1AL24

P1/mahoney poliovirus, single site mutant v1160i
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1al2400
1AR94 2RS14 1AR84 1MQTD 2HWC4 1HXS4 1RUG4 1VRH4 1AL24 1Z7S4 2PLV4 2X5ID 4Q4W4 1H8TD 3J8F4 4Q4V4 1R084 1D4M4 1HRV4 1POV0 1RMU4 1VBE4 1EV14 2R074 2RMU4 3JBG4 1NCQD 1RUI4 2RR14 1AR64 1RUJ4 4PDWD 1VBB4 1PIV4 1RUE4 1NA1D 2HWB4 1PO14 1K5MD 1VBA4 1RVF4 1RUD4 2RM24 2RS34 2RS54 1VBC4 3JD74 4Q4Y4 1AR74 1BEV4 1RUH4 4Q4X4 4RHV4 1COV4 1R094 1RHI4 2R044 1VBD4 2R064 1ASJ4 4GB34 1RUF4 1RUC4 1HRI4 1EAH4 1PVC4 1OOPD 1PO24
chains in the Genus database with same CATH superfamily
2PYJA 4Q4W4 1XHXA 3J8F4 2H89A 1R084 1D4M4 3JBG4 2RMU4 2EX3A 2WP9A 1AR64 4YSYA 1VBB4 1YQ4A 3GQHA 5C3JA 1NA1D 1K5MD 2WU5A 3CIRA 1AR74 1BEV4 1RUH4 1COV4 2B76A 1ASJ4 2WDVA 3P4PA 1HRI4 1OOPD 1AR94 1AR84 1HXS4 1VRH4 3VR8A 2X5ID 3AE3A 1HRV4 1RMU4 2R074 2PY5A 1NCQD 4YSZA 1RUE4 2RS54 1RUD4 2RS34 2WDQA 4Q4Y4 3AECA 3AE6A 2PYLA 4Q4X4 4YTMA 2R7FA 1RHI4 4RHV4 4YXDA 1RUF4 3AE8A 1EAH4 1PVC4 1KFYA 3AEFA 1ZP0A 3VRBA 1Z7S4 2PLV4 1XI1A 3VRAA 1KF6A 3FI7A 1XHZA 4YTPA 1H8TD 5C2TA 2WS3A 2WDRA 1VBE4 1RUI4 2RR14 1RUJ4 4KX6A 4PDWD 2RM24 1PO14 1VBA4 3AE4A 1RVF4 3JD74 2H88A 3VR9A 3SFDA 1YQ3A 4YTNA 1RUC4 3P4SA 3AE1A 1NEKA 1PO24 3AEEA 2RS14 3AEBA 1MQTD 2HWC4 1RUG4 1AL24 3SUCA 2WU2A 3P4RA 4Q4V4 3AE2A 1POV0 3P4QA 1EV14 3ABVA 4YT0A 2PZSA 2ACZA 1PIV4 4YSXA 2HWB4 3AEGA 3AEAA 3GQKA 1L0VA 3AEDA 1VBC4 1ZOYA 2FBWA 1R094 1NENA 1VBD4 2R044 3AE7A 3AE5A 2R064 2WQYA 4GB34 2PW9A 3SFEA 3AE9A
chains in the Genus database with same CATH topology
1AR94 2RS14 1AR84 1MQTD 2HWC4 1HXS4 1RUG4 1VRH4 1AL24 1Z7S4 2PLV4 2X5ID 4Q4W4 1H8TD 3J8F4 4Q4V4 1R084 1D4M4 1HRV4 1POV0 1RMU4 1VBE4 1EV14 2R074 2RMU4 3JBG4 1NCQD 1RUI4 2RR14 1AR64 1RUJ4 4PDWD 1VBB4 1PIV4 1RUE4 1NA1D 2HWB4 1PO14 1K5MD 1VBA4 1RVF4 1RUD4 2RM24 2RS34 2RS54 1VBC4 3JD74 4Q4Y4 1AR74 1BEV4 1RUH4 4Q4X4 4RHV4 1COV4 1R094 1RHI4 2R044 1VBD4 2R064 1ASJ4 4GB34 1RUF4 1RUC4 1HRI4 1EAH4 1PVC4 1OOPD 1PO24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR9 4;  2RS1 4;  1AR8 4;  1MQT D;  2HWC 4;  1HXS 4;  1RUG 4;  1VRH 4;  1AL2 4;  1Z7S 4;  2PLV 4;  2X5I D;  4Q4W 4;  1H8T D;  3J8F 4;  4Q4V 4;  1R08 4;  1D4M 4;  1HRV 4;  1POV 0;  1RMU 4;  1VBE 4;  1EV1 4;  2R07 4;  2RMU 4;  3JBG 4;  1NCQ D;  1RUI 4;  2RR1 4;  1AR6 4;  1RUJ 4;  4PDW D;  1VBB 4;  1PIV 4;  1RUE 4;  1NA1 D;  2HWB 4;  1PO1 4;  1K5M D;  1VBA 4;  1RVF 4;  1RUD 4;  2RM2 4;  2RS3 4;  2RS5 4;  1VBC 4;  3JD7 4;  4Q4Y 4;  1AR7 4;  1BEV 4;  1RUH 4;  4Q4X 4;  4RHV 4;  1COV 4;  1R09 4;  1RHI 4;  2R04 4;  1VBD 4;  2R06 4;  1ASJ 4;  4GB3 4;  1RUF 4;  1RUC 4;  1HRI 4;  1EAH 4;  1PVC 4;  1OOP D;  1PO2 4; 
#chains in the Genus database with same CATH topology
 2PYJ A;  4Q4W 4;  1XHX A;  3J8F 4;  2H89 A;  1R08 4;  1D4M 4;  3JBG 4;  2RMU 4;  2EX3 A;  2WP9 A;  1AR6 4;  4YSY A;  1VBB 4;  1YQ4 A;  3GQH A;  5C3J A;  1NA1 D;  1K5M D;  2WU5 A;  3CIR A;  1AR7 4;  1BEV 4;  1RUH 4;  1COV 4;  2B76 A;  1ASJ 4;  2WDV A;  3P4P A;  1HRI 4;  1OOP D;  1AR9 4;  1AR8 4;  1HXS 4;  1VRH 4;  3VR8 A;  2X5I D;  3AE3 A;  1HRV 4;  1RMU 4;  2R07 4;  2PY5 A;  1NCQ D;  4YSZ A;  1RUE 4;  2RS5 4;  1RUD 4;  2RS3 4;  2WDQ A;  4Q4Y 4;  3AEC A;  3AE6 A;  2PYL A;  4Q4X 4;  4YTM A;  2R7F A;  1RHI 4;  4RHV 4;  4YXD A;  1RUF 4;  3AE8 A;  1EAH 4;  1PVC 4;  1KFY A;  3AEF A;  1ZP0 A;  3VRB A;  1Z7S 4;  2PLV 4;  1XI1 A;  3VRA A;  1KF6 A;  3FI7 A;  1XHZ A;  4YTP A;  1H8T D;  5C2T A;  2WS3 A;  2WDR A;  1VBE 4;  1RUI 4;  2RR1 4;  1RUJ 4;  4KX6 A;  4PDW D;  2RM2 4;  1PO1 4;  1VBA 4;  3AE4 A;  1RVF 4;  3JD7 4;  2H88 A;  3VR9 A;  3SFD A;  1YQ3 A;  4YTN A;  1RUC 4;  3P4S A;  3AE1 A;  1NEK A;  1PO2 4;  3AEE A;  2RS1 4;  3AEB A;  1MQT D;  2HWC 4;  1RUG 4;  1AL2 4;  3SUC A;  2WU2 A;  3P4R A;  4Q4V 4;  3AE2 A;  1POV 0;  3P4Q A;  1EV1 4;  3ABV A;  4YT0 A;  2PZS A;  2ACZ A;  1PIV 4;  4YSX A;  2HWB 4;  3AEG A;  3AEA A;  3GQK A;  1L0V A;  3AED A;  1VBC 4;  1ZOY A;  2FBW A;  1R09 4;  1NEN A;  1VBD 4;  2R04 4;  3AE7 A;  3AE5 A;  2R06 4;  2WQY A;  4GB3 4;  2PW9 A;  3SFE A;  3AE9 A; 
#chains in the Genus database with same CATH homology
 1AR9 4;  2RS1 4;  1AR8 4;  1MQT D;  2HWC 4;  1HXS 4;  1RUG 4;  1VRH 4;  1AL2 4;  1Z7S 4;  2PLV 4;  2X5I D;  4Q4W 4;  1H8T D;  3J8F 4;  4Q4V 4;  1R08 4;  1D4M 4;  1HRV 4;  1POV 0;  1RMU 4;  1VBE 4;  1EV1 4;  2R07 4;  2RMU 4;  3JBG 4;  1NCQ D;  1RUI 4;  2RR1 4;  1AR6 4;  1RUJ 4;  4PDW D;  1VBB 4;  1PIV 4;  1RUE 4;  1NA1 D;  2HWB 4;  1PO1 4;  1K5M D;  1VBA 4;  1RVF 4;  1RUD 4;  2RM2 4;  2RS3 4;  2RS5 4;  1VBC 4;  3JD7 4;  4Q4Y 4;  1AR7 4;  1BEV 4;  1RUH 4;  4Q4X 4;  4RHV 4;  1COV 4;  1R09 4;  1RHI 4;  2R04 4;  1VBD 4;  2R06 4;  1ASJ 4;  4GB3 4;  1RUF 4;  1RUC 4;  1HRI 4;  1EAH 4;  1PVC 4;  1OOP D;  1PO2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...