1PVC4

Refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
b'GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3, SABIN STRAIN
publication title Refinement of the Sabin Strain of Type 3 Poliovirus at 2.4 Angstroms and the Crystal Structures of its Variants at 2.9 Angstroms Resolution
rcsb
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1pvc400
1AR64 1RUE4 2R044 1VBE4 3JD74 1POV0 2HWC4 1RUH4 4Q4V4 4Q4X4 1COV4 1Z7S4 1AL24 1RUF4 1RUI4 1VBC4 1RHI4 1R094 1VBB4 2PLV4 1HRI4 1R084 1AR84 1EV14 1PVC4 1BEV4 2RM24 2RMU4 2RS14 3JBG4 1NA1D 1AR94 2X5ID 2R064 1PIV4 1RUD4 1RVF4 3J8F4 2RS54 1H8TD 1RMU4 1OOPD 4GB34 1HRV4 4PDWD 1PO24 1MQTD 4Q4W4 1VBD4 4RHV4 1HXS4 1D4M4 1RUC4 2HWB4 1VBA4 1EAH4 1RUG4 1AR74 1RUJ4 2RS34 4Q4Y4 1K5MD 1PO14 2RR14 1VRH4 1ASJ4 1NCQD 2R074
chains in the Genus database with same CATH superfamily
3AE7A 1COV4 2H88A 1Z7S4 2WU5A 1XI1A 2WQYA 1EV14 2RM24 4YTMA 2EX3A 2X5ID 3VRBA 4YXDA 1NENA 4PDWD 2PY5A 1ZP0A 1D4M4 2HWB4 3P4RA 1VBA4 2PZSA 1AR74 2WDVA 1VRH4 4YT0A 1RUE4 3JD74 2HWC4 3AE3A 3GQKA 3P4QA 2B76A 4KX6A 5C2TA 1RUF4 1R094 3GQHA 2RS14 2PW9A 2RMU4 3JBG4 2WP9A 1NA1D 3P4PA 3AE1A 3AE9A 1PIV4 1L0VA 1RMU4 1OOPD 3VRAA 1PO24 3SFDA 3AEGA 3VR9A 4RHV4 4YTNA 1RUC4 1KFYA 1RUG4 2WDQA 3AECA 3SUCA 1K5MD 1PO14 1ASJ4 2R074 1KF6A 1AR64 2R044 1VBE4 3AE8A 1RUH4 1AL24 1RUI4 3AE5A 2WS3A 2R7FA 1HRI4 1AR84 1PVC4 2FBWA 1AR94 1YQ4A 2R064 3FI7A 3AEFA 1RUD4 2RS54 1HRV4 4Q4W4 3AE4A 3AE2A 3VR8A 4YSYA 1RUJ4 3AEEA 4YTPA 3AEDA 4Q4X4 1ZOYA 1NCQD 3ABVA 2H89A 2PYLA 4Q4V4 1POV0 3AEBA 2PYJA 1VBC4 1RHI4 2PLV4 3AEAA 3AE6A 1R084 1BEV4 1XHZA 5C3JA 3SFEA 1YQ3A 1RVF4 3J8F4 1H8TD 2WDRA 3P4SA 1NEKA 1MQTD 4YSZA 1VBD4 1XHXA 1HXS4 4YSXA 1EAH4 2RS34 4Q4Y4 2ACZA 2RR14 3CIRA 2WU2A 4GB34 1VBB4
chains in the Genus database with same CATH topology
1AR64 1RUE4 2R044 1VBE4 3JD74 1POV0 2HWC4 1RUH4 4Q4V4 4Q4X4 1COV4 1Z7S4 1AL24 1RUF4 1RUI4 1VBC4 1RHI4 1R094 1VBB4 2PLV4 1HRI4 1R084 1AR84 1EV14 1PVC4 1BEV4 2RM24 2RMU4 2RS14 3JBG4 1NA1D 1AR94 2X5ID 2R064 1PIV4 1RUD4 1RVF4 3J8F4 2RS54 1H8TD 1RMU4 1OOPD 4GB34 1HRV4 4PDWD 1PO24 1MQTD 4Q4W4 1VBD4 4RHV4 1HXS4 1D4M4 1RUC4 2HWB4 1VBA4 1EAH4 1RUG4 1AR74 1RUJ4 2RS34 4Q4Y4 1K5MD 1PO14 2RR14 1VRH4 1ASJ4 1NCQD 2R074
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR6 4;  1RUE 4;  2R04 4;  1VBE 4;  3JD7 4;  1POV 0;  2HWC 4;  1RUH 4;  4Q4V 4;  4Q4X 4;  1COV 4;  1Z7S 4;  1AL2 4;  1RUF 4;  1RUI 4;  1VBC 4;  1RHI 4;  1R09 4;  1VBB 4;  2PLV 4;  1HRI 4;  1R08 4;  1AR8 4;  1EV1 4;  1PVC 4;  1BEV 4;  2RM2 4;  2RMU 4;  2RS1 4;  3JBG 4;  1NA1 D;  1AR9 4;  2X5I D;  2R06 4;  1PIV 4;  1RUD 4;  1RVF 4;  3J8F 4;  2RS5 4;  1H8T D;  1RMU 4;  1OOP D;  4GB3 4;  1HRV 4;  4PDW D;  1PO2 4;  1MQT D;  4Q4W 4;  1VBD 4;  4RHV 4;  1HXS 4;  1D4M 4;  1RUC 4;  2HWB 4;  1VBA 4;  1EAH 4;  1RUG 4;  1AR7 4;  1RUJ 4;  2RS3 4;  4Q4Y 4;  1K5M D;  1PO1 4;  2RR1 4;  1VRH 4;  1ASJ 4;  1NCQ D;  2R07 4; 
#chains in the Genus database with same CATH topology
 3AE7 A;  1COV 4;  2H88 A;  1Z7S 4;  2WU5 A;  1XI1 A;  2WQY A;  1EV1 4;  2RM2 4;  4YTM A;  2EX3 A;  2X5I D;  3VRB A;  4YXD A;  1NEN A;  4PDW D;  2PY5 A;  1ZP0 A;  1D4M 4;  2HWB 4;  3P4R A;  1VBA 4;  2PZS A;  1AR7 4;  2WDV A;  1VRH 4;  4YT0 A;  1RUE 4;  3JD7 4;  2HWC 4;  3AE3 A;  3GQK A;  3P4Q A;  2B76 A;  4KX6 A;  5C2T A;  1RUF 4;  1R09 4;  3GQH A;  2RS1 4;  2PW9 A;  2RMU 4;  3JBG 4;  2WP9 A;  1NA1 D;  3P4P A;  3AE1 A;  3AE9 A;  1PIV 4;  1L0V A;  1RMU 4;  1OOP D;  3VRA A;  1PO2 4;  3SFD A;  3AEG A;  3VR9 A;  4RHV 4;  4YTN A;  1RUC 4;  1KFY A;  1RUG 4;  2WDQ A;  3AEC A;  3SUC A;  1K5M D;  1PO1 4;  1ASJ 4;  2R07 4;  1KF6 A;  1AR6 4;  2R04 4;  1VBE 4;  3AE8 A;  1RUH 4;  1AL2 4;  1RUI 4;  3AE5 A;  2WS3 A;  2R7F A;  1HRI 4;  1AR8 4;  1PVC 4;  2FBW A;  1AR9 4;  1YQ4 A;  2R06 4;  3FI7 A;  3AEF A;  1RUD 4;  2RS5 4;  1HRV 4;  4Q4W 4;  3AE4 A;  3AE2 A;  3VR8 A;  4YSY A;  1RUJ 4;  3AEE A;  4YTP A;  3AED A;  4Q4X 4;  1ZOY A;  1NCQ D;  3ABV A;  2H89 A;  2PYL A;  4Q4V 4;  1POV 0;  3AEB A;  2PYJ A;  1VBC 4;  1RHI 4;  2PLV 4;  3AEA A;  3AE6 A;  1R08 4;  1BEV 4;  1XHZ A;  5C3J A;  3SFE A;  1YQ3 A;  1RVF 4;  3J8F 4;  1H8T D;  2WDR A;  3P4S A;  1NEK A;  1MQT D;  4YSZ A;  1VBD 4;  1XHX A;  1HXS 4;  4YSX A;  1EAH 4;  2RS3 4;  4Q4Y 4;  2ACZ A;  2RR1 4;  3CIR A;  2WU2 A;  4GB3 4;  1VBB 4; 
#chains in the Genus database with same CATH homology
 1AR6 4;  1RUE 4;  2R04 4;  1VBE 4;  3JD7 4;  1POV 0;  2HWC 4;  1RUH 4;  4Q4V 4;  4Q4X 4;  1COV 4;  1Z7S 4;  1AL2 4;  1RUF 4;  1RUI 4;  1VBC 4;  1RHI 4;  1R09 4;  1VBB 4;  2PLV 4;  1HRI 4;  1R08 4;  1AR8 4;  1EV1 4;  1PVC 4;  1BEV 4;  2RM2 4;  2RMU 4;  2RS1 4;  3JBG 4;  1NA1 D;  1AR9 4;  2X5I D;  2R06 4;  1PIV 4;  1RUD 4;  1RVF 4;  3J8F 4;  2RS5 4;  1H8T D;  1RMU 4;  1OOP D;  4GB3 4;  1HRV 4;  4PDW D;  1PO2 4;  1MQT D;  4Q4W 4;  1VBD 4;  4RHV 4;  1HXS 4;  1D4M 4;  1RUC 4;  2HWB 4;  1VBA 4;  1EAH 4;  1RUG 4;  1AR7 4;  1RUJ 4;  2RS3 4;  4Q4Y 4;  1K5M D;  1PO1 4;  2RR1 4;  1VRH 4;  1ASJ 4;  1NCQ D;  2R07 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...