4GXBA

Structure of the snx17 atypical ferm domain bound to the npxy motif of p-selectin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
277
structure length
263
Chain Sequence
VPTEEVSLEVLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQLREGSFRVTRMRCWRVTSSVPLPSGGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICLQSMVDELMVKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/cell adhesion
molecule keywords Sorting nexin-17
total genus 79
structure length 263
sequence length 277
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18116 SNX17_FERM_C Sorting Nexin 17 FERM C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.60 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4gxbA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gxbA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gxbA01
4NJ6A 4I6PA 2JY6A 1WX7A 2BWES 3LJ3A 5J3QA 5KHOA 4ANWA 1P3RA 4LJOB 1RLFA 1WRDB 2C7NB 2L7RA 3KRXA 3QBVB 4JLCA 3UQBA 3KY9A 2CHWA 3TO1A 2Y7BA 5FI0A 2ZEQA 2K8CA 1PQSA 1WG7A 2OOBB 4NNJB 4MEMA 2RNRB 4PQ0A 2BF8B 3ZIMA 3KYDD 2K8HA 1XD4A 2FJLA 2KUPA 3IFWB 3OAWA 2QKLA 1MIZB 2W2XC 2LXAA 3ZDTA 1P9DU 1V49A 1XD3B 4RMAA 3UF8A 3V62A 3AXCA 3IVFA 2RGFA 5FR6A 4F7HA 2LRWA 2UWQA 2KANA 4HXDA 4ZRKA 4BBKA 3UZTA 3F5RA 1FHOA 1UELA 2MRPA 1PFJA 2IYBA 2AYOB 2WYQA 3W1SC 1H10A 4J6IA 2NVUI 3IHPC 1BT0A 2N9EB 5JHGA 3JW0X 5KQ1A 1X1GA 2PPHA 4GGQA 1ZC4B 4DHZB 2DAFA 5IA7A 5LOPB 1ISNA 2L76A 1MIXA 3PHWB 1KLVA 2BYVE 4G0NB 1W1HA 5C5BA 4KSKC 5DPRA 5LLIA 4EZLA 2MP2B 2KLCA 2YT1A 4HHVA 3WAPA 3ML4A 4WJQA 2C5LC 2Z0PA 2JWZA 2O6VA 3LDZE 4G50A 3NSUA 4BBNC 4NQLB 1X1FA 4AP4C 4MJSB 1WGUA 2IO3B 1DYNA 1ZVRA 4HAUB 2G3QB 4B6HA 3A9KA 1GJZA 5DHAB 1XODA 5FI1A 2XQNM 1MK7B 4K7UA 3I3TB 3IG3A 4EKUA 3W1YA 2P0FA 2DYQA 2MBOA 2EMTA 2JF5A 3NZUA 4DK5A 1TQZA 4GSWA 3A33B 4EUTA 1Y5OA 3GYPA 3MHSD 3NY5A 1CMXB 1FB8A 1NDDA 4MGIE 4K2OA 3GZNI 2VRRB 1Z87A 1U2BA 2G35A 5EFXA 3KUDB 1V6EA 4PNKA 1OMWA 5J3TA 1E8YA 2KC1A 1DBHA 3FSSA 3WYFB 1U29A 3CXBB 1ZC3B 2AL3A 4EJNA 2O2VB 1NTVA 2ZPYA 2W9NA 3H1UA 1BTNA 3P6AA 4A6KA 2HTHA 4FJVB 1V2YA 3SU8X 2COFA 2UZSA 4PS3A 4WQOB 3DBSA 3A9JB 3ZO5B 4FA6A 4K17A 5D27A 4RM9A 3VUYA 4B6WA 1Q0WB 2RGNB 2G4SA 1W1DA 2DAJA 1TZ1A 2GOWA 2L00B 3QJZA 1OTRB 1WGQA 2N23A 2KXJA 2N7EA 4RM8A 1WJ4A 1WXSA 1EGXA 4MM3A 4HB3B 4FADA 3M95A 2FIFA 2GJYA 1GNUA 2KO3A 5D3YA 5JP4A 3PVUA 1WR1A 3APDA 3NOBA 4MDKE 3W1SA 2RPQA 2WX1A 2ZNVB 3H7PA 4HB4B 1VCBA 2K2UA 3H9DA 4GDLB 5JH5C 4PYZA 4FHKA 4HAXB 2L1CA 2YS5A 1YIWA 2N1VA 1MK9B 1K5GB 1Y19B 4HDQA 5KCVA 1SIFA 5D3VA 3EFUA 4OVUA 2DENB 2LVOA 2M0XA 2YRYA 3DBHI 1V5MA 1X11A 3V60A 2KDBA 2NPTB 1C3TA 1X1MA 1BAKA 2Z0DB 1KOTA 3R66C 4EZJA 1KJTA 1BWNA 4LCDE 4FULA 2DHJA 2RUKB 3PG7A 2BYEA 2GBRA 4H8SA 1K8RB 4JQWC 1OGWA 2KOXA 2LGDA 2M4NA 3V61A 1LXDA 2DKQA 4DX90 1UZXB 2LWPA 3WANA 5C1ZA 3ULCA 3ODOA 4KVGB 2UVMA 1OQNA 3K9OB 2FIDA 3ZTDA 4EZKA 3DXDA 2Y5BB 2XEWA 2HD5B 4GB9A 1FXTB 3L16A 4IWOA 4E71A 1H8CA 1DROA 2M14A 4ASWC 3ODWA 1OEYJ 3PP2A 1U4AA 1JRUA 2ASQA 2FCSA 3B0AA 4A6FB 2BWFA 3ZTCA 3KRWA 4DWFA 4DX8A 3M3JA 4G3XB 2E2XA 2LXCA 5L81A 1ZW7A 3L17A 2V4LA 2DYMA 2I1KA 1W1GA 3ZVRA 1YD8U 3EC8A 1XCGA 2EKEC 2VKIA 3ODXA 5J3YA 3CSFA 1WGRA 2O6VB 3JSVB 2J0KA 3P7ZA 2ZNVC 4IAPA 2FCMA 1UD7A 2WWZA 3Q3FA 2KX0A 3QC8B 2YF0A 3ZVVA 4F7ZA 1KZGA 2X18A 2ZVNA 4NAWA 4EMOA 2CODA 5J18A 3PGEA 2MBBB 3A8QA 5AZFA 5IAAC 5D94A 2KMAA 2J0MA 4KAXB 3PRZA 4GZUA 2MWNB 1WXMA 1V5OA 3TJPA 3VTWA 2DN6A 2DLWA 2NR2A 3T8MA 3V6CB 2BYFA 3TL5A 2YS3A 2DYOA 1XX0A 3DQVA 1KM7A 3HM3A 4HJKA 3UINB 3RUIB 2VRWB 2CY5A 3ZRCA 3HQCA 2J7QB 2COAA 3PZDA 2KDIA 5DHFB 1FGZA 1P6SA 1PLSA 2NBUA 5AZGA 4F8CB 2IFSA 2V1YA 4ZDVA 1MAIA 2KNBA 2O2VA 3DXEA 3VAWA 4GN1A 3V5WA 2LULA 3ZNHB 2NS5A 4KIKA 1WGYA 4IG7B 3A9JA 2AWTA 5DPSA 2KFJA 1RAXA 3HIZA 3TIXA 3FEHA 5CLQB 2O6VD 2DZIA 2KQ7A 2L3ZA 3X0WA 4KHAA 2GMIC 4A3OA 4KV2A 4F1SA 2GBJA 4K81A 4II2B 2GBNA 1LQBA 2NBWB 2R0DA 3P2BA 2LGXA 2KTFA 4JL9A 3N3KB 3TW1A 5JHBA 2FUHB 5C16A 4LJPB 2RR9A 3VQIA 3X23A 2KC2A 1B55A 1GG3A 4AWJA 4CO7A 4EFOA 1P3QU 3KUZA 4BKSD 4N9F4 2IO2B 4MSMB 5C79A 1DDMA 2LJ5A 1YJ1A 2P0HA 2DHZA 3K9PB 3ZLZA 1PMSA 1E8WA 5LXIB 1IRSA 3CF6E 2DFKA 2MBEA 4TYZA 1TJ6A 4XC2A 1MG8A 2ZVOA 3MTNB 2IY1B 4XX5A 1TTNA 4JGHB 4WAAA 1M94A 2LASA 2MCNB 3ZW3A 4DDID 4IC7B 1P98A 1K5DB 2C7MB 4I6NB 4HB2B 5GOWB 1R4NI 3VUXA 4WJOA 3A4RA 3QK0A 3DXCA 5LONB 1AARA 1V9JA 2JRIB 4FHJA 2LOZA 3SNHA 3DOWA 3GOEA 2MDXA 2HTHB 2W2XD 4IFSA 2WX0A 3TVVA 4A5KA 2IYDB 3F0WA 4MELA 2K2JA 5CTRC 3RCZA 4BFRA 2DTCA 2CS4A 3AU5A 2L0FA 5AEKB 3OANA 1UBQA 2GBKA 3AULA 3EHVA 4M8MA 4KDLB 2JT4B 2NCNA 2XBBC 1YQBA 2A4ZA 2KZRA 2G45B 2CY4A 2EMSA 3PLUA 2BCJA 4TV3A 3SDLC 4W9CA 1X05A 3R7QA 3HM6X 3M63B 5J2RA 4K2PA 3RCPA 2BPSA 3NS8A 4PYUA 2P8VA 1I7AA 2JVCA 2L8JA 2LVQA 3DVGX 3MJWA 4HPMB 4W9GA 5JHAA 3PPAA 5LXHA 2IZVB 2PE9A 4D0NB 4Y94A 4GIVA 4IM3A 3ENEA 4HAVB 3KH0A 2KFKA 2REXA 4DXAB 3L13A 2KTRB 3NZSA 1V5TA 4FN2A 3D32A 4ZYNA 4WWNA 1XQQA 1FOEA 3CIKA 3SD5A 1I42A 5CLLB 3AU4A 3N7CA 3AI5A 2YLMA 3ALBA 3C0RB 2LVPA 4HB0B 3QA8A 4WJ7A 2N0YA 3DVGY 2DX5A 1LM8B 3ULBA 4WJNA 2CHXA 3PV1A 3CSTA 1IPGA 1C1YB 3SHQA 1TGZB 1EF1A 1U5GA 4KDIC 2N9PC 4E74A 2DZKA 5L95C 3BJIA 2V76A 3H6NA 1E8XA 4II3B 5CHVC 3RZWC 1ZSQA 1V81A 4FBJB 3Q3JA 2AEHA 4ICVA 2WDTB 1EAZA 4NPNA 3D8DA 2HJ8A 2D11A 3IBEA 2Z0OA 2ELBA 2LZ6A 4K1RB 4XWXA 4M0WB 2RLOA 4CHMA 2RVBB 4TKNA 3RULA 2OJRA 2M38A 2EC1A 3MDBC 1U27A 5HE3A 1Q5WB 1GC6A 3H7SA 3JSVA 3PREA 3ZDMC 3QX1A 1SHCA 4OVVA 3UGBB 4BOZB 3VVWB 2N4FA 3V6EB 2N9XA 4NAWB 1WI1A 4TQ1A 1WM2A 4KZ0A 1WH3A 4B9KA 1Y8RC 2EJ8A 2GCJA 2KJ6A 2ZPNA 2NMBA 1DDVA 2DYNA 3APCA 1WJUA 5E6PA 4WWPA 4GOCA 3ZNZB 3ZUNA 1V5UA 1UPRA 2DX1A 2L2IA 4W9FA 3HHMA 5D2MB 2H7DA 3OJ3A 3T9LA 4AJWA 4BKGA 5KQ4A 3R3MA 2ZJDA 2KKCA 1RRPB 4KHBB 2JP2A 3VTVA 2VSZA 2KWVB 3QQ8B 4G11A 3GYOA 3UQAA 4W9HA 2R09A 3B08A 3G9WA 2HE7A 4HAWB 2KCJA 4F7UP 2BKFA 2LI5A 1QQGA 1SE9A 1J19A 4FJZA 4WSFA 3DBLI 1M7RA 3SV1A 5D3WA 4GDKA 3VFKA 3TBLD 5TR5A 2YS1A 2OTXA 3NHEB 5J17A 2D9YA 2I1JA 1NBFC 2JXXA 2DYBA 1E7VA 2LRUA 2DZJA 5DPWA 2MWSB 2MSED 2K25A 1WE6A 4HCPB 1I2HA 1UNQA 3R7RA 4DHJB 1UEFA 1XT9B 1FHWA 1WF9A 4DBBA 1Z2MA 2D2QA 1WIAA 4NQKE 4GMVA 1WXAA 4KHOA 4EOYA 5KHQA 1Z5SB 5E6OA 3M62B 1R4MI 2IY0B 3OJ4B 4IWPA 4XZ4A 1HE8A 3SUZA 2NBVB 3SO6A 4IW0A 3ML8A 2BKRB 4IWQA 5CHWA 4HDOA 3UIOB 2D10A 2K6QA 4PS8A 3N32A 4YL8A 3A1QB 2KDFB 3L54A 2D9VA 1G6JA 1L7YA 4IUMB 4W9KA 4LDTB 1L2NA 4L6EA 2GCLA 1P1AA 1TBEA 3PRMB 5BO4B 1RJ2A 4AOFA 5HKHA 1EUVB 4HLEA 2ZCCA 3VH4B 3ZNGC 1J0WA 3DPDA 1WVHA 2CR5A 3PLVA 2CRFA 2A5UA 4KSLC 2JZZA 2BGFA 1WJ1A 4CYEA 2MKRA 2XK5A 3PSCA 1ZKHA 4TUUA 1NTYA 4MH0E 2D4QA 3AJ4A 3QWZB 4GMXB 4ANVA 2JRHA 2UZRA 2PE6B 3U30A 3PTFC 4MSQB 2I5FA 2H7EA 1V86A 1YX6B 2PEAA 4GU2A 4AJYB 5EDSA 1WY8A 3PVLA 2DHIA 1S1QB 5D7GA 2CAYA 4A20A 2L05A 3UIPB 5DI9B 1WJNA 3O65B 3M1IB 1DDWA 1UNRA 1OEYA 2IO1B 3O96A 3T06A 2K1FA 3DDCB 4FJYA 1WGGA 2ROZB 4W9JA 2KLGA 2KGXB 2D3GA 3TMPB 4TQ0A 2ZCBA 3JYUA 1LW3A 3BINA 2JUOA 2M17A 4HPLB 1I35A 5HE2A 5L83A 4LDTD 1H4RA 2OQBA 4F7GA 1WGHA 1FGYA 1KZ7A 5C6RA 3QAQA 5G55A 2RD0A 4AUQC 2MX2A 1V80A 1WX9A 2KTRA 2LD9A 3ML9A 4DBGA 2KN5A 4M8NA 3DBRI 1X86A 4MGYE 4HAYB 3EECA 5G2NA 1WYWB 3S2AA 1T0YA 1N3HA 3HK0A 2KFKB 4DHZE 2LYDA 3KZ1A 4NJ7A 1XKEA 2KQSA 4W9LA 3CMMB 2RSUA 2J59M 5DIFB 4ZRJA 2FAZA 2MA9B 3ZNID 2DA0A 4EEWA 1QC6A 3VDZA 3ZKJC 1FHXA 5HE1A 1AWEA 3QIJA 1UNPA 2GS0A 2DX5B 2IO0B 1WM3A 1OQYA 3B1LX 2DKPA 3JVZX 4HK2A 4ICUA 4JIOU 4CHKA 1IP9A 2Z59B 1WZ0A 1MPHA 2LKOA 4Z2MB 4HAZB 1UBIA 1S3SG 2Z0EB 3A4SC 4IM0A 3WA0A 1Q67A 2JZ3B 1GC7A 4K7SA 4KIKB 1E90A 3U7DA 3L0WB 3SYXA 5C23A 3WAMA 5C5BB 2KJHB 2CHZA 3DVNV 3TCAA 2MP2A 4BKTA 4MGKE 3VTUA 3MPXA 1WX8A 2ROVA 3D8FA 3U8ZA 5DH9B 2RSGA 2C9WB 2DZMA 2KVRA 2LUEA 3PSEB 4WVFB 1WMHA 4ZRIA 4MJSA 3ONSA 4B95A 5JLJB 5DCNA 4P7IA 2LGYA 2MQJA 4IM2A 3QARA 1E7UA 2IBIB 1V88A 3TFMA 2JPHA 3ECIA 3A1QA 3KW5B 4PS7A 4W9DA 4A3PA 1XR0B 2Y8FA 4MK0A 5GMVA 1YX5B 1OY2A 1TXDA 3D8EA 2PJHA 3KYCD 1EO6A 1BTKA 2DHKA 1E8ZA 1F9JA 2J0JA 5E6NA 3PEGA 4A6HA 3DVNU 3RZFA 3VH3B 3VIAA 3PRPB 5JZEB 1M7EA 2K6DB 2GBMA 2N7DA 3QHTA 4DHJD 1IYFA 4MT7A 2P0DA 4I6LB 1WI0A 2UYZB 2K8BA 3LJUX 4YONA 3PVWA 4KZCA 2MFQA 1SGHA 4W9IA 2AL6A 2M1MA 2MLBA 3VHTC 4ANUA 4BVUC 4CHJA 2KX3A 3APFA 4GDKB 2K00A 2FCQA 2R2QA 2W2WA 2KHWB 2L0TA 2ZZPB 4X57B 1NU2A 2N1WA 2D9WA 2V3SA 3A8PA 4FLHA 4HCNB 3KUCB 1P5TA 3QCAA 2KD0A 4C0AA 3FM8C 2I5CA 4HATB 1RRBA 5DPTA 2YSZA 1WE7A 2D9ZA 1U5DA 2C60A 3VXWA 1WJMA 2FCNA 1A5RA 1EF5A 2KJRA 1WZ3A 2B3AA 1AQCA 3WALA 1LFDA 3PS6A 4K7WA 2YT0A 1FAOA 1WFYA 4MGZE 2D07B 1WGDA 5CHFA 3DCGA 2G4DB 1UPQA 4ANXA 2COCA 4NSWA 1KI1B 1NI2A 3A98B 4MY6A 3A9KB 3L10B 4HWIB 4W9EA 3RD2A 3RT3B 4WJPA 4DDGD 2KMCA 2CU1A 2NPTA 4IOYX 2M8SA 4WWOA 1U5FA 5JHHA 3VOQA 1MKEA 1QZEA 2D9XA 1WJ6A 2R2OA 2QKMA 1LB1A 1EVHA 1V89A 2LOXA 2KWUB 3WIMA 2Q13A 2C7HA 4HVBA 1U5EA 4GXBA 5D6JB 2MBQA 2K39A 1WXVA 2MBHA 2XK5B 1J0GA 2YVCA 3ZRFA 2KK8A 1ZGUB 3QWMA 1E5WA 5D3XA 1V61A 3HW2B 2QHOA 2Y8GA 3N30A 3PHXB 3RYTA 3L08A 5AZHA 4BKSA 1J8CA 1VD2A 4Z2NA 2CKHB 1UGMA 3VUWA 4A6FA 1ZM0A 3OLMD 3PT2B 2FNJB 3KSYA 1RFAA 1P0RA 2KDEB 2MW5A 1V5PA 2NZ8B 3WAOA 1D3ZA 2ELAA 2PZ1A 5CX3A 1WMHB 1UH6A 4BOSC 4BBNF 2KWCA 1GUAB 1Q1OA 2ADZA 2LG1A 3H7PB 3BY4B 4E3CA 4GDLA 4URKA 5HE0A 4NY0A 2Z0QA 3KVFB 1WR6E 4GPTB
chains in the Genus database with same CATH superfamily
4NJ6A 4DQOC 3LJ3A 1WX7A 1TY2A 3KRXA 1VBHA 2CHWA 2OJWA 2K3UA 1PQSA 2QIEB 4PQ0A 2V0GA 3OAWA 1WYGA 2LXAA 4RMAA 4HXDA 2KANA 1PFJA 2SAKA 2INNE 4GLSC 1BT0A 2N9EB 1KLVA 4EZLA 5LLIA 2KLCA 4HROA 3NVVA 2JWZA 2PKOA 3A9KA 4HAUB 4B6HA 2V3PA 3W1YA 2EMTA 2JF5A 3NZUA 1LGRA 2WXJA 3FLVA 3MHSD 4MGIE 1CMXB 3AE4B 2N7JA 1Z87A 2WS3B 3ZQ4A 5EFXA 3AECB 3KUDB 1OMWA 5J3TA 1EM7A 2M0AA 2KC1A 3FSSA 4OW0A 2CU3A 1U29A 3H1UA 2ZPYA 1V2YA 2COFA 4WQOB 2KT7A 2GOWA 2KVZA 2QC8A 1OTRB 2KXJA 1WXSA 1EGXA 1WRIA 1FMAD 3APDA 5D3YA 5JP4A 3PVUA 1WR1A 3W1SA 1V97A 3TEXA 4GDLB 4PYZA 4FHKA 2N1VA 1MK9B 1SIFA 1I7HA 2LGSA 1X11A 3V60A 2KDBA 1BAKA 3PG7A 2BYEA 1FNUA 2CB8A 2M4NA 1UZXB 1FXIA 3K9OB 4R3DA 5BYSA 1KRHA 4LNOA 2X0SA 1H8CA 1YQ4B 1DROA 4RNAA 3AE6B 3PO0A 2IPKD 3ODWA 2ASQA 2BWFA 3ZTCA 4DX8A 2E2XA 5L81A 1V1PB 1ZW7A 1R7SA 3MFGA 2RMMA 5G5GA 2VKIA 3ODXA 1FRRA 2HDEA 3CSFA 1WGRA 3JSVB 1UD7A 3QC8B 4S0RA 1L0XB 1KZGA 3U2SC 2J4XA 2IJ0A 3LXFA 2KMAA 1VBGA 3PRZA 1F77A 3TJPA 2DN6A 3AE3B 3V6CB 1VRAB 3DQVA 1KM7A 3HM3A 4LTUA 4US9A 1L0YB 2KDIA 2OHFA 4JKHA 4ZDVA 4XWWA 3DXEA 3VAWA 3UI3A 3V5WA 3E56A 2LULA 1WGYA 4IG7B 5I2MA 1N60A 5DPSA 2KFJA 1RM6C 4C7ZA 4A3OA 2BBCA 4F1SA 4K81A 4II2B 2LGXA 2KTFA 3N3KB 2WXLA 1FIQA 2RR9A 2KC2A 4REZA 3AH7A 1CJEA 3RNGC 4N9F4 2IO2B 4TYZA 4O1NA 2ONQA 4BAXA 3MTNB 1WWTA 4JGHB 4WAAA 5AUKA 2LASA 2MCNB 4PT5A 2RPVA 4I6NB 3VUXA 2DIKA 3QK0A 4FHJA 4HEA1 3VRBB 3SNHA 2HTHB 1FO4A 4A5KA 4C4VA 1ZXHA 2K2JA 2GLSA 4BFRA 2L0FA 5D3DA 2MJEA 2GBKA 5BMIA 3EHVA 4M8MA 2XBBC 2A4ZA 2CY4A 2EMSA 3PLUA 2BCJA 3SDLC 4W9CA 3KWLA 4WWMA 3HM6X 5J2RA 4K2PA 3NVWA 2DLBA 5JHAA 1MFWA 3NZSA 4JKGA 1ZYIA 1JCKB 2WU5B 3D32A 4WWNA 3NG0A 3KWVA 1C76A 3AI5A 2YEPF 3ALBA 1QOAA 2VH1A 1LM8B 4WJNA 5EE1A 1GAQB 1U5GA 5L95C 2JSVX 2AEHA 2KDMA 3NWDA 2QJLA 2OEDA 2HJ8A 3IBEA 2ELBA 4M0WB 4XWXA 2N0SB 3PZ8A 3RULA 2OJRA 2W55A 1U27A 1Q5WB 4YTPB 3MHZA 1YNTE 1OQQA 1ROEA 2X38A 2K0PA 2PVGC 1IUEA 3RI7C 4BKGA 3DWGC 2KWVB 4G11A 3UQAA 1HTOA 4HAWB 2LI5A 1KC7A 3VFKA 4ACFA 3TBLD 2YS1A 2OTXA 3NHEB 4ITKA 4RH6A 4C4VB 2LRUA 2DZJA 2MSED 1WE6A 4HCPB 1B1ZA 1UEFA 3B77A 4JX1C 4DBBA 4J3OD 2D3AA 1VZ6A 4M00A 3TSSA 1R4MI 4N58A 2IY0B 4RF1A 4IW0A 4IKGA 1WGKA 1MI1A 4IWQA 4YL8A 1GB1A 2D9VA 1EU4A 2YT2A 4LDTB 1P1AA 1QOFA 2ZCCA 3VH4B 2X8XX 3ZNGC 1WVHA 4KSLC 2BGFA 1HBKA 3AEAB 1NTYA 4MH0E 1OQRA 4GOUA 4GMXB 2CQUA 2JRHA 1DOYA 4KGRA 3U30A 5M4YB 2H7EA 2KUQA 2MH7A 4AJYB 4ZRPA 1J7AA 2DHIA 4ILGB 3I9V1 1OEYA 3O96A 2HJ1A 2K1FA 4FJYA 5FR6A 4BKTA 2JUOA 2M17A 4HPLB 3NUHB 2RD0A 3ML9A 3DBRI 1X86A 4HAYB 3Q8CA 2LUMA 2LYDA 4NJ7A 3OHMB 3CMMB 3ZNID 4EEWA 1F1HA 3VDZA 5HE1A 1SXTA 2DX5B 4CQNA 4HK2A 1TKYA 4WH4A 1IP9A 2LKOA 4Z2MB 3FAHA 4HAZB 4IM0A 3WA0A 4KKJA 4ZHPA 5C23A 3WAMA 1I4GA 2C9WB 3D8FA 2KVRA 2RSGA 1WMHA 4LK0M 4ZRIA 5JLJB 2MQJA 1V88A 3TFMA 3BYYB 3KW5B 3Q69A 4W9DA 2FUG1 1TXDA 2PJHA 3KYCD 2HTME 3RZFA 3VH3B 4A6HA 3DVNU 3N1YC 3IT4B 1D5XC 4MT7A 2P0DA 3LJUX 2MFQA 4WURA 2KHWB 1NU2A 2N1WA 4HCNB 1E10A 4FLHA 3KUCB 1P5TA 2KD0A 4HATB 1WE7A 2VH2A 3VXWA 1SSNA 2KJRA 2LFIA 4MM3B 1AQCA 4K7WA 1I4PA 1FAOA 1WGDA 2DNFA 1UPQA 4MY6A 1E0ZA 3A98B 3A9KB 3RT3B 1YJJA 4WJPA 2IDYA 3IAM1 4DDGD 1AW7A 1KH0A 2G9HD 1T0QC 3H8HA 1MKEA 1R4MB 4HVBA 2LOXA 1D5MC 1QT9A 2Q13A 1U5EA 2K39A 2MBHA 2XK5B 1QQRA 2KK8A 1ZGUB 4JLCA 1E5WA 3RYTA 3ZW3A 4D2KA 3PHXB 4RCOA 1VD2A 4Z2NA 2ABDA 2WNMA 2FNJB 4TSSA 2MW5A 3DHIC 1UUPA 2PZ1A 1WMHB 1TZOA 1UH6A 3BVZA 2KWCA 1F0ZA 1Q1OA 3H7PB 1JW9D 2YEPB 2H89B 3AE7B 4GDLA 5HE0A 4NY0A 2Z0QA 4RM9A 4DXFA 4ANWA 2JY6A 2I2YA 1MVKA 3KY9A 2NTSA 2WGSA 3Q8BA 5FI0A 3ZIMA 5H92C 1XD4A 2FJLA 2R61A 2QKLA 1V49A 3UF8A 3V62A 3SBGA 2Z59A 2RGFA 4F7HA 2LRWA 2UWQA 3SHQA 3ZLZA 4ZRKA 4JK9A 3UZTA 3F5RA 1FHOA 2AYOB 2IYBA 3V3XA 3IHPC 2PPHA 1XO3A 1GGOA 5C5BA 1SEBD 2K8EA 2Z0PA 1CK1A 3NSUA 4NQLB 4AP4C 1WGUA 1NYRA 1GJZA 2XQNM 4ILJA 2DYQA 4TMAB 5EE9A 3AM9A 4DK5A 1TQZA 3A33B 3GYPA 1FB8A 2PIAA 2GI9A 1K51A 2G35A 4PNKA 1DBHA 3WYFB 2AL3A 4EJNA 3FVCA 2W9NA 3T3OA 1KLUD 1MHHE 1IYFA 2UZSA 3AE1B 4PS3A 4K17A 4YWGG 5D27A 3VUYA 4LNFA 2RGNB 3HVDA 2L00B 1TZ1A 3NW8A 3QJZA 1WGQA 2N23A 1B9RA 4L2YA 1WJ4A 3M95A 2FIFA 1GNUA 1HA5A 2KO3A 3NVZA 3NOBA 1TKGA 4QJ4B 3H7PA 4D6WA 5JH5C 1MHXA 3ENBA 2COPA 4HDQA 1K5GB 1QOGA 4OVUA 3L4PA 1J8CA 2LVOA 3Q14C 1V5MA 1KOTA 2AQ1B 4GNKB 1C3TA 4OZCA 1EWYC 3R66C 1WXQA 4KGTA 1KJTA 1BWNA 2WXGA 4LCDE 2GBRA 2R82A 4H8SA 1K8RB 4JQWC 1OGWA 2KOXA 4KGSA 3V61A 1LXDA 2LWPA 3ULCA 2UVMA 1OQNA 2WXFA 2FIDA 3ZTDA 3BWUD 4EZKA 2K5PA 2Y5BB 4GB9A 1ZUD2 1FXTB 5JVLA 4HRSA 2M14A 4ASWC 1OEYJ 3B0AA 3PP2A 5EDSA 2E3TA 4DWFA 1JALA 3M3JA 3L17A 2DYMA 1W1GA 4YSZB 1YD8U 1MPEA 2J0KA 4IAPA 2FCMA 3Q3FA 2KX0A 4EMOA 2CODA 3PGEA 3A8QA 1ESFA 1QILA 3A58A 4KAXB 3E66A 2AX5A 2YS3A 1XX0A 3AV8A 4HJKA 1NVLA 2V9HA 3UINB 2VRWB 1D6EC 2CY5A 1JWAD 3SFDB 1JROA 4WIPA 3PZDA 1FGZA 2NBUA 1V8CA 2IFSA 2V1YA 2KNBA 2O2VA 1NTIA 2NS5A 4KIKA 2Y3AA 2FJ9A 2WLBA 1RAXA 3TIXA 4M02A 2H88B 2O6VD 2DZIA 3X0WA 1IBXB 1L4DB 1DGJA 2LMCA 4JL9A 5FKAC 3VQIA 1P3QU 1L6VA 4BKSD 4A90A 2W3RA 2DHZA 2P0HA 2WXNA 1N5WA 3CF6E 2MBEA 4XC2A 3BVGA 1MG8A 3EPYA 2ZVOA 4ZHOA 1TTNA 4S17A 4RGTA 3AEEB 4IC7B 2W82A 2D3CA 2C7MB 4HB2B 4XDCA 3A4RA 1AARA 1L4ZB 2BVCA 3GOEA 3KLSX 2MDXA 2W2XD 4IFSA 4A55A 5CTRC 3RCZA 3SR6A 3AU5A 5FK9C 3OANA 5AEKB 4JKCA 1NEKB 4KDLB 1YQBA 4QJ5B 4OT1A 3R7QA 3RCPA 2KWDA 2LVQA 1VZ7A 3DVGX 4HPMB 3NJTA 2IZVB 4D0NB 2REXA 3L13A 1KBLA 2UU7A 4MH8A 3ZJVA 1V5TA 4ARIA 3AMZA 1EU3A 4K3BA 5HFYA 1YOVB 2LVPA 2D3BA 3QA8A 2N0YA 2BS4B 1IPGA 1C1YB 4KDIC 2DZKA 3BJIA 3RZWC 3H6NA 1V81A 4DXGA 1SE3A 4ICVA 2MHJA 1F52A 3Q6BA 4XGAB 2LZ6A 4K1RB 2RLOA 2RVBB 4TKNA 3IAS1 2Q5WD 2EC1A 3ZDMC 1GC6A 3UGBB 1SHCA 4BOZB 3VVWB 3W5UB 4NAWB 1WI1A 3MJ5A 1WM2A 4JE3B 2EJ8A 2GCJA 1N61A 2ZPNA 1M4VA 2BB5A 1DDVA 2DYNA 4WWPA 4GOCA 2DX1A 2H7DA 4AJWA 2Z13A 2PLPA 2ZJDA 3QQ8B 1ST7A 3GYOA 2HE7A 2WU2B 1M7RA 3SV1A 5D3WA 2WXMA 4GDKA 4WQMA 2I1JA 2D9YA 5C2TB 2JXXA 2DYBA 5HG2A 1E7VA 4RGMA 3R7RA 1STEA 2D2QA 4NQKE 5KHQA 4GMVA 3AEGB 4EOYA 1PGBA 5E6OA 3SUZA 2NBVB 2JU6X 3ML8A 4XE0A 5CHWA 4HDOA 2D10A 2K6QA 1PFDA 3N32A 3L54A 2WQYB 1G6JA 1L2NA 2EKIA 4L6EA 2GCLA 4AOFA 1RJ2A 5EE0A 5HKHA 5TSSA 1J0WA 3PLVA 2CRFA 2A5UA 4CYEA 2MKRA 2XK5A 3HIEA 2D4QA 3QWZB 1KFYB 2UZRA 2MEKA 5JHBA 1YX6B 2PEAA 1C4PA 4GU2A 3AEDB 3GE8C 1S1QB 4A20A 3UIPB 5I2SA 1DDWA 1UNRA 1L6UA 3NWFA 3AE2B 4MACA 3ZJUA 3T06A 2KLGA 4TQ0A 3BINA 5L83A 1H4RA 4F7GA 2J42A 2WXRA 1FGYA 5C6RA 1FEHA 3QAQA 4AUQC 2K9XA 1V80A 2L1AA 2LD9A 4DBGA 2KN5A 3AN1A 3TUOA 3LB8C 1VLBA 5G2NA 1WYWB 2KQ4X 3S2AA 1T0YA 2KFKB 3EGRA 4DHZE 2KR0A 1FPYA 2KQSA 4W9LA 1PYWD 2FAZA 1QC6A 3BK2A 3ZKJC 3QIJA 3B1LX 1FXAA 4ICUA 2PMVA 4CHKA 1WZ0A 5HI1A 3Q8AA 1MJDA 4YTNB 2TSSA 4ZOHC 2JZ3B 3RNCC 4K7SA 3U7DA 3P4SB 5BMHA 3SYXA 1CQVA 3AXCA 2ROVA 3U8ZA 2DZMA 2IGDA 4WVFB 1NVID 3ONSA 4UDUC 5DCNA 2WH5A 3DBRB 3QARA 1TS5A 3ECIA 5H8YE 4A3PA 2JWUA 4PS7A 3NWAA 2KACA 1OY2A 1IGDA 1EO6A 1BTKA 1E8ZA 2J0JA 3PEGA 1HZ5A 2N7DA 2B76B 2UYZB 2K8BA 4KZCA 1N6ZA 4W9IA 4ILHA 5EE3A 2KX3A 4X57B 2K00A 2R2QA 1P7EA 3E9SA 3FM8C 2YSZA 1WJMA 4LNKA 1ENFA 1LFDA 2XNAC 3AE8B 3KQ4A 4MGZE 2D07B 3DCGA 2G4DB 3C8YA 2COCA 4ANXA 1KI1B 4W9EA 1MG4A 3DHHC 4C00A 2M19A 5IRSA 4YXDB 2FDQA 2M8SA 3FP5A 5HHDG 1LB1A 1V89A 2INPE 5BMGA 3WIMA 4GXBA 2K22A 2JZPA 3EFCA 5D6JB 4ARCA 2MBQA 2JQRB 4NZLB 2YVCA 1QF6A 5D3XA 2QHOA 4BKSA 2RQ1A 3L08A 1XXGA 5AZHA 1UGMA 4NAMA 3VUWA 1FD6A 3DBLB 3OLMD 4XDDA 1V1PA 2M56B 3URYA 1P0RA 2NZ8B 1D3ZA 2ELAA 2R2YA 4BBNF 3R2TA 3BY4B 4GPTB 3Q3MC 1RLFA 1WRDB 2C7NB 3AE5B 3O13A 3TO1A 1J7BA 3I63C 2DWQA 2OOBB 4NNJB 2RNRB 1I4QA 3KYDD 2K8HA 2WDRB 2KUPA 2W2XC 1P9DU 2I38A 1ZOYB 4JKAA 4B6WA 1UELA 4KIKB 4QXAB 1T5XD 4C80A 1H10A 1XF5L 2NVUI 4GGQA 3JW0X 1KF6B 1ZC4B 4DHZB 1GOZA 2DAFA 1IBXA 5LOPB 1ISNA 3SEBA 2JXTA 2BYVE 4G0NB 4HKQA 5DPRA 2MP2B 1JWUD 3HUIA 4HHVA 4WJQA 4BBNC 2WXOA 4MJSB 3DWMA 2G3QB 1FFVA 5DHAB 4K7UA 1MK7B 3I3TB 4EKUA 2P0FA 5GXGB 3NS1A 3ZXVA 2GRIA 4GSWA 2RDHA 1VR9A 1NDDA 2LEKA 1GB4A 2VRRB 1U2BA 1C77A 4YT0B 3EUB2 4G50A 1ZC3B 2O2VB 1NTVA 1BTNA 3P6AA 4A6KA 2HTHA 4FJVB 1XLPA 1K50A 3DBSA 3ZO5B 4FA6A 1Q0WB 2G4SA 1W1DA 2DAJA 4RM8A 2N7EA 4FADA 3MP9A 4MDKE 1XCQL 1TY0A 2RPQA 1E6EB 2ZNVB 1VCBA 3H9DA 4HAXB 2YS5A 1YIWA 3AEFB 2Z4DA 3EFUA 5D3VA 2DENB 2M0XA 2YRYA 1FM0D 4YTMB 4JKEA 2Z0DB 2LHEA 2PW9A 2DHJA 2RUKB 3RNBC 3GZNB 3WANA 2LGDA 2DKQA 2WXQA 3ODOA 4HKZE 3DXDA 2XEWA 2HD5B 3L16A 3DBHB 1U4AA 2FCSA 2XN9C 2LXCA 3B9JA 2V4LA 2I1KA 4M0WA 3BK1A 3EC8A 2EKEC 2ON8A 5J3YA 4RGNA 1QKZA 3P7ZA 2ZNVC 2WWZA 4USAA 2YF0A 2ZVNA 2X18A 4HPPA 3BVMA 2WHIA 5IAAC 1UGJA 3B2GA 4GZUA 2MWNB 1WXMA 1Y56A 3N20C 3VTWA 1GPXA 2DLWA 2BYFA 1FFUA 2DYOA 2JX5A 3SBTA 2JYEA 3RUIB 1ACCA 2J7QB 2COAA 1AN8A 1YN3A 1P6SA 5AZGA 3FKYA 1MAIA 2LHDA 2BYTA 3ZNHB 3DHGC 3A9JA 2D5GA 2Y5CA 3HIZA 3FEHA 2RDGA 2IGHA 4KV2A 2GBJA 2GBNA 1EWCA 1LQBA 2KIEA 2R0DA 5T8IA 3Q2AC 3W9CB 1JWSD 2EELA 2FUHB 4AWJA 5E6JA 4MSMB 5C79A 2LJ5A 5LXIB 2IY1B 4P16A 4XX5A 3VR9B 1M94A 1ZPSA 2QMTA 1K5DB 3ZGZA 3W5VB 4WJOA 5IN7A 5LONB 1V9JA 3DOWA 1N63A 2WX0A 5G5HA 3F0WA 4MELA 2Y5PA 1UBQA 3AULA 2JT4B 2NCNA 3ABVB 2KZRA 2G45B 2MJDA 1X05A 1JWBD 4B0EA 4H2AA 2NBVA 2N9KA 2ZW1A 2P8VA 1I7AA 2JVCA 2L8JA 1KTKA 5BYRA 3PPAA 1OFFA 4YSYB 5LXHA 2PE9A 4GIVA 4Y94A 4LNNA 1F2RC 4HAVB 3ENEA 4ZYNA 1XLOA 1XQQA 1FOEA 3CIKA 1L0VB 1I42A 1L5PA 2YLMA 3C0RB 4FXCA 4WJ7A 2DX5A 3ULBA 2CHXA 3PV1A 3CSTA 3ZJTA 1RYJA 2QDFA 4II3B 1E8XA 5CHVC 4FBJB 2E6XA 3Q3JA 3B2FA 2WDTB 1A70A 4NPNA 4M01A 4CHMA 2ICIA 4HSIA 5HE3A 3AE9B 5J17A 3P4RB 3QX1A 3NVYA 4OVVA 3SFEB 1HTQA 1XEEA 2N4FA 3V6EB 1QLBB 1C4AA 4KZ0A 1WH3A 1RWSA 1Y8RC 2LGIA 1XLNA 2KJ6A 2NMBA 1WJUA 3N9YC 4JK7A 3Q8FA 5IOIA 3ZUNA 1V5UA 4W9FA 3HHMA 3OJ3A 3T9LA 5KQ4A 3R3MA 1RRPB 4KHBB 2JP2A 2Z14A 5JXVA 3TEWA 2R09A 3B08A 3G9WA 4FJZA 2KCJA 1QQGA 1SE9A 1J19A 3DBLI 5DPWA 1VZ8A 2HRJA 1FHWA 3GP7A 1WXAA 1Z5SB 3M62B 3OJ4B 4IWPA 1BMLC 4XZ4A 3SO6A 2BKRB 4JWSC 2V4IB 1FRDA 2KDFB 5FR3A 4IUMB 4W9KA 3PRMB 5BO4B 1VDVA 1JRPA 1EUVB 4P1BC 1WJ1A 3PSCA 1ZKHA 4TUUA 4ANVA 2PE6B 3PTFC 3MC0B 2I5FA 1V86A 1WY8A 3PVLA 4L23A 2CAYA 5DI9B 1JQ4A 3O65B 1ZDXA 4W9JA 1WGGA 2ROZB 3P42A 2KGXB 2ZCBA 1LW3A 1I35A 5HE2A 4LDTD 2OQBA 1WGHA 5G55A 2J53A 1KZ7A 1N62A 2MX2A 1FNVA 3VRAB 4MGYE 3TEZA 3EECA 4JKGB 3HK0A 4L1RA 3KZ1A 4KX6B 2RSUA 4ZRJA 2DA0A 5BYQA 1WM3A 1OQYA 2DKPA 4JIOU 2Z59B 1MPHA 4JWUC 2L32A 2Z0EB 1Q67A 4K3CA 2V3NA 1E90A 1PGXA 5C5BB 1TKEA 2CHZA 3DVNV 3U4EG 3VTUA 3MPXA 1WX8A 2QCZA 3GS2A 1T0SC 1E7PB 4MJSA 4B95A 2NTTA 3N1ZC 1HB8A 1XR0B 2Y8FA 4MK0A 4OHJA 3D8EA 1YQ3B 3VIAA 3PRPB 2GBMA 1CZPA 4I6LB 1WI0A 4YONA 3PVWA 2AL6A 2M1MA 2MLBA 3VHTC 4BVUC 4CHJA 5IP4D 2ZZPB 4A8XC 1DOXA 1T3QA 2D9WA 4QAYA 4OSNA 1K52A 3QCAA 4OZAA 2PTLA 2I5CA 5DPTA 4PK1A 2D9ZA 2C60A 1YMHE 2BW2A 1A5RA 1EF5A 2B3AA 2LJIA 1HB6A 3WALA 3PS6A 1NYQA 2YT0A 1YJIA 1YN4A 3ETRA 5CHFA 3R2IA 5LNK1 1SF0A 4NSWA 1NI2A 3J9CA 4HWIB 3L10B 5I4DA 2CU1A 4IOYX 4WWOA 5JHHA 1WJ6A 2R2OA 1FNWA 5GMVA 2QKMA 2KWUB 1EVHA 1ZDVA 2Z8LA 1PGAA 1WXVA 3C19A 3ZRFA 1V61A 3HW2B 3N30A 5IJMA 2Y8GA 2BTEA 3P4QB 1C4CA 1SJHD 3LYYA 1N5XA 2ACZB 1ZM0A 4OZBA 3KSYA 3RNEC 1V5PA 3WAOA 4US8A 4ZRQA 2IGGA 2J52A 1JMLA 1GUAB 2KTRB 1WR6E 5IO9A 4I6PA 2BWES 3U12A 5KHOA 5J3QA 1P3RA 4LJOB 1FCCC 2L7RA 3QBVB 3UQBA 3ZYYX 1TS4A 2Y7BA 2ZEQA 2K8CA 1WG7A 4MEMA 2BF8B 3W2DA 1YN5A 3RPFC 4AS1A 3IFWB 1MIZB 3ZDTA 1XD3B 1PUTA 3IVFA 1ZP0B 4BBKA 2MRPA 2WYQA 3W1SC 1BXTA 4J6IA 4ANUA 5JHGA 3IT6B 5KQ1A 1X1GA 5IA7A 2L76A 1MIXA 3PHWB 3R8BA 4KSKC 1W1HA 2YT1A 3WAPA 3P1MA 4DIXA 3ML4A 1D4BA 4JKDA 2C5LC 2O6VA 3LDZE 5IKCM 2SEBD 1X1FA 2IO3B 1DYNA 1ZVRA 4XWTA 2GUMA 1XODA 5FI1A 2KYWA 3IG3A 3P63A 1TIFA 2MBOA 1V1OA 1ZE3D 4EUTA 5D3IB 1Y5OA 3NY5A 4K2OA 2AQ2B 3GZNI 1ACAA 1V6EA 4OVZA 2G1EA 3CXBB 2PVOD 1Q10A 3SU8X 2NMQA 3A9JB 4MM3A 4HB3B 1SJED 3HVZA 3BYTB 2GJYA 4B9KA 1DOIA 1SE2A 2WX1A 4HB4B 2K2UA 2ZKMX 2L1CA 4ZYSA 4N59A 5KCVA 1Y19B 4LLGM 1I4RA 4JKFA 3DBHI 2NPTB 1X1MA 4EZJA 4FULA 4DX90 3I5JC 5C1ZA 4KVGB 4IWOA 4E71A 1WSPA 3Q3OC 4KKIA 3RMKC 1JRUA 4A6FB 1TJEA 3KRWA 4G3XB 3NRZA 1R4NB 3ZXRA 3NZ3A 3ZVRA 1XCGA 1T0RC 2O6VB 4F7ZA 3ZVVA 4NAWA 5J18A 4JKBA 2MBBB 5AZFA 3E9PA 4C7YA 5D94A 2J0MA 1V5OA 2NR2A 1J7CA 3T8MA 3TL5A 4KHBA 1SB3C 3ZRCA 3HQCA 5DHFB 1PLSA 4QJ3B 4F8CB 3Q8EA 4IOIE 1TS2A 3I57A 4GN1A 3GB1A 2L83A 2AWTA 5CLQB 3U7ZA 2KQ7A 2INDC 2K49A 4KHAA 2GMIC 2L3ZA 4CSQA 3IXSA 1XLQA 2BB6A 2NBWB 2FE8A 3P2BA 1C78A 3TW1A 5C16A 2QEJC 4LJPB 4EFOA 3X23A 4CO7A 1B55A 1GG3A 5LG4B 3KUZA 1DDMA 1YJ1A 3K9PB 2INCC 1PMSA 1E8WA 1UNSA 1IRSA 2DFKA 1TYGB 1TJ6A 1VJKA 4L1BA 1RFKA 2BT6A 4B0MA 3MC9A 4YSXB 3EA6A 4DDID 1P98A 5GOWB 1R4NI 3DXCA 2JRIB 2LOZA 2AQ3B 2BQQA 3TVVA 2WXHA 3GE3C 2IYDB 2VZKD 2DTCA 2CS4A 2RRFA 4TV3A 2MJ3A 1UWMA 3M63B 2JYTA 4WAFA 2BPSA 3NS8A 4PYUA 3E9LA 3MJWA 3FC4A 4W9GA 2KIGA 1ET9A 4Q2JA 1HEZE 4IM3A 3T3NA 1NENB 3KH0A 4FN2A 2KFKA 4DXAB 1DYQA 3SD5A 5CLLB 3AU4A 3N7CA 4HB0B 3DVGY 1AYFA 1TGZB 1EF1A 4E74A 2N9PC 2V76A 1ZSQA 4N6EB 4NJCA 4JK8A 1EAZA 3D8DA 2D11A 2Z0OA 1I4HA 3Q3NC 2M38A 3U52E 3MDBC 1PDXA 3H7SA 3PREA 3JSVA 3OWEB 1UF0A 2N9XA 1TS3A 1T6BX 4RF0A 2BS3B 5E6PA 3APCA 5C3JB 3BIID 3ZNZB 1UPRA 2L2IA 5D2MB 2N9LA 2KKCA 1QOBA 3VTVA 2VSZA 3OG5A 2WDVB 4W9HA 4F7UP 2BKFA 4WSFA 1K53A 3WCQA 5TR5A 2W54A 4HJGE 2BS2B 1NBFC 1FCLA 1D5ZC 2MWSB 2K25A 1I2HA 1UNQA 4DHJB 1XT9B 1WF9A 2KN4A 1Z2MA 1WIAA 4KHOA 2RDBC 4AQ7A 1HE8A 4RFBA 3RN9C 3CWIA 3UIOB 4PS8A 3A1QB 4JPSA 1L7YA 2KAJA 4MT5A 1TBEA 2FBWB 2VZKB 3FILA 4HLEA 3DPDA 2CR5A 1ZXIA 2WP9B 3AEBB 3MC8A 2JZZA 5AUIA 4RGOS 3AJ4A 1IGCA 4MSQB 5D7GA 2L05A 1HQRD 1WJNA 3M1IB 2IO1B 1AWDA 4LNIA 3HRDD 3DDCB 3TMPB 2D3GA 3JYUA 1NI3A 2KMMA 1WX9A 2KTRA 1F2RI 4M8NA 2WXPA 1P7FA 1N3HA 1E9MA 1JWMD 1XKEA 2J59M 5DIFB 2MA9B 4BZAA 1FHXA 1AWEA 1UNPA 2GS0A 2IO0B 3JVZX 4TQ1A 1HZ6A 3DCXA 1UBIA 1S3SG 4C56C 1T77A 1JDEA 3A4SC 1TT5B 1GC7A 3L0WB 4EE2A 3RFZB 2KJHB 3TCAA 1ET6A 2MP2A 4MGKE 2WXIA 5DH9B 3PSEB 2LUEA 3E9OA 4P7IA 2LGYA 2WDQB 4IM2A 1BUIC 1E7UA 2IBIB 2JPHA 3A1QA 3VR8B 1YX5B 2QILA 5E6NA 3TEYA 2DHKA 1F9JA 3FILB 5JZEB 1M7EA 2K6DB 3QHTA 4DHJD 3BZDB 1SGHA 2L52A 2QSDA 3V05A 3APFA 4GDKB 2FCQA 2W2WA 2L0TA 4P1CC 1MI0A 2V3SA 3A8PA 1SIJA 4C0AA 1KLGD 1RRBA 1C79A 3CIRB 1U5DA 2FCNA 4P6VF 1WZ3A 1WFYA 2CJOA 3PZ7A 1SE4A 1SBBB 1I4XA 4A9AA 3HSAA 3RD2A 2KMCA 1HXYD 1C9FA 2NPTA 3AB5A 1U5FA 3VOQA 1QZEA 2D9XA 2CJNA 4A6QA 2C7HA 1UWXA 3RNAC 1J0GA 2W3SA 3QWMA 1LO5D 1XCTL 2FJUB 2CKHB 2ZW0A 4A6FA 3PT2B 2DBYA 3RNFC 1RFAA 2KDEB 3P4PB 2LBBA 1DIKA 2GB1A 5CX3A 3N1XC 2WXKA 4BOSC 2ADZA 2LG1A 4IDIA 5MPOA 4E3CA 4URKA 4XYCA 3KVFB 1E8YA
chains in the Genus database with same CATH topology
4NJ6A 3LJ3A 1WX7A 3KRXA 1VBHA 2CHWA 1PQSA 4PQ0A 3OAWA 2LXAA 4RMAA 4HXDA 2KANA 1PFJA 1BT0A 2N9EB 1KLVA 4EZLA 5LLIA 2KLCA 2JWZA 3A9KA 4HAUB 4B6HA 3W1YA 2EMTA 2JF5A 3NZUA 3FLVA 3MHSD 4MGIE 1CMXB 1Z87A 5EFXA 3KUDB 1OMWA 5J3TA 2KC1A 3FSSA 1U29A 3H1UA 2ZPYA 1V2YA 2COFA 4WQOB 2GOWA 1OTRB 2KXJA 1WXSA 1EGXA 3APDA 5D3YA 5JP4A 3PVUA 1WR1A 3W1SA 4GDLB 4PYZA 4FHKA 2N1VA 1MK9B 1SIFA 1X11A 3V60A 2KDBA 1BAKA 3PG7A 2BYEA 2CB8A 2M4NA 1UZXB 3K9OB 2X0SA 1H8CA 1DROA 3ODWA 2ASQA 2BWFA 3ZTCA 4DX8A 2E2XA 5L81A 1ZW7A 2VKIA 3ODXA 3CSFA 1WGRA 3JSVB 1UD7A 3QC8B 1KZGA 2KMAA 1VBGA 3PRZA 3TJPA 2DN6A 3V6CB 3DQVA 3HM3A 1KM7A 2KDIA 4JKHA 4ZDVA 3DXEA 3VAWA 3V5WA 2LULA 1WGYA 4IG7B 5DPSA 2KFJA 4A3OA 4F1SA 4K81A 4II2B 2LGXA 2KTFA 3N3KB 2RR9A 2KC2A 4N9F4 2IO2B 4TYZA 3MTNB 4JGHB 4WAAA 2LASA 2MCNB 4I6NB 3VUXA 2DIKA 3QK0A 4FHJA 3SNHA 2HTHB 4A5KA 2K2JA 4BFRA 2L0FA 2GBKA 3EHVA 4M8MA 2XBBC 2A4ZA 2CY4A 2EMSA 3PLUA 2BCJA 3SDLC 4W9CA 3HM6X 5J2RA 4K2PA 5JHAA 3NZSA 4JKGA 3D32A 4WWNA 3AI5A 3ALBA 1LM8B 4WJNA 1U5GA 5L95C 2AEHA 2HJ8A 3IBEA 2ELBA 4M0WB 4XWXA 3RULA 2OJRA 1U27A 1Q5WB 4BKGA 2KWVB 4G11A 3UQAA 4HAWB 2LI5A 1KC7A 3VFKA 3TBLD 2YS1A 2OTXA 3NHEB 2LRUA 2DZJA 2MSED 1WE6A 4HCPB 1UEFA 4DBBA 1R4MI 2IY0B 4IW0A 4IWQA 4YL8A 2D9VA 4LDTB 1P1AA 2ZCCA 3VH4B 3ZNGC 1WVHA 4KSLC 2BGFA 1HBKA 1NTYA 4MH0E 4GMXB 2CQUA 2JRHA 3U30A 2H7EA 4AJYB 2DHIA 4ILGB 1OEYA 3O96A 5FR6A 2K1FA 4FJYA 4BKTA 2JUOA 2M17A 4HPLB 2RD0A 3ML9A 3DBRI 1X86A 4HAYB 2LYDA 4NJ7A 3CMMB 3ZNID 4EEWA 3VDZA 5HE1A 2DX5B 4HK2A 1IP9A 2LKOA 4Z2MB 4HAZB 4IM0A 3WA0A 5C23A 3WAMA 2C9WB 3D8FA 2KVRA 2RSGA 1WMHA 4ZRIA 5JLJB 2MQJA 1V88A 3TFMA 3KW5B 4W9DA 1TXDA 2PJHA 3KYCD 3RZFA 3VH3B 4A6HA 3DVNU 4MT7A 2P0DA 3LJUX 2MFQA 2KHWB 1NU2A 2N1WA 4HCNB 4FLHA 3KUCB 1P5TA 2KD0A 4HATB 1WE7A 3VXWA 2KJRA 1AQCA 4K7WA 1FAOA 1WGDA 1UPQA 4MY6A 3A98B 3A9KB 3RT3B 4WJPA 4DDGD 1MKEA 4HVBA 2LOXA 2Q13A 1U5EA 2K39A 2MBHA 2XK5B 4JLCA 2KK8A 3ZW3A 3RYTA 1ZGUB 1E5WA 3PHXB 1VD2A 4Z2NA 2ABDA 2FNJB 2MW5A 2PZ1A 1WMHB 1UH6A 2KWCA 1Q1OA 3H7PB 4GDLA 5HE0A 4RM9A 4NY0A 2Z0QA 4ANWA 2JY6A 3KY9A 5FI0A 3ZIMA 1XD4A 2FJLA 2QKLA 1V49A 3UF8A 3V62A 3SBGA 2RGFA 4F7HA 2LRWA 2UWQA 3ZLZA 3SHQA 4ZRKA 4JK9A 3UZTA 3F5RA 1FHOA 2AYOB 2IYBA 3IHPC 2PPHA 1GGOA 5C5BA 2Z0PA 3NSUA 4NQLB 4AP4C 1WGUA 1GJZA 2XQNM 4ILJA 2DYQA 4DK5A 1TQZA 3A33B 3GYPA 1FB8A 2G35A 4PNKA 1DBHA 3WYFB 2AL3A 4EJNA 2W9NA 1IYFA 2UZSA 4PS3A 4K17A 5D27A 3VUYA 2RGNB 2L00B 1TZ1A 3QJZA 1WGQA 2N23A 1WJ4A 3M95A 2FIFA 1GNUA 2KO3A 3NOBA 3H7PA 5JH5C 3ENBA 2COPA 4HDQA 1K5GB 4OVUA 1J8CA 2LVOA 1V5MA 1KOTA 1C3TA 3R66C 1KJTA 1BWNA 4LCDE 2GBRA 2R82A 4H8SA 1K8RB 4JQWC 1OGWA 2KOXA 3V61A 1LXDA 2LWPA 3ULCA 2UVMA 1OQNA 3ZTDA 2FIDA 4EZKA 2Y5BB 4GB9A 1FXTB 5JVLA 2M14A 4ASWC 1OEYJ 3B0AA 3PP2A 5EDSA 4DWFA 3M3JA 3L17A 2DYMA 1W1GA 1YD8U 2J0KA 4IAPA 2FCMA 3Q3FA 2KX0A 4EMOA 2CODA 3PGEA 3A8QA 4KAXB 3E66A 2YS3A 1XX0A 4HJKA 1NVLA 3UINB 2VRWB 2CY5A 3PZDA 1FGZA 2NBUA 2IFSA 2V1YA 2KNBA 2O2VA 1NTIA 2NS5A 4KIKA 2FJ9A 1RAXA 3TIXA 2O6VD 2DZIA 3X0WA 4JL9A 3VQIA 1P3QU 4BKSD 2DHZA 2P0HA 3CF6E 2MBEA 4XC2A 1MG8A 3EPYA 2ZVOA 1TTNA 4IC7B 2C7MB 4HB2B 3A4RA 1AARA 3GOEA 2MDXA 2W2XD 4IFSA 5CTRC 3RCZA 3AU5A 5AEKB 3OANA 4JKCA 4KDLB 1YQBA 3R7QA 3RCPA 2LVQA 3DVGX 4HPMB 2IZVB 4D0NB 2REXA 3L13A 1KBLA 1V5TA 2LVPA 3QA8A 2N0YA 1IPGA 1C1YB 4KDIC 2DZKA 3BJIA 3RZWC 3H6NA 1V81A 4ICVA 2LZ6A 4K1RB 2RLOA 2RVBB 4TKNA 2EC1A 3ZDMC 1GC6A 3UGBB 1SHCA 4BOZB 3VVWB 4NAWB 1WI1A 1WM2A 2EJ8A 2GCJA 2ZPNA 1DDVA 2DYNA 4WWPA 4GOCA 2DX1A 2H7DA 4AJWA 2ZJDA 3QQ8B 1ST7A 3GYOA 2HE7A 1M7RA 3SV1A 5D3WA 4GDKA 2I1JA 2D9YA 2JXXA 2DYBA 1E7VA 3R7RA 2D2QA 4NQKE 5KHQA 4GMVA 4EOYA 5E6OA 3SUZA 2NBVB 3ML8A 5CHWA 4HDOA 2D10A 2K6QA 3N32A 3L54A 1G6JA 1L2NA 4L6EA 2GCLA 4AOFA 1RJ2A 5HKHA 1J0WA 3PLVA 2CRFA 2A5UA 4CYEA 2MKRA 2XK5A 2D4QA 3QWZB 2UZRA 5JHBA 1YX6B 2PEAA 4GU2A 1S1QB 4A20A 3UIPB 1DDWA 1UNRA 3T06A 2KLGA 4TQ0A 3BINA 5L83A 1H4RA 4F7GA 3QAQA 1FGYA 5C6RA 4AUQC 1V80A 2LD9A 4DBGA 2KN5A 5G2NA 1WYWB 3S2AA 1T0YA 2KFKB 4DHZE 2KQSA 4W9LA 2FAZA 1QC6A 3ZKJC 3QIJA 3B1LX 4ICUA 4CHKA 1WZ0A 2JZ3B 4K7SA 3U7DA 3SYXA 3AXCA 2ROVA 3U8ZA 2DZMA 4WVFB 3ONSA 5DCNA 2WH5A 3QARA 3ECIA 4A3PA 4PS7A 1OY2A 1EO6A 1BTKA 1E8ZA 2J0JA 3PEGA 2N7DA 2UYZB 2K8BA 4KZCA 4W9IA 4ILHA 2KX3A 4X57B 2K00A 2R2QA 3FM8C 2YSZA 1WJMA 1LFDA 4MGZE 2D07B 3DCGA 2G4DB 4ANXA 2COCA 1KI1B 4W9EA 2FDQA 2M8SA 3FP5A 1LB1A 1V89A 3WIMA 4GXBA 5D6JB 2MBQA 2YVCA 5D3XA 2QHOA 4BKSA 2RQ1A 3L08A 5AZHA 1UGMA 3VUWA 3OLMD 1P0RA 2NZ8B 1D3ZA 2ELAA 4BBNF 3BY4B 4GPTB 1RLFA 1WRDB 2C7NB 3TO1A 2OOBB 4NNJB 2RNRB 3KYDD 2K8HA 2KUPA 2W2XC 1P9DU 4JKAA 4B6WA 1UELA 4KIKB 1H10A 2NVUI 4GGQA 3JW0X 1ZC4B 4DHZB 2DAFA 5LOPB 1ISNA 2BYVE 4G0NB 5DPRA 2MP2B 4HHVA 4WJQA 4BBNC 4MJSB 2G3QB 5DHAB 4K7UA 1MK7B 3I3TB 4EKUA 2P0FA 4GSWA 1NDDA 2VRRB 1U2BA 4G50A 1ZC3B 2O2VB 1NTVA 1BTNA 3P6AA 4A6KA 2HTHA 4FJVB 3DBSA 3ZO5B 4FA6A 1Q0WB 2G4SA 1W1DA 2DAJA 4RM8A 2N7EA 4FADA 4MDKE 2RPQA 2ZNVB 1VCBA 3H9DA 4HAXB 2YS5A 1YIWA 3EFUA 5D3VA 2DENB 2M0XA 2YRYA 4JKEA 2Z0DB 2DHJA 2RUKB 3WANA 2LGDA 2DKQA 3ODOA 3DXDA 2XEWA 2HD5B 3L16A 1U4AA 2FCSA 2LXCA 2V4LA 2I1KA 3EC8A 2EKEC 5J3YA 3P7ZA 2ZNVC 2WWZA 2YF0A 2ZVNA 2X18A 5IAAC 4GZUA 2MWNB 1WXMA 3VTWA 2DLWA 2BYFA 2DYOA 3SBTA 3RUIB 2J7QB 2COAA 1P6SA 5AZGA 1MAIA 3ZNHB 3A9JA 3HIZA 3FEHA 4KV2A 2GBJA 2GBNA 1LQBA 2R0DA 2FUHB 4AWJA 4MSMB 5C79A 2LJ5A 5LXIB 2IY1B 4XX5A 1M94A 1K5DB 4WJOA 5LONB 1V9JA 3DOWA 2WX0A 3F0WA 4MELA 1UBQA 3AULA 2JT4B 2NCNA 2KZRA 2G45B 1X05A 2P8VA 1I7AA 2JVCA 2L8JA 3PPAA 5LXHA 2PE9A 4GIVA 4Y94A 3ENEA 4HAVB 4ZYNA 1XQQA 1FOEA 3CIKA 1I42A 2YLMA 3C0RB 4WJ7A 2DX5A 3ULBA 2CHXA 3PV1A 3CSTA 4II3B 1E8XA 5CHVC 4FBJB 3Q3JA 2WDTB 4NPNA 4CHMA 5HE3A 5J17A 3QX1A 4OVVA 2N4FA 3V6EB 4KZ0A 1WH3A 1Y8RC 2KJ6A 2NMBA 1WJUA 4JK7A 3ZUNA 1V5UA 4W9FA 3HHMA 3OJ3A 3T9LA 5KQ4A 3R3MA 1RRPB 4KHBB 2JP2A 2R09A 3B08A 3G9WA 4FJZA 2KCJA 1QQGA 1SE9A 1J19A 3DBLI 5DPWA 2HRJA 1FHWA 1WXAA 1Z5SB 3M62B 3OJ4B 4IWPA 4XZ4A 3SO6A 2BKRB 2KDFB 4IUMB 4W9KA 3PRMB 5BO4B 1EUVB 1WJ1A 3PSCA 1ZKHA 4TUUA 4ANVA 2PE6B 3PTFC 2I5FA 1V86A 1WY8A 3PVLA 2CAYA 5DI9B 3O65B 4W9JA 1WGGA 2ROZB 2KGXB 2ZCBA 1LW3A 1I35A 5HE2A 4LDTD 2OQBA 1WGHA 5G55A 1KZ7A 2MX2A 4MGYE 3EECA 4JKGB 3HK0A 3KZ1A 2RSUA 4ZRJA 2DA0A 1WM3A 1OQYA 2DKPA 4JIOU 2Z59B 1MPHA 2Z0EB 1Q67A 1E90A 5C5BB 2CHZA 3DVNV 3VTUA 3MPXA 1WX8A 4MJSA 4B95A 1HB8A 1XR0B 2Y8FA 4MK0A 3D8EA 3VIAA 3PRPB 2GBMA 4I6LB 1WI0A 4YONA 3PVWA 2AL6A 2M1MA 2MLBA 3VHTC 4BVUC 4CHJA 2ZZPB 2D9WA 3QCAA 2I5CA 5DPTA 2D9ZA 2C60A 1A5RA 1EF5A 2B3AA 1HB6A 3WALA 3PS6A 2YT0A 5CHFA 4NSWA 1NI2A 4HWIB 3L10B 2CU1A 4IOYX 4WWOA 5JHHA 2R2OA 5GMVA 1WJ6A 2QKMA 1EVHA 2KWUB 1WXVA 3ZRFA 1V61A 3HW2B 3N30A 5IJMA 2Y8GA 1ZM0A 3KSYA 1V5PA 3WAOA 1GUAB 2KTRB 1WR6E 4I6PA 2BWES 5KHOA 5J3QA 1P3RA 4LJOB 2L7RA 3QBVB 3UQBA 2Y7BA 2ZEQA 2K8CA 1WG7A 4MEMA 2BF8B 3IFWB 1MIZB 3ZDTA 1XD3B 3IVFA 4BBKA 2MRPA 2WYQA 3W1SC 4J6IA 4ANUA 5JHGA 5KQ1A 1X1GA 5IA7A 2L76A 1MIXA 3PHWB 4KSKC 1W1HA 2YT1A 3WAPA 3ML4A 4JKDA 2C5LC 2O6VA 3LDZE 1X1FA 2IO3B 1DYNA 1ZVRA 1XODA 5FI1A 3IG3A 2MBOA 4EUTA 1Y5OA 3NY5A 4K2OA 3GZNI 1ACAA 1V6EA 3CXBB 3SU8X 3A9JB 4MM3A 4HB3B 2GJYA 4B9KA 2WX1A 4HB4B 2K2UA 2L1CA 5KCVA 1Y19B 3DBHI 4JKFA 2NPTB 1X1MA 4EZJA 4FULA 4DX90 5C1ZA 4KVGB 4IWOA 4E71A 1JRUA 4A6FB 3KRWA 4G3XB 3ZVRA 1XCGA 2O6VB 4F7ZA 3ZVVA 4NAWA 5J18A 4JKBA 2MBBB 5AZFA 3E9PA 5D94A 2J0MA 1V5OA 2NR2A 3T8MA 3TL5A 3ZRCA 3HQCA 5DHFB 1PLSA 4F8CB 4GN1A 2AWTA 5CLQB 2KQ7A 2L3ZA 4KHAA 2GMIC 2NBWB 3P2BA 3TW1A 5C16A 4LJPB 4EFOA 3X23A 4CO7A 1B55A 1GG3A 3KUZA 1DDMA 1YJ1A 3K9PB 1PMSA 1E8WA 1IRSA 2DFKA 1TJ6A 4DDID 1P98A 5GOWB 1R4NI 3DXCA 2JRIB 2LOZA 3TVVA 2IYDB 2DTCA 2CS4A 4TV3A 3M63B 2BPSA 3NS8A 4PYUA 3E9LA 3MJWA 4W9GA 4IM3A 3KH0A 4FN2A 2KFKA 4DXAB 3SD5A 5CLLB 3AU4A 3N7CA 4HB0B 3DVGY 1TGZB 1EF1A 4E74A 2N9PC 2V76A 1ZSQA 4JK8A 1EAZA 3D8DA 2D11A 2Z0OA 2M38A 3MDBC 3H7SA 3PREA 3JSVA 2N9XA 5E6PA 3APCA 3ZNZB 1UPRA 2L2IA 5D2MB 2KKCA 3VTVA 2VSZA 4W9HA 4F7UP 2BKFA 4WSFA 5TR5A 1NBFC 2MWSB 2K25A 1I2HA 1UNQA 4DHJB 1XT9B 1WF9A 1Z2MA 1WIAA 4KHOA 1HE8A 3UIOB 4PS8A 3A1QB 1L7YA 1TBEA 4HLEA 3DPDA 2CR5A 2JZZA 3AJ4A 4MSQB 5D7GA 2L05A 1WJNA 3M1IB 2IO1B 3DDCB 3TMPB 2D3GA 3JYUA 1WX9A 2KTRA 4M8NA 1N3HA 1XKEA 2J59M 5DIFB 2MA9B 1FHXA 1AWEA 1UNPA 2GS0A 4TQ1A 2IO0B 3JVZX 1UBIA 1S3SG 1JDEA 3A4SC 1GC7A 3L0WB 2KJHB 3TCAA 2MP2A 4MGKE 5DH9B 3PSEB 2LUEA 3E9OA 4P7IA 2LGYA 4IM2A 1E7UA 2IBIB 2JPHA 3A1QA 1YX5B 5E6NA 2DHKA 1F9JA 5JZEB 1M7EA 2K6DB 3QHTA 4DHJD 1SGHA 3APFA 4GDKB 2FCQA 2W2WA 2L0TA 2V3SA 3A8PA 4C0AA 1RRBA 1U5DA 2FCNA 1WZ3A 1WFYA 3RD2A 2KMCA 2NPTA 1U5FA 3VOQA 1QZEA 2D9XA 2C7HA 1J0GA 3QWMA 2CKHB 4A6FA 3PT2B 1RFAA 2KDEB 2LBBA 1DIKA 5CX3A 4BOSC 2ADZA 2LG1A 4E3CA 4URKA 3KVFB 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ6 A;  4I6P A;  2JY6 A;  1WX7 A;  2BWE S;  3LJ3 A;  5J3Q A;  5KHO A;  4ANW A;  1P3R A;  4LJO B;  1RLF A;  1WRD B;  2C7N B;  2L7R A;  3KRX A;  3QBV B;  4JLC A;  3UQB A;  3KY9 A;  2CHW A;  3TO1 A;  2Y7B A;  5FI0 A;  2ZEQ A;  2K8C A;  1PQS A;  1WG7 A;  2OOB B;  4NNJ B;  4MEM A;  2RNR B;  4PQ0 A;  2BF8 B;  3ZIM A;  3KYD D;  2K8H A;  1XD4 A;  2FJL A;  2KUP A;  3IFW B;  3OAW A;  2QKL A;  1MIZ B;  2W2X C;  2LXA A;  3ZDT A;  1P9D U;  1V49 A;  1XD3 B;  4RMA A;  3UF8 A;  3V62 A;  3AXC A;  3IVF A;  2RGF A;  5FR6 A;  4F7H A;  2LRW A;  2UWQ A;  2KAN A;  4HXD A;  4ZRK A;  4BBK A;  3UZT A;  3F5R A;  1FHO A;  1UEL A;  2MRP A;  1PFJ A;  2IYB A;  2AYO B;  2WYQ A;  3W1S C;  1H10 A;  4J6I A;  2NVU I;  3IHP C;  1BT0 A;  2N9E B;  5JHG A;  3JW0 X;  5KQ1 A;  1X1G A;  2PPH A;  4GGQ A;  1ZC4 B;  4DHZ B;  2DAF A;  5IA7 A;  5LOP B;  1ISN A;  2L76 A;  1MIX A;  3PHW B;  1KLV A;  2BYV E;  4G0N B;  1W1H A;  5C5B A;  4KSK C;  5DPR A;  5LLI A;  4EZL A;  2MP2 B;  2KLC A;  2YT1 A;  4HHV A;  3WAP A;  3ML4 A;  4WJQ A;  2C5L C;  2Z0P A;  2JWZ A;  2O6V A;  3LDZ E;  4G50 A;  3NSU A;  4BBN C;  4NQL B;  1X1F A;  4AP4 C;  4MJS B;  1WGU A;  2IO3 B;  1DYN A;  1ZVR A;  4HAU B;  2G3Q B;  4B6H A;  3A9K A;  1GJZ A;  5DHA B;  1XOD A;  5FI1 A;  2XQN M;  1MK7 B;  4K7U A;  3I3T B;  3IG3 A;  4EKU A;  3W1Y A;  2P0F A;  2DYQ A;  2MBO A;  2EMT A;  2JF5 A;  3NZU A;  4DK5 A;  1TQZ A;  4GSW A;  3A33 B;  4EUT A;  1Y5O A;  3GYP A;  3MHS D;  3NY5 A;  1CMX B;  1FB8 A;  1NDD A;  4MGI E;  4K2O A;  3GZN I;  2VRR B;  1Z87 A;  1U2B A;  2G35 A;  5EFX A;  3KUD B;  1V6E A;  4PNK A;  1OMW A;  5J3T A;  1E8Y A;  2KC1 A;  1DBH A;  3FSS A;  3WYF B;  1U29 A;  3CXB B;  1ZC3 B;  2AL3 A;  4EJN A;  2O2V B;  1NTV A;  2ZPY A;  2W9N A;  3H1U A;  1BTN A;  3P6A A;  4A6K A;  2HTH A;  4FJV B;  1V2Y A;  3SU8 X;  2COF A;  2UZS A;  4PS3 A;  4WQO B;  3DBS A;  3A9J B;  3ZO5 B;  4FA6 A;  4K17 A;  5D27 A;  4RM9 A;  3VUY A;  4B6W A;  1Q0W B;  2RGN B;  2G4S A;  1W1D A;  2DAJ A;  1TZ1 A;  2GOW A;  2L00 B;  3QJZ A;  1OTR B;  1WGQ A;  2N23 A;  2KXJ A;  2N7E A;  4RM8 A;  1WJ4 A;  1WXS A;  1EGX A;  4MM3 A;  4HB3 B;  4FAD A;  3M95 A;  2FIF A;  2GJY A;  1GNU A;  2KO3 A;  5D3Y A;  5JP4 A;  3PVU A;  1WR1 A;  3APD A;  3NOB A;  4MDK E;  3W1S A;  2RPQ A;  2WX1 A;  2ZNV B;  3H7P A;  4HB4 B;  1VCB A;  2K2U A;  3H9D A;  4GDL B;  5JH5 C;  4PYZ A;  4FHK A;  4HAX B;  2L1C A;  2YS5 A;  1YIW A;  2N1V A;  1MK9 B;  1K5G B;  1Y19 B;  4HDQ A;  5KCV A;  1SIF A;  5D3V A;  3EFU A;  4OVU A;  2DEN B;  2LVO A;  2M0X A;  2YRY A;  3DBH I;  1V5M A;  1X11 A;  3V60 A;  2KDB A;  2NPT B;  1C3T A;  1X1M A;  1BAK A;  2Z0D B;  1KOT A;  3R66 C;  4EZJ A;  1KJT A;  1BWN A;  4LCD E;  4FUL A;  2DHJ A;  2RUK B;  3PG7 A;  2BYE A;  2GBR A;  4H8S A;  1K8R B;  4JQW C;  1OGW A;  2KOX A;  2LGD A;  2M4N A;  3V61 A;  1LXD A;  2DKQ A;  4DX9 0;  1UZX B;  2LWP A;  3WAN A;  5C1Z A;  3ULC A;  3ODO A;  4KVG B;  2UVM A;  1OQN A;  3K9O B;  2FID A;  3ZTD A;  4EZK A;  3DXD A;  2Y5B B;  2XEW A;  2HD5 B;  4GB9 A;  1FXT B;  3L16 A;  4IWO A;  4E71 A;  1H8C A;  1DRO A;  2M14 A;  4ASW C;  3ODW A;  1OEY J;  3PP2 A;  1U4A A;  1JRU A;  2ASQ A;  2FCS A;  3B0A A;  4A6F B;  2BWF A;  3ZTC A;  3KRW A;  4DWF A;  4DX8 A;  3M3J A;  4G3X B;  2E2X A;  2LXC A;  5L81 A;  1ZW7 A;  3L17 A;  2V4L A;  2DYM A;  2I1K A;  1W1G A;  3ZVR A;  1YD8 U;  3EC8 A;  1XCG A;  2EKE C;  2VKI A;  3ODX A;  5J3Y A;  3CSF A;  1WGR A;  2O6V B;  3JSV B;  2J0K A;  3P7Z A;  2ZNV C;  4IAP A;  2FCM A;  1UD7 A;  2WWZ A;  3Q3F A;  2KX0 A;  3QC8 B;  2YF0 A;  3ZVV A;  4F7Z A;  1KZG A;  2X18 A;  2ZVN A;  4NAW A;  4EMO A;  2COD A;  5J18 A;  3PGE A;  2MBB B;  3A8Q A;  5AZF A;  5IAA C;  5D94 A;  2KMA A;  2J0M A;  4KAX B;  3PRZ A;  4GZU A;  2MWN B;  1WXM A;  1V5O A;  3TJP A;  3VTW A;  2DN6 A;  2DLW A;  2NR2 A;  3T8M A;  3V6C B;  2BYF A;  3TL5 A;  2YS3 A;  2DYO A;  1XX0 A;  3DQV A;  1KM7 A;  3HM3 A;  4HJK A;  3UIN B;  3RUI B;  2VRW B;  2CY5 A;  3ZRC A;  3HQC A;  2J7Q B;  2COA A;  3PZD A;  2KDI A;  5DHF B;  1FGZ A;  1P6S A;  1PLS A;  2NBU A;  5AZG A;  4F8C B;  2IFS A;  2V1Y A;  4ZDV A;  1MAI A;  2KNB A;  2O2V A;  3DXE A;  3VAW A;  4GN1 A;  3V5W A;  2LUL A;  3ZNH B;  2NS5 A;  4KIK A;  1WGY A;  4IG7 B;  3A9J A;  2AWT A;  5DPS A;  2KFJ A;  1RAX A;  3HIZ A;  3TIX A;  3FEH A;  5CLQ B;  2O6V D;  2DZI A;  2KQ7 A;  2L3Z A;  3X0W A;  4KHA A;  2GMI C;  4A3O A;  4KV2 A;  4F1S A;  2GBJ A;  4K81 A;  4II2 B;  2GBN A;  1LQB A;  2NBW B;  2R0D A;  3P2B A;  2LGX A;  2KTF A;  4JL9 A;  3N3K B;  3TW1 A;  5JHB A;  2FUH B;  5C16 A;  4LJP B;  2RR9 A;  3VQI A;  3X23 A;  2KC2 A;  1B55 A;  1GG3 A;  4AWJ A;  4CO7 A;  4EFO A;  1P3Q U;  3KUZ A;  4BKS D;  4N9F 4;  2IO2 B;  4MSM B;  5C79 A;  1DDM A;  2LJ5 A;  1YJ1 A;  2P0H A;  2DHZ A;  3K9P B;  3ZLZ A;  1PMS A;  1E8W A;  5LXI B;  1IRS A;  3CF6 E;  2DFK A;  2MBE A;  4TYZ A;  1TJ6 A;  4XC2 A;  1MG8 A;  2ZVO A;  3MTN B;  2IY1 B;  4XX5 A;  1TTN A;  4JGH B;  4WAA A;  1M94 A;  2LAS A;  2MCN B;  3ZW3 A;  4DDI D;  4IC7 B;  1P98 A;  1K5D B;  2C7M B;  4I6N B;  4HB2 B;  5GOW B;  1R4N I;  3VUX A;  4WJO A;  3A4R A;  3QK0 A;  3DXC A;  5LON B;  1AAR A;  1V9J A;  2JRI B;  4FHJ A;  2LOZ A;  3SNH A;  3DOW A;  3GOE A;  2MDX A;  2HTH B;  2W2X D;  4IFS A;  2WX0 A;  3TVV A;  4A5K A;  2IYD B;  3F0W A;  4MEL A;  2K2J A;  5CTR C;  3RCZ A;  4BFR A;  2DTC A;  2CS4 A;  3AU5 A;  2L0F A;  5AEK B;  3OAN A;  1UBQ A;  2GBK A;  3AUL A;  3EHV A;  4M8M A;  4KDL B;  2JT4 B;  2NCN A;  2XBB C;  1YQB A;  2A4Z A;  2KZR A;  2G45 B;  2CY4 A;  2EMS A;  3PLU A;  2BCJ A;  4TV3 A;  3SDL C;  4W9C A;  1X05 A;  3R7Q A;  3HM6 X;  3M63 B;  5J2R A;  4K2P A;  3RCP A;  2BPS A;  3NS8 A;  4PYU A;  2P8V A;  1I7A A;  2JVC A;  2L8J A;  2LVQ A;  3DVG X;  3MJW A;  4HPM B;  4W9G A;  5JHA A;  3PPA A;  5LXH A;  2IZV B;  2PE9 A;  4D0N B;  4Y94 A;  4GIV A;  4IM3 A;  3ENE A;  4HAV B;  3KH0 A;  2KFK A;  2REX A;  4DXA B;  3L13 A;  2KTR B;  3NZS A;  1V5T A;  4FN2 A;  3D32 A;  4ZYN A;  4WWN A;  1XQQ A;  1FOE A;  3CIK A;  3SD5 A;  1I42 A;  5CLL B;  3AU4 A;  3N7C A;  3AI5 A;  2YLM A;  3ALB A;  3C0R B;  2LVP A;  4HB0 B;  3QA8 A;  4WJ7 A;  2N0Y A;  3DVG Y;  2DX5 A;  1LM8 B;  3ULB A;  4WJN A;  2CHX A;  3PV1 A;  3CST A;  1IPG A;  1C1Y B;  3SHQ A;  1TGZ B;  1EF1 A;  1U5G A;  4KDI C;  2N9P C;  4E74 A;  2DZK A;  5L95 C;  3BJI A;  2V76 A;  3H6N A;  1E8X A;  4II3 B;  5CHV C;  3RZW C;  1ZSQ A;  1V81 A;  4FBJ B;  3Q3J A;  2AEH A;  4ICV A;  2WDT B;  1EAZ A;  4NPN A;  3D8D A;  2HJ8 A;  2D11 A;  3IBE A;  2Z0O A;  2ELB A;  2LZ6 A;  4K1R B;  4XWX A;  4M0W B;  2RLO A;  4CHM A;  2RVB B;  4TKN A;  3RUL A;  2OJR A;  2M38 A;  2EC1 A;  3MDB C;  1U27 A;  5HE3 A;  1Q5W B;  1GC6 A;  3H7S A;  3JSV A;  3PRE A;  3ZDM C;  3QX1 A;  1SHC A;  4OVV A;  3UGB B;  4BOZ B;  3VVW B;  2N4F A;  3V6E B;  2N9X A;  4NAW B;  1WI1 A;  4TQ1 A;  1WM2 A;  4KZ0 A;  1WH3 A;  4B9K A;  1Y8R C;  2EJ8 A;  2GCJ A;  2KJ6 A;  2ZPN A;  2NMB A;  1DDV A;  2DYN A;  3APC A;  1WJU A;  5E6P A;  4WWP A;  4GOC A;  3ZNZ B;  3ZUN A;  1V5U A;  1UPR A;  2DX1 A;  2L2I A;  4W9F A;  3HHM A;  5D2M B;  2H7D A;  3OJ3 A;  3T9L A;  4AJW A;  4BKG A;  5KQ4 A;  3R3M A;  2ZJD A;  2KKC A;  1RRP B;  4KHB B;  2JP2 A;  3VTV A;  2VSZ A;  2KWV B;  3QQ8 B;  4G11 A;  3GYO A;  3UQA A;  4W9H A;  2R09 A;  3B08 A;  3G9W A;  2HE7 A;  4HAW B;  2KCJ A;  4F7U P;  2BKF A;  2LI5 A;  1QQG A;  1SE9 A;  1J19 A;  4FJZ A;  4WSF A;  3DBL I;  1M7R A;  3SV1 A;  5D3W A;  4GDK A;  3VFK A;  3TBL D;  5TR5 A;  2YS1 A;  2OTX A;  3NHE B;  5J17 A;  2D9Y A;  2I1J A;  1NBF C;  2JXX A;  2DYB A;  1E7V A;  2LRU A;  2DZJ A;  5DPW A;  2MWS B;  2MSE D;  2K25 A;  1WE6 A;  4HCP B;  1I2H A;  1UNQ A;  3R7R A;  4DHJ B;  1UEF A;  1XT9 B;  1FHW A;  1WF9 A;  4DBB A;  1Z2M A;  2D2Q A;  1WIA A;  4NQK E;  4GMV A;  1WXA A;  4KHO A;  4EOY A;  5KHQ A;  1Z5S B;  5E6O A;  3M62 B;  1R4M I;  2IY0 B;  3OJ4 B;  4IWP A;  4XZ4 A;  1HE8 A;  3SUZ A;  2NBV B;  3SO6 A;  4IW0 A;  3ML8 A;  2BKR B;  4IWQ A;  5CHW A;  4HDO A;  3UIO B;  2D10 A;  2K6Q A;  4PS8 A;  3N32 A;  4YL8 A;  3A1Q B;  2KDF B;  3L54 A;  2D9V A;  1G6J A;  1L7Y A;  4IUM B;  4W9K A;  4LDT B;  1L2N A;  4L6E A;  2GCL A;  1P1A A;  1TBE A;  3PRM B;  5BO4 B;  1RJ2 A;  4AOF A;  5HKH A;  1EUV B;  4HLE A;  2ZCC A;  3VH4 B;  3ZNG C;  1J0W A;  3DPD A;  1WVH A;  2CR5 A;  3PLV A;  2CRF A;  2A5U A;  4KSL C;  2JZZ A;  2BGF A;  1WJ1 A;  4CYE A;  2MKR A;  2XK5 A;  3PSC A;  1ZKH A;  4TUU A;  1NTY A;  4MH0 E;  2D4Q A;  3AJ4 A;  3QWZ B;  4GMX B;  4ANV A;  2JRH A;  2UZR A;  2PE6 B;  3U30 A;  3PTF C;  4MSQ B;  2I5F A;  2H7E A;  1V86 A;  1YX6 B;  2PEA A;  4GU2 A;  4AJY B;  5EDS A;  1WY8 A;  3PVL A;  2DHI A;  1S1Q B;  5D7G A;  2CAY A;  4A20 A;  2L05 A;  3UIP B;  5DI9 B;  1WJN A;  3O65 B;  3M1I B;  1DDW A;  1UNR A;  1OEY A;  2IO1 B;  3O96 A;  3T06 A;  2K1F A;  3DDC B;  4FJY A;  1WGG A;  2ROZ B;  4W9J A;  2KLG A;  2KGX B;  2D3G A;  3TMP B;  4TQ0 A;  2ZCB A;  3JYU A;  1LW3 A;  3BIN A;  2JUO A;  2M17 A;  4HPL B;  1I35 A;  5HE2 A;  5L83 A;  4LDT D;  1H4R A;  2OQB A;  4F7G A;  1WGH A;  1FGY A;  1KZ7 A;  5C6R A;  3QAQ A;  5G55 A;  2RD0 A;  4AUQ C;  2MX2 A;  1V80 A;  1WX9 A;  2KTR A;  2LD9 A;  3ML9 A;  4DBG A;  2KN5 A;  4M8N A;  3DBR I;  1X86 A;  4MGY E;  4HAY B;  3EEC A;  5G2N A;  1WYW B;  3S2A A;  1T0Y A;  1N3H A;  3HK0 A;  2KFK B;  4DHZ E;  2LYD A;  3KZ1 A;  4NJ7 A;  1XKE A;  2KQS A;  4W9L A;  3CMM B;  2RSU A;  2J59 M;  5DIF B;  4ZRJ A;  2FAZ A;  2MA9 B;  3ZNI D;  2DA0 A;  4EEW A;  1QC6 A;  3VDZ A;  3ZKJ C;  1FHX A;  5HE1 A;  1AWE A;  3QIJ A;  1UNP A;  2GS0 A;  2DX5 B;  2IO0 B;  1WM3 A;  1OQY A;  3B1L X;  2DKP A;  3JVZ X;  4HK2 A;  4ICU A;  4JIO U;  4CHK A;  1IP9 A;  2Z59 B;  1WZ0 A;  1MPH A;  2LKO A;  4Z2M B;  4HAZ B;  1UBI A;  1S3S G;  2Z0E B;  3A4S C;  4IM0 A;  3WA0 A;  1Q67 A;  2JZ3 B;  1GC7 A;  4K7S A;  4KIK B;  1E90 A;  3U7D A;  3L0W B;  3SYX A;  5C23 A;  3WAM A;  5C5B B;  2KJH B;  2CHZ A;  3DVN V;  3TCA A;  2MP2 A;  4BKT A;  4MGK E;  3VTU A;  3MPX A;  1WX8 A;  2ROV A;  3D8F A;  3U8Z A;  5DH9 B;  2RSG A;  2C9W B;  2DZM A;  2KVR A;  2LUE A;  3PSE B;  4WVF B;  1WMH A;  4ZRI A;  4MJS A;  3ONS A;  4B95 A;  5JLJ B;  5DCN A;  4P7I A;  2LGY A;  2MQJ A;  4IM2 A;  3QAR A;  1E7U A;  2IBI B;  1V88 A;  3TFM A;  2JPH A;  3ECI A;  3A1Q A;  3KW5 B;  4PS7 A;  4W9D A;  4A3P A;  1XR0 B;  2Y8F A;  4MK0 A;  5GMV A;  1YX5 B;  1OY2 A;  1TXD A;  3D8E A;  2PJH A;  3KYC D;  1EO6 A;  1BTK A;  2DHK A;  1E8Z A;  1F9J A;  2J0J A;  5E6N A;  3PEG A;  4A6H A;  3DVN U;  3RZF A;  3VH3 B;  3VIA A;  3PRP B;  5JZE B;  1M7E A;  2K6D B;  2GBM A;  2N7D A;  3QHT A;  4DHJ D;  1IYF A;  4MT7 A;  2P0D A;  4I6L B;  1WI0 A;  2UYZ B;  2K8B A;  3LJU X;  4YON A;  3PVW A;  4KZC A;  2MFQ A;  1SGH A;  4W9I A;  2AL6 A;  2M1M A;  2MLB A;  3VHT C;  4ANU A;  4BVU C;  4CHJ A;  2KX3 A;  3APF A;  4GDK B;  2K00 A;  2FCQ A;  2R2Q A;  2W2W A;  2KHW B;  2L0T A;  2ZZP B;  4X57 B;  1NU2 A;  2N1W A;  2D9W A;  2V3S A;  3A8P A;  4FLH A;  4HCN B;  3KUC B;  1P5T A;  3QCA A;  2KD0 A;  4C0A A;  3FM8 C;  2I5C A;  4HAT B;  1RRB A;  5DPT A;  2YSZ A;  1WE7 A;  2D9Z A;  1U5D A;  2C60 A;  3VXW A;  1WJM A;  2FCN A;  1A5R A;  1EF5 A;  2KJR A;  1WZ3 A;  2B3A A;  1AQC A;  3WAL A;  1LFD A;  3PS6 A;  4K7W A;  2YT0 A;  1FAO A;  1WFY A;  4MGZ E;  2D07 B;  1WGD A;  5CHF A;  3DCG A;  2G4D B;  1UPQ A;  4ANX A;  2COC A;  4NSW A;  1KI1 B;  1NI2 A;  3A98 B;  4MY6 A;  3A9K B;  3L10 B;  4HWI B;  4W9E A;  3RD2 A;  3RT3 B;  4WJP A;  4DDG D;  2KMC A;  2CU1 A;  2NPT A;  4IOY X;  2M8S A;  4WWO A;  1U5F A;  5JHH A;  3VOQ A;  1MKE A;  1QZE A;  2D9X A;  1WJ6 A;  2R2O A;  2QKM A;  1LB1 A;  1EVH A;  1V89 A;  2LOX A;  2KWU B;  3WIM A;  2Q13 A;  2C7H A;  4HVB A;  1U5E A;  4GXB A;  5D6J B;  2MBQ A;  2K39 A;  1WXV A;  2MBH A;  2XK5 B;  1J0G A;  2YVC A;  3ZRF A;  2KK8 A;  1ZGU B;  3QWM A;  1E5W A;  5D3X A;  1V61 A;  3HW2 B;  2QHO A;  2Y8G A;  3N30 A;  3PHX B;  3RYT A;  3L08 A;  5AZH A;  4BKS A;  1J8C A;  1VD2 A;  4Z2N A;  2CKH B;  1UGM A;  3VUW A;  4A6F A;  1ZM0 A;  3OLM D;  3PT2 B;  2FNJ B;  3KSY A;  1RFA A;  1P0R A;  2KDE B;  2MW5 A;  1V5P A;  2NZ8 B;  3WAO A;  1D3Z A;  2ELA A;  2PZ1 A;  5CX3 A;  1WMH B;  1UH6 A;  4BOS C;  4BBN F;  2KWC A;  1GUA B;  1Q1O A;  2ADZ A;  2LG1 A;  3H7P B;  3BY4 B;  4E3C A;  4GDL A;  4URK A;  5HE0 A;  4NY0 A;  2Z0Q A;  3KVF B;  1WR6 E;  4GPT B; 
#chains in the Genus database with same CATH topology
 4NJ6 A;  4DQO C;  3LJ3 A;  1WX7 A;  1TY2 A;  3KRX A;  1VBH A;  2CHW A;  2OJW A;  2K3U A;  1PQS A;  2QIE B;  4PQ0 A;  2V0G A;  3OAW A;  1WYG A;  2LXA A;  4RMA A;  4HXD A;  2KAN A;  1PFJ A;  2SAK A;  2INN E;  4GLS C;  1BT0 A;  2N9E B;  1KLV A;  4EZL A;  5LLI A;  2KLC A;  4HRO A;  3NVV A;  2JWZ A;  2PKO A;  3A9K A;  4HAU B;  4B6H A;  2V3P A;  3W1Y A;  2EMT A;  2JF5 A;  3NZU A;  1LGR A;  2WXJ A;  3FLV A;  3MHS D;  4MGI E;  1CMX B;  3AE4 B;  2N7J A;  1Z87 A;  2WS3 B;  3ZQ4 A;  5EFX A;  3AEC B;  3KUD B;  1OMW A;  5J3T A;  1EM7 A;  2M0A A;  2KC1 A;  3FSS A;  4OW0 A;  2CU3 A;  1U29 A;  3H1U A;  2ZPY A;  1V2Y A;  2COF A;  4WQO B;  2KT7 A;  2GOW A;  2KVZ A;  2QC8 A;  1OTR B;  2KXJ A;  1WXS A;  1EGX A;  1WRI A;  1FMA D;  3APD A;  5D3Y A;  5JP4 A;  3PVU A;  1WR1 A;  3W1S A;  1V97 A;  3TEX A;  4GDL B;  4PYZ A;  4FHK A;  2N1V A;  1MK9 B;  1SIF A;  1I7H A;  2LGS A;  1X11 A;  3V60 A;  2KDB A;  1BAK A;  3PG7 A;  2BYE A;  1FNU A;  2CB8 A;  2M4N A;  1UZX B;  1FXI A;  3K9O B;  4R3D A;  5BYS A;  1KRH A;  4LNO A;  2X0S A;  1H8C A;  1YQ4 B;  1DRO A;  4RNA A;  3AE6 B;  3PO0 A;  2IPK D;  3ODW A;  2ASQ A;  2BWF A;  3ZTC A;  4DX8 A;  2E2X A;  5L81 A;  1V1P B;  1ZW7 A;  1R7S A;  3MFG A;  2RMM A;  5G5G A;  2VKI A;  3ODX A;  1FRR A;  2HDE A;  3CSF A;  1WGR A;  3JSV B;  1UD7 A;  3QC8 B;  4S0R A;  1L0X B;  1KZG A;  3U2S C;  2J4X A;  2IJ0 A;  3LXF A;  2KMA A;  1VBG A;  3PRZ A;  1F77 A;  3TJP A;  2DN6 A;  3AE3 B;  3V6C B;  1VRA B;  3DQV A;  1KM7 A;  3HM3 A;  4LTU A;  4US9 A;  1L0Y B;  2KDI A;  2OHF A;  4JKH A;  4ZDV A;  4XWW A;  3DXE A;  3VAW A;  3UI3 A;  3V5W A;  3E56 A;  2LUL A;  1WGY A;  4IG7 B;  5I2M A;  1N60 A;  5DPS A;  2KFJ A;  1RM6 C;  4C7Z A;  4A3O A;  2BBC A;  4F1S A;  4K81 A;  4II2 B;  2LGX A;  2KTF A;  3N3K B;  2WXL A;  1FIQ A;  2RR9 A;  2KC2 A;  4REZ A;  3AH7 A;  1CJE A;  3RNG C;  4N9F 4;  2IO2 B;  4TYZ A;  4O1N A;  2ONQ A;  4BAX A;  3MTN B;  1WWT A;  4JGH B;  4WAA A;  5AUK A;  2LAS A;  2MCN B;  4PT5 A;  2RPV A;  4I6N B;  3VUX A;  2DIK A;  3QK0 A;  4FHJ A;  4HEA 1;  3VRB B;  3SNH A;  2HTH B;  1FO4 A;  4A5K A;  4C4V A;  1ZXH A;  2K2J A;  2GLS A;  4BFR A;  2L0F A;  5D3D A;  2MJE A;  2GBK A;  5BMI A;  3EHV A;  4M8M A;  2XBB C;  2A4Z A;  2CY4 A;  2EMS A;  3PLU A;  2BCJ A;  3SDL C;  4W9C A;  3KWL A;  4WWM A;  3HM6 X;  5J2R A;  4K2P A;  3NVW A;  2DLB A;  5JHA A;  1MFW A;  3NZS A;  4JKG A;  1ZYI A;  1JCK B;  2WU5 B;  3D32 A;  4WWN A;  3NG0 A;  3KWV A;  1C76 A;  3AI5 A;  2YEP F;  3ALB A;  1QOA A;  2VH1 A;  1LM8 B;  4WJN A;  5EE1 A;  1GAQ B;  1U5G A;  5L95 C;  2JSV X;  2AEH A;  2KDM A;  3NWD A;  2QJL A;  2OED A;  2HJ8 A;  3IBE A;  2ELB A;  4M0W B;  4XWX A;  2N0S B;  3PZ8 A;  3RUL A;  2OJR A;  2W55 A;  1U27 A;  1Q5W B;  4YTP B;  3MHZ A;  1YNT E;  1OQQ A;  1ROE A;  2X38 A;  2K0P A;  2PVG C;  1IUE A;  3RI7 C;  4BKG A;  3DWG C;  2KWV B;  4G11 A;  3UQA A;  1HTO A;  4HAW B;  2LI5 A;  1KC7 A;  3VFK A;  4ACF A;  3TBL D;  2YS1 A;  2OTX A;  3NHE B;  4ITK A;  4RH6 A;  4C4V B;  2LRU A;  2DZJ A;  2MSE D;  1WE6 A;  4HCP B;  1B1Z A;  1UEF A;  3B77 A;  4JX1 C;  4DBB A;  4J3O D;  2D3A A;  1VZ6 A;  4M00 A;  3TSS A;  1R4M I;  4N58 A;  2IY0 B;  4RF1 A;  4IW0 A;  4IKG A;  1WGK A;  1MI1 A;  4IWQ A;  4YL8 A;  1GB1 A;  2D9V A;  1EU4 A;  2YT2 A;  4LDT B;  1P1A A;  1QOF A;  2ZCC A;  3VH4 B;  2X8X X;  3ZNG C;  1WVH A;  4KSL C;  2BGF A;  1HBK A;  3AEA B;  1NTY A;  4MH0 E;  1OQR A;  4GOU A;  4GMX B;  2CQU A;  2JRH A;  1DOY A;  4KGR A;  3U30 A;  5M4Y B;  2H7E A;  2KUQ A;  2MH7 A;  4AJY B;  4ZRP A;  1J7A A;  2DHI A;  4ILG B;  3I9V 1;  1OEY A;  3O96 A;  2HJ1 A;  2K1F A;  4FJY A;  5FR6 A;  4BKT A;  2JUO A;  2M17 A;  4HPL B;  3NUH B;  2RD0 A;  3ML9 A;  3DBR I;  1X86 A;  4HAY B;  3Q8C A;  2LUM A;  2LYD A;  4NJ7 A;  3OHM B;  3CMM B;  3ZNI D;  4EEW A;  1F1H A;  3VDZ A;  5HE1 A;  1SXT A;  2DX5 B;  4CQN A;  4HK2 A;  1TKY A;  4WH4 A;  1IP9 A;  2LKO A;  4Z2M B;  3FAH A;  4HAZ B;  4IM0 A;  3WA0 A;  4KKJ A;  4ZHP A;  5C23 A;  3WAM A;  1I4G A;  2C9W B;  3D8F A;  2KVR A;  2RSG A;  1WMH A;  4LK0 M;  4ZRI A;  5JLJ B;  2MQJ A;  1V88 A;  3TFM A;  3BYY B;  3KW5 B;  3Q69 A;  4W9D A;  2FUG 1;  1TXD A;  2PJH A;  3KYC D;  2HTM E;  3RZF A;  3VH3 B;  4A6H A;  3DVN U;  3N1Y C;  3IT4 B;  1D5X C;  4MT7 A;  2P0D A;  3LJU X;  2MFQ A;  4WUR A;  2KHW B;  1NU2 A;  2N1W A;  4HCN B;  1E10 A;  4FLH A;  3KUC B;  1P5T A;  2KD0 A;  4HAT B;  1WE7 A;  2VH2 A;  3VXW A;  1SSN A;  2KJR A;  2LFI A;  4MM3 B;  1AQC A;  4K7W A;  1I4P A;  1FAO A;  1WGD A;  2DNF A;  1UPQ A;  4MY6 A;  1E0Z A;  3A98 B;  3A9K B;  3RT3 B;  1YJJ A;  4WJP A;  2IDY A;  3IAM 1;  4DDG D;  1AW7 A;  1KH0 A;  2G9H D;  1T0Q C;  3H8H A;  1MKE A;  1R4M B;  4HVB A;  2LOX A;  1D5M C;  1QT9 A;  2Q13 A;  1U5E A;  2K39 A;  2MBH A;  2XK5 B;  1QQR A;  2KK8 A;  1ZGU B;  4JLC A;  1E5W A;  3RYT A;  3ZW3 A;  4D2K A;  3PHX B;  4RCO A;  1VD2 A;  4Z2N A;  2ABD A;  2WNM A;  2FNJ B;  4TSS A;  2MW5 A;  3DHI C;  1UUP A;  2PZ1 A;  1WMH B;  1TZO A;  1UH6 A;  3BVZ A;  2KWC A;  1F0Z A;  1Q1O A;  3H7P B;  1JW9 D;  2YEP B;  2H89 B;  3AE7 B;  4GDL A;  5HE0 A;  4NY0 A;  2Z0Q A;  4RM9 A;  4DXF A;  4ANW A;  2JY6 A;  2I2Y A;  1MVK A;  3KY9 A;  2NTS A;  2WGS A;  3Q8B A;  5FI0 A;  3ZIM A;  5H92 C;  1XD4 A;  2FJL A;  2R61 A;  2QKL A;  1V49 A;  3UF8 A;  3V62 A;  3SBG A;  2Z59 A;  2RGF A;  4F7H A;  2LRW A;  2UWQ A;  3SHQ A;  3ZLZ A;  4ZRK A;  4JK9 A;  3UZT A;  3F5R A;  1FHO A;  2AYO B;  2IYB A;  3V3X A;  3IHP C;  2PPH A;  1XO3 A;  1GGO A;  5C5B A;  1SEB D;  2K8E A;  2Z0P A;  1CK1 A;  3NSU A;  4NQL B;  4AP4 C;  1WGU A;  1NYR A;  1GJZ A;  2XQN M;  4ILJ A;  2DYQ A;  4TMA B;  5EE9 A;  3AM9 A;  4DK5 A;  1TQZ A;  3A33 B;  3GYP A;  1FB8 A;  2PIA A;  2GI9 A;  1K51 A;  2G35 A;  4PNK A;  1DBH A;  3WYF B;  2AL3 A;  4EJN A;  3FVC A;  2W9N A;  3T3O A;  1KLU D;  1MHH E;  1IYF A;  2UZS A;  3AE1 B;  4PS3 A;  4K17 A;  4YWG G;  5D27 A;  3VUY A;  4LNF A;  2RGN B;  3HVD A;  2L00 B;  1TZ1 A;  3NW8 A;  3QJZ A;  1WGQ A;  2N23 A;  1B9R A;  4L2Y A;  1WJ4 A;  3M95 A;  2FIF A;  1GNU A;  1HA5 A;  2KO3 A;  3NVZ A;  3NOB A;  1TKG A;  4QJ4 B;  3H7P A;  4D6W A;  5JH5 C;  1MHX A;  3ENB A;  2COP A;  4HDQ A;  1K5G B;  1QOG A;  4OVU A;  3L4P A;  1J8C A;  2LVO A;  3Q14 C;  1V5M A;  1KOT A;  2AQ1 B;  4GNK B;  1C3T A;  4OZC A;  1EWY C;  3R66 C;  1WXQ A;  4KGT A;  1KJT A;  1BWN A;  2WXG A;  4LCD E;  2GBR A;  2R82 A;  4H8S A;  1K8R B;  4JQW C;  1OGW A;  2KOX A;  4KGS A;  3V61 A;  1LXD A;  2LWP A;  3ULC A;  2UVM A;  1OQN A;  2WXF A;  2FID A;  3ZTD A;  3BWU D;  4EZK A;  2K5P A;  2Y5B B;  4GB9 A;  1ZUD 2;  1FXT B;  5JVL A;  4HRS A;  2M14 A;  4ASW C;  1OEY J;  3B0A A;  3PP2 A;  5EDS A;  2E3T A;  4DWF A;  1JAL A;  3M3J A;  3L17 A;  2DYM A;  1W1G A;  4YSZ B;  1YD8 U;  1MPE A;  2J0K A;  4IAP A;  2FCM A;  3Q3F A;  2KX0 A;  4EMO A;  2COD A;  3PGE A;  3A8Q A;  1ESF A;  1QIL A;  3A58 A;  4KAX B;  3E66 A;  2AX5 A;  2YS3 A;  1XX0 A;  3AV8 A;  4HJK A;  1NVL A;  2V9H A;  3UIN B;  2VRW B;  1D6E C;  2CY5 A;  1JWA D;  3SFD B;  1JRO A;  4WIP A;  3PZD A;  1FGZ A;  2NBU A;  1V8C A;  2IFS A;  2V1Y A;  2KNB A;  2O2V A;  1NTI A;  2NS5 A;  4KIK A;  2Y3A A;  2FJ9 A;  2WLB A;  1RAX A;  3TIX A;  4M02 A;  2H88 B;  2O6V D;  2DZI A;  3X0W A;  1IBX B;  1L4D B;  1DGJ A;  2LMC A;  4JL9 A;  5FKA C;  3VQI A;  1P3Q U;  1L6V A;  4BKS D;  4A90 A;  2W3R A;  2DHZ A;  2P0H A;  2WXN A;  1N5W A;  3CF6 E;  2MBE A;  4XC2 A;  3BVG A;  1MG8 A;  3EPY A;  2ZVO A;  4ZHO A;  1TTN A;  4S17 A;  4RGT A;  3AEE B;  4IC7 B;  2W82 A;  2D3C A;  2C7M B;  4HB2 B;  4XDC A;  3A4R A;  1AAR A;  1L4Z B;  2BVC A;  3GOE A;  3KLS X;  2MDX A;  2W2X D;  4IFS A;  4A55 A;  5CTR C;  3RCZ A;  3SR6 A;  3AU5 A;  5FK9 C;  3OAN A;  5AEK B;  4JKC A;  1NEK B;  4KDL B;  1YQB A;  4QJ5 B;  4OT1 A;  3R7Q A;  3RCP A;  2KWD A;  2LVQ A;  1VZ7 A;  3DVG X;  4HPM B;  3NJT A;  2IZV B;  4D0N B;  2REX A;  3L13 A;  1KBL A;  2UU7 A;  4MH8 A;  3ZJV A;  1V5T A;  4ARI A;  3AMZ A;  1EU3 A;  4K3B A;  5HFY A;  1YOV B;  2LVP A;  2D3B A;  3QA8 A;  2N0Y A;  2BS4 B;  1IPG A;  1C1Y B;  4KDI C;  2DZK A;  3BJI A;  3RZW C;  3H6N A;  1V81 A;  4DXG A;  1SE3 A;  4ICV A;  2MHJ A;  1F52 A;  3Q6B A;  4XGA B;  2LZ6 A;  4K1R B;  2RLO A;  2RVB B;  4TKN A;  3IAS 1;  2Q5W D;  2EC1 A;  3ZDM C;  1GC6 A;  3UGB B;  1SHC A;  4BOZ B;  3VVW B;  3W5U B;  4NAW B;  1WI1 A;  3MJ5 A;  1WM2 A;  4JE3 B;  2EJ8 A;  2GCJ A;  1N61 A;  2ZPN A;  1M4V A;  2BB5 A;  1DDV A;  2DYN A;  4WWP A;  4GOC A;  2DX1 A;  2H7D A;  4AJW A;  2Z13 A;  2PLP A;  2ZJD A;  3QQ8 B;  1ST7 A;  3GYO A;  2HE7 A;  2WU2 B;  1M7R A;  3SV1 A;  5D3W A;  2WXM A;  4GDK A;  4WQM A;  2I1J A;  2D9Y A;  5C2T B;  2JXX A;  2DYB A;  5HG2 A;  1E7V A;  4RGM A;  3R7R A;  1STE A;  2D2Q A;  4NQK E;  5KHQ A;  4GMV A;  3AEG B;  4EOY A;  1PGB A;  5E6O A;  3SUZ A;  2NBV B;  2JU6 X;  3ML8 A;  4XE0 A;  5CHW A;  4HDO A;  2D10 A;  2K6Q A;  1PFD A;  3N32 A;  3L54 A;  2WQY B;  1G6J A;  1L2N A;  2EKI A;  4L6E A;  2GCL A;  4AOF A;  1RJ2 A;  5EE0 A;  5HKH A;  5TSS A;  1J0W A;  3PLV A;  2CRF A;  2A5U A;  4CYE A;  2MKR A;  2XK5 A;  3HIE A;  2D4Q A;  3QWZ B;  1KFY B;  2UZR A;  2MEK A;  5JHB A;  1YX6 B;  2PEA A;  1C4P A;  4GU2 A;  3AED B;  3GE8 C;  1S1Q B;  4A20 A;  3UIP B;  5I2S A;  1DDW A;  1UNR A;  1L6U A;  3NWF A;  3AE2 B;  4MAC A;  3ZJU A;  3T06 A;  2KLG A;  4TQ0 A;  3BIN A;  5L83 A;  1H4R A;  4F7G A;  2J42 A;  2WXR A;  1FGY A;  5C6R A;  1FEH A;  3QAQ A;  4AUQ C;  2K9X A;  1V80 A;  2L1A A;  2LD9 A;  4DBG A;  2KN5 A;  3AN1 A;  3TUO A;  3LB8 C;  1VLB A;  5G2N A;  1WYW B;  2KQ4 X;  3S2A A;  1T0Y A;  2KFK B;  3EGR A;  4DHZ E;  2KR0 A;  1FPY A;  2KQS A;  4W9L A;  1PYW D;  2FAZ A;  1QC6 A;  3BK2 A;  3ZKJ C;  3QIJ A;  3B1L X;  1FXA A;  4ICU A;  2PMV A;  4CHK A;  1WZ0 A;  5HI1 A;  3Q8A A;  1MJD A;  4YTN B;  2TSS A;  4ZOH C;  2JZ3 B;  3RNC C;  4K7S A;  3U7D A;  3P4S B;  5BMH A;  3SYX A;  1CQV A;  3AXC A;  2ROV A;  3U8Z A;  2DZM A;  2IGD A;  4WVF B;  1NVI D;  3ONS A;  4UDU C;  5DCN A;  2WH5 A;  3DBR B;  3QAR A;  1TS5 A;  3ECI A;  5H8Y E;  4A3P A;  2JWU A;  4PS7 A;  3NWA A;  2KAC A;  1OY2 A;  1IGD A;  1EO6 A;  1BTK A;  1E8Z A;  2J0J A;  3PEG A;  1HZ5 A;  2N7D A;  2B76 B;  2UYZ B;  2K8B A;  4KZC A;  1N6Z A;  4W9I A;  4ILH A;  5EE3 A;  2KX3 A;  4X57 B;  2K00 A;  2R2Q A;  1P7E A;  3E9S A;  3FM8 C;  2YSZ A;  1WJM A;  4LNK A;  1ENF A;  1LFD A;  2XNA C;  3AE8 B;  3KQ4 A;  4MGZ E;  2D07 B;  3DCG A;  2G4D B;  3C8Y A;  2COC A;  4ANX A;  1KI1 B;  4W9E A;  1MG4 A;  3DHH C;  4C00 A;  2M19 A;  5IRS A;  4YXD B;  2FDQ A;  2M8S A;  3FP5 A;  5HHD G;  1LB1 A;  1V89 A;  2INP E;  5BMG A;  3WIM A;  4GXB A;  2K22 A;  2JZP A;  3EFC A;  5D6J B;  4ARC A;  2MBQ A;  2JQR B;  4NZL B;  2YVC A;  1QF6 A;  5D3X A;  2QHO A;  4BKS A;  2RQ1 A;  3L08 A;  1XXG A;  5AZH A;  1UGM A;  4NAM A;  3VUW A;  1FD6 A;  3DBL B;  3OLM D;  4XDD A;  1V1P A;  2M56 B;  3URY A;  1P0R A;  2NZ8 B;  1D3Z A;  2ELA A;  2R2Y A;  4BBN F;  3R2T A;  3BY4 B;  4GPT B;  3Q3M C;  1RLF A;  1WRD B;  2C7N B;  3AE5 B;  3O13 A;  3TO1 A;  1J7B A;  3I63 C;  2DWQ A;  2OOB B;  4NNJ B;  2RNR B;  1I4Q A;  3KYD D;  2K8H A;  2WDR B;  2KUP A;  2W2X C;  1P9D U;  2I38 A;  1ZOY B;  4JKA A;  4B6W A;  1UEL A;  4KIK B;  4QXA B;  1T5X D;  4C80 A;  1H10 A;  1XF5 L;  2NVU I;  4GGQ A;  3JW0 X;  1KF6 B;  1ZC4 B;  4DHZ B;  1GOZ A;  2DAF A;  1IBX A;  5LOP B;  1ISN A;  3SEB A;  2JXT A;  2BYV E;  4G0N B;  4HKQ A;  5DPR A;  2MP2 B;  1JWU D;  3HUI A;  4HHV A;  4WJQ A;  4BBN C;  2WXO A;  4MJS B;  3DWM A;  2G3Q B;  1FFV A;  5DHA B;  4K7U A;  1MK7 B;  3I3T B;  4EKU A;  2P0F A;  5GXG B;  3NS1 A;  3ZXV A;  2GRI A;  4GSW A;  2RDH A;  1VR9 A;  1NDD A;  2LEK A;  1GB4 A;  2VRR B;  1U2B A;  1C77 A;  4YT0 B;  3EUB 2;  4G50 A;  1ZC3 B;  2O2V B;  1NTV A;  1BTN A;  3P6A A;  4A6K A;  2HTH A;  4FJV B;  1XLP A;  1K50 A;  3DBS A;  3ZO5 B;  4FA6 A;  1Q0W B;  2G4S A;  1W1D A;  2DAJ A;  4RM8 A;  2N7E A;  4FAD A;  3MP9 A;  4MDK E;  1XCQ L;  1TY0 A;  2RPQ A;  1E6E B;  2ZNV B;  1VCB A;  3H9D A;  4HAX B;  2YS5 A;  1YIW A;  3AEF B;  2Z4D A;  3EFU A;  5D3V A;  2DEN B;  2M0X A;  2YRY A;  1FM0 D;  4YTM B;  4JKE A;  2Z0D B;  2LHE A;  2PW9 A;  2DHJ A;  2RUK B;  3RNB C;  3GZN B;  3WAN A;  2LGD A;  2DKQ A;  2WXQ A;  3ODO A;  4HKZ E;  3DXD A;  2XEW A;  2HD5 B;  3L16 A;  3DBH B;  1U4A A;  2FCS A;  2XN9 C;  2LXC A;  3B9J A;  2V4L A;  2I1K A;  4M0W A;  3BK1 A;  3EC8 A;  2EKE C;  2ON8 A;  5J3Y A;  4RGN A;  1QKZ A;  3P7Z A;  2ZNV C;  2WWZ A;  4USA A;  2YF0 A;  2ZVN A;  2X18 A;  4HPP A;  3BVM A;  2WHI A;  5IAA C;  1UGJ A;  3B2G A;  4GZU A;  2MWN B;  1WXM A;  1Y56 A;  3N20 C;  3VTW A;  1GPX A;  2DLW A;  2BYF A;  1FFU A;  2DYO A;  2JX5 A;  3SBT A;  2JYE A;  3RUI B;  1ACC A;  2J7Q B;  2COA A;  1AN8 A;  1YN3 A;  1P6S A;  5AZG A;  3FKY A;  1MAI A;  2LHD A;  2BYT A;  3ZNH B;  3DHG C;  3A9J A;  2D5G A;  2Y5C A;  3HIZ A;  3FEH A;  2RDG A;  2IGH A;  4KV2 A;  2GBJ A;  2GBN A;  1EWC A;  1LQB A;  2KIE A;  2R0D A;  5T8I A;  3Q2A C;  3W9C B;  1JWS D;  2EEL A;  2FUH B;  4AWJ A;  5E6J A;  4MSM B;  5C79 A;  2LJ5 A;  5LXI B;  2IY1 B;  4P16 A;  4XX5 A;  3VR9 B;  1M94 A;  1ZPS A;  2QMT A;  1K5D B;  3ZGZ A;  3W5V B;  4WJO A;  5IN7 A;  5LON B;  1V9J A;  3DOW A;  1N63 A;  2WX0 A;  5G5H A;  3F0W A;  4MEL A;  2Y5P A;  1UBQ A;  3AUL A;  2JT4 B;  2NCN A;  3ABV B;  2KZR A;  2G45 B;  2MJD A;  1X05 A;  1JWB D;  4B0E A;  4H2A A;  2NBV A;  2N9K A;  2ZW1 A;  2P8V A;  1I7A A;  2JVC A;  2L8J A;  1KTK A;  5BYR A;  3PPA A;  1OFF A;  4YSY B;  5LXH A;  2PE9 A;  4GIV A;  4Y94 A;  4LNN A;  1F2R C;  4HAV B;  3ENE A;  4ZYN A;  1XLO A;  1XQQ A;  1FOE A;  3CIK A;  1L0V B;  1I42 A;  1L5P A;  2YLM A;  3C0R B;  4FXC A;  4WJ7 A;  2DX5 A;  3ULB A;  2CHX A;  3PV1 A;  3CST A;  3ZJT A;  1RYJ A;  2QDF A;  4II3 B;  1E8X A;  5CHV C;  4FBJ B;  2E6X A;  3Q3J A;  3B2F A;  2WDT B;  1A70 A;  4NPN A;  4M01 A;  4CHM A;  2ICI A;  4HSI A;  5HE3 A;  3AE9 B;  5J17 A;  3P4R B;  3QX1 A;  3NVY A;  4OVV A;  3SFE B;  1HTQ A;  1XEE A;  2N4F A;  3V6E B;  1QLB B;  1C4A A;  4KZ0 A;  1WH3 A;  1RWS A;  1Y8R C;  2LGI A;  1XLN A;  2KJ6 A;  2NMB A;  1WJU A;  3N9Y C;  4JK7 A;  3Q8F A;  5IOI A;  3ZUN A;  1V5U A;  4W9F A;  3HHM A;  3OJ3 A;  3T9L A;  5KQ4 A;  3R3M A;  1RRP B;  4KHB B;  2JP2 A;  2Z14 A;  5JXV A;  3TEW A;  2R09 A;  3B08 A;  3G9W A;  4FJZ A;  2KCJ A;  1QQG A;  1SE9 A;  1J19 A;  3DBL I;  5DPW A;  1VZ8 A;  2HRJ A;  1FHW A;  3GP7 A;  1WXA A;  1Z5S B;  3M62 B;  3OJ4 B;  4IWP A;  1BML C;  4XZ4 A;  3SO6 A;  2BKR B;  4JWS C;  2V4I B;  1FRD A;  2KDF B;  5FR3 A;  4IUM B;  4W9K A;  3PRM B;  5BO4 B;  1VDV A;  1JRP A;  1EUV B;  4P1B C;  1WJ1 A;  3PSC A;  1ZKH A;  4TUU A;  4ANV A;  2PE6 B;  3PTF C;  3MC0 B;  2I5F A;  1V86 A;  1WY8 A;  3PVL A;  4L23 A;  2CAY A;  5DI9 B;  1JQ4 A;  3O65 B;  1ZDX A;  4W9J A;  1WGG A;  2ROZ B;  3P42 A;  2KGX B;  2ZCB A;  1LW3 A;  1I35 A;  5HE2 A;  4LDT D;  2OQB A;  1WGH A;  5G55 A;  2J53 A;  1KZ7 A;  1N62 A;  2MX2 A;  1FNV A;  3VRA B;  4MGY E;  3TEZ A;  3EEC A;  4JKG B;  3HK0 A;  4L1R A;  3KZ1 A;  4KX6 B;  2RSU A;  4ZRJ A;  2DA0 A;  5BYQ A;  1WM3 A;  1OQY A;  2DKP A;  4JIO U;  2Z59 B;  1MPH A;  4JWU C;  2L32 A;  2Z0E B;  1Q67 A;  4K3C A;  2V3N A;  1E90 A;  1PGX A;  5C5B B;  1TKE A;  2CHZ A;  3DVN V;  3U4E G;  3VTU A;  3MPX A;  1WX8 A;  2QCZ A;  3GS2 A;  1T0S C;  1E7P B;  4MJS A;  4B95 A;  2NTT A;  3N1Z C;  1HB8 A;  1XR0 B;  2Y8F A;  4MK0 A;  4OHJ A;  3D8E A;  1YQ3 B;  3VIA A;  3PRP B;  2GBM A;  1CZP A;  4I6L B;  1WI0 A;  4YON A;  3PVW A;  2AL6 A;  2M1M A;  2MLB A;  3VHT C;  4BVU C;  4CHJ A;  5IP4 D;  2ZZP B;  4A8X C;  1DOX A;  1T3Q A;  2D9W A;  4QAY A;  4OSN A;  1K52 A;  3QCA A;  4OZA A;  2PTL A;  2I5C A;  5DPT A;  4PK1 A;  2D9Z A;  2C60 A;  1YMH E;  2BW2 A;  1A5R A;  1EF5 A;  2B3A A;  2LJI A;  1HB6 A;  3WAL A;  3PS6 A;  1NYQ A;  2YT0 A;  1YJI A;  1YN4 A;  3ETR A;  5CHF A;  3R2I A;  5LNK 1;  1SF0 A;  4NSW A;  1NI2 A;  3J9C A;  4HWI B;  3L10 B;  5I4D A;  2CU1 A;  4IOY X;  4WWO A;  5JHH A;  1WJ6 A;  2R2O A;  1FNW A;  5GMV A;  2QKM A;  2KWU B;  1EVH A;  1ZDV A;  2Z8L A;  1PGA A;  1WXV A;  3C19 A;  3ZRF A;  1V61 A;  3HW2 B;  3N30 A;  5IJM A;  2Y8G A;  2BTE A;  3P4Q B;  1C4C A;  1SJH D;  3LYY A;  1N5X A;  2ACZ B;  1ZM0 A;  4OZB A;  3KSY A;  3RNE C;  1V5P A;  3WAO A;  4US8 A;  4ZRQ A;  2IGG A;  2J52 A;  1JML A;  1GUA B;  2KTR B;  1WR6 E;  5IO9 A;  4I6P A;  2BWE S;  3U12 A;  5KHO A;  5J3Q A;  1P3R A;  4LJO B;  1FCC C;  2L7R A;  3QBV B;  3UQB A;  3ZYY X;  1TS4 A;  2Y7B A;  2ZEQ A;  2K8C A;  1WG7 A;  4MEM A;  2BF8 B;  3W2D A;  1YN5 A;  3RPF C;  4AS1 A;  3IFW B;  1MIZ B;  3ZDT A;  1XD3 B;  1PUT A;  3IVF A;  1ZP0 B;  4BBK A;  2MRP A;  2WYQ A;  3W1S C;  1BXT A;  4J6I A;  4ANU A;  5JHG A;  3IT6 B;  5KQ1 A;  1X1G A;  5IA7 A;  2L76 A;  1MIX A;  3PHW B;  3R8B A;  4KSK C;  1W1H A;  2YT1 A;  3WAP A;  3P1M A;  4DIX A;  3ML4 A;  1D4B A;  4JKD A;  2C5L C;  2O6V A;  3LDZ E;  5IKC M;  2SEB D;  1X1F A;  2IO3 B;  1DYN A;  1ZVR A;  4XWT A;  2GUM A;  1XOD A;  5FI1 A;  2KYW A;  3IG3 A;  3P63 A;  1TIF A;  2MBO A;  1V1O A;  1ZE3 D;  4EUT A;  5D3I B;  1Y5O A;  3NY5 A;  4K2O A;  2AQ2 B;  3GZN I;  1ACA A;  1V6E A;  4OVZ A;  2G1E A;  3CXB B;  2PVO D;  1Q10 A;  3SU8 X;  2NMQ A;  3A9J B;  4MM3 A;  4HB3 B;  1SJE D;  3HVZ A;  3BYT B;  2GJY A;  4B9K A;  1DOI A;  1SE2 A;  2WX1 A;  4HB4 B;  2K2U A;  2ZKM X;  2L1C A;  4ZYS A;  4N59 A;  5KCV A;  1Y19 B;  4LLG M;  1I4R A;  4JKF A;  3DBH I;  2NPT B;  1X1M A;  4EZJ A;  4FUL A;  4DX9 0;  3I5J C;  5C1Z A;  4KVG B;  4IWO A;  4E71 A;  1WSP A;  3Q3O C;  4KKI A;  3RMK C;  1JRU A;  4A6F B;  1TJE A;  3KRW A;  4G3X B;  3NRZ A;  1R4N B;  3ZXR A;  3NZ3 A;  3ZVR A;  1XCG A;  1T0R C;  2O6V B;  4F7Z A;  3ZVV A;  4NAW A;  5J18 A;  4JKB A;  2MBB B;  5AZF A;  3E9P A;  4C7Y A;  5D94 A;  2J0M A;  1V5O A;  2NR2 A;  1J7C A;  3T8M A;  3TL5 A;  4KHB A;  1SB3 C;  3ZRC A;  3HQC A;  5DHF B;  1PLS A;  4QJ3 B;  4F8C B;  3Q8E A;  4IOI E;  1TS2 A;  3I57 A;  4GN1 A;  3GB1 A;  2L83 A;  2AWT A;  5CLQ B;  3U7Z A;  2KQ7 A;  2IND C;  2K49 A;  4KHA A;  2GMI C;  2L3Z A;  4CSQ A;  3IXS A;  1XLQ A;  2BB6 A;  2NBW B;  2FE8 A;  3P2B A;  1C78 A;  3TW1 A;  5C16 A;  2QEJ C;  4LJP B;  4EFO A;  3X23 A;  4CO7 A;  1B55 A;  1GG3 A;  5LG4 B;  3KUZ A;  1DDM A;  1YJ1 A;  3K9P B;  2INC C;  1PMS A;  1E8W A;  1UNS A;  1IRS A;  2DFK A;  1TYG B;  1TJ6 A;  1VJK A;  4L1B A;  1RFK A;  2BT6 A;  4B0M A;  3MC9 A;  4YSX B;  3EA6 A;  4DDI D;  1P98 A;  5GOW B;  1R4N I;  3DXC A;  2JRI B;  2LOZ A;  2AQ3 B;  2BQQ A;  3TVV A;  2WXH A;  3GE3 C;  2IYD B;  2VZK D;  2DTC A;  2CS4 A;  2RRF A;  4TV3 A;  2MJ3 A;  1UWM A;  3M63 B;  2JYT A;  4WAF A;  2BPS A;  3NS8 A;  4PYU A;  3E9L A;  3MJW A;  3FC4 A;  4W9G A;  2KIG A;  1ET9 A;  4Q2J A;  1HEZ E;  4IM3 A;  3T3N A;  1NEN B;  3KH0 A;  4FN2 A;  2KFK A;  4DXA B;  1DYQ A;  3SD5 A;  5CLL B;  3AU4 A;  3N7C A;  4HB0 B;  3DVG Y;  1AYF A;  1TGZ B;  1EF1 A;  4E74 A;  2N9P C;  2V76 A;  1ZSQ A;  4N6E B;  4NJC A;  4JK8 A;  1EAZ A;  3D8D A;  2D11 A;  2Z0O A;  1I4H A;  3Q3N C;  2M38 A;  3U52 E;  3MDB C;  1PDX A;  3H7S A;  3PRE A;  3JSV A;  3OWE B;  1UF0 A;  2N9X A;  1TS3 A;  1T6B X;  4RF0 A;  2BS3 B;  5E6P A;  3APC A;  5C3J B;  3BII D;  3ZNZ B;  1UPR A;  2L2I A;  5D2M B;  2N9L A;  2KKC A;  1QOB A;  3VTV A;  2VSZ A;  3OG5 A;  2WDV B;  4W9H A;  4F7U P;  2BKF A;  4WSF A;  1K53 A;  3WCQ A;  5TR5 A;  2W54 A;  4HJG E;  2BS2 B;  1NBF C;  1FCL A;  1D5Z C;  2MWS B;  2K25 A;  1I2H A;  1UNQ A;  4DHJ B;  1XT9 B;  1WF9 A;  2KN4 A;  1Z2M A;  1WIA A;  4KHO A;  2RDB C;  4AQ7 A;  1HE8 A;  4RFB A;  3RN9 C;  3CWI A;  3UIO B;  4PS8 A;  3A1Q B;  4JPS A;  1L7Y A;  2KAJ A;  4MT5 A;  1TBE A;  2FBW B;  2VZK B;  3FIL A;  4HLE A;  3DPD A;  2CR5 A;  1ZXI A;  2WP9 B;  3AEB B;  3MC8 A;  2JZZ A;  5AUI A;  4RGO S;  3AJ4 A;  1IGC A;  4MSQ B;  5D7G A;  2L05 A;  1HQR D;  1WJN A;  3M1I B;  2IO1 B;  1AWD A;  4LNI A;  3HRD D;  3DDC B;  3TMP B;  2D3G A;  3JYU A;  1NI3 A;  2KMM A;  1WX9 A;  2KTR A;  1F2R I;  4M8N A;  2WXP A;  1P7F A;  1N3H A;  1E9M A;  1JWM D;  1XKE A;  2J59 M;  5DIF B;  2MA9 B;  4BZA A;  1FHX A;  1AWE A;  1UNP A;  2GS0 A;  2IO0 B;  3JVZ X;  4TQ1 A;  1HZ6 A;  3DCX A;  1UBI A;  1S3S G;  4C56 C;  1T77 A;  1JDE A;  3A4S C;  1TT5 B;  1GC7 A;  3L0W B;  4EE2 A;  3RFZ B;  2KJH B;  3TCA A;  1ET6 A;  2MP2 A;  4MGK E;  2WXI A;  5DH9 B;  3PSE B;  2LUE A;  3E9O A;  4P7I A;  2LGY A;  2WDQ B;  4IM2 A;  1BUI C;  1E7U A;  2IBI B;  2JPH A;  3A1Q A;  3VR8 B;  1YX5 B;  2QIL A;  5E6N A;  3TEY A;  2DHK A;  1F9J A;  3FIL B;  5JZE B;  1M7E A;  2K6D B;  3QHT A;  4DHJ D;  3BZD B;  1SGH A;  2L52 A;  2QSD A;  3V05 A;  3APF A;  4GDK B;  2FCQ A;  2W2W A;  2L0T A;  4P1C C;  1MI0 A;  2V3S A;  3A8P A;  1SIJ A;  4C0A A;  1KLG D;  1RRB A;  1C79 A;  3CIR B;  1U5D A;  2FCN A;  4P6V F;  1WZ3 A;  1WFY A;  2CJO A;  3PZ7 A;  1SE4 A;  1SBB B;  1I4X A;  4A9A A;  3HSA A;  3RD2 A;  2KMC A;  1HXY D;  1C9F A;  2NPT A;  3AB5 A;  1U5F A;  3VOQ A;  1QZE A;  2D9X A;  2CJN A;  4A6Q A;  2C7H A;  1UWX A;  3RNA C;  1J0G A;  2W3S A;  3QWM A;  1LO5 D;  1XCT L;  2FJU B;  2CKH B;  2ZW0 A;  4A6F A;  3PT2 B;  2DBY A;  3RNF C;  1RFA A;  2KDE B;  3P4P B;  2LBB A;  1DIK A;  2GB1 A;  5CX3 A;  3N1X C;  2WXK A;  4BOS C;  2ADZ A;  2LG1 A;  4IDI A;  5MPO A;  4E3C A;  4URK A;  4XYC A;  3KVF B;  1E8Y A; 
#chains in the Genus database with same CATH homology
 4NJ6 A;  3LJ3 A;  1WX7 A;  3KRX A;  1VBH A;  2CHW A;  1PQS A;  4PQ0 A;  3OAW A;  2LXA A;  4RMA A;  4HXD A;  2KAN A;  1PFJ A;  1BT0 A;  2N9E B;  1KLV A;  4EZL A;  5LLI A;  2KLC A;  2JWZ A;  3A9K A;  4HAU B;  4B6H A;  3W1Y A;  2EMT A;  2JF5 A;  3NZU A;  3FLV A;  3MHS D;  4MGI E;  1CMX B;  1Z87 A;  5EFX A;  3KUD B;  1OMW A;  5J3T A;  2KC1 A;  3FSS A;  1U29 A;  3H1U A;  2ZPY A;  1V2Y A;  2COF A;  4WQO B;  2GOW A;  1OTR B;  2KXJ A;  1WXS A;  1EGX A;  3APD A;  5D3Y A;  5JP4 A;  3PVU A;  1WR1 A;  3W1S A;  4GDL B;  4PYZ A;  4FHK A;  2N1V A;  1MK9 B;  1SIF A;  1X11 A;  3V60 A;  2KDB A;  1BAK A;  3PG7 A;  2BYE A;  2CB8 A;  2M4N A;  1UZX B;  3K9O B;  2X0S A;  1H8C A;  1DRO A;  3ODW A;  2ASQ A;  2BWF A;  3ZTC A;  4DX8 A;  2E2X A;  5L81 A;  1ZW7 A;  2VKI A;  3ODX A;  3CSF A;  1WGR A;  3JSV B;  1UD7 A;  3QC8 B;  1KZG A;  2KMA A;  1VBG A;  3PRZ A;  3TJP A;  2DN6 A;  3V6C B;  3DQV A;  3HM3 A;  1KM7 A;  2KDI A;  4JKH A;  4ZDV A;  3DXE A;  3VAW A;  3V5W A;  2LUL A;  1WGY A;  4IG7 B;  5DPS A;  2KFJ A;  4A3O A;  4F1S A;  4K81 A;  4II2 B;  2LGX A;  2KTF A;  3N3K B;  2RR9 A;  2KC2 A;  4N9F 4;  2IO2 B;  4TYZ A;  3MTN B;  4JGH B;  4WAA A;  2LAS A;  2MCN B;  4I6N B;  3VUX A;  2DIK A;  3QK0 A;  4FHJ A;  3SNH A;  2HTH B;  4A5K A;  2K2J A;  4BFR A;  2L0F A;  2GBK A;  3EHV A;  4M8M A;  2XBB C;  2A4Z A;  2CY4 A;  2EMS A;  3PLU A;  2BCJ A;  3SDL C;  4W9C A;  3HM6 X;  5J2R A;  4K2P A;  5JHA A;  3NZS A;  4JKG A;  3D32 A;  4WWN A;  3AI5 A;  3ALB A;  1LM8 B;  4WJN A;  1U5G A;  5L95 C;  2AEH A;  2HJ8 A;  3IBE A;  2ELB A;  4M0W B;  4XWX A;  3RUL A;  2OJR A;  1U27 A;  1Q5W B;  4BKG A;  2KWV B;  4G11 A;  3UQA A;  4HAW B;  2LI5 A;  1KC7 A;  3VFK A;  3TBL D;  2YS1 A;  2OTX A;  3NHE B;  2LRU A;  2DZJ A;  2MSE D;  1WE6 A;  4HCP B;  1UEF A;  4DBB A;  1R4M I;  2IY0 B;  4IW0 A;  4IWQ A;  4YL8 A;  2D9V A;  4LDT B;  1P1A A;  2ZCC A;  3VH4 B;  3ZNG C;  1WVH A;  4KSL C;  2BGF A;  1HBK A;  1NTY A;  4MH0 E;  4GMX B;  2CQU A;  2JRH A;  3U30 A;  2H7E A;  4AJY B;  2DHI A;  4ILG B;  1OEY A;  3O96 A;  5FR6 A;  2K1F A;  4FJY A;  4BKT A;  2JUO A;  2M17 A;  4HPL B;  2RD0 A;  3ML9 A;  3DBR I;  1X86 A;  4HAY B;  2LYD A;  4NJ7 A;  3CMM B;  3ZNI D;  4EEW A;  3VDZ A;  5HE1 A;  2DX5 B;  4HK2 A;  1IP9 A;  2LKO A;  4Z2M B;  4HAZ B;  4IM0 A;  3WA0 A;  5C23 A;  3WAM A;  2C9W B;  3D8F A;  2KVR A;  2RSG A;  1WMH A;  4ZRI A;  5JLJ B;  2MQJ A;  1V88 A;  3TFM A;  3KW5 B;  4W9D A;  1TXD A;  2PJH A;  3KYC D;  3RZF A;  3VH3 B;  4A6H A;  3DVN U;  4MT7 A;  2P0D A;  3LJU X;  2MFQ A;  2KHW B;  1NU2 A;  2N1W A;  4HCN B;  4FLH A;  3KUC B;  1P5T A;  2KD0 A;  4HAT B;  1WE7 A;  3VXW A;  2KJR A;  1AQC A;  4K7W A;  1FAO A;  1WGD A;  1UPQ A;  4MY6 A;  3A98 B;  3A9K B;  3RT3 B;  4WJP A;  4DDG D;  1MKE A;  4HVB A;  2LOX A;  2Q13 A;  1U5E A;  2K39 A;  2MBH A;  2XK5 B;  4JLC A;  2KK8 A;  3ZW3 A;  3RYT A;  1ZGU B;  1E5W A;  3PHX B;  1VD2 A;  4Z2N A;  2ABD A;  2FNJ B;  2MW5 A;  2PZ1 A;  1WMH B;  1UH6 A;  2KWC A;  1Q1O A;  3H7P B;  4GDL A;  5HE0 A;  4RM9 A;  4NY0 A;  2Z0Q A;  4ANW A;  2JY6 A;  3KY9 A;  5FI0 A;  3ZIM A;  1XD4 A;  2FJL A;  2QKL A;  1V49 A;  3UF8 A;  3V62 A;  3SBG A;  2RGF A;  4F7H A;  2LRW A;  2UWQ A;  3ZLZ A;  3SHQ A;  4ZRK A;  4JK9 A;  3UZT A;  3F5R A;  1FHO A;  2AYO B;  2IYB A;  3IHP C;  2PPH A;  1GGO A;  5C5B A;  2Z0P A;  3NSU A;  4NQL B;  4AP4 C;  1WGU A;  1GJZ A;  2XQN M;  4ILJ A;  2DYQ A;  4DK5 A;  1TQZ A;  3A33 B;  3GYP A;  1FB8 A;  2G35 A;  4PNK A;  1DBH A;  3WYF B;  2AL3 A;  4EJN A;  2W9N A;  1IYF A;  2UZS A;  4PS3 A;  4K17 A;  5D27 A;  3VUY A;  2RGN B;  2L00 B;  1TZ1 A;  3QJZ A;  1WGQ A;  2N23 A;  1WJ4 A;  3M95 A;  2FIF A;  1GNU A;  2KO3 A;  3NOB A;  3H7P A;  5JH5 C;  3ENB A;  2COP A;  4HDQ A;  1K5G B;  4OVU A;  1J8C A;  2LVO A;  1V5M A;  1KOT A;  1C3T A;  3R66 C;  1KJT A;  1BWN A;  4LCD E;  2GBR A;  2R82 A;  4H8S A;  1K8R B;  4JQW C;  1OGW A;  2KOX A;  3V61 A;  1LXD A;  2LWP A;  3ULC A;  2UVM A;  1OQN A;  3ZTD A;  2FID A;  4EZK A;  2Y5B B;  4GB9 A;  1FXT B;  5JVL A;  2M14 A;  4ASW C;  1OEY J;  3B0A A;  3PP2 A;  5EDS A;  4DWF A;  3M3J A;  3L17 A;  2DYM A;  1W1G A;  1YD8 U;  2J0K A;  4IAP A;  2FCM A;  3Q3F A;  2KX0 A;  4EMO A;  2COD A;  3PGE A;  3A8Q A;  4KAX B;  3E66 A;  2YS3 A;  1XX0 A;  4HJK A;  1NVL A;  3UIN B;  2VRW B;  2CY5 A;  3PZD A;  1FGZ A;  2NBU A;  2IFS A;  2V1Y A;  2KNB A;  2O2V A;  1NTI A;  2NS5 A;  4KIK A;  2FJ9 A;  1RAX A;  3TIX A;  2O6V D;  2DZI A;  3X0W A;  4JL9 A;  3VQI A;  1P3Q U;  4BKS D;  2DHZ A;  2P0H A;  3CF6 E;  2MBE A;  4XC2 A;  1MG8 A;  3EPY A;  2ZVO A;  1TTN A;  4IC7 B;  2C7M B;  4HB2 B;  3A4R A;  1AAR A;  3GOE A;  2MDX A;  2W2X D;  4IFS A;  5CTR C;  3RCZ A;  3AU5 A;  5AEK B;  3OAN A;  4JKC A;  4KDL B;  1YQB A;  3R7Q A;  3RCP A;  2LVQ A;  3DVG X;  4HPM B;  2IZV B;  4D0N B;  2REX A;  3L13 A;  1KBL A;  1V5T A;  2LVP A;  3QA8 A;  2N0Y A;  1IPG A;  1C1Y B;  4KDI C;  2DZK A;  3BJI A;  3RZW C;  3H6N A;  1V81 A;  4ICV A;  2LZ6 A;  4K1R B;  2RLO A;  2RVB B;  4TKN A;  2EC1 A;  3ZDM C;  1GC6 A;  3UGB B;  1SHC A;  4BOZ B;  3VVW B;  4NAW B;  1WI1 A;  1WM2 A;  2EJ8 A;  2GCJ A;  2ZPN A;  1DDV A;  2DYN A;  4WWP A;  4GOC A;  2DX1 A;  2H7D A;  4AJW A;  2ZJD A;  3QQ8 B;  1ST7 A;  3GYO A;  2HE7 A;  1M7R A;  3SV1 A;  5D3W A;  4GDK A;  2I1J A;  2D9Y A;  2JXX A;  2DYB A;  1E7V A;  3R7R A;  2D2Q A;  4NQK E;  5KHQ A;  4GMV A;  4EOY A;  5E6O A;  3SUZ A;  2NBV B;  3ML8 A;  5CHW A;  4HDO A;  2D10 A;  2K6Q A;  3N32 A;  3L54 A;  1G6J A;  1L2N A;  4L6E A;  2GCL A;  4AOF A;  1RJ2 A;  5HKH A;  1J0W A;  3PLV A;  2CRF A;  2A5U A;  4CYE A;  2MKR A;  2XK5 A;  2D4Q A;  3QWZ B;  2UZR A;  5JHB A;  1YX6 B;  2PEA A;  4GU2 A;  1S1Q B;  4A20 A;  3UIP B;  1DDW A;  1UNR A;  3T06 A;  2KLG A;  4TQ0 A;  3BIN A;  5L83 A;  1H4R A;  4F7G A;  3QAQ A;  1FGY A;  5C6R A;  4AUQ C;  1V80 A;  2LD9 A;  4DBG A;  2KN5 A;  5G2N A;  1WYW B;  3S2A A;  1T0Y A;  2KFK B;  4DHZ E;  2KQS A;  4W9L A;  2FAZ A;  1QC6 A;  3ZKJ C;  3QIJ A;  3B1L X;  4ICU A;  4CHK A;  1WZ0 A;  2JZ3 B;  4K7S A;  3U7D A;  3SYX A;  3AXC A;  2ROV A;  3U8Z A;  2DZM A;  4WVF B;  3ONS A;  5DCN A;  2WH5 A;  3QAR A;  3ECI A;  4A3P A;  4PS7 A;  1OY2 A;  1EO6 A;  1BTK A;  1E8Z A;  2J0J A;  3PEG A;  2N7D A;  2UYZ B;  2K8B A;  4KZC A;  4W9I A;  4ILH A;  2KX3 A;  4X57 B;  2K00 A;  2R2Q A;  3FM8 C;  2YSZ A;  1WJM A;  1LFD A;  4MGZ E;  2D07 B;  3DCG A;  2G4D B;  4ANX A;  2COC A;  1KI1 B;  4W9E A;  2FDQ A;  2M8S A;  3FP5 A;  1LB1 A;  1V89 A;  3WIM A;  4GXB A;  5D6J B;  2MBQ A;  2YVC A;  5D3X A;  2QHO A;  4BKS A;  2RQ1 A;  3L08 A;  5AZH A;  1UGM A;  3VUW A;  3OLM D;  1P0R A;  2NZ8 B;  1D3Z A;  2ELA A;  4BBN F;  3BY4 B;  4GPT B;  1RLF A;  1WRD B;  2C7N B;  3TO1 A;  2OOB B;  4NNJ B;  2RNR B;  3KYD D;  2K8H A;  2KUP A;  2W2X C;  1P9D U;  4JKA A;  4B6W A;  1UEL A;  4KIK B;  1H10 A;  2NVU I;  4GGQ A;  3JW0 X;  1ZC4 B;  4DHZ B;  2DAF A;  5LOP B;  1ISN A;  2BYV E;  4G0N B;  5DPR A;  2MP2 B;  4HHV A;  4WJQ A;  4BBN C;  4MJS B;  2G3Q B;  5DHA B;  4K7U A;  1MK7 B;  3I3T B;  4EKU A;  2P0F A;  4GSW A;  1NDD A;  2VRR B;  1U2B A;  4G50 A;  1ZC3 B;  2O2V B;  1NTV A;  1BTN A;  3P6A A;  4A6K A;  2HTH A;  4FJV B;  3DBS A;  3ZO5 B;  4FA6 A;  1Q0W B;  2G4S A;  1W1D A;  2DAJ A;  4RM8 A;  2N7E A;  4FAD A;  4MDK E;  2RPQ A;  2ZNV B;  1VCB A;  3H9D A;  4HAX B;  2YS5 A;  1YIW A;  3EFU A;  5D3V A;  2DEN B;  2M0X A;  2YRY A;  4JKE A;  2Z0D B;  2DHJ A;  2RUK B;  3WAN A;  2LGD A;  2DKQ A;  3ODO A;  3DXD A;  2XEW A;  2HD5 B;  3L16 A;  1U4A A;  2FCS A;  2LXC A;  2V4L A;  2I1K A;  3EC8 A;  2EKE C;  5J3Y A;  3P7Z A;  2ZNV C;  2WWZ A;  2YF0 A;  2ZVN A;  2X18 A;  5IAA C;  4GZU A;  2MWN B;  1WXM A;  3VTW A;  2DLW A;  2BYF A;  2DYO A;  3SBT A;  3RUI B;  2J7Q B;  2COA A;  1P6S A;  5AZG A;  1MAI A;  3ZNH B;  3A9J A;  3HIZ A;  3FEH A;  4KV2 A;  2GBJ A;  2GBN A;  1LQB A;  2R0D A;  2FUH B;  4AWJ A;  4MSM B;  5C79 A;  2LJ5 A;  5LXI B;  2IY1 B;  4XX5 A;  1M94 A;  1K5D B;  4WJO A;  5LON B;  1V9J A;  3DOW A;  2WX0 A;  3F0W A;  4MEL A;  1UBQ A;  3AUL A;  2JT4 B;  2NCN A;  2KZR A;  2G45 B;  1X05 A;  2P8V A;  1I7A A;  2JVC A;  2L8J A;  3PPA A;  5LXH A;  2PE9 A;  4GIV A;  4Y94 A;  3ENE A;  4HAV B;  4ZYN A;  1XQQ A;  1FOE A;  3CIK A;  1I42 A;  2YLM A;  3C0R B;  4WJ7 A;  2DX5 A;  3ULB A;  2CHX A;  3PV1 A;  3CST A;  4II3 B;  1E8X A;  5CHV C;  4FBJ B;  3Q3J A;  2WDT B;  4NPN A;  4CHM A;  5HE3 A;  5J17 A;  3QX1 A;  4OVV A;  2N4F A;  3V6E B;  4KZ0 A;  1WH3 A;  1Y8R C;  2KJ6 A;  2NMB A;  1WJU A;  4JK7 A;  3ZUN A;  1V5U A;  4W9F A;  3HHM A;  3OJ3 A;  3T9L A;  5KQ4 A;  3R3M A;  1RRP B;  4KHB B;  2JP2 A;  2R09 A;  3B08 A;  3G9W A;  4FJZ A;  2KCJ A;  1QQG A;  1SE9 A;  1J19 A;  3DBL I;  5DPW A;  2HRJ A;  1FHW A;  1WXA A;  1Z5S B;  3M62 B;  3OJ4 B;  4IWP A;  4XZ4 A;  3SO6 A;  2BKR B;  2KDF B;  4IUM B;  4W9K A;  3PRM B;  5BO4 B;  1EUV B;  1WJ1 A;  3PSC A;  1ZKH A;  4TUU A;  4ANV A;  2PE6 B;  3PTF C;  2I5F A;  1V86 A;  1WY8 A;  3PVL A;  2CAY A;  5DI9 B;  3O65 B;  4W9J A;  1WGG A;  2ROZ B;  2KGX B;  2ZCB A;  1LW3 A;  1I35 A;  5HE2 A;  4LDT D;  2OQB A;  1WGH A;  5G55 A;  1KZ7 A;  2MX2 A;  4MGY E;  3EEC A;  4JKG B;  3HK0 A;  3KZ1 A;  2RSU A;  4ZRJ A;  2DA0 A;  1WM3 A;  1OQY A;  2DKP A;  4JIO U;  2Z59 B;  1MPH A;  2Z0E B;  1Q67 A;  1E90 A;  5C5B B;  2CHZ A;  3DVN V;  3VTU A;  3MPX A;  1WX8 A;  4MJS A;  4B95 A;  1HB8 A;  1XR0 B;  2Y8F A;  4MK0 A;  3D8E A;  3VIA A;  3PRP B;  2GBM A;  4I6L B;  1WI0 A;  4YON A;  3PVW A;  2AL6 A;  2M1M A;  2MLB A;  3VHT C;  4BVU C;  4CHJ A;  2ZZP B;  2D9W A;  3QCA A;  2I5C A;  5DPT A;  2D9Z A;  2C60 A;  1A5R A;  1EF5 A;  2B3A A;  1HB6 A;  3WAL A;  3PS6 A;  2YT0 A;  5CHF A;  4NSW A;  1NI2 A;  4HWI B;  3L10 B;  2CU1 A;  4IOY X;  4WWO A;  5JHH A;  2R2O A;  5GMV A;  1WJ6 A;  2QKM A;  1EVH A;  2KWU B;  1WXV A;  3ZRF A;  1V61 A;  3HW2 B;  3N30 A;  5IJM A;  2Y8G A;  1ZM0 A;  3KSY A;  1V5P A;  3WAO A;  1GUA B;  2KTR B;  1WR6 E;  4I6P A;  2BWE S;  5KHO A;  5J3Q A;  1P3R A;  4LJO B;  2L7R A;  3QBV B;  3UQB A;  2Y7B A;  2ZEQ A;  2K8C A;  1WG7 A;  4MEM A;  2BF8 B;  3IFW B;  1MIZ B;  3ZDT A;  1XD3 B;  3IVF A;  4BBK A;  2MRP A;  2WYQ A;  3W1S C;  4J6I A;  4ANU A;  5JHG A;  5KQ1 A;  1X1G A;  5IA7 A;  2L76 A;  1MIX A;  3PHW B;  4KSK C;  1W1H A;  2YT1 A;  3WAP A;  3ML4 A;  4JKD A;  2C5L C;  2O6V A;  3LDZ E;  1X1F A;  2IO3 B;  1DYN A;  1ZVR A;  1XOD A;  5FI1 A;  3IG3 A;  2MBO A;  4EUT A;  1Y5O A;  3NY5 A;  4K2O A;  3GZN I;  1ACA A;  1V6E A;  3CXB B;  3SU8 X;  3A9J B;  4MM3 A;  4HB3 B;  2GJY A;  4B9K A;  2WX1 A;  4HB4 B;  2K2U A;  2L1C A;  5KCV A;  1Y19 B;  3DBH I;  4JKF A;  2NPT B;  1X1M A;  4EZJ A;  4FUL A;  4DX9 0;  5C1Z A;  4KVG B;  4IWO A;  4E71 A;  1JRU A;  4A6F B;  3KRW A;  4G3X B;  3ZVR A;  1XCG A;  2O6V B;  4F7Z A;  3ZVV A;  4NAW A;  5J18 A;  4JKB A;  2MBB B;  5AZF A;  3E9P A;  5D94 A;  2J0M A;  1V5O A;  2NR2 A;  3T8M A;  3TL5 A;  3ZRC A;  3HQC A;  5DHF B;  1PLS A;  4F8C B;  4GN1 A;  2AWT A;  5CLQ B;  2KQ7 A;  2L3Z A;  4KHA A;  2GMI C;  2NBW B;  3P2B A;  3TW1 A;  5C16 A;  4LJP B;  4EFO A;  3X23 A;  4CO7 A;  1B55 A;  1GG3 A;  3KUZ A;  1DDM A;  1YJ1 A;  3K9P B;  1PMS A;  1E8W A;  1IRS A;  2DFK A;  1TJ6 A;  4DDI D;  1P98 A;  5GOW B;  1R4N I;  3DXC A;  2JRI B;  2LOZ A;  3TVV A;  2IYD B;  2DTC A;  2CS4 A;  4TV3 A;  3M63 B;  2BPS A;  3NS8 A;  4PYU A;  3E9L A;  3MJW A;  4W9G A;  4IM3 A;  3KH0 A;  4FN2 A;  2KFK A;  4DXA B;  3SD5 A;  5CLL B;  3AU4 A;  3N7C A;  4HB0 B;  3DVG Y;  1TGZ B;  1EF1 A;  4E74 A;  2N9P C;  2V76 A;  1ZSQ A;  4JK8 A;  1EAZ A;  3D8D A;  2D11 A;  2Z0O A;  2M38 A;  3MDB C;  3H7S A;  3PRE A;  3JSV A;  2N9X A;  5E6P A;  3APC A;  3ZNZ B;  1UPR A;  2L2I A;  5D2M B;  2KKC A;  3VTV A;  2VSZ A;  4W9H A;  4F7U P;  2BKF A;  4WSF A;  5TR5 A;  1NBF C;  2MWS B;  2K25 A;  1I2H A;  1UNQ A;  4DHJ B;  1XT9 B;  1WF9 A;  1Z2M A;  1WIA A;  4KHO A;  1HE8 A;  3UIO B;  4PS8 A;  3A1Q B;  1L7Y A;  1TBE A;  4HLE A;  3DPD A;  2CR5 A;  2JZZ A;  3AJ4 A;  4MSQ B;  5D7G A;  2L05 A;  1WJN A;  3M1I B;  2IO1 B;  3DDC B;  3TMP B;  2D3G A;  3JYU A;  1WX9 A;  2KTR A;  4M8N A;  1N3H A;  1XKE A;  2J59 M;  5DIF B;  2MA9 B;  1FHX A;  1AWE A;  1UNP A;  2GS0 A;  4TQ1 A;  2IO0 B;  3JVZ X;  1UBI A;  1S3S G;  1JDE A;  3A4S C;  1GC7 A;  3L0W B;  2KJH B;  3TCA A;  2MP2 A;  4MGK E;  5DH9 B;  3PSE B;  2LUE A;  3E9O A;  4P7I A;  2LGY A;  4IM2 A;  1E7U A;  2IBI B;  2JPH A;  3A1Q A;  1YX5 B;  5E6N A;  2DHK A;  1F9J A;  5JZE B;  1M7E A;  2K6D B;  3QHT A;  4DHJ D;  1SGH A;  3APF A;  4GDK B;  2FCQ A;  2W2W A;  2L0T A;  2V3S A;  3A8P A;  4C0A A;  1RRB A;  1U5D A;  2FCN A;  1WZ3 A;  1WFY A;  3RD2 A;  2KMC A;  2NPT A;  1U5F A;  3VOQ A;  1QZE A;  2D9X A;  2C7H A;  1J0G A;  3QWM A;  2CKH B;  4A6F A;  3PT2 B;  1RFA A;  2KDE B;  2LBB A;  1DIK A;  5CX3 A;  4BOS C;  2ADZ A;  2LG1 A;  4E3C A;  4URK A;  3KVF B;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...