1PVC4

Refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 3, SABIN STRAIN
publication title Refinement of the Sabin Strain of Type 3 Poliovirus at 2.4 Angstroms and the Crystal Structures of its Variants at 2.9 Angstroms Resolution
rcsb
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1pvc400
1BEV4 1HRV4 1AL24 1RHI4 1NA1D 2R074 2X5ID 1PO24 1RUH4 1NCQD 1RUI4 1VBB4 3JD74 2RS54 1R094 2RR14 3JBG4 1AR94 4GB34 1VRH4 1EAH4 1VBD4 4Q4V4 1RUE4 4RHV4 1COV4 4PDWD 2R064 1RUC4 1K5MD 1Z7S4 1AR84 1RMU4 1HXS4 1ASJ4 1VBA4 1VBC4 2PLV4 2RMU4 1POV0 1R084 1RUJ4 3J8F4 2RM24 1AR74 1HRI4 1RUD4 1RVF4 2RS34 1PO14 4Q4X4 1EV14 1RUG4 2R044 1RUF4 1D4M4 2RS14 1PIV4 1OOPD 1MQTD 1VBE4 2HWB4 1AR64 2HWC4 1H8TD 4Q4Y4 4Q4W4 1PVC4
chains in the Genus database with same CATH superfamily
1HRV4 4YSZA 1NA1D 3AE9A 2PY5A 2RS54 1ZP0A 3JBG4 3AEBA 4RHV4 1KF6A 3GQKA 1K5MD 1Z7S4 3AE8A 4YT0A 1VBA4 1POV0 3SUCA 1R084 2PW9A 3AE3A 3AE1A 1RUG4 4YTMA 3AEAA 3GQHA 1PIV4 1VBE4 2HWB4 2R7FA 2RMU4 1H8TD 3AECA 3AE5A 4Q4Y4 4YXDA 3VRAA 1AL24 3VR8A 2EX3A 2WU5A 1ZOYA 4YSYA 1VBB4 2RR14 2ACZA 1EAH4 1VBD4 1RUE4 1RUC4 3AE4A 3VRBA 2H89A 2FBWA 3P4RA 1XHXA 2RM24 2RS34 3CIRA 1PO14 3SFDA 2WDQA 1YQ4A 4Q4W4 3AEGA 1BEV4 5C3JA 1RHI4 2X5ID 2R074 1YQ3A 1RUH4 3JD74 3AE7A 4KX6A 3AEDA 4GB34 4Q4V4 1XHZA 2PYJA 2WU2A 1COV4 3AEEA 3SFEA 2WDVA 1HXS4 1NENA 1VBC4 1RUJ4 3J8F4 2WP9A 4Q4X4 2PZSA 5C2TA 1KFYA 3FI7A 4YSXA 1D4M4 2RS14 2WS3A 2HWC4 2WQYA 2B76A 1XI1A 3AEFA 1VRH4 1PVC4 3P4PA 1PO24 1RUI4 1NCQD 1NEKA 3VR9A 4YTPA 1R094 1AR94 3AE6A 3P4SA 4PDWD 2R064 1AR84 1RMU4 1ASJ4 2PLV4 3ABVA 1AR74 1HRI4 1RUD4 1RVF4 2WDRA 1EV14 2H88A 2R044 1RUF4 2PYLA 1OOPD 1MQTD 1L0VA 1AR64 3P4QA 4YTNA 3AE2A
chains in the Genus database with same CATH topology
1BEV4 1HRV4 1AL24 1RHI4 1NA1D 2R074 2X5ID 1PO24 1RUH4 1NCQD 1RUI4 1VBB4 3JD74 2RS54 1R094 2RR14 3JBG4 1AR94 4GB34 1VRH4 1EAH4 1VBD4 4Q4V4 1RUE4 4RHV4 1COV4 4PDWD 2R064 1RUC4 1K5MD 1Z7S4 1AR84 1RMU4 1HXS4 1ASJ4 1VBA4 1VBC4 2PLV4 2RMU4 1POV0 1R084 1RUJ4 3J8F4 2RM24 1AR74 1HRI4 1RUD4 1RVF4 2RS34 1PO14 4Q4X4 1EV14 1RUG4 2R044 1RUF4 1D4M4 2RS14 1PIV4 1OOPD 1MQTD 1VBE4 2HWB4 1AR64 2HWC4 1H8TD 4Q4Y4 4Q4W4 1PVC4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BEV 4;  1HRV 4;  1AL2 4;  1RHI 4;  1NA1 D;  2R07 4;  2X5I D;  1PO2 4;  1RUH 4;  1NCQ D;  1RUI 4;  1VBB 4;  3JD7 4;  2RS5 4;  1R09 4;  2RR1 4;  3JBG 4;  1AR9 4;  4GB3 4;  1VRH 4;  1EAH 4;  1VBD 4;  4Q4V 4;  1RUE 4;  4RHV 4;  1COV 4;  4PDW D;  2R06 4;  1RUC 4;  1K5M D;  1Z7S 4;  1AR8 4;  1RMU 4;  1HXS 4;  1ASJ 4;  1VBA 4;  1VBC 4;  2PLV 4;  2RMU 4;  1POV 0;  1R08 4;  1RUJ 4;  3J8F 4;  2RM2 4;  1AR7 4;  1HRI 4;  1RUD 4;  1RVF 4;  2RS3 4;  1PO1 4;  4Q4X 4;  1EV1 4;  1RUG 4;  2R04 4;  1RUF 4;  1D4M 4;  2RS1 4;  1PIV 4;  1OOP D;  1MQT D;  1VBE 4;  2HWB 4;  1AR6 4;  2HWC 4;  1H8T D;  4Q4Y 4;  4Q4W 4;  1PVC 4; 
#chains in the Genus database with same CATH topology
 1HRV 4;  4YSZ A;  1NA1 D;  3AE9 A;  2PY5 A;  2RS5 4;  1ZP0 A;  3JBG 4;  3AEB A;  4RHV 4;  1KF6 A;  3GQK A;  1K5M D;  1Z7S 4;  3AE8 A;  4YT0 A;  1VBA 4;  1POV 0;  3SUC A;  1R08 4;  2PW9 A;  3AE3 A;  3AE1 A;  1RUG 4;  4YTM A;  3AEA A;  3GQH A;  1PIV 4;  1VBE 4;  2HWB 4;  2R7F A;  2RMU 4;  1H8T D;  3AEC A;  3AE5 A;  4Q4Y 4;  4YXD A;  3VRA A;  1AL2 4;  3VR8 A;  2EX3 A;  2WU5 A;  1ZOY A;  4YSY A;  1VBB 4;  2RR1 4;  2ACZ A;  1EAH 4;  1VBD 4;  1RUE 4;  1RUC 4;  3AE4 A;  3VRB A;  2H89 A;  2FBW A;  3P4R A;  1XHX A;  2RM2 4;  2RS3 4;  3CIR A;  1PO1 4;  3SFD A;  2WDQ A;  1YQ4 A;  4Q4W 4;  3AEG A;  1BEV 4;  5C3J A;  1RHI 4;  2X5I D;  2R07 4;  1YQ3 A;  1RUH 4;  3JD7 4;  3AE7 A;  4KX6 A;  3AED A;  4GB3 4;  4Q4V 4;  1XHZ A;  2PYJ A;  2WU2 A;  1COV 4;  3AEE A;  3SFE A;  2WDV A;  1HXS 4;  1NEN A;  1VBC 4;  1RUJ 4;  3J8F 4;  2WP9 A;  4Q4X 4;  2PZS A;  5C2T A;  1KFY A;  3FI7 A;  4YSX A;  1D4M 4;  2RS1 4;  2WS3 A;  2HWC 4;  2WQY A;  2B76 A;  1XI1 A;  3AEF A;  1VRH 4;  1PVC 4;  3P4P A;  1PO2 4;  1RUI 4;  1NCQ D;  1NEK A;  3VR9 A;  4YTP A;  1R09 4;  1AR9 4;  3AE6 A;  3P4S A;  4PDW D;  2R06 4;  1AR8 4;  1RMU 4;  1ASJ 4;  2PLV 4;  3ABV A;  1AR7 4;  1HRI 4;  1RUD 4;  1RVF 4;  2WDR A;  1EV1 4;  2H88 A;  2R04 4;  1RUF 4;  2PYL A;  1OOP D;  1MQT D;  1L0V A;  1AR6 4;  3P4Q A;  4YTN A;  3AE2 A; 
#chains in the Genus database with same CATH homology
 1BEV 4;  1HRV 4;  1AL2 4;  1RHI 4;  1NA1 D;  2R07 4;  2X5I D;  1PO2 4;  1RUH 4;  1NCQ D;  1RUI 4;  1VBB 4;  3JD7 4;  2RS5 4;  1R09 4;  2RR1 4;  3JBG 4;  1AR9 4;  4GB3 4;  1VRH 4;  1EAH 4;  1VBD 4;  4Q4V 4;  1RUE 4;  4RHV 4;  1COV 4;  4PDW D;  2R06 4;  1RUC 4;  1K5M D;  1Z7S 4;  1AR8 4;  1RMU 4;  1HXS 4;  1ASJ 4;  1VBA 4;  1VBC 4;  2PLV 4;  2RMU 4;  1POV 0;  1R08 4;  1RUJ 4;  3J8F 4;  2RM2 4;  1AR7 4;  1HRI 4;  1RUD 4;  1RVF 4;  2RS3 4;  1PO1 4;  4Q4X 4;  1EV1 4;  1RUG 4;  2R04 4;  1RUF 4;  1D4M 4;  2RS1 4;  1PIV 4;  1OOP D;  1MQT D;  1VBE 4;  2HWB 4;  1AR6 4;  2HWC 4;  1H8T D;  4Q4Y 4;  4Q4W 4;  1PVC 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...