4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/cell adhesion
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
1S1QB 2L7RA 2OOBB 3VAWA 2G4DB 1EGXA 1WXAA 1EUVB 4AOFA 4MEMA 3UQAA 2D11A 4EFOA 2AL6A 3ZTCA 5IA7A 1OMWA 4IWPA 1XKEA 3SUZA 4HAVB 1W1DA 1YX6B 5HE2A 4HJKA 3A4RA 3A1QA 1WX9A 1FOEA 2DENB 1WGUA 1WY8A 4F1SA 1WI1A 4EOYA 4FHJA 2D2QA 1WJMA 5JP4A 2BKRB 3U30A 3P6AA 1X1GA 2LRWA 3DOWA 3ZRCA 4ZDVA 5L81A 3H7PA 4CHMA 3UIOB 3PTFC 4IWQA 5J2RA 4HB4B 1OY2A 4K7WA 1GC6A 2KX0A 3NZSA 1PLSA 3VUYA 1NU2A 1I42A 3CIKA 1KLVA 2MP2B 3N7CA 3BJIA 1GUAB 2M4NA 3VTUA 3VVWB 1FGZA 1WRDB 4WJPA 2RNRB 2MDXA 4HPMB 2XQNM 4WVFB 4DK5A 2ZNVB 1WVHA 4DX8A 1HE8A 3N3KB 3PVUA 1MG8A 4MELA 2KJRA 1OQNA 4W9LA 1U5DA 3A33B 2KTRB 4I6NB 2NMBA 1TZ1A 5D3XA 1H10A 1NBFC 2VKIA 4PS7A 5C6RA 4URKA 1P6SA 2P0FA 2MW5A 4DDGD 3L0WB 4A20A 4FADA 3DVNU 3HIZA 3BY4B 4HHVA 2KFKB 2MBOA 4G0NB 2L3ZA 1ZVRA 4JL9A 5D6JB 2ZVNA 2R09A 3PVWA 2KCJA 1AWEA 2N7DA 5CLLB 2W2XD 1WE7A 4NJ7A 4TUUA 2CHZA 4KDIC 5J18A 3DBRI 4II2B 3MDBC 4JQWC 1GNUA 3KUCB 4DBGA 1V89A 4H8SA 5DIFB 4KHOA 4CHJA 2LVQA 5L95C 2AWTA 3ZDMC 5IAAC 3PRPB 1J0WA 2RSGA 2N9PC 1GC7A 2X18A 2IO0B 4TV3A 1K8RB 2KWCA 3W1YA 1T0YA 2XEWA 1WGRA 3TFMA 4HLEA 2XBBC 3PVLA 2MFQA 1UPQA 1K5GB 2P0DA 4EZKA 1KM7A 3WAOA 2C60A 2C7HA 4GSWA 3ZNID 1DYNA 4NAWB 4AP4C 2YVCA 3KYCD 5HE0A 2KVRA 1OEYA 1Z2MA 3AULA 1K5DB 3KSYA 2WDTB 3R3MA 3BINA 2P8VA 2N0YA 5AZFA 5DHFB 4FJVB 1G6JA 3ZVRA 3KH0A 2OJRA 4K7SA 2MP2A 2YT0A 4DHJD 5FI0A 1WGDA 2PPHA 2DX5B 2PEAA 1TGZB 1P3QU 3NY5A 4KDLB 3AJ4A 1TJ6A 1V49A 3M63B 1UBQA 2KKCA 4EMOA 3KYDD 2M8SA 2Y5BB 2N1VA 3HM3A 3VIAA 4LJPB 2M38A 1LM8B 4ASWC 3QC8B 5CX3A 2DLWA 3RCPA 3AI5A 4MH0E 2C7MB 4CHKA 2KQ7A 2DYQA 5C5BB 1I35A 4A3OA 3P7ZA 4TYZA 2M17A 4F7UP 1FHWA 5EDSA 2A4ZA 2KFKA 2NS5A 2GOWA 3TVVA 3HM6X 5C23A 1XT9B 4W9CA 2HTHB 4MGZE 2ZPNA 4PS8A 4AUQC 4NJ6A 4PYZA 1WJ6A 1U4AA 3TL5A 4GPTB 2ELBA 2KOXA 5J3QA 2CS4A 4KSKC 1PQSA 1NTVA 1B55A 4IOYX 1UZXB 4FJYA 3UQBA 3PRZA 4P7IA 2LD9A 3PHXB 3QK0A 4GN1A 1X11A 5AZHA 4GIVA 3PZDA 2JWZA 2M1MA 2MBQA 2BGFA 3V6EB 3JSVB 3DBHI 4B95A 1H4RA 3QWMA 2MBEA 2Y8FA 4KIKB 2L1CA 2LWPA 4GXBA 2PE6B 2ZVOA 4EEWA 1WH3A 2FIDA 2ZCCA 4N9F4 2YS3A 1MIXA 3A8QA 2KNBA 4W9JA 3APFA 2K8HA 5LXHA 4NAWA 2DHJA 1P5TA 1AQCA 1EVHA 2IY0B 3QCAA 5JHGA 2Z0DB 3U8ZA 4W9HA 2KDEB 2K6QA 2L05A 1FB8A 3ZIMA 1XR0B 2XK5B 3WYFB 2KANA 5DI9B 3Q3FA 3S2AA 2RGFA 2K8CA 4MM3A 2DX5A 1J0GA 2LXCA 2K6DB 1MKEA 3V5WA 1RLFA 3ZNGC 1TXDA 1RRPB 1UH6A 4ANWA 1ZW7A 2V76A 2N4FA 5DPRA 4PQ0A 2KWUB 2FIFA 4KHAA 4HAZB 1LFDA 3M1IB 3SHQA 5FI1A 2HJ8A 5C5BA 3V61A 2GS0A 3ODXA 3D8FA 2CKHB 2KLGA 3A98B 5CHFA 1IRSA 1WJ1A 2V3SA 4WJ7A 2DYBA 2KC2A 1NI2A 2HTHA 3SDLC 1DBHA 2LASA 3CSTA 4GDKB 4LDTB 4ZRIA 2D9WA 4K2PA 1V5MA 3A9JB 4E3CA 4JIOU 3P2BA 2H7DA 3SU8X 1IPGA 4JLCA 3A8PA 3VTVA 3NOBA 1DDVA 3QHTA 2MWNB 1EF5A 3UZTA 3JSVA 1WZ3A 2KMAA 1VCBA 4KSLC 2O2VB 3V62A 4ZRJA 2MCNB 3KW5B 4MGYE 4CYEA 2MA9B 4HWIB 1P3RA 4KIKA 2D4QA 3W1SA 1GJZA 4GMXB 2J0JA 2J0KA 1V80A 1M94A 2PJHA 1BT0A 2Z0QA 4XZ4A 3APCA 3DPDA 4I6PA 2LKOA 4RMAA 2ZEQA 1QZEA 2MQJA 3GYOA 3WAPA 2LOZA 2FNJB 2EMSA 2VRWB 5D3WA 4WWNA 4MK0A 2JP2A 2KUPA 1SGHA 2COFA 2KFJA 1LXDA 2RLOA 3PGEA 2LUEA 4KVGB 3ML8A 2UZSA 2KDBA 2KHWB 1Q67A 5DPWA 5D2MB 2XK5A 4HB2B 4C0AA 1LW3A 3T06A 1V86A 4KZCA 2Z0EB 5FR6A 1J19A 5L83A 2EJ8A 3ALBA 4K7UA 3SO6A 4EUTA 2UYZB 3O96A 2LOXA 3VFKA 1P0RA 4Z2MB 2DX1A 2RVBB 5KQ4A 4NQLB 4MGKE 3KZ1A 2GCLA 2G35A 4IFSA 2ROZB 4ZRKA 2NBVB 1SHCA 2RR9A 4TQ1A 3TW1A 2GBRA 2R0DA 2K25A 4W9FA 2KJ6A 2R2OA 1PFJA 3I3TB 3C0RB 4EZLA 3KVFB 3VXWA 2FJLA 4BFRA 1R4MI 3RUIB 4KHBB 3WALA 4DHZB 3HHMA 3QBVB 3SYXA 2IO3B 4EJNA 2IFSA 1KJTA 4GDKA 1UNPA 4F7HA 4GOCA 3VUWA 4ICUA 3A9JA 1SE9A 2KXJA 2IY1B 3DXDA 3KY9A 1UGMA 2K39A 1OTRB 3AU5A 3NZUA 1M7EA 3R7QA 3JVZX 3FEHA 3OJ3A 3ML9A 3M62B 3SD5A 2GBMA 5JHAA 2O6VB 5GMVA 2I5CA 2O2VA 1WI0A 4JGHB 3VUXA 2WX1A 1D3ZA 3KRWA 1N3HA 1WGHA 4BKGA 4NQKE 4HAUB 4W9GA 5CTRC 2KMCA 1KOTA 4DHZE 3IG3A 4WJOA 3ZTDA 2JZ3B 1C3TA 1E8XA 4K1RB 1MPHA 4A6FB 2ZPYA 2J59M 2FCSA 3T9LA 2DA0A 4PYUA 3VOQA 3GOEA 1U27A 3ZNHB 3WIMA 5DH9B 2DAJA 1YJ1A 4WWPA 2IZVB 2DKQA 3PPAA 2COCA 5JZEB 1P9DU 4HATB 2NPTB 2D3GA 2OQBA 2DHKA 4F7ZA 4IAPA 1ZGUB 2BWES 1TTNA 2L8JA 4G50A 5HKHA 4BBKA 1WYWB 2JZZA 3L54A 1LQBA 4B6WA 3DDCB 3OAWA 2C5LC 1GG3A 2ZZPB 2MX2A 3N30A 1NDDA 2L2IA 1WXMA 1RFAA 4E74A 1WF9A 4IUMB 3B0AA 1ZKHA 2W2WA 2FCNA 3D8EA 2W9NA 2WX0A 2DZIA 2CAYA 2HE7A 2L0FA 4XX5A 3H1UA 4NPNA 5DPSA 1YD8U 3ZRFA 4YONA 3DXEA 2YSZA 2CU1A 3QAQA 2YT1A 1IYFA 1L2NA 4B9KA 3L08A 4EKUA 1V5TA 4XC2A 2KTRA 4GB9A 3ZDTA 1YQBA 2YRYA 2KWVB 1R4NI 3ZNZB 4GU2A 4HB3B 2DZJA 1WJNA 4HAWB 5LXIB 3QQ8B 2HD5B 3UIPB 1LB1A 2LGXA 1WZ0A 1BWNA 3G9WA 2WYQA 1WX7A 3HQCA 4PS3A 4E71A 2DYNA 4L6EA 4FBJB 4MJSB 3L10B 2K8BA 2NVUI 3LJ3A 3D32A 3R7RA 2KTFA 4M0WB 3UF8A 3X23A 1OQYA 1XD4A 2JXXA 2BWFA 1WGGA 4A6FA 4MSMB 4Y94A 5KHOA 1E8YA 2EKEC 3A9KB 3UGBB 4PNKA 4DXAB 2LGYA 2BF8B 2CRFA 2KQSA 1WMHB 4M8MA 3PRMB 1UNQA 2D10A 1WE6A 4BOSC 4BVUC 2N23A 4GGQA 3LJUX 4IC7B 1X86A 1UELA 4M8NA 4TKNA 3DQVA 3DVGX 4KV2A 3JW0X 1X1MA 3R66C 4DDID 4W9KA 2D9YA 3ENEA 3QARA 4IWOA 1E7VA 5HE3A 2NPTA 1WJ4A 1P1AA 4FA6A 3HK0A 2ZJDA 2FCMA 2P0HA 2BCJA 4MDKE 1FAOA 1WR6E 1WR1A 4AJWA 2V1YA 4NNJB 2BPSA 1V5UA 1X1FA 3ZW3A 4G3XB 3PHWB 4EZJA 1ZM0A 1XODA 1Y5OA 1Y19B 4GDLB 3TMPB 2Z59B 4HK2A 2NBUA 3PSCA 2KC1A 2IO1B 4A6HA 2YLMA 1RAXA 3VTWA 2CY4A 3DCGA 2RGNB 3QA8A 2VSZA 4BOZB 1FXTB 5TR5A 3DVNV 2EC1A 3TCAA 1TQZA 1DROA 1Z5SB 5JHHA 4HB0B 3QX1A 4GMVA 4CO7A 4MJSA 2DN6A 3VH3B 4FN2A 3IFWB 2COAA 5D3YA 3ZVVA 2YF0A 2G4SA 1AARA 1U5GA 2JPHA 5J3TA 2N7EA 1UPRA 2LI5A 3O65B 3A9KA 3F0WA 5KQ1A 4LCDE 2ROVA 2DHZA 2CY5A 1WMHA 2NBWB 1BTKA 2BKFA 3PSEB 2MLBA 3EFUA 1U5FA 2LYDA 2W2XC 3OJ4B 2AEHA 1I7AA 1BTNA 4ANVA 2QKLA 3RZWC 2IBIB 1QQGA 5C79A 2RUKB 2L00B 1V61A 1V88A 3M95A 3TIXA 3F5RA 3PLVA 1ZSQA 3L13A 3GYPA 2M14A 4DBBA 2AYOB 4NSWA 1M7RA 3A4SC 1U2BA 5G2NA 3AU4A 4MY6A 1XQQA 1FGYA 4B6HA 3L16A 1Q1OA 4ANXA 5JH5C 1C1YB 5GOWB 1W1HA 1FHOA 2KN5A 2A5UA 4F7GA 5DPTA 4G11A 2GBKA 1MAIA 2JUOA 2GMIC 1RRBA 1KZGA 5DHAB 2VRRB 4GDLA 1V6EA 1MIZB 3FM8C 1MK9B 1E7UA 1UBIA 2K2UA 4K2OA 2DYOA 4LJOB 4A5KA 1FHXA 2LVOA 3PT2B 1TBEA 4IM0A 1EF1A 1YIWA 2LRUA 2CODA 3ECIA 3ZUNA 3OLMD 2FAZA 3AXCA 1RJ2A 1WM2A 2DZKA 4MGIE 1QC6A 5D3VA 2ELAA 1UNRA 4FLHA 4X57B 1DDWA 4K17A 5CLQB 3ZLZA 5HE1A 4DX90 1J8CA 5EFXA 2KDFB 3IVFA 2PZ1A 2OTXA 2E2XA 1WXVA 4HXDA 2IYBA 2Y8GA 1V9JA 3MHSD 3SNHA 4KZ0A 4FULA 4IW0A 2DTCA 2GBJA 4ICVA 1V81A 2C7NB 3WANA 1PMSA 2D9ZA 1W1GA 2LG1A 4HCNB 1Q0WB 2I1KA 2G3QB 1WG7A 2KD0A 1Y8RC 3VH4B 2LJ5A 1E8ZA 3ULBA 3CXBB 3NHEB 3T8MA 2Z0OA 4OVUA 3X0WA 4HPLB 5D7GA 3IHPC 1P98A 3RZFA 2JT4B 2B3AA 1Z87A 2ZNVC 3CSFA 1S3SG 3PG7A 4LDTD 5CHVC 3ZO5B 5JHBA 2L76A 3HW2B 3QWZB 3LDZE 5LONB 4RM9A 3PP2A 4BBNF 3MTNB 4YL8A 3ODOA 4HCPB 2H7EA 3OANA 1WGQA 4MT7A 1OGWA 5J17A 4F8CB 1EO6A 2RSUA 2JF5A 4A3PA 1VD2A 5BO4B 2YS1A 5KCVA 1YX5B 3CMMB 2N9XA 1DDMA 4BBNC 1H8CA 2CHWA 1F9JA 2DAFA 1XCGA 4BKSA 1Q5WB 4WJQA 1WJUA 3VDZA 2K2JA 3GZNI 5C16A 3MJWA 3K9OB 4IG7B 2BYEA 2DFKA 2BYFA 2M0XA 2MBBB 2N1WA 2JRIB 1XD3B 3CF6E 1WXSA 3K9PB 2Y7BA 2KZRA 4II3B 4Z2NA 5CHWA 2DYMA 4WSFA 2J0MA 2IO2B 5G55A 2O6VA 1CMXB 3KUZA 2LGDA 5J3YA 1A5RA 2GBNA 3V6CB 2I5FA 3DXCA 3VHTC 2NR2A 2K1FA 3RD2A 1U29A 4ANUA 3PS6A 1UEFA 3IBEA 1KI1B 2NZ8B 2UZRA 3PLUA 2UVMA 4K81A 4OVVA 1JRUA 3JYUA 2ZCBA 4FJZA 5E6NA 2GCJA 3U7DA 3QJZA 4ZYNA 1WX8A 3RULA 2Z0PA 3PV1A 4D0NB 3H9DA 1UD7A 2DKPA 2KO3A 2BYVE 2IYDB 3ONSA 2JVCA 2JY6A 3QIJA 1NTYA 5AZGA 2N9EB 1V2YA 2ADZA 3NS8A 1V5OA 3EHVA 1SIFA 4BKSD 1ZC4B 2MKRA 3D8DA 3KUDB 4AWJA 2RD0A 2KDIA 3ODWA 3RYTA 4MSQB 1BAKA 2K00A 2MRPA 2I1JA 4WWOA 4W9IA 2KJHB 4DWFA 4HDOA 4HVBA 1ISNA 2PE9A 2D9XA 2MWSB 3H7SA 2FCQA 1E90A 2J7QB 1E8WA 3PREA 2KGXB 5JLJB 2CHXA 3FSSA 2MSED 4FHKA 3EECA 4NY0A 2DHIA 2O6VD 3PEGA 3A1QB 3DBLI 5AEKB 3N32A 2V4LA 5LLIA 4WQOB 1EAZA 2MBHA 1X05A 3UINB 2DZMA 2WWZA 3APDA 1WFYA 2D9VA 2R2QA 2LULA 2FUHB 1L7YA 2LVPA 3EC8A 1MK7B 5C1ZA 3Q3JA 2UWQA 3SV1A 2L0TA 2LZ6A 3TJPA 2QHOA 3H7PB 1ZC3B 3VQIA 5D27A 2GJYA 1WIAA 3B1LX 1E5WA 1V5PA 3WA0A 4XWXA 3ULCA 2RPQA 3WAMA 2EMTA 5LOPB 3W1SC 5E6PA 2G45B 4BKTA 4GZUA 4AJYB 2YS5A 3KRXA 3DBSA 4TQ0A 4HAYB 1WGYA 2QKMA 5E6OA 3RCZA 2NCNA 4IM3A 2KX3A 2LXAA 2ASQA 1WM3A 4I6LB 3NSUA 4RM8A 1KZ7A 4IM2A 3ZKJC 2JRHA 1IP9A 1U5EA 4HAXB 4HDQA 3TO1A 3B08A 4KAXB 2AL3A 4W9EA 3DVGY 5D94A 3RT3B 4WAAA 3H6NA 1I2HA 4A6KA 5KHQA 2KK8A 3MPXA 3V60A 3M3JA 3TBLD 2REXA 2Q13A 4DHJB 2KLCA 1OEYJ 4WJNA 3ML4A 2D07B 5DCNA 2C9WB 3L17A 1XX0A 2CR5A 4W9DA 4J6IA
chains in the Genus database with same CATH superfamily
1S1QB 5BMIA 1R4NB 2L7RA 2OOBB 3VAWA 2G4DB 1EGXA 2L32A 1WXAA 3N20C 1EUVB 4AOFA 4MEMA 2WXRA 3UQAA 2D11A 4EFOA 1ESFA 2AL6A 3ZTCA 4N6EB 3AEBB 4RF1A 5IA7A 2LEKA 1OMWA 1C76A 4IWPA 3R8BA 4N58A 1XKEA 3SUZA 4HAVB 1W1DA 1YN3A 3U12A 1YX6B 3KQ4A 5HE2A 4HJKA 3A4RA 1TS4A 5HI1A 3A1QA 1WX9A 1B9RA 1ST7A 1FOEA 3CWIA 2DENB 1WGUA 1WY8A 2MHJA 4F1SA 1WI1A 3T3NA 4EOYA 4FHJA 5M4YB 2D2QA 1KRHA 1WJMA 3I5JC 2YEPF 5JP4A 2BKRB 2IGDA 3U30A 1JALA 1V8CA 4QAYA 3P6AA 1X1GA 3ZQ4A 2LRWA 3DOWA 4XDCA 3ZRCA 4ZDVA 5L81A 3H7PA 4CHMA 3UIOB 3PTFC 4IWQA 4L1RA 5J2RA 4HB4B 1OY2A 2INCC 3TEZA 3AB5A 2BVCA 2KWDA 3E9SA 4K7WA 1GC6A 2KX0A 3NZSA 2WXNA 2ONQA 1PLSA 3VUYA 2Z8LA 1WWTA 1NU2A 2N7JA 1I42A 5I2SA 3CIKA 1KLVA 1PGBA 2E3TA 2MP2B 2GRIA 4OZBA 3N7CA 3BJIA 1GUAB 4M01A 2M4NA 4JK9A 4US8A 3VTUA 3VVWB 1FGZA 3BK2A 1WRDB 4QJ4B 4WJPA 2RNRB 2MDXA 4HPMB 2XQNM 4QXAB 4WVFB 4DK5A 4KGTA 2ZNVB 1J7AA 1WVHA 4DX8A 3EPYA 1HE8A 3N3KB 3PVUA 2PMVA 1ZOYB 1MG8A 4MELA 5LNK1 2JSVX 1OQNA 2KJRA 4W9LA 5IRSA 4EE2A 2JX5A 4S0RA 4L23A 1U5DA 3A33B 1XXGA 2KTRB 2J4XA 1VRAB 4I6NB 2NMBA 1TZ1A 5D3XA 1H10A 2AQ1B 1NBFC 2VKIA 4PS7A 5C6RA 4URKA 1P6SA 4C7ZA 1VBHA 2P0FA 2MW5A 3B77A 4DDGD 3L0WB 4A20A 3FLVA 4FADA 3DVNU 3HIZA 4TMAB 1WSPA 3BY4B 4HHVA 2KFKB 3GP7A 3RNAC 2MBOA 2M56B 4G0NB 2L3ZA 2WXOA 1FRRA 3IT4B 1ZVRA 4JL9A 5D6JB 3DHHC 3SBTA 1FPYA 2ZVNA 3VR8B 4XDDA 2R09A 3PVWA 2KCJA 1AWEA 2N7DA 5CLLB 2W2XD 1NENB 1WE7A 2AX5A 1E0ZA 2BBCA 4WQMA 4NJ7A 4TUUA 3U4EG 1L4DB 2CHZA 4KDIC 5J18A 2ON8A 3DBRI 4II2B 3MDBC 4JQWC 3ZJVA 1GNUA 3KUCB 4DBGA 1V89A 4H8SA 5DIFB 1CJEA 4JWSC 1C4CA 4KHOA 4CHJA 2LVQA 1I4GA 5L95C 2AWTA 3ZDMC 4OT1A 5IAAC 4L2YA 3PRPB 1OQRA 1J0WA 2RSGA 3N1ZC 2N9PC 1GC7A 2X18A 4XWWA 2IO0B 1YQ3B 2BB6A 1K8RB 4TV3A 2KWCA 3W1YA 1WRIA 1XO3A 1L6VA 1T0YA 1L0YB 2XEWA 1WGRA 3TFMA 4HLEA 2XBBC 1P7FA 2W3RA 3FKYA 3PVLA 3Q6BA 2MFQA 1UPQA 4RNAA 1K5GB 2CJNA 2P0DA 2LJIA 2LGIA 4D6WA 4EZKA 1KM7A 2RDBC 2C60A 3WAOA 2C7HA 1PDXA 3C19A 4GSWA 3ZNID 1DYNA 1F2RI 4NAWB 1JRPA 3Q2AC 4AP4C 2YVCA 3KYCD 5HE0A 2KVRA 4USAA 1OEYA 1Z2MA 2KAJA 1JQ4A 2ICIA 2JXTA 3AULA 1ZXIA 1K5DB 3KSYA 2WDTB 3R3MA 4RH6A 4KX6B 3BINA 2P8VA 2N0YA 5AZFA 4R3DA 5DHFB 4FJVB 1D5MC 1G6JA 3ZVRA 3KH0A 1Y56A 2OJRA 4K7SA 5IOIA 2MP2A 4L1BA 4TSSA 2CU3A 2BS3B 2WP9B 2L52A 3R2IA 2YT0A 4DHJD 4ZRPA 5FI0A 1WGDA 2PPHA 4GLSC 4MM3B 2DX5B 2PEAA 1TGZB 1SXTA 1N61A 1P3QU 3NY5A 2BB5A 4KDLB 3AJ4A 1TJ6A 1V49A 3M63B 1UBQA 2KKCA 5GXGB 4JE3B 2PW9A 4B0EA 4EMOA 3N1YC 3KYDD 2M8SA 2Y5BB 3DCXA 2N1VA 3HM3A 3VIAA 4LJPB 2M38A 1LM8B 4ASWC 3QC8B 4AQ7A 5CX3A 2DLWA 4JWUC 1PGAA 3RCPA 3AI5A 4MH0E 2C7MB 4CHKA 4MT5A 1ZP0B 2KQ7A 5FR3A 2DYQA 5C5BB 1I35A 2KACA 4A3OA 3P7ZA 4TYZA 3NVVA 4ZOHC 2M17A 3HUIA 4F7UP 1FHWA 1JWAD 5EDSA 1SJED 2A4ZA 2KFKA 3Q3OC 2NS5A 3SEBA 2GOWA 3TVVA 3HM6X 3FILB 5C23A 1XT9B 2K3UA 4XE0A 4W9CA 3RPFC 3RNCC 2HTHB 3R2TA 1DOIA 1JWBD 4MGZE 2BS4B 5HFYA 4K3CA 2ZPNA 4PS8A 3OHMB 1C78A 1KLUD 1T6BX 4AUQC 4NJ6A 4PYZA 1FFUA 1WJ6A 1U4AA 3TL5A 4GPTB 2ELBA 1C77A 3MP9A 2KOXA 2X8XX 5J3QA 2CS4A 3EGRA 1PQSA 4KSKC 3P1MA 1NTVA 1B55A 4IOYX 1QOGA 1UZXB 2K9XA 4A90A 1KTKA 4FJYA 3UQBA 3PRZA 4P7IA 2MJEA 2LD9A 1SF0A 3PHXB 3QK0A 4GN1A 1X11A 5AZHA 1EWCA 4GIVA 1NYRA 3PZDA 2JWZA 2M1MA 2MBQA 2BGFA 1CZPA 3V6EB 3JSVB 1N60A 3DBHI 4B95A 1H4RA 4P16A 4XGAB 1FNWA 1SE4A 3QWMA 2MBEA 2WDVB 2RMMA 2Y8FA 4KIKB 2L1CA 2LWPA 4K3BA 4GXBA 3NWFA 2PE6B 2ZVOA 2SEBD 4EEWA 1WH3A 2V4IB 5IKCM 2FIDA 2ZCCA 2V9HA 4N9F4 1ZDVA 2YS3A 4C00A 4ZHPA 2KYWA 1MIXA 1HB8A 3A8QA 2KNBA 2R82A 5G5HA 4OW0A 3AE7B 3LXFA 4W9JA 3APFA 2K8HA 2D3AA 5BMHA 4IKGA 5LXHA 1L0XB 4NAWA 1PUTA 2DHJA 1P5TA 3AEDB 1AQCA 1EVHA 1J7BA 2KT7A 2IY0B 1ACCA 2KUQA 2PKOA 4OZCA 3QCAA 2WU5B 5JHGA 2DBYA 2Z0DB 3U8ZA 1TKEA 4W9HA 2KDEB 4DXFA 2K6QA 1KBLA 2L05A 1FB8A 1HTOA 4ZRQA 3ZIMA 1XR0B 2XK5B 3L4PA 3WYFB 2KANA 5DI9B 3Q3FA 3S2AA 2RGFA 2WXFA 2K8CA 4MM3A 5D3IB 2DX5A 1J0GA 2LXCA 3Q3NC 2K6DB 5EE3A 3OG5A 4YWGG 1MKEA 4LNKA 1N6ZA 2FJUB 3V5WA 1RLFA 3ZNGC 2MJDA 1TXDA 1RRPB 1UH6A 3NVZA 4ANWA 4LNFA 1ZW7A 2V76A 2INNE 3C8YA 3BVZA 2N4FA 1XCTL 5DPRA 1L4ZB 1GOZA 4PQ0A 2KWUB 4JKGB 2FIFA 4KHAA 3W9CB 3U7ZA 4HAZB 1LFDA 3M1IB 3SHQA 3I57A 5FI1A 2HJ8A 3DHGC 3NZ3A 5C5BA 3V61A 2GS0A 3ODXA 2R2YA 3N9YC 3D8FA 2CKHB 2KLGA 3A98B 5CHFA 1IRSA 1WJ1A 2Z14A 1XF5L 3FILA 3HSAA 4NJCA 2V3SA 4WJ7A 2DYBA 2KC2A 1NI2A 2HTHA 3SDLC 1DBHA 3LYYA 2LASA 3CSTA 4GDKB 4LDTB 4ZRIA 1T0SC 2D9WA 1D6EC 1C4PA 1IGCA 2WDRB 4K2PA 1V5MA 4A9AA 3NVYA 2BQQA 3A9JB 4E3CA 4JIOU 3P2BA 5G5GA 2Y3AA 2H7DA 1BUIC 3SU8X 1IPGA 4JLCA 4OVZA 3A8PA 3VTVA 3NOBA 2WXIA 2WXQA 1DDVA 1TS3A 1KLGD 2Y5PA 3QHTA 2MWNB 1B1ZA 1EF5A 3UZTA 3P63A 2V3NA 3HRDD 3LB8C 3JSVA 3GZNB 1WZ3A 2KMAA 1XCQL 1VCBA 4KSLC 3AE4B 3NUHB 2O2VB 3V62A 4ZRJA 4JPSA 2MCNB 3KW5B 2AQ2B 2BS2B 4CYEA 2MA9B 4MGYE 4HWIB 1P3RA 4KIKA 2D4QA 3W1SA 1GJZA 4BAXA 4JKBA 4GMXB 2J0JA 2J0KA 2ZW1A 4JKHA 1JWMD 1V80A 1M94A 1SEBD 5IN7A 2PJHA 1VBGA 2CB8A 2MEKA 1IBXA 1BT0A 4P6VF 2Z0QA 4XZ4A 3APCA 1EM7A 3DPDA 4I6PA 2KR0A 3KLSX 4JX1C 2LKOA 4RMAA 2ZEQA 1QZEA 2PVOD 3ZGZA 1GB4A 2MQJA 3GYOA 3WAPA 2LOZA 2FNJB 2EMSA 3FC4A 2VRWB 5D3WA 1DGJA 4WWNA 4MK0A 2JP2A 3P4RB 2KUPA 4Q2JA 2LHDA 4DXGA 3RFZB 1SGHA 1L6UA 3SFDB 2COFA 2KFJA 1LXDA 2RLOA 5E6JA 3PGEA 2LUEA 2DNFA 4KVGB 3ML8A 2UZSA 2KDBA 2KHWB 1Q67A 5DPWA 1UWMA 1F2RC 2KDMA 5D2MB 1HA5A 2XK5A 3NS1A 4HB2B 4C0AA 1LW3A 2QC8A 3T06A 1V86A 3Q8FA 2Z0EB 4KZCA 1J19A 5FR6A 1VZ6A 5L83A 2QEJC 2EJ8A 3ALBA 4K7UA 3RI7C 1XLNA 3SO6A 4EUTA 1XLPA 3RNFC 2UYZB 3O96A 2LOXA 3VFKA 1P0RA 4Z2MB 2DX1A 2RVBB 1ZPSA 5KQ4A 4NQLB 4MGKE 1D5ZC 1ZDXA 3AV8A 3KZ1A 1YMHE 2GCLA 2G35A 4A8XC 4P1CC 3URYA 4IFSA 2E6XA 4ZHOA 2ROZB 4ZRKA 2NBVB 1SHCA 2QIEB 4JKGA 2RR9A 3E9LA 1YJIA 4TQ1A 3TW1A 2GBRA 3AEAB 1N63A 3CIRB 2R0DA 2K25A 4W9FA 2KJ6A 2R2OA 3VRAB 1PFJA 2H88B 3I3TB 3C0RB 4EZLA 1XEEA 3KVFB 1FNVA 3VXWA 2FJLA 3PZ7A 3RNEC 4BFRA 1R4MI 3RUIB 4KHBB 3WALA 4DHZB 3NRZA 2DWQA 2D3BA 3HHMA 1FD6A 3QBVB 3SYXA 2IO3B 4EJNA 2IFSA 1KJTA 2UU7A 4GDKA 1UNPA 4F7HA 4GOCA 5FKAC 1YNTE 1NTIA 3VUWA 4ICUA 2Z13A 3A9JA 4KGRA 1SE9A 1QOAA 2KXJA 2IY1B 1PGXA 3WCQA 3DXDA 2LFIA 3DBLB 1PFDA 3VR9B 3KY9A 1UGMA 2K39A 1OTRB 1LGRA 3AU5A 3NZUA 1M7EA 3R7QA 3JVZX 5BYQA 1VZ8A 4KKJA 4LK0M 3FEHA 3OJ3A 3B2FA 4C4VB 4H2AA 5BYSA 2COPA 3ML9A 3M62B 3SD5A 2GBMA 5JHAA 2O6VB 5GMVA 1YJJA 3HVZA 2I5CA 2O2VA 1WI0A 4JGHB 3Q14C 3VUXA 2WX1A 1D3ZA 1NVLA 3KRWA 1N3HA 2LHEA 3W5VB 1WGHA 1EU3A 4BKGA 4NQKE 4HKQA 4HAUB 2JQRB 2PLPA 4W9GA 5CTRC 1STEA 2KMCA 4DHZE 1KOTA 3IG3A 4WJOA 3ZTDA 2JZ3B 1J7CA 1C3TA 1E8XA 2FJ9A 4K1RB 1MPHA 2KIGA 4A6FB 4O1NA 2LGSA 2QDFA 2ZPYA 1GGOA 2J59M 3BVMA 2FCSA 2WXJA 1UUPA 3V3XA 1QOBA 2DA0A 3T9LA 2W82A 1T3QA 4PYUA 1TY0A 2BT6A 3VOQA 2WU2B 4M00A 3GOEA 1TZOA 1U27A 4WAFA 5MPOA 3ZNHB 3BK1A 3WIMA 5DH9B 2DAJA 3EA6A 1YJ1A 4WWPA 2IZVB 2DKQA 3PPAA 3Q8AA 4WURA 3PO0A 2W55A 2COCA 3GB1A 5JZEB 4RGNA 1XLQA 3MHZA 1SJHD 1UGJA 1P9DU 3EFCA 4HATB 2V3PA 2NPTB 2D3GA 2OQBA 2DHKA 4F7ZA 4IAPA 1ZGUB 2BWES 1TTNA 2L8JA 4G50A 5HKHA 4BBKA 1WYWB 2JZZA 3L54A 1LQBA 4B6WA 3DDCB 3OAWA 1D4BA 2C5LC 1IGDA 2XNAC 1GG3A 2W54A 2ZZPB 2MX2A 3N30A 1NDDA 2L2IA 1ET6A 1WXMA 1RFAA 4E74A 1WF9A 3B2GA 4IUMB 3B0AA 1ZKHA 2W2WA 2NBVA 2FCNA 3D8EA 2W9NA 2WX0A 1EWYC 4ITKA 1T77A 1BXTA 2DZIA 2CAYA 2KN4A 4IDIA 4PT5A 2M0AA 2HE7A 2L0FA 2SAKA 1E7PB 4XX5A 3W2DA 4JKDA 2QILA 3H1UA 4NPNA 5DPSA 1YD8U 3ZRFA 4YONA 1HXYD 3DXEA 2K8EA 4KHBA 3AEFB 2YSZA 2CU1A 3QAQA 2YT1A 1IYFA 1L2NA 4REZA 2NMQA 4B9KA 1N5WA 1DYQA 3L08A 4EKUA 3TUOA 1V5TA 4XC2A 2KTRA 1VLBA 1K52A 3ZDTA 4GB9A 1YQBA 2YRYA 2KWVB 1UF0A 4IOIE 2RDHA 3TEXA 1R4NI 3MJ5A 3ZNZB 2FDQA 4GU2A 4HB3B 2DZJA 1WJNA 3AE8B 4HAWB 1FEHA 3ENBA 5LXIB 1SE2A 3QQ8B 2HD5B 3UIPB 1LB1A 4C4VA 2LGXA 1WZ0A 1JDEA 3G9WA 1BWNA 2K5PA 2WYQA 3Q8BA 1WX7A 2ACZB 3HQCA 4PS3A 4E71A 2DYNA 3AE3B 4L6EA 3OWEB 1TS5A 4FBJB 5JXVA 4MJSB 3L10B 2K8BA 3DWMA 4RCOA 2NVUI 3LJ3A 3D32A 3R7RA 2KTFA 4M0WB 4JK7A 2AQ3B 2WHIA 1T0RC 3UF8A 1BMLC 3X23A 1VZ7A 1OQYA 1XD4A 2JXXA 4QJ3B 1JWSD 2BWFA 1WGGA 4A6FA 4MSMB 1JWUD 4Y94A 3EUB2 3RNBC 5KHOA 1E8YA 1FM0D 2EKEC 1MFWA 3A9KB 3UGBB 4PNKA 4DXAB 2LGYA 1RM6C 4J3OD 2RQ1A 2BF8B 2CRFA 3AECB 2KQSA 1ACAA 1WMHB 1DOXA 4M8MA 3ZYYX 3PRMB 3U2SC 1UNQA 2D10A 1WE6A 5C3JB 4HROA 5C2TB 4BOSC 4BVUC 2N23A 4GGQA 3LJUX 4IC7B 1T0QC 1X86A 1UELA 4M8NA 4TKNA 3DQVA 3DVGX 4KV2A 3HIEA 2WXMA 3U52E 1HB6A 3JW0X 2OJWA 1X1MA 3R66C 4DDID 4W9KA 2D9YA 3H8HA 3P42A 4N59A 3ENEA 3QARA 4IWOA 1UNSA 1E7VA 5HE3A 2NPTA 3FVCA 1WJ4A 2WDQB 3P4SB 1P1AA 4FA6A 4MACA 1I4PA 3HK0A 1GAQB 2WXGA 2ZJDA 5EE0A 2FCMA 1LO5D 2IGGA 2N9LA 2JYTA 3BYTB 1K53A 4LTUA 4RFBA 4OZAA 2P0HA 2BCJA 4MDKE 1FAOA 2QJLA 4OSNA 1WR6E 1WR1A 5EE1A 4AJWA 2V1YA 4NNJB 3RN9C 5IJMA 1KH0A 2BPSA 3AE6B 3N1XC 1V5UA 2CJOA 4UDUC 1X1FA 1YOVB 3ZW3A 4G3XB 3PHWB 4EZJA 1ZM0A 1OQQA 5H8YE 1XODA 1Y5OA 1Y19B 2RPVA 1SSNA 3KWLA 4GDLB 3DBRB 3TMPB 2Z59B 4HK2A 2NBUA 4DQOC 3E9PA 3PSCA 1QLBB 4ARIA 2M19A 2KMMA 2KC1A 2IO1B 3I63C 3RMKC 4A6HA 1HQRD 1HTQA 2YLMA 4D2KA 3I9V1 1RAXA 1TT5B 3DHIC 4KKIA 3VTWA 2CY4A 3DCGA 4QJ5B 2RGNB 2BTEA 1VR9A 3BYYB 1JMLA 3QA8A 1TKYA 3NVWA 2VSZA 1OFFA 1EU4A 2NTSA 1FXTB 4BOZB 5TR5A 4JKAA 3DVNV 2EC1A 4LNIA 4RF0A 3TCAA 1TQZA 1NYQA 3GE8C 1HBKA 1DROA 1FXIA 1ZE3D 1I4HA 1WYGA 4YTNB 1Z5SB 1SBBB 1YN4A 1L5PA 5JHHA 4HB0B 3QX1A 3NW8A 4GMVA 4CO7A 1TY2A 4MJSA 2Y5CA 2R61A 2DN6A 3VH3B 4FN2A 3IFWB 2COAA 4LNNA 5D3YA 1SE3A 3ZVVA 1MG4A 1MHHE 2YF0A 1NI3A 2G4SA 3AMZA 5LG4B 2TSSA 3HVDA 1V1OA 1AARA 4A55A 1U5GA 2JPHA 5J3TA 2N7EA 1UPRA 2LI5A 1F0ZA 3O65B 2YEPB 2JZPA 2PIAA 3A9KA 3F0WA 4XWTA 1AWDA 4A6QA 5KQ1A 4LCDE 1JW9D 2ROVA 3AN1A 2DHZA 1AYFA 2CY5A 1WMHA 2NBWB 1BTKA 1ENFA 1ROEA 5EE9A 2WQYB 3E56A 2HTME 2BKFA 3PSEB 2MLBA 3EFUA 2Z4DA 1U5FA 2LYDA 2W2XC 3OJ4B 2AEHA 4ZYSA 1I7AA 1BTNA 4ANVA 2QKLA 3RZWC 2IBIB 1QQGA 4YTPB 5C79A 2RUKB 4WWMA 3P4PB 2L00B 2PVGC 2VZKB 1V61A 1V88A 3M95A 2N0SB 2I38A 3TIXA 3F5RA 3PLVA 3NWAA 1ZSQA 3L13A 2WLBA 3GYPA 2M14A 4DBBA 5IO9A 2AYOB 4NSWA 4C80A 4YSYB 1M7RA 3A4SC 1YQ4B 1U2BA 4XYCA 1I7HA 5G2NA 2DIKA 3P4QB 3PZ8A 1TKGA 1K51A 3AU4A 4MY6A 1XQQA 1FGYA 5D3DA 4B6HA 1T5XD 3L16A 1Q1OA 4ANXA 5JH5C 1C1YB 1MI0A 5GOWB 2N9KA 2WXHA 1W1HA 2EKIA 3AM9A 2WH5A 3Q69A 1FHOA 2KN5A 2A5UA 3T3OA 3AEGB 3Q3MC 4F7GA 5DPTA 4G11A 2GBKA 1MAIA 2JUOA 2GMIC 1RRBA 1KZGA 2WS3B 5DHAB 4ARCA 2GUMA 3MC9A 3W5UB 2VRRB 4GDLA 2Z59A 1V6EA 2DLBA 1MIZB 3BZDB 1MJDA 3FM8C 1MK9B 1E7UA 1UBIA 2K2UA 2KVZA 1QF6A 4K2OA 4PK1A 2DYOA 1QT9A 4LJOB 2LMCA 3DBHB 4A5KA 1FRDA 1VJKA 2INPE 4YT0B 1FHXA 2LVOA 3AE9B 3PT2B 1TBEA 4IM0A 1EF1A 1YIWA 2LRUA 2CODA 3ECIA 3ZUNA 3OLMD 5TSSA 1ET9A 2FAZA 1ZUD2 4HSIA 3AXCA 1RJ2A 4S17A 1WM2A 3TEYA 1F77A 1TYGB 4WH4A 3ETRA 2DZKA 4YXDB 4MGIE 1QC6A 3TSSA 2IPKD 3MC0B 5D3VA 2ELAA 1UNRA 4FLHA 4X57B 1FNUA 1GPXA 1DDWA 4K17A 5CLQB 3ZLZA 3KWVA 4YSZB 5HE1A 1C9FA 2VH2A 4DX90 2RRFA 2HDEA 1J8CA 1HZ6A 5EFXA 2KDFB 4ILJA 2QMTA 3IVFA 1MI1A 1AN8A 2PZ1A 2K49A 5HG2A 5I4DA 2OTXA 2E2XA 1WXVA 4HPPA 3V05A 1SB3C 4HXDA 3SR6A 2IYBA 2Y8GA 1V9JA 3MHSD 1KF6B 3SNHA 4C7YA 4KZ0A 2RDGA 4HRSA 4FULA 1E10A 5I2MA 4IW0A 2B76B 3BVGA 2INDC 1WGKA 3AE2B 2DTCA 2J52A 2MH7A 2GBJA 1RWSA 1TS2A 4ICVA 3ZJUA 1V81A 3UI3A 2C7NB 3WANA 1V1PB 2K0PA 3E9OA 1PMSA 2D9ZA 1C4AA 5FK9C 1W1GA 4HJGE 2LG1A 4HCNB 2VH1A 3ABVB 1TJEA 1Q0WB 2I1KA 2G3QB 4DIXA 3IAS1 3FP5A 2LBBA 1WG7A 2KD0A 1KFYB 2HRJA 1Y8RC 3VH4B 2LJ5A 2W3SA 1E8ZA 3ULBA 3CXBB 2GB1A 2ABDA 3NHEB 3T8MA 3MC8A 2Z0OA 4OVUA 4RGOS 3X0WA 4HPLB 5D7GA 4CSQA 3IHPC 1P98A 3RZFA 2JT4B 2B3AA 2JYEA 1Z87A 2ZNVC 3ZXVA 3CSFA 1S3SG 4P1BC 1KC7A 1HZ5A 3PG7A 2G1EA 4LDTD 2J53A 5CHVC 3ZO5B 5JHBA 3Q8CA 2L76A 2ZKMX 3HW2B 3QWZB 3LDZE 5LONB 4ACFA 4RM9A 3PP2A 2YT2A 1N62A 4BBNF 1M4VA 3IAM1 3MTNB 4YL8A 3ODOA 4HCPB 3AEEB 2H7EA 5BMGA 3OANA 1V97A 1WGQA 4MT7A 3SBGA 1OGWA 1NVID 4NAMA 5J17A 4F8CB 1EO6A 2RSUA 2JF5A 5JVLA 4A3PA 1VD2A 3ZJTA 5BO4B 1FIQA 2YS1A 5KCVA 1YX5B 4WIPA 4RGMA 3CMMB 2N9XA 1DDMA 3TEWA 4BBNC 4JKCA 1H8CA 2CHWA 1A70A 3NJTA 1WXQA 1F9JA 2DAFA 1XCGA 1RFKA 3IXSA 4BKSA 1Q5WB 4WJQA 1FXAA 1WJUA 2J42A 3VDZA 1QILA 2K2JA 2G9HD 3GZNI 2CQUA 5C16A 3MJWA 1NEKB 3K9OB 4IG7B 1FO4A 1F1HA 2VZKD 2BYEA 2WXKA 2DFKA 1DIKA 2WNMA 2BYFA 2M0XA 2MBBB 2N1WA 2JRIB 1XD3B 2H89B 3CF6E 1WXSA 3K9PB 2FUG1 2HJ1A 2Y7BA 2FE8A 2KZRA 3GE3C 1CK1A 4II3B 4Z2NA 2D3CA 5CHWA 1QOFA 1FFVA 2DYMA 5IP4D 1K50A 2KQ4X 5HHDG 4WSFA 3AH7A 2J0MA 1E9MA 3E66A 2IO2B 5G55A 2O6VA 2WXPA 1CMXB 3KUZA 2LGDA 4MH8A 5J3YA 1A5RA 3A58A 4RGTA 2MJ3A 2GBNA 3V6CB 2I5FA 3DXCA 1YN5A 1L0VB 3VHTC 2NR2A 3NG0A 2K1FA 3RD2A 1U29A 1D5XC 4ANUA 3PS6A 1ZYIA 4AS1A 1UEFA 3FAHA 3IBEA 4JKEA 4YTMB 1V1PA 1KI1B 2NZ8B 2UZRA 3PLUA 3AE1B 2UVMA 4K81A 4LLGM 3GS2A 2OHFA 4OVVA 1E6EB 1JRUA 3JYUA 2WXLA 2ZCBA 4FJZA 4B0MA 4M02A 5E6NA 2GCJA 3U7DA 3SFEB 2K22A 3QJZA 4ZYNA 1WX8A 2IGHA 3RULA 2JU6X 1JROA 1QKZA 2Z0PA 3PV1A 3ZXRA 4D0NB 3H9DA 1UD7A 2QSDA 2DKPA 2KO3A 4NZLB 1VDVA 4C56C 2KIEA 2BYVE 2IYDB 3ONSA 2JVCA 2JY6A 1FCLA 1R4MB 3NWDA 3QIJA 1NTYA 5AZGA 2N9EB 1V2YA 2ADZA 4JKFA 3Q8EA 3NS8A 4JK8A 3O13A 1V5OA 3EHVA 1SIFA 4BKSD 5AUIA 1ZC4B 2QCZA 2MKRA 3D8DA 3IT6B 3KUDB 1ZXHA 4AWJA 5AUKA 2XN9C 2RD0A 1TIFA 1I4QA 2KDIA 3ODWA 3RYTA 1IUEA 4MSQB 1BAKA 2K00A 2MRPA 4LNOA 2I1JA 4WWOA 1R7SA 4W9IA 3RNGC 2KJHB 1C79A 4DWFA 4HDOA 1IBXB 5T8IA 4HKZE 4HVBA 1ISNA 2PE9A 2D9XA 2MWSB 3H7SA 2FCQA 1SIJA 1E90A 2J7QB 4KGSA 1QQRA 4US9A 1E8WA 3PREA 2X0SA 2KGXB 5JLJB 2CHXA 3FSSA 2MSED 4FHKA 2D5GA 3EECA 1MPEA 4NY0A 1UWXA 2DHIA 1CQVA 2IJ0A 2O6VD 3J9CA 3PEGA 3A1QB 3DBLI 5AEKB 3N32A 4CQNA 2V4LA 4WQOB 2JWUA 1EAZA 5LLIA 2MBHA 1X05A 3DWGC 3UINB 2X38A 2DZMA 2WWZA 3APDA 1WFYA 2D9VA 1DOYA 2R2QA 2LULA 2FUHB 1HEZE 1L7YA 4YSXB 2LVPA 3EC8A 1N5XA 1MK7B 5C1ZA 3Q3JA 2UWQA 3SV1A 2L0TA 3AE5B 2LZ6A 2L1AA 3TJPA 2QHOA 3H7PB 1ZC3B 2WGSA 3VQIA 5D27A 4ILGB 2IDYA 2BW2A 1XLOA 2GJYA 1WIAA 1AW7A 3VRBB 1MVKA 1RYJA 3B1LX 1MHXA 1E5WA 1I4RA 5BYRA 4GNKB 2PTLA 3WA0A 1V5PA 4XWXA 3MFGA 3ULCA 2RPQA 3WAMA 2EMTA 4ILHA 1GB1A 5LOPB 3W1SC 5E6PA 2G45B 4BKTA 2FBWB 4GZUA 4AJYB 2YS5A 3KRXA 3DBSA 4TQ0A 4HAYB 1WGYA 2QKMA 4M0WA 3BIID 5E6OA 2NTTA 1FMAD 1FCCC 1P7EA 3RCZA 2NCNA 4IM3A 2EELA 2I2YA 4BZAA 4HEA1 2KX3A 2LXAA 4FXCA 2ASQA 1WM3A 4I6LB 3NSUA 4RM8A 1KZ7A 4IM2A 3ZKJC 2JRHA 1IP9A 1U5EA 2L83A 4HDQA 4HAXB 3TO1A 1I4XA 3B08A 4KAXB 2AL3A 4W9EA 1Q10A 3DVGY 1F52A 5D94A 2GI9A 3RT3B 4WAAA 3H6NA 1I2HA 4A6KA 5KHQA 2KK8A 3MPXA 3V60A 1JCKB 2GLSA 3M3JA 3TBLD 2REXA 2Q13A 4DHJB 2KLCA 1OEYJ 4WJNA 2LUMA 3ML4A 2V0GA 2D07B 2OEDA 2BYTA 1PYWD 5DCNA 3B9JA 2C9WB 2Q5WD 2ZW0A 5H92C 3L17A 1XX0A 2CR5A 4W9DA 3BWUD 4J6IA 4GOUA 4OHJA
chains in the Genus database with same CATH topology
1S1QB 2L7RA 2OOBB 3VAWA 2G4DB 1EGXA 1WXAA 1EUVB 4AOFA 4MEMA 3UQAA 2D11A 4EFOA 2AL6A 3ZTCA 5IA7A 1OMWA 4IWPA 1XKEA 3SUZA 4HAVB 1W1DA 1YX6B 5HE2A 4HJKA 3A4RA 3A1QA 1WX9A 1ST7A 1FOEA 2DENB 1WGUA 1WY8A 4F1SA 1WI1A 4EOYA 4FHJA 2D2QA 1WJMA 5JP4A 2BKRB 3U30A 3P6AA 1X1GA 2LRWA 3DOWA 3ZRCA 4ZDVA 5L81A 3H7PA 4CHMA 3UIOB 3PTFC 4IWQA 5J2RA 4HB4B 1OY2A 4K7WA 1GC6A 2KX0A 3NZSA 1PLSA 3VUYA 1NU2A 1I42A 3CIKA 1KLVA 2MP2B 3N7CA 3BJIA 1GUAB 2M4NA 4JK9A 3VTUA 3VVWB 1FGZA 1WRDB 4WJPA 2RNRB 2MDXA 4HPMB 2XQNM 4WVFB 4DK5A 2ZNVB 1WVHA 4DX8A 3EPYA 1HE8A 3N3KB 3PVUA 1MG8A 4MELA 2KJRA 1OQNA 4W9LA 1U5DA 3A33B 2KTRB 4I6NB 2NMBA 1TZ1A 5D3XA 1H10A 1NBFC 2VKIA 4PS7A 5C6RA 4URKA 1P6SA 1VBHA 2P0FA 2MW5A 4DDGD 3L0WB 4A20A 3FLVA 4FADA 3DVNU 3HIZA 3BY4B 4HHVA 2KFKB 2MBOA 4G0NB 2L3ZA 1ZVRA 4JL9A 5D6JB 3SBTA 2ZVNA 2R09A 3PVWA 2KCJA 1AWEA 2N7DA 5CLLB 2W2XD 1WE7A 4NJ7A 4TUUA 2CHZA 4KDIC 5J18A 3DBRI 4II2B 3MDBC 4JQWC 1GNUA 3KUCB 4DBGA 1V89A 4H8SA 5DIFB 4KHOA 4CHJA 2LVQA 5L95C 2AWTA 3ZDMC 5IAAC 3PRPB 1J0WA 2RSGA 2N9PC 1GC7A 2X18A 2IO0B 4TV3A 1K8RB 2KWCA 3W1YA 1T0YA 2XEWA 1WGRA 3TFMA 4HLEA 2XBBC 3PVLA 2MFQA 1UPQA 1K5GB 2P0DA 4EZKA 1KM7A 3WAOA 2C60A 2C7HA 4GSWA 3ZNID 1DYNA 4NAWB 4AP4C 2YVCA 3KYCD 5HE0A 2KVRA 1OEYA 1Z2MA 3AULA 1K5DB 3KSYA 2WDTB 3R3MA 3BINA 2P8VA 2N0YA 5AZFA 5DHFB 4FJVB 1G6JA 3ZVRA 3KH0A 2OJRA 4K7SA 2MP2A 2YT0A 4DHJD 5FI0A 1WGDA 2PPHA 2DX5B 2PEAA 1TGZB 1P3QU 3NY5A 4KDLB 3AJ4A 1TJ6A 1V49A 3M63B 1UBQA 2KKCA 4EMOA 3KYDD 2M8SA 2Y5BB 2N1VA 3HM3A 3VIAA 4LJPB 2M38A 1LM8B 4ASWC 3QC8B 5CX3A 2DLWA 3RCPA 3AI5A 4MH0E 2C7MB 4CHKA 2KQ7A 2DYQA 5C5BB 1I35A 4A3OA 3P7ZA 4TYZA 2M17A 4F7UP 1FHWA 5EDSA 2A4ZA 2KFKA 2NS5A 2GOWA 3TVVA 3HM6X 5C23A 1XT9B 4W9CA 2HTHB 4MGZE 2ZPNA 4PS8A 4AUQC 4NJ6A 4PYZA 1WJ6A 1U4AA 3TL5A 4GPTB 2ELBA 2KOXA 5J3QA 2CS4A 4KSKC 1PQSA 1NTVA 1B55A 4IOYX 1UZXB 4FJYA 3UQBA 3PRZA 4P7IA 2LD9A 3PHXB 3QK0A 4GN1A 1X11A 5AZHA 4GIVA 3PZDA 2JWZA 2M1MA 2MBQA 2BGFA 3V6EB 3JSVB 3DBHI 4B95A 1H4RA 3QWMA 2MBEA 2Y8FA 4KIKB 2L1CA 2LWPA 4GXBA 2PE6B 2ZVOA 4EEWA 1WH3A 2FIDA 2ZCCA 4N9F4 2YS3A 1MIXA 1HB8A 3A8QA 2KNBA 2R82A 4W9JA 3APFA 2K8HA 5LXHA 4NAWA 2DHJA 1P5TA 1AQCA 1EVHA 2IY0B 3QCAA 5JHGA 2Z0DB 3U8ZA 4W9HA 2KDEB 2K6QA 1KBLA 2L05A 1FB8A 3ZIMA 1XR0B 2XK5B 3WYFB 2KANA 5DI9B 3Q3FA 3S2AA 2RGFA 2K8CA 4MM3A 2DX5A 1J0GA 2LXCA 2K6DB 1MKEA 3V5WA 1RLFA 3ZNGC 1TXDA 1RRPB 1UH6A 4ANWA 1ZW7A 2V76A 2N4FA 5DPRA 4PQ0A 2KWUB 4JKGB 2FIFA 4KHAA 4HAZB 1LFDA 3M1IB 3SHQA 5FI1A 2HJ8A 5C5BA 3V61A 2GS0A 3ODXA 3D8FA 2CKHB 2KLGA 3A98B 5CHFA 1IRSA 1WJ1A 2V3SA 4WJ7A 2DYBA 2KC2A 1NI2A 2HTHA 3SDLC 1DBHA 2LASA 3CSTA 4GDKB 4LDTB 4ZRIA 2D9WA 4K2PA 1V5MA 3A9JB 4E3CA 4JIOU 3P2BA 2H7DA 3SU8X 1IPGA 4JLCA 3A8PA 3VTVA 3NOBA 1DDVA 3QHTA 2MWNB 1EF5A 3UZTA 3JSVA 1WZ3A 2KMAA 1VCBA 4KSLC 2O2VB 3V62A 4ZRJA 2MCNB 3KW5B 4MGYE 4CYEA 2MA9B 4HWIB 1P3RA 4KIKA 2D4QA 3W1SA 1GJZA 4JKBA 4GMXB 2J0JA 2J0KA 4JKHA 1V80A 1M94A 2PJHA 1VBGA 2CB8A 1BT0A 2Z0QA 4XZ4A 3APCA 3DPDA 4I6PA 2LKOA 4RMAA 2ZEQA 1QZEA 2MQJA 3GYOA 3WAPA 2LOZA 2FNJB 2EMSA 2VRWB 5D3WA 4WWNA 4MK0A 2JP2A 2KUPA 1SGHA 2COFA 2KFJA 1LXDA 2RLOA 3PGEA 2LUEA 4KVGB 3ML8A 2UZSA 2KDBA 2KHWB 1Q67A 5DPWA 5D2MB 2XK5A 4HB2B 4C0AA 1LW3A 3T06A 1V86A 4KZCA 2Z0EB 5FR6A 1J19A 5L83A 2EJ8A 3ALBA 4K7UA 3SO6A 4EUTA 2UYZB 3O96A 2LOXA 3VFKA 1P0RA 4Z2MB 2DX1A 2RVBB 5KQ4A 4NQLB 4MGKE 3KZ1A 2GCLA 2G35A 4IFSA 2ROZB 4ZRKA 2NBVB 1SHCA 4JKGA 2RR9A 3E9LA 4TQ1A 3TW1A 2GBRA 2R0DA 2K25A 4W9FA 2KJ6A 2R2OA 1PFJA 3I3TB 3C0RB 4EZLA 3KVFB 3VXWA 2FJLA 4BFRA 1R4MI 3RUIB 4KHBB 3WALA 4DHZB 3HHMA 3QBVB 3SYXA 2IO3B 4EJNA 2IFSA 1KJTA 4GDKA 1UNPA 4F7HA 4GOCA 1NTIA 3VUWA 4ICUA 3A9JA 1SE9A 2KXJA 2IY1B 3DXDA 3KY9A 1UGMA 2K39A 1OTRB 3AU5A 3NZUA 1M7EA 3R7QA 3JVZX 3FEHA 3OJ3A 2COPA 3ML9A 3M62B 3SD5A 2GBMA 5JHAA 2O6VB 5GMVA 2I5CA 2O2VA 1WI0A 4JGHB 3VUXA 2WX1A 1D3ZA 1NVLA 3KRWA 1N3HA 1WGHA 4BKGA 4NQKE 4HAUB 4W9GA 5CTRC 2KMCA 1KOTA 4DHZE 3IG3A 4WJOA 3ZTDA 2JZ3B 1C3TA 1E8XA 2FJ9A 4K1RB 1MPHA 4A6FB 2ZPYA 1GGOA 2J59M 2FCSA 3T9LA 2DA0A 4PYUA 3VOQA 3GOEA 1U27A 3ZNHB 3WIMA 5DH9B 2DAJA 1YJ1A 4WWPA 2IZVB 2DKQA 3PPAA 2COCA 5JZEB 1P9DU 4HATB 2NPTB 2D3GA 2OQBA 2DHKA 4F7ZA 4IAPA 1ZGUB 2BWES 1TTNA 2L8JA 4G50A 5HKHA 4BBKA 1WYWB 2JZZA 3L54A 1LQBA 4B6WA 3DDCB 3OAWA 2C5LC 1GG3A 2ZZPB 2MX2A 3N30A 1NDDA 2L2IA 1WXMA 1RFAA 4E74A 1WF9A 4IUMB 3B0AA 1ZKHA 2W2WA 2FCNA 3D8EA 2W9NA 2WX0A 2DZIA 2CAYA 2HE7A 2L0FA 4XX5A 4JKDA 3H1UA 4NPNA 5DPSA 1YD8U 3ZRFA 4YONA 3DXEA 2YSZA 2CU1A 3QAQA 2YT1A 1IYFA 1L2NA 4B9KA 3L08A 4EKUA 1V5TA 4XC2A 2KTRA 4GB9A 3ZDTA 1YQBA 2YRYA 2KWVB 1R4NI 3ZNZB 2FDQA 4GU2A 4HB3B 2DZJA 1WJNA 4HAWB 3ENBA 5LXIB 3QQ8B 2HD5B 3UIPB 1LB1A 2LGXA 1WZ0A 1JDEA 3G9WA 1BWNA 2WYQA 1WX7A 3HQCA 4PS3A 4E71A 2DYNA 4L6EA 4FBJB 4MJSB 3L10B 2K8BA 2NVUI 3LJ3A 3D32A 3R7RA 2KTFA 4M0WB 4JK7A 3UF8A 3X23A 1OQYA 1XD4A 2JXXA 2BWFA 1WGGA 4A6FA 4MSMB 4Y94A 5KHOA 1E8YA 2EKEC 3A9KB 3UGBB 4PNKA 4DXAB 2LGYA 2RQ1A 2BF8B 2CRFA 2KQSA 1ACAA 1WMHB 4M8MA 3PRMB 1UNQA 2D10A 1WE6A 4BOSC 4BVUC 2N23A 4GGQA 3LJUX 4IC7B 1X86A 1UELA 4M8NA 4TKNA 3DQVA 3DVGX 4KV2A 1HB6A 3JW0X 1X1MA 3R66C 4DDID 4W9KA 2D9YA 3ENEA 3QARA 4IWOA 1E7VA 5HE3A 2NPTA 1WJ4A 1P1AA 4FA6A 3HK0A 2ZJDA 2FCMA 2P0HA 2BCJA 4MDKE 1FAOA 1WR6E 1WR1A 4AJWA 2V1YA 4NNJB 5IJMA 2BPSA 1V5UA 1X1FA 3ZW3A 4G3XB 3PHWB 4EZJA 1ZM0A 1XODA 1Y5OA 1Y19B 4GDLB 3TMPB 2Z59B 4HK2A 2NBUA 3E9PA 3PSCA 2KC1A 2IO1B 4A6HA 2YLMA 1RAXA 3VTWA 2CY4A 3DCGA 2RGNB 3QA8A 2VSZA 4BOZB 1FXTB 5TR5A 4JKAA 3DVNV 2EC1A 3TCAA 1TQZA 1HBKA 1DROA 1Z5SB 5JHHA 4HB0B 3QX1A 4GMVA 4CO7A 4MJSA 2DN6A 3VH3B 4FN2A 3IFWB 2COAA 5D3YA 3ZVVA 2YF0A 2G4SA 1AARA 1U5GA 2JPHA 5J3TA 2N7EA 1UPRA 2LI5A 3O65B 3A9KA 3F0WA 5KQ1A 4LCDE 2ROVA 2DHZA 2CY5A 1WMHA 2NBWB 1BTKA 2BKFA 3PSEB 2MLBA 3EFUA 1U5FA 2LYDA 2W2XC 3OJ4B 2AEHA 1I7AA 1BTNA 4ANVA 2QKLA 3RZWC 2IBIB 1QQGA 5C79A 2RUKB 2L00B 1V61A 1V88A 3M95A 3TIXA 3F5RA 3PLVA 1ZSQA 3L13A 3GYPA 2M14A 4DBBA 2AYOB 4NSWA 1M7RA 3A4SC 1U2BA 5G2NA 2DIKA 3AU4A 4MY6A 1XQQA 1FGYA 4B6HA 3L16A 1Q1OA 4ANXA 5JH5C 1C1YB 5GOWB 1W1HA 2WH5A 1FHOA 2KN5A 2A5UA 4F7GA 5DPTA 4G11A 2GBKA 1MAIA 2JUOA 2GMIC 1RRBA 1KZGA 5DHAB 2VRRB 4GDLA 1V6EA 1MIZB 3FM8C 1MK9B 1E7UA 1UBIA 2K2UA 4K2OA 2DYOA 4LJOB 4A5KA 1FHXA 2LVOA 3PT2B 1TBEA 4IM0A 1EF1A 1YIWA 2LRUA 2CODA 3ECIA 3ZUNA 3OLMD 2FAZA 3AXCA 1RJ2A 1WM2A 2DZKA 4MGIE 1QC6A 5D3VA 2ELAA 1UNRA 4FLHA 4X57B 1DDWA 4K17A 5CLQB 3ZLZA 5HE1A 4DX90 1J8CA 5EFXA 2KDFB 4ILJA 3IVFA 2PZ1A 2OTXA 2E2XA 1WXVA 4HXDA 2IYBA 2Y8GA 1V9JA 3MHSD 3SNHA 4KZ0A 4FULA 4IW0A 2DTCA 2GBJA 4ICVA 1V81A 2C7NB 3WANA 3E9OA 1PMSA 2D9ZA 1W1GA 2LG1A 4HCNB 1Q0WB 2I1KA 2G3QB 3FP5A 2LBBA 1WG7A 2KD0A 2HRJA 1Y8RC 3VH4B 2LJ5A 1E8ZA 3ULBA 3CXBB 2ABDA 3NHEB 3T8MA 2Z0OA 4OVUA 3X0WA 4HPLB 5D7GA 3IHPC 1P98A 3RZFA 2JT4B 2B3AA 1Z87A 2ZNVC 3CSFA 1S3SG 1KC7A 3PG7A 4LDTD 5CHVC 3ZO5B 5JHBA 2L76A 3HW2B 3QWZB 3LDZE 5LONB 4RM9A 3PP2A 4BBNF 3MTNB 4YL8A 3ODOA 4HCPB 2H7EA 3OANA 1WGQA 4MT7A 3SBGA 1OGWA 5J17A 4F8CB 1EO6A 2RSUA 2JF5A 5JVLA 4A3PA 1VD2A 5BO4B 2YS1A 5KCVA 1YX5B 3CMMB 2N9XA 1DDMA 4BBNC 4JKCA 1H8CA 2CHWA 1F9JA 2DAFA 1XCGA 4BKSA 1Q5WB 4WJQA 1WJUA 3VDZA 2K2JA 3GZNI 2CQUA 5C16A 3MJWA 3K9OB 4IG7B 2BYEA 2DFKA 1DIKA 2BYFA 2M0XA 2MBBB 2N1WA 2JRIB 1XD3B 3CF6E 1WXSA 3K9PB 2Y7BA 2KZRA 4II3B 4Z2NA 5CHWA 2DYMA 4WSFA 2J0MA 3E66A 2IO2B 5G55A 2O6VA 1CMXB 3KUZA 2LGDA 5J3YA 1A5RA 2GBNA 3V6CB 2I5FA 3DXCA 3VHTC 2NR2A 2K1FA 3RD2A 1U29A 4ANUA 3PS6A 1UEFA 3IBEA 4JKEA 1KI1B 2NZ8B 2UZRA 3PLUA 2UVMA 4K81A 4OVVA 1JRUA 3JYUA 2ZCBA 4FJZA 5E6NA 2GCJA 3U7DA 3QJZA 4ZYNA 1WX8A 3RULA 2Z0PA 3PV1A 4D0NB 3H9DA 1UD7A 2DKPA 2KO3A 2BYVE 2IYDB 3ONSA 2JVCA 2JY6A 3QIJA 1NTYA 5AZGA 2N9EB 1V2YA 2ADZA 4JKFA 3NS8A 4JK8A 1V5OA 3EHVA 1SIFA 4BKSD 1ZC4B 2MKRA 3D8DA 3KUDB 4AWJA 2RD0A 2KDIA 3ODWA 3RYTA 4MSQB 1BAKA 2K00A 2MRPA 2I1JA 4WWOA 4W9IA 2KJHB 4DWFA 4HDOA 4HVBA 1ISNA 2PE9A 2D9XA 2MWSB 3H7SA 2FCQA 1E90A 2J7QB 1E8WA 3PREA 2X0SA 2KGXB 5JLJB 2CHXA 3FSSA 2MSED 4FHKA 3EECA 4NY0A 2DHIA 2O6VD 3PEGA 3A1QB 3DBLI 5AEKB 3N32A 2V4LA 5LLIA 4WQOB 1EAZA 2MBHA 1X05A 3UINB 2DZMA 2WWZA 3APDA 1WFYA 2D9VA 2R2QA 2LULA 2FUHB 1L7YA 2LVPA 3EC8A 1MK7B 5C1ZA 3Q3JA 2UWQA 3SV1A 2L0TA 2LZ6A 3TJPA 2QHOA 3H7PB 1ZC3B 3VQIA 5D27A 4ILGB 2GJYA 1WIAA 3B1LX 1E5WA 3WA0A 1V5PA 4XWXA 3ULCA 2RPQA 3WAMA 2EMTA 4ILHA 5LOPB 3W1SC 5E6PA 2G45B 4BKTA 4GZUA 4AJYB 2YS5A 3KRXA 3DBSA 4TQ0A 4HAYB 1WGYA 2QKMA 5E6OA 3RCZA 2NCNA 4IM3A 2KX3A 2LXAA 2ASQA 1WM3A 4I6LB 3NSUA 4RM8A 1KZ7A 4IM2A 3ZKJC 2JRHA 1IP9A 1U5EA 4HDQA 4HAXB 3TO1A 3B08A 4KAXB 2AL3A 4W9EA 3DVGY 5D94A 3RT3B 4WAAA 3H6NA 1I2HA 4A6KA 5KHQA 2KK8A 3MPXA 3V60A 3M3JA 3TBLD 2REXA 2Q13A 4DHJB 2KLCA 1OEYJ 4WJNA 3ML4A 2D07B 5DCNA 2C9WB 3L17A 1XX0A 2CR5A 4W9DA 4J6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  2L7R A;  2OOB B;  3VAW A;  2G4D B;  1EGX A;  1WXA A;  1EUV B;  4AOF A;  4MEM A;  3UQA A;  2D11 A;  4EFO A;  2AL6 A;  3ZTC A;  5IA7 A;  1OMW A;  4IWP A;  1XKE A;  3SUZ A;  4HAV B;  1W1D A;  1YX6 B;  5HE2 A;  4HJK A;  3A4R A;  3A1Q A;  1WX9 A;  1FOE A;  2DEN B;  1WGU A;  1WY8 A;  4F1S A;  1WI1 A;  4EOY A;  4FHJ A;  2D2Q A;  1WJM A;  5JP4 A;  2BKR B;  3U30 A;  3P6A A;  1X1G A;  2LRW A;  3DOW A;  3ZRC A;  4ZDV A;  5L81 A;  3H7P A;  4CHM A;  3UIO B;  3PTF C;  4IWQ A;  5J2R A;  4HB4 B;  1OY2 A;  4K7W A;  1GC6 A;  2KX0 A;  3NZS A;  1PLS A;  3VUY A;  1NU2 A;  1I42 A;  3CIK A;  1KLV A;  2MP2 B;  3N7C A;  3BJI A;  1GUA B;  2M4N A;  3VTU A;  3VVW B;  1FGZ A;  1WRD B;  4WJP A;  2RNR B;  2MDX A;  4HPM B;  2XQN M;  4WVF B;  4DK5 A;  2ZNV B;  1WVH A;  4DX8 A;  1HE8 A;  3N3K B;  3PVU A;  1MG8 A;  4MEL A;  2KJR A;  1OQN A;  4W9L A;  1U5D A;  3A33 B;  2KTR B;  4I6N B;  2NMB A;  1TZ1 A;  5D3X A;  1H10 A;  1NBF C;  2VKI A;  4PS7 A;  5C6R A;  4URK A;  1P6S A;  2P0F A;  2MW5 A;  4DDG D;  3L0W B;  4A20 A;  4FAD A;  3DVN U;  3HIZ A;  3BY4 B;  4HHV A;  2KFK B;  2MBO A;  4G0N B;  2L3Z A;  1ZVR A;  4JL9 A;  5D6J B;  2ZVN A;  2R09 A;  3PVW A;  2KCJ A;  1AWE A;  2N7D A;  5CLL B;  2W2X D;  1WE7 A;  4NJ7 A;  4TUU A;  2CHZ A;  4KDI C;  5J18 A;  3DBR I;  4II2 B;  3MDB C;  4JQW C;  1GNU A;  3KUC B;  4DBG A;  1V89 A;  4H8S A;  5DIF B;  4KHO A;  4CHJ A;  2LVQ A;  5L95 C;  2AWT A;  3ZDM C;  5IAA C;  3PRP B;  1J0W A;  2RSG A;  2N9P C;  1GC7 A;  2X18 A;  2IO0 B;  4TV3 A;  1K8R B;  2KWC A;  3W1Y A;  1T0Y A;  2XEW A;  1WGR A;  3TFM A;  4HLE A;  2XBB C;  3PVL A;  2MFQ A;  1UPQ A;  1K5G B;  2P0D A;  4EZK A;  1KM7 A;  3WAO A;  2C60 A;  2C7H A;  4GSW A;  3ZNI D;  1DYN A;  4NAW B;  4AP4 C;  2YVC A;  3KYC D;  5HE0 A;  2KVR A;  1OEY A;  1Z2M A;  3AUL A;  1K5D B;  3KSY A;  2WDT B;  3R3M A;  3BIN A;  2P8V A;  2N0Y A;  5AZF A;  5DHF B;  4FJV B;  1G6J A;  3ZVR A;  3KH0 A;  2OJR A;  4K7S A;  2MP2 A;  2YT0 A;  4DHJ D;  5FI0 A;  1WGD A;  2PPH A;  2DX5 B;  2PEA A;  1TGZ B;  1P3Q U;  3NY5 A;  4KDL B;  3AJ4 A;  1TJ6 A;  1V49 A;  3M63 B;  1UBQ A;  2KKC A;  4EMO A;  3KYD D;  2M8S A;  2Y5B B;  2N1V A;  3HM3 A;  3VIA A;  4LJP B;  2M38 A;  1LM8 B;  4ASW C;  3QC8 B;  5CX3 A;  2DLW A;  3RCP A;  3AI5 A;  4MH0 E;  2C7M B;  4CHK A;  2KQ7 A;  2DYQ A;  5C5B B;  1I35 A;  4A3O A;  3P7Z A;  4TYZ A;  2M17 A;  4F7U P;  1FHW A;  5EDS A;  2A4Z A;  2KFK A;  2NS5 A;  2GOW A;  3TVV A;  3HM6 X;  5C23 A;  1XT9 B;  4W9C A;  2HTH B;  4MGZ E;  2ZPN A;  4PS8 A;  4AUQ C;  4NJ6 A;  4PYZ A;  1WJ6 A;  1U4A A;  3TL5 A;  4GPT B;  2ELB A;  2KOX A;  5J3Q A;  2CS4 A;  4KSK C;  1PQS A;  1NTV A;  1B55 A;  4IOY X;  1UZX B;  4FJY A;  3UQB A;  3PRZ A;  4P7I A;  2LD9 A;  3PHX B;  3QK0 A;  4GN1 A;  1X11 A;  5AZH A;  4GIV A;  3PZD A;  2JWZ A;  2M1M A;  2MBQ A;  2BGF A;  3V6E B;  3JSV B;  3DBH I;  4B95 A;  1H4R A;  3QWM A;  2MBE A;  2Y8F A;  4KIK B;  2L1C A;  2LWP A;  4GXB A;  2PE6 B;  2ZVO A;  4EEW A;  1WH3 A;  2FID A;  2ZCC A;  4N9F 4;  2YS3 A;  1MIX A;  3A8Q A;  2KNB A;  4W9J A;  3APF A;  2K8H A;  5LXH A;  4NAW A;  2DHJ A;  1P5T A;  1AQC A;  1EVH A;  2IY0 B;  3QCA A;  5JHG A;  2Z0D B;  3U8Z A;  4W9H A;  2KDE B;  2K6Q A;  2L05 A;  1FB8 A;  3ZIM A;  1XR0 B;  2XK5 B;  3WYF B;  2KAN A;  5DI9 B;  3Q3F A;  3S2A A;  2RGF A;  2K8C A;  4MM3 A;  2DX5 A;  1J0G A;  2LXC A;  2K6D B;  1MKE A;  3V5W A;  1RLF A;  3ZNG C;  1TXD A;  1RRP B;  1UH6 A;  4ANW A;  1ZW7 A;  2V76 A;  2N4F A;  5DPR A;  4PQ0 A;  2KWU B;  2FIF A;  4KHA A;  4HAZ B;  1LFD A;  3M1I B;  3SHQ A;  5FI1 A;  2HJ8 A;  5C5B A;  3V61 A;  2GS0 A;  3ODX A;  3D8F A;  2CKH B;  2KLG A;  3A98 B;  5CHF A;  1IRS A;  1WJ1 A;  2V3S A;  4WJ7 A;  2DYB A;  2KC2 A;  1NI2 A;  2HTH A;  3SDL C;  1DBH A;  2LAS A;  3CST A;  4GDK B;  4LDT B;  4ZRI A;  2D9W A;  4K2P A;  1V5M A;  3A9J B;  4E3C A;  4JIO U;  3P2B A;  2H7D A;  3SU8 X;  1IPG A;  4JLC A;  3A8P A;  3VTV A;  3NOB A;  1DDV A;  3QHT A;  2MWN B;  1EF5 A;  3UZT A;  3JSV A;  1WZ3 A;  2KMA A;  1VCB A;  4KSL C;  2O2V B;  3V62 A;  4ZRJ A;  2MCN B;  3KW5 B;  4MGY E;  4CYE A;  2MA9 B;  4HWI B;  1P3R A;  4KIK A;  2D4Q A;  3W1S A;  1GJZ A;  4GMX B;  2J0J A;  2J0K A;  1V80 A;  1M94 A;  2PJH A;  1BT0 A;  2Z0Q A;  4XZ4 A;  3APC A;  3DPD A;  4I6P A;  2LKO A;  4RMA A;  2ZEQ A;  1QZE A;  2MQJ A;  3GYO A;  3WAP A;  2LOZ A;  2FNJ B;  2EMS A;  2VRW B;  5D3W A;  4WWN A;  4MK0 A;  2JP2 A;  2KUP A;  1SGH A;  2COF A;  2KFJ A;  1LXD A;  2RLO A;  3PGE A;  2LUE A;  4KVG B;  3ML8 A;  2UZS A;  2KDB A;  2KHW B;  1Q67 A;  5DPW A;  5D2M B;  2XK5 A;  4HB2 B;  4C0A A;  1LW3 A;  3T06 A;  1V86 A;  4KZC A;  2Z0E B;  5FR6 A;  1J19 A;  5L83 A;  2EJ8 A;  3ALB A;  4K7U A;  3SO6 A;  4EUT A;  2UYZ B;  3O96 A;  2LOX A;  3VFK A;  1P0R A;  4Z2M B;  2DX1 A;  2RVB B;  5KQ4 A;  4NQL B;  4MGK E;  3KZ1 A;  2GCL A;  2G35 A;  4IFS A;  2ROZ B;  4ZRK A;  2NBV B;  1SHC A;  2RR9 A;  4TQ1 A;  3TW1 A;  2GBR A;  2R0D A;  2K25 A;  4W9F A;  2KJ6 A;  2R2O A;  1PFJ A;  3I3T B;  3C0R B;  4EZL A;  3KVF B;  3VXW A;  2FJL A;  4BFR A;  1R4M I;  3RUI B;  4KHB B;  3WAL A;  4DHZ B;  3HHM A;  3QBV B;  3SYX A;  2IO3 B;  4EJN A;  2IFS A;  1KJT A;  4GDK A;  1UNP A;  4F7H A;  4GOC A;  3VUW A;  4ICU A;  3A9J A;  1SE9 A;  2KXJ A;  2IY1 B;  3DXD A;  3KY9 A;  1UGM A;  2K39 A;  1OTR B;  3AU5 A;  3NZU A;  1M7E A;  3R7Q A;  3JVZ X;  3FEH A;  3OJ3 A;  3ML9 A;  3M62 B;  3SD5 A;  2GBM A;  5JHA A;  2O6V B;  5GMV A;  2I5C A;  2O2V A;  1WI0 A;  4JGH B;  3VUX A;  2WX1 A;  1D3Z A;  3KRW A;  1N3H A;  1WGH A;  4BKG A;  4NQK E;  4HAU B;  4W9G A;  5CTR C;  2KMC A;  1KOT A;  4DHZ E;  3IG3 A;  4WJO A;  3ZTD A;  2JZ3 B;  1C3T A;  1E8X A;  4K1R B;  1MPH A;  4A6F B;  2ZPY A;  2J59 M;  2FCS A;  3T9L A;  2DA0 A;  4PYU A;  3VOQ A;  3GOE A;  1U27 A;  3ZNH B;  3WIM A;  5DH9 B;  2DAJ A;  1YJ1 A;  4WWP A;  2IZV B;  2DKQ A;  3PPA A;  2COC A;  5JZE B;  1P9D U;  4HAT B;  2NPT B;  2D3G A;  2OQB A;  2DHK A;  4F7Z A;  4IAP A;  1ZGU B;  2BWE S;  1TTN A;  2L8J A;  4G50 A;  5HKH A;  4BBK A;  1WYW B;  2JZZ A;  3L54 A;  1LQB A;  4B6W A;  3DDC B;  3OAW A;  2C5L C;  1GG3 A;  2ZZP B;  2MX2 A;  3N30 A;  1NDD A;  2L2I A;  1WXM A;  1RFA A;  4E74 A;  1WF9 A;  4IUM B;  3B0A A;  1ZKH A;  2W2W A;  2FCN A;  3D8E A;  2W9N A;  2WX0 A;  2DZI A;  2CAY A;  2HE7 A;  2L0F A;  4XX5 A;  3H1U A;  4NPN A;  5DPS A;  1YD8 U;  3ZRF A;  4YON A;  3DXE A;  2YSZ A;  2CU1 A;  3QAQ A;  2YT1 A;  1IYF A;  1L2N A;  4B9K A;  3L08 A;  4EKU A;  1V5T A;  4XC2 A;  2KTR A;  4GB9 A;  3ZDT A;  1YQB A;  2YRY A;  2KWV B;  1R4N I;  3ZNZ B;  4GU2 A;  4HB3 B;  2DZJ A;  1WJN A;  4HAW B;  5LXI B;  3QQ8 B;  2HD5 B;  3UIP B;  1LB1 A;  2LGX A;  1WZ0 A;  1BWN A;  3G9W A;  2WYQ A;  1WX7 A;  3HQC A;  4PS3 A;  4E71 A;  2DYN A;  4L6E A;  4FBJ B;  4MJS B;  3L10 B;  2K8B A;  2NVU I;  3LJ3 A;  3D32 A;  3R7R A;  2KTF A;  4M0W B;  3UF8 A;  3X23 A;  1OQY A;  1XD4 A;  2JXX A;  2BWF A;  1WGG A;  4A6F A;  4MSM B;  4Y94 A;  5KHO A;  1E8Y A;  2EKE C;  3A9K B;  3UGB B;  4PNK A;  4DXA B;  2LGY A;  2BF8 B;  2CRF A;  2KQS A;  1WMH B;  4M8M A;  3PRM B;  1UNQ A;  2D10 A;  1WE6 A;  4BOS C;  4BVU C;  2N23 A;  4GGQ A;  3LJU X;  4IC7 B;  1X86 A;  1UEL A;  4M8N A;  4TKN A;  3DQV A;  3DVG X;  4KV2 A;  3JW0 X;  1X1M A;  3R66 C;  4DDI D;  4W9K A;  2D9Y A;  3ENE A;  3QAR A;  4IWO A;  1E7V A;  5HE3 A;  2NPT A;  1WJ4 A;  1P1A A;  4FA6 A;  3HK0 A;  2ZJD A;  2FCM A;  2P0H A;  2BCJ A;  4MDK E;  1FAO A;  1WR6 E;  1WR1 A;  4AJW A;  2V1Y A;  4NNJ B;  2BPS A;  1V5U A;  1X1F A;  3ZW3 A;  4G3X B;  3PHW B;  4EZJ A;  1ZM0 A;  1XOD A;  1Y5O A;  1Y19 B;  4GDL B;  3TMP B;  2Z59 B;  4HK2 A;  2NBU A;  3PSC A;  2KC1 A;  2IO1 B;  4A6H A;  2YLM A;  1RAX A;  3VTW A;  2CY4 A;  3DCG A;  2RGN B;  3QA8 A;  2VSZ A;  4BOZ B;  1FXT B;  5TR5 A;  3DVN V;  2EC1 A;  3TCA A;  1TQZ A;  1DRO A;  1Z5S B;  5JHH A;  4HB0 B;  3QX1 A;  4GMV A;  4CO7 A;  4MJS A;  2DN6 A;  3VH3 B;  4FN2 A;  3IFW B;  2COA A;  5D3Y A;  3ZVV A;  2YF0 A;  2G4S A;  1AAR A;  1U5G A;  2JPH A;  5J3T A;  2N7E A;  1UPR A;  2LI5 A;  3O65 B;  3A9K A;  3F0W A;  5KQ1 A;  4LCD E;  2ROV A;  2DHZ A;  2CY5 A;  1WMH A;  2NBW B;  1BTK A;  2BKF A;  3PSE B;  2MLB A;  3EFU A;  1U5F A;  2LYD A;  2W2X C;  3OJ4 B;  2AEH A;  1I7A A;  1BTN A;  4ANV A;  2QKL A;  3RZW C;  2IBI B;  1QQG A;  5C79 A;  2RUK B;  2L00 B;  1V61 A;  1V88 A;  3M95 A;  3TIX A;  3F5R A;  3PLV A;  1ZSQ A;  3L13 A;  3GYP A;  2M14 A;  4DBB A;  2AYO B;  4NSW A;  1M7R A;  3A4S C;  1U2B A;  5G2N A;  3AU4 A;  4MY6 A;  1XQQ A;  1FGY A;  4B6H A;  3L16 A;  1Q1O A;  4ANX A;  5JH5 C;  1C1Y B;  5GOW B;  1W1H A;  1FHO A;  2KN5 A;  2A5U A;  4F7G A;  5DPT A;  4G11 A;  2GBK A;  1MAI A;  2JUO A;  2GMI C;  1RRB A;  1KZG A;  5DHA B;  2VRR B;  4GDL A;  1V6E A;  1MIZ B;  3FM8 C;  1MK9 B;  1E7U A;  1UBI A;  2K2U A;  4K2O A;  2DYO A;  4LJO B;  4A5K A;  1FHX A;  2LVO A;  3PT2 B;  1TBE A;  4IM0 A;  1EF1 A;  1YIW A;  2LRU A;  2COD A;  3ECI A;  3ZUN A;  3OLM D;  2FAZ A;  3AXC A;  1RJ2 A;  1WM2 A;  2DZK A;  4MGI E;  1QC6 A;  5D3V A;  2ELA A;  1UNR A;  4FLH A;  4X57 B;  1DDW A;  4K17 A;  5CLQ B;  3ZLZ A;  5HE1 A;  4DX9 0;  1J8C A;  5EFX A;  2KDF B;  3IVF A;  2PZ1 A;  2OTX A;  2E2X A;  1WXV A;  4HXD A;  2IYB A;  2Y8G A;  1V9J A;  3MHS D;  3SNH A;  4KZ0 A;  4FUL A;  4IW0 A;  2DTC A;  2GBJ A;  4ICV A;  1V81 A;  2C7N B;  3WAN A;  1PMS A;  2D9Z A;  1W1G A;  2LG1 A;  4HCN B;  1Q0W B;  2I1K A;  2G3Q B;  1WG7 A;  2KD0 A;  1Y8R C;  3VH4 B;  2LJ5 A;  1E8Z A;  3ULB A;  3CXB B;  3NHE B;  3T8M A;  2Z0O A;  4OVU A;  3X0W A;  4HPL B;  5D7G A;  3IHP C;  1P98 A;  3RZF A;  2JT4 B;  2B3A A;  1Z87 A;  2ZNV C;  3CSF A;  1S3S G;  3PG7 A;  4LDT D;  5CHV C;  3ZO5 B;  5JHB A;  2L76 A;  3HW2 B;  3QWZ B;  3LDZ E;  5LON B;  4RM9 A;  3PP2 A;  4BBN F;  3MTN B;  4YL8 A;  3ODO A;  4HCP B;  2H7E A;  3OAN A;  1WGQ A;  4MT7 A;  1OGW A;  5J17 A;  4F8C B;  1EO6 A;  2RSU A;  2JF5 A;  4A3P A;  1VD2 A;  5BO4 B;  2YS1 A;  5KCV A;  1YX5 B;  3CMM B;  2N9X A;  1DDM A;  4BBN C;  1H8C A;  2CHW A;  1F9J A;  2DAF A;  1XCG A;  4BKS A;  1Q5W B;  4WJQ A;  1WJU A;  3VDZ A;  2K2J A;  3GZN I;  5C16 A;  3MJW A;  3K9O B;  4IG7 B;  2BYE A;  2DFK A;  2BYF A;  2M0X A;  2MBB B;  2N1W A;  2JRI B;  1XD3 B;  3CF6 E;  1WXS A;  3K9P B;  2Y7B A;  2KZR A;  4II3 B;  4Z2N A;  5CHW A;  2DYM A;  4WSF A;  2J0M A;  2IO2 B;  5G55 A;  2O6V A;  1CMX B;  3KUZ A;  2LGD A;  5J3Y A;  1A5R A;  2GBN A;  3V6C B;  2I5F A;  3DXC A;  3VHT C;  2NR2 A;  2K1F A;  3RD2 A;  1U29 A;  4ANU A;  3PS6 A;  1UEF A;  3IBE A;  1KI1 B;  2NZ8 B;  2UZR A;  3PLU A;  2UVM A;  4K81 A;  4OVV A;  1JRU A;  3JYU A;  2ZCB A;  4FJZ A;  5E6N A;  2GCJ A;  3U7D A;  3QJZ A;  4ZYN A;  1WX8 A;  3RUL A;  2Z0P A;  3PV1 A;  4D0N B;  3H9D A;  1UD7 A;  2DKP A;  2KO3 A;  2BYV E;  2IYD B;  3ONS A;  2JVC A;  2JY6 A;  3QIJ A;  1NTY A;  5AZG A;  2N9E B;  1V2Y A;  2ADZ A;  3NS8 A;  1V5O A;  3EHV A;  1SIF A;  4BKS D;  1ZC4 B;  2MKR A;  3D8D A;  3KUD B;  4AWJ A;  2RD0 A;  2KDI A;  3ODW A;  3RYT A;  4MSQ B;  1BAK A;  2K00 A;  2MRP A;  2I1J A;  4WWO A;  4W9I A;  2KJH B;  4DWF A;  4HDO A;  4HVB A;  1ISN A;  2PE9 A;  2D9X A;  2MWS B;  3H7S A;  2FCQ A;  1E90 A;  2J7Q B;  1E8W A;  3PRE A;  2KGX B;  5JLJ B;  2CHX A;  3FSS A;  2MSE D;  4FHK A;  3EEC A;  4NY0 A;  2DHI A;  2O6V D;  3PEG A;  3A1Q B;  3DBL I;  5AEK B;  3N32 A;  2V4L A;  5LLI A;  4WQO B;  1EAZ A;  2MBH A;  1X05 A;  3UIN B;  2DZM A;  2WWZ A;  3APD A;  1WFY A;  2D9V A;  2R2Q A;  2LUL A;  2FUH B;  1L7Y A;  2LVP A;  3EC8 A;  1MK7 B;  5C1Z A;  3Q3J A;  2UWQ A;  3SV1 A;  2L0T A;  2LZ6 A;  3TJP A;  2QHO A;  3H7P B;  1ZC3 B;  3VQI A;  5D27 A;  2GJY A;  1WIA A;  3B1L X;  1E5W A;  1V5P A;  3WA0 A;  4XWX A;  3ULC A;  2RPQ A;  3WAM A;  2EMT A;  5LOP B;  3W1S C;  5E6P A;  2G45 B;  4BKT A;  4GZU A;  4AJY B;  2YS5 A;  3KRX A;  3DBS A;  4TQ0 A;  4HAY B;  1WGY A;  2QKM A;  5E6O A;  3RCZ A;  2NCN A;  4IM3 A;  2KX3 A;  2LXA A;  2ASQ A;  1WM3 A;  4I6L B;  3NSU A;  4RM8 A;  1KZ7 A;  4IM2 A;  3ZKJ C;  2JRH A;  1IP9 A;  1U5E A;  4HAX B;  4HDQ A;  3TO1 A;  3B08 A;  4KAX B;  2AL3 A;  4W9E A;  3DVG Y;  5D94 A;  3RT3 B;  4WAA A;  3H6N A;  1I2H A;  4A6K A;  5KHQ A;  2KK8 A;  3MPX A;  3V60 A;  3M3J A;  3TBL D;  2REX A;  2Q13 A;  4DHJ B;  2KLC A;  1OEY J;  4WJN A;  3ML4 A;  2D07 B;  5DCN A;  2C9W B;  3L17 A;  1XX0 A;  2CR5 A;  4W9D A;  4J6I A; 
#chains in the Genus database with same CATH topology
 1S1Q B;  5BMI A;  1R4N B;  2L7R A;  2OOB B;  3VAW A;  2G4D B;  1EGX A;  2L32 A;  1WXA A;  3N20 C;  1EUV B;  4AOF A;  4MEM A;  2WXR A;  3UQA A;  2D11 A;  4EFO A;  1ESF A;  2AL6 A;  3ZTC A;  4N6E B;  3AEB B;  4RF1 A;  5IA7 A;  2LEK A;  1OMW A;  1C76 A;  4IWP A;  3R8B A;  4N58 A;  1XKE A;  3SUZ A;  4HAV B;  1W1D A;  1YN3 A;  3U12 A;  1YX6 B;  3KQ4 A;  5HE2 A;  4HJK A;  3A4R A;  1TS4 A;  5HI1 A;  3A1Q A;  1WX9 A;  1B9R A;  1ST7 A;  1FOE A;  3CWI A;  2DEN B;  1WGU A;  1WY8 A;  2MHJ A;  4F1S A;  1WI1 A;  3T3N A;  4EOY A;  4FHJ A;  5M4Y B;  2D2Q A;  1KRH A;  1WJM A;  3I5J C;  2YEP F;  5JP4 A;  2BKR B;  2IGD A;  3U30 A;  1JAL A;  1V8C A;  4QAY A;  3P6A A;  1X1G A;  3ZQ4 A;  2LRW A;  3DOW A;  4XDC A;  3ZRC A;  4ZDV A;  5L81 A;  3H7P A;  4CHM A;  3UIO B;  3PTF C;  4IWQ A;  4L1R A;  5J2R A;  4HB4 B;  1OY2 A;  2INC C;  3TEZ A;  3AB5 A;  2BVC A;  2KWD A;  3E9S A;  4K7W A;  1GC6 A;  2KX0 A;  3NZS A;  2WXN A;  2ONQ A;  1PLS A;  3VUY A;  2Z8L A;  1WWT A;  1NU2 A;  2N7J A;  1I42 A;  5I2S A;  3CIK A;  1KLV A;  1PGB A;  2E3T A;  2MP2 B;  2GRI A;  4OZB A;  3N7C A;  3BJI A;  1GUA B;  4M01 A;  2M4N A;  4JK9 A;  4US8 A;  3VTU A;  3VVW B;  1FGZ A;  3BK2 A;  1WRD B;  4QJ4 B;  4WJP A;  2RNR B;  2MDX A;  4HPM B;  2XQN M;  4QXA B;  4WVF B;  4DK5 A;  4KGT A;  2ZNV B;  1J7A A;  1WVH A;  4DX8 A;  3EPY A;  1HE8 A;  3N3K B;  3PVU A;  2PMV A;  1ZOY B;  1MG8 A;  4MEL A;  5LNK 1;  2JSV X;  1OQN A;  2KJR A;  4W9L A;  5IRS A;  4EE2 A;  2JX5 A;  4S0R A;  4L23 A;  1U5D A;  3A33 B;  1XXG A;  2KTR B;  2J4X A;  1VRA B;  4I6N B;  2NMB A;  1TZ1 A;  5D3X A;  1H10 A;  2AQ1 B;  1NBF C;  2VKI A;  4PS7 A;  5C6R A;  4URK A;  1P6S A;  4C7Z A;  1VBH A;  2P0F A;  2MW5 A;  3B77 A;  4DDG D;  3L0W B;  4A20 A;  3FLV A;  4FAD A;  3DVN U;  3HIZ A;  4TMA B;  1WSP A;  3BY4 B;  4HHV A;  2KFK B;  3GP7 A;  3RNA C;  2MBO A;  2M56 B;  4G0N B;  2L3Z A;  2WXO A;  1FRR A;  3IT4 B;  1ZVR A;  4JL9 A;  5D6J B;  3DHH C;  3SBT A;  1FPY A;  2ZVN A;  3VR8 B;  4XDD A;  2R09 A;  3PVW A;  2KCJ A;  1AWE A;  2N7D A;  5CLL B;  2W2X D;  1NEN B;  1WE7 A;  2AX5 A;  1E0Z A;  2BBC A;  4WQM A;  4NJ7 A;  4TUU A;  3U4E G;  1L4D B;  2CHZ A;  4KDI C;  5J18 A;  2ON8 A;  3DBR I;  4II2 B;  3MDB C;  4JQW C;  3ZJV A;  1GNU A;  3KUC B;  4DBG A;  1V89 A;  4H8S A;  5DIF B;  1CJE A;  4JWS C;  1C4C A;  4KHO A;  4CHJ A;  2LVQ A;  1I4G A;  5L95 C;  2AWT A;  3ZDM C;  4OT1 A;  5IAA C;  4L2Y A;  3PRP B;  1OQR A;  1J0W A;  2RSG A;  3N1Z C;  2N9P C;  1GC7 A;  2X18 A;  4XWW A;  2IO0 B;  1YQ3 B;  2BB6 A;  1K8R B;  4TV3 A;  2KWC A;  3W1Y A;  1WRI A;  1XO3 A;  1L6V A;  1T0Y A;  1L0Y B;  2XEW A;  1WGR A;  3TFM A;  4HLE A;  2XBB C;  1P7F A;  2W3R A;  3FKY A;  3PVL A;  3Q6B A;  2MFQ A;  1UPQ A;  4RNA A;  1K5G B;  2CJN A;  2P0D A;  2LJI A;  2LGI A;  4D6W A;  4EZK A;  1KM7 A;  2RDB C;  2C60 A;  3WAO A;  2C7H A;  1PDX A;  3C19 A;  4GSW A;  3ZNI D;  1DYN A;  1F2R I;  4NAW B;  1JRP A;  3Q2A C;  4AP4 C;  2YVC A;  3KYC D;  5HE0 A;  2KVR A;  4USA A;  1OEY A;  1Z2M A;  2KAJ A;  1JQ4 A;  2ICI A;  2JXT A;  3AUL A;  1ZXI A;  1K5D B;  3KSY A;  2WDT B;  3R3M A;  4RH6 A;  4KX6 B;  3BIN A;  2P8V A;  2N0Y A;  5AZF A;  4R3D A;  5DHF B;  4FJV B;  1D5M C;  1G6J A;  3ZVR A;  3KH0 A;  1Y56 A;  2OJR A;  4K7S A;  5IOI A;  2MP2 A;  4L1B A;  4TSS A;  2CU3 A;  2BS3 B;  2WP9 B;  2L52 A;  3R2I A;  2YT0 A;  4DHJ D;  4ZRP A;  5FI0 A;  1WGD A;  2PPH A;  4GLS C;  4MM3 B;  2DX5 B;  2PEA A;  1TGZ B;  1SXT A;  1N61 A;  1P3Q U;  3NY5 A;  2BB5 A;  4KDL B;  3AJ4 A;  1TJ6 A;  1V49 A;  3M63 B;  1UBQ A;  2KKC A;  5GXG B;  4JE3 B;  2PW9 A;  4B0E A;  4EMO A;  3N1Y C;  3KYD D;  2M8S A;  2Y5B B;  3DCX A;  2N1V A;  3HM3 A;  3VIA A;  4LJP B;  2M38 A;  1LM8 B;  4ASW C;  3QC8 B;  4AQ7 A;  5CX3 A;  2DLW A;  4JWU C;  1PGA A;  3RCP A;  3AI5 A;  4MH0 E;  2C7M B;  4CHK A;  4MT5 A;  1ZP0 B;  2KQ7 A;  5FR3 A;  2DYQ A;  5C5B B;  1I35 A;  2KAC A;  4A3O A;  3P7Z A;  4TYZ A;  3NVV A;  4ZOH C;  2M17 A;  3HUI A;  4F7U P;  1FHW A;  1JWA D;  5EDS A;  1SJE D;  2A4Z A;  2KFK A;  3Q3O C;  2NS5 A;  3SEB A;  2GOW A;  3TVV A;  3HM6 X;  3FIL B;  5C23 A;  1XT9 B;  2K3U A;  4XE0 A;  4W9C A;  3RPF C;  3RNC C;  2HTH B;  3R2T A;  1DOI A;  1JWB D;  4MGZ E;  2BS4 B;  5HFY A;  4K3C A;  2ZPN A;  4PS8 A;  3OHM B;  1C78 A;  1KLU D;  1T6B X;  4AUQ C;  4NJ6 A;  4PYZ A;  1FFU A;  1WJ6 A;  1U4A A;  3TL5 A;  4GPT B;  2ELB A;  1C77 A;  3MP9 A;  2KOX A;  2X8X X;  5J3Q A;  2CS4 A;  3EGR A;  1PQS A;  4KSK C;  3P1M A;  1NTV A;  1B55 A;  4IOY X;  1QOG A;  1UZX B;  2K9X A;  4A90 A;  1KTK A;  4FJY A;  3UQB A;  3PRZ A;  4P7I A;  2MJE A;  2LD9 A;  1SF0 A;  3PHX B;  3QK0 A;  4GN1 A;  1X11 A;  5AZH A;  1EWC A;  4GIV A;  1NYR A;  3PZD A;  2JWZ A;  2M1M A;  2MBQ A;  2BGF A;  1CZP A;  3V6E B;  3JSV B;  1N60 A;  3DBH I;  4B95 A;  1H4R A;  4P16 A;  4XGA B;  1FNW A;  1SE4 A;  3QWM A;  2MBE A;  2WDV B;  2RMM A;  2Y8F A;  4KIK B;  2L1C A;  2LWP A;  4K3B A;  4GXB A;  3NWF A;  2PE6 B;  2ZVO A;  2SEB D;  4EEW A;  1WH3 A;  2V4I B;  5IKC M;  2FID A;  2ZCC A;  2V9H A;  4N9F 4;  1ZDV A;  2YS3 A;  4C00 A;  4ZHP A;  2KYW A;  1MIX A;  1HB8 A;  3A8Q A;  2KNB A;  2R82 A;  5G5H A;  4OW0 A;  3AE7 B;  3LXF A;  4W9J A;  3APF A;  2K8H A;  2D3A A;  5BMH A;  4IKG A;  5LXH A;  1L0X B;  4NAW A;  1PUT A;  2DHJ A;  1P5T A;  3AED B;  1AQC A;  1EVH A;  1J7B A;  2KT7 A;  2IY0 B;  1ACC A;  2KUQ A;  2PKO A;  4OZC A;  3QCA A;  2WU5 B;  5JHG A;  2DBY A;  2Z0D B;  3U8Z A;  1TKE A;  4W9H A;  2KDE B;  4DXF A;  2K6Q A;  1KBL A;  2L05 A;  1FB8 A;  1HTO A;  4ZRQ A;  3ZIM A;  1XR0 B;  2XK5 B;  3L4P A;  3WYF B;  2KAN A;  5DI9 B;  3Q3F A;  3S2A A;  2RGF A;  2WXF A;  2K8C A;  4MM3 A;  5D3I B;  2DX5 A;  1J0G A;  2LXC A;  3Q3N C;  2K6D B;  5EE3 A;  3OG5 A;  4YWG G;  1MKE A;  4LNK A;  1N6Z A;  2FJU B;  3V5W A;  1RLF A;  3ZNG C;  2MJD A;  1TXD A;  1RRP B;  1UH6 A;  3NVZ A;  4ANW A;  4LNF A;  1ZW7 A;  2V76 A;  2INN E;  3C8Y A;  3BVZ A;  2N4F A;  1XCT L;  5DPR A;  1L4Z B;  1GOZ A;  4PQ0 A;  2KWU B;  4JKG B;  2FIF A;  4KHA A;  3W9C B;  3U7Z A;  4HAZ B;  1LFD A;  3M1I B;  3SHQ A;  3I57 A;  5FI1 A;  2HJ8 A;  3DHG C;  3NZ3 A;  5C5B A;  3V61 A;  2GS0 A;  3ODX A;  2R2Y A;  3N9Y C;  3D8F A;  2CKH B;  2KLG A;  3A98 B;  5CHF A;  1IRS A;  1WJ1 A;  2Z14 A;  1XF5 L;  3FIL A;  3HSA A;  4NJC A;  2V3S A;  4WJ7 A;  2DYB A;  2KC2 A;  1NI2 A;  2HTH A;  3SDL C;  1DBH A;  3LYY A;  2LAS A;  3CST A;  4GDK B;  4LDT B;  4ZRI A;  1T0S C;  2D9W A;  1D6E C;  1C4P A;  1IGC A;  2WDR B;  4K2P A;  1V5M A;  4A9A A;  3NVY A;  2BQQ A;  3A9J B;  4E3C A;  4JIO U;  3P2B A;  5G5G A;  2Y3A A;  2H7D A;  1BUI C;  3SU8 X;  1IPG A;  4JLC A;  4OVZ A;  3A8P A;  3VTV A;  3NOB A;  2WXI A;  2WXQ A;  1DDV A;  1TS3 A;  1KLG D;  2Y5P A;  3QHT A;  2MWN B;  1B1Z A;  1EF5 A;  3UZT A;  3P63 A;  2V3N A;  3HRD D;  3LB8 C;  3JSV A;  3GZN B;  1WZ3 A;  2KMA A;  1XCQ L;  1VCB A;  4KSL C;  3AE4 B;  3NUH B;  2O2V B;  3V62 A;  4ZRJ A;  4JPS A;  2MCN B;  3KW5 B;  2AQ2 B;  2BS2 B;  4CYE A;  2MA9 B;  4MGY E;  4HWI B;  1P3R A;  4KIK A;  2D4Q A;  3W1S A;  1GJZ A;  4BAX A;  4JKB A;  4GMX B;  2J0J A;  2J0K A;  2ZW1 A;  4JKH A;  1JWM D;  1V80 A;  1M94 A;  1SEB D;  5IN7 A;  2PJH A;  1VBG A;  2CB8 A;  2MEK A;  1IBX A;  1BT0 A;  4P6V F;  2Z0Q A;  4XZ4 A;  3APC A;  1EM7 A;  3DPD A;  4I6P A;  2KR0 A;  3KLS X;  4JX1 C;  2LKO A;  4RMA A;  2ZEQ A;  1QZE A;  2PVO D;  3ZGZ A;  1GB4 A;  2MQJ A;  3GYO A;  3WAP A;  2LOZ A;  2FNJ B;  2EMS A;  3FC4 A;  2VRW B;  5D3W A;  1DGJ A;  4WWN A;  4MK0 A;  2JP2 A;  3P4R B;  2KUP A;  4Q2J A;  2LHD A;  4DXG A;  3RFZ B;  1SGH A;  1L6U A;  3SFD B;  2COF A;  2KFJ A;  1LXD A;  2RLO A;  5E6J A;  3PGE A;  2LUE A;  2DNF A;  4KVG B;  3ML8 A;  2UZS A;  2KDB A;  2KHW B;  1Q67 A;  5DPW A;  1UWM A;  1F2R C;  2KDM A;  5D2M B;  1HA5 A;  2XK5 A;  3NS1 A;  4HB2 B;  4C0A A;  1LW3 A;  2QC8 A;  3T06 A;  1V86 A;  3Q8F A;  2Z0E B;  4KZC A;  1J19 A;  5FR6 A;  1VZ6 A;  5L83 A;  2QEJ C;  2EJ8 A;  3ALB A;  4K7U A;  3RI7 C;  1XLN A;  3SO6 A;  4EUT A;  1XLP A;  3RNF C;  2UYZ B;  3O96 A;  2LOX A;  3VFK A;  1P0R A;  4Z2M B;  2DX1 A;  2RVB B;  1ZPS A;  5KQ4 A;  4NQL B;  4MGK E;  1D5Z C;  1ZDX A;  3AV8 A;  3KZ1 A;  1YMH E;  2GCL A;  2G35 A;  4A8X C;  4P1C C;  3URY A;  4IFS A;  2E6X A;  4ZHO A;  2ROZ B;  4ZRK A;  2NBV B;  1SHC A;  2QIE B;  4JKG A;  2RR9 A;  3E9L A;  1YJI A;  4TQ1 A;  3TW1 A;  2GBR A;  3AEA B;  1N63 A;  3CIR B;  2R0D A;  2K25 A;  4W9F A;  2KJ6 A;  2R2O A;  3VRA B;  1PFJ A;  2H88 B;  3I3T B;  3C0R B;  4EZL A;  1XEE A;  3KVF B;  1FNV A;  3VXW A;  2FJL A;  3PZ7 A;  3RNE C;  4BFR A;  1R4M I;  3RUI B;  4KHB B;  3WAL A;  4DHZ B;  3NRZ A;  2DWQ A;  2D3B A;  3HHM A;  1FD6 A;  3QBV B;  3SYX A;  2IO3 B;  4EJN A;  2IFS A;  1KJT A;  2UU7 A;  4GDK A;  1UNP A;  4F7H A;  4GOC A;  5FKA C;  1YNT E;  1NTI A;  3VUW A;  4ICU A;  2Z13 A;  3A9J A;  4KGR A;  1SE9 A;  1QOA A;  2KXJ A;  2IY1 B;  1PGX A;  3WCQ A;  3DXD A;  2LFI A;  3DBL B;  1PFD A;  3VR9 B;  3KY9 A;  1UGM A;  2K39 A;  1OTR B;  1LGR A;  3AU5 A;  3NZU A;  1M7E A;  3R7Q A;  3JVZ X;  5BYQ A;  1VZ8 A;  4KKJ A;  4LK0 M;  3FEH A;  3OJ3 A;  3B2F A;  4C4V B;  4H2A A;  5BYS A;  2COP A;  3ML9 A;  3M62 B;  3SD5 A;  2GBM A;  5JHA A;  2O6V B;  5GMV A;  1YJJ A;  3HVZ A;  2I5C A;  2O2V A;  1WI0 A;  4JGH B;  3Q14 C;  3VUX A;  2WX1 A;  1D3Z A;  1NVL A;  3KRW A;  1N3H A;  2LHE A;  3W5V B;  1WGH A;  1EU3 A;  4BKG A;  4NQK E;  4HKQ A;  4HAU B;  2JQR B;  2PLP A;  4W9G A;  5CTR C;  1STE A;  2KMC A;  4DHZ E;  1KOT A;  3IG3 A;  4WJO A;  3ZTD A;  2JZ3 B;  1J7C A;  1C3T A;  1E8X A;  2FJ9 A;  4K1R B;  1MPH A;  2KIG A;  4A6F B;  4O1N A;  2LGS A;  2QDF A;  2ZPY A;  1GGO A;  2J59 M;  3BVM A;  2FCS A;  2WXJ A;  1UUP A;  3V3X A;  1QOB A;  2DA0 A;  3T9L A;  2W82 A;  1T3Q A;  4PYU A;  1TY0 A;  2BT6 A;  3VOQ A;  2WU2 B;  4M00 A;  3GOE A;  1TZO A;  1U27 A;  4WAF A;  5MPO A;  3ZNH B;  3BK1 A;  3WIM A;  5DH9 B;  2DAJ A;  3EA6 A;  1YJ1 A;  4WWP A;  2IZV B;  2DKQ A;  3PPA A;  3Q8A A;  4WUR A;  3PO0 A;  2W55 A;  2COC A;  3GB1 A;  5JZE B;  4RGN A;  1XLQ A;  3MHZ A;  1SJH D;  1UGJ A;  1P9D U;  3EFC A;  4HAT B;  2V3P A;  2NPT B;  2D3G A;  2OQB A;  2DHK A;  4F7Z A;  4IAP A;  1ZGU B;  2BWE S;  1TTN A;  2L8J A;  4G50 A;  5HKH A;  4BBK A;  1WYW B;  2JZZ A;  3L54 A;  1LQB A;  4B6W A;  3DDC B;  3OAW A;  1D4B A;  2C5L C;  1IGD A;  2XNA C;  1GG3 A;  2W54 A;  2ZZP B;  2MX2 A;  3N30 A;  1NDD A;  2L2I A;  1ET6 A;  1WXM A;  1RFA A;  4E74 A;  1WF9 A;  3B2G A;  4IUM B;  3B0A A;  1ZKH A;  2W2W A;  2NBV A;  2FCN A;  3D8E A;  2W9N A;  2WX0 A;  1EWY C;  4ITK A;  1T77 A;  1BXT A;  2DZI A;  2CAY A;  2KN4 A;  4IDI A;  4PT5 A;  2M0A A;  2HE7 A;  2L0F A;  2SAK A;  1E7P B;  4XX5 A;  3W2D A;  4JKD A;  2QIL A;  3H1U A;  4NPN A;  5DPS A;  1YD8 U;  3ZRF A;  4YON A;  1HXY D;  3DXE A;  2K8E A;  4KHB A;  3AEF B;  2YSZ A;  2CU1 A;  3QAQ A;  2YT1 A;  1IYF A;  1L2N A;  4REZ A;  2NMQ A;  4B9K A;  1N5W A;  1DYQ A;  3L08 A;  4EKU A;  3TUO A;  1V5T A;  4XC2 A;  2KTR A;  1VLB A;  1K52 A;  3ZDT A;  4GB9 A;  1YQB A;  2YRY A;  2KWV B;  1UF0 A;  4IOI E;  2RDH A;  3TEX A;  1R4N I;  3MJ5 A;  3ZNZ B;  2FDQ A;  4GU2 A;  4HB3 B;  2DZJ A;  1WJN A;  3AE8 B;  4HAW B;  1FEH A;  3ENB A;  5LXI B;  1SE2 A;  3QQ8 B;  2HD5 B;  3UIP B;  1LB1 A;  4C4V A;  2LGX A;  1WZ0 A;  1JDE A;  3G9W A;  1BWN A;  2K5P A;  2WYQ A;  3Q8B A;  1WX7 A;  2ACZ B;  3HQC A;  4PS3 A;  4E71 A;  2DYN A;  3AE3 B;  4L6E A;  3OWE B;  1TS5 A;  4FBJ B;  5JXV A;  4MJS B;  3L10 B;  2K8B A;  3DWM A;  4RCO A;  2NVU I;  3LJ3 A;  3D32 A;  3R7R A;  2KTF A;  4M0W B;  4JK7 A;  2AQ3 B;  2WHI A;  1T0R C;  3UF8 A;  1BML C;  3X23 A;  1VZ7 A;  1OQY A;  1XD4 A;  2JXX A;  4QJ3 B;  1JWS D;  2BWF A;  1WGG A;  4A6F A;  4MSM B;  1JWU D;  4Y94 A;  3EUB 2;  3RNB C;  5KHO A;  1E8Y A;  1FM0 D;  2EKE C;  1MFW A;  3A9K B;  3UGB B;  4PNK A;  4DXA B;  2LGY A;  1RM6 C;  4J3O D;  2RQ1 A;  2BF8 B;  2CRF A;  3AEC B;  2KQS A;  1ACA A;  1WMH B;  1DOX A;  4M8M A;  3ZYY X;  3PRM B;  3U2S C;  1UNQ A;  2D10 A;  1WE6 A;  5C3J B;  4HRO A;  5C2T B;  4BOS C;  4BVU C;  2N23 A;  4GGQ A;  3LJU X;  4IC7 B;  1T0Q C;  1X86 A;  1UEL A;  4M8N A;  4TKN A;  3DQV A;  3DVG X;  4KV2 A;  3HIE A;  2WXM A;  3U52 E;  1HB6 A;  3JW0 X;  2OJW A;  1X1M A;  3R66 C;  4DDI D;  4W9K A;  2D9Y A;  3H8H A;  3P42 A;  4N59 A;  3ENE A;  3QAR A;  4IWO A;  1UNS A;  1E7V A;  5HE3 A;  2NPT A;  3FVC A;  1WJ4 A;  2WDQ B;  3P4S B;  1P1A A;  4FA6 A;  4MAC A;  1I4P A;  3HK0 A;  1GAQ B;  2WXG A;  2ZJD A;  5EE0 A;  2FCM A;  1LO5 D;  2IGG A;  2N9L A;  2JYT A;  3BYT B;  1K53 A;  4LTU A;  4RFB A;  4OZA A;  2P0H A;  2BCJ A;  4MDK E;  1FAO A;  2QJL A;  4OSN A;  1WR6 E;  1WR1 A;  5EE1 A;  4AJW A;  2V1Y A;  4NNJ B;  3RN9 C;  5IJM A;  1KH0 A;  2BPS A;  3AE6 B;  3N1X C;  1V5U A;  2CJO A;  4UDU C;  1X1F A;  1YOV B;  3ZW3 A;  4G3X B;  3PHW B;  4EZJ A;  1ZM0 A;  1OQQ A;  5H8Y E;  1XOD A;  1Y5O A;  1Y19 B;  2RPV A;  1SSN A;  3KWL A;  4GDL B;  3DBR B;  3TMP B;  2Z59 B;  4HK2 A;  2NBU A;  4DQO C;  3E9P A;  3PSC A;  1QLB B;  4ARI A;  2M19 A;  2KMM A;  2KC1 A;  2IO1 B;  3I63 C;  3RMK C;  4A6H A;  1HQR D;  1HTQ A;  2YLM A;  4D2K A;  3I9V 1;  1RAX A;  1TT5 B;  3DHI C;  4KKI A;  3VTW A;  2CY4 A;  3DCG A;  4QJ5 B;  2RGN B;  2BTE A;  1VR9 A;  3BYY B;  1JML A;  3QA8 A;  1TKY A;  3NVW A;  2VSZ A;  1OFF A;  1EU4 A;  2NTS A;  1FXT B;  4BOZ B;  5TR5 A;  4JKA A;  3DVN V;  2EC1 A;  4LNI A;  4RF0 A;  3TCA A;  1TQZ A;  1NYQ A;  3GE8 C;  1HBK A;  1DRO A;  1FXI A;  1ZE3 D;  1I4H A;  1WYG A;  4YTN B;  1Z5S B;  1SBB B;  1YN4 A;  1L5P A;  5JHH A;  4HB0 B;  3QX1 A;  3NW8 A;  4GMV A;  4CO7 A;  1TY2 A;  4MJS A;  2Y5C A;  2R61 A;  2DN6 A;  3VH3 B;  4FN2 A;  3IFW B;  2COA A;  4LNN A;  5D3Y A;  1SE3 A;  3ZVV A;  1MG4 A;  1MHH E;  2YF0 A;  1NI3 A;  2G4S A;  3AMZ A;  5LG4 B;  2TSS A;  3HVD A;  1V1O A;  1AAR A;  4A55 A;  1U5G A;  2JPH A;  5J3T A;  2N7E A;  1UPR A;  2LI5 A;  1F0Z A;  3O65 B;  2YEP B;  2JZP A;  2PIA A;  3A9K A;  3F0W A;  4XWT A;  1AWD A;  4A6Q A;  5KQ1 A;  4LCD E;  1JW9 D;  2ROV A;  3AN1 A;  2DHZ A;  1AYF A;  2CY5 A;  1WMH A;  2NBW B;  1BTK A;  1ENF A;  1ROE A;  5EE9 A;  2WQY B;  3E56 A;  2HTM E;  2BKF A;  3PSE B;  2MLB A;  3EFU A;  2Z4D A;  1U5F A;  2LYD A;  2W2X C;  3OJ4 B;  2AEH A;  4ZYS A;  1I7A A;  1BTN A;  4ANV A;  2QKL A;  3RZW C;  2IBI B;  1QQG A;  4YTP B;  5C79 A;  2RUK B;  4WWM A;  3P4P B;  2L00 B;  2PVG C;  2VZK B;  1V61 A;  1V88 A;  3M95 A;  2N0S B;  2I38 A;  3TIX A;  3F5R A;  3PLV A;  3NWA A;  1ZSQ A;  3L13 A;  2WLB A;  3GYP A;  2M14 A;  4DBB A;  5IO9 A;  2AYO B;  4NSW A;  4C80 A;  4YSY B;  1M7R A;  3A4S C;  1YQ4 B;  1U2B A;  4XYC A;  1I7H A;  5G2N A;  2DIK A;  3P4Q B;  3PZ8 A;  1TKG A;  1K51 A;  3AU4 A;  4MY6 A;  1XQQ A;  1FGY A;  5D3D A;  4B6H A;  1T5X D;  3L16 A;  1Q1O A;  4ANX A;  5JH5 C;  1C1Y B;  1MI0 A;  5GOW B;  2N9K A;  2WXH A;  1W1H A;  2EKI A;  3AM9 A;  2WH5 A;  3Q69 A;  1FHO A;  2KN5 A;  2A5U A;  3T3O A;  3AEG B;  3Q3M C;  4F7G A;  5DPT A;  4G11 A;  2GBK A;  1MAI A;  2JUO A;  2GMI C;  1RRB A;  1KZG A;  2WS3 B;  5DHA B;  4ARC A;  2GUM A;  3MC9 A;  3W5U B;  2VRR B;  4GDL A;  2Z59 A;  1V6E A;  2DLB A;  1MIZ B;  3BZD B;  1MJD A;  3FM8 C;  1MK9 B;  1E7U A;  1UBI A;  2K2U A;  2KVZ A;  1QF6 A;  4K2O A;  4PK1 A;  2DYO A;  1QT9 A;  4LJO B;  2LMC A;  3DBH B;  4A5K A;  1FRD A;  1VJK A;  2INP E;  4YT0 B;  1FHX A;  2LVO A;  3AE9 B;  3PT2 B;  1TBE A;  4IM0 A;  1EF1 A;  1YIW A;  2LRU A;  2COD A;  3ECI A;  3ZUN A;  3OLM D;  5TSS A;  1ET9 A;  2FAZ A;  1ZUD 2;  4HSI A;  3AXC A;  1RJ2 A;  4S17 A;  1WM2 A;  3TEY A;  1F77 A;  1TYG B;  4WH4 A;  3ETR A;  2DZK A;  4YXD B;  4MGI E;  1QC6 A;  3TSS A;  2IPK D;  3MC0 B;  5D3V A;  2ELA A;  1UNR A;  4FLH A;  4X57 B;  1FNU A;  1GPX A;  1DDW A;  4K17 A;  5CLQ B;  3ZLZ A;  3KWV A;  4YSZ B;  5HE1 A;  1C9F A;  2VH2 A;  4DX9 0;  2RRF A;  2HDE A;  1J8C A;  1HZ6 A;  5EFX A;  2KDF B;  4ILJ A;  2QMT A;  3IVF A;  1MI1 A;  1AN8 A;  2PZ1 A;  2K49 A;  5HG2 A;  5I4D A;  2OTX A;  2E2X A;  1WXV A;  4HPP A;  3V05 A;  1SB3 C;  4HXD A;  3SR6 A;  2IYB A;  2Y8G A;  1V9J A;  3MHS D;  1KF6 B;  3SNH A;  4C7Y A;  4KZ0 A;  2RDG A;  4HRS A;  4FUL A;  1E10 A;  5I2M A;  4IW0 A;  2B76 B;  3BVG A;  2IND C;  1WGK A;  3AE2 B;  2DTC A;  2J52 A;  2MH7 A;  2GBJ A;  1RWS A;  1TS2 A;  4ICV A;  3ZJU A;  1V81 A;  3UI3 A;  2C7N B;  3WAN A;  1V1P B;  2K0P A;  3E9O A;  1PMS A;  2D9Z A;  1C4A A;  5FK9 C;  1W1G A;  4HJG E;  2LG1 A;  4HCN B;  2VH1 A;  3ABV B;  1TJE A;  1Q0W B;  2I1K A;  2G3Q B;  4DIX A;  3IAS 1;  3FP5 A;  2LBB A;  1WG7 A;  2KD0 A;  1KFY B;  2HRJ A;  1Y8R C;  3VH4 B;  2LJ5 A;  2W3S A;  1E8Z A;  3ULB A;  3CXB B;  2GB1 A;  2ABD A;  3NHE B;  3T8M A;  3MC8 A;  2Z0O A;  4OVU A;  4RGO S;  3X0W A;  4HPL B;  5D7G A;  4CSQ A;  3IHP C;  1P98 A;  3RZF A;  2JT4 B;  2B3A A;  2JYE A;  1Z87 A;  2ZNV C;  3ZXV A;  3CSF A;  1S3S G;  4P1B C;  1KC7 A;  1HZ5 A;  3PG7 A;  2G1E A;  4LDT D;  2J53 A;  5CHV C;  3ZO5 B;  5JHB A;  3Q8C A;  2L76 A;  2ZKM X;  3HW2 B;  3QWZ B;  3LDZ E;  5LON B;  4ACF A;  4RM9 A;  3PP2 A;  2YT2 A;  1N62 A;  4BBN F;  1M4V A;  3IAM 1;  3MTN B;  4YL8 A;  3ODO A;  4HCP B;  3AEE B;  2H7E A;  5BMG A;  3OAN A;  1V97 A;  1WGQ A;  4MT7 A;  3SBG A;  1OGW A;  1NVI D;  4NAM A;  5J17 A;  4F8C B;  1EO6 A;  2RSU A;  2JF5 A;  5JVL A;  4A3P A;  1VD2 A;  3ZJT A;  5BO4 B;  1FIQ A;  2YS1 A;  5KCV A;  1YX5 B;  4WIP A;  4RGM A;  3CMM B;  2N9X A;  1DDM A;  3TEW A;  4BBN C;  4JKC A;  1H8C A;  2CHW A;  1A70 A;  3NJT A;  1WXQ A;  1F9J A;  2DAF A;  1XCG A;  1RFK A;  3IXS A;  4BKS A;  1Q5W B;  4WJQ A;  1FXA A;  1WJU A;  2J42 A;  3VDZ A;  1QIL A;  2K2J A;  2G9H D;  3GZN I;  2CQU A;  5C16 A;  3MJW A;  1NEK B;  3K9O B;  4IG7 B;  1FO4 A;  1F1H A;  2VZK D;  2BYE A;  2WXK A;  2DFK A;  1DIK A;  2WNM A;  2BYF A;  2M0X A;  2MBB B;  2N1W A;  2JRI B;  1XD3 B;  2H89 B;  3CF6 E;  1WXS A;  3K9P B;  2FUG 1;  2HJ1 A;  2Y7B A;  2FE8 A;  2KZR A;  3GE3 C;  1CK1 A;  4II3 B;  4Z2N A;  2D3C A;  5CHW A;  1QOF A;  1FFV A;  2DYM A;  5IP4 D;  1K50 A;  2KQ4 X;  5HHD G;  4WSF A;  3AH7 A;  2J0M A;  1E9M A;  3E66 A;  2IO2 B;  5G55 A;  2O6V A;  2WXP A;  1CMX B;  3KUZ A;  2LGD A;  4MH8 A;  5J3Y A;  1A5R A;  3A58 A;  4RGT A;  2MJ3 A;  2GBN A;  3V6C B;  2I5F A;  3DXC A;  1YN5 A;  1L0V B;  3VHT C;  2NR2 A;  3NG0 A;  2K1F A;  3RD2 A;  1U29 A;  1D5X C;  4ANU A;  3PS6 A;  1ZYI A;  4AS1 A;  1UEF A;  3FAH A;  3IBE A;  4JKE A;  4YTM B;  1V1P A;  1KI1 B;  2NZ8 B;  2UZR A;  3PLU A;  3AE1 B;  2UVM A;  4K81 A;  4LLG M;  3GS2 A;  2OHF A;  4OVV A;  1E6E B;  1JRU A;  3JYU A;  2WXL A;  2ZCB A;  4FJZ A;  4B0M A;  4M02 A;  5E6N A;  2GCJ A;  3U7D A;  3SFE B;  2K22 A;  3QJZ A;  4ZYN A;  1WX8 A;  2IGH A;  3RUL A;  2JU6 X;  1JRO A;  1QKZ A;  2Z0P A;  3PV1 A;  3ZXR A;  4D0N B;  3H9D A;  1UD7 A;  2QSD A;  2DKP A;  2KO3 A;  4NZL B;  1VDV A;  4C56 C;  2KIE A;  2BYV E;  2IYD B;  3ONS A;  2JVC A;  2JY6 A;  1FCL A;  1R4M B;  3NWD A;  3QIJ A;  1NTY A;  5AZG A;  2N9E B;  1V2Y A;  2ADZ A;  4JKF A;  3Q8E A;  3NS8 A;  4JK8 A;  3O13 A;  1V5O A;  3EHV A;  1SIF A;  4BKS D;  5AUI A;  1ZC4 B;  2QCZ A;  2MKR A;  3D8D A;  3IT6 B;  3KUD B;  1ZXH A;  4AWJ A;  5AUK A;  2XN9 C;  2RD0 A;  1TIF A;  1I4Q A;  2KDI A;  3ODW A;  3RYT A;  1IUE A;  4MSQ B;  1BAK A;  2K00 A;  2MRP A;  4LNO A;  2I1J A;  4WWO A;  1R7S A;  4W9I A;  3RNG C;  2KJH B;  1C79 A;  4DWF A;  4HDO A;  1IBX B;  5T8I A;  4HKZ E;  4HVB A;  1ISN A;  2PE9 A;  2D9X A;  2MWS B;  3H7S A;  2FCQ A;  1SIJ A;  1E90 A;  2J7Q B;  4KGS A;  1QQR A;  4US9 A;  1E8W A;  3PRE A;  2X0S A;  2KGX B;  5JLJ B;  2CHX A;  3FSS A;  2MSE D;  4FHK A;  2D5G A;  3EEC A;  1MPE A;  4NY0 A;  1UWX A;  2DHI A;  1CQV A;  2IJ0 A;  2O6V D;  3J9C A;  3PEG A;  3A1Q B;  3DBL I;  5AEK B;  3N32 A;  4CQN A;  2V4L A;  4WQO B;  2JWU A;  1EAZ A;  5LLI A;  2MBH A;  1X05 A;  3DWG C;  3UIN B;  2X38 A;  2DZM A;  2WWZ A;  3APD A;  1WFY A;  2D9V A;  1DOY A;  2R2Q A;  2LUL A;  2FUH B;  1HEZ E;  1L7Y A;  4YSX B;  2LVP A;  3EC8 A;  1N5X A;  1MK7 B;  5C1Z A;  3Q3J A;  2UWQ A;  3SV1 A;  2L0T A;  3AE5 B;  2LZ6 A;  2L1A A;  3TJP A;  2QHO A;  3H7P B;  1ZC3 B;  2WGS A;  3VQI A;  5D27 A;  4ILG B;  2IDY A;  2BW2 A;  1XLO A;  2GJY A;  1WIA A;  1AW7 A;  3VRB B;  1MVK A;  1RYJ A;  3B1L X;  1MHX A;  1E5W A;  1I4R A;  5BYR A;  4GNK B;  2PTL A;  3WA0 A;  1V5P A;  4XWX A;  3MFG A;  3ULC A;  2RPQ A;  3WAM A;  2EMT A;  4ILH A;  1GB1 A;  5LOP B;  3W1S C;  5E6P A;  2G45 B;  4BKT A;  2FBW B;  4GZU A;  4AJY B;  2YS5 A;  3KRX A;  3DBS A;  4TQ0 A;  4HAY B;  1WGY A;  2QKM A;  4M0W A;  3BII D;  5E6O A;  2NTT A;  1FMA D;  1FCC C;  1P7E A;  3RCZ A;  2NCN A;  4IM3 A;  2EEL A;  2I2Y A;  4BZA A;  4HEA 1;  2KX3 A;  2LXA A;  4FXC A;  2ASQ A;  1WM3 A;  4I6L B;  3NSU A;  4RM8 A;  1KZ7 A;  4IM2 A;  3ZKJ C;  2JRH A;  1IP9 A;  1U5E A;  2L83 A;  4HDQ A;  4HAX B;  3TO1 A;  1I4X A;  3B08 A;  4KAX B;  2AL3 A;  4W9E A;  1Q10 A;  3DVG Y;  1F52 A;  5D94 A;  2GI9 A;  3RT3 B;  4WAA A;  3H6N A;  1I2H A;  4A6K A;  5KHQ A;  2KK8 A;  3MPX A;  3V60 A;  1JCK B;  2GLS A;  3M3J A;  3TBL D;  2REX A;  2Q13 A;  4DHJ B;  2KLC A;  1OEY J;  4WJN A;  2LUM A;  3ML4 A;  2V0G A;  2D07 B;  2OED A;  2BYT A;  1PYW D;  5DCN A;  3B9J A;  2C9W B;  2Q5W D;  2ZW0 A;  5H92 C;  3L17 A;  1XX0 A;  2CR5 A;  4W9D A;  3BWU D;  4J6I A;  4GOU A;  4OHJ A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  2L7R A;  2OOB B;  3VAW A;  2G4D B;  1EGX A;  1WXA A;  1EUV B;  4AOF A;  4MEM A;  3UQA A;  2D11 A;  4EFO A;  2AL6 A;  3ZTC A;  5IA7 A;  1OMW A;  4IWP A;  1XKE A;  3SUZ A;  4HAV B;  1W1D A;  1YX6 B;  5HE2 A;  4HJK A;  3A4R A;  3A1Q A;  1WX9 A;  1ST7 A;  1FOE A;  2DEN B;  1WGU A;  1WY8 A;  4F1S A;  1WI1 A;  4EOY A;  4FHJ A;  2D2Q A;  1WJM A;  5JP4 A;  2BKR B;  3U30 A;  3P6A A;  1X1G A;  2LRW A;  3DOW A;  3ZRC A;  4ZDV A;  5L81 A;  3H7P A;  4CHM A;  3UIO B;  3PTF C;  4IWQ A;  5J2R A;  4HB4 B;  1OY2 A;  4K7W A;  1GC6 A;  2KX0 A;  3NZS A;  1PLS A;  3VUY A;  1NU2 A;  1I42 A;  3CIK A;  1KLV A;  2MP2 B;  3N7C A;  3BJI A;  1GUA B;  2M4N A;  4JK9 A;  3VTU A;  3VVW B;  1FGZ A;  1WRD B;  4WJP A;  2RNR B;  2MDX A;  4HPM B;  2XQN M;  4WVF B;  4DK5 A;  2ZNV B;  1WVH A;  4DX8 A;  3EPY A;  1HE8 A;  3N3K B;  3PVU A;  1MG8 A;  4MEL A;  2KJR A;  1OQN A;  4W9L A;  1U5D A;  3A33 B;  2KTR B;  4I6N B;  2NMB A;  1TZ1 A;  5D3X A;  1H10 A;  1NBF C;  2VKI A;  4PS7 A;  5C6R A;  4URK A;  1P6S A;  1VBH A;  2P0F A;  2MW5 A;  4DDG D;  3L0W B;  4A20 A;  3FLV A;  4FAD A;  3DVN U;  3HIZ A;  3BY4 B;  4HHV A;  2KFK B;  2MBO A;  4G0N B;  2L3Z A;  1ZVR A;  4JL9 A;  5D6J B;  3SBT A;  2ZVN A;  2R09 A;  3PVW A;  2KCJ A;  1AWE A;  2N7D A;  5CLL B;  2W2X D;  1WE7 A;  4NJ7 A;  4TUU A;  2CHZ A;  4KDI C;  5J18 A;  3DBR I;  4II2 B;  3MDB C;  4JQW C;  1GNU A;  3KUC B;  4DBG A;  1V89 A;  4H8S A;  5DIF B;  4KHO A;  4CHJ A;  2LVQ A;  5L95 C;  2AWT A;  3ZDM C;  5IAA C;  3PRP B;  1J0W A;  2RSG A;  2N9P C;  1GC7 A;  2X18 A;  2IO0 B;  4TV3 A;  1K8R B;  2KWC A;  3W1Y A;  1T0Y A;  2XEW A;  1WGR A;  3TFM A;  4HLE A;  2XBB C;  3PVL A;  2MFQ A;  1UPQ A;  1K5G B;  2P0D A;  4EZK A;  1KM7 A;  3WAO A;  2C60 A;  2C7H A;  4GSW A;  3ZNI D;  1DYN A;  4NAW B;  4AP4 C;  2YVC A;  3KYC D;  5HE0 A;  2KVR A;  1OEY A;  1Z2M A;  3AUL A;  1K5D B;  3KSY A;  2WDT B;  3R3M A;  3BIN A;  2P8V A;  2N0Y A;  5AZF A;  5DHF B;  4FJV B;  1G6J A;  3ZVR A;  3KH0 A;  2OJR A;  4K7S A;  2MP2 A;  2YT0 A;  4DHJ D;  5FI0 A;  1WGD A;  2PPH A;  2DX5 B;  2PEA A;  1TGZ B;  1P3Q U;  3NY5 A;  4KDL B;  3AJ4 A;  1TJ6 A;  1V49 A;  3M63 B;  1UBQ A;  2KKC A;  4EMO A;  3KYD D;  2M8S A;  2Y5B B;  2N1V A;  3HM3 A;  3VIA A;  4LJP B;  2M38 A;  1LM8 B;  4ASW C;  3QC8 B;  5CX3 A;  2DLW A;  3RCP A;  3AI5 A;  4MH0 E;  2C7M B;  4CHK A;  2KQ7 A;  2DYQ A;  5C5B B;  1I35 A;  4A3O A;  3P7Z A;  4TYZ A;  2M17 A;  4F7U P;  1FHW A;  5EDS A;  2A4Z A;  2KFK A;  2NS5 A;  2GOW A;  3TVV A;  3HM6 X;  5C23 A;  1XT9 B;  4W9C A;  2HTH B;  4MGZ E;  2ZPN A;  4PS8 A;  4AUQ C;  4NJ6 A;  4PYZ A;  1WJ6 A;  1U4A A;  3TL5 A;  4GPT B;  2ELB A;  2KOX A;  5J3Q A;  2CS4 A;  4KSK C;  1PQS A;  1NTV A;  1B55 A;  4IOY X;  1UZX B;  4FJY A;  3UQB A;  3PRZ A;  4P7I A;  2LD9 A;  3PHX B;  3QK0 A;  4GN1 A;  1X11 A;  5AZH A;  4GIV A;  3PZD A;  2JWZ A;  2M1M A;  2MBQ A;  2BGF A;  3V6E B;  3JSV B;  3DBH I;  4B95 A;  1H4R A;  3QWM A;  2MBE A;  2Y8F A;  4KIK B;  2L1C A;  2LWP A;  4GXB A;  2PE6 B;  2ZVO A;  4EEW A;  1WH3 A;  2FID A;  2ZCC A;  4N9F 4;  2YS3 A;  1MIX A;  1HB8 A;  3A8Q A;  2KNB A;  2R82 A;  4W9J A;  3APF A;  2K8H A;  5LXH A;  4NAW A;  2DHJ A;  1P5T A;  1AQC A;  1EVH A;  2IY0 B;  3QCA A;  5JHG A;  2Z0D B;  3U8Z A;  4W9H A;  2KDE B;  2K6Q A;  1KBL A;  2L05 A;  1FB8 A;  3ZIM A;  1XR0 B;  2XK5 B;  3WYF B;  2KAN A;  5DI9 B;  3Q3F A;  3S2A A;  2RGF A;  2K8C A;  4MM3 A;  2DX5 A;  1J0G A;  2LXC A;  2K6D B;  1MKE A;  3V5W A;  1RLF A;  3ZNG C;  1TXD A;  1RRP B;  1UH6 A;  4ANW A;  1ZW7 A;  2V76 A;  2N4F A;  5DPR A;  4PQ0 A;  2KWU B;  4JKG B;  2FIF A;  4KHA A;  4HAZ B;  1LFD A;  3M1I B;  3SHQ A;  5FI1 A;  2HJ8 A;  5C5B A;  3V61 A;  2GS0 A;  3ODX A;  3D8F A;  2CKH B;  2KLG A;  3A98 B;  5CHF A;  1IRS A;  1WJ1 A;  2V3S A;  4WJ7 A;  2DYB A;  2KC2 A;  1NI2 A;  2HTH A;  3SDL C;  1DBH A;  2LAS A;  3CST A;  4GDK B;  4LDT B;  4ZRI A;  2D9W A;  4K2P A;  1V5M A;  3A9J B;  4E3C A;  4JIO U;  3P2B A;  2H7D A;  3SU8 X;  1IPG A;  4JLC A;  3A8P A;  3VTV A;  3NOB A;  1DDV A;  3QHT A;  2MWN B;  1EF5 A;  3UZT A;  3JSV A;  1WZ3 A;  2KMA A;  1VCB A;  4KSL C;  2O2V B;  3V62 A;  4ZRJ A;  2MCN B;  3KW5 B;  4MGY E;  4CYE A;  2MA9 B;  4HWI B;  1P3R A;  4KIK A;  2D4Q A;  3W1S A;  1GJZ A;  4JKB A;  4GMX B;  2J0J A;  2J0K A;  4JKH A;  1V80 A;  1M94 A;  2PJH A;  1VBG A;  2CB8 A;  1BT0 A;  2Z0Q A;  4XZ4 A;  3APC A;  3DPD A;  4I6P A;  2LKO A;  4RMA A;  2ZEQ A;  1QZE A;  2MQJ A;  3GYO A;  3WAP A;  2LOZ A;  2FNJ B;  2EMS A;  2VRW B;  5D3W A;  4WWN A;  4MK0 A;  2JP2 A;  2KUP A;  1SGH A;  2COF A;  2KFJ A;  1LXD A;  2RLO A;  3PGE A;  2LUE A;  4KVG B;  3ML8 A;  2UZS A;  2KDB A;  2KHW B;  1Q67 A;  5DPW A;  5D2M B;  2XK5 A;  4HB2 B;  4C0A A;  1LW3 A;  3T06 A;  1V86 A;  4KZC A;  2Z0E B;  5FR6 A;  1J19 A;  5L83 A;  2EJ8 A;  3ALB A;  4K7U A;  3SO6 A;  4EUT A;  2UYZ B;  3O96 A;  2LOX A;  3VFK A;  1P0R A;  4Z2M B;  2DX1 A;  2RVB B;  5KQ4 A;  4NQL B;  4MGK E;  3KZ1 A;  2GCL A;  2G35 A;  4IFS A;  2ROZ B;  4ZRK A;  2NBV B;  1SHC A;  4JKG A;  2RR9 A;  3E9L A;  4TQ1 A;  3TW1 A;  2GBR A;  2R0D A;  2K25 A;  4W9F A;  2KJ6 A;  2R2O A;  1PFJ A;  3I3T B;  3C0R B;  4EZL A;  3KVF B;  3VXW A;  2FJL A;  4BFR A;  1R4M I;  3RUI B;  4KHB B;  3WAL A;  4DHZ B;  3HHM A;  3QBV B;  3SYX A;  2IO3 B;  4EJN A;  2IFS A;  1KJT A;  4GDK A;  1UNP A;  4F7H A;  4GOC A;  1NTI A;  3VUW A;  4ICU A;  3A9J A;  1SE9 A;  2KXJ A;  2IY1 B;  3DXD A;  3KY9 A;  1UGM A;  2K39 A;  1OTR B;  3AU5 A;  3NZU A;  1M7E A;  3R7Q A;  3JVZ X;  3FEH A;  3OJ3 A;  2COP A;  3ML9 A;  3M62 B;  3SD5 A;  2GBM A;  5JHA A;  2O6V B;  5GMV A;  2I5C A;  2O2V A;  1WI0 A;  4JGH B;  3VUX A;  2WX1 A;  1D3Z A;  1NVL A;  3KRW A;  1N3H A;  1WGH A;  4BKG A;  4NQK E;  4HAU B;  4W9G A;  5CTR C;  2KMC A;  1KOT A;  4DHZ E;  3IG3 A;  4WJO A;  3ZTD A;  2JZ3 B;  1C3T A;  1E8X A;  2FJ9 A;  4K1R B;  1MPH A;  4A6F B;  2ZPY A;  1GGO A;  2J59 M;  2FCS A;  3T9L A;  2DA0 A;  4PYU A;  3VOQ A;  3GOE A;  1U27 A;  3ZNH B;  3WIM A;  5DH9 B;  2DAJ A;  1YJ1 A;  4WWP A;  2IZV B;  2DKQ A;  3PPA A;  2COC A;  5JZE B;  1P9D U;  4HAT B;  2NPT B;  2D3G A;  2OQB A;  2DHK A;  4F7Z A;  4IAP A;  1ZGU B;  2BWE S;  1TTN A;  2L8J A;  4G50 A;  5HKH A;  4BBK A;  1WYW B;  2JZZ A;  3L54 A;  1LQB A;  4B6W A;  3DDC B;  3OAW A;  2C5L C;  1GG3 A;  2ZZP B;  2MX2 A;  3N30 A;  1NDD A;  2L2I A;  1WXM A;  1RFA A;  4E74 A;  1WF9 A;  4IUM B;  3B0A A;  1ZKH A;  2W2W A;  2FCN A;  3D8E A;  2W9N A;  2WX0 A;  2DZI A;  2CAY A;  2HE7 A;  2L0F A;  4XX5 A;  4JKD A;  3H1U A;  4NPN A;  5DPS A;  1YD8 U;  3ZRF A;  4YON A;  3DXE A;  2YSZ A;  2CU1 A;  3QAQ A;  2YT1 A;  1IYF A;  1L2N A;  4B9K A;  3L08 A;  4EKU A;  1V5T A;  4XC2 A;  2KTR A;  4GB9 A;  3ZDT A;  1YQB A;  2YRY A;  2KWV B;  1R4N I;  3ZNZ B;  2FDQ A;  4GU2 A;  4HB3 B;  2DZJ A;  1WJN A;  4HAW B;  3ENB A;  5LXI B;  3QQ8 B;  2HD5 B;  3UIP B;  1LB1 A;  2LGX A;  1WZ0 A;  1JDE A;  3G9W A;  1BWN A;  2WYQ A;  1WX7 A;  3HQC A;  4PS3 A;  4E71 A;  2DYN A;  4L6E A;  4FBJ B;  4MJS B;  3L10 B;  2K8B A;  2NVU I;  3LJ3 A;  3D32 A;  3R7R A;  2KTF A;  4M0W B;  4JK7 A;  3UF8 A;  3X23 A;  1OQY A;  1XD4 A;  2JXX A;  2BWF A;  1WGG A;  4A6F A;  4MSM B;  4Y94 A;  5KHO A;  1E8Y A;  2EKE C;  3A9K B;  3UGB B;  4PNK A;  4DXA B;  2LGY A;  2RQ1 A;  2BF8 B;  2CRF A;  2KQS A;  1ACA A;  1WMH B;  4M8M A;  3PRM B;  1UNQ A;  2D10 A;  1WE6 A;  4BOS C;  4BVU C;  2N23 A;  4GGQ A;  3LJU X;  4IC7 B;  1X86 A;  1UEL A;  4M8N A;  4TKN A;  3DQV A;  3DVG X;  4KV2 A;  1HB6 A;  3JW0 X;  1X1M A;  3R66 C;  4DDI D;  4W9K A;  2D9Y A;  3ENE A;  3QAR A;  4IWO A;  1E7V A;  5HE3 A;  2NPT A;  1WJ4 A;  1P1A A;  4FA6 A;  3HK0 A;  2ZJD A;  2FCM A;  2P0H A;  2BCJ A;  4MDK E;  1FAO A;  1WR6 E;  1WR1 A;  4AJW A;  2V1Y A;  4NNJ B;  5IJM A;  2BPS A;  1V5U A;  1X1F A;  3ZW3 A;  4G3X B;  3PHW B;  4EZJ A;  1ZM0 A;  1XOD A;  1Y5O A;  1Y19 B;  4GDL B;  3TMP B;  2Z59 B;  4HK2 A;  2NBU A;  3E9P A;  3PSC A;  2KC1 A;  2IO1 B;  4A6H A;  2YLM A;  1RAX A;  3VTW A;  2CY4 A;  3DCG A;  2RGN B;  3QA8 A;  2VSZ A;  4BOZ B;  1FXT B;  5TR5 A;  4JKA A;  3DVN V;  2EC1 A;  3TCA A;  1TQZ A;  1HBK A;  1DRO A;  1Z5S B;  5JHH A;  4HB0 B;  3QX1 A;  4GMV A;  4CO7 A;  4MJS A;  2DN6 A;  3VH3 B;  4FN2 A;  3IFW B;  2COA A;  5D3Y A;  3ZVV A;  2YF0 A;  2G4S A;  1AAR A;  1U5G A;  2JPH A;  5J3T A;  2N7E A;  1UPR A;  2LI5 A;  3O65 B;  3A9K A;  3F0W A;  5KQ1 A;  4LCD E;  2ROV A;  2DHZ A;  2CY5 A;  1WMH A;  2NBW B;  1BTK A;  2BKF A;  3PSE B;  2MLB A;  3EFU A;  1U5F A;  2LYD A;  2W2X C;  3OJ4 B;  2AEH A;  1I7A A;  1BTN A;  4ANV A;  2QKL A;  3RZW C;  2IBI B;  1QQG A;  5C79 A;  2RUK B;  2L00 B;  1V61 A;  1V88 A;  3M95 A;  3TIX A;  3F5R A;  3PLV A;  1ZSQ A;  3L13 A;  3GYP A;  2M14 A;  4DBB A;  2AYO B;  4NSW A;  1M7R A;  3A4S C;  1U2B A;  5G2N A;  2DIK A;  3AU4 A;  4MY6 A;  1XQQ A;  1FGY A;  4B6H A;  3L16 A;  1Q1O A;  4ANX A;  5JH5 C;  1C1Y B;  5GOW B;  1W1H A;  2WH5 A;  1FHO A;  2KN5 A;  2A5U A;  4F7G A;  5DPT A;  4G11 A;  2GBK A;  1MAI A;  2JUO A;  2GMI C;  1RRB A;  1KZG A;  5DHA B;  2VRR B;  4GDL A;  1V6E A;  1MIZ B;  3FM8 C;  1MK9 B;  1E7U A;  1UBI A;  2K2U A;  4K2O A;  2DYO A;  4LJO B;  4A5K A;  1FHX A;  2LVO A;  3PT2 B;  1TBE A;  4IM0 A;  1EF1 A;  1YIW A;  2LRU A;  2COD A;  3ECI A;  3ZUN A;  3OLM D;  2FAZ A;  3AXC A;  1RJ2 A;  1WM2 A;  2DZK A;  4MGI E;  1QC6 A;  5D3V A;  2ELA A;  1UNR A;  4FLH A;  4X57 B;  1DDW A;  4K17 A;  5CLQ B;  3ZLZ A;  5HE1 A;  4DX9 0;  1J8C A;  5EFX A;  2KDF B;  4ILJ A;  3IVF A;  2PZ1 A;  2OTX A;  2E2X A;  1WXV A;  4HXD A;  2IYB A;  2Y8G A;  1V9J A;  3MHS D;  3SNH A;  4KZ0 A;  4FUL A;  4IW0 A;  2DTC A;  2GBJ A;  4ICV A;  1V81 A;  2C7N B;  3WAN A;  3E9O A;  1PMS A;  2D9Z A;  1W1G A;  2LG1 A;  4HCN B;  1Q0W B;  2I1K A;  2G3Q B;  3FP5 A;  2LBB A;  1WG7 A;  2KD0 A;  2HRJ A;  1Y8R C;  3VH4 B;  2LJ5 A;  1E8Z A;  3ULB A;  3CXB B;  2ABD A;  3NHE B;  3T8M A;  2Z0O A;  4OVU A;  3X0W A;  4HPL B;  5D7G A;  3IHP C;  1P98 A;  3RZF A;  2JT4 B;  2B3A A;  1Z87 A;  2ZNV C;  3CSF A;  1S3S G;  1KC7 A;  3PG7 A;  4LDT D;  5CHV C;  3ZO5 B;  5JHB A;  2L76 A;  3HW2 B;  3QWZ B;  3LDZ E;  5LON B;  4RM9 A;  3PP2 A;  4BBN F;  3MTN B;  4YL8 A;  3ODO A;  4HCP B;  2H7E A;  3OAN A;  1WGQ A;  4MT7 A;  3SBG A;  1OGW A;  5J17 A;  4F8C B;  1EO6 A;  2RSU A;  2JF5 A;  5JVL A;  4A3P A;  1VD2 A;  5BO4 B;  2YS1 A;  5KCV A;  1YX5 B;  3CMM B;  2N9X A;  1DDM A;  4BBN C;  4JKC A;  1H8C A;  2CHW A;  1F9J A;  2DAF A;  1XCG A;  4BKS A;  1Q5W B;  4WJQ A;  1WJU A;  3VDZ A;  2K2J A;  3GZN I;  2CQU A;  5C16 A;  3MJW A;  3K9O B;  4IG7 B;  2BYE A;  2DFK A;  1DIK A;  2BYF A;  2M0X A;  2MBB B;  2N1W A;  2JRI B;  1XD3 B;  3CF6 E;  1WXS A;  3K9P B;  2Y7B A;  2KZR A;  4II3 B;  4Z2N A;  5CHW A;  2DYM A;  4WSF A;  2J0M A;  3E66 A;  2IO2 B;  5G55 A;  2O6V A;  1CMX B;  3KUZ A;  2LGD A;  5J3Y A;  1A5R A;  2GBN A;  3V6C B;  2I5F A;  3DXC A;  3VHT C;  2NR2 A;  2K1F A;  3RD2 A;  1U29 A;  4ANU A;  3PS6 A;  1UEF A;  3IBE A;  4JKE A;  1KI1 B;  2NZ8 B;  2UZR A;  3PLU A;  2UVM A;  4K81 A;  4OVV A;  1JRU A;  3JYU A;  2ZCB A;  4FJZ A;  5E6N A;  2GCJ A;  3U7D A;  3QJZ A;  4ZYN A;  1WX8 A;  3RUL A;  2Z0P A;  3PV1 A;  4D0N B;  3H9D A;  1UD7 A;  2DKP A;  2KO3 A;  2BYV E;  2IYD B;  3ONS A;  2JVC A;  2JY6 A;  3QIJ A;  1NTY A;  5AZG A;  2N9E B;  1V2Y A;  2ADZ A;  4JKF A;  3NS8 A;  4JK8 A;  1V5O A;  3EHV A;  1SIF A;  4BKS D;  1ZC4 B;  2MKR A;  3D8D A;  3KUD B;  4AWJ A;  2RD0 A;  2KDI A;  3ODW A;  3RYT A;  4MSQ B;  1BAK A;  2K00 A;  2MRP A;  2I1J A;  4WWO A;  4W9I A;  2KJH B;  4DWF A;  4HDO A;  4HVB A;  1ISN A;  2PE9 A;  2D9X A;  2MWS B;  3H7S A;  2FCQ A;  1E90 A;  2J7Q B;  1E8W A;  3PRE A;  2X0S A;  2KGX B;  5JLJ B;  2CHX A;  3FSS A;  2MSE D;  4FHK A;  3EEC A;  4NY0 A;  2DHI A;  2O6V D;  3PEG A;  3A1Q B;  3DBL I;  5AEK B;  3N32 A;  2V4L A;  5LLI A;  4WQO B;  1EAZ A;  2MBH A;  1X05 A;  3UIN B;  2DZM A;  2WWZ A;  3APD A;  1WFY A;  2D9V A;  2R2Q A;  2LUL A;  2FUH B;  1L7Y A;  2LVP A;  3EC8 A;  1MK7 B;  5C1Z A;  3Q3J A;  2UWQ A;  3SV1 A;  2L0T A;  2LZ6 A;  3TJP A;  2QHO A;  3H7P B;  1ZC3 B;  3VQI A;  5D27 A;  4ILG B;  2GJY A;  1WIA A;  3B1L X;  1E5W A;  3WA0 A;  1V5P A;  4XWX A;  3ULC A;  2RPQ A;  3WAM A;  2EMT A;  4ILH A;  5LOP B;  3W1S C;  5E6P A;  2G45 B;  4BKT A;  4GZU A;  4AJY B;  2YS5 A;  3KRX A;  3DBS A;  4TQ0 A;  4HAY B;  1WGY A;  2QKM A;  5E6O A;  3RCZ A;  2NCN A;  4IM3 A;  2KX3 A;  2LXA A;  2ASQ A;  1WM3 A;  4I6L B;  3NSU A;  4RM8 A;  1KZ7 A;  4IM2 A;  3ZKJ C;  2JRH A;  1IP9 A;  1U5E A;  4HDQ A;  4HAX B;  3TO1 A;  3B08 A;  4KAX B;  2AL3 A;  4W9E A;  3DVG Y;  5D94 A;  3RT3 B;  4WAA A;  3H6N A;  1I2H A;  4A6K A;  5KHQ A;  2KK8 A;  3MPX A;  3V60 A;  3M3J A;  3TBL D;  2REX A;  2Q13 A;  4DHJ B;  2KLC A;  1OEY J;  4WJN A;  3ML4 A;  2D07 B;  5DCN A;  2C9W B;  3L17 A;  1XX0 A;  2CR5 A;  4W9D A;  4J6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...