2HWC4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwc400
4Q4X4 1RVF4 1NCQD 1RUF4 4Q4W4 2RR14 1NA1D 1ASJ4 4RHV4 2PLV4 2HWC4 2R064 1VBC4 2RM24 1EV14 3JBG4 3JD74 1HXS4 2RS34 3J8F4 1HRI4 4Q4Y4 2HWB4 1R084 1MQTD 1R094 1VBD4 2RS14 1PO14 1RUH4 1AL24 1EAH4 1OOPD 1RMU4 1AR74 1D4M4 1VRH4 1Z7S4 4Q4V4 1K5MD 1POV0 2X5ID 1PVC4 1AR94 1BEV4 2R074 1VBA4 4GB34 1H8TD 1AR64 1RUJ4 1RUE4 4PDWD 1RUG4 2RS54 1VBE4 1AR84 1RUC4 1RUI4 2RMU4 1PIV4 1HRV4 1PO24 1VBB4 1COV4 1RUD4 2R044 1RHI4
chains in the Genus database with same CATH superfamily
1RVF4 3AEFA 1XHXA 2PYJA 2PLV4 1VBC4 3JBG4 2RS34 3P4QA 2WU5A 4YSZA 4YXDA 1ZOYA 1XI1A 1EAH4 1OOPD 2B76A 1Z7S4 2FBWA 3P4RA 3FI7A 2WDVA 1RUE4 1PIV4 2ACZA 1PO24 1VBB4 4YTPA 1COV4 1RHI4 4Q4X4 3AEAA 1NCQD 1RUF4 3AEDA 2RR14 1NA1D 2PZSA 2R064 1HXS4 1VRH4 1POV0 3ABVA 2WDRA 5C3JA 3AEEA 1YQ3A 1BEV4 3AE6A 3VRAA 2R074 1VBA4 3AE9A 4KX6A 1AR64 1RUJ4 3P4SA 2RS54 1RUC4 2RMU4 2PY5A 4YTMA 3AE5A 3AEBA 4Q4W4 1ASJ4 4RHV4 2HWC4 3JD74 1HRI4 4Q4Y4 3AE4A 2WDQA 3AE7A 1R084 3AE1A 2RS14 1RMU4 2WQYA 3AE8A 1ZP0A 2WP9A 1PVC4 5C2TA 3AEGA 4YSYA 3SFEA 4GB34 2H88A 1H8TD 4PDWD 3P4PA 1NEKA 4YT0A 1NENA 1VBE4 1AR84 1KF6A 1RUI4 3AE2A 3VRBA 1KFYA 3AE3A 1EV14 3SUCA 3J8F4 3SFDA 2HWB4 3VR8A 1MQTD 1R094 1VBD4 1PO14 1RUH4 1AL24 3CIRA 1AR74 1D4M4 2WS3A 3GQHA 2H89A 1K5MD 4Q4V4 2PYLA 2X5ID 3VR9A 1YQ4A 1AR94 2R7FA 2PW9A 3GQKA 4YTNA 2EX3A 1RUG4 4YSXA 1L0VA 1HRV4 3AECA 2WU2A 2RM24 1RUD4 2R044 1XHZA
chains in the Genus database with same CATH topology
4Q4X4 1RVF4 1NCQD 1RUF4 4Q4W4 2RR14 1NA1D 1ASJ4 4RHV4 2PLV4 2HWC4 2R064 1VBC4 2RM24 1EV14 3JBG4 3JD74 1HXS4 2RS34 3J8F4 1HRI4 4Q4Y4 2HWB4 1R084 1MQTD 1R094 1VBD4 2RS14 1PO14 1RUH4 1AL24 1EAH4 1OOPD 1RMU4 1AR74 1D4M4 1VRH4 1Z7S4 4Q4V4 1K5MD 1POV0 2X5ID 1PVC4 1AR94 1BEV4 2R074 1VBA4 4GB34 1H8TD 1AR64 1RUJ4 1RUE4 4PDWD 1RUG4 2RS54 1VBE4 1AR84 1RUC4 1RUI4 2RMU4 1PIV4 1HRV4 1PO24 1VBB4 1COV4 1RUD4 2R044 1RHI4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4X 4;  1RVF 4;  1NCQ D;  1RUF 4;  4Q4W 4;  2RR1 4;  1NA1 D;  1ASJ 4;  4RHV 4;  2PLV 4;  2HWC 4;  2R06 4;  1VBC 4;  2RM2 4;  1EV1 4;  3JBG 4;  3JD7 4;  1HXS 4;  2RS3 4;  3J8F 4;  1HRI 4;  4Q4Y 4;  2HWB 4;  1R08 4;  1MQT D;  1R09 4;  1VBD 4;  2RS1 4;  1PO1 4;  1RUH 4;  1AL2 4;  1EAH 4;  1OOP D;  1RMU 4;  1AR7 4;  1D4M 4;  1VRH 4;  1Z7S 4;  4Q4V 4;  1K5M D;  1POV 0;  2X5I D;  1PVC 4;  1AR9 4;  1BEV 4;  2R07 4;  1VBA 4;  4GB3 4;  1H8T D;  1AR6 4;  1RUJ 4;  1RUE 4;  4PDW D;  1RUG 4;  2RS5 4;  1VBE 4;  1AR8 4;  1RUC 4;  1RUI 4;  2RMU 4;  1PIV 4;  1HRV 4;  1PO2 4;  1VBB 4;  1COV 4;  1RUD 4;  2R04 4;  1RHI 4; 
#chains in the Genus database with same CATH topology
 1RVF 4;  3AEF A;  1XHX A;  2PYJ A;  2PLV 4;  1VBC 4;  3JBG 4;  2RS3 4;  3P4Q A;  2WU5 A;  4YSZ A;  4YXD A;  1ZOY A;  1XI1 A;  1EAH 4;  1OOP D;  2B76 A;  1Z7S 4;  2FBW A;  3P4R A;  3FI7 A;  2WDV A;  1RUE 4;  1PIV 4;  2ACZ A;  1PO2 4;  1VBB 4;  4YTP A;  1COV 4;  1RHI 4;  4Q4X 4;  3AEA A;  1NCQ D;  1RUF 4;  3AED A;  2RR1 4;  1NA1 D;  2PZS A;  2R06 4;  1HXS 4;  1VRH 4;  1POV 0;  3ABV A;  2WDR A;  5C3J A;  3AEE A;  1YQ3 A;  1BEV 4;  3AE6 A;  3VRA A;  2R07 4;  1VBA 4;  3AE9 A;  4KX6 A;  1AR6 4;  1RUJ 4;  3P4S A;  2RS5 4;  1RUC 4;  2RMU 4;  2PY5 A;  4YTM A;  3AE5 A;  3AEB A;  4Q4W 4;  1ASJ 4;  4RHV 4;  2HWC 4;  3JD7 4;  1HRI 4;  4Q4Y 4;  3AE4 A;  2WDQ A;  3AE7 A;  1R08 4;  3AE1 A;  2RS1 4;  1RMU 4;  2WQY A;  3AE8 A;  1ZP0 A;  2WP9 A;  1PVC 4;  5C2T A;  3AEG A;  4YSY A;  3SFE A;  4GB3 4;  2H88 A;  1H8T D;  4PDW D;  3P4P A;  1NEK A;  4YT0 A;  1NEN A;  1VBE 4;  1AR8 4;  1KF6 A;  1RUI 4;  3AE2 A;  3VRB A;  1KFY A;  3AE3 A;  1EV1 4;  3SUC A;  3J8F 4;  3SFD A;  2HWB 4;  3VR8 A;  1MQT D;  1R09 4;  1VBD 4;  1PO1 4;  1RUH 4;  1AL2 4;  3CIR A;  1AR7 4;  1D4M 4;  2WS3 A;  3GQH A;  2H89 A;  1K5M D;  4Q4V 4;  2PYL A;  2X5I D;  3VR9 A;  1YQ4 A;  1AR9 4;  2R7F A;  2PW9 A;  3GQK A;  4YTN A;  2EX3 A;  1RUG 4;  4YSX A;  1L0V A;  1HRV 4;  3AEC A;  2WU2 A;  2RM2 4;  1RUD 4;  2R04 4;  1XHZ A; 
#chains in the Genus database with same CATH homology
 4Q4X 4;  1RVF 4;  1NCQ D;  1RUF 4;  4Q4W 4;  2RR1 4;  1NA1 D;  1ASJ 4;  4RHV 4;  2PLV 4;  2HWC 4;  2R06 4;  1VBC 4;  2RM2 4;  1EV1 4;  3JBG 4;  3JD7 4;  1HXS 4;  2RS3 4;  3J8F 4;  1HRI 4;  4Q4Y 4;  2HWB 4;  1R08 4;  1MQT D;  1R09 4;  1VBD 4;  2RS1 4;  1PO1 4;  1RUH 4;  1AL2 4;  1EAH 4;  1OOP D;  1RMU 4;  1AR7 4;  1D4M 4;  1VRH 4;  1Z7S 4;  4Q4V 4;  1K5M D;  1POV 0;  2X5I D;  1PVC 4;  1AR9 4;  1BEV 4;  2R07 4;  1VBA 4;  4GB3 4;  1H8T D;  1AR6 4;  1RUJ 4;  1RUE 4;  4PDW D;  1RUG 4;  2RS5 4;  1VBE 4;  1AR8 4;  1RUC 4;  1RUI 4;  2RMU 4;  1PIV 4;  1HRV 4;  1PO2 4;  1VBB 4;  1COV 4;  1RUD 4;  2R04 4;  1RHI 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...