2RM24

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rm2400
1PVC4 4Q4X4 1VBC4 1EAH4 1RVF4 1VRH4 1Z7S4 2RMU4 2RM24 2R044 1R084 1AR74 1PO24 2HWC4 1BEV4 1OOPD 1R094 1VBD4 4PDWD 1AR84 4Q4Y4 1H8TD 1PO14 1RUE4 1MQTD 1PIV4 2RS54 2PLV4 1K5MD 1VBA4 1EV14 1RHI4 3JD74 1RUC4 1HRI4 1NA1D 3JBG4 4RHV4 1ASJ4 2RS34 1RMU4 1D4M4 1AL24 1HXS4 3J8F4 1VBB4 1AR94 1VBE4 1RUI4 1HRV4 1RUJ4 2R074 1RUG4 1COV4 2R064 1RUD4 1RUF4 2HWB4 2RR14 4Q4W4 1POV0 1RUH4 2RS14 2X5ID 1AR64 4GB34 1NCQD 4Q4V4
chains in the Genus database with same CATH superfamily
1VRH4 3AE7A 4YSYA 3VRBA 2RM24 1BEV4 1R094 2PY5A 1AR84 1H8TD 1PIV4 1YQ3A 1NEKA 1RHI4 2R7FA 4KX6A 2WDQA 1ASJ4 3AEGA 1RMU4 2ACZA 3J8F4 3AE2A 3GQKA 1HRV4 2R074 1RUF4 1POV0 3CIRA 3AE4A 3SFDA 4Q4X4 1RVF4 2EX3A 4YTPA 1XHXA 1NENA 3AEAA 2HWC4 2PW9A 2B76A 3SFEA 3VRAA 3AEEA 1MQTD 2PLV4 1K5MD 1VBA4 1EV14 3JD74 1NA1D 1D4M4 1AL24 2WU2A 2H89A 1VBB4 2WS3A 1XI1A 2WP9A 2WU5A 4Q4W4 1RUD4 2FBWA 3ABVA 3GQHA 3FI7A 3AE1A 4GB34 1NCQD 2WDRA 1VBC4 1EAH4 1Z7S4 2RMU4 1KF6A 1R084 3AEDA 1PO24 4PDWD 4YSXA 3AEFA 3AECA 2H88A 1XHZA 2RS54 3AE9A 1L0VA 1HRI4 4YTMA 2PYLA 2RS34 1ZOYA 1YQ4A 1VBE4 2PZSA 1RUI4 1RUJ4 4YT0A 3P4RA 1RUG4 3SUCA 2X5ID 1AR64 4Q4V4 1PVC4 2PYJA 4YXDA 3AEBA 2R044 1AR74 1OOPD 1VBD4 5C3JA 3P4QA 1PO14 1RUE4 2WQYA 1RUC4 3VR8A 3AE3A 3AE8A 3JBG4 4RHV4 1HXS4 2WDVA 1ZP0A 4YTNA 3AE6A 1AR94 4YSZA 3P4PA 5C2TA 2R064 1COV4 2HWB4 2RR14 1RUH4 2RS14 1KFYA 3AE5A 3VR9A 4Q4Y4 3P4SA
chains in the Genus database with same CATH topology
1PVC4 4Q4X4 1VBC4 1EAH4 1RVF4 1VRH4 1Z7S4 2RMU4 2RM24 2R044 1R084 1AR74 1PO24 2HWC4 1BEV4 1OOPD 1R094 1VBD4 4PDWD 1AR84 4Q4Y4 1H8TD 1PO14 1RUE4 1MQTD 1PIV4 2RS54 2PLV4 1K5MD 1VBA4 1EV14 1RHI4 3JD74 1RUC4 1HRI4 1NA1D 3JBG4 4RHV4 1ASJ4 2RS34 1RMU4 1D4M4 1AL24 1HXS4 3J8F4 1VBB4 1AR94 1VBE4 1RUI4 1HRV4 1RUJ4 2R074 1RUG4 1COV4 2R064 1RUD4 1RUF4 2HWB4 2RR14 4Q4W4 1POV0 1RUH4 2RS14 2X5ID 1AR64 4GB34 1NCQD 4Q4V4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVC 4;  4Q4X 4;  1VBC 4;  1EAH 4;  1RVF 4;  1VRH 4;  1Z7S 4;  2RMU 4;  2RM2 4;  2R04 4;  1R08 4;  1AR7 4;  1PO2 4;  2HWC 4;  1BEV 4;  1OOP D;  1R09 4;  1VBD 4;  4PDW D;  1AR8 4;  4Q4Y 4;  1H8T D;  1PO1 4;  1RUE 4;  1MQT D;  1PIV 4;  2RS5 4;  2PLV 4;  1K5M D;  1VBA 4;  1EV1 4;  1RHI 4;  3JD7 4;  1RUC 4;  1HRI 4;  1NA1 D;  3JBG 4;  4RHV 4;  1ASJ 4;  2RS3 4;  1RMU 4;  1D4M 4;  1AL2 4;  1HXS 4;  3J8F 4;  1VBB 4;  1AR9 4;  1VBE 4;  1RUI 4;  1HRV 4;  1RUJ 4;  2R07 4;  1RUG 4;  1COV 4;  2R06 4;  1RUD 4;  1RUF 4;  2HWB 4;  2RR1 4;  4Q4W 4;  1POV 0;  1RUH 4;  2RS1 4;  2X5I D;  1AR6 4;  4GB3 4;  1NCQ D;  4Q4V 4; 
#chains in the Genus database with same CATH topology
 1VRH 4;  3AE7 A;  4YSY A;  3VRB A;  2RM2 4;  1BEV 4;  1R09 4;  2PY5 A;  1AR8 4;  1H8T D;  1PIV 4;  1YQ3 A;  1NEK A;  1RHI 4;  2R7F A;  4KX6 A;  2WDQ A;  1ASJ 4;  3AEG A;  1RMU 4;  2ACZ A;  3J8F 4;  3AE2 A;  3GQK A;  1HRV 4;  2R07 4;  1RUF 4;  1POV 0;  3CIR A;  3AE4 A;  3SFD A;  4Q4X 4;  1RVF 4;  2EX3 A;  4YTP A;  1XHX A;  1NEN A;  3AEA A;  2HWC 4;  2PW9 A;  2B76 A;  3SFE A;  3VRA A;  3AEE A;  1MQT D;  2PLV 4;  1K5M D;  1VBA 4;  1EV1 4;  3JD7 4;  1NA1 D;  1D4M 4;  1AL2 4;  2WU2 A;  2H89 A;  1VBB 4;  2WS3 A;  1XI1 A;  2WP9 A;  2WU5 A;  4Q4W 4;  1RUD 4;  2FBW A;  3ABV A;  3GQH A;  3FI7 A;  3AE1 A;  4GB3 4;  1NCQ D;  2WDR A;  1VBC 4;  1EAH 4;  1Z7S 4;  2RMU 4;  1KF6 A;  1R08 4;  3AED A;  1PO2 4;  4PDW D;  4YSX A;  3AEF A;  3AEC A;  2H88 A;  1XHZ A;  2RS5 4;  3AE9 A;  1L0V A;  1HRI 4;  4YTM A;  2PYL A;  2RS3 4;  1ZOY A;  1YQ4 A;  1VBE 4;  2PZS A;  1RUI 4;  1RUJ 4;  4YT0 A;  3P4R A;  1RUG 4;  3SUC A;  2X5I D;  1AR6 4;  4Q4V 4;  1PVC 4;  2PYJ A;  4YXD A;  3AEB A;  2R04 4;  1AR7 4;  1OOP D;  1VBD 4;  5C3J A;  3P4Q A;  1PO1 4;  1RUE 4;  2WQY A;  1RUC 4;  3VR8 A;  3AE3 A;  3AE8 A;  3JBG 4;  4RHV 4;  1HXS 4;  2WDV A;  1ZP0 A;  4YTN A;  3AE6 A;  1AR9 4;  4YSZ A;  3P4P A;  5C2T A;  2R06 4;  1COV 4;  2HWB 4;  2RR1 4;  1RUH 4;  2RS1 4;  1KFY A;  3AE5 A;  3VR9 A;  4Q4Y 4;  3P4S A; 
#chains in the Genus database with same CATH homology
 1PVC 4;  4Q4X 4;  1VBC 4;  1EAH 4;  1RVF 4;  1VRH 4;  1Z7S 4;  2RMU 4;  2RM2 4;  2R04 4;  1R08 4;  1AR7 4;  1PO2 4;  2HWC 4;  1BEV 4;  1OOP D;  1R09 4;  1VBD 4;  4PDW D;  1AR8 4;  4Q4Y 4;  1H8T D;  1PO1 4;  1RUE 4;  1MQT D;  1PIV 4;  2RS5 4;  2PLV 4;  1K5M D;  1VBA 4;  1EV1 4;  1RHI 4;  3JD7 4;  1RUC 4;  1HRI 4;  1NA1 D;  3JBG 4;  4RHV 4;  1ASJ 4;  2RS3 4;  1RMU 4;  1D4M 4;  1AL2 4;  1HXS 4;  3J8F 4;  1VBB 4;  1AR9 4;  1VBE 4;  1RUI 4;  1HRV 4;  1RUJ 4;  2R07 4;  1RUG 4;  1COV 4;  2R06 4;  1RUD 4;  1RUF 4;  2HWB 4;  2RR1 4;  4Q4W 4;  1POV 0;  1RUH 4;  2RS1 4;  2X5I D;  1AR6 4;  4GB3 4;  1NCQ D;  4Q4V 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...