2HWC4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwc400
1EV14 1HXS4 1RUJ4 2RR14 1HRI4 1EAH4 1H8TD 1NA1D 1RUI4 2HWB4 2R044 1RUC4 1VRH4 4RHV4 1PVC4 1MQTD 1RUG4 3JBG4 4Q4Y4 2X5ID 1RHI4 1RVF4 1AR94 1VBD4 2R074 4PDWD 1RUE4 1AR64 1NCQD 1RUH4 1VBA4 1PIV4 1R084 1VBB4 2RS54 2RS34 1RUF4 1PO24 1RMU4 4GB34 1COV4 1D4M4 2PLV4 1VBC4 1K5MD 2HWC4 3J8F4 1BEV4 1ASJ4 1Z7S4 1HRV4 1AL24 2RMU4 3JD74 4Q4V4 1OOPD 1RUD4 1AR74 1R094 1POV0 4Q4X4 2RS14 1PO14 4Q4W4 2R064 2RM24 1VBE4 1AR84
chains in the Genus database with same CATH superfamily
1EV14 3AE2A 3AE4A 4YTMA 2WP9A 2WDVA 3AEDA 1RUI4 2WDQA 1VRH4 3AE7A 2ACZA 3AEEA 2H88A 3P4QA 1AR94 3P4SA 1RUH4 1PIV4 3SUCA 4YSYA 4YSXA 2HWC4 3J8F4 2RMU4 3AE5A 1OOPD 1RUD4 3VRAA 1POV0 3CIRA 1VBE4 1HXS4 2RR14 2FBWA 1NENA 5C3JA 2HWB4 3SFDA 3AE8A 2R044 4Q4X4 3GQKA 4YT0A 1MQTD 1RHI4 1VBD4 3FI7A 4PDWD 1VBA4 1AR64 1NCQD 3P4RA 1RUF4 1PO24 1RMU4 2PW9A 1COV4 1D4M4 4YXDA 2WS3A 1K5MD 1XHXA 1AL24 1ZOYA 1NEKA 1AR74 4YTPA 1PO14 3AE6A 1AR84 4KX6A 1HRI4 4YSZA 3VR9A 1H8TD 1YQ4A 2PY5A 1PVC4 2R074 1RUE4 1ZP0A 1R084 2B76A 2RS54 3VRBA 2WDRA 2PZSA 3AEFA 1KFYA 1ASJ4 1Z7S4 1HRV4 4Q4W4 2R064 3ABVA 2RM24 2WQYA 1VBB4 2EX3A 2WU5A 1XHZA 1RUJ4 2H89A 4YTNA 3VR8A 1EAH4 1XI1A 2PYJA 2PYLA 1NA1D 1RUC4 4RHV4 2R7FA 1RUG4 3JBG4 4Q4Y4 1L0VA 2WU2A 2X5ID 1RVF4 3P4PA 3AE9A 3AE3A 3SFEA 2RS34 3AEBA 4GB34 1YQ3A 1KF6A 3AE1A 3AECA 2PLV4 1VBC4 1BEV4 3AEAA 3JD74 4Q4V4 1R094 3GQHA 2RS14 5C2TA 3AEGA
chains in the Genus database with same CATH topology
1EV14 1HXS4 1RUJ4 2RR14 1HRI4 1EAH4 1H8TD 1NA1D 1RUI4 2HWB4 2R044 1RUC4 1VRH4 4RHV4 1PVC4 1MQTD 1RUG4 3JBG4 4Q4Y4 2X5ID 1RHI4 1RVF4 1AR94 1VBD4 2R074 4PDWD 1RUE4 1AR64 1NCQD 1RUH4 1VBA4 1PIV4 1R084 1VBB4 2RS54 2RS34 1RUF4 1PO24 1RMU4 4GB34 1COV4 1D4M4 2PLV4 1VBC4 1K5MD 2HWC4 3J8F4 1BEV4 1ASJ4 1Z7S4 1HRV4 1AL24 2RMU4 3JD74 4Q4V4 1OOPD 1RUD4 1AR74 1R094 1POV0 4Q4X4 2RS14 1PO14 4Q4W4 2R064 2RM24 1VBE4 1AR84
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV1 4;  1HXS 4;  1RUJ 4;  2RR1 4;  1HRI 4;  1EAH 4;  1H8T D;  1NA1 D;  1RUI 4;  2HWB 4;  2R04 4;  1RUC 4;  1VRH 4;  4RHV 4;  1PVC 4;  1MQT D;  1RUG 4;  3JBG 4;  4Q4Y 4;  2X5I D;  1RHI 4;  1RVF 4;  1AR9 4;  1VBD 4;  2R07 4;  4PDW D;  1RUE 4;  1AR6 4;  1NCQ D;  1RUH 4;  1VBA 4;  1PIV 4;  1R08 4;  1VBB 4;  2RS5 4;  2RS3 4;  1RUF 4;  1PO2 4;  1RMU 4;  4GB3 4;  1COV 4;  1D4M 4;  2PLV 4;  1VBC 4;  1K5M D;  2HWC 4;  3J8F 4;  1BEV 4;  1ASJ 4;  1Z7S 4;  1HRV 4;  1AL2 4;  2RMU 4;  3JD7 4;  4Q4V 4;  1OOP D;  1RUD 4;  1AR7 4;  1R09 4;  1POV 0;  4Q4X 4;  2RS1 4;  1PO1 4;  4Q4W 4;  2R06 4;  2RM2 4;  1VBE 4;  1AR8 4; 
#chains in the Genus database with same CATH topology
 1EV1 4;  3AE2 A;  3AE4 A;  4YTM A;  2WP9 A;  2WDV A;  3AED A;  1RUI 4;  2WDQ A;  1VRH 4;  3AE7 A;  2ACZ A;  3AEE A;  2H88 A;  3P4Q A;  1AR9 4;  3P4S A;  1RUH 4;  1PIV 4;  3SUC A;  4YSY A;  4YSX A;  2HWC 4;  3J8F 4;  2RMU 4;  3AE5 A;  1OOP D;  1RUD 4;  3VRA A;  1POV 0;  3CIR A;  1VBE 4;  1HXS 4;  2RR1 4;  2FBW A;  1NEN A;  5C3J A;  2HWB 4;  3SFD A;  3AE8 A;  2R04 4;  4Q4X 4;  3GQK A;  4YT0 A;  1MQT D;  1RHI 4;  1VBD 4;  3FI7 A;  4PDW D;  1VBA 4;  1AR6 4;  1NCQ D;  3P4R A;  1RUF 4;  1PO2 4;  1RMU 4;  2PW9 A;  1COV 4;  1D4M 4;  4YXD A;  2WS3 A;  1K5M D;  1XHX A;  1AL2 4;  1ZOY A;  1NEK A;  1AR7 4;  4YTP A;  1PO1 4;  3AE6 A;  1AR8 4;  4KX6 A;  1HRI 4;  4YSZ A;  3VR9 A;  1H8T D;  1YQ4 A;  2PY5 A;  1PVC 4;  2R07 4;  1RUE 4;  1ZP0 A;  1R08 4;  2B76 A;  2RS5 4;  3VRB A;  2WDR A;  2PZS A;  3AEF A;  1KFY A;  1ASJ 4;  1Z7S 4;  1HRV 4;  4Q4W 4;  2R06 4;  3ABV A;  2RM2 4;  2WQY A;  1VBB 4;  2EX3 A;  2WU5 A;  1XHZ A;  1RUJ 4;  2H89 A;  4YTN A;  3VR8 A;  1EAH 4;  1XI1 A;  2PYJ A;  2PYL A;  1NA1 D;  1RUC 4;  4RHV 4;  2R7F A;  1RUG 4;  3JBG 4;  4Q4Y 4;  1L0V A;  2WU2 A;  2X5I D;  1RVF 4;  3P4P A;  3AE9 A;  3AE3 A;  3SFE A;  2RS3 4;  3AEB A;  4GB3 4;  1YQ3 A;  1KF6 A;  3AE1 A;  3AEC A;  2PLV 4;  1VBC 4;  1BEV 4;  3AEA A;  3JD7 4;  4Q4V 4;  1R09 4;  3GQH A;  2RS1 4;  5C2T A;  3AEG A; 
#chains in the Genus database with same CATH homology
 1EV1 4;  1HXS 4;  1RUJ 4;  2RR1 4;  1HRI 4;  1EAH 4;  1H8T D;  1NA1 D;  1RUI 4;  2HWB 4;  2R04 4;  1RUC 4;  1VRH 4;  4RHV 4;  1PVC 4;  1MQT D;  1RUG 4;  3JBG 4;  4Q4Y 4;  2X5I D;  1RHI 4;  1RVF 4;  1AR9 4;  1VBD 4;  2R07 4;  4PDW D;  1RUE 4;  1AR6 4;  1NCQ D;  1RUH 4;  1VBA 4;  1PIV 4;  1R08 4;  1VBB 4;  2RS5 4;  2RS3 4;  1RUF 4;  1PO2 4;  1RMU 4;  4GB3 4;  1COV 4;  1D4M 4;  2PLV 4;  1VBC 4;  1K5M D;  2HWC 4;  3J8F 4;  1BEV 4;  1ASJ 4;  1Z7S 4;  1HRV 4;  1AL2 4;  2RMU 4;  3JD7 4;  4Q4V 4;  1OOP D;  1RUD 4;  1AR7 4;  1R09 4;  1POV 0;  4Q4X 4;  2RS1 4;  1PO1 4;  4Q4W 4;  2R06 4;  2RM2 4;  1VBE 4;  1AR8 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...