1AL24

P1/mahoney poliovirus, single site mutant v1160i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
b'GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1al2400
1RUD4 1PO24 1AR84 1RMU4 1RUH4 1VBB4 1MQTD 2RMU4 2RS34 1EV14 1RHI4 1RUF4 3J8F4 1HRV4 1AR94 1RUC4 1HXS4 2RM24 1AR74 3JD74 2HWC4 1ASJ4 1NA1D 2HWB4 1NCQD 1VBC4 1R084 1AL24 2RS54 2X5ID 1VBE4 4Q4W4 1PO14 1RUJ4 4Q4X4 1POV0 1H8TD 1EAH4 1RVF4 2PLV4 1PVC4 2R064 3JBG4 2RS14 1COV4 1PIV4 1R094 1RUE4 4Q4V4 4RHV4 1HRI4 1RUG4 1AR64 1OOPD 1BEV4 1VRH4 4PDWD 1Z7S4 1VBD4 1RUI4 4Q4Y4 2RR14 2R074 2R044 1VBA4 4GB34 1K5MD 1D4M4
chains in the Genus database with same CATH superfamily
2RMU4 3AE3A 3AEAA 2HWC4 1ASJ4 1NA1D 3FI7A 1L0VA 2HWB4 1VBC4 3AEEA 4YT0A 3AE6A 3VR8A 1COV4 1R094 2WQYA 3VR9A 2WP9A 1BEV4 4PDWD 2H88A 3AE1A 1ZOYA 3AEGA 2PYLA 1Z7S4 2B76A 4Q4Y4 2RR14 1XI1A 1K5MD 3SUCA 1RUD4 1PO24 1XHXA 2RS34 3AE8A 3VRAA 1EV14 1RHI4 1RUF4 1HRV4 3AE7A 2EX3A 1RUC4 2RM24 1YQ4A 2RS54 2X5ID 5C3JA 1R084 1AL24 4YTNA 1VBE4 1RUJ4 4Q4X4 3AEBA 3P4PA 1EAH4 2R064 2WDQA 3AEFA 4RHV4 2ACZA 2PZSA 1NENA 1VRH4 3CIRA 4YXDA 1VBD4 1XHZA 4YTMA 3AECA 4YTPA 2H89A 1D4M4 3JBG4 1AR84 1RMU4 1RUH4 1VBB4 3J8F4 1AR94 3SFEA 4YSZA 1HXS4 3JD74 3AE5A 3GQHA 2PYJA 4YSXA 3AE9A 1RVF4 1NEKA 3P4RA 3P4SA 1PVC4 2R7FA 3AE2A 3P4QA 4KX6A 2PY5A 2RS14 3AE4A 1RUE4 5C2TA 3ABVA 1HRI4 1AR64 2WDRA 3VRBA 2WU5A 3GQKA 4YSYA 2WS3A 2R074 1VBA4 1KFYA 3SFDA 1MQTD 1ZP0A 2WDVA 3AEDA 2PW9A 1AR74 1NCQD 1YQ3A 4Q4W4 1PO14 2FBWA 1KF6A 1POV0 1H8TD 2PLV4 1PIV4 4Q4V4 1RUG4 1OOPD 2WU2A 1RUI4 2R044 4GB34
chains in the Genus database with same CATH topology
1RUD4 1PO24 1AR84 1RMU4 1RUH4 1VBB4 1MQTD 2RMU4 2RS34 1EV14 1RHI4 1RUF4 3J8F4 1HRV4 1AR94 1RUC4 1HXS4 2RM24 1AR74 3JD74 2HWC4 1ASJ4 1NA1D 2HWB4 1NCQD 1VBC4 1R084 1AL24 2RS54 2X5ID 1VBE4 4Q4W4 1PO14 1RUJ4 4Q4X4 1POV0 1H8TD 1EAH4 1RVF4 2PLV4 1PVC4 2R064 3JBG4 2RS14 1COV4 1PIV4 1R094 1RUE4 4Q4V4 4RHV4 1HRI4 1RUG4 1AR64 1OOPD 1BEV4 1VRH4 4PDWD 1Z7S4 1VBD4 1RUI4 4Q4Y4 2RR14 2R074 2R044 1VBA4 4GB34 1K5MD 1D4M4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUD 4;  1PO2 4;  1AR8 4;  1RMU 4;  1RUH 4;  1VBB 4;  1MQT D;  2RMU 4;  2RS3 4;  1EV1 4;  1RHI 4;  1RUF 4;  3J8F 4;  1HRV 4;  1AR9 4;  1RUC 4;  1HXS 4;  2RM2 4;  1AR7 4;  3JD7 4;  2HWC 4;  1ASJ 4;  1NA1 D;  2HWB 4;  1NCQ D;  1VBC 4;  1R08 4;  1AL2 4;  2RS5 4;  2X5I D;  1VBE 4;  4Q4W 4;  1PO1 4;  1RUJ 4;  4Q4X 4;  1POV 0;  1H8T D;  1EAH 4;  1RVF 4;  2PLV 4;  1PVC 4;  2R06 4;  3JBG 4;  2RS1 4;  1COV 4;  1PIV 4;  1R09 4;  1RUE 4;  4Q4V 4;  4RHV 4;  1HRI 4;  1RUG 4;  1AR6 4;  1OOP D;  1BEV 4;  1VRH 4;  4PDW D;  1Z7S 4;  1VBD 4;  1RUI 4;  4Q4Y 4;  2RR1 4;  2R07 4;  2R04 4;  1VBA 4;  4GB3 4;  1K5M D;  1D4M 4; 
#chains in the Genus database with same CATH topology
 2RMU 4;  3AE3 A;  3AEA A;  2HWC 4;  1ASJ 4;  1NA1 D;  3FI7 A;  1L0V A;  2HWB 4;  1VBC 4;  3AEE A;  4YT0 A;  3AE6 A;  3VR8 A;  1COV 4;  1R09 4;  2WQY A;  3VR9 A;  2WP9 A;  1BEV 4;  4PDW D;  2H88 A;  3AE1 A;  1ZOY A;  3AEG A;  2PYL A;  1Z7S 4;  2B76 A;  4Q4Y 4;  2RR1 4;  1XI1 A;  1K5M D;  3SUC A;  1RUD 4;  1PO2 4;  1XHX A;  2RS3 4;  3AE8 A;  3VRA A;  1EV1 4;  1RHI 4;  1RUF 4;  1HRV 4;  3AE7 A;  2EX3 A;  1RUC 4;  2RM2 4;  1YQ4 A;  2RS5 4;  2X5I D;  5C3J A;  1R08 4;  1AL2 4;  4YTN A;  1VBE 4;  1RUJ 4;  4Q4X 4;  3AEB A;  3P4P A;  1EAH 4;  2R06 4;  2WDQ A;  3AEF A;  4RHV 4;  2ACZ A;  2PZS A;  1NEN A;  1VRH 4;  3CIR A;  4YXD A;  1VBD 4;  1XHZ A;  4YTM A;  3AEC A;  4YTP A;  2H89 A;  1D4M 4;  3JBG 4;  1AR8 4;  1RMU 4;  1RUH 4;  1VBB 4;  3J8F 4;  1AR9 4;  3SFE A;  4YSZ A;  1HXS 4;  3JD7 4;  3AE5 A;  3GQH A;  2PYJ A;  4YSX A;  3AE9 A;  1RVF 4;  1NEK A;  3P4R A;  3P4S A;  1PVC 4;  2R7F A;  3AE2 A;  3P4Q A;  4KX6 A;  2PY5 A;  2RS1 4;  3AE4 A;  1RUE 4;  5C2T A;  3ABV A;  1HRI 4;  1AR6 4;  2WDR A;  3VRB A;  2WU5 A;  3GQK A;  4YSY A;  2WS3 A;  2R07 4;  1VBA 4;  1KFY A;  3SFD A;  1MQT D;  1ZP0 A;  2WDV A;  3AED A;  2PW9 A;  1AR7 4;  1NCQ D;  1YQ3 A;  4Q4W 4;  1PO1 4;  2FBW A;  1KF6 A;  1POV 0;  1H8T D;  2PLV 4;  1PIV 4;  4Q4V 4;  1RUG 4;  1OOP D;  2WU2 A;  1RUI 4;  2R04 4;  4GB3 4; 
#chains in the Genus database with same CATH homology
 1RUD 4;  1PO2 4;  1AR8 4;  1RMU 4;  1RUH 4;  1VBB 4;  1MQT D;  2RMU 4;  2RS3 4;  1EV1 4;  1RHI 4;  1RUF 4;  3J8F 4;  1HRV 4;  1AR9 4;  1RUC 4;  1HXS 4;  2RM2 4;  1AR7 4;  3JD7 4;  2HWC 4;  1ASJ 4;  1NA1 D;  2HWB 4;  1NCQ D;  1VBC 4;  1R08 4;  1AL2 4;  2RS5 4;  2X5I D;  1VBE 4;  4Q4W 4;  1PO1 4;  1RUJ 4;  4Q4X 4;  1POV 0;  1H8T D;  1EAH 4;  1RVF 4;  2PLV 4;  1PVC 4;  2R06 4;  3JBG 4;  2RS1 4;  1COV 4;  1PIV 4;  1R09 4;  1RUE 4;  4Q4V 4;  4RHV 4;  1HRI 4;  1RUG 4;  1AR6 4;  1OOP D;  1BEV 4;  1VRH 4;  4PDW D;  1Z7S 4;  1VBD 4;  1RUI 4;  4Q4Y 4;  2RR1 4;  2R07 4;  2R04 4;  1VBA 4;  4GB3 4;  1K5M D;  1D4M 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...