2RM24

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rm2400
1PIV4 3JD74 3JBG4 1VRH4 1VBA4 1RUD4 1AL24 1ASJ4 1AR64 2PLV4 1K5MD 2HWB4 4Q4Y4 1RUI4 2RS14 2RS54 4GB34 1RHI4 1EV14 1AR74 1RMU4 1HRV4 1COV4 1R094 4Q4X4 1EAH4 1Z7S4 1MQTD 1NA1D 1RUF4 2RMU4 1VBD4 1H8TD 4PDWD 2R044 4RHV4 1NCQD 1PO24 2R074 2X5ID 1HRI4 1AR84 3J8F4 2RR14 1RUH4 2RM24 1BEV4 1RUE4 2R064 4Q4W4 1HXS4 1VBC4 2HWC4 1PVC4 1AR94 1POV0 1VBB4 1D4M4 1RUJ4 1R084 1RVF4 1RUC4 1VBE4 2RS34 1OOPD 4Q4V4 1PO14 1RUG4
chains in the Genus database with same CATH superfamily
3AE7A 1RUD4 1AR64 2PLV4 3GQHA 2ACZA 1XHXA 1R094 3ABVA 1Z7S4 2R7FA 2PW9A 2RMU4 1H8TD 1NCQD 3P4SA 1PO24 2R074 1NEKA 2X5ID 1ZOYA 2RR14 3J8F4 2B76A 1HXS4 3AE8A 2WDVA 4YSZA 2PYJA 2WS3A 4Q4V4 1RUI4 3JBG4 1K5MD 2HWB4 2WU2A 4Q4Y4 3SFEA 1RHI4 3GQKA 1YQ4A 4YSYA 1EAH4 2WQYA 1NA1D 1RUF4 3AEBA 4YSXA 4RHV4 4YTNA 3VRBA 3AE4A 3CIRA 4YT0A 1HRI4 2RM24 2R064 1VBC4 2HWC4 1ZP0A 1R084 4KX6A 2WU5A 3FI7A 1XHZA 3P4RA 3P4PA 3P4QA 3VR8A 5C2TA 2WP9A 3AEDA 2H88A 1VRH4 3AEAA 1KFYA 2WDQA 3AE5A 2RS54 1EV14 5C3JA 1HRV4 1RMU4 3AE1A 1COV4 1XI1A 1MQTD 1VBD4 2R044 1YQ3A 1AR84 3SUCA 4YTPA 2PZSA 1RUE4 4Q4W4 4YXDA 1PVC4 3AE6A 1POV0 1VBB4 1D4M4 1RUJ4 1RUC4 1KF6A 1PO14 3AEEA 1PIV4 3JD74 3VR9A 2FBWA 3AEGA 1VBA4 3AEFA 1AL24 1ASJ4 2RS14 4GB34 1AR74 4Q4X4 1L0VA 4PDWD 2EX3A 3AE2A 3SFDA 1RUH4 1BEV4 2PYLA 3VRAA 3AE3A 1AR94 3AE9A 1RVF4 2H89A 4YTMA 3AECA 1VBE4 2RS34 1OOPD 2PY5A 2WDRA 1NENA 1RUG4
chains in the Genus database with same CATH topology
1PIV4 3JD74 3JBG4 1VRH4 1VBA4 1RUD4 1AL24 1ASJ4 1AR64 2PLV4 1K5MD 2HWB4 4Q4Y4 1RUI4 2RS14 2RS54 4GB34 1RHI4 1EV14 1AR74 1RMU4 1HRV4 1COV4 1R094 4Q4X4 1EAH4 1Z7S4 1MQTD 1NA1D 1RUF4 2RMU4 1VBD4 1H8TD 4PDWD 2R044 4RHV4 1NCQD 1PO24 2R074 2X5ID 1HRI4 1AR84 3J8F4 2RR14 1RUH4 2RM24 1BEV4 1RUE4 2R064 4Q4W4 1HXS4 1VBC4 2HWC4 1PVC4 1AR94 1POV0 1VBB4 1D4M4 1RUJ4 1R084 1RVF4 1RUC4 1VBE4 2RS34 1OOPD 4Q4V4 1PO14 1RUG4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIV 4;  3JD7 4;  3JBG 4;  1VRH 4;  1VBA 4;  1RUD 4;  1AL2 4;  1ASJ 4;  1AR6 4;  2PLV 4;  1K5M D;  2HWB 4;  4Q4Y 4;  1RUI 4;  2RS1 4;  2RS5 4;  4GB3 4;  1RHI 4;  1EV1 4;  1AR7 4;  1RMU 4;  1HRV 4;  1COV 4;  1R09 4;  4Q4X 4;  1EAH 4;  1Z7S 4;  1MQT D;  1NA1 D;  1RUF 4;  2RMU 4;  1VBD 4;  1H8T D;  4PDW D;  2R04 4;  4RHV 4;  1NCQ D;  1PO2 4;  2R07 4;  2X5I D;  1HRI 4;  1AR8 4;  3J8F 4;  2RR1 4;  1RUH 4;  2RM2 4;  1BEV 4;  1RUE 4;  2R06 4;  4Q4W 4;  1HXS 4;  1VBC 4;  2HWC 4;  1PVC 4;  1AR9 4;  1POV 0;  1VBB 4;  1D4M 4;  1RUJ 4;  1R08 4;  1RVF 4;  1RUC 4;  1VBE 4;  2RS3 4;  1OOP D;  4Q4V 4;  1PO1 4;  1RUG 4; 
#chains in the Genus database with same CATH topology
 3AE7 A;  1RUD 4;  1AR6 4;  2PLV 4;  3GQH A;  2ACZ A;  1XHX A;  1R09 4;  3ABV A;  1Z7S 4;  2R7F A;  2PW9 A;  2RMU 4;  1H8T D;  1NCQ D;  3P4S A;  1PO2 4;  2R07 4;  1NEK A;  2X5I D;  1ZOY A;  2RR1 4;  3J8F 4;  2B76 A;  1HXS 4;  3AE8 A;  2WDV A;  4YSZ A;  2PYJ A;  2WS3 A;  4Q4V 4;  1RUI 4;  3JBG 4;  1K5M D;  2HWB 4;  2WU2 A;  4Q4Y 4;  3SFE A;  1RHI 4;  3GQK A;  1YQ4 A;  4YSY A;  1EAH 4;  2WQY A;  1NA1 D;  1RUF 4;  3AEB A;  4YSX A;  4RHV 4;  4YTN A;  3VRB A;  3AE4 A;  3CIR A;  4YT0 A;  1HRI 4;  2RM2 4;  2R06 4;  1VBC 4;  2HWC 4;  1ZP0 A;  1R08 4;  4KX6 A;  2WU5 A;  3FI7 A;  1XHZ A;  3P4R A;  3P4P A;  3P4Q A;  3VR8 A;  5C2T A;  2WP9 A;  3AED A;  2H88 A;  1VRH 4;  3AEA A;  1KFY A;  2WDQ A;  3AE5 A;  2RS5 4;  1EV1 4;  5C3J A;  1HRV 4;  1RMU 4;  3AE1 A;  1COV 4;  1XI1 A;  1MQT D;  1VBD 4;  2R04 4;  1YQ3 A;  1AR8 4;  3SUC A;  4YTP A;  2PZS A;  1RUE 4;  4Q4W 4;  4YXD A;  1PVC 4;  3AE6 A;  1POV 0;  1VBB 4;  1D4M 4;  1RUJ 4;  1RUC 4;  1KF6 A;  1PO1 4;  3AEE A;  1PIV 4;  3JD7 4;  3VR9 A;  2FBW A;  3AEG A;  1VBA 4;  3AEF A;  1AL2 4;  1ASJ 4;  2RS1 4;  4GB3 4;  1AR7 4;  4Q4X 4;  1L0V A;  4PDW D;  2EX3 A;  3AE2 A;  3SFD A;  1RUH 4;  1BEV 4;  2PYL A;  3VRA A;  3AE3 A;  1AR9 4;  3AE9 A;  1RVF 4;  2H89 A;  4YTM A;  3AEC A;  1VBE 4;  2RS3 4;  1OOP D;  2PY5 A;  2WDR A;  1NEN A;  1RUG 4; 
#chains in the Genus database with same CATH homology
 1PIV 4;  3JD7 4;  3JBG 4;  1VRH 4;  1VBA 4;  1RUD 4;  1AL2 4;  1ASJ 4;  1AR6 4;  2PLV 4;  1K5M D;  2HWB 4;  4Q4Y 4;  1RUI 4;  2RS1 4;  2RS5 4;  4GB3 4;  1RHI 4;  1EV1 4;  1AR7 4;  1RMU 4;  1HRV 4;  1COV 4;  1R09 4;  4Q4X 4;  1EAH 4;  1Z7S 4;  1MQT D;  1NA1 D;  1RUF 4;  2RMU 4;  1VBD 4;  1H8T D;  4PDW D;  2R04 4;  4RHV 4;  1NCQ D;  1PO2 4;  2R07 4;  2X5I D;  1HRI 4;  1AR8 4;  3J8F 4;  2RR1 4;  1RUH 4;  2RM2 4;  1BEV 4;  1RUE 4;  2R06 4;  4Q4W 4;  1HXS 4;  1VBC 4;  2HWC 4;  1PVC 4;  1AR9 4;  1POV 0;  1VBB 4;  1D4M 4;  1RUJ 4;  1R08 4;  1RVF 4;  1RUC 4;  1VBE 4;  2RS3 4;  1OOP D;  4Q4V 4;  1PO1 4;  1RUG 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...