1PVC4

Refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3, SABIN STRAIN
publication title Refinement of the Sabin Strain of Type 3 Poliovirus at 2.4 Angstroms and the Crystal Structures of its Variants at 2.9 Angstroms Resolution
rcsb
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1pvc400
1VBE4 1VBA4 1BEV4 2RS54 1D4M4 1EV14 1NA1D 3JD74 4GB34 1HXS4 1AR74 1AR84 1AR94 1RUE4 4RHV4 1ASJ4 1RUI4 1PO14 2HWC4 1K5MD 2PLV4 4Q4W4 2R074 1RHI4 1NCQD 1OOPD 1RUF4 1RUC4 1PO24 2HWB4 3J8F4 4Q4X4 4Q4V4 1R094 1R084 1COV4 2R064 4Q4Y4 1RUD4 2R044 1PVC4 1VBD4 1VRH4 1RMU4 3JBG4 1HRI4 1Z7S4 1MQTD 1POV0 1RUJ4 1VBC4 2RMU4 2X5ID 1H8TD 4PDWD 1PIV4 1RUG4 1EAH4 2RS34 2RS14 1HRV4 1AL24 1RUH4 1VBB4 1RVF4 2RR14 1AR64 2RM24
chains in the Genus database with same CATH superfamily
1VBE4 1ZP0A 3AE1A 1NA1D 2WU5A 2PY5A 1HXS4 1RUE4 1AR94 2FBWA 4RHV4 3VR8A 1PO14 2HWC4 1K5MD 2WP9A 1RUD4 2R044 1PVC4 1HRI4 2RMU4 3P4QA 1H8TD 1RUG4 3AEDA 3SFDA 1RUH4 2RM24 1BEV4 1D4M4 1YQ4A 1EV14 3AE6A 1XI1A 3CIRA 1AR84 1NENA 4YT0A 1ASJ4 1RUI4 3AE2A 3GQHA 1OOPD 4YTMA 1PO24 3J8F4 2WU2A 1R094 1R084 2R064 1ZOYA 3P4SA 3AECA 1RMU4 2H89A 3GQKA 1XHXA 3JBG4 1MQTD 2PZSA 2WDRA 4YTNA 3AE3A 4KX6A 2RS34 2RR14 3P4PA 3AE8A 2H88A 3FI7A 2RS54 3AE9A 5C2TA 1XHZA 3JD74 4YTPA 4GB34 1AR74 2WDVA 1YQ3A 3SFEA 4Q4W4 2R074 4YSXA 1RHI4 1NCQD 1RUF4 3AEAA 1RUC4 2WDQA 1L0VA 4Q4X4 4Q4V4 3AEEA 1COV4 4Q4Y4 1VBD4 1VRH4 2PW9A 1Z7S4 3AE7A 1POV0 2WQYA 1VBC4 3P4RA 4PDWD 1PIV4 3AE5A 3VR9A 4YSZA 3VRBA 1RVF4 3VRAA 1VBA4 3SUCA 1KFYA 2WS3A 2PYLA 3AE4A 1KF6A 2PLV4 2EX3A 2B76A 2ACZA 2PYJA 2HWB4 5C3JA 3AEFA 1NEKA 3AEGA 4YXDA 1RUJ4 4YSYA 2X5ID 1EAH4 2RS14 1HRV4 1AL24 1VBB4 3AEBA 3ABVA 1AR64 2R7FA
chains in the Genus database with same CATH topology
1VBE4 1VBA4 1BEV4 2RS54 1D4M4 1EV14 1NA1D 3JD74 4GB34 1HXS4 1AR74 1AR84 1AR94 1RUE4 4RHV4 1ASJ4 1RUI4 1PO14 2HWC4 1K5MD 2PLV4 4Q4W4 2R074 1RHI4 1NCQD 1OOPD 1RUF4 1RUC4 1PO24 2HWB4 3J8F4 4Q4X4 4Q4V4 1R094 1R084 1COV4 2R064 4Q4Y4 1RUD4 2R044 1PVC4 1VBD4 1VRH4 1RMU4 3JBG4 1HRI4 1Z7S4 1MQTD 1POV0 1RUJ4 1VBC4 2RMU4 2X5ID 1H8TD 4PDWD 1PIV4 1RUG4 1EAH4 2RS34 2RS14 1HRV4 1AL24 1RUH4 1VBB4 1RVF4 2RR14 1AR64 2RM24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBE 4;  1VBA 4;  1BEV 4;  2RS5 4;  1D4M 4;  1EV1 4;  1NA1 D;  3JD7 4;  4GB3 4;  1HXS 4;  1AR7 4;  1AR8 4;  1AR9 4;  1RUE 4;  4RHV 4;  1ASJ 4;  1RUI 4;  1PO1 4;  2HWC 4;  1K5M D;  2PLV 4;  4Q4W 4;  2R07 4;  1RHI 4;  1NCQ D;  1OOP D;  1RUF 4;  1RUC 4;  1PO2 4;  2HWB 4;  3J8F 4;  4Q4X 4;  4Q4V 4;  1R09 4;  1R08 4;  1COV 4;  2R06 4;  4Q4Y 4;  1RUD 4;  2R04 4;  1PVC 4;  1VBD 4;  1VRH 4;  1RMU 4;  3JBG 4;  1HRI 4;  1Z7S 4;  1MQT D;  1POV 0;  1RUJ 4;  1VBC 4;  2RMU 4;  2X5I D;  1H8T D;  4PDW D;  1PIV 4;  1RUG 4;  1EAH 4;  2RS3 4;  2RS1 4;  1HRV 4;  1AL2 4;  1RUH 4;  1VBB 4;  1RVF 4;  2RR1 4;  1AR6 4;  2RM2 4; 
#chains in the Genus database with same CATH topology
 1VBE 4;  1ZP0 A;  3AE1 A;  1NA1 D;  2WU5 A;  2PY5 A;  1HXS 4;  1RUE 4;  1AR9 4;  2FBW A;  4RHV 4;  3VR8 A;  1PO1 4;  2HWC 4;  1K5M D;  2WP9 A;  1RUD 4;  2R04 4;  1PVC 4;  1HRI 4;  2RMU 4;  3P4Q A;  1H8T D;  1RUG 4;  3AED A;  3SFD A;  1RUH 4;  2RM2 4;  1BEV 4;  1D4M 4;  1YQ4 A;  1EV1 4;  3AE6 A;  1XI1 A;  3CIR A;  1AR8 4;  1NEN A;  4YT0 A;  1ASJ 4;  1RUI 4;  3AE2 A;  3GQH A;  1OOP D;  4YTM A;  1PO2 4;  3J8F 4;  2WU2 A;  1R09 4;  1R08 4;  2R06 4;  1ZOY A;  3P4S A;  3AEC A;  1RMU 4;  2H89 A;  3GQK A;  1XHX A;  3JBG 4;  1MQT D;  2PZS A;  2WDR A;  4YTN A;  3AE3 A;  4KX6 A;  2RS3 4;  2RR1 4;  3P4P A;  3AE8 A;  2H88 A;  3FI7 A;  2RS5 4;  3AE9 A;  5C2T A;  1XHZ A;  3JD7 4;  4YTP A;  4GB3 4;  1AR7 4;  2WDV A;  1YQ3 A;  3SFE A;  4Q4W 4;  2R07 4;  4YSX A;  1RHI 4;  1NCQ D;  1RUF 4;  3AEA A;  1RUC 4;  2WDQ A;  1L0V A;  4Q4X 4;  4Q4V 4;  3AEE A;  1COV 4;  4Q4Y 4;  1VBD 4;  1VRH 4;  2PW9 A;  1Z7S 4;  3AE7 A;  1POV 0;  2WQY A;  1VBC 4;  3P4R A;  4PDW D;  1PIV 4;  3AE5 A;  3VR9 A;  4YSZ A;  3VRB A;  1RVF 4;  3VRA A;  1VBA 4;  3SUC A;  1KFY A;  2WS3 A;  2PYL A;  3AE4 A;  1KF6 A;  2PLV 4;  2EX3 A;  2B76 A;  2ACZ A;  2PYJ A;  2HWB 4;  5C3J A;  3AEF A;  1NEK A;  3AEG A;  4YXD A;  1RUJ 4;  4YSY A;  2X5I D;  1EAH 4;  2RS1 4;  1HRV 4;  1AL2 4;  1VBB 4;  3AEB A;  3ABV A;  1AR6 4;  2R7F A; 
#chains in the Genus database with same CATH homology
 1VBE 4;  1VBA 4;  1BEV 4;  2RS5 4;  1D4M 4;  1EV1 4;  1NA1 D;  3JD7 4;  4GB3 4;  1HXS 4;  1AR7 4;  1AR8 4;  1AR9 4;  1RUE 4;  4RHV 4;  1ASJ 4;  1RUI 4;  1PO1 4;  2HWC 4;  1K5M D;  2PLV 4;  4Q4W 4;  2R07 4;  1RHI 4;  1NCQ D;  1OOP D;  1RUF 4;  1RUC 4;  1PO2 4;  2HWB 4;  3J8F 4;  4Q4X 4;  4Q4V 4;  1R09 4;  1R08 4;  1COV 4;  2R06 4;  4Q4Y 4;  1RUD 4;  2R04 4;  1PVC 4;  1VBD 4;  1VRH 4;  1RMU 4;  3JBG 4;  1HRI 4;  1Z7S 4;  1MQT D;  1POV 0;  1RUJ 4;  1VBC 4;  2RMU 4;  2X5I D;  1H8T D;  4PDW D;  1PIV 4;  1RUG 4;  1EAH 4;  2RS3 4;  2RS1 4;  1HRV 4;  1AL2 4;  1RUH 4;  1VBB 4;  1RVF 4;  2RR1 4;  1AR6 4;  2RM2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...