2RM24

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rm2400
1AR74 1PO14 1AR64 1HRI4 1H8TD 1VRH4 1ASJ4 1PO24 1RUE4 1RUF4 1RVF4 2X5ID 1HXS4 4Q4V4 1RUI4 1BEV4 2HWC4 2RS54 1HRV4 1VBD4 1PVC4 1D4M4 1MQTD 2RM24 1RUH4 1AR94 2RR14 1POV0 1COV4 1R084 1R094 2R044 1EV14 1VBE4 1VBA4 2RMU4 1RUC4 3JBG4 1RUG4 4Q4X4 2RS14 4RHV4 1RHI4 1VBC4 2R064 4Q4Y4 1RUD4 2HWB4 2R074 2RS34 1VBB4 4PDWD 3JD74 1K5MD 1AR84 2PLV4 1RMU4 1NA1D 1NCQD 3J8F4 4GB34 4Q4W4 1EAH4 1RUJ4 1PIV4 1Z7S4 1OOPD 1AL24
chains in the Genus database with same CATH superfamily
1AR64 2PW9A 2EX3A 2H89A 3AEBA 1ASJ4 1XI1A 1XHXA 2X5ID 1HXS4 4Q4V4 1RUI4 3AE6A 1KF6A 1HRV4 2R7FA 2PYLA 3P4QA 1MQTD 2RM24 2WP9A 1R084 1R094 4YXDA 1VBE4 2WS3A 3VR9A 4Q4X4 2RS14 2WU2A 3SUCA 1RHI4 1VBC4 3GQHA 2WQYA 3SFDA 1VBB4 1K5MD 1RMU4 3J8F4 4Q4W4 1EAH4 1PIV4 1Z7S4 1OOPD 3AE8A 1YQ4A 1AR74 1PO14 4KX6A 1RUF4 2WDQA 3AEEA 3AEDA 3AE5A 1VBD4 2B76A 2WU5A 4YTPA 4YSXA 5C2TA 1ZOYA 4YTMA 3GQKA 3JBG4 4RHV4 5C3JA 4Q4Y4 3CIRA 3AE2A 1L0VA 3AEFA 1AR84 1NENA 3ABVA 4YSYA 1AL24 3AE7A 3P4PA 1HRI4 1H8TD 1VRH4 3P4RA 1RUE4 3FI7A 1BEV4 1PVC4 3AE4A 3AEAA 1XHZA 1RUH4 2RR14 3VRBA 2R044 3VRAA 1EV14 2RMU4 3AE1A 3P4SA 2R064 2HWB4 3AECA 2RS34 2PZSA 2WDVA 3VR8A 3SFEA 2ACZA 2PY5A 1ZP0A 1PO24 1RVF4 2H88A 4YT0A 4YTNA 2HWC4 2RS54 1KFYA 1D4M4 3AE3A 2FBWA 1AR94 1POV0 1COV4 3AEGA 3AE9A 1VBA4 1RUC4 1RUG4 2PYJA 1NEKA 1RUD4 2WDRA 2R074 4PDWD 3JD74 2PLV4 1NA1D 1NCQD 4GB34 1RUJ4 1YQ3A 4YSZA
chains in the Genus database with same CATH topology
1AR74 1PO14 1AR64 1HRI4 1H8TD 1VRH4 1ASJ4 1PO24 1RUE4 1RUF4 1RVF4 2X5ID 1HXS4 4Q4V4 1RUI4 1BEV4 2HWC4 2RS54 1HRV4 1VBD4 1PVC4 1D4M4 1MQTD 2RM24 1RUH4 1AR94 2RR14 1POV0 1COV4 1R084 1R094 2R044 1EV14 1VBE4 1VBA4 2RMU4 1RUC4 3JBG4 1RUG4 4Q4X4 2RS14 4RHV4 1RHI4 1VBC4 2R064 4Q4Y4 1RUD4 2HWB4 2R074 2RS34 1VBB4 4PDWD 3JD74 1K5MD 1AR84 2PLV4 1RMU4 1NA1D 1NCQD 3J8F4 4GB34 4Q4W4 1EAH4 1RUJ4 1PIV4 1Z7S4 1OOPD 1AL24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR7 4;  1PO1 4;  1AR6 4;  1HRI 4;  1H8T D;  1VRH 4;  1ASJ 4;  1PO2 4;  1RUE 4;  1RUF 4;  1RVF 4;  2X5I D;  1HXS 4;  4Q4V 4;  1RUI 4;  1BEV 4;  2HWC 4;  2RS5 4;  1HRV 4;  1VBD 4;  1PVC 4;  1D4M 4;  1MQT D;  2RM2 4;  1RUH 4;  1AR9 4;  2RR1 4;  1POV 0;  1COV 4;  1R08 4;  1R09 4;  2R04 4;  1EV1 4;  1VBE 4;  1VBA 4;  2RMU 4;  1RUC 4;  3JBG 4;  1RUG 4;  4Q4X 4;  2RS1 4;  4RHV 4;  1RHI 4;  1VBC 4;  2R06 4;  4Q4Y 4;  1RUD 4;  2HWB 4;  2R07 4;  2RS3 4;  1VBB 4;  4PDW D;  3JD7 4;  1K5M D;  1AR8 4;  2PLV 4;  1RMU 4;  1NA1 D;  1NCQ D;  3J8F 4;  4GB3 4;  4Q4W 4;  1EAH 4;  1RUJ 4;  1PIV 4;  1Z7S 4;  1OOP D;  1AL2 4; 
#chains in the Genus database with same CATH topology
 1AR6 4;  2PW9 A;  2EX3 A;  2H89 A;  3AEB A;  1ASJ 4;  1XI1 A;  1XHX A;  2X5I D;  1HXS 4;  4Q4V 4;  1RUI 4;  3AE6 A;  1KF6 A;  1HRV 4;  2R7F A;  2PYL A;  3P4Q A;  1MQT D;  2RM2 4;  2WP9 A;  1R08 4;  1R09 4;  4YXD A;  1VBE 4;  2WS3 A;  3VR9 A;  4Q4X 4;  2RS1 4;  2WU2 A;  3SUC A;  1RHI 4;  1VBC 4;  3GQH A;  2WQY A;  3SFD A;  1VBB 4;  1K5M D;  1RMU 4;  3J8F 4;  4Q4W 4;  1EAH 4;  1PIV 4;  1Z7S 4;  1OOP D;  3AE8 A;  1YQ4 A;  1AR7 4;  1PO1 4;  4KX6 A;  1RUF 4;  2WDQ A;  3AEE A;  3AED A;  3AE5 A;  1VBD 4;  2B76 A;  2WU5 A;  4YTP A;  4YSX A;  5C2T A;  1ZOY A;  4YTM A;  3GQK A;  3JBG 4;  4RHV 4;  5C3J A;  4Q4Y 4;  3CIR A;  3AE2 A;  1L0V A;  3AEF A;  1AR8 4;  1NEN A;  3ABV A;  4YSY A;  1AL2 4;  3AE7 A;  3P4P A;  1HRI 4;  1H8T D;  1VRH 4;  3P4R A;  1RUE 4;  3FI7 A;  1BEV 4;  1PVC 4;  3AE4 A;  3AEA A;  1XHZ A;  1RUH 4;  2RR1 4;  3VRB A;  2R04 4;  3VRA A;  1EV1 4;  2RMU 4;  3AE1 A;  3P4S A;  2R06 4;  2HWB 4;  3AEC A;  2RS3 4;  2PZS A;  2WDV A;  3VR8 A;  3SFE A;  2ACZ A;  2PY5 A;  1ZP0 A;  1PO2 4;  1RVF 4;  2H88 A;  4YT0 A;  4YTN A;  2HWC 4;  2RS5 4;  1KFY A;  1D4M 4;  3AE3 A;  2FBW A;  1AR9 4;  1POV 0;  1COV 4;  3AEG A;  3AE9 A;  1VBA 4;  1RUC 4;  1RUG 4;  2PYJ A;  1NEK A;  1RUD 4;  2WDR A;  2R07 4;  4PDW D;  3JD7 4;  2PLV 4;  1NA1 D;  1NCQ D;  4GB3 4;  1RUJ 4;  1YQ3 A;  4YSZ A; 
#chains in the Genus database with same CATH homology
 1AR7 4;  1PO1 4;  1AR6 4;  1HRI 4;  1H8T D;  1VRH 4;  1ASJ 4;  1PO2 4;  1RUE 4;  1RUF 4;  1RVF 4;  2X5I D;  1HXS 4;  4Q4V 4;  1RUI 4;  1BEV 4;  2HWC 4;  2RS5 4;  1HRV 4;  1VBD 4;  1PVC 4;  1D4M 4;  1MQT D;  2RM2 4;  1RUH 4;  1AR9 4;  2RR1 4;  1POV 0;  1COV 4;  1R08 4;  1R09 4;  2R04 4;  1EV1 4;  1VBE 4;  1VBA 4;  2RMU 4;  1RUC 4;  3JBG 4;  1RUG 4;  4Q4X 4;  2RS1 4;  4RHV 4;  1RHI 4;  1VBC 4;  2R06 4;  4Q4Y 4;  1RUD 4;  2HWB 4;  2R07 4;  2RS3 4;  1VBB 4;  4PDW D;  3JD7 4;  1K5M D;  1AR8 4;  2PLV 4;  1RMU 4;  1NA1 D;  1NCQ D;  3J8F 4;  4GB3 4;  4Q4W 4;  1EAH 4;  1RUJ 4;  1PIV 4;  1Z7S 4;  1OOP D;  1AL2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...