1AL24

P1/mahoney poliovirus, single site mutant v1160i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1al2400
1EAH4 1Z7S4 1NCQD 2R064 4RHV4 2HWB4 2R074 4PDWD 1K5MD 1RHI4 1HRV4 1NA1D 1MQTD 1HRI4 1EV14 1R094 1RUI4 1BEV4 1VBC4 2X5ID 3JBG4 1HXS4 4Q4X4 1ASJ4 1H8TD 1R084 1AR84 2RS54 2RR14 2RS34 1RVF4 1VBD4 2RMU4 3J8F4 1RUE4 4Q4V4 1AR94 2R044 2PLV4 4Q4W4 1D4M4 4GB34 1RUJ4 1OOPD 2HWC4 1RUF4 1COV4 1RUH4 1AL24 1POV0 1RMU4 1AR64 1PIV4 1RUG4 1PO14 1VBA4 1VBE4 3JD74 1RUC4 4Q4Y4 1VRH4 1PO24 1AR74 2RM24 1VBB4 1PVC4 1RUD4 2RS14
chains in the Genus database with same CATH superfamily
2WU2A 5C3JA 2HWB4 2PZSA 1ZP0A 3AE3A 2R074 1RHI4 1XHXA 1BEV4 2R7FA 2WDVA 3SFDA 3VR9A 1R084 1NEKA 3GQHA 2RS54 3J8F4 2WU5A 1YQ3A 2PLV4 1XI1A 3P4RA 1KFYA 3AE8A 1RUH4 1POV0 1RUG4 4Q4Y4 2WDQA 1PO14 1RUD4 3AE4A 1EAH4 4YSYA 2R064 3SUCA 1HRV4 4PDWD 1K5MD 1NA1D 1MQTD 1HRI4 1VBC4 1R094 3JBG4 2X5ID 1ASJ4 3CIRA 3AE9A 4YTMA 4YT0A 2RR14 3AE6A 1RVF4 2RMU4 3VR8A 2R044 1RUJ4 1NENA 1ZOYA 1COV4 1L0VA 1AL24 3AE2A 1AR64 3JD74 1VBB4 1PVC4 2WS3A 2PYJA 3AECA 2PY5A 2ACZA 5C2TA 2FBWA 1RUI4 1EV14 3SFEA 1XHZA 4Q4X4 3AEBA 1HXS4 3AEFA 1H8TD 1AR84 2RS34 3FI7A 4Q4V4 3AEGA 2PYLA 3AEDA 2H88A 4YSZA 4Q4W4 1D4M4 2H89A 2WP9A 4GB34 1OOPD 3AEAA 2HWC4 3VRAA 3AE5A 1VBA4 1VRH4 1PO24 1AR74 3P4SA 3VRBA 3ABVA 3GQKA 1NCQD 4RHV4 2B76A 2EX3A 2PW9A 3P4PA 2WDRA 3AE1A 3P4QA 3AE7A 1VBD4 4YXDA 1KF6A 1RUE4 4YTNA 1AR94 4KX6A 4YSXA 1RUF4 1RMU4 1VBE4 4YTPA 1PIV4 1YQ4A 1RUC4 2RM24 2WQYA 3AEEA 1Z7S4 2RS14
chains in the Genus database with same CATH topology
1EAH4 1Z7S4 1NCQD 2R064 4RHV4 2HWB4 2R074 4PDWD 1K5MD 1RHI4 1HRV4 1NA1D 1MQTD 1HRI4 1EV14 1R094 1RUI4 1BEV4 1VBC4 2X5ID 3JBG4 1HXS4 4Q4X4 1ASJ4 1H8TD 1R084 1AR84 2RS54 2RR14 2RS34 1RVF4 1VBD4 2RMU4 3J8F4 1RUE4 4Q4V4 1AR94 2R044 2PLV4 4Q4W4 1D4M4 4GB34 1RUJ4 1OOPD 2HWC4 1RUF4 1COV4 1RUH4 1AL24 1POV0 1RMU4 1AR64 1PIV4 1RUG4 1PO14 1VBA4 1VBE4 3JD74 1RUC4 4Q4Y4 1VRH4 1PO24 1AR74 2RM24 1VBB4 1PVC4 1RUD4 2RS14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAH 4;  1Z7S 4;  1NCQ D;  2R06 4;  4RHV 4;  2HWB 4;  2R07 4;  4PDW D;  1K5M D;  1RHI 4;  1HRV 4;  1NA1 D;  1MQT D;  1HRI 4;  1EV1 4;  1R09 4;  1RUI 4;  1BEV 4;  1VBC 4;  2X5I D;  3JBG 4;  1HXS 4;  4Q4X 4;  1ASJ 4;  1H8T D;  1R08 4;  1AR8 4;  2RS5 4;  2RR1 4;  2RS3 4;  1RVF 4;  1VBD 4;  2RMU 4;  3J8F 4;  1RUE 4;  4Q4V 4;  1AR9 4;  2R04 4;  2PLV 4;  4Q4W 4;  1D4M 4;  4GB3 4;  1RUJ 4;  1OOP D;  2HWC 4;  1RUF 4;  1COV 4;  1RUH 4;  1AL2 4;  1POV 0;  1RMU 4;  1AR6 4;  1PIV 4;  1RUG 4;  1PO1 4;  1VBA 4;  1VBE 4;  3JD7 4;  1RUC 4;  4Q4Y 4;  1VRH 4;  1PO2 4;  1AR7 4;  2RM2 4;  1VBB 4;  1PVC 4;  1RUD 4;  2RS1 4; 
#chains in the Genus database with same CATH topology
 2WU2 A;  5C3J A;  2HWB 4;  2PZS A;  1ZP0 A;  3AE3 A;  2R07 4;  1RHI 4;  1XHX A;  1BEV 4;  2R7F A;  2WDV A;  3SFD A;  3VR9 A;  1R08 4;  1NEK A;  3GQH A;  2RS5 4;  3J8F 4;  2WU5 A;  1YQ3 A;  2PLV 4;  1XI1 A;  3P4R A;  1KFY A;  3AE8 A;  1RUH 4;  1POV 0;  1RUG 4;  4Q4Y 4;  2WDQ A;  1PO1 4;  1RUD 4;  3AE4 A;  1EAH 4;  4YSY A;  2R06 4;  3SUC A;  1HRV 4;  4PDW D;  1K5M D;  1NA1 D;  1MQT D;  1HRI 4;  1VBC 4;  1R09 4;  3JBG 4;  2X5I D;  1ASJ 4;  3CIR A;  3AE9 A;  4YTM A;  4YT0 A;  2RR1 4;  3AE6 A;  1RVF 4;  2RMU 4;  3VR8 A;  2R04 4;  1RUJ 4;  1NEN A;  1ZOY A;  1COV 4;  1L0V A;  1AL2 4;  3AE2 A;  1AR6 4;  3JD7 4;  1VBB 4;  1PVC 4;  2WS3 A;  2PYJ A;  3AEC A;  2PY5 A;  2ACZ A;  5C2T A;  2FBW A;  1RUI 4;  1EV1 4;  3SFE A;  1XHZ A;  4Q4X 4;  3AEB A;  1HXS 4;  3AEF A;  1H8T D;  1AR8 4;  2RS3 4;  3FI7 A;  4Q4V 4;  3AEG A;  2PYL A;  3AED A;  2H88 A;  4YSZ A;  4Q4W 4;  1D4M 4;  2H89 A;  2WP9 A;  4GB3 4;  1OOP D;  3AEA A;  2HWC 4;  3VRA A;  3AE5 A;  1VBA 4;  1VRH 4;  1PO2 4;  1AR7 4;  3P4S A;  3VRB A;  3ABV A;  3GQK A;  1NCQ D;  4RHV 4;  2B76 A;  2EX3 A;  2PW9 A;  3P4P A;  2WDR A;  3AE1 A;  3P4Q A;  3AE7 A;  1VBD 4;  4YXD A;  1KF6 A;  1RUE 4;  4YTN A;  1AR9 4;  4KX6 A;  4YSX A;  1RUF 4;  1RMU 4;  1VBE 4;  4YTP A;  1PIV 4;  1YQ4 A;  1RUC 4;  2RM2 4;  2WQY A;  3AEE A;  1Z7S 4;  2RS1 4; 
#chains in the Genus database with same CATH homology
 1EAH 4;  1Z7S 4;  1NCQ D;  2R06 4;  4RHV 4;  2HWB 4;  2R07 4;  4PDW D;  1K5M D;  1RHI 4;  1HRV 4;  1NA1 D;  1MQT D;  1HRI 4;  1EV1 4;  1R09 4;  1RUI 4;  1BEV 4;  1VBC 4;  2X5I D;  3JBG 4;  1HXS 4;  4Q4X 4;  1ASJ 4;  1H8T D;  1R08 4;  1AR8 4;  2RS5 4;  2RR1 4;  2RS3 4;  1RVF 4;  1VBD 4;  2RMU 4;  3J8F 4;  1RUE 4;  4Q4V 4;  1AR9 4;  2R04 4;  2PLV 4;  4Q4W 4;  1D4M 4;  4GB3 4;  1RUJ 4;  1OOP D;  2HWC 4;  1RUF 4;  1COV 4;  1RUH 4;  1AL2 4;  1POV 0;  1RMU 4;  1AR6 4;  1PIV 4;  1RUG 4;  1PO1 4;  1VBA 4;  1VBE 4;  3JD7 4;  1RUC 4;  4Q4Y 4;  1VRH 4;  1PO2 4;  1AR7 4;  2RM2 4;  1VBB 4;  1PVC 4;  1RUD 4;  2RS1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...