2HWC4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwc400
4RHV4 1HRV4 1NCQD 1AR84 1VBB4 1Z7S4 1VBA4 1H8TD 2R064 1AR94 4Q4W4 2RS34 1PO24 1RUI4 4GB34 1HRI4 1COV4 4Q4X4 1NA1D 1PIV4 1PVC4 1R084 2RS54 1RVF4 1D4M4 1RUJ4 1RUD4 1AL24 2RMU4 3JD74 1VBD4 1K5MD 1AR74 1EV14 1PO14 1VRH4 2RR14 1RUE4 2R074 3JBG4 2RS14 2HWB4 1R094 1AR64 2PLV4 4Q4Y4 1ASJ4 4PDWD 1VBC4 1RUC4 3J8F4 1MQTD 1VBE4 1EAH4 1RUH4 1OOPD 1RHI4 1RMU4 2RM24 2X5ID 1RUF4 1BEV4 1RUG4 2HWC4 1HXS4 4Q4V4 2R044 1POV0
chains in the Genus database with same CATH superfamily
1HRV4 1AR84 1VBB4 3AEDA 1H8TD 4Q4W4 1ZP0A 2H88A 2PW9A 1COV4 2H89A 1XHZA 1PIV4 4KX6A 2RS54 3AE5A 2WP9A 1NEKA 1K5MD 1PO14 1VRH4 3AEEA 2WU5A 1KF6A 2RS14 2HWB4 5C2TA 3AE3A 4PDWD 4YTPA 2ACZA 2WDRA 2X5ID 1RHI4 1RMU4 2R7FA 4YSXA 3P4SA 2RMU4 5C3JA 1HXS4 3AEBA 2R044 3VRBA 1AR94 4Q4X4 4YTNA 1R084 3AEFA 4YXDA 3AE4A 1D4M4 1RUJ4 1AL24 3JD74 1VBD4 3GQKA 2RR14 2PYLA 1YQ4A 3P4QA 2R074 4Q4Y4 2PY5A 1ASJ4 1MQTD 1VBE4 2RM24 2WDQA 2PYJA 3AE9A 2PZSA 2WS3A 3VR8A 3P4RA 1XHXA 1AR74 4Q4V4 4RHV4 3AE7A 3SUCA 1VBA4 3ABVA 2RS34 2B76A 2EX3A 1PVC4 1RVF4 3SFEA 1L0VA 1EV14 1KFYA 4YSYA 3AE2A 1R094 3AE6A 3VRAA 1VBC4 1RUC4 1EAH4 1OOPD 3AE1A 1XI1A 1RUG4 2HWC4 1YQ3A 3AE8A 3SFDA 1RUI4 1POV0 1ZOYA 1NCQD 4YTMA 1Z7S4 2R064 3P4PA 4YSZA 3FI7A 2WDVA 1PO24 4GB34 1HRI4 1NA1D 2WQYA 3GQHA 1RUD4 1RUE4 3VR9A 3JBG4 3AEAA 1AR64 2PLV4 1NENA 3AEGA 3J8F4 1RUH4 1RUF4 4YT0A 1BEV4 2FBWA 3AECA 2WU2A 3CIRA
chains in the Genus database with same CATH topology
4RHV4 1HRV4 1NCQD 1AR84 1VBB4 1Z7S4 1VBA4 1H8TD 2R064 1AR94 4Q4W4 2RS34 1PO24 1RUI4 4GB34 1HRI4 1COV4 4Q4X4 1NA1D 1PIV4 1PVC4 1R084 2RS54 1RVF4 1D4M4 1RUJ4 1RUD4 1AL24 2RMU4 3JD74 1VBD4 1K5MD 1AR74 1EV14 1PO14 1VRH4 2RR14 1RUE4 2R074 3JBG4 2RS14 2HWB4 1R094 1AR64 2PLV4 4Q4Y4 1ASJ4 4PDWD 1VBC4 1RUC4 3J8F4 1MQTD 1VBE4 1EAH4 1RUH4 1OOPD 1RHI4 1RMU4 2RM24 2X5ID 1RUF4 1BEV4 1RUG4 2HWC4 1HXS4 4Q4V4 2R044 1POV0
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHV 4;  1HRV 4;  1NCQ D;  1AR8 4;  1VBB 4;  1Z7S 4;  1VBA 4;  1H8T D;  2R06 4;  1AR9 4;  4Q4W 4;  2RS3 4;  1PO2 4;  1RUI 4;  4GB3 4;  1HRI 4;  1COV 4;  4Q4X 4;  1NA1 D;  1PIV 4;  1PVC 4;  1R08 4;  2RS5 4;  1RVF 4;  1D4M 4;  1RUJ 4;  1RUD 4;  1AL2 4;  2RMU 4;  3JD7 4;  1VBD 4;  1K5M D;  1AR7 4;  1EV1 4;  1PO1 4;  1VRH 4;  2RR1 4;  1RUE 4;  2R07 4;  3JBG 4;  2RS1 4;  2HWB 4;  1R09 4;  1AR6 4;  2PLV 4;  4Q4Y 4;  1ASJ 4;  4PDW D;  1VBC 4;  1RUC 4;  3J8F 4;  1MQT D;  1VBE 4;  1EAH 4;  1RUH 4;  1OOP D;  1RHI 4;  1RMU 4;  2RM2 4;  2X5I D;  1RUF 4;  1BEV 4;  1RUG 4;  2HWC 4;  1HXS 4;  4Q4V 4;  2R04 4;  1POV 0; 
#chains in the Genus database with same CATH topology
 1HRV 4;  1AR8 4;  1VBB 4;  3AED A;  1H8T D;  4Q4W 4;  1ZP0 A;  2H88 A;  2PW9 A;  1COV 4;  2H89 A;  1XHZ A;  1PIV 4;  4KX6 A;  2RS5 4;  3AE5 A;  2WP9 A;  1NEK A;  1K5M D;  1PO1 4;  1VRH 4;  3AEE A;  2WU5 A;  1KF6 A;  2RS1 4;  2HWB 4;  5C2T A;  3AE3 A;  4PDW D;  4YTP A;  2ACZ A;  2WDR A;  2X5I D;  1RHI 4;  1RMU 4;  2R7F A;  4YSX A;  3P4S A;  2RMU 4;  5C3J A;  1HXS 4;  3AEB A;  2R04 4;  3VRB A;  1AR9 4;  4Q4X 4;  4YTN A;  1R08 4;  3AEF A;  4YXD A;  3AE4 A;  1D4M 4;  1RUJ 4;  1AL2 4;  3JD7 4;  1VBD 4;  3GQK A;  2RR1 4;  2PYL A;  1YQ4 A;  3P4Q A;  2R07 4;  4Q4Y 4;  2PY5 A;  1ASJ 4;  1MQT D;  1VBE 4;  2RM2 4;  2WDQ A;  2PYJ A;  3AE9 A;  2PZS A;  2WS3 A;  3VR8 A;  3P4R A;  1XHX A;  1AR7 4;  4Q4V 4;  4RHV 4;  3AE7 A;  3SUC A;  1VBA 4;  3ABV A;  2RS3 4;  2B76 A;  2EX3 A;  1PVC 4;  1RVF 4;  3SFE A;  1L0V A;  1EV1 4;  1KFY A;  4YSY A;  3AE2 A;  1R09 4;  3AE6 A;  3VRA A;  1VBC 4;  1RUC 4;  1EAH 4;  1OOP D;  3AE1 A;  1XI1 A;  1RUG 4;  2HWC 4;  1YQ3 A;  3AE8 A;  3SFD A;  1RUI 4;  1POV 0;  1ZOY A;  1NCQ D;  4YTM A;  1Z7S 4;  2R06 4;  3P4P A;  4YSZ A;  3FI7 A;  2WDV A;  1PO2 4;  4GB3 4;  1HRI 4;  1NA1 D;  2WQY A;  3GQH A;  1RUD 4;  1RUE 4;  3VR9 A;  3JBG 4;  3AEA A;  1AR6 4;  2PLV 4;  1NEN A;  3AEG A;  3J8F 4;  1RUH 4;  1RUF 4;  4YT0 A;  1BEV 4;  2FBW A;  3AEC A;  2WU2 A;  3CIR A; 
#chains in the Genus database with same CATH homology
 4RHV 4;  1HRV 4;  1NCQ D;  1AR8 4;  1VBB 4;  1Z7S 4;  1VBA 4;  1H8T D;  2R06 4;  1AR9 4;  4Q4W 4;  2RS3 4;  1PO2 4;  1RUI 4;  4GB3 4;  1HRI 4;  1COV 4;  4Q4X 4;  1NA1 D;  1PIV 4;  1PVC 4;  1R08 4;  2RS5 4;  1RVF 4;  1D4M 4;  1RUJ 4;  1RUD 4;  1AL2 4;  2RMU 4;  3JD7 4;  1VBD 4;  1K5M D;  1AR7 4;  1EV1 4;  1PO1 4;  1VRH 4;  2RR1 4;  1RUE 4;  2R07 4;  3JBG 4;  2RS1 4;  2HWB 4;  1R09 4;  1AR6 4;  2PLV 4;  4Q4Y 4;  1ASJ 4;  4PDW D;  1VBC 4;  1RUC 4;  3J8F 4;  1MQT D;  1VBE 4;  1EAH 4;  1RUH 4;  1OOP D;  1RHI 4;  1RMU 4;  2RM2 4;  2X5I D;  1RUF 4;  1BEV 4;  1RUG 4;  2HWC 4;  1HXS 4;  4Q4V 4;  2R04 4;  1POV 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...