4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-17
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/cell adhesion
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
4A3OA 1Q0WB 2D9VA 4NY0A 2IO2B 4F7HA 1P98A 4P7IA 2C9WB 2MDXA 4TQ0A 1V6EA 2N7EA 1P1AA 2R0DA 4YL8A 4EZLA 1FHOA 1NTVA 2MFQA 4MEMA 1PFJA 2W2XD 4TQ1A 2KVRA 4NAWB 3H7SA 2BYFA 1GJZA 3ONSA 2R09A 4DHZE 2RPQA 1YX5B 3D8EA 1XR0B 2KWCA 2G45B 3ODXA 3ALBA 4MELA 4WWNA 2EMSA 3GYOA 2L00B 4B6HA 4WJOA 2LUEA 1UD7A 4LCDE 4WWOA 3CSTA 1WGRA 3KY9A 3DVNV 3B08A 5JLJB 2HTHB 3SV1A 2GOWA 1FB8A 2KD0A 3ZRFA 4AWJA 3P2BA 2JT4B 2IYBA 2COAA 3VXWA 2MBBB 1WXSA 2M4NA 4F7GA 4TYZA 4LDTB 3M62B 2KDEB 2BWFA 1U2BA 2DX1A 5JHAA 3AU5A 4TKNA 4PYZA 3DXEA 2KC1A 2N1VA 1E5WA 2CHWA 3TIXA 2NBUA 4IWQA 3QHTA 1WI0A 2KDIA 2N23A 2K6QA 2R2QA 2KJ6A 4F1SA 4KSKC 3PRZA 3OAWA 5C23A 1WFYA 5LXIB 1EF1A 1UBIA 3WIMA 3PEGA 4DBBA 2C7NB 3ZNGC 3M3JA 3KUZA 4KAXB 1UPQA 1S3SG 2O6VA 4BBKA 2X18A 4WVFB 2NR2A 2A4ZA 5E6NA 2DX5B 3SDLC 4HB4B 2KLGA 2YF0A 4IW0A 5CLQB 3U7DA 2K39A 4NSWA 4RM9A 2DYMA 4ANWA 2YSZA 1WZ3A 3PHWB 2C7MB 5LOPB 2LWPA 2UZSA 2HE7A 1R4MI 2VKIA 5GMVA 4ZYNA 3EECA 2L1CA 2KK8A 2FNJB 3ZNID 1WJNA 1V5PA 2LOXA 1K5GB 5JHBA 3X23A 1DYNA 2H7EA 2LOZA 2KX3A 2LGXA 2V3SA 3T8MA 2ZCCA 4KIKA 4C0AA 2MW5A 1WRDB 4WQOB 4FJYA 1AQCA 1ZVRA 1AWEA 2KLCA 2L76A 1UPRA 2PE6B 3KRWA 5HE1A 3PSEB 1WX7A 1GNUA 3A9JB 2OTXA 4L6EA 4KHBB 2KJHB 3PVLA 3S2AA 2LVOA 4DK5A 2KX0A 4X57B 3NZUA 1KLVA 1XODA 1Z2MA 1BTKA 3WAMA 2ZCBA 2KO3A 1WXAA 1E8WA 4WWPA 3HW2B 5HE0A 1BT0A 4DDID 3BINA 2MRPA 3MDBC 1BWNA 3TO1A 4NPNA 2C5LC 2L0FA 3QWZB 4BBNF 2BYVE 3OLMD 2I5CA 3T06A 2C60A 1EVHA 2RNRB 5D3VA 3VQIA 1RAXA 3WA0A 3RULA 1LM8B 4GPTB 4LJPB 3UIOB 2LI5A 4DWFA 3DPDA 1XT9B 2YS5A 4NAWA 4DBGA 1EO6A 1UEFA 1P6SA 4PYUA 2JRHA 2HD5B 2PE9A 2K2UA 1UNQA 2D9ZA 2LYDA 4ZRJA 1M94A 3VFKA 2FCMA 1WXVA 1I42A 3CF6E 2P0HA 2DZKA 4BBNC 1NTYA 1ZW7A 5CLLB 3TMPB 4PQ0A 2B3AA 2Y5BB 2D11A 5JP4A 4M0WB 1WJUA 1GG3A 2C7HA 3BJIA 4GMVA 3BY4B 3FEHA 2KWVB 3DVGY 3R3MA 1WY8A 2JF5A 4A20A 1WIAA 2GBRA 3V6EB 4BOZB 4F7ZA 2WYQA 2KFKA 1MG8A 3ZLZA 2N9XA 3DDCB 1XD4A 3FM8C 2AYOB 2MP2A 3WAOA 3HHMA 2M0XA 2QHOA 1J0WA 2MWSB 1DBHA 3DBHI 3NOBA 1WG7A 2IO0B 4HXDA 4WJQA 1L7YA 1WJ4A 4MDKE 2L0TA 3F5RA 3NZSA 4FBJB 3TW1A 1XCGA 3OJ3A 2RLOA 4KV2A 3UF8A 1E7VA 3UZTA 3PLVA 4FULA 2Z0QA 1FAOA 1WX8A 2DYQA 2JRIB 3KYCD 3KRXA 1WJ6A 4GU2A 1U5GA 3KUDB 1E8ZA 2DKPA 2DX5A 3ZNHB 2ZNVC 1D3ZA 4J6IA 2Z0EB 3ZKJC 1MKEA 2Z0OA 2O6VB 3PT2B 2FUHB 2M38A 4GSWA 4MY6A 2WX0A 4JL9A 4HK2A 1W1GA 2KUPA 1WI1A 2HJ8A 4F8CB 3C0RB 2YT1A 2ROZB 2J59M 1RLFA 2BF8B 3DVNU 1UNRA 1OEYA 4I6LB 2N7DA 3QBVB 4ZDVA 1WJ1A 3PRMB 2ZNVB 3NHEB 3A8PA 2K8CA 5G55A 2KDFB 2MWNB 4CYEA 2KFJA 1N3HA 3PRPB 2N0YA 4KZ0A 2Y7BA 3R7RA 1OQNA 5DPWA 3SNHA 1NBFC 4KIKB 2DENB 3ULBA 3ENEA 4NJ6A 2KGXB 2LD9A 2M1MA 3EHVA 3QIJA 3MTNB 2P8VA 4PS7A 2GCLA 5DPRA 4GZUA 3O96A 5C5BA 2KC2A 2LZ6A 1WMHB 3UQBA 5J2RA 3WYFB 2NVUI 1ZKHA 1LW3A 1H10A 1X1GA 4W9DA 3RT3B 3DQVA 4DHZB 4EKUA 3DBSA 3L16A 2VRWB 4IM3A 3KW5B 2GBKA 2W2XC 1I35A 1FHXA 3D8FA 2RVBB 3QWMA 4Z2MB 5E6PA 2K6DB 4E74A 3LJUX 1OY2A 4WJNA 5J3YA 3PTFC 2Z59B 4IWPA 2DA0A 4IC7B 1V5UA 4BKSD 2COCA 4MM3A 1I7AA 3IVFA 2KTRB 3T9LA 5HE3A 3QAQA 3NSUA 1BAKA 4A6HA 4HDQA 2DHIA 1XX0A 3VH3B 1E7UA 1WM2A 1MIXA 1LXDA 1X86A 1A5RA 2OQBA 4KHAA 3VVWB 3VUYA 5CX3A 2KN5A 3APDA 2MBHA 2KKCA 2I5FA 2VSZA 4K81A 3R7QA 4HVBA 4EMOA 3GZNI 1MK7B 4HAZB 1Q67A 5D3YA 3ZRCA 5HE2A 2OJRA 4IOYX 2IFSA 2KCJA 1DROA 2N9EB 2KFKB 1MPHA 1RFAA 1NI2A 1V5MA 2LVPA 2MP2B 2PJHA 4URKA 5IA7A 2MA9B 4ANVA 5DPTA 1GC7A 1KZGA 4DX8A 3JVZX 1OQYA 3WAPA 4CO7A 1X1FA 3SYXA 2LJ5A 4ANXA 4JGHB 2V76A 4HWIB 3PVWA 1RRBA 1KM7A 1WGUA 4AP4C 5LLIA 3RUIB 4BVUC 3KYDD 2CODA 2ZPYA 1P9DU 2XBBC 4GGQA 1WYWB 2G3QB 2IBIB 3UQAA 2JPHA 3VH4B 1PQSA 1UZXB 2D9WA 2CHZA 2KHWB 2FIDA 2M8SA 2CRFA 2KZRA 4XX5A 4JIOU 2IY1B 1FGYA 2Z0PA 4HCPB 2CKHB 2PZ1A 2WDTB 4AOFA 1QC6A 1V88A 1Y19B 3RCPA 3PS6A 1V89A 5DI9B 2XQNM 4PNKA 1E8XA 1UH6A 4JLCA 3ZDMC 2LASA 1M7EA 4NQLB 4TUUA 2KMAA 3SHQA 1LFDA 3U8ZA 1ISNA 2L7RA 2IO3B 3N32A 1EF5A 2D4QA 4PS3A 5CHVC 2YVCA 4K7WA 1WH3A 3W1SA 3KUCB 3D8DA 3M95A 4G11A 5D27A 3ML9A 2D9XA 4ZRIA 1WGQA 3MHSD 4GDKA 1Y5OA 1TGZB 4HJKA 4MGZE 3QC8B 3AXCA 3SU8X 2MKRA 1LQBA 2KANA 1WX9A 2JP2A 4AJYB 2D9YA 3LDZE 3ZUNA 4HAWB 2JVCA 1R4NI 3DXCA 1U29A 4IFSA 1WMHA 4XC2A 5C5BB 1WE6A 5CTRC 1M7RA 3L54A 5DIFB 2FIFA 5KHQA 2ZZPB 2N1WA 2W2WA 3ZW3A 2MX2A 3GOEA 2ZPNA 2QKMA 2GS0A 2KQSA 4A3PA 3IHPC 1YQBA 2L8JA 1P0RA 1KI1B 4HDOA 5FI1A 2DAJA 3D32A 2DLWA 1V81A 4FJZA 2O2VA 1U4AA 4G0NB 4F7UP 4KSLC 2PPHA 3JSVB 3SUZA 2AEHA 3QARA 1MIZB 2KTRA 2KQ7A 3ZTCA 3LJ3A 1VCBA 4HCNB 2K8BA 4ZRKA 5GOWB 1IPGA 1WGYA 1SGHA 2QKLA 4XWXA 4WAAA 2MBOA 4B95A 2P0DA 2EKEC 1L2NA 4HHVA 2LKOA 2DYOA 3HQCA 2J0KA 2K2JA 1EUVB 1YD8U 4E71A 5D94A 3ZVVA 2RGNB 1SHCA 4BFRA 3DXDA 2WWZA 4MH0E 3VTUA 1S1QB 3QCAA 2KWUB 4HPLB 4GXBA 2KOXA 1V61A 1FGZA 5LXHA 4W9KA 2A5UA 2K8HA 3KSYA 5BO4B 2BGFA 3DCGA 3DOWA 3NY5A 1FOEA 2KDBA 5AZGA 2K25A 1P5TA 1OGWA 1WF9A 2MBEA 3SO6A 2UVMA 3B1LX 5D7GA 1CMXB 1XQQA 4II3B 2L3ZA 4EOYA 1DDWA 2BCJA 1E90A 2FCNA 4WJPA 3Q3JA 3CXBB 2L2IA 5LONB 1UNPA 1XD3B 4I6PA 3VIAA 3TBLD 2OOBB 2G4SA 1X05A 4WJ7A 1P3QU 4A6FA 2ASQA 1DDVA 1WGDA 2CS4A 2NBWB 2UZRA 2DKQA 4FHKA 2KNBA 4G3XB 2Z0DB 5DCNA 4DDGD 3W1SC 3H7PB 1B55A 2FJLA 2BWES 3PREA 3WANA 3A98B 4GOCA 2J0JA 3RYTA 2GJYA 3WALA 1Y8RC 4ASWC 4I6NB 4MGKE 1QZEA 1H4RA 4K17A 2MCNB 2G35A 2CU1A 1NU2A 3IBEA 4MK0A 1WGHA 3DBLI 5KHOA 3HIZA 4EJNA 5AZFA 4EEWA 3TVVA 3PG7A 3PV1A 3A9KB 2CR5A 3KH0A 3ZTDA 4IAPA 1V86A 1IYFA 1W1DA 4GDKB 5JH5C 4G50A 2V4LA 1U27A 4ANUA 1G6JA 1YJ1A 3MJWA 5JHGA 3M1IB 4DHJD 2GBMA 3HM6X 1AARA 2K1FA 2NPTB 3L10B 2IZVB 2RSUA 4CHMA 1J19A 4BOSC 2L05A 2JZZA 2DZMA 2RSGA 2J7QB 1U5FA 4HB3B 5KCVA 3RD2A 2LGDA 4N9F4 1WE7A 3VHTC 1J8CA 2AL6A 2COFA 4GMXB 3CIKA 1EGXA 4PS8A 2IY0B 3JSVA 1KZ7A 1IP9A 3QQ8B 1ZC4B 3JYUA 2O2VB 2GBJA 1WJMA 4MJSB 4MGIE 4MGYE 3H9DA 2LG1A 4OVUA 1MAIA 2N9PC 3PP2A 3H1UA 1H8CA 2VRRB 1WR1A 2DN6A 1V49A 1W1HA 2EJ8A 4GDLA 2RUKB 1U5DA 3ECIA 3JW0X 2REXA 3EFUA 3NS8A 5DH9B 4HAVB 3QK0A 5FR6A 2NMBA 2I1KA 1V5TA 2XK5A 3N30A 4W9CA 2JXXA 4NNJB 3V62A 2DHZA 1V5OA 2YS3A 3PVUA 5EDSA 1EAZA 1TJ6A 3A1QB 2LXCA 3PGEA 2YS1A 4FADA 4AJWA 3V6CB 3UGBB 3PSCA 1TBEA 2YRYA 4LDTD 3ZVRA 4OVVA 3HK0A 4IUMB 3OANA 5IAAC 4WSFA 3HM3A 2ADZA 4IM0A 5D3XA 2LXAA 2DFKA 4W9LA 2AL3A 2YT0A 4M8MA 2XEWA 4HB0B 3VAWA 2LRUA 2WX1A 4KVGB 1WZ0A 5TR5A 2FAZA 3A33B 3TJPA 3N7CA 4HAUB 1ZGUB 3W1YA 3H7PA 1RRPB 3B0AA 1UELA 4A6FB 1C3TA 4FHJA 1P3RA 4Y94A 5D6JB 4MT7A 2D07B 2IYDB 4HPMB 4K2OA 2Y8FA 2UWQA 1E8YA 3RZFA 1VD2A 4E3CA 5L83A 2D10A 3VUXA 2JWZA 2DHKA 2DTCA 2DAFA 3APCA 3SD5A 3KZ1A 4FA6A 1WR6E 1WM3A 4Z2NA 2ROVA 1OMWA 4DXAB 1Q1OA 3A9KA 3K9OB 2MBQA 1BTNA 3TL5A 1GUAB 1HE8A 4NQKE 3PLUA 1UGMA 2CY4A 3QX1A 2KXJA 2NCNA 4K1RB 3ML4A 4M8NA 1YIWA 1C1YB 1V80A 3ULCA 4W9EA 1SIFA 2E2XA 4KDIC 1SE9A 2AWTA 3M63B 5E6OA 1Q5WB 2NPTA 4H8SA 5DHAB 4BKGA 3N3KB 4EZJA 3O65B 5JHHA 3VTVA 5C6RA 3VOQA 4K7UA 3QA8A 4ICVA 2BKFA 1JRUA 4IG7B 4IWOA 3TFMA 3VUWA 2JUOA 3L08A 1V9JA 2I1JA 1TQZA 1J0GA 5JZEB 3AU4A 4MSMB 3VDZA 2LGYA 3ODOA 1FHWA 3UIPB 5CHWA 3IFWB 5L95C 4GIVA 5D2MB 2DZJA 2ZVOA 3V5WA 2ZVNA 5C79A 2M17A 4MJSA 2RGFA 1Z87A 2R2OA 1WVHA 2P0FA 4NJ7A 3APFA 3EC8A 2GBNA 4MSQB 3PZDA 4BKSA 3I3TB 3L0WB 3AJ4A 2DHJA 2ZEQA 3OJ4B 3PHXB 3ZO5B 1ZM0A 5CHFA 2ELAA 3MPXA 4GB9A 4GDLB 3TCAA 2KJRA 4B6WA 1U5EA 2DZIA 5KQ4A 2K00A 2M14A 2W9NA 1ZC3B 2BPSA 1F9JA 4CHKA 2NBVB 2XK5B 4KZCA 1TXDA 1PMSA 3GYPA 1Z5SB 4HLEA 3A1QA 2CAYA 1X1MA 2BKRB 4EUTA 3U30A 2GCJA 2H7DA 5C1ZA 2LULA 5AZHA 4HATB 1WGGA 2MLBA 1PLSA 3L13A 3AULA 2MQJA 4HAYB 1OEYJ 2HTHA 3G9WA 2IO1B 4K7SA 3CSFA 3AI5A 3L17A 4RM8A 2JZ3B 4W9IA 4KDLB 2DYBA 2FCSA 2PEAA 4K2PA 5J17A 1K5DB 3ZDTA 4A6KA 2Q13A 4W9GA 3VTWA 2N4FA 2EC1A 4FN2A 5J18A 2LRWA 2JY6A 4II2B 5DHFB 2D3GA 4IM2A 5G2NA 2CHXA 2KMCA 2BYEA 3V61A 4ICUA 2ZJDA 2LVQA 3RZWC 1T0YA 4W9HA 2FCQA 2O6VD 5AEKB 4LJOB 5C16A 4TV3A 3KVFB 4FJVB 1GC6A 1K8RB 4GN1A 4AUQC 3ODWA 3Q3FA 1FXTB 3IG3A 1WXMA 4YONA 2GMIC 3R66C 4KHOA 1NDDA 1IRSA 1UBQA 3QJZA 1X11A 2J0MA 4W9FA 2CY5A 4D0NB 2D2QA 5DPSA 5J3QA 3DBRI 1TZ1A 4B9KA 4HAXB 3H6NA 3V60A 4RMAA 1KJTA 4FLHA 3ML8A 2DYNA 3A4SC 1QQGA 1OTRB 4JQWC 2ELBA 5L81A 3DVGX 3FSSA 2MSED 4HB2B 3A9JA 4DHJB 3A8QA 4W9JA 4CHJA 1KOTA 5FI0A 5EFXA 4A5KA 1I2HA 2UYZB 1RJ2A 3P6AA 2NS5A 2EMTA 2NZ8B 3P7ZA 2KTFA 2RD0A 3UINB 1LB1A 4EZKA 5KQ1A 1V2YA 1YX6B 4XZ4A 3ZIMA 4EFOA 1XKEA 4DX90 2V1YA 5HKHA 4BKTA 3CMMB 2YLMA 1ZSQA 5J3TA 1MK9B 1DDMA 2G4DB 3PPAA 3K9PB 3ZNZB 5D3WA 3RCZA 1TTNA 2RR9A 2Y8GA 3F0WA 3A4RA 3X0WA
chains in the Genus database with same CATH superfamily
4A3OA 1FCLA 1Q0WB 4NY0A 2D9VA 2IO2B 4F7HA 1P98A 4P7IA 2GI9A 2CQUA 1FD6A 5D3DA 2C9WB 1XEEA 1SIJA 2MDXA 4LTUA 4TQ0A 1JDEA 1HA5A 1V6EA 1FCCC 2N7EA 1P1AA 4S17A 1KC7A 2R0DA 4JKCA 4YL8A 3RNEC 4EZLA 3W5UB 4ILJA 3ZJTA 1FHOA 1NTVA 2MFQA 4MEMA 2WXMA 1OQRA 3ZJVA 1PFJA 2ON8A 2W2XD 4TQ1A 1KFYB 2KVRA 4NAWB 2RQ1A 4LNNA 3PZ8A 2Z13A 2FDQA 3EFCA 2NTTA 3H7SA 4GOUA 2NBVA 2BYFA 4M00A 1HB6A 3P4QB 1GJZA 3ONSA 2R09A 4WQMA 3GE8C 4DHZE 3RMKC 2RPQA 1V1PB 1YX5B 3D8EA 2UU7A 4ZHOA 1XR0B 1PGXA 2KWCA 2G45B 3ODXA 4OZAA 4M0WA 3ALBA 4MELA 1HBKA 1FPYA 4WWNA 1L4ZB 2EMSA 1T0QC 3GYOA 3IT4B 2L00B 3Q14C 1GB1A 2YEPF 4B6HA 1YJJA 4WJOA 2LUEA 4WAFA 1ACCA 1UD7A 4LCDE 4WWOA 3CSTA 1UWMA 3BYTB 1MFWA 1WYGA 1WGRA 4B0MA 1EWYC 3KY9A 3I57A 3DVNV 3B08A 4XWTA 5JLJB 2HTHB 3SV1A 2GOWA 2K5PA 1FB8A 2KD0A 2BQQA 3ZRFA 4AWJA 3NW8A 3P2BA 2JT4B 2IYBA 2COAA 4OVZA 2LMCA 4REZA 1N60A 1I4RA 2JQRB 3VXWA 2MBBB 1DGJA 1WXSA 2M4NA 4F7GA 4TYZA 4LDTB 4KGRA 1JRPA 3FLVA 2KDEB 2BWFA 1U2BA 3AV8A 3M62B 2DX1A 5JHAA 1JWBD 2CU3A 3AU5A 4HSIA 2ZW1A 4TKNA 5IO9A 1Y56A 1NI3A 3N1XC 4PYZA 3DXEA 2KC1A 1L5PA 1SBBB 4RH6A 2N1VA 2SEBD 2IJ0A 1E5WA 3NZ3A 2CHWA 2IDYA 4KKIA 2NBUA 4IWQA 3TIXA 1MVKA 3QHTA 1WI0A 2KDIA 2WLBA 3PO0A 2N23A 2K6QA 3WCQA 2R2QA 2KJ6A 2COPA 3FP5A 4F1SA 4KSKC 4YSYB 3PRZA 3SR6A 3OAWA 3FC4A 1YQ4B 1WFYA 3B2GA 3B9JA 5C23A 4C4VA 3FVCA 5JXVA 5LXIB 3N20C 3NJTA 1EF1A 1UBIA 2WXRA 3WIMA 3PEGA 4DBBA 2C7NB 1ZPSA 3ZNGC 3M3JA 3KUZA 4KAXB 1YNTE 1UPQA 1S3SG 2O6VA 3AH7A 4BBKA 5H92C 1EM7A 2X18A 4WVFB 2NR2A 2A4ZA 5E6NA 2MHJA 1TYGB 2DX5B 2TSSA 3SDLC 4HB4B 2KLGA 2YF0A 4IW0A 5CLQB 3U7DA 2K39A 4NSWA 4RM9A 2DYMA 3SBGA 3T3NA 4ANWA 3DHHC 2YSZA 1WZ3A 2CJNA 3PHWB 1TIFA 3ZXRA 2C7MB 5LOPB 3HVZA 2LWPA 2WXJA 1SB3C 2MEKA 2UZSA 2OJWA 1MG4A 1TY2A 2HE7A 1QOGA 1R4MI 2VKIA 5GMVA 4ZYNA 1CZPA 1YN4A 2J53A 3EECA 3RNCC 2PLPA 2L1CA 2KK8A 2FNJB 3ZNID 1WJNA 1V5PA 1K51A 2PVOD 3AEAB 3I5JC 2LOXA 1FFVA 1K5GB 4JX1C 1MPEA 5JHBA 4C00A 3X23A 5JVLA 1D5XC 1DYNA 2H7EA 2LOZA 1SXTA 1MI0A 2KX3A 2LGXA 2V3SA 2WXOA 2ZCCA 4KIKA 3T8MA 4C0AA 2MW5A 1WRDB 2HRJA 1XCQL 4WQOB 2FBWB 4FJYA 1AQCA 1ZVRA 2ZKMX 2JXTA 2LFIA 1AWEA 4OZBA 2KLCA 2L76A 2VH2A 1UPRA 2KIGA 1QOAA 2PE6B 3TEXA 3KRWA 5HE1A 3PSEB 1WX7A 1GNUA 3A9JB 2OTXA 2RDHA 4M01A 4L6EA 4KHBB 1XXGA 2KACA 2KJHB 1TT5B 3RNBC 3PVLA 3S2AA 3V05A 2LVOA 2KIEA 4JKAA 2BW2A 4DK5A 2G9HD 1KLUD 2KX0A 4X57B 3NZUA 1KLVA 2KDMA 3E9PA 1XODA 2W55A 1Z2MA 1BTKA 3CWIA 1WWTA 3WAMA 2ZCBA 1TS2A 2KO3A 1ESFA 1WXAA 1E8WA 4RGMA 2KMMA 4WWPA 3HW2B 1IBXB 4N59A 4D2KA 5EE1A 5HE0A 1BT0A 2PIAA 1N5XA 3AE7B 4DDID 3BINA 2MRPA 3MDBC 2JX5A 1BWNA 3GB1A 3TO1A 4NPNA 2C5LC 2JYEA 2L0FA 3QWZB 4BBNF 2BYVE 3OLMD 1TY0A 2I5CA 3ETRA 3T06A 2C60A 1EVHA 3H8HA 2RNRB 5D3VA 5GXGB 4RF1A 2Z59A 3VQIA 1K50A 1RAXA 2WU2B 3WA0A 3RULA 1LM8B 4GPTB 4ZYSA 1T3QA 4LJPB 1QQRA 2PKOA 3UIOB 2LI5A 4DWFA 3DPDA 1XT9B 4TSSA 1C4PA 2YS5A 4NAWA 4YWGG 4YSZB 4DBGA 1EO6A 1UEFA 3UI3A 1P6SA 3PZ7A 2JRHA 4QJ4B 4PYUA 3J9CA 2HD5B 3SFDB 2PE9A 1L0VB 2K2UA 1UNQA 2D9ZA 2LYDA 4ZRJA 1M94A 3VFKA 2FCMA 1WXVA 1VZ8A 1I42A 3CF6E 1CQVA 2P0HA 2DZKA 4BBNC 2KAJA 1NTYA 1FNWA 1ZW7A 4JKGB 4M02A 4CQNA 1WGKA 4HKZE 4N58A 2ZW0A 5CLLB 3TMPB 4PQ0A 2B3AA 3LYYA 1XLNA 2Y5BB 2D11A 5JP4A 4M0WB 1WJUA 1GG3A 2C7HA 2PTLA 3BJIA 4GMVA 3BWUD 2N7JA 3BY4B 4NAMA 2R2YA 3FEHA 2KWVB 3DVGY 3R3MA 1WY8A 2JF5A 4A20A 3DBHB 1WIAA 2GBRA 3V6EB 4BOZB 4F7ZA 1L4DB 2WYQA 2KFKA 1MG8A 3OWEB 3ZLZA 2N9XA 1QKZA 3DDCB 2V3NA 1XD4A 3FM8C 2D3AA 2AYOB 2MP2A 3WAOA 1YOVB 3A58A 2M0XA 3HHMA 2QHOA 3Q8EA 1J0WA 2FJ9A 4A6QA 3DHGC 2MWSB 1DBHA 1JCKB 3DBHI 3NOBA 1WG7A 2IO0B 3Q3MC 3DWMA 4HXDA 4WJQA 3Q8AA 1L7YA 1WJ4A 2X8XX 4MDKE 2L0TA 4Q2JA 3F5RA 3NZSA 4FBJB 1TS4A 3TW1A 1XCGA 4S0RA 3OJ3A 2DNFA 2RLOA 1FO4A 4KV2A 3HIEA 3UF8A 2GUMA 1E7VA 3UZTA 3PLVA 4FULA 2Z0QA 1FAOA 1WX8A 2DYQA 2G1EA 2JRIB 1C79A 3KYCD 3KRXA 1WJ6A 1QT9A 1U5GA 4GU2A 4C4VB 3KUDB 4PK1A 1E8ZA 3KWLA 2DKPA 2DX5A 3ZNHB 2ZNVC 1D3ZA 4J6IA 2Z0EB 4XDDA 1GPXA 2K0PA 3ZKJC 1MKEA 1KH0A 2Z0OA 2O6VB 3PT2B 2FUHB 2M38A 4JKDA 4GSWA 3LB8C 4MY6A 1ZDVA 2WX0A 4JL9A 4HK2A 1W1GA 4OSNA 2KUPA 3MC0B 1P7EA 1WI1A 2HJ8A 4F8CB 3DBRB 3C0RB 2FUG1 2YT1A 3TSSA 2ROZB 2J59M 1RLFA 3R8BA 2BF8B 3DVNU 4LLGM 1ACAA 1UNRA 1FXIA 1OEYA 4JKFA 1JMLA 1C9FA 2KVZA 4I6LB 1V97A 2N7DA 3FKYA 5BYSA 3QBVB 4ZDVA 2J4XA 1FRDA 1WJ1A 3PRMB 2ZNVB 5EE9A 2YT2A 3NHEB 3AM9A 1SF0A 3A8PA 1L6VA 1T6BX 2K8CA 5G55A 2KDFB 2MWNB 4CYEA 2KFJA 1N3HA 3PRPB 2QDFA 2N0YA 4KZ0A 1E9MA 1UUPA 1WRIA 2Y7BA 2LUMA 5IRSA 3R7RA 1OQNA 5DPWA 2CB8A 5IOIA 3MP9A 3SNHA 1NBFC 4KIKB 2GRIA 2DENB 3ULBA 3ENEA 2WDRB 4NJ6A 2KGXB 2LD9A 2M1MA 3EHVA 2WXGA 3QIJA 4JK8A 4ILHA 4ZHPA 3AE2B 3MTNB 2P8VA 1LGRA 4RF0A 4PS7A 2GCLA 5DPRA 2LBBA 4GZUA 3O96A 2LHEA 5C5BA 2Q5WD 2KC2A 3NVWA 5LNK1 4XE0A 2IPKD 3P4PB 1QOBA 2LZ6A 1WMHB 3UQBA 5HG2A 5J2RA 2DWQA 4C80A 3WYFB 2N9KA 2NVUI 1ZKHA 2MH7A 3P63A 1LW3A 1ET6A 1H10A 1PGAA 2DLBA 2INCC 3Q8CA 4P1BC 1X1GA 1UNSA 4W9DA 5I2SA 3RT3B 3DQVA 5HHDG 1HZ5A 3IXSA 1FXAA 4DHZB 4EKUA 3DBSA 3L16A 2VRWB 4IM3A 2M19A 3KW5B 2GBKA 3FAHA 2W2XC 1JWMD 3VRBB 2Y5PA 1I35A 1FHXA 3D8FA 2GB1A 2RVBB 2INPE 3VRAB 1NTIA 3QWMA 3ZJUA 4Z2MB 2J42A 4HPPA 5E6PA 4QJ5B 2K6DB 4E74A 5FR3A 3LJUX 1SE4A 1OY2A 4WJNA 3DWGC 5J3YA 3PTFC 2Z59B 3SEBA 1HB8A 4IWPA 2DA0A 2AQ1B 4IC7B 1V5UA 4BKSD 2COCA 4MM3A 1I7AA 3IVFA 1N63A 2KTRB 4KX6B 3T9LA 5HE3A 3V3XA 4OT1A 3QAQA 2RMMA 3NSUA 1ZOYB 1F77A 4JWUC 5HI1A 1BAKA 1EWCA 3N1YC 1MHHE 4JE3B 4A6HA 4HDQA 4UDUC 4DIXA 4JKGA 2DHIA 1XX0A 3P1MA 2BS2B 1SJHD 3RNFC 3VH3B 1E7UA 1WM2A 1MIXA 1LXDA 1X86A 1A5RA 1DOYA 2OQBA 4KHAA 4RFBA 3VVWB 3VUYA 5CX3A 2KN5A 3APDA 2JWUA 2MBHA 4MH8A 1VDVA 3B77A 2KKCA 2I5FA 1VZ7A 3SFEB 1IUEA 2VSZA 4K81A 4P1CC 3R7QA 3EUB2 3GS2A 1C77A 4HVBA 4EMOA 3GZNI 1MK7B 4HAZB 1F0ZA 1Q67A 2BBCA 2BT6A 5D3YA 2DBYA 1L6UA 5HE2A 3ZRCA 2OJRA 4IOYX 2IFSA 2WXFA 2KCJA 1DROA 2N9EB 2KFKB 1HTQA 2ONQA 1ZYIA 1MPHA 1RFAA 3OG5A 3R2IA 1NI2A 2KR0A 5M4YB 1V5MA 2RDGA 2LVPA 2K9XA 2MP2B 2PJHA 4URKA 5IA7A 2MA9B 3E66A 2BS3B 4ANVA 1ZDXA 5DPTA 1GC7A 1KZGA 1UF0A 4DX8A 3JVZX 1OQYA 2LGIA 3WAPA 4CO7A 1X1FA 1IGCA 3SYXA 1NVID 2LJ5A 4ANXA 4JGHB 2V76A 3R2TA 4HWIB 4DQOC 4AQ7A 3U52E 3PVWA 1RRBA 1KM7A 1WGUA 4AP4C 1PDXA 4ZRQA 4ZOHC 5LLIA 3RUIB 4BVUC 2OHFA 3KYDD 2CODA 2ZPYA 1P9DU 2XBBC 4GGQA 1WYWB 4DXGA 2G3QB 2IBIB 3UQAA 2Y5CA 3RNGC 2JPHA 3P42A 3VH4B 1PQSA 1UZXB 2WXLA 2D9WA 2CHZA 2K49A 3HVDA 1A70A 2KHWB 2FIDA 2M8SA 1R4MB 2CRFA 1PYWD 2KZRA 4XX5A 3RNAC 4JIOU 2E6XA 2IY1B 1FGYA 3VR9B 2Z0PA 4HCPB 2CKHB 2PZ1A 2WDTB 4AOFA 1QC6A 1V88A 1XF5L 1Y19B 3RCPA 1QLBB 3PS6A 1V89A 5DI9B 2XQNM 4PNKA 1E8XA 1PFDA 1UH6A 2WNMA 4JLCA 2LASA 3ZDMC 1M7EA 1NENB 1VBHA 4NQLB 4QJ3B 2AQ3B 2WQYB 4TUUA 2KMAA 1ZXIA 3SHQA 1LFDA 3U8ZA 3CIRB 1ISNA 2L7RA 2IO3B 3N32A 1EF5A 4OW0A 1UGJA 2D4QA 4PS3A 5CHVC 1MI1A 2YVCA 4K7WA 1N62A 1WH3A 3W1SA 1I7HA 3D8DA 1UWXA 2XNAC 3KUCB 3M95A 5IN7A 1B9RA 4G11A 4L23A 3NVVA 5D27A 4O1NA 3ML9A 2D9XA 1XLQA 4ZRIA 1WGQA 1I4GA 2PVGC 3MHSD 4ARCA 4GDKA 1Y5OA 1TGZB 1N5WA 4C7YA 2KN4A 4HJKA 4MGZE 1JWSD 4MT5A 3QC8B 3AXCA 3AEFB 2FJUB 2WDVB 4IOIE 4WIPA 3SU8X 2MKRA 1LQBA 3C8YA 2KANA 1DOXA 1WX9A 2JP2A 4AJYB 1RWSA 2D9YA 3LDZE 1K53A 4K3CA 3ZUNA 2LGSA 4K3BA 1MHXA 4HAWB 4OZCA 2JVCA 1R4NI 3DXCA 1U29A 4IFSA 2N0SB 1WMHA 4XC2A 5C5BB 1WE6A 2H89B 3BVMA 4RGTA 5CTRC 1EU3A 1M7RA 3L54A 5DIFB 2QCZA 2FIFA 3I63C 5KHQA 2ZZPB 1VLBA 2KWDA 2N1WA 2W2WA 3ZW3A 4LNIA 2MX2A 4ILGB 3GOEA 4ITKA 2ZPNA 2QKMA 4L1BA 2GS0A 2KQSA 3AECB 3KLSX 1XLPA 4A3PA 3IHPC 1YQBA 2L8JA 2ABDA 2DIKA 1P0RA 3VR8B 4HDOA 1KI1B 3EA6A 1ST7A 5FI1A 2WHIA 2DAJA 4JKBA 3D32A 2DLWA 3FILA 4HJGE 1V81A 4FJZA 4LNFA 1TS3A 3Q6BA 2O2VA 1U4AA 3AE9B 1TKEA 4N6EB 4G0NB 2QC8A 3KQ4A 4F7UP 4KSLC 2RDBC 2PPHA 3JSVB 3SUZA 2AEHA 3DCXA 3QARA 1MIZB 2KTRA 2KQ7A 1XLOA 3BVGA 3ZTCA 3LJ3A 1VCBA 4HCNB 2K8BA 4ZRKA 5GOWB 1F1HA 3E56A 3O13A 1IPGA 1WGYA 3GE3C 3HRDD 4MM3B 1SGHA 2BYTA 3AE1B 5EE0A 1OQQA 2QKLA 4XWXA 4WAAA 2W3SA 2MBOA 4B95A 2P0DA 2EKEC 1L2NA 4HHVA 2LKOA 5IP4D 3MC9A 3ZGZA 4GNKB 2DYOA 3HQCA 2J0KA 2K2JA 1EUVB 1YD8U 5C3JB 4E71A 5D94A 3ZVVA 2RGNB 1SHCA 4BFRA 1BUIC 3DXDA 1B1ZA 2WWZA 4MH0E 3VTUA 1S1QB 3P4RB 1T0SC 3QCAA 1R7SA 2KWUB 4HPLB 4GXBA 2HTME 2KOXA 1V61A 1FGZA 3TEWA 5LXHA 4US8A 4W9KA 2A5UA 2K8HA 3KSYA 3AEDB 1AWDA 4AS1A 1GGOA 1XO3A 3AN1A 5BO4B 5H8YE 2BGFA 3DCGA 3DOWA 4KGTA 1FM0D 3Q3OC 3NY5A 1FOEA 2KDBA 2JZPA 1ENFA 5AZGA 2K25A 3N9YC 1P5TA 2L1AA 1OGWA 3NWFA 1WF9A 1XCTL 2MBEA 3L4PA 2EELA 3RPFC 3SO6A 2UVMA 3B1LX 5D7GA 1CMXB 1BXTA 1XQQA 2EKIA 4II3B 2L3ZA 4EOYA 1DDWA 2V4IB 3MFGA 2BCJA 1DYQA 1E90A 2FCNA 2HDEA 4WJPA 2KUQA 3Q3JA 3CXBB 4JKEA 2L2IA 5LONB 2QEJC 5HFYA 1UNPA 1DIKA 3AE5B 1XD3B 3AEBB 3NWAA 4I6PA 3VIAA 3TBLD 2OOBB 2G4SA 1X05A 4WJ7A 1P3QU 4A6FA 2ASQA 1JALA 3TUOA 1DDVA 1WGDA 4WURA 2CS4A 2NBWB 1AYFA 3NG0A 2UZRA 2DKQA 2ACZB 1J7AA 4FHKA 2KNBA 4G3XB 2Z0DB 5DCNA 4H2AA 3W1SC 4DDGD 3H7PB 1QOFA 1B55A 2FJLA 2M0AA 5AUIA 2BWES 3PREA 2WDQB 2MJDA 3WANA 2WH5A 3A98B 1CJEA 4GOCA 2J0JA 3IAS1 3RYTA 2GJYA 2X38A 3WALA 1Y8RC 4ASWC 4I6NB 4MGKE 1GOZA 1QZEA 3W5VB 3MJ5A 1H4RA 3DHIC 4RGOS 2WGSA 2QILA 1VJKA 4K17A 2MCNB 2MJEA 2X0SA 2G35A 2CU1A 1NU2A 4HKQA 3IBEA 4MK0A 3E9OA 1WGHA 1HZ6A 3NVZA 3DBLI 5KHOA 1WXQA 3HIZA 4IKGA 4EJNA 5AZFA 2KQ4X 4EEWA 3TVVA 5IKCM 3PG7A 3PV1A 3A9KB 2WP9B 2CR5A 3KH0A 3ZTDA 1TJEA 4IAPA 1V86A 1IYFA 1W1DA 2Z4DA 3BYYB 1GAQB 4GDKB 5JH5C 4G50A 2V4LA 1U27A 4ANUA 1G6JA 1E7PB 1YJ1A 1E10A 3MJWA 5JHGA 3M1IB 4DHJD 2GBMA 3HM6X 1AARA 1KF6B 2D3BA 2BTEA 2K1FA 3LXFA 2NPTB 5D3IB 4EE2A 4R3DA 3L10B 2IZVB 4TMAB 2RSUA 4CHMA 1J19A 4BOSC 2L05A 1OFFA 2JZZA 3NRZA 3Q8FA 1JROA 2DZMA 2RSGA 2J7QB 4B0EA 1C76A 1RYJA 2VZKD 1V8CA 2N9LA 2WXHA 1U5FA 4HB3B 5KCVA 3RD2A 2LGDA 4N9F4 1WE7A 4CSQA 3VHTC 1J8CA 2AL6A 1EU4A 2COFA 2WXKA 4GMXB 3CIKA 1EGXA 4PS8A 5G5HA 2IY0B 1QILA 4GLSC 3JSVA 1KZ7A 1MJDA 1IP9A 3FILB 3QQ8B 1ZC4B 3JYUA 5EE3A 2O2VB 4JWSC 2GBJA 1WJMA 4XYCA 4MJSB 4MGIE 4MGYE 2R82A 3H9DA 2LG1A 1ROEA 4OVUA 1MAIA 2N9PC 3PP2A 3H1UA 1H8CA 1BMLC 2WXPA 4YT0B 2VRRB 1WR1A 2DN6A 1V49A 3AE6B 1STEA 1W1HA 1FNVA 3BK1A 2EJ8A 4GDLA 2RUKB 5BYQA 1F2RI 2INDC 1I4QA 3SBTA 1U5DA 3ECIA 2PMVA 3GZNB 3JW0X 1J7CA 1JQ4A 2REXA 3EFUA 2W3RA 3NS8A 1N6ZA 5DH9B 4HAVB 2E3TA 3QK0A 5FR6A 2NMBA 2I1KA 2BB5A 3BVZA 3RI7C 1V5TA 2Z14A 2XK5A 3Q8BA 1I4PA 3N30A 1ZE3D 3RN9C 4W9CA 1AN8A 2QSDA 1RM6C 3AE4B 4YTNB 2JXXA 4JK9A 3MC8A 4NNJB 3V62A 2DHZA 4WWMA 2I2YA 1V5OA 4YTPB 2YS3A 2Y3AA 3PVUA 5EDSA 1EAZA 1TJ6A 3A1QB 4RCOA 2LXCA 3PGEA 3GP7A 2QMTA 2K3UA 4RNAA 2YS1A 4QXAB 1SE2A 4FADA 1HEZE 3NVYA 4AJWA 3E9LA 3V6CB 3UGBB 2XN9C 3PSCA 3AE3B 5TSSA 1ZXHA 3ZXVA 1NVLA 1TBEA 2YRYA 2MJ3A 4LDTD 3ZVRA 3W2DA 4OVVA 2IGGA 3HK0A 3U2SC 4IUMB 3OANA 5IAAC 4WSFA 3HM3A 3C19A 2JSVX 2KT7A 4YSXB 2ADZA 4IM0A 5D3XA 2LXAA 5FK9C 2DFKA 4W9LA 1VBGA 1V1OA 4HRSA 1TZOA 2AL3A 2R61A 2YT0A 2D5GA 4M8MA 2L32A 2XEWA 4HB0B 3VAWA 1TS5A 2LRUA 2WX1A 1KBLA 5BMGA 4KVGB 5T8IA 1WZ0A 5TR5A 3U4EG 2FAZA 3A33B 3TJPA 3N7CA 1YQ3B 4YXDB 2J52A 4HAUB 4C56C 1ZGUB 1YJIA 2LJIA 3W1YA 1D6EC 3H7PA 1HTOA 1RRPB 4QAYA 1T77A 1KLGD 1UELA 4A6FB 3B0AA 5BMHA 1C3TA 4FHJA 1P3RA 4Y94A 4JKHA 2NTSA 4LNKA 5D6JB 4MT7A 2D07B 2IYDB 4HPMB 4K2OA 2K8EA 2Y8FA 2UWQA 1E8YA 2K22A 1GB4A 3RZFA 1VD2A 3N1ZC 4E3CA 1E6EB 5L83A 1K52A 1L0YB 3BIID 4BAXA 2D10A 3VUXA 2YEPB 2JWZA 2DHKA 1P7FA 2DTCA 3IT6B 2DAFA 3APCA 3SD5A 3KZ1A 2W82A 4FA6A 1PGBA 1WR6E 1WM3A 4Z2NA 2QIEB 2ROVA 1OMWA 4DXAB 1Q1OA 3A9KA 4C7ZA 1TKYA 3K9OB 2BB6A 2MBQA 1SSNA 1BTNA 3TL5A 1GUAB 4XDCA 4KKJA 1HE8A 1D5ZC 4NQKE 3PLUA 1UGMA 2CY4A 3QX1A 2KXJA 2NCNA 4K1RB 4WH4A 3ML4A 2FE8A 1R4NB 4M8NA 2KYWA 4ARIA 1YIWA 1C1YB 1V80A 3ULCA 1C78A 4W9EA 1SIFA 2E2XA 4KDIC 1SE9A 2AWTA 3M63B 5E6OA 1Q5WB 3OHMB 2NPTA 4H8SA 5C2TB 5DHAB 4BKGA 3N3KB 1M4VA 2WXQA 4EZJA 1IGDA 3O65B 5JHHA 2I38A 3VTVA 1ET9A 2AX5A 5C6RA 3VOQA 4K7UA 3QA8A 1KRHA 1D5MC 4ICVA 1NYRA 2BKFA 1JRUA 2RRFA 4US9A 4IG7B 4IWOA 3TFMA 4KGSA 3VUWA 2JUOA 3BK2A 3L08A 1V9JA 4L1RA 3ENBA 2ICIA 3ZYYX 2I1JA 1TQZA 2BS4B 1J0GA 5JZEB 3EGRA 3AU4A 4MSMB 4HEA1 3VDZA 2LGYA 3ODOA 3HUIA 4JPSA 3I9V1 2QJLA 2CJOA 1FHWA 3UIPB 3NS1A 5CHWA 3IFWB 4USAA 5L95C 4GIVA 5D2MB 3Q3NC 2DZJA 2ZVOA 3V5WA 2ZVNA 1E0ZA 3T3OA 1YN5A 5C79A 1SEBD 1HXYD 2WS3B 2M17A 2GLSA 4MJSA 2RGFA 2WXIA 1Z87A 2R2OA 1WVHA 2P0FA 4NJ7A 3APFA 1KTKA 3EC8A 2GBNA 4P6VF 4MSQB 3U7ZA 3EPYA 3PZDA 4BKSA 1AW7A 2L83A 2IGHA 3I3TB 3L0WB 3AJ4A 2DHJA 4MACA 2V9HA 2VH1A 2ZEQA 3OJ4B 3PHXB 3IAM1 3ZO5B 1ZM0A 2B76B 1F52A 5CHFA 3NWDA 2ELAA 3MPXA 5BMIA 4GB9A 4GDLB 4A9AA 3TCAA 2KJRA 4B6WA 1NYQA 1U5EA 5FKAC 1YMHE 4D6WA 2DZIA 5KQ4A 2K00A 2M14A 2LHDA 4RGNA 2W9NA 1ZC3B 1V1PA 2BPSA 1F9JA 4J3OD 4A8XC 4CHKA 2WU5B 3TEYA 2NBVB 2XK5B 4KZCA 1TXDA 1PMSA 3GYPA 1Z5SB 3E9SA 3A1QA 4HLEA 1T0RC 2CAYA 1ZP0B 1X1MA 3B2FA 2BKRB 4EUTA 3U30A 2GCJA 2H7DA 1N61A 4A90A 5C1ZA 2INNE 1Q10A 2LULA 5AZHA 4HATB 1WGGA 2MLBA 1PLSA 3L13A 3AULA 1PUTA 2MQJA 4HAYB 1OEYJ 2HTHA 3G9WA 2IO1B 4IDIA 3AEEB 5IJMA 4LK0M 3AE8B 1L0XB 4K7SA 3CSFA 3AI5A 3P4SB 3L17A 4RM8A 2JZ3B 4W9IA 4KDLB 1WSPA 3AMZA 2DYBA 2FCSA 2PEAA 1FEHA 4K2PA 4NZLB 5J17A 1SE3A 4JK7A 1FIQA 3RFZB 1LO5D 3ZDTA 1K5DB 3KWVA 2IGDA 1RFKA 4A6KA 2Q13A 4W9GA 3VTWA 2N4FA 1CK1A 2EC1A 4FN2A 5J18A 2JU6X 2L52A 2LRWA 2JY6A 4II2B 5DHFB 2V3PA 2D3GA 4IM2A 2W54A 3TEZA 5G2NA 5G5GA 2WXNA 2M56B 4XWWA 2CHXA 2KMCA 2BYEA 2OEDA 1YN3A 3V61A 1VRAB 4ICUA 3AEGB 2ZJDA 2LVQA 4OHJA 1T0YA 3RZWC 4W9HA 1ZUD2 1DOIA 2FCQA 2O6VD 3Q2AC 5AEKB 4LJOB 5C16A 5I2MA 4TV3A 3BZDB 3Q69A 2NMQA 1I4HA 3KVFB 4XGAB 3ZQ4A 2HJ1A 4FJVB 1GC6A 1K8RB 3NUHB 4GN1A 1NEKB 4AUQC 3ODWA 3Q3FA 3DBLB 1FMAD 4LNOA 1FXTB 3IG3A 2BVCA 4BZAA 1WXMA 3MHZA 4YONA 2GMIC 3R66C 4KHOA 4DXFA 1J7BA 1SJED 1NDDA 1IRSA 1UBQA 2SAKA 5LG4B 4FXCA 3QJZA 1VR9A 1X11A 2J0MA 4W9FA 2CY5A 4D0NB 2D2QA 1JWAD 5DPSA 2Z8LA 5J3QA 3DBRI 4L2YA 1TZ1A 4B9KA 3URYA 4HAXB 1T5XD 2H88B 1C4AA 1C4CA 3H6NA 3V60A 1TKGA 4RMAA 1KJTA 1D4BA 1FFUA 4FLHA 3ML8A 2DYNA 4HROA 3A4SC 1QQGA 1OTRB 4JQWC 5MPOA 2ELBA 3W9CB 5L81A 2JYTA 4A55A 3DVGX 3FSSA 2MSED 2D3CA 4HB2B 4P16A 3A9JA 4DHJB 4KHBA 3ABVB 3A8QA 4W9JA 4CHJA 2AQ2B 1KOTA 5FI0A 1FRRA 1JWUD 5EFXA 4ACFA 3U12A 4A5KA 1I2HA 2UYZB 5BYRA 1RJ2A 3P6AA 2NS5A 1I4XA 2EMTA 1F2RC 1HQRD 2NZ8B 3P7ZA 2KTFA 2RD0A 3UINB 1LB1A 4EZKA 4ZRPA 5KQ1A 1VZ6A 1V2YA 1YX6B 5AUKA 4NJCA 4XZ4A 1QF6A 4YTMB 3ZIMA 5I4DA 4EFOA 2LEKA 1XKEA 4DX90 2V1YA 5E6JA 1FNUA 3HSAA 3AB5A 5HKHA 2VZKB 4BKTA 3CMMB 4PT5A 2YLMA 1ZSQA 5J3TA 1IBXA 1MK9B 1DDMA 2G4DB 3PPAA 3K9PB 3ZNZB 5D3WA 3RCZA 1TTNA 2RR9A 2V0GA 2Y8GA 3F0WA 2PW9A 3A4RA 1JW9D 2RPVA 3X0WA
chains in the Genus database with same CATH topology
4A3OA 1Q0WB 4NY0A 2D9VA 2IO2B 4F7HA 1P98A 4P7IA 2CQUA 2C9WB 2MDXA 4TQ0A 1JDEA 1V6EA 2N7EA 1P1AA 1KC7A 2R0DA 4JKCA 4YL8A 4EZLA 4ILJA 1FHOA 1NTVA 2MFQA 4MEMA 1PFJA 2W2XD 4TQ1A 2KVRA 4NAWB 2RQ1A 2FDQA 3H7SA 2BYFA 1HB6A 1GJZA 3ONSA 2R09A 4DHZE 2RPQA 1YX5B 3D8EA 1XR0B 2KWCA 2G45B 3ODXA 3ALBA 4MELA 1HBKA 4WWNA 2EMSA 3GYOA 2L00B 4B6HA 4WJOA 2LUEA 1UD7A 4LCDE 4WWOA 3CSTA 1WGRA 3KY9A 3DVNV 3B08A 5JLJB 2HTHB 3SV1A 2GOWA 1FB8A 2KD0A 3ZRFA 4AWJA 3P2BA 2JT4B 2IYBA 2COAA 3VXWA 2MBBB 1WXSA 2M4NA 4F7GA 4TYZA 4LDTB 3FLVA 2KDEB 2BWFA 1U2BA 3M62B 2DX1A 5JHAA 3AU5A 4TKNA 4PYZA 3DXEA 2KC1A 2N1VA 1E5WA 2CHWA 3TIXA 2NBUA 4IWQA 3QHTA 1WI0A 2KDIA 2N23A 2K6QA 2R2QA 2KJ6A 2COPA 3FP5A 4F1SA 4KSKC 3PRZA 3OAWA 5C23A 1WFYA 5LXIB 1EF1A 1UBIA 3WIMA 3PEGA 4DBBA 2C7NB 3ZNGC 3M3JA 3KUZA 4KAXB 1UPQA 1S3SG 2O6VA 4BBKA 2X18A 4WVFB 2NR2A 2A4ZA 5E6NA 2DX5B 3SDLC 4HB4B 2KLGA 2YF0A 4IW0A 5CLQB 3U7DA 2K39A 4NSWA 4RM9A 2DYMA 3SBGA 4ANWA 2YSZA 1WZ3A 3PHWB 2C7MB 5LOPB 2LWPA 2UZSA 2HE7A 1R4MI 2VKIA 5GMVA 4ZYNA 3EECA 2L1CA 2KK8A 2FNJB 3ZNID 1WJNA 1V5PA 2LOXA 1K5GB 5JHBA 3X23A 5JVLA 1DYNA 2H7EA 2LOZA 2KX3A 2LGXA 2V3SA 3T8MA 2ZCCA 4KIKA 4C0AA 2MW5A 1WRDB 2HRJA 4WQOB 4FJYA 1AQCA 1ZVRA 1AWEA 2KLCA 2L76A 1UPRA 2PE6B 3KRWA 5HE1A 3PSEB 1WX7A 1GNUA 3A9JB 2OTXA 4L6EA 4KHBB 2KJHB 3PVLA 3S2AA 2LVOA 4JKAA 4DK5A 2KX0A 4X57B 3NZUA 1KLVA 3E9PA 1XODA 1Z2MA 1BTKA 3WAMA 2ZCBA 2KO3A 1WXAA 1E8WA 4WWPA 3HW2B 5HE0A 1BT0A 4DDID 3BINA 2MRPA 3MDBC 1BWNA 3TO1A 4NPNA 2C5LC 2L0FA 3QWZB 4BBNF 2BYVE 3OLMD 2I5CA 3T06A 2C60A 1EVHA 2RNRB 5D3VA 3VQIA 1RAXA 3WA0A 3RULA 1LM8B 4GPTB 4LJPB 3UIOB 2LI5A 4DWFA 3DPDA 1XT9B 2YS5A 4NAWA 4DBGA 1EO6A 1UEFA 1P6SA 4PYUA 2JRHA 2HD5B 2PE9A 2K2UA 1UNQA 2D9ZA 2LYDA 4ZRJA 1M94A 3VFKA 2FCMA 1WXVA 1I42A 3CF6E 2P0HA 2DZKA 4BBNC 1NTYA 1ZW7A 4JKGB 5CLLB 3TMPB 4PQ0A 2B3AA 2Y5BB 2D11A 5JP4A 4M0WB 1WJUA 1GG3A 2C7HA 3BJIA 4GMVA 3BY4B 3FEHA 2KWVB 3DVGY 3R3MA 1WY8A 2JF5A 4A20A 1WIAA 2GBRA 3V6EB 4BOZB 4F7ZA 2WYQA 2KFKA 1MG8A 3ZLZA 2N9XA 3DDCB 1XD4A 3FM8C 2AYOB 2MP2A 3WAOA 3HHMA 2M0XA 2QHOA 1J0WA 2FJ9A 2MWSB 1DBHA 3DBHI 3NOBA 1WG7A 2IO0B 4HXDA 4WJQA 1L7YA 1WJ4A 4MDKE 2L0TA 3F5RA 3NZSA 4FBJB 3TW1A 1XCGA 3OJ3A 2RLOA 4KV2A 3UF8A 1E7VA 3UZTA 3PLVA 4FULA 2Z0QA 1FAOA 1WX8A 2DYQA 2JRIB 3KYCD 3KRXA 1WJ6A 4GU2A 1U5GA 3KUDB 1E8ZA 2DKPA 2DX5A 3ZNHB 2ZNVC 1D3ZA 4J6IA 2Z0EB 3ZKJC 1MKEA 2Z0OA 2O6VB 3PT2B 2FUHB 2M38A 4JKDA 4GSWA 4MY6A 2WX0A 4JL9A 4HK2A 1W1GA 2KUPA 1WI1A 2HJ8A 4F8CB 3C0RB 2YT1A 2ROZB 2J59M 1RLFA 2BF8B 3DVNU 1ACAA 1UNRA 1OEYA 4JKFA 4I6LB 2N7DA 3QBVB 4ZDVA 1WJ1A 3PRMB 2ZNVB 3NHEB 3A8PA 2K8CA 5G55A 2KDFB 2MWNB 4CYEA 2KFJA 1N3HA 3PRPB 2N0YA 4KZ0A 2Y7BA 3R7RA 1OQNA 5DPWA 2CB8A 3SNHA 1NBFC 4KIKB 2DENB 3ULBA 3ENEA 4NJ6A 2KGXB 2LD9A 2M1MA 3EHVA 3QIJA 4JK8A 4ILHA 3MTNB 2P8VA 4PS7A 2GCLA 5DPRA 2LBBA 4GZUA 3O96A 5C5BA 2KC2A 2LZ6A 1WMHB 3UQBA 5J2RA 3WYFB 2NVUI 1ZKHA 1LW3A 1H10A 1X1GA 4W9DA 3RT3B 3DQVA 4DHZB 4EKUA 3DBSA 3L16A 2VRWB 4IM3A 3KW5B 2GBKA 2W2XC 1I35A 1FHXA 3D8FA 2RVBB 1NTIA 3QWMA 4Z2MB 5E6PA 2K6DB 4E74A 3LJUX 1OY2A 4WJNA 5J3YA 3PTFC 2Z59B 1HB8A 4IWPA 2DA0A 4IC7B 1V5UA 4BKSD 2COCA 4MM3A 1I7AA 3IVFA 2KTRB 3T9LA 5HE3A 3QAQA 3NSUA 1BAKA 4A6HA 4HDQA 4JKGA 2DHIA 1XX0A 3VH3B 1E7UA 1WM2A 1MIXA 1LXDA 1X86A 1A5RA 2OQBA 4KHAA 3VVWB 3VUYA 5CX3A 2KN5A 3APDA 2MBHA 2KKCA 2I5FA 2VSZA 4K81A 3R7QA 4HVBA 4EMOA 3GZNI 1MK7B 4HAZB 1Q67A 5D3YA 3ZRCA 5HE2A 2OJRA 4IOYX 2IFSA 2KCJA 1DROA 2N9EB 2KFKB 1MPHA 1RFAA 1NI2A 1V5MA 2LVPA 2MP2B 2PJHA 4URKA 5IA7A 2MA9B 3E66A 4ANVA 5DPTA 1GC7A 1KZGA 4DX8A 3JVZX 1OQYA 3WAPA 4CO7A 1X1FA 3SYXA 2LJ5A 4ANXA 4JGHB 2V76A 4HWIB 3PVWA 1RRBA 1KM7A 1WGUA 4AP4C 5LLIA 3RUIB 4BVUC 3KYDD 2CODA 2ZPYA 1P9DU 2XBBC 4GGQA 1WYWB 2G3QB 2IBIB 3UQAA 2JPHA 3VH4B 1PQSA 1UZXB 2D9WA 2CHZA 2KHWB 2FIDA 2M8SA 2CRFA 2KZRA 4XX5A 4JIOU 2IY1B 1FGYA 2Z0PA 4HCPB 2CKHB 2PZ1A 2WDTB 4AOFA 1QC6A 1V88A 1Y19B 3RCPA 3PS6A 1V89A 5DI9B 2XQNM 4PNKA 1E8XA 1UH6A 4JLCA 3ZDMC 2LASA 1M7EA 1VBHA 4NQLB 4TUUA 2KMAA 3SHQA 1LFDA 3U8ZA 1ISNA 2L7RA 2IO3B 3N32A 1EF5A 2D4QA 4PS3A 5CHVC 2YVCA 4K7WA 1WH3A 3W1SA 3KUCB 3D8DA 3M95A 4G11A 5D27A 3ML9A 2D9XA 4ZRIA 1WGQA 3MHSD 4GDKA 1Y5OA 1TGZB 4HJKA 4MGZE 3QC8B 3AXCA 3SU8X 2MKRA 1LQBA 2KANA 1WX9A 2JP2A 4AJYB 2D9YA 3LDZE 3ZUNA 4HAWB 2JVCA 1R4NI 3DXCA 1U29A 4IFSA 1WMHA 4XC2A 5C5BB 1WE6A 5CTRC 1M7RA 3L54A 5DIFB 2FIFA 5KHQA 2ZZPB 2N1WA 2W2WA 3ZW3A 2MX2A 4ILGB 3GOEA 2ZPNA 2QKMA 2GS0A 2KQSA 4A3PA 3IHPC 1YQBA 2L8JA 2ABDA 2DIKA 1P0RA 4HDOA 1KI1B 1ST7A 5FI1A 2DAJA 4JKBA 3D32A 2DLWA 1V81A 4FJZA 2O2VA 1U4AA 4G0NB 4F7UP 4KSLC 2PPHA 3JSVB 3SUZA 2AEHA 3QARA 1MIZB 2KTRA 2KQ7A 3ZTCA 3LJ3A 1VCBA 4HCNB 2K8BA 4ZRKA 5GOWB 1IPGA 1WGYA 1SGHA 2QKLA 4XWXA 4WAAA 2MBOA 4B95A 2P0DA 2EKEC 1L2NA 4HHVA 2LKOA 2DYOA 3HQCA 2J0KA 2K2JA 1EUVB 1YD8U 4E71A 5D94A 3ZVVA 2RGNB 1SHCA 4BFRA 3DXDA 2WWZA 4MH0E 3VTUA 1S1QB 3QCAA 2KWUB 4HPLB 4GXBA 2KOXA 1V61A 1FGZA 5LXHA 4W9KA 2A5UA 2K8HA 3KSYA 1GGOA 5BO4B 2BGFA 3DCGA 3DOWA 3NY5A 1FOEA 2KDBA 5AZGA 2K25A 1P5TA 1OGWA 1WF9A 2MBEA 3SO6A 2UVMA 3B1LX 5D7GA 1CMXB 1XQQA 4II3B 2L3ZA 4EOYA 1DDWA 2BCJA 1E90A 2FCNA 4WJPA 3Q3JA 3CXBB 4JKEA 2L2IA 5LONB 1UNPA 1DIKA 1XD3B 4I6PA 3VIAA 3TBLD 2OOBB 2G4SA 1X05A 4WJ7A 1P3QU 4A6FA 2ASQA 1DDVA 1WGDA 2CS4A 2NBWB 2UZRA 2DKQA 4FHKA 2KNBA 4G3XB 2Z0DB 5DCNA 4DDGD 3W1SC 3H7PB 1B55A 2FJLA 2BWES 3PREA 3WANA 2WH5A 3A98B 4GOCA 2J0JA 3RYTA 2GJYA 3WALA 1Y8RC 4ASWC 4I6NB 4MGKE 1QZEA 1H4RA 4K17A 2MCNB 2X0SA 2G35A 2CU1A 1NU2A 3IBEA 4MK0A 3E9OA 1WGHA 3DBLI 5KHOA 3HIZA 4EJNA 5AZFA 4EEWA 3TVVA 3PG7A 3PV1A 3A9KB 2CR5A 3KH0A 3ZTDA 4IAPA 1V86A 1IYFA 1W1DA 4GDKB 5JH5C 4G50A 2V4LA 1U27A 4ANUA 1G6JA 1YJ1A 3MJWA 5JHGA 3M1IB 4DHJD 2GBMA 3HM6X 1AARA 2K1FA 2NPTB 3L10B 2IZVB 2RSUA 4CHMA 1J19A 4BOSC 2L05A 2JZZA 2DZMA 2RSGA 2J7QB 1U5FA 4HB3B 5KCVA 3RD2A 2LGDA 4N9F4 1WE7A 3VHTC 1J8CA 2AL6A 2COFA 4GMXB 3CIKA 1EGXA 4PS8A 2IY0B 3JSVA 1KZ7A 1IP9A 3QQ8B 1ZC4B 3JYUA 2O2VB 2GBJA 1WJMA 4MJSB 4MGIE 4MGYE 2R82A 3H9DA 2LG1A 4OVUA 1MAIA 2N9PC 3PP2A 3H1UA 1H8CA 2VRRB 1WR1A 2DN6A 1V49A 1W1HA 2EJ8A 4GDLA 2RUKB 3SBTA 1U5DA 3ECIA 3JW0X 2REXA 3EFUA 3NS8A 5DH9B 4HAVB 3QK0A 5FR6A 2NMBA 2I1KA 1V5TA 2XK5A 3N30A 4W9CA 2JXXA 4JK9A 4NNJB 3V62A 2DHZA 1V5OA 2YS3A 3PVUA 5EDSA 1EAZA 1TJ6A 3A1QB 2LXCA 3PGEA 2YS1A 4FADA 4AJWA 3E9LA 3V6CB 3UGBB 3PSCA 1NVLA 1TBEA 2YRYA 4LDTD 3ZVRA 4OVVA 3HK0A 4IUMB 3OANA 5IAAC 4WSFA 3HM3A 2ADZA 4IM0A 5D3XA 2LXAA 2DFKA 4W9LA 1VBGA 2AL3A 2YT0A 4M8MA 2XEWA 4HB0B 3VAWA 2LRUA 2WX1A 1KBLA 4KVGB 1WZ0A 5TR5A 2FAZA 3A33B 3TJPA 3N7CA 4HAUB 1ZGUB 3W1YA 3H7PA 1RRPB 3B0AA 1UELA 4A6FB 1C3TA 4FHJA 1P3RA 4Y94A 4JKHA 5D6JB 4MT7A 2D07B 2IYDB 4HPMB 4K2OA 2Y8FA 2UWQA 1E8YA 3RZFA 1VD2A 4E3CA 5L83A 2D10A 3VUXA 2JWZA 2DHKA 2DTCA 2DAFA 3APCA 3SD5A 3KZ1A 4FA6A 1WR6E 1WM3A 4Z2NA 2ROVA 1OMWA 4DXAB 1Q1OA 3A9KA 3K9OB 2MBQA 1BTNA 3TL5A 1GUAB 1HE8A 4NQKE 3PLUA 1UGMA 2CY4A 3QX1A 2KXJA 2NCNA 4K1RB 3ML4A 4M8NA 1YIWA 1C1YB 1V80A 3ULCA 4W9EA 1SIFA 2E2XA 4KDIC 1SE9A 2AWTA 3M63B 5E6OA 1Q5WB 2NPTA 4H8SA 5DHAB 4BKGA 3N3KB 4EZJA 3O65B 5JHHA 3VTVA 5C6RA 3VOQA 4K7UA 3QA8A 4ICVA 2BKFA 1JRUA 4IG7B 4IWOA 3TFMA 3VUWA 2JUOA 3L08A 1V9JA 3ENBA 2I1JA 1TQZA 1J0GA 5JZEB 3AU4A 4MSMB 3VDZA 2LGYA 3ODOA 1FHWA 3UIPB 5CHWA 3IFWB 5L95C 4GIVA 5D2MB 2DZJA 2ZVOA 3V5WA 2ZVNA 5C79A 2M17A 4MJSA 2RGFA 1Z87A 2R2OA 1WVHA 2P0FA 4NJ7A 3APFA 3EC8A 2GBNA 4MSQB 3EPYA 3PZDA 4BKSA 3I3TB 3L0WB 3AJ4A 2DHJA 2ZEQA 3OJ4B 3PHXB 3ZO5B 1ZM0A 5CHFA 2ELAA 3MPXA 4GB9A 4GDLB 3TCAA 2KJRA 4B6WA 1U5EA 2DZIA 5KQ4A 2K00A 2M14A 2W9NA 1ZC3B 2BPSA 1F9JA 4CHKA 2NBVB 2XK5B 4KZCA 1TXDA 1PMSA 3GYPA 1Z5SB 4HLEA 3A1QA 2CAYA 1X1MA 2BKRB 4EUTA 3U30A 2GCJA 2H7DA 5C1ZA 2LULA 5AZHA 4HATB 1WGGA 2MLBA 1PLSA 3L13A 3AULA 2MQJA 4HAYB 1OEYJ 2HTHA 3G9WA 2IO1B 5IJMA 4K7SA 3CSFA 3AI5A 3L17A 4RM8A 2JZ3B 4W9IA 4KDLB 2DYBA 2FCSA 2PEAA 4K2PA 5J17A 4JK7A 3ZDTA 1K5DB 4A6KA 2Q13A 4W9GA 3VTWA 2N4FA 2EC1A 4FN2A 5J18A 2LRWA 2JY6A 4II2B 5DHFB 2D3GA 4IM2A 5G2NA 2CHXA 2KMCA 2BYEA 3V61A 4ICUA 2ZJDA 2LVQA 3RZWC 1T0YA 4W9HA 2FCQA 2O6VD 5AEKB 4LJOB 5C16A 4TV3A 3KVFB 4FJVB 1GC6A 1K8RB 4GN1A 4AUQC 3ODWA 3Q3FA 1FXTB 3IG3A 1WXMA 4YONA 2GMIC 3R66C 4KHOA 1NDDA 1IRSA 1UBQA 3QJZA 1X11A 2J0MA 4W9FA 2CY5A 4D0NB 2D2QA 5DPSA 5J3QA 3DBRI 1TZ1A 4B9KA 4HAXB 3H6NA 3V60A 4RMAA 1KJTA 4FLHA 3ML8A 2DYNA 3A4SC 1QQGA 1OTRB 4JQWC 2ELBA 5L81A 3DVGX 3FSSA 2MSED 4HB2B 3A9JA 4DHJB 3A8QA 4W9JA 4CHJA 1KOTA 5FI0A 5EFXA 4A5KA 1I2HA 2UYZB 1RJ2A 3P6AA 2NS5A 2EMTA 2NZ8B 3P7ZA 2KTFA 2RD0A 3UINB 1LB1A 4EZKA 5KQ1A 1V2YA 1YX6B 4XZ4A 3ZIMA 4EFOA 1XKEA 4DX90 2V1YA 5HKHA 4BKTA 3CMMB 2YLMA 1ZSQA 5J3TA 1MK9B 1DDMA 2G4DB 3PPAA 3K9PB 3ZNZB 5D3WA 3RCZA 1TTNA 2RR9A 2Y8GA 3F0WA 3A4RA 3X0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3O A;  1Q0W B;  2D9V A;  4NY0 A;  2IO2 B;  4F7H A;  1P98 A;  4P7I A;  2C9W B;  2MDX A;  4TQ0 A;  1V6E A;  2N7E A;  1P1A A;  2R0D A;  4YL8 A;  4EZL A;  1FHO A;  1NTV A;  2MFQ A;  4MEM A;  1PFJ A;  2W2X D;  4TQ1 A;  2KVR A;  4NAW B;  3H7S A;  2BYF A;  1GJZ A;  3ONS A;  2R09 A;  4DHZ E;  2RPQ A;  1YX5 B;  3D8E A;  1XR0 B;  2KWC A;  2G45 B;  3ODX A;  3ALB A;  4MEL A;  4WWN A;  2EMS A;  3GYO A;  2L00 B;  4B6H A;  4WJO A;  2LUE A;  1UD7 A;  4LCD E;  4WWO A;  3CST A;  1WGR A;  3KY9 A;  3DVN V;  3B08 A;  5JLJ B;  2HTH B;  3SV1 A;  2GOW A;  1FB8 A;  2KD0 A;  3ZRF A;  4AWJ A;  3P2B A;  2JT4 B;  2IYB A;  2COA A;  3VXW A;  2MBB B;  1WXS A;  2M4N A;  4F7G A;  4TYZ A;  4LDT B;  3M62 B;  2KDE B;  2BWF A;  1U2B A;  2DX1 A;  5JHA A;  3AU5 A;  4TKN A;  4PYZ A;  3DXE A;  2KC1 A;  2N1V A;  1E5W A;  2CHW A;  3TIX A;  2NBU A;  4IWQ A;  3QHT A;  1WI0 A;  2KDI A;  2N23 A;  2K6Q A;  2R2Q A;  2KJ6 A;  4F1S A;  4KSK C;  3PRZ A;  3OAW A;  5C23 A;  1WFY A;  5LXI B;  1EF1 A;  1UBI A;  3WIM A;  3PEG A;  4DBB A;  2C7N B;  3ZNG C;  3M3J A;  3KUZ A;  4KAX B;  1UPQ A;  1S3S G;  2O6V A;  4BBK A;  2X18 A;  4WVF B;  2NR2 A;  2A4Z A;  5E6N A;  2DX5 B;  3SDL C;  4HB4 B;  2KLG A;  2YF0 A;  4IW0 A;  5CLQ B;  3U7D A;  2K39 A;  4NSW A;  4RM9 A;  2DYM A;  4ANW A;  2YSZ A;  1WZ3 A;  3PHW B;  2C7M B;  5LOP B;  2LWP A;  2UZS A;  2HE7 A;  1R4M I;  2VKI A;  5GMV A;  4ZYN A;  3EEC A;  2L1C A;  2KK8 A;  2FNJ B;  3ZNI D;  1WJN A;  1V5P A;  2LOX A;  1K5G B;  5JHB A;  3X23 A;  1DYN A;  2H7E A;  2LOZ A;  2KX3 A;  2LGX A;  2V3S A;  3T8M A;  2ZCC A;  4KIK A;  4C0A A;  2MW5 A;  1WRD B;  4WQO B;  4FJY A;  1AQC A;  1ZVR A;  1AWE A;  2KLC A;  2L76 A;  1UPR A;  2PE6 B;  3KRW A;  5HE1 A;  3PSE B;  1WX7 A;  1GNU A;  3A9J B;  2OTX A;  4L6E A;  4KHB B;  2KJH B;  3PVL A;  3S2A A;  2LVO A;  4DK5 A;  2KX0 A;  4X57 B;  3NZU A;  1KLV A;  1XOD A;  1Z2M A;  1BTK A;  3WAM A;  2ZCB A;  2KO3 A;  1WXA A;  1E8W A;  4WWP A;  3HW2 B;  5HE0 A;  1BT0 A;  4DDI D;  3BIN A;  2MRP A;  3MDB C;  1BWN A;  3TO1 A;  4NPN A;  2C5L C;  2L0F A;  3QWZ B;  4BBN F;  2BYV E;  3OLM D;  2I5C A;  3T06 A;  2C60 A;  1EVH A;  2RNR B;  5D3V A;  3VQI A;  1RAX A;  3WA0 A;  3RUL A;  1LM8 B;  4GPT B;  4LJP B;  3UIO B;  2LI5 A;  4DWF A;  3DPD A;  1XT9 B;  2YS5 A;  4NAW A;  4DBG A;  1EO6 A;  1UEF A;  1P6S A;  4PYU A;  2JRH A;  2HD5 B;  2PE9 A;  2K2U A;  1UNQ A;  2D9Z A;  2LYD A;  4ZRJ A;  1M94 A;  3VFK A;  2FCM A;  1WXV A;  1I42 A;  3CF6 E;  2P0H A;  2DZK A;  4BBN C;  1NTY A;  1ZW7 A;  5CLL B;  3TMP B;  4PQ0 A;  2B3A A;  2Y5B B;  2D11 A;  5JP4 A;  4M0W B;  1WJU A;  1GG3 A;  2C7H A;  3BJI A;  4GMV A;  3BY4 B;  3FEH A;  2KWV B;  3DVG Y;  3R3M A;  1WY8 A;  2JF5 A;  4A20 A;  1WIA A;  2GBR A;  3V6E B;  4BOZ B;  4F7Z A;  2WYQ A;  2KFK A;  1MG8 A;  3ZLZ A;  2N9X A;  3DDC B;  1XD4 A;  3FM8 C;  2AYO B;  2MP2 A;  3WAO A;  3HHM A;  2M0X A;  2QHO A;  1J0W A;  2MWS B;  1DBH A;  3DBH I;  3NOB A;  1WG7 A;  2IO0 B;  4HXD A;  4WJQ A;  1L7Y A;  1WJ4 A;  4MDK E;  2L0T A;  3F5R A;  3NZS A;  4FBJ B;  3TW1 A;  1XCG A;  3OJ3 A;  2RLO A;  4KV2 A;  3UF8 A;  1E7V A;  3UZT A;  3PLV A;  4FUL A;  2Z0Q A;  1FAO A;  1WX8 A;  2DYQ A;  2JRI B;  3KYC D;  3KRX A;  1WJ6 A;  4GU2 A;  1U5G A;  3KUD B;  1E8Z A;  2DKP A;  2DX5 A;  3ZNH B;  2ZNV C;  1D3Z A;  4J6I A;  2Z0E B;  3ZKJ C;  1MKE A;  2Z0O A;  2O6V B;  3PT2 B;  2FUH B;  2M38 A;  4GSW A;  4MY6 A;  2WX0 A;  4JL9 A;  4HK2 A;  1W1G A;  2KUP A;  1WI1 A;  2HJ8 A;  4F8C B;  3C0R B;  2YT1 A;  2ROZ B;  2J59 M;  1RLF A;  2BF8 B;  3DVN U;  1UNR A;  1OEY A;  4I6L B;  2N7D A;  3QBV B;  4ZDV A;  1WJ1 A;  3PRM B;  2ZNV B;  3NHE B;  3A8P A;  2K8C A;  5G55 A;  2KDF B;  2MWN B;  4CYE A;  2KFJ A;  1N3H A;  3PRP B;  2N0Y A;  4KZ0 A;  2Y7B A;  3R7R A;  1OQN A;  5DPW A;  3SNH A;  1NBF C;  4KIK B;  2DEN B;  3ULB A;  3ENE A;  4NJ6 A;  2KGX B;  2LD9 A;  2M1M A;  3EHV A;  3QIJ A;  3MTN B;  2P8V A;  4PS7 A;  2GCL A;  5DPR A;  4GZU A;  3O96 A;  5C5B A;  2KC2 A;  2LZ6 A;  1WMH B;  3UQB A;  5J2R A;  3WYF B;  2NVU I;  1ZKH A;  1LW3 A;  1H10 A;  1X1G A;  4W9D A;  3RT3 B;  3DQV A;  4DHZ B;  4EKU A;  3DBS A;  3L16 A;  2VRW B;  4IM3 A;  3KW5 B;  2GBK A;  2W2X C;  1I35 A;  1FHX A;  3D8F A;  2RVB B;  3QWM A;  4Z2M B;  5E6P A;  2K6D B;  4E74 A;  3LJU X;  1OY2 A;  4WJN A;  5J3Y A;  3PTF C;  2Z59 B;  4IWP A;  2DA0 A;  4IC7 B;  1V5U A;  4BKS D;  2COC A;  4MM3 A;  1I7A A;  3IVF A;  2KTR B;  3T9L A;  5HE3 A;  3QAQ A;  3NSU A;  1BAK A;  4A6H A;  4HDQ A;  2DHI A;  1XX0 A;  3VH3 B;  1E7U A;  1WM2 A;  1MIX A;  1LXD A;  1X86 A;  1A5R A;  2OQB A;  4KHA A;  3VVW B;  3VUY A;  5CX3 A;  2KN5 A;  3APD A;  2MBH A;  2KKC A;  2I5F A;  2VSZ A;  4K81 A;  3R7Q A;  4HVB A;  4EMO A;  3GZN I;  1MK7 B;  4HAZ B;  1Q67 A;  5D3Y A;  3ZRC A;  5HE2 A;  2OJR A;  4IOY X;  2IFS A;  2KCJ A;  1DRO A;  2N9E B;  2KFK B;  1MPH A;  1RFA A;  1NI2 A;  1V5M A;  2LVP A;  2MP2 B;  2PJH A;  4URK A;  5IA7 A;  2MA9 B;  4ANV A;  5DPT A;  1GC7 A;  1KZG A;  4DX8 A;  3JVZ X;  1OQY A;  3WAP A;  4CO7 A;  1X1F A;  3SYX A;  2LJ5 A;  4ANX A;  4JGH B;  2V76 A;  4HWI B;  3PVW A;  1RRB A;  1KM7 A;  1WGU A;  4AP4 C;  5LLI A;  3RUI B;  4BVU C;  3KYD D;  2COD A;  2ZPY A;  1P9D U;  2XBB C;  4GGQ A;  1WYW B;  2G3Q B;  2IBI B;  3UQA A;  2JPH A;  3VH4 B;  1PQS A;  1UZX B;  2D9W A;  2CHZ A;  2KHW B;  2FID A;  2M8S A;  2CRF A;  2KZR A;  4XX5 A;  4JIO U;  2IY1 B;  1FGY A;  2Z0P A;  4HCP B;  2CKH B;  2PZ1 A;  2WDT B;  4AOF A;  1QC6 A;  1V88 A;  1Y19 B;  3RCP A;  3PS6 A;  1V89 A;  5DI9 B;  2XQN M;  4PNK A;  1E8X A;  1UH6 A;  4JLC A;  3ZDM C;  2LAS A;  1M7E A;  4NQL B;  4TUU A;  2KMA A;  3SHQ A;  1LFD A;  3U8Z A;  1ISN A;  2L7R A;  2IO3 B;  3N32 A;  1EF5 A;  2D4Q A;  4PS3 A;  5CHV C;  2YVC A;  4K7W A;  1WH3 A;  3W1S A;  3KUC B;  3D8D A;  3M95 A;  4G11 A;  5D27 A;  3ML9 A;  2D9X A;  4ZRI A;  1WGQ A;  3MHS D;  4GDK A;  1Y5O A;  1TGZ B;  4HJK A;  4MGZ E;  3QC8 B;  3AXC A;  3SU8 X;  2MKR A;  1LQB A;  2KAN A;  1WX9 A;  2JP2 A;  4AJY B;  2D9Y A;  3LDZ E;  3ZUN A;  4HAW B;  2JVC A;  1R4N I;  3DXC A;  1U29 A;  4IFS A;  1WMH A;  4XC2 A;  5C5B B;  1WE6 A;  5CTR C;  1M7R A;  3L54 A;  5DIF B;  2FIF A;  5KHQ A;  2ZZP B;  2N1W A;  2W2W A;  3ZW3 A;  2MX2 A;  3GOE A;  2ZPN A;  2QKM A;  2GS0 A;  2KQS A;  4A3P A;  3IHP C;  1YQB A;  2L8J A;  1P0R A;  1KI1 B;  4HDO A;  5FI1 A;  2DAJ A;  3D32 A;  2DLW A;  1V81 A;  4FJZ A;  2O2V A;  1U4A A;  4G0N B;  4F7U P;  4KSL C;  2PPH A;  3JSV B;  3SUZ A;  2AEH A;  3QAR A;  1MIZ B;  2KTR A;  2KQ7 A;  3ZTC A;  3LJ3 A;  1VCB A;  4HCN B;  2K8B A;  4ZRK A;  5GOW B;  1IPG A;  1WGY A;  1SGH A;  2QKL A;  4XWX A;  4WAA A;  2MBO A;  4B95 A;  2P0D A;  2EKE C;  1L2N A;  4HHV A;  2LKO A;  2DYO A;  3HQC A;  2J0K A;  2K2J A;  1EUV B;  1YD8 U;  4E71 A;  5D94 A;  3ZVV A;  2RGN B;  1SHC A;  4BFR A;  3DXD A;  2WWZ A;  4MH0 E;  3VTU A;  1S1Q B;  3QCA A;  2KWU B;  4HPL B;  4GXB A;  2KOX A;  1V61 A;  1FGZ A;  5LXH A;  4W9K A;  2A5U A;  2K8H A;  3KSY A;  5BO4 B;  2BGF A;  3DCG A;  3DOW A;  3NY5 A;  1FOE A;  2KDB A;  5AZG A;  2K25 A;  1P5T A;  1OGW A;  1WF9 A;  2MBE A;  3SO6 A;  2UVM A;  3B1L X;  5D7G A;  1CMX B;  1XQQ A;  4II3 B;  2L3Z A;  4EOY A;  1DDW A;  2BCJ A;  1E90 A;  2FCN A;  4WJP A;  3Q3J A;  3CXB B;  2L2I A;  5LON B;  1UNP A;  1XD3 B;  4I6P A;  3VIA A;  3TBL D;  2OOB B;  2G4S A;  1X05 A;  4WJ7 A;  1P3Q U;  4A6F A;  2ASQ A;  1DDV A;  1WGD A;  2CS4 A;  2NBW B;  2UZR A;  2DKQ A;  4FHK A;  2KNB A;  4G3X B;  2Z0D B;  5DCN A;  4DDG D;  3W1S C;  3H7P B;  1B55 A;  2FJL A;  2BWE S;  3PRE A;  3WAN A;  3A98 B;  4GOC A;  2J0J A;  3RYT A;  2GJY A;  3WAL A;  1Y8R C;  4ASW C;  4I6N B;  4MGK E;  1QZE A;  1H4R A;  4K17 A;  2MCN B;  2G35 A;  2CU1 A;  1NU2 A;  3IBE A;  4MK0 A;  1WGH A;  3DBL I;  5KHO A;  3HIZ A;  4EJN A;  5AZF A;  4EEW A;  3TVV A;  3PG7 A;  3PV1 A;  3A9K B;  2CR5 A;  3KH0 A;  3ZTD A;  4IAP A;  1V86 A;  1IYF A;  1W1D A;  4GDK B;  5JH5 C;  4G50 A;  2V4L A;  1U27 A;  4ANU A;  1G6J A;  1YJ1 A;  3MJW A;  5JHG A;  3M1I B;  4DHJ D;  2GBM A;  3HM6 X;  1AAR A;  2K1F A;  2NPT B;  3L10 B;  2IZV B;  2RSU A;  4CHM A;  1J19 A;  4BOS C;  2L05 A;  2JZZ A;  2DZM A;  2RSG A;  2J7Q B;  1U5F A;  4HB3 B;  5KCV A;  3RD2 A;  2LGD A;  4N9F 4;  1WE7 A;  3VHT C;  1J8C A;  2AL6 A;  2COF A;  4GMX B;  3CIK A;  1EGX A;  4PS8 A;  2IY0 B;  3JSV A;  1KZ7 A;  1IP9 A;  3QQ8 B;  1ZC4 B;  3JYU A;  2O2V B;  2GBJ A;  1WJM A;  4MJS B;  4MGI E;  4MGY E;  3H9D A;  2LG1 A;  4OVU A;  1MAI A;  2N9P C;  3PP2 A;  3H1U A;  1H8C A;  2VRR B;  1WR1 A;  2DN6 A;  1V49 A;  1W1H A;  2EJ8 A;  4GDL A;  2RUK B;  1U5D A;  3ECI A;  3JW0 X;  2REX A;  3EFU A;  3NS8 A;  5DH9 B;  4HAV B;  3QK0 A;  5FR6 A;  2NMB A;  2I1K A;  1V5T A;  2XK5 A;  3N30 A;  4W9C A;  2JXX A;  4NNJ B;  3V62 A;  2DHZ A;  1V5O A;  2YS3 A;  3PVU A;  5EDS A;  1EAZ A;  1TJ6 A;  3A1Q B;  2LXC A;  3PGE A;  2YS1 A;  4FAD A;  4AJW A;  3V6C B;  3UGB B;  3PSC A;  1TBE A;  2YRY A;  4LDT D;  3ZVR A;  4OVV A;  3HK0 A;  4IUM B;  3OAN A;  5IAA C;  4WSF A;  3HM3 A;  2ADZ A;  4IM0 A;  5D3X A;  2LXA A;  2DFK A;  4W9L A;  2AL3 A;  2YT0 A;  4M8M A;  2XEW A;  4HB0 B;  3VAW A;  2LRU A;  2WX1 A;  4KVG B;  1WZ0 A;  5TR5 A;  2FAZ A;  3A33 B;  3TJP A;  3N7C A;  4HAU B;  1ZGU B;  3W1Y A;  3H7P A;  1RRP B;  3B0A A;  1UEL A;  4A6F B;  1C3T A;  4FHJ A;  1P3R A;  4Y94 A;  5D6J B;  4MT7 A;  2D07 B;  2IYD B;  4HPM B;  4K2O A;  2Y8F A;  2UWQ A;  1E8Y A;  3RZF A;  1VD2 A;  4E3C A;  5L83 A;  2D10 A;  3VUX A;  2JWZ A;  2DHK A;  2DTC A;  2DAF A;  3APC A;  3SD5 A;  3KZ1 A;  4FA6 A;  1WR6 E;  1WM3 A;  4Z2N A;  2ROV A;  1OMW A;  4DXA B;  1Q1O A;  3A9K A;  3K9O B;  2MBQ A;  1BTN A;  3TL5 A;  1GUA B;  1HE8 A;  4NQK E;  3PLU A;  1UGM A;  2CY4 A;  3QX1 A;  2KXJ A;  2NCN A;  4K1R B;  3ML4 A;  4M8N A;  1YIW A;  1C1Y B;  1V80 A;  3ULC A;  4W9E A;  1SIF A;  2E2X A;  4KDI C;  1SE9 A;  2AWT A;  3M63 B;  5E6O A;  1Q5W B;  2NPT A;  4H8S A;  5DHA B;  4BKG A;  3N3K B;  4EZJ A;  3O65 B;  5JHH A;  3VTV A;  5C6R A;  3VOQ A;  4K7U A;  3QA8 A;  4ICV A;  2BKF A;  1JRU A;  4IG7 B;  4IWO A;  3TFM A;  3VUW A;  2JUO A;  3L08 A;  1V9J A;  2I1J A;  1TQZ A;  1J0G A;  5JZE B;  3AU4 A;  4MSM B;  3VDZ A;  2LGY A;  3ODO A;  1FHW A;  3UIP B;  5CHW A;  3IFW B;  5L95 C;  4GIV A;  5D2M B;  2DZJ A;  2ZVO A;  3V5W A;  2ZVN A;  5C79 A;  2M17 A;  4MJS A;  2RGF A;  1Z87 A;  2R2O A;  1WVH A;  2P0F A;  4NJ7 A;  3APF A;  3EC8 A;  2GBN A;  4MSQ B;  3PZD A;  4BKS A;  3I3T B;  3L0W B;  3AJ4 A;  2DHJ A;  2ZEQ A;  3OJ4 B;  3PHX B;  3ZO5 B;  1ZM0 A;  5CHF A;  2ELA A;  3MPX A;  4GB9 A;  4GDL B;  3TCA A;  2KJR A;  4B6W A;  1U5E A;  2DZI A;  5KQ4 A;  2K00 A;  2M14 A;  2W9N A;  1ZC3 B;  2BPS A;  1F9J A;  4CHK A;  2NBV B;  2XK5 B;  4KZC A;  1TXD A;  1PMS A;  3GYP A;  1Z5S B;  4HLE A;  3A1Q A;  2CAY A;  1X1M A;  2BKR B;  4EUT A;  3U30 A;  2GCJ A;  2H7D A;  5C1Z A;  2LUL A;  5AZH A;  4HAT B;  1WGG A;  2MLB A;  1PLS A;  3L13 A;  3AUL A;  2MQJ A;  4HAY B;  1OEY J;  2HTH A;  3G9W A;  2IO1 B;  4K7S A;  3CSF A;  3AI5 A;  3L17 A;  4RM8 A;  2JZ3 B;  4W9I A;  4KDL B;  2DYB A;  2FCS A;  2PEA A;  4K2P A;  5J17 A;  1K5D B;  3ZDT A;  4A6K A;  2Q13 A;  4W9G A;  3VTW A;  2N4F A;  2EC1 A;  4FN2 A;  5J18 A;  2LRW A;  2JY6 A;  4II2 B;  5DHF B;  2D3G A;  4IM2 A;  5G2N A;  2CHX A;  2KMC A;  2BYE A;  3V61 A;  4ICU A;  2ZJD A;  2LVQ A;  3RZW C;  1T0Y A;  4W9H A;  2FCQ A;  2O6V D;  5AEK B;  4LJO B;  5C16 A;  4TV3 A;  3KVF B;  4FJV B;  1GC6 A;  1K8R B;  4GN1 A;  4AUQ C;  3ODW A;  3Q3F A;  1FXT B;  3IG3 A;  1WXM A;  4YON A;  2GMI C;  3R66 C;  4KHO A;  1NDD A;  1IRS A;  1UBQ A;  3QJZ A;  1X11 A;  2J0M A;  4W9F A;  2CY5 A;  4D0N B;  2D2Q A;  5DPS A;  5J3Q A;  3DBR I;  1TZ1 A;  4B9K A;  4HAX B;  3H6N A;  3V60 A;  4RMA A;  1KJT A;  4FLH A;  3ML8 A;  2DYN A;  3A4S C;  1QQG A;  1OTR B;  4JQW C;  2ELB A;  5L81 A;  3DVG X;  3FSS A;  2MSE D;  4HB2 B;  3A9J A;  4DHJ B;  3A8Q A;  4W9J A;  4CHJ A;  1KOT A;  5FI0 A;  5EFX A;  4A5K A;  1I2H A;  2UYZ B;  1RJ2 A;  3P6A A;  2NS5 A;  2EMT A;  2NZ8 B;  3P7Z A;  2KTF A;  2RD0 A;  3UIN B;  1LB1 A;  4EZK A;  5KQ1 A;  1V2Y A;  1YX6 B;  4XZ4 A;  3ZIM A;  4EFO A;  1XKE A;  4DX9 0;  2V1Y A;  5HKH A;  4BKT A;  3CMM B;  2YLM A;  1ZSQ A;  5J3T A;  1MK9 B;  1DDM A;  2G4D B;  3PPA A;  3K9P B;  3ZNZ B;  5D3W A;  3RCZ A;  1TTN A;  2RR9 A;  2Y8G A;  3F0W A;  3A4R A;  3X0W A; 
#chains in the Genus database with same CATH topology
 4A3O A;  1FCL A;  1Q0W B;  4NY0 A;  2D9V A;  2IO2 B;  4F7H A;  1P98 A;  4P7I A;  2GI9 A;  2CQU A;  1FD6 A;  5D3D A;  2C9W B;  1XEE A;  1SIJ A;  2MDX A;  4LTU A;  4TQ0 A;  1JDE A;  1HA5 A;  1V6E A;  1FCC C;  2N7E A;  1P1A A;  4S17 A;  1KC7 A;  2R0D A;  4JKC A;  4YL8 A;  3RNE C;  4EZL A;  3W5U B;  4ILJ A;  3ZJT A;  1FHO A;  1NTV A;  2MFQ A;  4MEM A;  2WXM A;  1OQR A;  3ZJV A;  1PFJ A;  2ON8 A;  2W2X D;  4TQ1 A;  1KFY B;  2KVR A;  4NAW B;  2RQ1 A;  4LNN A;  3PZ8 A;  2Z13 A;  2FDQ A;  3EFC A;  2NTT A;  3H7S A;  4GOU A;  2NBV A;  2BYF A;  4M00 A;  1HB6 A;  3P4Q B;  1GJZ A;  3ONS A;  2R09 A;  4WQM A;  3GE8 C;  4DHZ E;  3RMK C;  2RPQ A;  1V1P B;  1YX5 B;  3D8E A;  2UU7 A;  4ZHO A;  1XR0 B;  1PGX A;  2KWC A;  2G45 B;  3ODX A;  4OZA A;  4M0W A;  3ALB A;  4MEL A;  1HBK A;  1FPY A;  4WWN A;  1L4Z B;  2EMS A;  1T0Q C;  3GYO A;  3IT4 B;  2L00 B;  3Q14 C;  1GB1 A;  2YEP F;  4B6H A;  1YJJ A;  4WJO A;  2LUE A;  4WAF A;  1ACC A;  1UD7 A;  4LCD E;  4WWO A;  3CST A;  1UWM A;  3BYT B;  1MFW A;  1WYG A;  1WGR A;  4B0M A;  1EWY C;  3KY9 A;  3I57 A;  3DVN V;  3B08 A;  4XWT A;  5JLJ B;  2HTH B;  3SV1 A;  2GOW A;  2K5P A;  1FB8 A;  2KD0 A;  2BQQ A;  3ZRF A;  4AWJ A;  3NW8 A;  3P2B A;  2JT4 B;  2IYB A;  2COA A;  4OVZ A;  2LMC A;  4REZ A;  1N60 A;  1I4R A;  2JQR B;  3VXW A;  2MBB B;  1DGJ A;  1WXS A;  2M4N A;  4F7G A;  4TYZ A;  4LDT B;  4KGR A;  1JRP A;  3FLV A;  2KDE B;  2BWF A;  1U2B A;  3AV8 A;  3M62 B;  2DX1 A;  5JHA A;  1JWB D;  2CU3 A;  3AU5 A;  4HSI A;  2ZW1 A;  4TKN A;  5IO9 A;  1Y56 A;  1NI3 A;  3N1X C;  4PYZ A;  3DXE A;  2KC1 A;  1L5P A;  1SBB B;  4RH6 A;  2N1V A;  2SEB D;  2IJ0 A;  1E5W A;  3NZ3 A;  2CHW A;  2IDY A;  4KKI A;  2NBU A;  4IWQ A;  3TIX A;  1MVK A;  3QHT A;  1WI0 A;  2KDI A;  2WLB A;  3PO0 A;  2N23 A;  2K6Q A;  3WCQ A;  2R2Q A;  2KJ6 A;  2COP A;  3FP5 A;  4F1S A;  4KSK C;  4YSY B;  3PRZ A;  3SR6 A;  3OAW A;  3FC4 A;  1YQ4 B;  1WFY A;  3B2G A;  3B9J A;  5C23 A;  4C4V A;  3FVC A;  5JXV A;  5LXI B;  3N20 C;  3NJT A;  1EF1 A;  1UBI A;  2WXR A;  3WIM A;  3PEG A;  4DBB A;  2C7N B;  1ZPS A;  3ZNG C;  3M3J A;  3KUZ A;  4KAX B;  1YNT E;  1UPQ A;  1S3S G;  2O6V A;  3AH7 A;  4BBK A;  5H92 C;  1EM7 A;  2X18 A;  4WVF B;  2NR2 A;  2A4Z A;  5E6N A;  2MHJ A;  1TYG B;  2DX5 B;  2TSS A;  3SDL C;  4HB4 B;  2KLG A;  2YF0 A;  4IW0 A;  5CLQ B;  3U7D A;  2K39 A;  4NSW A;  4RM9 A;  2DYM A;  3SBG A;  3T3N A;  4ANW A;  3DHH C;  2YSZ A;  1WZ3 A;  2CJN A;  3PHW B;  1TIF A;  3ZXR A;  2C7M B;  5LOP B;  3HVZ A;  2LWP A;  2WXJ A;  1SB3 C;  2MEK A;  2UZS A;  2OJW A;  1MG4 A;  1TY2 A;  2HE7 A;  1QOG A;  1R4M I;  2VKI A;  5GMV A;  4ZYN A;  1CZP A;  1YN4 A;  2J53 A;  3EEC A;  3RNC C;  2PLP A;  2L1C A;  2KK8 A;  2FNJ B;  3ZNI D;  1WJN A;  1V5P A;  1K51 A;  2PVO D;  3AEA B;  3I5J C;  2LOX A;  1FFV A;  1K5G B;  4JX1 C;  1MPE A;  5JHB A;  4C00 A;  3X23 A;  5JVL A;  1D5X C;  1DYN A;  2H7E A;  2LOZ A;  1SXT A;  1MI0 A;  2KX3 A;  2LGX A;  2V3S A;  2WXO A;  2ZCC A;  4KIK A;  3T8M A;  4C0A A;  2MW5 A;  1WRD B;  2HRJ A;  1XCQ L;  4WQO B;  2FBW B;  4FJY A;  1AQC A;  1ZVR A;  2ZKM X;  2JXT A;  2LFI A;  1AWE A;  4OZB A;  2KLC A;  2L76 A;  2VH2 A;  1UPR A;  2KIG A;  1QOA A;  2PE6 B;  3TEX A;  3KRW A;  5HE1 A;  3PSE B;  1WX7 A;  1GNU A;  3A9J B;  2OTX A;  2RDH A;  4M01 A;  4L6E A;  4KHB B;  1XXG A;  2KAC A;  2KJH B;  1TT5 B;  3RNB C;  3PVL A;  3S2A A;  3V05 A;  2LVO A;  2KIE A;  4JKA A;  2BW2 A;  4DK5 A;  2G9H D;  1KLU D;  2KX0 A;  4X57 B;  3NZU A;  1KLV A;  2KDM A;  3E9P A;  1XOD A;  2W55 A;  1Z2M A;  1BTK A;  3CWI A;  1WWT A;  3WAM A;  2ZCB A;  1TS2 A;  2KO3 A;  1ESF A;  1WXA A;  1E8W A;  4RGM A;  2KMM A;  4WWP A;  3HW2 B;  1IBX B;  4N59 A;  4D2K A;  5EE1 A;  5HE0 A;  1BT0 A;  2PIA A;  1N5X A;  3AE7 B;  4DDI D;  3BIN A;  2MRP A;  3MDB C;  2JX5 A;  1BWN A;  3GB1 A;  3TO1 A;  4NPN A;  2C5L C;  2JYE A;  2L0F A;  3QWZ B;  4BBN F;  2BYV E;  3OLM D;  1TY0 A;  2I5C A;  3ETR A;  3T06 A;  2C60 A;  1EVH A;  3H8H A;  2RNR B;  5D3V A;  5GXG B;  4RF1 A;  2Z59 A;  3VQI A;  1K50 A;  1RAX A;  2WU2 B;  3WA0 A;  3RUL A;  1LM8 B;  4GPT B;  4ZYS A;  1T3Q A;  4LJP B;  1QQR A;  2PKO A;  3UIO B;  2LI5 A;  4DWF A;  3DPD A;  1XT9 B;  4TSS A;  1C4P A;  2YS5 A;  4NAW A;  4YWG G;  4YSZ B;  4DBG A;  1EO6 A;  1UEF A;  3UI3 A;  1P6S A;  3PZ7 A;  2JRH A;  4QJ4 B;  4PYU A;  3J9C A;  2HD5 B;  3SFD B;  2PE9 A;  1L0V B;  2K2U A;  1UNQ A;  2D9Z A;  2LYD A;  4ZRJ A;  1M94 A;  3VFK A;  2FCM A;  1WXV A;  1VZ8 A;  1I42 A;  3CF6 E;  1CQV A;  2P0H A;  2DZK A;  4BBN C;  2KAJ A;  1NTY A;  1FNW A;  1ZW7 A;  4JKG B;  4M02 A;  4CQN A;  1WGK A;  4HKZ E;  4N58 A;  2ZW0 A;  5CLL B;  3TMP B;  4PQ0 A;  2B3A A;  3LYY A;  1XLN A;  2Y5B B;  2D11 A;  5JP4 A;  4M0W B;  1WJU A;  1GG3 A;  2C7H A;  2PTL A;  3BJI A;  4GMV A;  3BWU D;  2N7J A;  3BY4 B;  4NAM A;  2R2Y A;  3FEH A;  2KWV B;  3DVG Y;  3R3M A;  1WY8 A;  2JF5 A;  4A20 A;  3DBH B;  1WIA A;  2GBR A;  3V6E B;  4BOZ B;  4F7Z A;  1L4D B;  2WYQ A;  2KFK A;  1MG8 A;  3OWE B;  3ZLZ A;  2N9X A;  1QKZ A;  3DDC B;  2V3N A;  1XD4 A;  3FM8 C;  2D3A A;  2AYO B;  2MP2 A;  3WAO A;  1YOV B;  3A58 A;  2M0X A;  3HHM A;  2QHO A;  3Q8E A;  1J0W A;  2FJ9 A;  4A6Q A;  3DHG C;  2MWS B;  1DBH A;  1JCK B;  3DBH I;  3NOB A;  1WG7 A;  2IO0 B;  3Q3M C;  3DWM A;  4HXD A;  4WJQ A;  3Q8A A;  1L7Y A;  1WJ4 A;  2X8X X;  4MDK E;  2L0T A;  4Q2J A;  3F5R A;  3NZS A;  4FBJ B;  1TS4 A;  3TW1 A;  1XCG A;  4S0R A;  3OJ3 A;  2DNF A;  2RLO A;  1FO4 A;  4KV2 A;  3HIE A;  3UF8 A;  2GUM A;  1E7V A;  3UZT A;  3PLV A;  4FUL A;  2Z0Q A;  1FAO A;  1WX8 A;  2DYQ A;  2G1E A;  2JRI B;  1C79 A;  3KYC D;  3KRX A;  1WJ6 A;  1QT9 A;  1U5G A;  4GU2 A;  4C4V B;  3KUD B;  4PK1 A;  1E8Z A;  3KWL A;  2DKP A;  2DX5 A;  3ZNH B;  2ZNV C;  1D3Z A;  4J6I A;  2Z0E B;  4XDD A;  1GPX A;  2K0P A;  3ZKJ C;  1MKE A;  1KH0 A;  2Z0O A;  2O6V B;  3PT2 B;  2FUH B;  2M38 A;  4JKD A;  4GSW A;  3LB8 C;  4MY6 A;  1ZDV A;  2WX0 A;  4JL9 A;  4HK2 A;  1W1G A;  4OSN A;  2KUP A;  3MC0 B;  1P7E A;  1WI1 A;  2HJ8 A;  4F8C B;  3DBR B;  3C0R B;  2FUG 1;  2YT1 A;  3TSS A;  2ROZ B;  2J59 M;  1RLF A;  3R8B A;  2BF8 B;  3DVN U;  4LLG M;  1ACA A;  1UNR A;  1FXI A;  1OEY A;  4JKF A;  1JML A;  1C9F A;  2KVZ A;  4I6L B;  1V97 A;  2N7D A;  3FKY A;  5BYS A;  3QBV B;  4ZDV A;  2J4X A;  1FRD A;  1WJ1 A;  3PRM B;  2ZNV B;  5EE9 A;  2YT2 A;  3NHE B;  3AM9 A;  1SF0 A;  3A8P A;  1L6V A;  1T6B X;  2K8C A;  5G55 A;  2KDF B;  2MWN B;  4CYE A;  2KFJ A;  1N3H A;  3PRP B;  2QDF A;  2N0Y A;  4KZ0 A;  1E9M A;  1UUP A;  1WRI A;  2Y7B A;  2LUM A;  5IRS A;  3R7R A;  1OQN A;  5DPW A;  2CB8 A;  5IOI A;  3MP9 A;  3SNH A;  1NBF C;  4KIK B;  2GRI A;  2DEN B;  3ULB A;  3ENE A;  2WDR B;  4NJ6 A;  2KGX B;  2LD9 A;  2M1M A;  3EHV A;  2WXG A;  3QIJ A;  4JK8 A;  4ILH A;  4ZHP A;  3AE2 B;  3MTN B;  2P8V A;  1LGR A;  4RF0 A;  4PS7 A;  2GCL A;  5DPR A;  2LBB A;  4GZU A;  3O96 A;  2LHE A;  5C5B A;  2Q5W D;  2KC2 A;  3NVW A;  5LNK 1;  4XE0 A;  2IPK D;  3P4P B;  1QOB A;  2LZ6 A;  1WMH B;  3UQB A;  5HG2 A;  5J2R A;  2DWQ A;  4C80 A;  3WYF B;  2N9K A;  2NVU I;  1ZKH A;  2MH7 A;  3P63 A;  1LW3 A;  1ET6 A;  1H10 A;  1PGA A;  2DLB A;  2INC C;  3Q8C A;  4P1B C;  1X1G A;  1UNS A;  4W9D A;  5I2S A;  3RT3 B;  3DQV A;  5HHD G;  1HZ5 A;  3IXS A;  1FXA A;  4DHZ B;  4EKU A;  3DBS A;  3L16 A;  2VRW B;  4IM3 A;  2M19 A;  3KW5 B;  2GBK A;  3FAH A;  2W2X C;  1JWM D;  3VRB B;  2Y5P A;  1I35 A;  1FHX A;  3D8F A;  2GB1 A;  2RVB B;  2INP E;  3VRA B;  1NTI A;  3QWM A;  3ZJU A;  4Z2M B;  2J42 A;  4HPP A;  5E6P A;  4QJ5 B;  2K6D B;  4E74 A;  5FR3 A;  3LJU X;  1SE4 A;  1OY2 A;  4WJN A;  3DWG C;  5J3Y A;  3PTF C;  2Z59 B;  3SEB A;  1HB8 A;  4IWP A;  2DA0 A;  2AQ1 B;  4IC7 B;  1V5U A;  4BKS D;  2COC A;  4MM3 A;  1I7A A;  3IVF A;  1N63 A;  2KTR B;  4KX6 B;  3T9L A;  5HE3 A;  3V3X A;  4OT1 A;  3QAQ A;  2RMM A;  3NSU A;  1ZOY B;  1F77 A;  4JWU C;  5HI1 A;  1BAK A;  1EWC A;  3N1Y C;  1MHH E;  4JE3 B;  4A6H A;  4HDQ A;  4UDU C;  4DIX A;  4JKG A;  2DHI A;  1XX0 A;  3P1M A;  2BS2 B;  1SJH D;  3RNF C;  3VH3 B;  1E7U A;  1WM2 A;  1MIX A;  1LXD A;  1X86 A;  1A5R A;  1DOY A;  2OQB A;  4KHA A;  4RFB A;  3VVW B;  3VUY A;  5CX3 A;  2KN5 A;  3APD A;  2JWU A;  2MBH A;  4MH8 A;  1VDV A;  3B77 A;  2KKC A;  2I5F A;  1VZ7 A;  3SFE B;  1IUE A;  2VSZ A;  4K81 A;  4P1C C;  3R7Q A;  3EUB 2;  3GS2 A;  1C77 A;  4HVB A;  4EMO A;  3GZN I;  1MK7 B;  4HAZ B;  1F0Z A;  1Q67 A;  2BBC A;  2BT6 A;  5D3Y A;  2DBY A;  1L6U A;  5HE2 A;  3ZRC A;  2OJR A;  4IOY X;  2IFS A;  2WXF A;  2KCJ A;  1DRO A;  2N9E B;  2KFK B;  1HTQ A;  2ONQ A;  1ZYI A;  1MPH A;  1RFA A;  3OG5 A;  3R2I A;  1NI2 A;  2KR0 A;  5M4Y B;  1V5M A;  2RDG A;  2LVP A;  2K9X A;  2MP2 B;  2PJH A;  4URK A;  5IA7 A;  2MA9 B;  3E66 A;  2BS3 B;  4ANV A;  1ZDX A;  5DPT A;  1GC7 A;  1KZG A;  1UF0 A;  4DX8 A;  3JVZ X;  1OQY A;  2LGI A;  3WAP A;  4CO7 A;  1X1F A;  1IGC A;  3SYX A;  1NVI D;  2LJ5 A;  4ANX A;  4JGH B;  2V76 A;  3R2T A;  4HWI B;  4DQO C;  4AQ7 A;  3U52 E;  3PVW A;  1RRB A;  1KM7 A;  1WGU A;  4AP4 C;  1PDX A;  4ZRQ A;  4ZOH C;  5LLI A;  3RUI B;  4BVU C;  2OHF A;  3KYD D;  2COD A;  2ZPY A;  1P9D U;  2XBB C;  4GGQ A;  1WYW B;  4DXG A;  2G3Q B;  2IBI B;  3UQA A;  2Y5C A;  3RNG C;  2JPH A;  3P42 A;  3VH4 B;  1PQS A;  1UZX B;  2WXL A;  2D9W A;  2CHZ A;  2K49 A;  3HVD A;  1A70 A;  2KHW B;  2FID A;  2M8S A;  1R4M B;  2CRF A;  1PYW D;  2KZR A;  4XX5 A;  3RNA C;  4JIO U;  2E6X A;  2IY1 B;  1FGY A;  3VR9 B;  2Z0P A;  4HCP B;  2CKH B;  2PZ1 A;  2WDT B;  4AOF A;  1QC6 A;  1V88 A;  1XF5 L;  1Y19 B;  3RCP A;  1QLB B;  3PS6 A;  1V89 A;  5DI9 B;  2XQN M;  4PNK A;  1E8X A;  1PFD A;  1UH6 A;  2WNM A;  4JLC A;  2LAS A;  3ZDM C;  1M7E A;  1NEN B;  1VBH A;  4NQL B;  4QJ3 B;  2AQ3 B;  2WQY B;  4TUU A;  2KMA A;  1ZXI A;  3SHQ A;  1LFD A;  3U8Z A;  3CIR B;  1ISN A;  2L7R A;  2IO3 B;  3N32 A;  1EF5 A;  4OW0 A;  1UGJ A;  2D4Q A;  4PS3 A;  5CHV C;  1MI1 A;  2YVC A;  4K7W A;  1N62 A;  1WH3 A;  3W1S A;  1I7H A;  3D8D A;  1UWX A;  2XNA C;  3KUC B;  3M95 A;  5IN7 A;  1B9R A;  4G11 A;  4L23 A;  3NVV A;  5D27 A;  4O1N A;  3ML9 A;  2D9X A;  1XLQ A;  4ZRI A;  1WGQ A;  1I4G A;  2PVG C;  3MHS D;  4ARC A;  4GDK A;  1Y5O A;  1TGZ B;  1N5W A;  4C7Y A;  2KN4 A;  4HJK A;  4MGZ E;  1JWS D;  4MT5 A;  3QC8 B;  3AXC A;  3AEF B;  2FJU B;  2WDV B;  4IOI E;  4WIP A;  3SU8 X;  2MKR A;  1LQB A;  3C8Y A;  2KAN A;  1DOX A;  1WX9 A;  2JP2 A;  4AJY B;  1RWS A;  2D9Y A;  3LDZ E;  1K53 A;  4K3C A;  3ZUN A;  2LGS A;  4K3B A;  1MHX A;  4HAW B;  4OZC A;  2JVC A;  1R4N I;  3DXC A;  1U29 A;  4IFS A;  2N0S B;  1WMH A;  4XC2 A;  5C5B B;  1WE6 A;  2H89 B;  3BVM A;  4RGT A;  5CTR C;  1EU3 A;  1M7R A;  3L54 A;  5DIF B;  2QCZ A;  2FIF A;  3I63 C;  5KHQ A;  2ZZP B;  1VLB A;  2KWD A;  2N1W A;  2W2W A;  3ZW3 A;  4LNI A;  2MX2 A;  4ILG B;  3GOE A;  4ITK A;  2ZPN A;  2QKM A;  4L1B A;  2GS0 A;  2KQS A;  3AEC B;  3KLS X;  1XLP A;  4A3P A;  3IHP C;  1YQB A;  2L8J A;  2ABD A;  2DIK A;  1P0R A;  3VR8 B;  4HDO A;  1KI1 B;  3EA6 A;  1ST7 A;  5FI1 A;  2WHI A;  2DAJ A;  4JKB A;  3D32 A;  2DLW A;  3FIL A;  4HJG E;  1V81 A;  4FJZ A;  4LNF A;  1TS3 A;  3Q6B A;  2O2V A;  1U4A A;  3AE9 B;  1TKE A;  4N6E B;  4G0N B;  2QC8 A;  3KQ4 A;  4F7U P;  4KSL C;  2RDB C;  2PPH A;  3JSV B;  3SUZ A;  2AEH A;  3DCX A;  3QAR A;  1MIZ B;  2KTR A;  2KQ7 A;  1XLO A;  3BVG A;  3ZTC A;  3LJ3 A;  1VCB A;  4HCN B;  2K8B A;  4ZRK A;  5GOW B;  1F1H A;  3E56 A;  3O13 A;  1IPG A;  1WGY A;  3GE3 C;  3HRD D;  4MM3 B;  1SGH A;  2BYT A;  3AE1 B;  5EE0 A;  1OQQ A;  2QKL A;  4XWX A;  4WAA A;  2W3S A;  2MBO A;  4B95 A;  2P0D A;  2EKE C;  1L2N A;  4HHV A;  2LKO A;  5IP4 D;  3MC9 A;  3ZGZ A;  4GNK B;  2DYO A;  3HQC A;  2J0K A;  2K2J A;  1EUV B;  1YD8 U;  5C3J B;  4E71 A;  5D94 A;  3ZVV A;  2RGN B;  1SHC A;  4BFR A;  1BUI C;  3DXD A;  1B1Z A;  2WWZ A;  4MH0 E;  3VTU A;  1S1Q B;  3P4R B;  1T0S C;  3QCA A;  1R7S A;  2KWU B;  4HPL B;  4GXB A;  2HTM E;  2KOX A;  1V61 A;  1FGZ A;  3TEW A;  5LXH A;  4US8 A;  4W9K A;  2A5U A;  2K8H A;  3KSY A;  3AED B;  1AWD A;  4AS1 A;  1GGO A;  1XO3 A;  3AN1 A;  5BO4 B;  5H8Y E;  2BGF A;  3DCG A;  3DOW A;  4KGT A;  1FM0 D;  3Q3O C;  3NY5 A;  1FOE A;  2KDB A;  2JZP A;  1ENF A;  5AZG A;  2K25 A;  3N9Y C;  1P5T A;  2L1A A;  1OGW A;  3NWF A;  1WF9 A;  1XCT L;  2MBE A;  3L4P A;  2EEL A;  3RPF C;  3SO6 A;  2UVM A;  3B1L X;  5D7G A;  1CMX B;  1BXT A;  1XQQ A;  2EKI A;  4II3 B;  2L3Z A;  4EOY A;  1DDW A;  2V4I B;  3MFG A;  2BCJ A;  1DYQ A;  1E90 A;  2FCN A;  2HDE A;  4WJP A;  2KUQ A;  3Q3J A;  3CXB B;  4JKE A;  2L2I A;  5LON B;  2QEJ C;  5HFY A;  1UNP A;  1DIK A;  3AE5 B;  1XD3 B;  3AEB B;  3NWA A;  4I6P A;  3VIA A;  3TBL D;  2OOB B;  2G4S A;  1X05 A;  4WJ7 A;  1P3Q U;  4A6F A;  2ASQ A;  1JAL A;  3TUO A;  1DDV A;  1WGD A;  4WUR A;  2CS4 A;  2NBW B;  1AYF A;  3NG0 A;  2UZR A;  2DKQ A;  2ACZ B;  1J7A A;  4FHK A;  2KNB A;  4G3X B;  2Z0D B;  5DCN A;  4H2A A;  3W1S C;  4DDG D;  3H7P B;  1QOF A;  1B55 A;  2FJL A;  2M0A A;  5AUI A;  2BWE S;  3PRE A;  2WDQ B;  2MJD A;  3WAN A;  2WH5 A;  3A98 B;  1CJE A;  4GOC A;  2J0J A;  3IAS 1;  3RYT A;  2GJY A;  2X38 A;  3WAL A;  1Y8R C;  4ASW C;  4I6N B;  4MGK E;  1GOZ A;  1QZE A;  3W5V B;  3MJ5 A;  1H4R A;  3DHI C;  4RGO S;  2WGS A;  2QIL A;  1VJK A;  4K17 A;  2MCN B;  2MJE A;  2X0S A;  2G35 A;  2CU1 A;  1NU2 A;  4HKQ A;  3IBE A;  4MK0 A;  3E9O A;  1WGH A;  1HZ6 A;  3NVZ A;  3DBL I;  5KHO A;  1WXQ A;  3HIZ A;  4IKG A;  4EJN A;  5AZF A;  2KQ4 X;  4EEW A;  3TVV A;  5IKC M;  3PG7 A;  3PV1 A;  3A9K B;  2WP9 B;  2CR5 A;  3KH0 A;  3ZTD A;  1TJE A;  4IAP A;  1V86 A;  1IYF A;  1W1D A;  2Z4D A;  3BYY B;  1GAQ B;  4GDK B;  5JH5 C;  4G50 A;  2V4L A;  1U27 A;  4ANU A;  1G6J A;  1E7P B;  1YJ1 A;  1E10 A;  3MJW A;  5JHG A;  3M1I B;  4DHJ D;  2GBM A;  3HM6 X;  1AAR A;  1KF6 B;  2D3B A;  2BTE A;  2K1F A;  3LXF A;  2NPT B;  5D3I B;  4EE2 A;  4R3D A;  3L10 B;  2IZV B;  4TMA B;  2RSU A;  4CHM A;  1J19 A;  4BOS C;  2L05 A;  1OFF A;  2JZZ A;  3NRZ A;  3Q8F A;  1JRO A;  2DZM A;  2RSG A;  2J7Q B;  4B0E A;  1C76 A;  1RYJ A;  2VZK D;  1V8C A;  2N9L A;  2WXH A;  1U5F A;  4HB3 B;  5KCV A;  3RD2 A;  2LGD A;  4N9F 4;  1WE7 A;  4CSQ A;  3VHT C;  1J8C A;  2AL6 A;  1EU4 A;  2COF A;  2WXK A;  4GMX B;  3CIK A;  1EGX A;  4PS8 A;  5G5H A;  2IY0 B;  1QIL A;  4GLS C;  3JSV A;  1KZ7 A;  1MJD A;  1IP9 A;  3FIL B;  3QQ8 B;  1ZC4 B;  3JYU A;  5EE3 A;  2O2V B;  4JWS C;  2GBJ A;  1WJM A;  4XYC A;  4MJS B;  4MGI E;  4MGY E;  2R82 A;  3H9D A;  2LG1 A;  1ROE A;  4OVU A;  1MAI A;  2N9P C;  3PP2 A;  3H1U A;  1H8C A;  1BML C;  2WXP A;  4YT0 B;  2VRR B;  1WR1 A;  2DN6 A;  1V49 A;  3AE6 B;  1STE A;  1W1H A;  1FNV A;  3BK1 A;  2EJ8 A;  4GDL A;  2RUK B;  5BYQ A;  1F2R I;  2IND C;  1I4Q A;  3SBT A;  1U5D A;  3ECI A;  2PMV A;  3GZN B;  3JW0 X;  1J7C A;  1JQ4 A;  2REX A;  3EFU A;  2W3R A;  3NS8 A;  1N6Z A;  5DH9 B;  4HAV B;  2E3T A;  3QK0 A;  5FR6 A;  2NMB A;  2I1K A;  2BB5 A;  3BVZ A;  3RI7 C;  1V5T A;  2Z14 A;  2XK5 A;  3Q8B A;  1I4P A;  3N30 A;  1ZE3 D;  3RN9 C;  4W9C A;  1AN8 A;  2QSD A;  1RM6 C;  3AE4 B;  4YTN B;  2JXX A;  4JK9 A;  3MC8 A;  4NNJ B;  3V62 A;  2DHZ A;  4WWM A;  2I2Y A;  1V5O A;  4YTP B;  2YS3 A;  2Y3A A;  3PVU A;  5EDS A;  1EAZ A;  1TJ6 A;  3A1Q B;  4RCO A;  2LXC A;  3PGE A;  3GP7 A;  2QMT A;  2K3U A;  4RNA A;  2YS1 A;  4QXA B;  1SE2 A;  4FAD A;  1HEZ E;  3NVY A;  4AJW A;  3E9L A;  3V6C B;  3UGB B;  2XN9 C;  3PSC A;  3AE3 B;  5TSS A;  1ZXH A;  3ZXV A;  1NVL A;  1TBE A;  2YRY A;  2MJ3 A;  4LDT D;  3ZVR A;  3W2D A;  4OVV A;  2IGG A;  3HK0 A;  3U2S C;  4IUM B;  3OAN A;  5IAA C;  4WSF A;  3HM3 A;  3C19 A;  2JSV X;  2KT7 A;  4YSX B;  2ADZ A;  4IM0 A;  5D3X A;  2LXA A;  5FK9 C;  2DFK A;  4W9L A;  1VBG A;  1V1O A;  4HRS A;  1TZO A;  2AL3 A;  2R61 A;  2YT0 A;  2D5G A;  4M8M A;  2L32 A;  2XEW A;  4HB0 B;  3VAW A;  1TS5 A;  2LRU A;  2WX1 A;  1KBL A;  5BMG A;  4KVG B;  5T8I A;  1WZ0 A;  5TR5 A;  3U4E G;  2FAZ A;  3A33 B;  3TJP A;  3N7C A;  1YQ3 B;  4YXD B;  2J52 A;  4HAU B;  4C56 C;  1ZGU B;  1YJI A;  2LJI A;  3W1Y A;  1D6E C;  3H7P A;  1HTO A;  1RRP B;  4QAY A;  1T77 A;  1KLG D;  1UEL A;  4A6F B;  3B0A A;  5BMH A;  1C3T A;  4FHJ A;  1P3R A;  4Y94 A;  4JKH A;  2NTS A;  4LNK A;  5D6J B;  4MT7 A;  2D07 B;  2IYD B;  4HPM B;  4K2O A;  2K8E A;  2Y8F A;  2UWQ A;  1E8Y A;  2K22 A;  1GB4 A;  3RZF A;  1VD2 A;  3N1Z C;  4E3C A;  1E6E B;  5L83 A;  1K52 A;  1L0Y B;  3BII D;  4BAX A;  2D10 A;  3VUX A;  2YEP B;  2JWZ A;  2DHK A;  1P7F A;  2DTC A;  3IT6 B;  2DAF A;  3APC A;  3SD5 A;  3KZ1 A;  2W82 A;  4FA6 A;  1PGB A;  1WR6 E;  1WM3 A;  4Z2N A;  2QIE B;  2ROV A;  1OMW A;  4DXA B;  1Q1O A;  3A9K A;  4C7Z A;  1TKY A;  3K9O B;  2BB6 A;  2MBQ A;  1SSN A;  1BTN A;  3TL5 A;  1GUA B;  4XDC A;  4KKJ A;  1HE8 A;  1D5Z C;  4NQK E;  3PLU A;  1UGM A;  2CY4 A;  3QX1 A;  2KXJ A;  2NCN A;  4K1R B;  4WH4 A;  3ML4 A;  2FE8 A;  1R4N B;  4M8N A;  2KYW A;  4ARI A;  1YIW A;  1C1Y B;  1V80 A;  3ULC A;  1C78 A;  4W9E A;  1SIF A;  2E2X A;  4KDI C;  1SE9 A;  2AWT A;  3M63 B;  5E6O A;  1Q5W B;  3OHM B;  2NPT A;  4H8S A;  5C2T B;  5DHA B;  4BKG A;  3N3K B;  1M4V A;  2WXQ A;  4EZJ A;  1IGD A;  3O65 B;  5JHH A;  2I38 A;  3VTV A;  1ET9 A;  2AX5 A;  5C6R A;  3VOQ A;  4K7U A;  3QA8 A;  1KRH A;  1D5M C;  4ICV A;  1NYR A;  2BKF A;  1JRU A;  2RRF A;  4US9 A;  4IG7 B;  4IWO A;  3TFM A;  4KGS A;  3VUW A;  2JUO A;  3BK2 A;  3L08 A;  1V9J A;  4L1R A;  3ENB A;  2ICI A;  3ZYY X;  2I1J A;  1TQZ A;  2BS4 B;  1J0G A;  5JZE B;  3EGR A;  3AU4 A;  4MSM B;  4HEA 1;  3VDZ A;  2LGY A;  3ODO A;  3HUI A;  4JPS A;  3I9V 1;  2QJL A;  2CJO A;  1FHW A;  3UIP B;  3NS1 A;  5CHW A;  3IFW B;  4USA A;  5L95 C;  4GIV A;  5D2M B;  3Q3N C;  2DZJ A;  2ZVO A;  3V5W A;  2ZVN A;  1E0Z A;  3T3O A;  1YN5 A;  5C79 A;  1SEB D;  1HXY D;  2WS3 B;  2M17 A;  2GLS A;  4MJS A;  2RGF A;  2WXI A;  1Z87 A;  2R2O A;  1WVH A;  2P0F A;  4NJ7 A;  3APF A;  1KTK A;  3EC8 A;  2GBN A;  4P6V F;  4MSQ B;  3U7Z A;  3EPY A;  3PZD A;  4BKS A;  1AW7 A;  2L83 A;  2IGH A;  3I3T B;  3L0W B;  3AJ4 A;  2DHJ A;  4MAC A;  2V9H A;  2VH1 A;  2ZEQ A;  3OJ4 B;  3PHX B;  3IAM 1;  3ZO5 B;  1ZM0 A;  2B76 B;  1F52 A;  5CHF A;  3NWD A;  2ELA A;  3MPX A;  5BMI A;  4GB9 A;  4GDL B;  4A9A A;  3TCA A;  2KJR A;  4B6W A;  1NYQ A;  1U5E A;  5FKA C;  1YMH E;  4D6W A;  2DZI A;  5KQ4 A;  2K00 A;  2M14 A;  2LHD A;  4RGN A;  2W9N A;  1ZC3 B;  1V1P A;  2BPS A;  1F9J A;  4J3O D;  4A8X C;  4CHK A;  2WU5 B;  3TEY A;  2NBV B;  2XK5 B;  4KZC A;  1TXD A;  1PMS A;  3GYP A;  1Z5S B;  3E9S A;  3A1Q A;  4HLE A;  1T0R C;  2CAY A;  1ZP0 B;  1X1M A;  3B2F A;  2BKR B;  4EUT A;  3U30 A;  2GCJ A;  2H7D A;  1N61 A;  4A90 A;  5C1Z A;  2INN E;  1Q10 A;  2LUL A;  5AZH A;  4HAT B;  1WGG A;  2MLB A;  1PLS A;  3L13 A;  3AUL A;  1PUT A;  2MQJ A;  4HAY B;  1OEY J;  2HTH A;  3G9W A;  2IO1 B;  4IDI A;  3AEE B;  5IJM A;  4LK0 M;  3AE8 B;  1L0X B;  4K7S A;  3CSF A;  3AI5 A;  3P4S B;  3L17 A;  4RM8 A;  2JZ3 B;  4W9I A;  4KDL B;  1WSP A;  3AMZ A;  2DYB A;  2FCS A;  2PEA A;  1FEH A;  4K2P A;  4NZL B;  5J17 A;  1SE3 A;  4JK7 A;  1FIQ A;  3RFZ B;  1LO5 D;  3ZDT A;  1K5D B;  3KWV A;  2IGD A;  1RFK A;  4A6K A;  2Q13 A;  4W9G A;  3VTW A;  2N4F A;  1CK1 A;  2EC1 A;  4FN2 A;  5J18 A;  2JU6 X;  2L52 A;  2LRW A;  2JY6 A;  4II2 B;  5DHF B;  2V3P A;  2D3G A;  4IM2 A;  2W54 A;  3TEZ A;  5G2N A;  5G5G A;  2WXN A;  2M56 B;  4XWW A;  2CHX A;  2KMC A;  2BYE A;  2OED A;  1YN3 A;  3V61 A;  1VRA B;  4ICU A;  3AEG B;  2ZJD A;  2LVQ A;  4OHJ A;  1T0Y A;  3RZW C;  4W9H A;  1ZUD 2;  1DOI A;  2FCQ A;  2O6V D;  3Q2A C;  5AEK B;  4LJO B;  5C16 A;  5I2M A;  4TV3 A;  3BZD B;  3Q69 A;  2NMQ A;  1I4H A;  3KVF B;  4XGA B;  3ZQ4 A;  2HJ1 A;  4FJV B;  1GC6 A;  1K8R B;  3NUH B;  4GN1 A;  1NEK B;  4AUQ C;  3ODW A;  3Q3F A;  3DBL B;  1FMA D;  4LNO A;  1FXT B;  3IG3 A;  2BVC A;  4BZA A;  1WXM A;  3MHZ A;  4YON A;  2GMI C;  3R66 C;  4KHO A;  4DXF A;  1J7B A;  1SJE D;  1NDD A;  1IRS A;  1UBQ A;  2SAK A;  5LG4 B;  4FXC A;  3QJZ A;  1VR9 A;  1X11 A;  2J0M A;  4W9F A;  2CY5 A;  4D0N B;  2D2Q A;  1JWA D;  5DPS A;  2Z8L A;  5J3Q A;  3DBR I;  4L2Y A;  1TZ1 A;  4B9K A;  3URY A;  4HAX B;  1T5X D;  2H88 B;  1C4A A;  1C4C A;  3H6N A;  3V60 A;  1TKG A;  4RMA A;  1KJT A;  1D4B A;  1FFU A;  4FLH A;  3ML8 A;  2DYN A;  4HRO A;  3A4S C;  1QQG A;  1OTR B;  4JQW C;  5MPO A;  2ELB A;  3W9C B;  5L81 A;  2JYT A;  4A55 A;  3DVG X;  3FSS A;  2MSE D;  2D3C A;  4HB2 B;  4P16 A;  3A9J A;  4DHJ B;  4KHB A;  3ABV B;  3A8Q A;  4W9J A;  4CHJ A;  2AQ2 B;  1KOT A;  5FI0 A;  1FRR A;  1JWU D;  5EFX A;  4ACF A;  3U12 A;  4A5K A;  1I2H A;  2UYZ B;  5BYR A;  1RJ2 A;  3P6A A;  2NS5 A;  1I4X A;  2EMT A;  1F2R C;  1HQR D;  2NZ8 B;  3P7Z A;  2KTF A;  2RD0 A;  3UIN B;  1LB1 A;  4EZK A;  4ZRP A;  5KQ1 A;  1VZ6 A;  1V2Y A;  1YX6 B;  5AUK A;  4NJC A;  4XZ4 A;  1QF6 A;  4YTM B;  3ZIM A;  5I4D A;  4EFO A;  2LEK A;  1XKE A;  4DX9 0;  2V1Y A;  5E6J A;  1FNU A;  3HSA A;  3AB5 A;  5HKH A;  2VZK B;  4BKT A;  3CMM B;  4PT5 A;  2YLM A;  1ZSQ A;  5J3T A;  1IBX A;  1MK9 B;  1DDM A;  2G4D B;  3PPA A;  3K9P B;  3ZNZ B;  5D3W A;  3RCZ A;  1TTN A;  2RR9 A;  2V0G A;  2Y8G A;  3F0W A;  2PW9 A;  3A4R A;  1JW9 D;  2RPV A;  3X0W A; 
#chains in the Genus database with same CATH homology
 4A3O A;  1Q0W B;  4NY0 A;  2D9V A;  2IO2 B;  4F7H A;  1P98 A;  4P7I A;  2CQU A;  2C9W B;  2MDX A;  4TQ0 A;  1JDE A;  1V6E A;  2N7E A;  1P1A A;  1KC7 A;  2R0D A;  4JKC A;  4YL8 A;  4EZL A;  4ILJ A;  1FHO A;  1NTV A;  2MFQ A;  4MEM A;  1PFJ A;  2W2X D;  4TQ1 A;  2KVR A;  4NAW B;  2RQ1 A;  2FDQ A;  3H7S A;  2BYF A;  1HB6 A;  1GJZ A;  3ONS A;  2R09 A;  4DHZ E;  2RPQ A;  1YX5 B;  3D8E A;  1XR0 B;  2KWC A;  2G45 B;  3ODX A;  3ALB A;  4MEL A;  1HBK A;  4WWN A;  2EMS A;  3GYO A;  2L00 B;  4B6H A;  4WJO A;  2LUE A;  1UD7 A;  4LCD E;  4WWO A;  3CST A;  1WGR A;  3KY9 A;  3DVN V;  3B08 A;  5JLJ B;  2HTH B;  3SV1 A;  2GOW A;  1FB8 A;  2KD0 A;  3ZRF A;  4AWJ A;  3P2B A;  2JT4 B;  2IYB A;  2COA A;  3VXW A;  2MBB B;  1WXS A;  2M4N A;  4F7G A;  4TYZ A;  4LDT B;  3FLV A;  2KDE B;  2BWF A;  1U2B A;  3M62 B;  2DX1 A;  5JHA A;  3AU5 A;  4TKN A;  4PYZ A;  3DXE A;  2KC1 A;  2N1V A;  1E5W A;  2CHW A;  3TIX A;  2NBU A;  4IWQ A;  3QHT A;  1WI0 A;  2KDI A;  2N23 A;  2K6Q A;  2R2Q A;  2KJ6 A;  2COP A;  3FP5 A;  4F1S A;  4KSK C;  3PRZ A;  3OAW A;  5C23 A;  1WFY A;  5LXI B;  1EF1 A;  1UBI A;  3WIM A;  3PEG A;  4DBB A;  2C7N B;  3ZNG C;  3M3J A;  3KUZ A;  4KAX B;  1UPQ A;  1S3S G;  2O6V A;  4BBK A;  2X18 A;  4WVF B;  2NR2 A;  2A4Z A;  5E6N A;  2DX5 B;  3SDL C;  4HB4 B;  2KLG A;  2YF0 A;  4IW0 A;  5CLQ B;  3U7D A;  2K39 A;  4NSW A;  4RM9 A;  2DYM A;  3SBG A;  4ANW A;  2YSZ A;  1WZ3 A;  3PHW B;  2C7M B;  5LOP B;  2LWP A;  2UZS A;  2HE7 A;  1R4M I;  2VKI A;  5GMV A;  4ZYN A;  3EEC A;  2L1C A;  2KK8 A;  2FNJ B;  3ZNI D;  1WJN A;  1V5P A;  2LOX A;  1K5G B;  5JHB A;  3X23 A;  5JVL A;  1DYN A;  2H7E A;  2LOZ A;  2KX3 A;  2LGX A;  2V3S A;  3T8M A;  2ZCC A;  4KIK A;  4C0A A;  2MW5 A;  1WRD B;  2HRJ A;  4WQO B;  4FJY A;  1AQC A;  1ZVR A;  1AWE A;  2KLC A;  2L76 A;  1UPR A;  2PE6 B;  3KRW A;  5HE1 A;  3PSE B;  1WX7 A;  1GNU A;  3A9J B;  2OTX A;  4L6E A;  4KHB B;  2KJH B;  3PVL A;  3S2A A;  2LVO A;  4JKA A;  4DK5 A;  2KX0 A;  4X57 B;  3NZU A;  1KLV A;  3E9P A;  1XOD A;  1Z2M A;  1BTK A;  3WAM A;  2ZCB A;  2KO3 A;  1WXA A;  1E8W A;  4WWP A;  3HW2 B;  5HE0 A;  1BT0 A;  4DDI D;  3BIN A;  2MRP A;  3MDB C;  1BWN A;  3TO1 A;  4NPN A;  2C5L C;  2L0F A;  3QWZ B;  4BBN F;  2BYV E;  3OLM D;  2I5C A;  3T06 A;  2C60 A;  1EVH A;  2RNR B;  5D3V A;  3VQI A;  1RAX A;  3WA0 A;  3RUL A;  1LM8 B;  4GPT B;  4LJP B;  3UIO B;  2LI5 A;  4DWF A;  3DPD A;  1XT9 B;  2YS5 A;  4NAW A;  4DBG A;  1EO6 A;  1UEF A;  1P6S A;  4PYU A;  2JRH A;  2HD5 B;  2PE9 A;  2K2U A;  1UNQ A;  2D9Z A;  2LYD A;  4ZRJ A;  1M94 A;  3VFK A;  2FCM A;  1WXV A;  1I42 A;  3CF6 E;  2P0H A;  2DZK A;  4BBN C;  1NTY A;  1ZW7 A;  4JKG B;  5CLL B;  3TMP B;  4PQ0 A;  2B3A A;  2Y5B B;  2D11 A;  5JP4 A;  4M0W B;  1WJU A;  1GG3 A;  2C7H A;  3BJI A;  4GMV A;  3BY4 B;  3FEH A;  2KWV B;  3DVG Y;  3R3M A;  1WY8 A;  2JF5 A;  4A20 A;  1WIA A;  2GBR A;  3V6E B;  4BOZ B;  4F7Z A;  2WYQ A;  2KFK A;  1MG8 A;  3ZLZ A;  2N9X A;  3DDC B;  1XD4 A;  3FM8 C;  2AYO B;  2MP2 A;  3WAO A;  3HHM A;  2M0X A;  2QHO A;  1J0W A;  2FJ9 A;  2MWS B;  1DBH A;  3DBH I;  3NOB A;  1WG7 A;  2IO0 B;  4HXD A;  4WJQ A;  1L7Y A;  1WJ4 A;  4MDK E;  2L0T A;  3F5R A;  3NZS A;  4FBJ B;  3TW1 A;  1XCG A;  3OJ3 A;  2RLO A;  4KV2 A;  3UF8 A;  1E7V A;  3UZT A;  3PLV A;  4FUL A;  2Z0Q A;  1FAO A;  1WX8 A;  2DYQ A;  2JRI B;  3KYC D;  3KRX A;  1WJ6 A;  4GU2 A;  1U5G A;  3KUD B;  1E8Z A;  2DKP A;  2DX5 A;  3ZNH B;  2ZNV C;  1D3Z A;  4J6I A;  2Z0E B;  3ZKJ C;  1MKE A;  2Z0O A;  2O6V B;  3PT2 B;  2FUH B;  2M38 A;  4JKD A;  4GSW A;  4MY6 A;  2WX0 A;  4JL9 A;  4HK2 A;  1W1G A;  2KUP A;  1WI1 A;  2HJ8 A;  4F8C B;  3C0R B;  2YT1 A;  2ROZ B;  2J59 M;  1RLF A;  2BF8 B;  3DVN U;  1ACA A;  1UNR A;  1OEY A;  4JKF A;  4I6L B;  2N7D A;  3QBV B;  4ZDV A;  1WJ1 A;  3PRM B;  2ZNV B;  3NHE B;  3A8P A;  2K8C A;  5G55 A;  2KDF B;  2MWN B;  4CYE A;  2KFJ A;  1N3H A;  3PRP B;  2N0Y A;  4KZ0 A;  2Y7B A;  3R7R A;  1OQN A;  5DPW A;  2CB8 A;  3SNH A;  1NBF C;  4KIK B;  2DEN B;  3ULB A;  3ENE A;  4NJ6 A;  2KGX B;  2LD9 A;  2M1M A;  3EHV A;  3QIJ A;  4JK8 A;  4ILH A;  3MTN B;  2P8V A;  4PS7 A;  2GCL A;  5DPR A;  2LBB A;  4GZU A;  3O96 A;  5C5B A;  2KC2 A;  2LZ6 A;  1WMH B;  3UQB A;  5J2R A;  3WYF B;  2NVU I;  1ZKH A;  1LW3 A;  1H10 A;  1X1G A;  4W9D A;  3RT3 B;  3DQV A;  4DHZ B;  4EKU A;  3DBS A;  3L16 A;  2VRW B;  4IM3 A;  3KW5 B;  2GBK A;  2W2X C;  1I35 A;  1FHX A;  3D8F A;  2RVB B;  1NTI A;  3QWM A;  4Z2M B;  5E6P A;  2K6D B;  4E74 A;  3LJU X;  1OY2 A;  4WJN A;  5J3Y A;  3PTF C;  2Z59 B;  1HB8 A;  4IWP A;  2DA0 A;  4IC7 B;  1V5U A;  4BKS D;  2COC A;  4MM3 A;  1I7A A;  3IVF A;  2KTR B;  3T9L A;  5HE3 A;  3QAQ A;  3NSU A;  1BAK A;  4A6H A;  4HDQ A;  4JKG A;  2DHI A;  1XX0 A;  3VH3 B;  1E7U A;  1WM2 A;  1MIX A;  1LXD A;  1X86 A;  1A5R A;  2OQB A;  4KHA A;  3VVW B;  3VUY A;  5CX3 A;  2KN5 A;  3APD A;  2MBH A;  2KKC A;  2I5F A;  2VSZ A;  4K81 A;  3R7Q A;  4HVB A;  4EMO A;  3GZN I;  1MK7 B;  4HAZ B;  1Q67 A;  5D3Y A;  3ZRC A;  5HE2 A;  2OJR A;  4IOY X;  2IFS A;  2KCJ A;  1DRO A;  2N9E B;  2KFK B;  1MPH A;  1RFA A;  1NI2 A;  1V5M A;  2LVP A;  2MP2 B;  2PJH A;  4URK A;  5IA7 A;  2MA9 B;  3E66 A;  4ANV A;  5DPT A;  1GC7 A;  1KZG A;  4DX8 A;  3JVZ X;  1OQY A;  3WAP A;  4CO7 A;  1X1F A;  3SYX A;  2LJ5 A;  4ANX A;  4JGH B;  2V76 A;  4HWI B;  3PVW A;  1RRB A;  1KM7 A;  1WGU A;  4AP4 C;  5LLI A;  3RUI B;  4BVU C;  3KYD D;  2COD A;  2ZPY A;  1P9D U;  2XBB C;  4GGQ A;  1WYW B;  2G3Q B;  2IBI B;  3UQA A;  2JPH A;  3VH4 B;  1PQS A;  1UZX B;  2D9W A;  2CHZ A;  2KHW B;  2FID A;  2M8S A;  2CRF A;  2KZR A;  4XX5 A;  4JIO U;  2IY1 B;  1FGY A;  2Z0P A;  4HCP B;  2CKH B;  2PZ1 A;  2WDT B;  4AOF A;  1QC6 A;  1V88 A;  1Y19 B;  3RCP A;  3PS6 A;  1V89 A;  5DI9 B;  2XQN M;  4PNK A;  1E8X A;  1UH6 A;  4JLC A;  3ZDM C;  2LAS A;  1M7E A;  1VBH A;  4NQL B;  4TUU A;  2KMA A;  3SHQ A;  1LFD A;  3U8Z A;  1ISN A;  2L7R A;  2IO3 B;  3N32 A;  1EF5 A;  2D4Q A;  4PS3 A;  5CHV C;  2YVC A;  4K7W A;  1WH3 A;  3W1S A;  3KUC B;  3D8D A;  3M95 A;  4G11 A;  5D27 A;  3ML9 A;  2D9X A;  4ZRI A;  1WGQ A;  3MHS D;  4GDK A;  1Y5O A;  1TGZ B;  4HJK A;  4MGZ E;  3QC8 B;  3AXC A;  3SU8 X;  2MKR A;  1LQB A;  2KAN A;  1WX9 A;  2JP2 A;  4AJY B;  2D9Y A;  3LDZ E;  3ZUN A;  4HAW B;  2JVC A;  1R4N I;  3DXC A;  1U29 A;  4IFS A;  1WMH A;  4XC2 A;  5C5B B;  1WE6 A;  5CTR C;  1M7R A;  3L54 A;  5DIF B;  2FIF A;  5KHQ A;  2ZZP B;  2N1W A;  2W2W A;  3ZW3 A;  2MX2 A;  4ILG B;  3GOE A;  2ZPN A;  2QKM A;  2GS0 A;  2KQS A;  4A3P A;  3IHP C;  1YQB A;  2L8J A;  2ABD A;  2DIK A;  1P0R A;  4HDO A;  1KI1 B;  1ST7 A;  5FI1 A;  2DAJ A;  4JKB A;  3D32 A;  2DLW A;  1V81 A;  4FJZ A;  2O2V A;  1U4A A;  4G0N B;  4F7U P;  4KSL C;  2PPH A;  3JSV B;  3SUZ A;  2AEH A;  3QAR A;  1MIZ B;  2KTR A;  2KQ7 A;  3ZTC A;  3LJ3 A;  1VCB A;  4HCN B;  2K8B A;  4ZRK A;  5GOW B;  1IPG A;  1WGY A;  1SGH A;  2QKL A;  4XWX A;  4WAA A;  2MBO A;  4B95 A;  2P0D A;  2EKE C;  1L2N A;  4HHV A;  2LKO A;  2DYO A;  3HQC A;  2J0K A;  2K2J A;  1EUV B;  1YD8 U;  4E71 A;  5D94 A;  3ZVV A;  2RGN B;  1SHC A;  4BFR A;  3DXD A;  2WWZ A;  4MH0 E;  3VTU A;  1S1Q B;  3QCA A;  2KWU B;  4HPL B;  4GXB A;  2KOX A;  1V61 A;  1FGZ A;  5LXH A;  4W9K A;  2A5U A;  2K8H A;  3KSY A;  1GGO A;  5BO4 B;  2BGF A;  3DCG A;  3DOW A;  3NY5 A;  1FOE A;  2KDB A;  5AZG A;  2K25 A;  1P5T A;  1OGW A;  1WF9 A;  2MBE A;  3SO6 A;  2UVM A;  3B1L X;  5D7G A;  1CMX B;  1XQQ A;  4II3 B;  2L3Z A;  4EOY A;  1DDW A;  2BCJ A;  1E90 A;  2FCN A;  4WJP A;  3Q3J A;  3CXB B;  4JKE A;  2L2I A;  5LON B;  1UNP A;  1DIK A;  1XD3 B;  4I6P A;  3VIA A;  3TBL D;  2OOB B;  2G4S A;  1X05 A;  4WJ7 A;  1P3Q U;  4A6F A;  2ASQ A;  1DDV A;  1WGD A;  2CS4 A;  2NBW B;  2UZR A;  2DKQ A;  4FHK A;  2KNB A;  4G3X B;  2Z0D B;  5DCN A;  4DDG D;  3W1S C;  3H7P B;  1B55 A;  2FJL A;  2BWE S;  3PRE A;  3WAN A;  2WH5 A;  3A98 B;  4GOC A;  2J0J A;  3RYT A;  2GJY A;  3WAL A;  1Y8R C;  4ASW C;  4I6N B;  4MGK E;  1QZE A;  1H4R A;  4K17 A;  2MCN B;  2X0S A;  2G35 A;  2CU1 A;  1NU2 A;  3IBE A;  4MK0 A;  3E9O A;  1WGH A;  3DBL I;  5KHO A;  3HIZ A;  4EJN A;  5AZF A;  4EEW A;  3TVV A;  3PG7 A;  3PV1 A;  3A9K B;  2CR5 A;  3KH0 A;  3ZTD A;  4IAP A;  1V86 A;  1IYF A;  1W1D A;  4GDK B;  5JH5 C;  4G50 A;  2V4L A;  1U27 A;  4ANU A;  1G6J A;  1YJ1 A;  3MJW A;  5JHG A;  3M1I B;  4DHJ D;  2GBM A;  3HM6 X;  1AAR A;  2K1F A;  2NPT B;  3L10 B;  2IZV B;  2RSU A;  4CHM A;  1J19 A;  4BOS C;  2L05 A;  2JZZ A;  2DZM A;  2RSG A;  2J7Q B;  1U5F A;  4HB3 B;  5KCV A;  3RD2 A;  2LGD A;  4N9F 4;  1WE7 A;  3VHT C;  1J8C A;  2AL6 A;  2COF A;  4GMX B;  3CIK A;  1EGX A;  4PS8 A;  2IY0 B;  3JSV A;  1KZ7 A;  1IP9 A;  3QQ8 B;  1ZC4 B;  3JYU A;  2O2V B;  2GBJ A;  1WJM A;  4MJS B;  4MGI E;  4MGY E;  2R82 A;  3H9D A;  2LG1 A;  4OVU A;  1MAI A;  2N9P C;  3PP2 A;  3H1U A;  1H8C A;  2VRR B;  1WR1 A;  2DN6 A;  1V49 A;  1W1H A;  2EJ8 A;  4GDL A;  2RUK B;  3SBT A;  1U5D A;  3ECI A;  3JW0 X;  2REX A;  3EFU A;  3NS8 A;  5DH9 B;  4HAV B;  3QK0 A;  5FR6 A;  2NMB A;  2I1K A;  1V5T A;  2XK5 A;  3N30 A;  4W9C A;  2JXX A;  4JK9 A;  4NNJ B;  3V62 A;  2DHZ A;  1V5O A;  2YS3 A;  3PVU A;  5EDS A;  1EAZ A;  1TJ6 A;  3A1Q B;  2LXC A;  3PGE A;  2YS1 A;  4FAD A;  4AJW A;  3E9L A;  3V6C B;  3UGB B;  3PSC A;  1NVL A;  1TBE A;  2YRY A;  4LDT D;  3ZVR A;  4OVV A;  3HK0 A;  4IUM B;  3OAN A;  5IAA C;  4WSF A;  3HM3 A;  2ADZ A;  4IM0 A;  5D3X A;  2LXA A;  2DFK A;  4W9L A;  1VBG A;  2AL3 A;  2YT0 A;  4M8M A;  2XEW A;  4HB0 B;  3VAW A;  2LRU A;  2WX1 A;  1KBL A;  4KVG B;  1WZ0 A;  5TR5 A;  2FAZ A;  3A33 B;  3TJP A;  3N7C A;  4HAU B;  1ZGU B;  3W1Y A;  3H7P A;  1RRP B;  3B0A A;  1UEL A;  4A6F B;  1C3T A;  4FHJ A;  1P3R A;  4Y94 A;  4JKH A;  5D6J B;  4MT7 A;  2D07 B;  2IYD B;  4HPM B;  4K2O A;  2Y8F A;  2UWQ A;  1E8Y A;  3RZF A;  1VD2 A;  4E3C A;  5L83 A;  2D10 A;  3VUX A;  2JWZ A;  2DHK A;  2DTC A;  2DAF A;  3APC A;  3SD5 A;  3KZ1 A;  4FA6 A;  1WR6 E;  1WM3 A;  4Z2N A;  2ROV A;  1OMW A;  4DXA B;  1Q1O A;  3A9K A;  3K9O B;  2MBQ A;  1BTN A;  3TL5 A;  1GUA B;  1HE8 A;  4NQK E;  3PLU A;  1UGM A;  2CY4 A;  3QX1 A;  2KXJ A;  2NCN A;  4K1R B;  3ML4 A;  4M8N A;  1YIW A;  1C1Y B;  1V80 A;  3ULC A;  4W9E A;  1SIF A;  2E2X A;  4KDI C;  1SE9 A;  2AWT A;  3M63 B;  5E6O A;  1Q5W B;  2NPT A;  4H8S A;  5DHA B;  4BKG A;  3N3K B;  4EZJ A;  3O65 B;  5JHH A;  3VTV A;  5C6R A;  3VOQ A;  4K7U A;  3QA8 A;  4ICV A;  2BKF A;  1JRU A;  4IG7 B;  4IWO A;  3TFM A;  3VUW A;  2JUO A;  3L08 A;  1V9J A;  3ENB A;  2I1J A;  1TQZ A;  1J0G A;  5JZE B;  3AU4 A;  4MSM B;  3VDZ A;  2LGY A;  3ODO A;  1FHW A;  3UIP B;  5CHW A;  3IFW B;  5L95 C;  4GIV A;  5D2M B;  2DZJ A;  2ZVO A;  3V5W A;  2ZVN A;  5C79 A;  2M17 A;  4MJS A;  2RGF A;  1Z87 A;  2R2O A;  1WVH A;  2P0F A;  4NJ7 A;  3APF A;  3EC8 A;  2GBN A;  4MSQ B;  3EPY A;  3PZD A;  4BKS A;  3I3T B;  3L0W B;  3AJ4 A;  2DHJ A;  2ZEQ A;  3OJ4 B;  3PHX B;  3ZO5 B;  1ZM0 A;  5CHF A;  2ELA A;  3MPX A;  4GB9 A;  4GDL B;  3TCA A;  2KJR A;  4B6W A;  1U5E A;  2DZI A;  5KQ4 A;  2K00 A;  2M14 A;  2W9N A;  1ZC3 B;  2BPS A;  1F9J A;  4CHK A;  2NBV B;  2XK5 B;  4KZC A;  1TXD A;  1PMS A;  3GYP A;  1Z5S B;  4HLE A;  3A1Q A;  2CAY A;  1X1M A;  2BKR B;  4EUT A;  3U30 A;  2GCJ A;  2H7D A;  5C1Z A;  2LUL A;  5AZH A;  4HAT B;  1WGG A;  2MLB A;  1PLS A;  3L13 A;  3AUL A;  2MQJ A;  4HAY B;  1OEY J;  2HTH A;  3G9W A;  2IO1 B;  5IJM A;  4K7S A;  3CSF A;  3AI5 A;  3L17 A;  4RM8 A;  2JZ3 B;  4W9I A;  4KDL B;  2DYB A;  2FCS A;  2PEA A;  4K2P A;  5J17 A;  4JK7 A;  3ZDT A;  1K5D B;  4A6K A;  2Q13 A;  4W9G A;  3VTW A;  2N4F A;  2EC1 A;  4FN2 A;  5J18 A;  2LRW A;  2JY6 A;  4II2 B;  5DHF B;  2D3G A;  4IM2 A;  5G2N A;  2CHX A;  2KMC A;  2BYE A;  3V61 A;  4ICU A;  2ZJD A;  2LVQ A;  3RZW C;  1T0Y A;  4W9H A;  2FCQ A;  2O6V D;  5AEK B;  4LJO B;  5C16 A;  4TV3 A;  3KVF B;  4FJV B;  1GC6 A;  1K8R B;  4GN1 A;  4AUQ C;  3ODW A;  3Q3F A;  1FXT B;  3IG3 A;  1WXM A;  4YON A;  2GMI C;  3R66 C;  4KHO A;  1NDD A;  1IRS A;  1UBQ A;  3QJZ A;  1X11 A;  2J0M A;  4W9F A;  2CY5 A;  4D0N B;  2D2Q A;  5DPS A;  5J3Q A;  3DBR I;  1TZ1 A;  4B9K A;  4HAX B;  3H6N A;  3V60 A;  4RMA A;  1KJT A;  4FLH A;  3ML8 A;  2DYN A;  3A4S C;  1QQG A;  1OTR B;  4JQW C;  2ELB A;  5L81 A;  3DVG X;  3FSS A;  2MSE D;  4HB2 B;  3A9J A;  4DHJ B;  3A8Q A;  4W9J A;  4CHJ A;  1KOT A;  5FI0 A;  5EFX A;  4A5K A;  1I2H A;  2UYZ B;  1RJ2 A;  3P6A A;  2NS5 A;  2EMT A;  2NZ8 B;  3P7Z A;  2KTF A;  2RD0 A;  3UIN B;  1LB1 A;  4EZK A;  5KQ1 A;  1V2Y A;  1YX6 B;  4XZ4 A;  3ZIM A;  4EFO A;  1XKE A;  4DX9 0;  2V1Y A;  5HKH A;  4BKT A;  3CMM B;  2YLM A;  1ZSQ A;  5J3T A;  1MK9 B;  1DDM A;  2G4D B;  3PPA A;  3K9P B;  3ZNZ B;  5D3W A;  3RCZ A;  1TTN A;  2RR9 A;  2Y8G A;  3F0W A;  3A4R A;  3X0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...