2NA 4P16A 1V5OA 3ZDTA 1N3HA 2LMCA 1RM6C 2O6VA 3AE4B 2W9NA 4YTMB 2AQ1B 2KFKB 2HDEA 5TR5A 2DBYA 3R2IA 4XYCA 4JX1C 4Z2NA 2BW2A 2L32A 2MWNB 4MM3A 4HEA1 1N5WA 5BMHA 1XKEA 3F0WA 2Y7BA 2D9WA 3DHGC 2DYMA 2KMMA 4BVUC 3NSUA 2NBWB 4WJQA 3ONSA 2MW5A 3UQBA 3NY5A 1GOZA 1QC6A 2MEKA 2V9HA 3LYYA 3V62A 2K8HA 1GB4A 1ZE3D 1YNTE 2X38A 1TS5A 4JKEA 1X05A 2OTXA 3UGBB 4W9IA 1AARA 4WWPA 3D8DA 4WQOB 3UZTA 3OJ4B 2O6VB 4X57B 1FFVA 4LTUA 3H7PB 1ROEA 4M0WA 1K5DB 1V6EA 2K25A 2K8EA 5BYQA 3VTWA 3MTNB 4WWNA 5EE9A 1I4HA 1MIZB 1L4DB 3IT6B 1SE9A 3EPYA 2AQ2B 2JT4B 3C19A 4DXAB 2PE6B 4FJYA 3VDZA 1SJED 4AWJA 1U5FA 2ELBA 1FNWA 2BYFA 3ZJTA 3UIOB 3WAPA 2GOWA 2BCJA 1E10A 1WE7A 4E74A 1Z2MA 3ZJVA 4ZHPA 1VBGA 2ONQA 2SAKA 4IWQA 2BPSA 2LGIA 4RNAA 1OQNA 2WP9B 3M95A 2HD5B 2JZPA 1TBEA 3B08A 5G5HA 4P1CC 1F2RC 3SBGA 1DOXA 4AJYB 1X1GA 3OJ3A 3D32A 1HXYD 1OGWA 3Q6BA 3VH3B 3FLVA 1BXTA 1MKEA 3SO6A 4GSWA 1N63A 2KX3A 4W9CA 1YN3A 3NRZA 2MH7A 5J18A 3BZDB 2JYTA 2ICIA 2V76A 4C00A 3ZUNA 3PLVA 2DIKA 3PT2B 3KWVA 1UEFA 1FHXA 4OVZA 5AZGA 1WRIA 3AJ4A 1BUIC 2VKIA 4BBKA 4MJSB 2V4LA 2DHKA 2KVRA 2EKEC 4JIOU 1JW9D 3ZW3A 3ML4A 1QILA 3QQ8B 4HAWB 2OJWA 3NUHB 2KTRA 1JWUD 2AL6A 2JZ3B 1D5ZC 3RNCC 2DHZA 2P0DA 1TKGA 5AUIA 2D5GA 2KDFB 3P2BA 1KI1B 3RMKC 1WX8A 3R66C 2PLPA 3KYCD 4HJKA 2MFQA 1W1DA 3AN1A 2M4NA 1ET9A 4PYZA 2DLWA 3P4SB 2YRYA 3A9KB 4WJOA 3AU4A 1T6BX 5H92C 2INCC 3V6CB 3V61A 2DZIA 3E56A 3ENBA 1KLGD 3NVYA 1EM7A 3RUIB 4P6VF 4TSSA 4JKFA 2IY0B 4K7WA 1WJ1A 4GGQA 2LXCA 5EE1A 3OLMD 5GXGB 5E6NA 2EKIA 1KFYB 1OY2A 2RR9A 1UPRA 3ECIA 2FBWB 2NPTB 3L0WB 4DX90 1M7RA 4DHZB 2R2OA 1IBXB 5FK9C 3L10B 3C0RB 3IT4B 3NZSA 1AYFA 1WM3A 2ZKMX 2FUHB 2REXA 3M3JA 2AX5A 2ZW0A 3DVNV 4N58A 5DPRA 1TT5B 4WQMA 1NYQA 1AW7A 3AI5A 3KUZA 1QZEA 2G35A 4L1RA 1NEKB 3BK1A 1G6JA 2VSZA 2KNBA 4GOUA 1E8YA 4KV2A 5BMGA 3VUYA 2BWFA 1GAQB 3ALBA 3DVGX 2RVBB 4ASWC 2ASQA 3T9LA 4R3DA 3GZNB 2JXXA 4KGRA 4D0NB 2KWVB 4OZBA 4KKJA 1Z87A 1XLOA 1FPYA 1ZOYB 2WQYB 3NWFA 2MP2A 2K2JA 4KHOA 3VTVA 2N7DA 4AP4C 1V97A 1MI1A 2RSGA 1IGDA 2YEPB 1UNPA 2IY1B 1VD2A 3L17A 4EKUA 3G9WA 5JVLA 5JP4A 5LLIA 4CQNA 1IUEA 4UDUC 4FULA 2V4IB 4L6EA 1XCTL 3PS6A 4MT5A 1MI0A 4M0WB 3NJTA 4A9AA 5C5BA 2XN9C 2CAYA 2QC8A 1FM0D 2GMIC 4KZCA 1DYQA 2FCSA 3P1MA 4NJ7A 4XX5A 3IVFA 4KHBB 2RDGA 2AQ3B 2WXLA 1E6EB 1L0VB 4IM2A 1KZ7A 1VJKA 2DWQA 2HTHA 1WMHB 5IO9A 2NMQA 2BBCA 1DIKA 1ACCA 3DBSA 3O96A 2FCMA 2L00B 1N62A 2BB5A 5I2MA 1V1PB 4JKGA 1H8CA 5LXHA 3B77A 3MP9A 2KLCA 1RRPB 1XEEA 2N7EA 1GPXA 4RGMA 2Y8FA 3U12A 4IM3A 2JF5A 1HTQA 1LGRA 4IOIE 5M4YB 4AQ7A 1XF5L 4F7UP 4BFRA 3DVGY 1EGXA 1Q10A 1YQ4B 4E71A 3KRXA 2D2QA 1HZ5A 1WX9A 2CRFA 3ZNID 4DBBA 3AM9A 2QCZA 2K0PA 2KWCA 2E2XA 5I4DA 4PYUA 1V2YA 4IG7B 4PT5A 5IA7A 1QQGA 2MX2A 3N3KB 3PP2A 1AN8A 3VRAB 2EELA 2KMCA 2JYEA 4NAWA 1T77A 2IO1B 3NVWA 3QARA 2HTME 2D9ZA 1WGHA 1V1PA 2EMSA 3SFDB 3W5VB 2KUQA 2JP2A 4P1BC 1E5WA 3A4RA 4FXCA 4JQWC 5KCVA 2BKFA 3APFA 2Z4DA 3CIKA 4W9DA 2N4FA 2DZKA 4DBGA 2O2VB 3EA6A 3QK0A 4WWOA 3AULA 4HXDA 1KRHA 3I63C 4MT7A 2K00A 2ZPNA 1L6UA 1I4XA 4XC2A 4I6LB 1ZM0A 1PUTA 4L1BA 3LXFA 3K9OB 4RCOA 4ILHA 3VVWB 1ZKHA 2G4SA 1K52A 3CSTA 2BS3B 3IAM1 4KIKB 1P1AA 4G11A 3DBLI 1HA5A 1WGRA 5FI0A 2DYOA 3B9JA 4AOFA 3TUOA 1WJ6A 4ZOHC 3PGEA 2CR5A 2O2VA 1I4QA 3D8FA 2K3UA 3T3OA 2GBNA 1M94A 2DYNA 2KFKA 5IP4D 1C78A 4CHKA 2Q13A 3DBRI 3P4PB 3N1XC 4EFOA 3L08A 5J17A 5D6JB 3TEZA 2DTCA 1FNVA 4JWUC 5G5GA 4JKDA 2KXJA 3I9V1 2WDQB 1GB1A 4OZAA 3ZXVA 1WJMA 3WYFB 3GP7A 4NPNA 2GUMA 4FA6A 3A98B 1MHXA 1I4PA 5CHFA 2KVZA 1WI1A 3H7PA 3QAQA 2EMTA 4B95A 1KBLA 4C4VB 1D5MC 2KZRA 2WX0A 4LNIA 1OEYA 4XDCA 2C7NB 4YTPB 3TO1A 3RD2A 3JYUA 4WH4A 3CIRB 3NZ3A 4EZJA 2J59M 2K39A 1PLSA 3KZ1A 2D3CA 2LXAA 2MP2B 3U7DA 2WXKA 2KJRA 5HKHA 2JX5A 1EU4A 5D3YA 3H6NA 3CXBB 2KK8A 4A90A 3Q8AA 4HAUB 3RNBC 3ZKJC 4A20A 2IFSA 2L3ZA 2WHIA 3N9YC 2WXPA 2Y5CA 3W1SC 3ABVB 2WYQA 4EJNA 1QT9A 3P6AA 1RJ2A 3QHTA 3RYTA 3E9LA 2BF8B 3L54A 3ML8A 2OOBB 4Q2JA 3ZLZA 1UGMA 5C16A 1UGJA 2ZW1A 3RFZB 5KQ4A 2FNJB 2KQSA 1MG4A 4A8XC 2Z13A 1WJUA 1OFFA 4KHAA 4KHBA 4RMAA 1ZDXA 5I2SA 3M62B 2N9PC 1GC7A 2JUOA 4URKA 1MK7B 3EFUA 1EF5A 2CU1A 1KF6B 5J3TA 1L4ZB 1DOIA 2YF0A 2VZKB 4XGAB 1C4PA 2N7JA 2ZZPB 3X23A 4OVVA 5D2MB 2IGHA 2KUPA 1EWCA 1XODA 1D4BA 1ZC3B 2LOZA 4AS1A 1TGZB 2MBHA 4DX8A 1E8ZA 3URYA 2L05A 1Y19B 1YD8U 2LRWA 2A4ZA 3JSVA 4S0RA 1W1GA 4ZRJA 2KWDA 1YJIA 1SIJA 2Z0DB 5DI9B 2WXHA 5BO4B 3SEBA 2WXQA 3KSYA 5C2TB 1GC6A 3AEDB 1BAKA 3MFGA 1JALA 4NSWA 2K8BA 4F7GA 3DXEA 2Y8GA 4KZ0A 3WCQA 5HE2A 5MPOA 1WX7A 1LM8B 3CWIA 2NBVB 1E7PB 5CLQB 3GE3C 3N7CA 4HAVB 4DWFA 1AWEA 1U5EA 1T5XD 5AEKB 2P0HA 4GDLA 2OQBA 1DROA 2UU7A 3PVUA 4ARIA 2YS1A 4QJ5B 2WWZA 4IDIA 4IAPA 2KHWB 3OHMB 1NTIA 1YN5A 2BKRB 1SIFA 4F1SA 3TJPA 1MHHE 3SYXA 3ZNZB 2MJEA 2LVQA 5HE3A 4HB4B 3AEAB 2J4XA 3MHZA 2N0SB 5HFYA 2UZRA 3GS2A 4L23A 2BQQA 4JKHA 5DPWA 4ZRIA 2DA0A 3W2DA 5HHDG 4TV3A 2K9XA 2FDQA 2PE9A 4HB3B 3I5JC 4MSQB 1IGCA 4KDLB 3VR8B 4IW0A 5HI1A 4E3CA 3GYPA 4HROA 4ZYSA 2LJ5A 3L16A 2PKOA 2EJ8A 2E3TA 4GDLB 3ZRFA 1RLFA 4JK7A 4F7HA 1V86A 4LNOA 4PK1A 4CYEA 3DOWA 4IWOA 3A9JB 4D2KA 2N1WA 4ANWA 1FB8A 3D8EA 1XQQA 5BMIA 1E7VA 5IRSA 3S2AA 3Q3JA 3DXDA 3ZTDA 2VRRB 2P0FA 3NG0A 4RH6A 3DCGA 4YSXB 2K22A 2FJUB 4TQ0A 3AEFB 4K2OA 1XLNA 1WM2A 2YLMA 2Z59A 2LJIA 5L83A 4A6FB 2ZEQA 2NVUI 2MJ3A 4HWIB 4IUMB 2OEDA 2SEBD 2XQNM 1CJEA 4ZYNA 4HDOA 1LB1A 3OG5A 1C1YB 3BVGA 2BGFA 4NZLB 4MGZE 3ZTCA 3A4SC 3VRBB 1NU2A 2WDVB 3KVFB 4KGSA 2XEWA 2DYBA 3DDCB 4XDDA 1UPQA 3DPDA 4XE0A 1SF0A 2HRJA 3ZVRA 1UNQA 1ESFA 1V9JA 2FIFA 1BTKA 1C9FA 4KKIA 1WMHA 4G50A 2WGSA 2LULA 4QJ4B 5JHAA 1HQRD 2JWUA 1NVLA 4A5KA 3JVZX 3NS1A 1ENFA 5E6PA 3SHQA 3BJIA 1X11A 3EGRA 2KQ7A 1KOTA 5DHFB 1PGXA 3T06A 4MY6A 3NHEB 3B2GA 3EUB2 1TS2A 2COFA 2QIEB 3R3MA 1VR9A 1E9MA 3PRPB 2LUEA 3W1SA 1K53A 2COCA 2I5FA 2LGSA 2RD0A 1JQ4A 1JWBD 3A58A 3UQAA 2KX0A 1WIAA 2G45B 1WE6A 5IKCM 3BIID 5D3IB 2CHZA 2L76A 3A1QB 4HK2A 1YQ3B 3TL5A 4M8MA 3TW1A 2IO3B 5DIFB 2KWUB 3PSCA 2M0AA 3BVZA 3HHMA 3K9PB 5H8YE 2G9HD 1MG8A 1K5GB 4HLEA 3HK0A 5LONB 4EMOA 3R7RA 2GB1A 2K5PA 2PZ1A 2MLBA 2KO3A 4M01A 4HCNB 1FMAD 2VH1A 3R8BA 3WIMA 3WAOA 3V05A 2PPHA 1TYGB 1L2NA 3Q3OC 2QEJC 3SU8X 2MWSB 3BK2A 1CK1A 3KRWA 5DHAB 3PRMB 2N9XA 4DHJB 1UNSA 1WGGA 3M63B 3H7SA 4GMVA 1IBXA 2MJDA 1TS4A 4NQKE 4ARCA 1TQZA 4DXFA 1YX5B 4DK5A 4EUTA 2HJ1A 1KLVA 5C6RA 1YQBA 1Q67A 4EOYA 1FXIA 3PG7A 2GRIA 2B3AA 3SNHA 1PYWD 2K1FA 2NMBA 3T3NA 2IYDB 2CJOA 1FAOA 2D4QA 4DHJD 2WNMA 3GZNI 4MACA 2WS3B 1I42A 3VQIA 4K81A 3N32A 4OSNA 3BY4B 3MHSD 4NJCA 4RF1A 3SD5A 1MVKA 1EU3A 2DHIA 2E6XA 2KMAA 2WXOA 2D11A 3TSSA 1CQVA 3TVVA 4XWTA 2WXIA 2RLOA 1C77A 3GB1A 3HSAA 2XK5A 3KLSX 4ICUA 1XO3A 5LOPB 3E9OA 1TKYA 2JU6X 3P63A 1T0YA 1GNUA 2ABDA 4W9KA 3HVDA 3APCA 2G3QB 4C7ZA 2RQ1A 1FCCC 3DWGC 3VAWA 3ZVVA 2LYDA 2M0XA 2IDYA 2LKOA 4REZA 1Y56A 3J9CA 4HHVA 1FEHA 3PRZA 1U2BA 4IWPA 3UINB 1JRPA 3BWUD 4GZUA 5D3WA 1KC7A 2C7MB 3ZGZA 4DIXA 3OAWA 1SGHA 1VCBA 1CZPA 1N61A 2M14A 1HE8A 2J42A 1BT0A 1UNRA 2ZVOA 3OANA 4A6QA 1UWXA 1OEYJ 1TIFA 2FIDA 3VOQA 4EEWA 3SV1A 4MJSA 1LO5D 2PJHA 3ML9A 4JWSC 1ZW7A 3BYTB 4ITKA 2GJYA 2JRIB 4MGYE 1EF1A 2LOXA 1OMWA 2FCQA 4XZ4A 1S3SG 1WGQA 1F1HA 4ACFA 1MFWA 2DN6A 1ZXIA 5D3XA 2IO0B 2PVOD 5CHVC 1QQRA 1DBHA 4GDKB 3KW5B 2AWTA 1EAZA 2KT7A 1YX6B 3W9CB 3FP5A 3VFKA 4K17A 2DNFA 2ADZA 3FILB 1SHCA 1L5PA 1WRDB 1WYWB 1K8RB 2TSSA 4GU2A 2YT2A 2KYWA 4EZLA 2H89B 5DPSA 4IFSA 3PHWB 1I2HA 4KX6B 1BTNA 1STEA 2H7EA 3AEBB 1IYFA 1XT9B 2RGNB 4HATB 4II3B 3DWMA 3UF8A 3PVWA 3O65B 3KUCB 3A1QA 2KC1A 1B1ZA 2G4DB 3HVZA 4KDIC 4MM3B 1KLUD 3FSSA 3P4QB 2L1AA 3AXCA 1WZ0A 3MJ5A 1OQRA 2IBIB 3ZNHB 3RZWC 4C80A 5J3YA 1T3QA 1KZGA 2CHWA 3HM3A 1W1HA 2CQUA 4WJPA 2KOXA 2V1YA 2AEHA 2X0SA 3PHXB 3VH4B 2L8JA 4HKQA 4W9HA 3PREA 4ICVA 1R4NI 2Q5WD 1TKEA 4IOYX 1LXDA 2DAFA 2LGXA 1FXTB 2N9EB 3DBRB 1PQSA 4WVFB 2BS4B 4OVUA 1IRSA 5GMVA 2QILA 3T8MA 3FM8C 3DVNU 2X18A 1K50A 1FCLA 5JZEB 4TQ1A 3LJUX 2ZJDA 1LFDA 3QWMA 1V8CA 3NW8A 2NBUA 1SB3C 3Q3MC 4YSZB 1ZGUB 2YEPF 2NZ8B 3NWAA 4HPLB 1NENB 1RRBA 3E9PA 2YT1A 3IFWB 3N1YC 1J0GA 4LJPB 1UBQA 4ANUA 1WGKA 2RGFA 4MDKE 2H88B 2ZCBA 1XCQL 3A9JA 2OHFA 2K6DB 2LHDA 3W1YA 2KC2A 1A70A 3ZQ4A 5BYSA 2V0GA 1WF9A 4FJZA 1P7FA 1WXMA 2PW9A 5CTRC 4DHZE 2Z59B 4GMXB 3SFEB 2DKPA 1Q5WB 2PVGC 4JL9A 2VRWB 4JKBA 5HG2A 2W2WA 2ZVNA 2LASA 3ZRCA 1X86A 1F52A 5JH5C 1QLBB 1M7EA 1H4RA 4FN2A 2HTHB 2GLSA 2K8CA 4WIPA 3ENEA 1DDVA 4MSMB 1K51A 5LXIB 2M56B 2COAA 3ETRA 2Z0EB 4HSIA 4W9GA 2LWPA 3VUWA 1PDXA 1VZ8A 3RCZA 4A55A 4WWMA 1XD4A 2L52A 3HM6X 5CLLB 2KGXB 1WGYA 1UD7A 1FOEA 4CHJA 4TMAB 2MKRA 2QKMA 4CSQA 3PSEB 3L4PA 4ILJA 2NR2A 4FLHA 2WXNA 4Y94A 2BYVE 1VBHA 1QKZA 4S17A 5D27A 3PVLA 3BVMA 4XWWA 4G3XB 1L6VA 2O6VD 2IYBA 4NAWB 1L0YB 2UYZB 5AUKA 5LNK1 2RNRB 1IPGA 3O13A 1N6ZA 2K6QA 3DBHB 4LDTD 2JY6A 1Y5OA 3QBVB 1I7AA 2EC1A 3A8QA 3Q3NC 1V5PA 1V5TA 4TUUA 1CMXB 2J0JA 2INDC 2KIGA 4GB9A 1I4RA 2ON8A 2KKCA 4JKCA 2INPE 1ZC4B 4M02A 3Q2AC 5CX3A 3EHVA 2DAJA 1ZYIA 2LRUA 1SJHD 2GS0A 3RI7C 1FFUA 2D07B 3AE6B 4HJGE 4USAA 4FHJA 4US8A 3WANA 2ZCCA 2LZ6A 4WSFA 3DBLB 1B55A 2MBQA 4RF0A 4LNKA 2JWZA 3BINA 2NBVA 2GBRA 2MQJA 3SR6A 2QKLA 2L83A 3SDLC 2YSZA 1E90A 4HVBA 1B9RA 4FADA 3PEGA 2Z0OA 1P6SA 2JXTA 1JDEA 1ISNA 3KQ4A 3V6EB 1WYGA 3IHPC 2WU5B 3HRDD 2WXGA 4YSYB 3U4EG 3FKYA 1MPHA 1C79A 1FO4A 5AZHA 2UWQA 4PS7A 5G55A 1MAIA 1NVID 5KQ1A 1P3QU 2HJ8A 1TZOA 1TJ6A 4KSLC 2WH5A 1PFDA 4B0MA 4HB2B 4GLSC 1WXVA 2DX5A 2W3SA 1V89A 5LG4B 3U7ZA 1P7EA 3Q69A 2W3RA 4EZKA 4NNJB 1WY8A 2HE7A 2M1MA 2D10A 3EFCA 3U30A 2ZPYA 3V5WA 5IAAC 4H8SA 1AWDA 3QX1A 1WXSA 2PTLA 3RNFC 3W5UB 2KACA 4A3PA 1MPEA 3H9DA 4BOSC 2I38A 2LGDA 1GG3A 2LHEA 1HBKA 4A6FA 1KH0A 2MDXA 3U8ZA 4BKSD 2LEKA 2QHOA 2J0KA 4YTNB 2IPKD 3MPXA 4I6PA 1TS3A 1E8WA 2N9LA 4BOZB 4PNKA 1EO6A 1JMLA 4GIVA 2K2UA 2WLBA 2ACZB 2JZZA 2LD9A 2COPA 1BWNA 3Q8BA 1F9JA 3PZDA 1ZP0B 2VH2A 3L13A 1C4CA 2WXFA 4B6WA 1FGZA 4P7IA 4KGTA 2KDIA 3AEEB 3DCXA 1J7BA 4WAAA 1VZ6A 4KSKC 4RFBA 2UZSA 3NZUA 3AH7A 4IC7B 2KFJA 2MSED 1NYRA 2KDMA 1WGUA 5EE0A 1DYNA 4CO7A 1JRUA 1IP9A 4BKSA 1ACAA 3LDZE 3ZYYX 4PS8A 2P8VA 1YMHE 1DOYA 3A9KA 2IGDA 2KANA 3APDA 1P5TA 1PFJA 1OQQA 3FVCA 4IM0A 2KJHB 1S1QB 2KQ4X 2QDFA 3ZO5B 1UH6A 1U29A 2BT6A 2MHJA 3AMZA 3PZ8A 3B0AA 2RUKB 4TKNA 5JLJB 2GCLA 3A8PA 4F8CB 3PO0A 4LCDE 2NPTA 1KJTA 1NTVA 2L2IA 3TCAA 2MBEA 1L0XB 3ODOA 1WXAA 4BBNF 3DXCA 3AB5A 3AE9B 2J7QB 1VLBA 2DLBA 3MJWA 1J8CA 4NY0A 1XLQA 1T0SC 2BWES 1T0QC 2GBJA 2W2XD 2MRPA 1UZXB 3WALA 3MC8A 4ANXA 2DKQA 4OT1A 3PTFC 4ZDVA 1JWSD 2KN5A 3TBLD 2VZKD 3TEWA 2YS3A 1HTOA 1V49A 2LFIA 1NBFC 5AZFA 4WJ7A 1SSNA 3H8HA 1QOBA 1RFAA 2ZNVC 1WJNA 2QJLA 5FR6A 1EVHA 3Q8CA 1U4AA 1A5RA 3QA8A 1V80A 2RDBC 4HPPA 1QOGA 3NS8A 2AL3A 2DFKA 3PPAA 1WJ4A 2Y5PA 2BYTA 2M19A 4LLGM 3Q8EA 5FR3A 4EE2A 3Q3FA 1MIXA 1P3RA 1DGJA 3NVZA 5D3DA 2Z0PA 1WGDA 2J53A 4KVGB 3M1IB 4B6HA 2DX5B 1NI2A 3AE8B 5DCNA 2NS5A 1FXAA 2C9WB 2M38A 2QSDA 2M8SA 3RN9C 3CF6E 2D9XA 2INNE 4FJVB 5C3JB 3PLUA 2ROZB 3E66A 1LW3A 1VDVA 4K3BA 1SBBB 1SE4A 1V81A 5J3QA 1RYJA 2NCNA 2KJ6A 4G0NB 4MGKE 2BYEA 4W9LA 3HUIA 1HB8A 1UWMA 1M4VA 1GJZA 3RULA 2MBOA 1XX0A 5C1ZA 1J7AA 1N60A 4FBJB 2ELAA 2H7DA 4WJNA 1C3TA 4JLCA 3AE5B 1MK9B 3KUDB 1ST7A 4LDTB 2J0MA 1FGYA 3DQVA 1GUAB 1I7HA 2KTRB 5C79A 2WXMA 2KCJA 1P98A 4C7YA 1E7UA 2Z8LA 5CHWA 2OJRA 4MH0E 2XNAC 2J52A 3P42A 2CKHB 1PMSA 4GNKB 1UELA 1V5UA 2IGGA 2L0FA 2R82A 1F0ZA 4YXDB 2FJ9A 2KN4A 1FHWA 1X1MA 4M00A 4DQOC 2Z14A 3FAHA 3AE3B 1E0ZA 1P9DU 4RGTA 1ZDVA 2V3PA 2CY5A 2DX1A 3LB8C 3RT3B 1Y8RC 1D6EC 1WVHA 4LNFA 5D3VA 1HEZE 1PGBA 1WWTA 4PQ0A 3GYOA 1WH3A 2RPQA 2YT0A 3RNEC 1TJEA 3HIZA 4KIKA 5EE3A 3DHIC 1UF0A 1TXDA 2CY4A 2RSUA 1ET6A 4C56C 3FILA 4C0AA 1C4AA 4JGHB 2I1KA 3AEGB 3KH0A 3HQCA 1EWYC 1WR6E 2DZJA 2WU2B 4KAXB 2JRHA 1FD6A 2I1JA 4CHMA 4LK0M 3RNGC 4NQLB 1VRAB 2L0TA 3SBTA 4MGIE 2MCNB 1U27A 2KAJA 3VR9B 4D6WA 3AE7B 1I35A 3ZIMA 3IAS1 1FHOA 2V3NA 1R7SA 2I5CA 5HE1A 5JHHA 2D3AA 4RM8A 1RWSA 4HRSA 5T8IA 3N30A 4I6NB 1NI3A 4N9F4 1HZ6A 4LNNA 4OHJA 3E9SA 1D3ZA 3U2SC 4OW0A 2W54A 4II2B 4A6KA 3ZXRA 4HPMB 3Q8FA 4C4VA 1PGAA 1H10A 3ZNGC 2LGYA 4J3OD 5IN7A 1AQCA 1WXQA 2CB8A 2YS5A 2CODA 5EFXA 4N59A 4L2YA 2L7RA 2Z0QA 3KWLA 4Z2MB 1Q0WB 2KLGA 4W9EA 3NWDA 3QCAA 2A5UA 4MEMA 2LVPA 3AE2B 4K7SA 4YT0B 2JPHA 5E6OA 3H1UA 1Z5SB 5C5BB 4HKZE 3VTUA 4W9FA 2NTTA 2FAZA 4A6HA 3CMMB 4NAMA 5JHBA 3PZ7A 4DXGA 3NOBA 2IO2B 5IJMA 3QIJA 5E6JA 2N0YA 2XK5B 3IBEA 1SXTA 1FRRA 1YJ1A 2ROVA 1UUPA 4JKGB 3RPFC 4GOCA 1YOVB 2R09A 2KR0A 5JHGA 1D5XC 2PMVA 4HDQA 2B76B 2MA9B 1XLPA 2V3SA 2WDRB 4QXAB 4JPSA 4K2PA 4WAFA 1V5MA 2JQRB 3FEHA 2D9VA 3AV8A 1OTRB 1U5DA 3TFMA 2RRFA 1ZPSA 3N20C 4GXBA 4QAYA 1WZ3A 2RPVA 4K1RB 3R2TA 3GE8C 2MBBB 2QMTA 5FI1A 1DDMA 2IJ0A 4H2AA 3RNAC 2R2YA 1QF6A 1OQYA 1R4MB 3TEYA 1SEBD 1TZ1A 2KDEB 2PIAA 2KDBA 1WFYA 3P4RB 1V88A 3MC9A 2CHXA 2CS4A 4BKTA 1I4GA 1WI0A 2R2QA 1JROA 2N9KA 4O1NA 5J2RA 1V1OA 4YWGG 4BKGA 3BYYB 3I57A 4FHKA 1J19A 1X1FA 1XXGA 2BB6A 2ZNVB 2KD0A 3GOEA 4K3CA 4B0EA 4K7UA 4AUQC 3ODWA 1YN4A 2AYOB 2M17A 2W55A 2WDTB 4RGOS 1T0RC 4B9KA 2FUG1 3HIEA 2N23A 3ODXA 1P0RA 3NVVA 3TIXA 2JVCA 4HCPB 3V3XA 1YIWA 2NTSA 5BYRA 4ZRPA 1J0WA 1JCKB 1F2RI 2GBKA 1RAXA 3DBHI 4JE3B 4JK9A 1QOAA 2Y5BB 2D3GA 1V61A 2RDHA 4ZHOA 4ANVA 2WX1A 1NTYA 3SUZA 1FRDA 2XBBC 3LJ3A 1WG7A 1Q1OA 1KM7A 3F5RA 2X8XX 2LI5A 4OZCA 1WR1A 4TYZA 4QJ3B 1N5XA 4W9JA 1XR0B 4HB0B 2DHJA 2UVMA 2K49A 2I2YA 3VHTC 5FKAC 2Y3AA 5EDSA 3VIAA 3RZFA 1U5GA 5DH9B 1EUVB 4NJ6A 3ULCA 5JXVA 4JKAA 4BAXA 2JSVX 3UI3A 3V60A 4XWXA 2FJLA 2R0DA 3N1ZC 3AECB 3X0WA 4HAZB 1VZ7A 3KYDD 2YVCA 2GI9A 1XCGA 1BMLC 2N1VA 1R4NB 1ZSQA 2KIEA 2KTFA 2PEAA 5D94A 4JK8A 2BS2B 3MDBC 4RM9A 1SE3A 2G1EA 2DENB 1LQBA 1YJJA 2WXRA 3MC0B 3ULBA 1SE2A 4N6EB 3I3TB 1TTNA 2DYQA 4ZRKA 2L1CA 1UBIA 2LBBA 1HB6A 4HAXB 3EECA 3P7ZA 2FE8A 1FIQA 5IOIA 3R7QA 1RFKA 4US9A 2CU3A 3Q14C 4MH8A 1JWMD 3QC8B 3UIPB 3RCPA
chains in the Genus database with same CATH topology
5C23A 3JW0X 2LVOA 4BBNC 4MELA 5HE0A 1E8XA 4AJWA 1L7YA 3TMPB 4LJOB 4F7ZA 5GOWB 4GPTB 2DZMA 2LG1A 4MK0A 3QJZA 2D9YA 3KY9A 3VXWA 1DDWA 3EC8A 5D7GA 3HW2B 1R4MI 4ILGB 3WA0A 1NDDA 4DDGD 3B1LX 2C60A 3IG3A 3ZDMC 2GBMA 1ZVRA 3JSVB 4GN1A 1XD3B 3PV1A 2GCJA 2IZVB 3A33B 3CSFA 5L81A 4HAYB 4A3OA 5DPTA 4GDKA 4DDID 4PS3A 4YONA 4YL8A 2C5LC 4J6IA 3WAMA 2FCNA 3QWZB 1GGOA 5KHQA 2C7HA 3VUXA 2W2XC 3AU5A 5KHOA 4M8NA 5L95C 5G2NA 1V5OA 3ZDTA 1N3HA 2O6VA 2W9NA 2KFKB 5TR5A 4Z2NA 2MWNB 4MM3A 1XKEA 3F0WA 2Y7BA 2D9WA 2DYMA 4BVUC 3NSUA 2NBWB 4WJQA 3ONSA 2MW5A 3UQBA 3NY5A 1QC6A 3V62A 2K8HA 4JKEA 1X05A 2OTXA 3UGBB 4W9IA 1AARA 4WWPA 3D8DA 4WQOB 3UZTA 3OJ4B 2O6VB 4X57B 3H7PB 1K5DB 1V6EA 2K25A 3VTWA 3MTNB 4WWNA 1MIZB 1SE9A 3EPYA 2JT4B 4DXAB 2PE6B 4FJYA 3VDZA 4AWJA 1U5FA 2ELBA 2BYFA 3UIOB 3WAPA 2GOWA 2BCJA 1WE7A 4E74A 1Z2MA 1VBGA 4IWQA 2BPSA 1OQNA 3M95A 2HD5B 1TBEA 3B08A 3SBGA 4AJYB 1X1GA 3OJ3A 3D32A 1OGWA 3VH3B 3FLVA 1MKEA 3SO6A 4GSWA 2KX3A 4W9CA 5J18A 2V76A 3ZUNA 3PLVA 2DIKA 3PT2B 1UEFA 1FHXA 5AZGA 3AJ4A 2VKIA 4BBKA 4MJSB 2V4LA 2DHKA 2KVRA 2EKEC 4JIOU 3ZW3A 3ML4A 3QQ8B 4HAWB 2KTRA 2AL6A 2JZ3B 2DHZA 2P0DA 3P2BA 2KDFB 1KI1B 1WX8A 3R66C 3KYCD 4HJKA 2MFQA 1W1DA 2M4NA 4PYZA 2DLWA 2YRYA 3A9KB 4WJOA 3AU4A 3V6CB 3V61A 2DZIA 3ENBA 3RUIB 4JKFA 2IY0B 4K7WA 1WJ1A 4GGQA 2LXCA 3OLMD 5E6NA 1OY2A 2RR9A 1UPRA 3ECIA 2NPTB 3L0WB 4DX90 1M7RA 4DHZB 2R2OA 3L10B 3C0RB 3NZSA 1WM3A 2FUHB 2REXA 3M3JA 3DVNV 5DPRA 3AI5A 3KUZA 1QZEA 2G35A 1G6JA 2VSZA 2KNBA 1E8YA 4KV2A 3VUYA 2BWFA 3ALBA 3DVGX 2RVBB 4ASWC 2ASQA 3T9LA 2JXXA 4D0NB 2KWVB 1Z87A 2MP2A 2K2JA 4KHOA 3VTVA 2N7DA 4AP4C 2RSGA 1UNPA 2IY1B 1VD2A 3L17A 4EKUA 3G9WA 5JVLA 5JP4A 5LLIA 4FULA 4L6EA 3PS6A 4M0WB 5C5BA 2CAYA 2GMIC 4KZCA 2FCSA 4NJ7A 4XX5A 3IVFA 4KHBB 4IM2A 1KZ7A 2HTHA 1WMHB 1DIKA 3DBSA 3O96A 2FCMA 2L00B 4JKGA 1H8CA 5LXHA 2KLCA 1RRPB 2N7EA 2Y8FA 4IM3A 2JF5A 4BFRA 4F7UP 3DVGY 1EGXA 4E71A 3KRXA 2D2QA 1WX9A 2CRFA 3ZNID 4DBBA 2KWCA 2E2XA 4PYUA 1V2YA 4IG7B 5IA7A 1QQGA 2MX2A 3N3KB 3PP2A 2KMCA 4NAWA 2IO1B 3QARA 2D9ZA 1WGHA 2EMSA 2JP2A 1E5WA 3A4RA 4JQWC 5KCVA 2BKFA 3APFA 3CIKA 4W9DA 2N4FA 2DZKA 4DBGA 2O2VB 3QK0A 4WWOA 3AULA 4HXDA 4MT7A 2K00A 2ZPNA 4XC2A 4I6LB 1ZM0A 3K9OB 4ILHA 3VVWB 1ZKHA 2G4SA 3CSTA 4KIKB 1P1AA 4G11A 3DBLI 1WGRA 5FI0A 2DYOA 4AOFA 1WJ6A 3PGEA 2CR5A 2O2VA 3D8FA 2GBNA 1M94A 2DYNA 2KFKA 4CHKA 2Q13A 3DBRI 4EFOA 3L08A 5J17A 5D6JB 2DTCA 4JKDA 2KXJA 1WJMA 3WYFB 4NPNA 4FA6A 3A98B 5CHFA 1WI1A 3H7PA 3QAQA 2EMTA 4B95A 1KBLA 2KZRA 2WX0A 1OEYA 2C7NB 3TO1A 3RD2A 3JYUA 4EZJA 2J59M 2K39A 1PLSA 3KZ1A 2LXAA 2MP2B 3U7DA 2KJRA 5HKHA 5D3YA 3H6NA 3CXBB 2KK8A 4HAUB 3ZKJC 4A20A 2IFSA 2L3ZA 3W1SC 2WYQA 4EJNA 3P6AA 1RJ2A 3QHTA 3RYTA 3E9LA 2BF8B 3L54A 3ML8A 2OOBB 3ZLZA 1UGMA 5C16A 5KQ4A 2FNJB 2KQSA 1WJUA 4KHAA 4RMAA 3M62B 2N9PC 1GC7A 2JUOA 4URKA 1MK7B 3EFUA 1EF5A 2CU1A 5J3TA 2YF0A 2ZZPB 3X23A 4OVVA 5D2MB 2KUPA 1XODA 1ZC3B 2LOZA 1TGZB 2MBHA 4DX8A 1E8ZA 2L05A 1Y19B 1YD8U 2LRWA 2A4ZA 3JSVA 1W1GA 4ZRJA 2Z0DB 5DI9B 5BO4B 3KSYA 1GC6A 1BAKA 4NSWA 2K8BA 4F7GA 3DXEA 2Y8GA 4KZ0A 5HE2A 1WX7A 1LM8B 2NBVB 5CLQB 3N7CA 4HAVB 4DWFA 1AWEA 1U5EA 5AEKB 2P0HA 4GDLA 2OQBA 1DROA 3PVUA 2YS1A 2WWZA 4IAPA 2KHWB 1NTIA 2BKRB 1SIFA 4F1SA 3TJPA 3SYXA 3ZNZB 2LVQA 5HE3A 4HB4B 2UZRA 4JKHA 5DPWA 4ZRIA 2DA0A 4TV3A 2PE9A 2FDQA 4HB3B 4MSQB 4KDLB 4IW0A 4E3CA 3GYPA 2LJ5A 3L16A 2EJ8A 4GDLB 3ZRFA 1RLFA 4JK7A 4F7HA 1V86A 4CYEA 3DOWA 4IWOA 3A9JB 2N1WA 4ANWA 1FB8A 3D8EA 1XQQA 1E7VA 3S2AA 3Q3JA 3DXDA 3ZTDA 2VRRB 2P0FA 3DCGA 4TQ0A 4K2OA 1WM2A 2YLMA 5L83A 4A6FB 2ZEQA 2NVUI 4HWIB 4IUMB 2XQNM 4ZYNA 4HDOA 1LB1A 1C1YB 2BGFA 4MGZE 3ZTCA 3A4SC 1NU2A 3KVFB 2XEWA 2DYBA 3DDCB 1UPQA 3DPDA 2HRJA 3ZVRA 1UNQA 1V9JA 2FIFA 1BTKA 1WMHA 4G50A 2LULA 5JHAA 1NVLA 4A5KA 3JVZX 5E6PA 3SHQA 3BJIA 1X11A 2KQ7A 1KOTA 5DHFB 3T06A 4MY6A 3NHEB 2COFA 3R3MA 3PRPB 2LUEA 3W1SA 2COCA 2I5FA 2RD0A 3UQAA 2KX0A 1WIAA 2G45B 1WE6A 2CHZA 2L76A 3A1QB 4HK2A 3TL5A 4M8MA 3TW1A 2IO3B 5DIFB 2KWUB 3PSCA 3HHMA 3K9PB 1MG8A 1K5GB 4HLEA 3HK0A 5LONB 4EMOA 3R7RA 2PZ1A 2MLBA 2KO3A 4HCNB 3WIMA 3WAOA 2PPHA 1L2NA 3SU8X 2MWSB 3KRWA 5DHAB 3PRMB 2N9XA 4DHJB 1WGGA 3M63B 3H7SA 4GMVA 4NQKE 1TQZA 1YX5B 4DK5A 4EUTA 1KLVA 5C6RA 1YQBA 1Q67A 4EOYA 3PG7A 2B3AA 3SNHA 2K1FA 2NMBA 2IYDB 1FAOA 2D4QA 4DHJD 3GZNI 1I42A 3VQIA 4K81A 3N32A 3BY4B 3MHSD 3SD5A 2DHIA 2KMAA 2D11A 3TVVA 2RLOA 2XK5A 4ICUA 5LOPB 3E9OA 1T0YA 1GNUA 2ABDA 4W9KA 3APCA 2G3QB 2RQ1A 3VAWA 3ZVVA 2LYDA 2M0XA 2LKOA 4HHVA 3PRZA 1U2BA 4IWPA 3UINB 4GZUA 5D3WA 1KC7A 2C7MB 3OAWA 1SGHA 1VCBA 2M14A 1HE8A 1BT0A 1UNRA 2ZVOA 3OANA 1OEYJ 2FIDA 3VOQA 4EEWA 3SV1A 4MJSA 2PJHA 3ML9A 1ZW7A 2GJYA 2JRIB 4MGYE 1EF1A 2LOXA 1OMWA 2FCQA 4XZ4A 1S3SG 1WGQA 2DN6A 5D3XA 2IO0B 5CHVC 1DBHA 4GDKB 3KW5B 2AWTA 1EAZA 1YX6B 3FP5A 3VFKA 4K17A 2ADZA 1SHCA 1WRDB 1WYWB 1K8RB 4GU2A 4EZLA 5DPSA 4IFSA 3PHWB 1I2HA 1BTNA 2H7EA 1IYFA 1XT9B 2RGNB 4HATB 4II3B 3UF8A 3PVWA 3O65B 3KUCB 3A1QA 2KC1A 2G4DB 4KDIC 3FSSA 3AXCA 1WZ0A 2IBIB 3ZNHB 3RZWC 5J3YA 1KZGA 2CHWA 3HM3A 1W1HA 2CQUA 4WJPA 2KOXA 2V1YA 2AEHA 2X0SA 3PHXB 3VH4B 2L8JA 4W9HA 3PREA 4ICVA 1R4NI 4IOYX 1LXDA 2DAFA 2LGXA 1FXTB 2N9EB 1PQSA 4WVFB 4OVUA 1IRSA 5GMVA 3T8MA 3FM8C 3DVNU 2X18A 5JZEB 4TQ1A 3LJUX 2ZJDA 1LFDA 3QWMA 2NBUA 1ZGUB 2NZ8B 4HPLB 1RRBA 3E9PA 2YT1A 3IFWB 1J0GA 4LJPB 1UBQA 4ANUA 2RGFA 4MDKE 2ZCBA 3A9JA 2K6DB 3W1YA 2KC2A 1WF9A 4FJZA 1WXMA 5CTRC 4DHZE 2Z59B 4GMXB 2DKPA 1Q5WB 4JL9A 2VRWB 4JKBA 2W2WA 2ZVNA 2LASA 3ZRCA 1X86A 5JH5C 1M7EA 1H4RA 4FN2A 2HTHB 2K8CA 3ENEA 1DDVA 4MSMB 5LXIB 2COAA 2Z0EB 4W9GA 2LWPA 3VUWA 3RCZA 1XD4A 3HM6X 5CLLB 2KGXB 1WGYA 1UD7A 1FOEA 4CHJA 2MKRA 2QKMA 3PSEB 4ILJA 2NR2A 4FLHA 4Y94A 2BYVE 1VBHA 5D27A 3PVLA 4G3XB 2O6VD 2IYBA 4NAWB 2UYZB 2RNRB 1IPGA 2K6QA 4LDTD 2JY6A 1Y5OA 3QBVB 1I7AA 2EC1A 3A8QA 1V5PA 1V5TA 4TUUA 1CMXB 2J0JA 4GB9A 2KKCA 4JKCA 1ZC4B 5CX3A 3EHVA 2DAJA 2LRUA 2GS0A 2D07B 4FHJA 3WANA 2ZCCA 2LZ6A 4WSFA 1B55A 2MBQA 2JWZA 3BINA 2GBRA 2MQJA 2QKLA 3SDLC 2YSZA 1E90A 4HVBA 4FADA 3PEGA 2Z0OA 1P6SA 1JDEA 1ISNA 3V6EB 3IHPC 1MPHA 5AZHA 2UWQA 4PS7A 5G55A 1MAIA 5KQ1A 1P3QU 2HJ8A 1TJ6A 4KSLC 2WH5A 4HB2B 1WXVA 2DX5A 1V89A 4EZKA 4NNJB 1WY8A 2HE7A 2M1MA 2D10A 3U30A 2ZPYA 3V5WA 5IAAC 4H8SA 3QX1A 1WXSA 4A3PA 3H9DA 4BOSC 2LGDA 1GG3A 1HBKA 4A6FA 3U8ZA 2MDXA 4BKSD 2QHOA 2J0KA 3MPXA 4I6PA 1E8WA 4BOZB 4PNKA 1EO6A 4GIVA 2K2UA 2JZZA 2LD9A 2COPA 1BWNA 1F9JA 3PZDA 3L13A 4B6WA 1FGZA 4P7IA 2KDIA 4WAAA 4KSKC 2UZSA 3NZUA 4IC7B 2KFJA 2MSED 1WGUA 1DYNA 4CO7A 1JRUA 1IP9A 4BKSA 1ACAA 3LDZE 4PS8A 2P8VA 3A9KA 2KANA 3APDA 1P5TA 1PFJA 4IM0A 2KJHB 1S1QB 3ZO5B 1UH6A 1U29A 3B0AA 2RUKB 4TKNA 5JLJB 2GCLA 3A8PA 4F8CB 4LCDE 2NPTA 1KJTA 1NTVA 2L2IA 3TCAA 2MBEA 3ODOA 1WXAA 4BBNF 3DXCA 2J7QB 3MJWA 1J8CA 4NY0A 2BWES 2GBJA 2W2XD 2MRPA 1UZXB 3WALA 4ANXA 2DKQA 3PTFC 4ZDVA 2KN5A 3TBLD 2YS3A 1V49A 1NBFC 5AZFA 4WJ7A 1RFAA 2ZNVC 1WJNA 5FR6A 1EVHA 1U4AA 1A5RA 3QA8A 1V80A 3NS8A 2AL3A 2DFKA 3PPAA 1WJ4A 3Q3FA 1MIXA 1P3RA 2Z0PA 1WGDA 4KVGB 3M1IB 4B6HA 2DX5B 1NI2A 5DCNA 2NS5A 2C9WB 2M38A 2M8SA 3CF6E 2D9XA 4FJVB 3PLUA 2ROZB 3E66A 1LW3A 1V81A 5J3QA 2NCNA 2KJ6A 4G0NB 4MGKE 2BYEA 4W9LA 1HB8A 1GJZA 3RULA 2MBOA 1XX0A 5C1ZA 4FBJB 2ELAA 2H7DA 4WJNA 1C3TA 4JLCA 1MK9B 3KUDB 1ST7A 4LDTB 2J0MA 1FGYA 3DQVA 1GUAB 2KTRB 5C79A 2KCJA 1P98A 1E7UA 5CHWA 2OJRA 4MH0E 2CKHB 1PMSA 1UELA 1V5UA 2L0FA 2R82A 2FJ9A 1FHWA 1X1MA 1P9DU 2CY5A 2DX1A 3RT3B 1Y8RC 1WVHA 5D3VA 4PQ0A 3GYOA 1WH3A 2RPQA 2YT0A 3HIZA 4KIKA 1TXDA 2CY4A 2RSUA 4C0AA 4JGHB 2I1KA 3KH0A 3HQCA 1WR6E 2DZJA 4KAXB 2JRHA 2I1JA 4CHMA 4NQLB 2L0TA 3SBTA 4MGIE 2MCNB 1U27A 1I35A 3ZIMA 1FHOA 2I5CA 5HE1A 5JHHA 4RM8A 3N30A 4I6NB 4N9F4 1D3ZA 4II2B 4A6KA 4HPMB 1H10A 3ZNGC 2LGYA 1AQCA 2CB8A 2YS5A 2CODA 5EFXA 2L7RA 2Z0QA 4Z2MB 1Q0WB 2KLGA 4W9EA 3QCAA 2A5UA 4MEMA 2LVPA 4K7SA 2JPHA 5E6OA 3H1UA 1Z5SB 5C5BB 3VTUA 4W9FA 2FAZA 4A6HA 3CMMB 5JHBA 3NOBA 2IO2B 5IJMA 3QIJA 2N0YA 2XK5B 3IBEA 1YJ1A 2ROVA 4JKGB 4GOCA 2R09A 5JHGA 4HDQA 2MA9B 2V3SA 4K2PA 1V5MA 3FEHA 2D9VA 1OTRB 1U5DA 3TFMA 4GXBA 1WZ3A 4K1RB 2MBBB 5FI1A 1DDMA 1OQYA 1TZ1A 2KDEB 2KDBA 1WFYA 1V88A 2CHXA 2CS4A 4BKTA 1WI0A 2R2QA 5J2RA 4BKGA 4FHKA 1J19A 1X1FA 2ZNVB 2KD0A 3GOEA 4K7UA 4AUQC 3ODWA 2AYOB 2M17A 2WDTB 4B9KA 2N23A 3ODXA 1P0RA 3TIXA 2JVCA 4HCPB 1YIWA 1J0WA 2GBKA 1RAXA 3DBHI 4JK9A 2Y5BB 2D3GA 1V61A 4ANVA 2WX1A 1NTYA 3SUZA 2XBBC 3LJ3A 1WG7A 1Q1OA 1KM7A 3F5RA 2LI5A 1WR1A 4TYZA 4W9JA 1XR0B 4HB0B 2DHJA 2UVMA 3VHTC 5EDSA 3VIAA 3RZFA 1U5GA 5DH9B 1EUVB 4NJ6A 3ULCA 4JKAA 3V60A 4XWXA 2FJLA 2R0DA 3X0WA 4HAZB 3KYDD 2YVCA 1XCGA 2N1VA 1ZSQA 2PEAA 2KTFA 5D94A 4JK8A 3MDBC 4RM9A 2DENB 1LQBA 3ULBA 3I3TB 1TTNA 2DYQA 4ZRKA 2L1CA 1UBIA 2LBBA 1HB6A 4HAXB 3EECA 3P7ZA 3R7QA 3QC8B 3UIPB 3RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O B;  2XK5 A;  4ICU A;  5C23 A;  4LCD E;  5LOP B;  3VVW B;  2NPT A;  1T0Y A;  1KJT A;  1NTV A;  2L2I A;  1GNU A;  2LVO A;  3JW0 X;  3TCA A;  2MBE A;  1ZKH A;  2G4S A;  4W9K A;  4BBN C;  3APC A;  3ODO A;  1WXA A;  2G3Q B;  4BBN F;  3CST A;  3DXC A;  4MEL A;  5HE0 A;  2J7Q B;  1E8X A;  4AJW A;  4KIK B;  3VAW A;  3ZVV A;  1P1A A;  2LYD A;  1L7Y A;  2M0X A;  3DBL I;  3MJW A;  2LKO A;  4G11 A;  1J8C A;  4NY0 A;  3TMP B;  4LJO B;  4HHV A;  1WGR A;  2BWE S;  3PRZ A;  4F7Z A;  5FI0 A;  1U2B A;  2GBJ A;  2W2X D;  2MRP A;  1UZX B;  2DYO A;  3WAL A;  4AOF A;  5GOW B;  4IWP A;  3UIN B;  4GPT B;  1WJ6 A;  2DZM A;  4ANX A;  2LG1 A;  3PGE A;  2DKQ A;  2CR5 A;  4GZU A;  2O2V A;  3PTF C;  4MK0 A;  4ZDV A;  3D8F A;  2KN5 A;  5D3W A;  3TBL D;  3QJZ A;  2C7M B;  2D9Y A;  3KY9 A;  2GBN A;  1M94 A;  2DYN A;  2KFK A;  3VXW A;  3OAW A;  1SGH A;  1VCB A;  2YS3 A;  1DDW A;  2M14 A;  3EC8 A;  5D7G A;  1HE8 A;  1V49 A;  4CHK A;  3HW2 B;  1NBF C;  1R4M I;  1BT0 A;  1UNR A;  2ZVO A;  3OAN A;  3WA0 A;  2Q13 A;  1NDD A;  1OEY J;  3DBR I;  4WJ7 A;  5AZF A;  4DDG D;  2FID A;  3B1L X;  4EFO A;  3L08 A;  5J17 A;  3VOQ A;  4EEW A;  5D6J B;  3SV1 A;  2DTC A;  1RFA A;  2C60 A;  4MJS A;  2ZNV C;  1WJN A;  2PJH A;  3ML9 A;  3IG3 A;  2KXJ A;  5FR6 A;  1ZW7 A;  1EVH A;  2GJY A;  3ZDM C;  2JRI B;  4MGY E;  1U4A A;  1WJM A;  1EF1 A;  3WYF B;  4W9E A;  1A5R A;  2GBM A;  1ZVR A;  3JSV B;  4NPN A;  2LOX A;  1OMW A;  2FCQ A;  4XZ4 A;  4GN1 A;  1XD3 B;  1S3S G;  4FA6 A;  1WGQ A;  3A98 B;  2DN6 A;  3PV1 A;  2GCJ A;  2IZV B;  3A33 B;  3CSF A;  5D3X A;  4HAY B;  5L81 A;  2IO0 B;  3QA8 A;  4A3O A;  5DPT A;  4GDK A;  1V80 A;  4DDI D;  5CHF A;  4PS3 A;  5CHV C;  1WI1 A;  4YON A;  1DBH A;  3H7P A;  2AL3 A;  3NS8 A;  3KW5 B;  2DFK A;  3PPA A;  3QAQ A;  2EMT A;  4GDK B;  4B95 A;  1WJ4 A;  2AWT A;  2KZR A;  1EAZ A;  4YL8 A;  1YX6 B;  2C5L C;  2WX0 A;  1OEY A;  4J6I A;  3WAM A;  2FCN A;  3VFK A;  3Q3F A;  2C7N B;  1MIX A;  1P3R A;  3TO1 A;  3RD2 A;  4K17 A;  3JYU A;  2ADZ A;  3QWZ B;  5KHQ A;  2Z0P A;  1WGD A;  2J59 M;  1SHC A;  4KVG B;  2C7H A;  4EZJ A;  2K39 A;  3M1I B;  3VUX A;  1PLS A;  2W2X C;  1WRD B;  3KZ1 A;  1WYW B;  2LXA A;  1K8R B;  4B6H A;  2DX5 B;  1NI2 A;  3U7D A;  2MP2 B;  5DCN A;  2KJR A;  4GU2 A;  5HKH A;  3AU5 A;  4EZL A;  5D3Y A;  3H6N A;  2NS5 A;  5DPS A;  3CXB B;  2KK8 A;  5KHO A;  2C9W B;  2M38 A;  4HAU B;  4M8N A;  4IFS A;  2M8S A;  5L95 C;  5G2N A;  3ZKJ C;  4A20 A;  1V5O A;  3ZDT A;  1N3H A;  2IFS A;  3PHW B;  3CF6 E;  2D9X A;  2L3Z A;  4FJV B;  5E6N A;  1I2H A;  2O6V A;  3PLU A;  1BTN A;  2ROZ B;  2H7E A;  3W1S C;  1LW3 A;  2W9N A;  2WYQ A;  1IYF A;  4EJN A;  1XT9 B;  2RGN B;  3P6A A;  4HAT B;  2KFK B;  4II3 B;  1V81 A;  5TR5 A;  1RJ2 A;  5J3Q A;  3QHT A;  3RYT A;  3UF8 A;  3PVW A;  2NCN A;  2KJ6 A;  3O65 B;  4G0N B;  4B6W A;  4MGK E;  2BYE A;  4Z2N A;  4W9L A;  2BF8 B;  2MWN B;  3A1Q A;  3KUC B;  3L54 A;  3ML8 A;  2OOB B;  4MM3 A;  2KC1 A;  1GJZ A;  3RUL A;  2G4D B;  2MBO A;  1XKE A;  3F0W A;  3ZLZ A;  1UGM A;  1XX0 A;  2Y7B A;  5C16 A;  4KDI C;  5C1Z A;  3FSS A;  2D9W A;  3AXC A;  1WZ0 A;  2IBI B;  3ZNH B;  2DYM A;  4BVU C;  2ELA A;  5KQ4 A;  2FNJ B;  3NSU A;  2NBW B;  3RZW C;  4FBJ B;  4WJQ A;  3ONS A;  2MW5 A;  3UQB A;  2H7D A;  5J3Y A;  2KQS A;  3NY5 A;  4WJN A;  1C3T A;  1KZG A;  1QC6 A;  1WJU A;  2CHW A;  3HM3 A;  4JLC A;  1W1H A;  4KHA A;  1MK9 B;  2K8H A;  2KOX A;  3KUD B;  4WJO A;  2V1Y A;  4WJP A;  3V62 A;  2AEH A;  3PHX B;  4RMA A;  4LDT B;  2J0M A;  3VH4 B;  2L8J A;  3M62 B;  1FGY A;  1X05 A;  2OTX A;  3DQV A;  1GUA B;  3PRE A;  4ICV A;  4W9H A;  4W9I A;  3UGB B;  1AAR A;  2KTR B;  2N9P C;  4WWP A;  5C79 A;  1GC7 A;  2KCJ A;  3D8D A;  1P98 A;  1R4N I;  1E7U A;  2JUO A;  3UZT A;  4WQO B;  5CHW A;  4URK A;  2OJR A;  4IOY X;  1MK7 B;  1LXD A;  2DAF A;  1EF5 A;  2LGX A;  2O6V B;  3EFU A;  3OJ4 B;  4MH0 E;  2CU1 A;  1FXT B;  4X57 B;  5J3T A;  2N9E B;  3H7P B;  2YF0 A;  2CKH B;  1PQS A;  1PMS A;  1UEL A;  1K5D B;  4WVF B;  1V6E A;  1V5U A;  2K25 A;  2ZZP B;  3X23 A;  1IRS A;  2L0F A;  3MTN B;  4OVV A;  4OVU A;  2KUP A;  5D2M B;  5GMV A;  1XOD A;  3NZU A;  4WWN A;  3T8M A;  3FM8 C;  1MIZ B;  3DVN U;  1ZC3 B;  1FHW A;  2LOZ A;  2X18 A;  1X1M A;  1SE9 A;  5JZE B;  4TQ1 A;  1TGZ B;  2MBH A;  3LJU X;  2JT4 B;  1LFD A;  2ZJD A;  3QWM A;  4DXA B;  2PE6 B;  4FJY A;  3VDZ A;  2NBU A;  4DX8 A;  1E8Z A;  2L05 A;  1Y19 B;  1ZGU B;  4AWJ A;  1U5F A;  1YD8 U;  2ELB A;  2NZ8 B;  1P9D U;  2BYF A;  1RRB A;  4HPL B;  2YT1 A;  3IFW B;  2LRW A;  3UIO B;  3VTW A;  2A4Z A;  3JSV A;  4LJP B;  3WAP A;  1UBQ A;  2GOW A;  1W1G A;  2BCJ A;  2CY5 A;  2DX1 A;  4ZRJ A;  1WE7 A;  4ANU A;  1Z2M A;  3RT3 B;  4E74 A;  1Y8R C;  2RGF A;  4ZYN A;  4MDK E;  2Z0D B;  1WVH A;  2ZCB A;  5D3V A;  5DI9 B;  5BO4 B;  3A9J A;  4IWQ A;  2BPS A;  2K6D B;  3KSY A;  4PQ0 A;  1GC6 A;  1OQN A;  2KC2 A;  3W1Y A;  3GYO A;  1BAK A;  1WH3 A;  2RPQ A;  3M95 A;  2YT0 A;  1WF9 A;  4NSW A;  2K8B A;  4F7G A;  3HIZ A;  4KIK A;  2HD5 B;  4FJZ A;  3DXE A;  1TBE A;  2Y8G A;  1WXM A;  4KZ0 A;  5HE2 A;  3B08 A;  1TXD A;  2CY4 A;  1WX7 A;  2RSU A;  1LM8 B;  5CTR C;  2NBV B;  4C0A A;  1X1G A;  3OJ3 A;  4AJY B;  5CLQ B;  4JGH B;  2I1K A;  4DHZ E;  3D32 A;  3KH0 A;  3HQC A;  3N7C A;  4HAV B;  4GMX B;  1OGW A;  2Z59 B;  4DWF A;  4K7W A;  1AWE A;  1U5E A;  3VH3 B;  5AEK B;  1WR6 E;  2DKP A;  1MKE A;  2P0H A;  3SO6 A;  1Q5W B;  2DZJ A;  4KAX B;  2JRH A;  4GSW A;  2I1J A;  2OQB A;  2VRW B;  2KX3 A;  4GDL A;  4W9C A;  4CHM A;  1DRO A;  2W2W A;  5J18 A;  3PVU A;  2YS1 A;  2ZVN A;  2LAS A;  4NQL B;  3ZRC A;  5JLJ B;  2WWZ A;  1X86 A;  5JH5 C;  2V76 A;  2L0T A;  4IAP A;  4MGI E;  2KHW B;  2MCN B;  3ZUN A;  1U27 A;  1M7E A;  1H4R A;  2BKR B;  3PLV A;  1SIF A;  4FN2 A;  4F1S A;  2HTH B;  3TJP A;  3PT2 B;  3SYX A;  3ZNZ B;  1I35 A;  3ZIM A;  1UEF A;  2LVQ A;  1FHX A;  5AZG A;  1FHO A;  5HE3 A;  4HB4 B;  2K8C A;  3AJ4 A;  3ENE A;  1DDV A;  2VKI A;  4BBK A;  4MJS B;  2V4L A;  2I5C A;  2DHK A;  4MSM B;  5LXI B;  2COA A;  2UZR A;  5HE1 A;  5JHH A;  4RM8 A;  5DPW A;  4ZRI A;  2KVR A;  2Z0E B;  2DA0 A;  2EKE C;  4JIO U;  3ZW3 A;  3ML4 A;  3N30 A;  4I6N B;  2LWP A;  3QQ8 B;  4TV3 A;  2PE9 A;  4W9G A;  3VUW A;  4HAW B;  4HB3 B;  4MSQ B;  3RCZ A;  4N9F 4;  2KTR A;  1XD4 A;  4KDL B;  3HM6 X;  4IW0 A;  4E3C A;  5CLL B;  1D3Z A;  2AL6 A;  2KGX B;  3GYP A;  2JZ3 B;  2DHZ A;  4II2 B;  2LJ5 A;  2P0D A;  4A6K A;  1WGY A;  1UD7 A;  3L16 A;  1FOE A;  4CHJ A;  4HPM B;  2EJ8 A;  1H10 A;  4GDL B;  3ZNG C;  3ZRF A;  2LGY A;  2MKR A;  1RLF A;  1AQC A;  3P2B A;  2KDF B;  2QKM A;  4F7H A;  1V86 A;  1KI1 B;  3PSE B;  1WX8 A;  2YS5 A;  4CYE A;  3R66 C;  2NR2 A;  3DOW A;  4FLH A;  4Y94 A;  2BYV E;  3A9J B;  3KYC D;  4HJK A;  4IWO A;  2COD A;  2N1W A;  4ANW A;  5EFX A;  2MFQ A;  1FB8 A;  5D27 A;  3PVL A;  2L7R A;  1W1D A;  2M4N A;  4G3X B;  2Z0Q A;  2O6V D;  3D8E A;  2IYB A;  1XQQ A;  4NAW B;  4PYZ A;  2DLW A;  2UYZ B;  1E7V A;  2YRY A;  4Z2M B;  2RNR B;  1IPG A;  1Q0W B;  3A9K B;  2KLG A;  3S2A A;  3Q3J A;  3AU4 A;  3QCA A;  2A5U A;  3DXD A;  2K6Q A;  2LVP A;  4K7S A;  2VRR B;  4MEM A;  2P0F A;  3ZTD A;  2JPH A;  4LDT D;  3DCG A;  5E6O A;  2JY6 A;  3H1U A;  1Y5O A;  3QBV B;  1Z5S B;  3V6C B;  5C5B B;  1I7A A;  2DZI A;  3V61 A;  3VTU A;  2EC1 A;  4TQ0 A;  3A8Q A;  4K2O A;  4W9F A;  1V5P A;  1V5T A;  4TUU A;  1CMX B;  1WM2 A;  4A6H A;  2FAZ A;  2YLM A;  3CMM B;  3RUI B;  4A6F B;  2J0J A;  2ZEQ A;  2NVU I;  5JHB A;  5L83 A;  4HWI B;  2IY0 B;  4GB9 A;  1WJ1 A;  4GGQ A;  3NOB A;  2KKC A;  2IO2 B;  2LXC A;  1ZC4 B;  3QIJ A;  3OLM D;  4IUM B;  2N0Y A;  2XQN M;  5CX3 A;  2XK5 B;  4HDO A;  1YJ1 A;  2DAJ A;  1OY2 A;  2ROV A;  1LB1 A;  2RR9 A;  3EHV A;  3IBE A;  1UPR A;  1C1Y B;  2LRU A;  2NPT B;  3ECI A;  4GOC A;  3L0W B;  2GS0 A;  4DX9 0;  2R09 A;  1M7R A;  2BGF A;  2D07 B;  4DHZ B;  4MGZ E;  2R2O A;  5JHG A;  4FHJ A;  3ZTC A;  3A4S C;  4HDQ A;  3L10 B;  1NU2 A;  2MA9 B;  3KVF B;  2V3S A;  3C0R B;  3WAN A;  2ZCC A;  3NZS A;  2LZ6 A;  2XEW A;  4WSF A;  1WM3 A;  4K2P A;  2DYB A;  2FUH B;  2REX A;  3DDC B;  1V5M A;  3M3J A;  1B55 A;  3FEH A;  2D9V A;  1OTR B;  3DVN V;  1UPQ A;  1U5D A;  3TFM A;  5DPR A;  2MBQ A;  3DPD A;  4GXB A;  2JWZ A;  3BIN A;  1WZ3 A;  3ZVR A;  2GBR A;  1UNQ A;  2MQJ A;  4K1R B;  2QKL A;  3SDL C;  1V9J A;  2YSZ A;  1E90 A;  2FIF A;  4HVB A;  1BTK A;  4FAD A;  3PEG A;  2MBB B;  1WMH A;  2Z0O A;  3AI5 A;  1P6S A;  3KUZ A;  1ISN A;  4G50 A;  1QZE A;  3V6E B;  2G35 A;  2LUL A;  1G6J A;  5FI1 A;  2VSZ A;  1DDM A;  2KNB A;  5JHA A;  3IHP C;  1E8Y A;  4KV2 A;  3VUY A;  5J2R A;  2BWF A;  1OQY A;  3ALB A;  1MPH A;  3DVG X;  2RVB B;  5AZH A;  4A5K A;  2UWQ A;  1TZ1 A;  3JVZ X;  4PS7 A;  2KDE B;  5G55 A;  4ASW C;  2KDB A;  1WFY A;  1MAI A;  2ASQ A;  3T9L A;  1V88 A;  5KQ1 A;  1P3Q U;  2CHX A;  2CS4 A;  2HJ8 A;  5E6P A;  4BKT A;  2JXX A;  1WI0 A;  1TJ6 A;  4D0N B;  2R2Q A;  4KSL C;  3SHQ A;  2KWV B;  3BJI A;  1Z87 A;  1X11 A;  2KQ7 A;  4HB2 B;  1KOT A;  1WXV A;  2DX5 A;  2K2J A;  4KHO A;  5DHF B;  3T06 A;  4MY6 A;  2MP2 A;  3NHE B;  2N7D A;  3VTV A;  1V89 A;  4AP4 C;  4BKG A;  2RSG A;  2COF A;  1UNP A;  2IY1 B;  1VD2 A;  4FHK A;  3L17 A;  4EKU A;  1J19 A;  1X1F A;  3R3M A;  3G9W A;  2ZNV B;  2KD0 A;  3GOE A;  4EZK A;  3PRP B;  4K7U A;  5JP4 A;  4NNJ B;  2LUE A;  5LLI A;  3W1S A;  4AUQ C;  3ODW A;  2COC A;  2I5F A;  2AYO B;  4FUL A;  2M17 A;  2RD0 A;  4L6E A;  2WDT B;  3UQA A;  4B9K A;  2KX0 A;  1WIA A;  2N23 A;  3ODX A;  1P0R A;  1WE6 A;  2G45 B;  1WY8 A;  2HE7 A;  2M1M A;  2D10 A;  2JVC A;  3PS6 A;  3TIX A;  3U30 A;  2CHZ A;  2ZPY A;  2L76 A;  3A1Q B;  4M0W B;  4HCP B;  4HK2 A;  3TL5 A;  4M8M A;  3TW1 A;  3V5W A;  2IO3 B;  5DIF B;  5IAA C;  2KWU B;  3PSC A;  4H8S A;  1YIW A;  3QX1 A;  5C5B A;  3HHM A;  2CAY A;  3K9P B;  1MG8 A;  2GMI C;  4JL9 A;  1J0W A;  1K5G B;  1WXS A;  4HLE A;  2GBK A;  4KZC A;  3HK0 A;  5LON B;  1RAX A;  4EMO A;  2FCS A;  3DBH I;  3R7R A;  2Y5B B;  2D3G A;  1V61 A;  4NJ7 A;  4ANV A;  2PZ1 A;  2WX1 A;  1NTY A;  3SUZ A;  2XBB C;  2MLB A;  3LJ3 A;  1WG7 A;  1Q1O A;  4XX5 A;  4A3P A;  3IVF A;  4KHB B;  3H9D A;  2KO3 A;  4BOS C;  1KM7 A;  3F5R A;  4HCN B;  4IM2 A;  2LGD A;  3WIM A;  3WAO A;  1KZ7 A;  2LI5 A;  2PPH A;  1GG3 A;  2HTH A;  4A6F A;  1WMH B;  2MDX A;  3U8Z A;  1WR1 A;  4BKS D;  2QHO A;  2J0K A;  4TYZ A;  3MPX A;  1L2N A;  4W9J A;  4I6P A;  3DBS A;  2MWS B;  1E8W A;  1XR0 B;  3SU8 X;  3O96 A;  4HB0 B;  2DHJ A;  2UVM A;  3KRW A;  5DHA B;  4PNK A;  2FCM A;  2L00 B;  2N9X A;  1EO6 A;  3PRM B;  4BOZ B;  3VHT C;  4GIV A;  1WGG A;  4DHJ B;  3M63 B;  1H8C A;  2K2U A;  2JZZ A;  5EDS A;  3H7S A;  2LD9 A;  3VIA A;  3RZF A;  4GMV A;  5LXH A;  2KLC A;  1RRP B;  2N7E A;  4NQK E;  2Y8F A;  1U5G A;  5DH9 B;  4IM3 A;  1BWN A;  1TQZ A;  1EUV B;  1YX5 B;  2JF5 A;  4NJ6 A;  4DK5 A;  4EUT A;  3ULC A;  1F9J A;  4F7U P;  4BFR A;  3PZD A;  3DVG Y;  1EGX A;  1KLV A;  3V60 A;  3L13 A;  5C6R A;  4E71 A;  3KRX A;  2D2Q A;  4XWX A;  1FGZ A;  1Q67 A;  2FJL A;  2R0D A;  4P7I A;  1WX9 A;  1YQB A;  2CRF A;  4EOY A;  3X0W A;  4DBB A;  3ZNI D;  2KDI A;  4HAZ B;  2KWC A;  4WAA A;  3PG7 A;  2E2X A;  3KYD D;  4PYU A;  1V2Y A;  4IG7 B;  2B3A A;  2YVC A;  3SNH A;  4KSK C;  5IA7 A;  2UZS A;  1QQG A;  1XCG A;  2NMB A;  2K1F A;  2MX2 A;  2KFJ A;  2IYD B;  2N1V A;  3N3K B;  3PP2 A;  4IC7 B;  2KMC A;  2MSE D;  1ZSQ A;  4NAW A;  1WGU A;  1FAO A;  2KTF A;  2PEA A;  2IO1 B;  5D94 A;  2D4Q A;  4DHJ D;  3MDB C;  4RM9 A;  1DYN A;  2DEN B;  4CO7 A;  1LQB A;  3QAR A;  1JRU A;  1IP9 A;  2D9Z A;  3ULB A;  4BKS A;  1WGH A;  3GZN I;  1J0G A;  2EMS A;  3I3T B;  1TTN A;  3LDZ E;  1I42 A;  3VQI A;  2DYQ A;  2L1C A;  4K81 A;  4ZRK A;  4PS8 A;  1UBI A;  2JP2 A;  2P8V A;  3N32 A;  1E5W A;  4HAX B;  3A4R A;  3A9K A;  3BY4 B;  5KCV A;  3EEC A;  3MHS D;  4JQW C;  3SD5 A;  2BKF A;  2KAN A;  3APF A;  3APD A;  1P5T A;  1PFJ A;  3CIK A;  4W9D A;  3P7Z A;  2N4F A;  2DZK A;  4DBG A;  2O2V B;  3QK0 A;  4IM0 A;  4WWO A;  2KJH B;  1S1Q B;  3AUL A;  4HXD A;  3R7Q A;  2DHI A;  3ZO5 B;  4MT7 A;  1UH6 A;  1U29 A;  2D11 A;  2KMA A;  2K00 A;  3TVV A;  3B0A A;  2ZPN A;  3QC8 B;  4XC2 A;  4I6L B;  3UIP B;  1ZM0 A;  4TKN A;  2RUK B;  3RCP A;  2RLO A;  2GCL A;  3A8P A;  4F8C B; 
#chains in the Genus database with same CATH topology
 5C23 A;  3DHH C;  3ZJU A;  3JW0 X;  2LVO A;  3U52 E;  1TY2 A;  4BBN C;  5TSS A;  3TEX A;  4MEL A;  1TY0 A;  5HE0 A;  1E8X A;  4AJW A;  1KTK A;  1L7Y A;  3TMP B;  4LJO B;  4F7Z A;  1ZUD 2;  3IXS A;  2W82 A;  2CJN A;  5GOW B;  4GPT B;  2DZM A;  1QOF A;  2LG1 A;  4IKG A;  2R61 A;  4MK0 A;  3QJZ A;  2D9Y A;  3KY9 A;  3VXW A;  1DDW A;  3EC8 A;  5D7G A;  3HW2 B;  1R4M I;  3AE1 B;  4ILG B;  3WA0 A;  1NDD A;  4DDG D;  3B1L X;  3C8Y A;  4RGN A;  2C60 A;  2RMM A;  3IG3 A;  3ZDM C;  1FNU A;  2GBM A;  1ZVR A;  3JSV B;  1F77 A;  4WUR A;  3OWE B;  4GN1 A;  1XD3 B;  2WXJ A;  2LUM A;  1MJD A;  2D3B A;  3PV1 A;  2GCJ A;  2BVC A;  2IZV B;  3A33 B;  5L81 A;  4HAY B;  3CSF A;  4A3O A;  5DPT A;  4GDK A;  4DDI D;  4PS3 A;  4YON A;  1C76 A;  1J7C A;  3B2F A;  4YL8 A;  2C5L C;  4J6I A;  3WAM A;  2FCN A;  2BTE A;  3QWZ B;  1ZXH A;  1GGO A;  5KHQ A;  4ZRQ A;  2C7H A;  3VUX A;  2W2X C;  3FC4 A;  4BZA A;  3AU5 A;  5KHO A;  1JWA D;  4M8N A;  5L95 C;  1WSP A;  5G2N A;  4P16 A;  1V5O A;  3ZDT A;  1N3H A;  2LMC A;  1RM6 C;  2O6V A;  3AE4 B;  2W9N A;  4YTM B;  2AQ1 B;  2KFK B;  2HDE A;  5TR5 A;  2DBY A;  3R2I A;  4XYC A;  4JX1 C;  4Z2N A;  2BW2 A;  2L32 A;  2MWN B;  4MM3 A;  4HEA 1;  1N5W A;  5BMH A;  1XKE A;  3F0W A;  2Y7B A;  2D9W A;  3DHG C;  2DYM A;  2KMM A;  4BVU C;  3NSU A;  2NBW B;  4WJQ A;  3ONS A;  2MW5 A;  3UQB A;  3NY5 A;  1GOZ A;  1QC6 A;  2MEK A;  2V9H A;  3LYY A;  3V62 A;  2K8H A;  1GB4 A;  1ZE3 D;  1YNT E;  2X38 A;  1TS5 A;  4JKE A;  1X05 A;  2OTX A;  3UGB B;  4W9I A;  1AAR A;  4WWP A;  3D8D A;  4WQO B;  3UZT A;  3OJ4 B;  2O6V B;  4X57 B;  1FFV A;  4LTU A;  3H7P B;  1ROE A;  4M0W A;  1K5D B;  1V6E A;  2K25 A;  2K8E A;  5BYQ A;  3VTW A;  3MTN B;  4WWN A;  5EE9 A;  1I4H A;  1MIZ B;  1L4D B;  3IT6 B;  1SE9 A;  3EPY A;  2AQ2 B;  2JT4 B;  3C19 A;  4DXA B;  2PE6 B;  4FJY A;  3VDZ A;  1SJE D;  4AWJ A;  1U5F A;  2ELB A;  1FNW A;  2BYF A;  3ZJT A;  3UIO B;  3WAP A;  2GOW A;  2BCJ A;  1E10 A;  1WE7 A;  4E74 A;  1Z2M A;  3ZJV A;  4ZHP A;  1VBG A;  2ONQ A;  2SAK A;  4IWQ A;  2BPS A;  2LGI A;  4RNA A;  1OQN A;  2WP9 B;  3M95 A;  2HD5 B;  2JZP A;  1TBE A;  3B08 A;  5G5H A;  4P1C C;  1F2R C;  3SBG A;  1DOX A;  4AJY B;  1X1G A;  3OJ3 A;  3D32 A;  1HXY D;  1OGW A;  3Q6B A;  3VH3 B;  3FLV A;  1BXT A;  1MKE A;  3SO6 A;  4GSW A;  1N63 A;  2KX3 A;  4W9C A;  1YN3 A;  3NRZ A;  2MH7 A;  5J18 A;  3BZD B;  2JYT A;  2ICI A;  2V76 A;  4C00 A;  3ZUN A;  3PLV A;  2DIK A;  3PT2 B;  3KWV A;  1UEF A;  1FHX A;  4OVZ A;  5AZG A;  1WRI A;  3AJ4 A;  1BUI C;  2VKI A;  4BBK A;  4MJS B;  2V4L A;  2DHK A;  2KVR A;  2EKE C;  4JIO U;  1JW9 D;  3ZW3 A;  3ML4 A;  1QIL A;  3QQ8 B;  4HAW B;  2OJW A;  3NUH B;  2KTR A;  1JWU D;  2AL6 A;  2JZ3 B;  1D5Z C;  3RNC C;  2DHZ A;  2P0D A;  1TKG A;  5AUI A;  2D5G A;  2KDF B;  3P2B A;  1KI1 B;  3RMK C;  1WX8 A;  3R66 C;  2PLP A;  3KYC D;  4HJK A;  2MFQ A;  1W1D A;  3AN1 A;  2M4N A;  1ET9 A;  4PYZ A;  2DLW A;  3P4S B;  2YRY A;  3A9K B;  4WJO A;  3AU4 A;  1T6B X;  5H92 C;  2INC C;  3V6C B;  3V61 A;  2DZI A;  3E56 A;  3ENB A;  1KLG D;  3NVY A;  1EM7 A;  3RUI B;  4P6V F;  4TSS A;  4JKF A;  2IY0 B;  4K7W A;  1WJ1 A;  4GGQ A;  2LXC A;  5EE1 A;  3OLM D;  5GXG B;  5E6N A;  2EKI A;  1KFY B;  1OY2 A;  2RR9 A;  1UPR A;  3ECI A;  2FBW B;  2NPT B;  3L0W B;  4DX9 0;  1M7R A;  4DHZ B;  2R2O A;  1IBX B;  5FK9 C;  3L10 B;  3C0R B;  3IT4 B;  3NZS A;  1AYF A;  1WM3 A;  2ZKM X;  2FUH B;  2REX A;  3M3J A;  2AX5 A;  2ZW0 A;  3DVN V;  4N58 A;  5DPR A;  1TT5 B;  4WQM A;  1NYQ A;  1AW7 A;  3AI5 A;  3KUZ A;  1QZE A;  2G35 A;  4L1R A;  1NEK B;  3BK1 A;  1G6J A;  2VSZ A;  2KNB A;  4GOU A;  1E8Y A;  4KV2 A;  5BMG A;  3VUY A;  2BWF A;  1GAQ B;  3ALB A;  3DVG X;  2RVB B;  4ASW C;  2ASQ A;  3T9L A;  4R3D A;  3GZN B;  2JXX A;  4KGR A;  4D0N B;  2KWV B;  4OZB A;  4KKJ A;  1Z87 A;  1XLO A;  1FPY A;  1ZOY B;  2WQY B;  3NWF A;  2MP2 A;  2K2J A;  4KHO A;  3VTV A;  2N7D A;  4AP4 C;  1V97 A;  1MI1 A;  2RSG A;  1IGD A;  2YEP B;  1UNP A;  2IY1 B;  1VD2 A;  3L17 A;  4EKU A;  3G9W A;  5JVL A;  5JP4 A;  5LLI A;  4CQN A;  1IUE A;  4UDU C;  4FUL A;  2V4I B;  4L6E A;  1XCT L;  3PS6 A;  4MT5 A;  1MI0 A;  4M0W B;  3NJT A;  4A9A A;  5C5B A;  2XN9 C;  2CAY A;  2QC8 A;  1FM0 D;  2GMI C;  4KZC A;  1DYQ A;  2FCS A;  3P1M A;  4NJ7 A;  4XX5 A;  3IVF A;  4KHB B;  2RDG A;  2AQ3 B;  2WXL A;  1E6E B;  1L0V B;  4IM2 A;  1KZ7 A;  1VJK A;  2DWQ A;  2HTH A;  1WMH B;  5IO9 A;  2NMQ A;  2BBC A;  1DIK A;  1ACC A;  3DBS A;  3O96 A;  2FCM A;  2L00 B;  1N62 A;  2BB5 A;  5I2M A;  1V1P B;  4JKG A;  1H8C A;  5LXH A;  3B77 A;  3MP9 A;  2KLC A;  1RRP B;  1XEE A;  2N7E A;  1GPX A;  4RGM A;  2Y8F A;  3U12 A;  4IM3 A;  2JF5 A;  1HTQ A;  1LGR A;  4IOI E;  5M4Y B;  4AQ7 A;  1XF5 L;  4F7U P;  4BFR A;  3DVG Y;  1EGX A;  1Q10 A;  1YQ4 B;  4E71 A;  3KRX A;  2D2Q A;  1HZ5 A;  1WX9 A;  2CRF A;  3ZNI D;  4DBB A;  3AM9 A;  2QCZ A;  2K0P A;  2KWC A;  2E2X A;  5I4D A;  4PYU A;  1V2Y A;  4IG7 B;  4PT5 A;  5IA7 A;  1QQG A;  2MX2 A;  3N3K B;  3PP2 A;  1AN8 A;  3VRA B;  2EEL A;  2KMC A;  2JYE A;  4NAW A;  1T77 A;  2IO1 B;  3NVW A;  3QAR A;  2HTM E;  2D9Z A;  1WGH A;  1V1P A;  2EMS A;  3SFD B;  3W5V B;  2KUQ A;  2JP2 A;  4P1B C;  1E5W A;  3A4R A;  4FXC A;  4JQW C;  5KCV A;  2BKF A;  3APF A;  2Z4D A;  3CIK A;  4W9D A;  2N4F A;  2DZK A;  4DBG A;  2O2V B;  3EA6 A;  3QK0 A;  4WWO A;  3AUL A;  4HXD A;  1KRH A;  3I63 C;  4MT7 A;  2K00 A;  2ZPN A;  1L6U A;  1I4X A;  4XC2 A;  4I6L B;  1ZM0 A;  1PUT A;  4L1B A;  3LXF A;  3K9O B;  4RCO A;  4ILH A;  3VVW B;  1ZKH A;  2G4S A;  1K52 A;  3CST A;  2BS3 B;  3IAM 1;  4KIK B;  1P1A A;  4G11 A;  3DBL I;  1HA5 A;  1WGR A;  5FI0 A;  2DYO A;  3B9J A;  4AOF A;  3TUO A;  1WJ6 A;  4ZOH C;  3PGE A;  2CR5 A;  2O2V A;  1I4Q A;  3D8F A;  2K3U A;  3T3O A;  2GBN A;  1M94 A;  2DYN A;  2KFK A;  5IP4 D;  1C78 A;  4CHK A;  2Q13 A;  3DBR I;  3P4P B;  3N1X C;  4EFO A;  3L08 A;  5J17 A;  5D6J B;  3TEZ A;  2DTC A;  1FNV A;  4JWU C;  5G5G A;  4JKD A;  2KXJ A;  3I9V 1;  2WDQ B;  1GB1 A;  4OZA A;  3ZXV A;  1WJM A;  3WYF B;  3GP7 A;  4NPN A;  2GUM A;  4FA6 A;  3A98 B;  1MHX A;  1I4P A;  5CHF A;  2KVZ A;  1WI1 A;  3H7P A;  3QAQ A;  2EMT A;  4B95 A;  1KBL A;  4C4V B;  1D5M C;  2KZR A;  2WX0 A;  4LNI A;  1OEY A;  4XDC A;  2C7N B;  4YTP B;  3TO1 A;  3RD2 A;  3JYU A;  4WH4 A;  3CIR B;  3NZ3 A;  4EZJ A;  2J59 M;  2K39 A;  1PLS A;  3KZ1 A;  2D3C A;  2LXA A;  2MP2 B;  3U7D A;  2WXK A;  2KJR A;  5HKH A;  2JX5 A;  1EU4 A;  5D3Y A;  3H6N A;  3CXB B;  2KK8 A;  4A90 A;  3Q8A A;  4HAU B;  3RNB C;  3ZKJ C;  4A20 A;  2IFS A;  2L3Z A;  2WHI A;  3N9Y C;  2WXP A;  2Y5C A;  3W1S C;  3ABV B;  2WYQ A;  4EJN A;  1QT9 A;  3P6A A;  1RJ2 A;  3QHT A;  3RYT A;  3E9L A;  2BF8 B;  3L54 A;  3ML8 A;  2OOB B;  4Q2J A;  3ZLZ A;  1UGM A;  5C16 A;  1UGJ A;  2ZW1 A;  3RFZ B;  5KQ4 A;  2FNJ B;  2KQS A;  1MG4 A;  4A8X C;  2Z13 A;  1WJU A;  1OFF A;  4KHA A;  4KHB A;  4RMA A;  1ZDX A;  5I2S A;  3M62 B;  2N9P C;  1GC7 A;  2JUO A;  4URK A;  1MK7 B;  3EFU A;  1EF5 A;  2CU1 A;  1KF6 B;  5J3T A;  1L4Z B;  1DOI A;  2YF0 A;  2VZK B;  4XGA B;  1C4P A;  2N7J A;  2ZZP B;  3X23 A;  4OVV A;  5D2M B;  2IGH A;  2KUP A;  1EWC A;  1XOD A;  1D4B A;  1ZC3 B;  2LOZ A;  4AS1 A;  1TGZ B;  2MBH A;  4DX8 A;  1E8Z A;  3URY A;  2L05 A;  1Y19 B;  1YD8 U;  2LRW A;  2A4Z A;  3JSV A;  4S0R A;  1W1G A;  4ZRJ A;  2KWD A;  1YJI A;  1SIJ A;  2Z0D B;  5DI9 B;  2WXH A;  5BO4 B;  3SEB A;  2WXQ A;  3KSY A;  5C2T B;  1GC6 A;  3AED B;  1BAK A;  3MFG A;  1JAL A;  4NSW A;  2K8B A;  4F7G A;  3DXE A;  2Y8G A;  4KZ0 A;  3WCQ A;  5HE2 A;  5MPO A;  1WX7 A;  1LM8 B;  3CWI A;  2NBV B;  1E7P B;  5CLQ B;  3GE3 C;  3N7C A;  4HAV B;  4DWF A;  1AWE A;  1U5E A;  1T5X D;  5AEK B;  2P0H A;  4GDL A;  2OQB A;  1DRO A;  2UU7 A;  3PVU A;  4ARI A;  2YS1 A;  4QJ5 B;  2WWZ A;  4IDI A;  4IAP A;  2KHW B;  3OHM B;  1NTI A;  1YN5 A;  2BKR B;  1SIF A;  4F1S A;  3TJP A;  1MHH E;  3SYX A;  3ZNZ B;  2MJE A;  2LVQ A;  5HE3 A;  4HB4 B;  3AEA B;  2J4X A;  3MHZ A;  2N0S B;  5HFY A;  2UZR A;  3GS2 A;  4L23 A;  2BQQ A;  4JKH A;  5DPW A;  4ZRI A;  2DA0 A;  3W2D A;  5HHD G;  4TV3 A;  2K9X A;  2FDQ A;  2PE9 A;  4HB3 B;  3I5J C;  4MSQ B;  1IGC A;  4KDL B;  3VR8 B;  4IW0 A;  5HI1 A;  4E3C A;  3GYP A;  4HRO A;  4ZYS A;  2LJ5 A;  3L16 A;  2PKO A;  2EJ8 A;  2E3T A;  4GDL B;  3ZRF A;  1RLF A;  4JK7 A;  4F7H A;  1V86 A;  4LNO A;  4PK1 A;  4CYE A;  3DOW A;  4IWO A;  3A9J B;  4D2K A;  2N1W A;  4ANW A;  1FB8 A;  3D8E A;  1XQQ A;  5BMI A;  1E7V A;  5IRS A;  3S2A A;  3Q3J A;  3DXD A;  3ZTD A;  2VRR B;  2P0F A;  3NG0 A;  4RH6 A;  3DCG A;  4YSX B;  2K22 A;  2FJU B;  4TQ0 A;  3AEF B;  4K2O A;  1XLN A;  1WM2 A;  2YLM A;  2Z59 A;  2LJI A;  5L83 A;  4A6F B;  2ZEQ A;  2NVU I;  2MJ3 A;  4HWI B;  4IUM B;  2OED A;  2SEB D;  2XQN M;  1CJE A;  4ZYN A;  4HDO A;  1LB1 A;  3OG5 A;  1C1Y B;  3BVG A;  2BGF A;  4NZL B;  4MGZ E;  3ZTC A;  3A4S C;  3VRB B;  1NU2 A;  2WDV B;  3KVF B;  4KGS A;  2XEW A;  2DYB A;  3DDC B;  4XDD A;  1UPQ A;  3DPD A;  4XE0 A;  1SF0 A;  2HRJ A;  3ZVR A;  1UNQ A;  1ESF A;  1V9J A;  2FIF A;  1BTK A;  1C9F A;  4KKI A;  1WMH A;  4G50 A;  2WGS A;  2LUL A;  4QJ4 B;  5JHA A;  1HQR D;  2JWU A;  1NVL A;  4A5K A;  3JVZ X;  3NS1 A;  1ENF A;  5E6P A;  3SHQ A;  3BJI A;  1X11 A;  3EGR A;  2KQ7 A;  1KOT A;  5DHF B;  1PGX A;  3T06 A;  4MY6 A;  3NHE B;  3B2G A;  3EUB 2;  1TS2 A;  2COF A;  2QIE B;  3R3M A;  1VR9 A;  1E9M A;  3PRP B;  2LUE A;  3W1S A;  1K53 A;  2COC A;  2I5F A;  2LGS A;  2RD0 A;  1JQ4 A;  1JWB D;  3A58 A;  3UQA A;  2KX0 A;  1WIA A;  2G45 B;  1WE6 A;  5IKC M;  3BII D;  5D3I B;  2CHZ A;  2L76 A;  3A1Q B;  4HK2 A;  1YQ3 B;  3TL5 A;  4M8M A;  3TW1 A;  2IO3 B;  5DIF B;  2KWU B;  3PSC A;  2M0A A;  3BVZ A;  3HHM A;  3K9P B;  5H8Y E;  2G9H D;  1MG8 A;  1K5G B;  4HLE A;  3HK0 A;  5LON B;  4EMO A;  3R7R A;  2GB1 A;  2K5P A;  2PZ1 A;  2MLB A;  2KO3 A;  4M01 A;  4HCN B;  1FMA D;  2VH1 A;  3R8B A;  3WIM A;  3WAO A;  3V05 A;  2PPH A;  1TYG B;  1L2N A;  3Q3O C;  2QEJ C;  3SU8 X;  2MWS B;  3BK2 A;  1CK1 A;  3KRW A;  5DHA B;  3PRM B;  2N9X A;  4DHJ B;  1UNS A;  1WGG A;  3M63 B;  3H7S A;  4GMV A;  1IBX A;  2MJD A;  1TS4 A;  4NQK E;  4ARC A;  1TQZ A;  4DXF A;  1YX5 B;  4DK5 A;  4EUT A;  2HJ1 A;  1KLV A;  5C6R A;  1YQB A;  1Q67 A;  4EOY A;  1FXI A;  3PG7 A;  2GRI A;  2B3A A;  3SNH A;  1PYW D;  2K1F A;  2NMB A;  3T3N A;  2IYD B;  2CJO A;  1FAO A;  2D4Q A;  4DHJ D;  2WNM A;  3GZN I;  4MAC A;  2WS3 B;  1I42 A;  3VQI A;  4K81 A;  3N32 A;  4OSN A;  3BY4 B;  3MHS D;  4NJC A;  4RF1 A;  3SD5 A;  1MVK A;  1EU3 A;  2DHI A;  2E6X A;  2KMA A;  2WXO A;  2D11 A;  3TSS A;  1CQV A;  3TVV A;  4XWT A;  2WXI A;  2RLO A;  1C77 A;  3GB1 A;  3HSA A;  2XK5 A;  3KLS X;  4ICU A;  1XO3 A;  5LOP B;  3E9O A;  1TKY A;  2JU6 X;  3P63 A;  1T0Y A;  1GNU A;  2ABD A;  4W9K A;  3HVD A;  3APC A;  2G3Q B;  4C7Z A;  2RQ1 A;  1FCC C;  3DWG C;  3VAW A;  3ZVV A;  2LYD A;  2M0X A;  2IDY A;  2LKO A;  4REZ A;  1Y56 A;  3J9C A;  4HHV A;  1FEH A;  3PRZ A;  1U2B A;  4IWP A;  3UIN B;  1JRP A;  3BWU D;  4GZU A;  5D3W A;  1KC7 A;  2C7M B;  3ZGZ A;  4DIX A;  3OAW A;  1SGH A;  1VCB A;  1CZP A;  1N61 A;  2M14 A;  1HE8 A;  2J42 A;  1BT0 A;  1UNR A;  2ZVO A;  3OAN A;  4A6Q A;  1UWX A;  1OEY J;  1TIF A;  2FID A;  3VOQ A;  4EEW A;  3SV1 A;  4MJS A;  1LO5 D;  2PJH A;  3ML9 A;  4JWS C;  1ZW7 A;  3BYT B;  4ITK A;  2GJY A;  2JRI B;  4MGY E;  1EF1 A;  2LOX A;  1OMW A;  2FCQ A;  4XZ4 A;  1S3S G;  1WGQ A;  1F1H A;  4ACF A;  1MFW A;  2DN6 A;  1ZXI A;  5D3X A;  2IO0 B;  2PVO D;  5CHV C;  1QQR A;  1DBH A;  4GDK B;  3KW5 B;  2AWT A;  1EAZ A;  2KT7 A;  1YX6 B;  3W9C B;  3FP5 A;  3VFK A;  4K17 A;  2DNF A;  2ADZ A;  3FIL B;  1SHC A;  1L5P A;  1WRD B;  1WYW B;  1K8R B;  2TSS A;  4GU2 A;  2YT2 A;  2KYW A;  4EZL A;  2H89 B;  5DPS A;  4IFS A;  3PHW B;  1I2H A;  4KX6 B;  1BTN A;  1STE A;  2H7E A;  3AEB B;  1IYF A;  1XT9 B;  2RGN B;  4HAT B;  4II3 B;  3DWM A;  3UF8 A;  3PVW A;  3O65 B;  3KUC B;  3A1Q A;  2KC1 A;  1B1Z A;  2G4D B;  3HVZ A;  4KDI C;  4MM3 B;  1KLU D;  3FSS A;  3P4Q B;  2L1A A;  3AXC A;  1WZ0 A;  3MJ5 A;  1OQR A;  2IBI B;  3ZNH B;  3RZW C;  4C80 A;  5J3Y A;  1T3Q A;  1KZG A;  2CHW A;  3HM3 A;  1W1H A;  2CQU A;  4WJP A;  2KOX A;  2V1Y A;  2AEH A;  2X0S A;  3PHX B;  3VH4 B;  2L8J A;  4HKQ A;  4W9H A;  3PRE A;  4ICV A;  1R4N I;  2Q5W D;  1TKE A;  4IOY X;  1LXD A;  2DAF A;  2LGX A;  1FXT B;  2N9E B;  3DBR B;  1PQS A;  4WVF B;  2BS4 B;  4OVU A;  1IRS A;  5GMV A;  2QIL A;  3T8M A;  3FM8 C;  3DVN U;  2X18 A;  1K50 A;  1FCL A;  5JZE B;  4TQ1 A;  3LJU X;  2ZJD A;  1LFD A;  3QWM A;  1V8C A;  3NW8 A;  2NBU A;  1SB3 C;  3Q3M C;  4YSZ B;  1ZGU B;  2YEP F;  2NZ8 B;  3NWA A;  4HPL B;  1NEN B;  1RRB A;  3E9P A;  2YT1 A;  3IFW B;  3N1Y C;  1J0G A;  4LJP B;  1UBQ A;  4ANU A;  1WGK A;  2RGF A;  4MDK E;  2H88 B;  2ZCB A;  1XCQ L;  3A9J A;  2OHF A;  2K6D B;  2LHD A;  3W1Y A;  2KC2 A;  1A70 A;  3ZQ4 A;  5BYS A;  2V0G A;  1WF9 A;  4FJZ A;  1P7F A;  1WXM A;  2PW9 A;  5CTR C;  4DHZ E;  2Z59 B;  4GMX B;  3SFE B;  2DKP A;  1Q5W B;  2PVG C;  4JL9 A;  2VRW B;  4JKB A;  5HG2 A;  2W2W A;  2ZVN A;  2LAS A;  3ZRC A;  1X86 A;  1F52 A;  5JH5 C;  1QLB B;  1M7E A;  1H4R A;  4FN2 A;  2HTH B;  2GLS A;  2K8C A;  4WIP A;  3ENE A;  1DDV A;  4MSM B;  1K51 A;  5LXI B;  2M56 B;  2COA A;  3ETR A;  2Z0E B;  4HSI A;  4W9G A;  2LWP A;  3VUW A;  1PDX A;  1VZ8 A;  3RCZ A;  4A55 A;  4WWM A;  1XD4 A;  2L52 A;  3HM6 X;  5CLL B;  2KGX B;  1WGY A;  1UD7 A;  1FOE A;  4CHJ A;  4TMA B;  2MKR A;  2QKM A;  4CSQ A;  3PSE B;  3L4P A;  4ILJ A;  2NR2 A;  4FLH A;  2WXN A;  4Y94 A;  2BYV E;  1VBH A;  1QKZ A;  4S17 A;  5D27 A;  3PVL A;  3BVM A;  4XWW A;  4G3X B;  1L6V A;  2O6V D;  2IYB A;  4NAW B;  1L0Y B;  2UYZ B;  5AUK A;  5LNK 1;  2RNR B;  1IPG A;  3O13 A;  1N6Z A;  2K6Q A;  3DBH B;  4LDT D;  2JY6 A;  1Y5O A;  3QBV B;  1I7A A;  2EC1 A;  3A8Q A;  3Q3N C;  1V5P A;  1V5T A;  4TUU A;  1CMX B;  2J0J A;  2IND C;  2KIG A;  4GB9 A;  1I4R A;  2ON8 A;  2KKC A;  4JKC A;  2INP E;  1ZC4 B;  4M02 A;  3Q2A C;  5CX3 A;  3EHV A;  2DAJ A;  1ZYI A;  2LRU A;  1SJH D;  2GS0 A;  3RI7 C;  1FFU A;  2D07 B;  3AE6 B;  4HJG E;  4USA A;  4FHJ A;  4US8 A;  3WAN A;  2ZCC A;  2LZ6 A;  4WSF A;  3DBL B;  1B55 A;  2MBQ A;  4RF0 A;  4LNK A;  2JWZ A;  3BIN A;  2NBV A;  2GBR A;  2MQJ A;  3SR6 A;  2QKL A;  2L83 A;  3SDL C;  2YSZ A;  1E90 A;  4HVB A;  1B9R A;  4FAD A;  3PEG A;  2Z0O A;  1P6S A;  2JXT A;  1JDE A;  1ISN A;  3KQ4 A;  3V6E B;  1WYG A;  3IHP C;  2WU5 B;  3HRD D;  2WXG A;  4YSY B;  3U4E G;  3FKY A;  1MPH A;  1C79 A;  1FO4 A;  5AZH A;  2UWQ A;  4PS7 A;  5G55 A;  1MAI A;  1NVI D;  5KQ1 A;  1P3Q U;  2HJ8 A;  1TZO A;  1TJ6 A;  4KSL C;  2WH5 A;  1PFD A;  4B0M A;  4HB2 B;  4GLS C;  1WXV A;  2DX5 A;  2W3S A;  1V89 A;  5LG4 B;  3U7Z A;  1P7E A;  3Q69 A;  2W3R A;  4EZK A;  4NNJ B;  1WY8 A;  2HE7 A;  2M1M A;  2D10 A;  3EFC A;  3U30 A;  2ZPY A;  3V5W A;  5IAA C;  4H8S A;  1AWD A;  3QX1 A;  1WXS A;  2PTL A;  3RNF C;  3W5U B;  2KAC A;  4A3P A;  1MPE A;  3H9D A;  4BOS C;  2I38 A;  2LGD A;  1GG3 A;  2LHE A;  1HBK A;  4A6F A;  1KH0 A;  2MDX A;  3U8Z A;  4BKS D;  2LEK A;  2QHO A;  2J0K A;  4YTN B;  2IPK D;  3MPX A;  4I6P A;  1TS3 A;  1E8W A;  2N9L A;  4BOZ B;  4PNK A;  1EO6 A;  1JML A;  4GIV A;  2K2U A;  2WLB A;  2ACZ B;  2JZZ A;  2LD9 A;  2COP A;  1BWN A;  3Q8B A;  1F9J A;  3PZD A;  1ZP0 B;  2VH2 A;  3L13 A;  1C4C A;  2WXF A;  4B6W A;  1FGZ A;  4P7I A;  4KGT A;  2KDI A;  3AEE B;  3DCX A;  1J7B A;  4WAA A;  1VZ6 A;  4KSK C;  4RFB A;  2UZS A;  3NZU A;  3AH7 A;  4IC7 B;  2KFJ A;  2MSE D;  1NYR A;  2KDM A;  1WGU A;  5EE0 A;  1DYN A;  4CO7 A;  1JRU A;  1IP9 A;  4BKS A;  1ACA A;  3LDZ E;  3ZYY X;  4PS8 A;  2P8V A;  1YMH E;  1DOY A;  3A9K A;  2IGD A;  2KAN A;  3APD A;  1P5T A;  1PFJ A;  1OQQ A;  3FVC A;  4IM0 A;  2KJH B;  1S1Q B;  2KQ4 X;  2QDF A;  3ZO5 B;  1UH6 A;  1U29 A;  2BT6 A;  2MHJ A;  3AMZ A;  3PZ8 A;  3B0A A;  2RUK B;  4TKN A;  5JLJ B;  2GCL A;  3A8P A;  4F8C B;  3PO0 A;  4LCD E;  2NPT A;  1KJT A;  1NTV A;  2L2I A;  3TCA A;  2MBE A;  1L0X B;  3ODO A;  1WXA A;  4BBN F;  3DXC A;  3AB5 A;  3AE9 B;  2J7Q B;  1VLB A;  2DLB A;  3MJW A;  1J8C A;  4NY0 A;  1XLQ A;  1T0S C;  2BWE S;  1T0Q C;  2GBJ A;  2W2X D;  2MRP A;  1UZX B;  3WAL A;  3MC8 A;  4ANX A;  2DKQ A;  4OT1 A;  3PTF C;  4ZDV A;  1JWS D;  2KN5 A;  3TBL D;  2VZK D;  3TEW A;  2YS3 A;  1HTO A;  1V49 A;  2LFI A;  1NBF C;  5AZF A;  4WJ7 A;  1SSN A;  3H8H A;  1QOB A;  1RFA A;  2ZNV C;  1WJN A;  2QJL A;  5FR6 A;  1EVH A;  3Q8C A;  1U4A A;  1A5R A;  3QA8 A;  1V80 A;  2RDB C;  4HPP A;  1QOG A;  3NS8 A;  2AL3 A;  2DFK A;  3PPA A;  1WJ4 A;  2Y5P A;  2BYT A;  2M19 A;  4LLG M;  3Q8E A;  5FR3 A;  4EE2 A;  3Q3F A;  1MIX A;  1P3R A;  1DGJ A;  3NVZ A;  5D3D A;  2Z0P A;  1WGD A;  2J53 A;  4KVG B;  3M1I B;  4B6H A;  2DX5 B;  1NI2 A;  3AE8 B;  5DCN A;  2NS5 A;  1FXA A;  2C9W B;  2M38 A;  2QSD A;  2M8S A;  3RN9 C;  3CF6 E;  2D9X A;  2INN E;  4FJV B;  5C3J B;  3PLU A;  2ROZ B;  3E66 A;  1LW3 A;  1VDV A;  4K3B A;  1SBB B;  1SE4 A;  1V81 A;  5J3Q A;  1RYJ A;  2NCN A;  2KJ6 A;  4G0N B;  4MGK E;  2BYE A;  4W9L A;  3HUI A;  1HB8 A;  1UWM A;  1M4V A;  1GJZ A;  3RUL A;  2MBO A;  1XX0 A;  5C1Z A;  1J7A A;  1N60 A;  4FBJ B;  2ELA A;  2H7D A;  4WJN A;  1C3T A;  4JLC A;  3AE5 B;  1MK9 B;  3KUD B;  1ST7 A;  4LDT B;  2J0M A;  1FGY A;  3DQV A;  1GUA B;  1I7H A;  2KTR B;  5C79 A;  2WXM A;  2KCJ A;  1P98 A;  4C7Y A;  1E7U A;  2Z8L A;  5CHW A;  2OJR A;  4MH0 E;  2XNA C;  2J52 A;  3P42 A;  2CKH B;  1PMS A;  4GNK B;  1UEL A;  1V5U A;  2IGG A;  2L0F A;  2R82 A;  1F0Z A;  4YXD B;  2FJ9 A;  2KN4 A;  1FHW A;  1X1M A;  4M00 A;  4DQO C;  2Z14 A;  3FAH A;  3AE3 B;  1E0Z A;  1P9D U;  4RGT A;  1ZDV A;  2V3P A;  2CY5 A;  2DX1 A;  3LB8 C;  3RT3 B;  1Y8R C;  1D6E C;  1WVH A;  4LNF A;  5D3V A;  1HEZ E;  1PGB A;  1WWT A;  4PQ0 A;  3GYO A;  1WH3 A;  2RPQ A;  2YT0 A;  3RNE C;  1TJE A;  3HIZ A;  4KIK A;  5EE3 A;  3DHI C;  1UF0 A;  1TXD A;  2CY4 A;  2RSU A;  1ET6 A;  4C56 C;  3FIL A;  4C0A A;  1C4A A;  4JGH B;  2I1K A;  3AEG B;  3KH0 A;  3HQC A;  1EWY C;  1WR6 E;  2DZJ A;  2WU2 B;  4KAX B;  2JRH A;  1FD6 A;  2I1J A;  4CHM A;  4LK0 M;  3RNG C;  4NQL B;  1VRA B;  2L0T A;  3SBT A;  4MGI E;  2MCN B;  1U27 A;  2KAJ A;  3VR9 B;  4D6W A;  3AE7 B;  1I35 A;  3ZIM A;  3IAS 1;  1FHO A;  2V3N A;  1R7S A;  2I5C A;  5HE1 A;  5JHH A;  2D3A A;  4RM8 A;  1RWS A;  4HRS A;  5T8I A;  3N30 A;  4I6N B;  1NI3 A;  4N9F 4;  1HZ6 A;  4LNN A;  4OHJ A;  3E9S A;  1D3Z A;  3U2S C;  4OW0 A;  2W54 A;  4II2 B;  4A6K A;  3ZXR A;  4HPM B;  3Q8F A;  4C4V A;  1PGA A;  1H10 A;  3ZNG C;  2LGY A;  4J3O D;  5IN7 A;  1AQC A;  1WXQ A;  2CB8 A;  2YS5 A;  2COD A;  5EFX A;  4N59 A;  4L2Y A;  2L7R A;  2Z0Q A;  3KWL A;  4Z2M B;  1Q0W B;  2KLG A;  4W9E A;  3NWD A;  3QCA A;  2A5U A;  4MEM A;  2LVP A;  3AE2 B;  4K7S A;  4YT0 B;  2JPH A;  5E6O A;  3H1U A;  1Z5S B;  5C5B B;  4HKZ E;  3VTU A;  4W9F A;  2NTT A;  2FAZ A;  4A6H A;  3CMM B;  4NAM A;  5JHB A;  3PZ7 A;  4DXG A;  3NOB A;  2IO2 B;  5IJM A;  3QIJ A;  5E6J A;  2N0Y A;  2XK5 B;  3IBE A;  1SXT A;  1FRR A;  1YJ1 A;  2ROV A;  1UUP A;  4JKG B;  3RPF C;  4GOC A;  1YOV B;  2R09 A;  2KR0 A;  5JHG A;  1D5X C;  2PMV A;  4HDQ A;  2B76 B;  2MA9 B;  1XLP A;  2V3S A;  2WDR B;  4QXA B;  4JPS A;  4K2P A;  4WAF A;  1V5M A;  2JQR B;  3FEH A;  2D9V A;  3AV8 A;  1OTR B;  1U5D A;  3TFM A;  2RRF A;  1ZPS A;  3N20 C;  4GXB A;  4QAY A;  1WZ3 A;  2RPV A;  4K1R B;  3R2T A;  3GE8 C;  2MBB B;  2QMT A;  5FI1 A;  1DDM A;  2IJ0 A;  4H2A A;  3RNA C;  2R2Y A;  1QF6 A;  1OQY A;  1R4M B;  3TEY A;  1SEB D;  1TZ1 A;  2KDE B;  2PIA A;  2KDB A;  1WFY A;  3P4R B;  1V88 A;  3MC9 A;  2CHX A;  2CS4 A;  4BKT A;  1I4G A;  1WI0 A;  2R2Q A;  1JRO A;  2N9K A;  4O1N A;  5J2R A;  1V1O A;  4YWG G;  4BKG A;  3BYY B;  3I57 A;  4FHK A;  1J19 A;  1X1F A;  1XXG A;  2BB6 A;  2ZNV B;  2KD0 A;  3GOE A;  4K3C A;  4B0E A;  4K7U A;  4AUQ C;  3ODW A;  1YN4 A;  2AYO B;  2M17 A;  2W55 A;  2WDT B;  4RGO S;  1T0R C;  4B9K A;  2FUG 1;  3HIE A;  2N23 A;  3ODX A;  1P0R A;  3NVV A;  3TIX A;  2JVC A;  4HCP B;  3V3X A;  1YIW A;  2NTS A;  5BYR A;  4ZRP A;  1J0W A;  1JCK B;  1F2R I;  2GBK A;  1RAX A;  3DBH I;  4JE3 B;  4JK9 A;  1QOA A;  2Y5B B;  2D3G A;  1V61 A;  2RDH A;  4ZHO A;  4ANV A;  2WX1 A;  1NTY A;  3SUZ A;  1FRD A;  2XBB C;  3LJ3 A;  1WG7 A;  1Q1O A;  1KM7 A;  3F5R A;  2X8X X;  2LI5 A;  4OZC A;  1WR1 A;  4TYZ A;  4QJ3 B;  1N5X A;  4W9J A;  1XR0 B;  4HB0 B;  2DHJ A;  2UVM A;  2K49 A;  2I2Y A;  3VHT C;  5FKA C;  2Y3A A;  5EDS A;  3VIA A;  3RZF A;  1U5G A;  5DH9 B;  1EUV B;  4NJ6 A;  3ULC A;  5JXV A;  4JKA A;  4BAX A;  2JSV X;  3UI3 A;  3V60 A;  4XWX A;  2FJL A;  2R0D A;  3N1Z C;  3AEC B;  3X0W A;  4HAZ B;  1VZ7 A;  3KYD D;  2YVC A;  2GI9 A;  1XCG A;  1BML C;  2N1V A;  1R4N B;  1ZSQ A;  2KIE A;  2KTF A;  2PEA A;  5D94 A;  4JK8 A;  2BS2 B;  3MDB C;  4RM9 A;  1SE3 A;  2G1E A;  2DEN B;  1LQB A;  1YJJ A;  2WXR A;  3MC0 B;  3ULB A;  1SE2 A;  4N6E B;  3I3T B;  1TTN A;  2DYQ A;  4ZRK A;  2L1C A;  1UBI A;  2LBB A;  1HB6 A;  4HAX B;  3EEC A;  3P7Z A;  2FE8 A;  1FIQ A;  5IOI A;  3R7Q A;  1RFK A;  4US9 A;  2CU3 A;  3Q14 C;  4MH8 A;  1JWM D;  3QC8 B;  3UIP B;  3RCP A; 
#chains in the Genus database with same CATH homology
 5C23 A;  3JW0 X;  2LVO A;  4BBN C;  4MEL A;  5HE0 A;  1E8X A;  4AJW A;  1L7Y A;  3TMP B;  4LJO B;  4F7Z A;  5GOW B;  4GPT B;  2DZM A;  2LG1 A;  4MK0 A;  3QJZ A;  2D9Y A;  3KY9 A;  3VXW A;  1DDW A;  3EC8 A;  5D7G A;  3HW2 B;  1R4M I;  4ILG B;  3WA0 A;  1NDD A;  4DDG D;  3B1L X;  2C60 A;  3IG3 A;  3ZDM C;  2GBM A;  1ZVR A;  3JSV B;  4GN1 A;  1XD3 B;  3PV1 A;  2GCJ A;  2IZV B;  3A33 B;  3CSF A;  5L81 A;  4HAY B;  4A3O A;  5DPT A;  4GDK A;  4DDI D;  4PS3 A;  4YON A;  4YL8 A;  2C5L C;  4J6I A;  3WAM A;  2FCN A;  3QWZ B;  1GGO A;  5KHQ A;  2C7H A;  3VUX A;  2W2X C;  3AU5 A;  5KHO A;  4M8N A;  5L95 C;  5G2N A;  1V5O A;  3ZDT A;  1N3H A;  2O6V A;  2W9N A;  2KFK B;  5TR5 A;  4Z2N A;  2MWN B;  4MM3 A;  1XKE A;  3F0W A;  2Y7B A;  2D9W A;  2DYM A;  4BVU C;  3NSU A;  2NBW B;  4WJQ A;  3ONS A;  2MW5 A;  3UQB A;  3NY5 A;  1QC6 A;  3V62 A;  2K8H A;  4JKE A;  1X05 A;  2OTX A;  3UGB B;  4W9I A;  1AAR A;  4WWP A;  3D8D A;  4WQO B;  3UZT A;  3OJ4 B;  2O6V B;  4X57 B;  3H7P B;  1K5D B;  1V6E A;  2K25 A;  3VTW A;  3MTN B;  4WWN A;  1MIZ B;  1SE9 A;  3EPY A;  2JT4 B;  4DXA B;  2PE6 B;  4FJY A;  3VDZ A;  4AWJ A;  1U5F A;  2ELB A;  2BYF A;  3UIO B;  3WAP A;  2GOW A;  2BCJ A;  1WE7 A;  4E74 A;  1Z2M A;  1VBG A;  4IWQ A;  2BPS A;  1OQN A;  3M95 A;  2HD5 B;  1TBE A;  3B08 A;  3SBG A;  4AJY B;  1X1G A;  3OJ3 A;  3D32 A;  1OGW A;  3VH3 B;  3FLV A;  1MKE A;  3SO6 A;  4GSW A;  2KX3 A;  4W9C A;  5J18 A;  2V76 A;  3ZUN A;  3PLV A;  2DIK A;  3PT2 B;  1UEF A;  1FHX A;  5AZG A;  3AJ4 A;  2VKI A;  4BBK A;  4MJS B;  2V4L A;  2DHK A;  2KVR A;  2EKE C;  4JIO U;  3ZW3 A;  3ML4 A;  3QQ8 B;  4HAW B;  2KTR A;  2AL6 A;  2JZ3 B;  2DHZ A;  2P0D A;  3P2B A;  2KDF B;  1KI1 B;  1WX8 A;  3R66 C;  3KYC D;  4HJK A;  2MFQ A;  1W1D A;  2M4N A;  4PYZ A;  2DLW A;  2YRY A;  3A9K B;  4WJO A;  3AU4 A;  3V6C B;  3V61 A;  2DZI A;  3ENB A;  3RUI B;  4JKF A;  2IY0 B;  4K7W A;  1WJ1 A;  4GGQ A;  2LXC A;  3OLM D;  5E6N A;  1OY2 A;  2RR9 A;  1UPR A;  3ECI A;  2NPT B;  3L0W B;  4DX9 0;  1M7R A;  4DHZ B;  2R2O A;  3L10 B;  3C0R B;  3NZS A;  1WM3 A;  2FUH B;  2REX A;  3M3J A;  3DVN V;  5DPR A;  3AI5 A;  3KUZ A;  1QZE A;  2G35 A;  1G6J A;  2VSZ A;  2KNB A;  1E8Y A;  4KV2 A;  3VUY A;  2BWF A;  3ALB A;  3DVG X;  2RVB B;  4ASW C;  2ASQ A;  3T9L A;  2JXX A;  4D0N B;  2KWV B;  1Z87 A;  2MP2 A;  2K2J A;  4KHO A;  3VTV A;  2N7D A;  4AP4 C;  2RSG A;  1UNP A;  2IY1 B;  1VD2 A;  3L17 A;  4EKU A;  3G9W A;  5JVL A;  5JP4 A;  5LLI A;  4FUL A;  4L6E A;  3PS6 A;  4M0W B;  5C5B A;  2CAY A;  2GMI C;  4KZC A;  2FCS A;  4NJ7 A;  4XX5 A;  3IVF A;  4KHB B;  4IM2 A;  1KZ7 A;  2HTH A;  1WMH B;  1DIK A;  3DBS A;  3O96 A;  2FCM A;  2L00 B;  4JKG A;  1H8C A;  5LXH A;  2KLC A;  1RRP B;  2N7E A;  2Y8F A;  4IM3 A;  2JF5 A;  4BFR A;  4F7U P;  3DVG Y;  1EGX A;  4E71 A;  3KRX A;  2D2Q A;  1WX9 A;  2CRF A;  3ZNI D;  4DBB A;  2KWC A;  2E2X A;  4PYU A;  1V2Y A;  4IG7 B;  5IA7 A;  1QQG A;  2MX2 A;  3N3K B;  3PP2 A;  2KMC A;  4NAW A;  2IO1 B;  3QAR A;  2D9Z A;  1WGH A;  2EMS A;  2JP2 A;  1E5W A;  3A4R A;  4JQW C;  5KCV A;  2BKF A;  3APF A;  3CIK A;  4W9D A;  2N4F A;  2DZK A;  4DBG A;  2O2V B;  3QK0 A;  4WWO A;  3AUL A;  4HXD A;  4MT7 A;  2K00 A;  2ZPN A;  4XC2 A;  4I6L B;  1ZM0 A;  3K9O B;  4ILH A;  3VVW B;  1ZKH A;  2G4S A;  3CST A;  4KIK B;  1P1A A;  4G11 A;  3DBL I;  1WGR A;  5FI0 A;  2DYO A;  4AOF A;  1WJ6 A;  3PGE A;  2CR5 A;  2O2V A;  3D8F A;  2GBN A;  1M94 A;  2DYN A;  2KFK A;  4CHK A;  2Q13 A;  3DBR I;  4EFO A;  3L08 A;  5J17 A;  5D6J B;  2DTC A;  4JKD A;  2KXJ A;  1WJM A;  3WYF B;  4NPN A;  4FA6 A;  3A98 B;  5CHF A;  1WI1 A;  3H7P A;  3QAQ A;  2EMT A;  4B95 A;  1KBL A;  2KZR A;  2WX0 A;  1OEY A;  2C7N B;  3TO1 A;  3RD2 A;  3JYU A;  4EZJ A;  2J59 M;  2K39 A;  1PLS A;  3KZ1 A;  2LXA A;  2MP2 B;  3U7D A;  2KJR A;  5HKH A;  5D3Y A;  3H6N A;  3CXB B;  2KK8 A;  4HAU B;  3ZKJ C;  4A20 A;  2IFS A;  2L3Z A;  3W1S C;  2WYQ A;  4EJN A;  3P6A A;  1RJ2 A;  3QHT A;  3RYT A;  3E9L A;  2BF8 B;  3L54 A;  3ML8 A;  2OOB B;  3ZLZ A;  1UGM A;  5C16 A;  5KQ4 A;  2FNJ B;  2KQS A;  1WJU A;  4KHA A;  4RMA A;  3M62 B;  2N9P C;  1GC7 A;  2JUO A;  4URK A;  1MK7 B;  3EFU A;  1EF5 A;  2CU1 A;  5J3T A;  2YF0 A;  2ZZP B;  3X23 A;  4OVV A;  5D2M B;  2KUP A;  1XOD A;  1ZC3 B;  2LOZ A;  1TGZ B;  2MBH A;  4DX8 A;  1E8Z A;  2L05 A;  1Y19 B;  1YD8 U;  2LRW A;  2A4Z A;  3JSV A;  1W1G A;  4ZRJ A;  2Z0D B;  5DI9 B;  5BO4 B;  3KSY A;  1GC6 A;  1BAK A;  4NSW A;  2K8B A;  4F7G A;  3DXE A;  2Y8G A;  4KZ0 A;  5HE2 A;  1WX7 A;  1LM8 B;  2NBV B;  5CLQ B;  3N7C A;  4HAV B;  4DWF A;  1AWE A;  1U5E A;  5AEK B;  2P0H A;  4GDL A;  2OQB A;  1DRO A;  3PVU A;  2YS1 A;  2WWZ A;  4IAP A;  2KHW B;  1NTI A;  2BKR B;  1SIF A;  4F1S A;  3TJP A;  3SYX A;  3ZNZ B;  2LVQ A;  5HE3 A;  4HB4 B;  2UZR A;  4JKH A;  5DPW A;  4ZRI A;  2DA0 A;  4TV3 A;  2PE9 A;  2FDQ A;  4HB3 B;  4MSQ B;  4KDL B;  4IW0 A;  4E3C A;  3GYP A;  2LJ5 A;  3L16 A;  2EJ8 A;  4GDL B;  3ZRF A;  1RLF A;  4JK7 A;  4F7H A;  1V86 A;  4CYE A;  3DOW A;  4IWO A;  3A9J B;  2N1W A;  4ANW A;  1FB8 A;  3D8E A;  1XQQ A;  1E7V A;  3S2A A;  3Q3J A;  3DXD A;  3ZTD A;  2VRR B;  2P0F A;  3DCG A;  4TQ0 A;  4K2O A;  1WM2 A;  2YLM A;  5L83 A;  4A6F B;  2ZEQ A;  2NVU I;  4HWI B;  4IUM B;  2XQN M;  4ZYN A;  4HDO A;  1LB1 A;  1C1Y B;  2BGF A;  4MGZ E;  3ZTC A;  3A4S C;  1NU2 A;  3KVF B;  2XEW A;  2DYB A;  3DDC B;  1UPQ A;  3DPD A;  2HRJ A;  3ZVR A;  1UNQ A;  1V9J A;  2FIF A;  1BTK A;  1WMH A;  4G50 A;  2LUL A;  5JHA A;  1NVL A;  4A5K A;  3JVZ X;  5E6P A;  3SHQ A;  3BJI A;  1X11 A;  2KQ7 A;  1KOT A;  5DHF B;  3T06 A;  4MY6 A;  3NHE B;  2COF A;  3R3M A;  3PRP B;  2LUE A;  3W1S A;  2COC A;  2I5F A;  2RD0 A;  3UQA A;  2KX0 A;  1WIA A;  2G45 B;  1WE6 A;  2CHZ A;  2L76 A;  3A1Q B;  4HK2 A;  3TL5 A;  4M8M A;  3TW1 A;  2IO3 B;  5DIF B;  2KWU B;  3PSC A;  3HHM A;  3K9P B;  1MG8 A;  1K5G B;  4HLE A;  3HK0 A;  5LON B;  4EMO A;  3R7R A;  2PZ1 A;  2MLB A;  2KO3 A;  4HCN B;  3WIM A;  3WAO A;  2PPH A;  1L2N A;  3SU8 X;  2MWS B;  3KRW A;  5DHA B;  3PRM B;  2N9X A;  4DHJ B;  1WGG A;  3M63 B;  3H7S A;  4GMV A;  4NQK E;  1TQZ A;  1YX5 B;  4DK5 A;  4EUT A;  1KLV A;  5C6R A;  1YQB A;  1Q67 A;  4EOY A;  3PG7 A;  2B3A A;  3SNH A;  2K1F A;  2NMB A;  2IYD B;  1FAO A;  2D4Q A;  4DHJ D;  3GZN I;  1I42 A;  3VQI A;  4K81 A;  3N32 A;  3BY4 B;  3MHS D;  3SD5 A;  2DHI A;  2KMA A;  2D11 A;  3TVV A;  2RLO A;  2XK5 A;  4ICU A;  5LOP B;  3E9O A;  1T0Y A;  1GNU A;  2ABD A;  4W9K A;  3APC A;  2G3Q B;  2RQ1 A;  3VAW A;  3ZVV A;  2LYD A;  2M0X A;  2LKO A;  4HHV A;  3PRZ A;  1U2B A;  4IWP A;  3UIN B;  4GZU A;  5D3W A;  1KC7 A;  2C7M B;  3OAW A;  1SGH A;  1VCB A;  2M14 A;  1HE8 A;  1BT0 A;  1UNR A;  2ZVO A;  3OAN A;  1OEY J;  2FID A;  3VOQ A;  4EEW A;  3SV1 A;  4MJS A;  2PJH A;  3ML9 A;  1ZW7 A;  2GJY A;  2JRI B;  4MGY E;  1EF1 A;  2LOX A;  1OMW A;  2FCQ A;  4XZ4 A;  1S3S G;  1WGQ A;  2DN6 A;  5D3X A;  2IO0 B;  5CHV C;  1DBH A;  4GDK B;  3KW5 B;  2AWT A;  1EAZ A;  1YX6 B;  3FP5 A;  3VFK A;  4K17 A;  2ADZ A;  1SHC A;  1WRD B;  1WYW B;  1K8R B;  4GU2 A;  4EZL A;  5DPS A;  4IFS A;  3PHW B;  1I2H A;  1BTN A;  2H7E A;  1IYF A;  1XT9 B;  2RGN B;  4HAT B;  4II3 B;  3UF8 A;  3PVW A;  3O65 B;  3KUC B;  3A1Q A;  2KC1 A;  2G4D B;  4KDI C;  3FSS A;  3AXC A;  1WZ0 A;  2IBI B;  3ZNH B;  3RZW C;  5J3Y A;  1KZG A;  2CHW A;  3HM3 A;  1W1H A;  2CQU A;  4WJP A;  2KOX A;  2V1Y A;  2AEH A;  2X0S A;  3PHX B;  3VH4 B;  2L8J A;  4W9H A;  3PRE A;  4ICV A;  1R4N I;  4IOY X;  1LXD A;  2DAF A;  2LGX A;  1FXT B;  2N9E B;  1PQS A;  4WVF B;  4OVU A;  1IRS A;  5GMV A;  3T8M A;  3FM8 C;  3DVN U;  2X18 A;  5JZE B;  4TQ1 A;  3LJU X;  2ZJD A;  1LFD A;  3QWM A;  2NBU A;  1ZGU B;  2NZ8 B;  4HPL B;  1RRB A;  3E9P A;  2YT1 A;  3IFW B;  1J0G A;  4LJP B;  1UBQ A;  4ANU A;  2RGF A;  4MDK E;  2ZCB A;  3A9J A;  2K6D B;  3W1Y A;  2KC2 A;  1WF9 A;  4FJZ A;  1WXM A;  5CTR C;  4DHZ E;  2Z59 B;  4GMX B;  2DKP A;  1Q5W B;  4JL9 A;  2VRW B;  4JKB A;  2W2W A;  2ZVN A;  2LAS A;  3ZRC A;  1X86 A;  5JH5 C;  1M7E A;  1H4R A;  4FN2 A;  2HTH B;  2K8C A;  3ENE A;  1DDV A;  4MSM B;  5LXI B;  2COA A;  2Z0E B;  4W9G A;  2LWP A;  3VUW A;  3RCZ A;  1XD4 A;  3HM6 X;  5CLL B;  2KGX B;  1WGY A;  1UD7 A;  1FOE A;  4CHJ A;  2MKR A;  2QKM A;  3PSE B;  4ILJ A;  2NR2 A;  4FLH A;  4Y94 A;  2BYV E;  1VBH A;  5D27 A;  3PVL A;  4G3X B;  2O6V D;  2IYB A;  4NAW B;  2UYZ B;  2RNR B;  1IPG A;  2K6Q A;  4LDT D;  2JY6 A;  1Y5O A;  3QBV B;  1I7A A;  2EC1 A;  3A8Q A;  1V5P A;  1V5T A;  4TUU A;  1CMX B;  2J0J A;  4GB9 A;  2KKC A;  4JKC A;  1ZC4 B;  5CX3 A;  3EHV A;  2DAJ A;  2LRU A;  2GS0 A;  2D07 B;  4FHJ A;  3WAN A;  2ZCC A;  2LZ6 A;  4WSF A;  1B55 A;  2MBQ A;  2JWZ A;  3BIN A;  2GBR A;  2MQJ A;  2QKL A;  3SDL C;  2YSZ A;  1E90 A;  4HVB A;  4FAD A;  3PEG A;  2Z0O A;  1P6S A;  1JDE A;  1ISN A;  3V6E B;  3IHP C;  1MPH A;  5AZH A;  2UWQ A;  4PS7 A;  5G55 A;  1MAI A;  5KQ1 A;  1P3Q U;  2HJ8 A;  1TJ6 A;  4KSL C;  2WH5 A;  4HB2 B;  1WXV A;  2DX5 A;  1V89 A;  4EZK A;  4NNJ B;  1WY8 A;  2HE7 A;  2M1M A;  2D10 A;  3U30 A;  2ZPY A;  3V5W A;  5IAA C;  4H8S A;  3QX1 A;  1WXS A;  4A3P A;  3H9D A;  4BOS C;  2LGD A;  1GG3 A;  1HBK A;  4A6F A;  3U8Z A;  2MDX A;  4BKS D;  2QHO A;  2J0K A;  3MPX A;  4I6P A;  1E8W A;  4BOZ B;  4PNK A;  1EO6 A;  4GIV A;  2K2U A;  2JZZ A;  2LD9 A;  2COP A;  1BWN A;  1F9J A;  3PZD A;  3L13 A;  4B6W A;  1FGZ A;  4P7I A;  2KDI A;  4WAA A;  4KSK C;  2UZS A;  3NZU A;  4IC7 B;  2KFJ A;  2MSE D;  1WGU A;  1DYN A;  4CO7 A;  1JRU A;  1IP9 A;  4BKS A;  1ACA A;  3LDZ E;  4PS8 A;  2P8V A;  3A9K A;  2KAN A;  3APD A;  1P5T A;  1PFJ A;  4IM0 A;  2KJH B;  1S1Q B;  3ZO5 B;  1UH6 A;  1U29 A;  3B0A A;  2RUK B;  4TKN A;  5JLJ B;  2GCL A;  3A8P A;  4F8C B;  4LCD E;  2NPT A;  1KJT A;  1NTV A;  2L2I A;  3TCA A;  2MBE A;  3ODO A;  1WXA A;  4BBN F;  3DXC A;  2J7Q B;  3MJW A;  1J8C A;  4NY0 A;  2BWE S;  2GBJ A;  2W2X D;  2MRP A;  1UZX B;  3WAL A;  4ANX A;  2DKQ A;  3PTF C;  4ZDV A;  2KN5 A;  3TBL D;  2YS3 A;  1V49 A;  1NBF C;  5AZF A;  4WJ7 A;  1RFA A;  2ZNV C;  1WJN A;  5FR6 A;  1EVH A;  1U4A A;  1A5R A;  3QA8 A;  1V80 A;  3NS8 A;  2AL3 A;  2DFK A;  3PPA A;  1WJ4 A;  3Q3F A;  1MIX A;  1P3R A;  2Z0P A;  1WGD A;  4KVG B;  3M1I B;  4B6H A;  2DX5 B;  1NI2 A;  5DCN A;  2NS5 A;  2C9W B;  2M38 A;  2M8S A;  3CF6 E;  2D9X A;  4FJV B;  3PLU A;  2ROZ B;  3E66 A;  1LW3 A;  1V81 A;  5J3Q A;  2NCN A;  2KJ6 A;  4G0N B;  4MGK E;  2BYE A;  4W9L A;  1HB8 A;  1GJZ A;  3RUL A;  2MBO A;  1XX0 A;  5C1Z A;  4FBJ B;  2ELA A;  2H7D A;  4WJN A;  1C3T A;  4JLC A;  1MK9 B;  3KUD B;  1ST7 A;  4LDT B;  2J0M A;  1FGY A;  3DQV A;  1GUA B;  2KTR B;  5C79 A;  2KCJ A;  1P98 A;  1E7U A;  5CHW A;  2OJR A;  4MH0 E;  2CKH B;  1PMS A;  1UEL A;  1V5U A;  2L0F A;  2R82 A;  2FJ9 A;  1FHW A;  1X1M A;  1P9D U;  2CY5 A;  2DX1 A;  3RT3 B;  1Y8R C;  1WVH A;  5D3V A;  4PQ0 A;  3GYO A;  1WH3 A;  2RPQ A;  2YT0 A;  3HIZ A;  4KIK A;  1TXD A;  2CY4 A;  2RSU A;  4C0A A;  4JGH B;  2I1K A;  3KH0 A;  3HQC A;  1WR6 E;  2DZJ A;  4KAX B;  2JRH A;  2I1J A;  4CHM A;  4NQL B;  2L0T A;  3SBT A;  4MGI E;  2MCN B;  1U27 A;  1I35 A;  3ZIM A;  1FHO A;  2I5C A;  5HE1 A;  5JHH A;  4RM8 A;  3N30 A;  4I6N B;  4N9F 4;  1D3Z A;  4II2 B;  4A6K A;  4HPM B;  1H10 A;  3ZNG C;  2LGY A;  1AQC A;  2CB8 A;  2YS5 A;  2COD A;  5EFX A;  2L7R A;  2Z0Q A;  4Z2M B;  1Q0W B;  2KLG A;  4W9E A;  3QCA A;  2A5U A;  4MEM A;  2LVP A;  4K7S A;  2JPH A;  5E6O A;  3H1U A;  1Z5S B;  5C5B B;  3VTU A;  4W9F A;  2FAZ A;  4A6H A;  3CMM B;  5JHB A;  3NOB A;  2IO2 B;  5IJM A;  3QIJ A;  2N0Y A;  2XK5 B;  3IBE A;  1YJ1 A;  2ROV A;  4JKG B;  4GOC A;  2R09 A;  5JHG A;  4HDQ A;  2MA9 B;  2V3S A;  4K2P A;  1V5M A;  3FEH A;  2D9V A;  1OTR B;  1U5D A;  3TFM A;  4GXB A;  1WZ3 A;  4K1R B;  2MBB B;  5FI1 A;  1DDM A;  1OQY A;  1TZ1 A;  2KDE B;  2KDB A;  1WFY A;  1V88 A;  2CHX A;  2CS4 A;  4BKT A;  1WI0 A;  2R2Q A;  5J2R A;  4BKG A;  4FHK A;  1J19 A;  1X1F A;  2ZNV B;  2KD0 A;  3GOE A;  4K7U A;  4AUQ C;  3ODW A;  2AYO B;  2M17 A;  2WDT B;  4B9K A;  2N23 A;  3ODX A;  1P0R A;  3TIX A;  2JVC A;  4HCP B;  1YIW A;  1J0W A;  2GBK A;  1RAX A;  3DBH I;  4JK9 A;  2Y5B B;  2D3G A;  1V61 A;  4ANV A;  2WX1 A;  1NTY A;  3SUZ A;  2XBB C;  3LJ3 A;  1WG7 A;  1Q1O A;  1KM7 A;  3F5R A;  2LI5 A;  1WR1 A;  4TYZ A;  4W9J A;  1XR0 B;  4HB0 B;  2DHJ A;  2UVM A;  3VHT C;  5EDS A;  3VIA A;  3RZF A;  1U5G A;  5DH9 B;  1EUV B;  4NJ6 A;  3ULC A;  4JKA A;  3V60 A;  4XWX A;  2FJL A;  2R0D A;  3X0W A;  4HAZ B;  3KYD D;  2YVC A;  1XCG A;  2N1V A;  1ZSQ A;  2PEA A;  2KTF A;  5D94 A;  4JK8 A;  3MDB C;  4RM9 A;  2DEN B;  1LQB A;  3ULB A;  3I3T B;  1TTN A;  2DYQ A;  4ZRK A;  2L1C A;  1UBI A;  2LBB A;  1HB6 A;  4HAX B;  3EEC A;  3P7Z A;  3R7Q A;  3QC8 B;  3UIP B;  3RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...