1AR84

P1/mahoney poliovirus, mutant p1095s
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
60
Chain Sequence
b'GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 5
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar8400
1HRV4 2RR14 1MQTD 1NCQD 4Q4Y4 1RMU4 1RUJ4 1HRI4 4Q4V4 1COV4 2X5ID 1PIV4 1BEV4 3JD74 1AR84 1PO14 4Q4X4 4PDWD 4Q4W4 2HWC4 1AR64 1VBE4 2RS34 2RS54 1RUI4 3J8F4 1RUC4 1R094 1K5MD 3JBG4 4RHV4 1PVC4 1EAH4 1OOPD 1AR94 1D4M4 2R064 1VBD4 1HXS4 2R044 2RMU4 1RUD4 1AR74 2RS14 1H8TD 2PLV4 2HWB4 1ASJ4 1NA1D 1RHI4 1RUG4 1RUE4 1EV14 1RVF4 1Z7S4 4GB34 1R084 1RUH4 1VBC4 1AL24 1POV0 1RUF4 1VBB4 2RM24 1VBA4 1PO24 2R074 1VRH4
chains in the Genus database with same CATH superfamily
1HRV4 4YTNA 4Q4Y4 2WDVA 2R7FA 2WDRA 1ZOYA 2X5ID 1PIV4 3AEFA 3JD74 1NEKA 3AE8A 2HWC4 1AR64 3AE5A 2RS54 1RUI4 1RUC4 1PVC4 3AECA 1AR94 2R064 4YSXA 1HXS4 1H8TD 3P4RA 3VR9A 1Z7S4 2WS3A 4GB34 1R084 3SFDA 1VBC4 5C3JA 1VRH4 2RR14 3CIRA 1RMU4 3P4PA 1HRI4 3AE1A 1KFYA 1XHXA 1ZP0A 1AR84 1PO14 3SFEA 1VBE4 3J8F4 1XI1A 2WDQA 4RHV4 1NENA 1VBD4 2ACZA 2R044 2HWB4 1RUG4 2FBWA 1EV14 2H89A 1RUH4 4KX6A 1AL24 2WU5A 1RUF4 2WU2A 3VRBA 4YTPA 1VBA4 1PO24 3AE6A 2R074 2PLV4 1KF6A 1MQTD 2PZSA 2WP9A 4Q4V4 3AEAA 3GQKA 3GQHA 2PY5A 1R094 3JBG4 1OOPD 1L0VA 1D4M4 3AE2A 3AE9A 4YSZA 1ASJ4 1NA1D 1RHI4 3AE4A 3AE3A 2PYLA 2RM24 3AEGA 2PW9A 2PYJA 2RMU4 1NCQD 3ABVA 2B76A 4YT0A 1RUJ4 3AE7A 1COV4 3P4QA 1BEV4 1YQ3A 4Q4X4 4PDWD 4Q4W4 2RS34 3FI7A 1YQ4A 2EX3A 3AEEA 1K5MD 3AEDA 3VR8A 1EAH4 2WQYA 1RUD4 1AR74 4YXDA 4YSYA 3AEBA 3SUCA 5C2TA 1RVF4 1XHZA 1RUE4 3VRAA 4YTMA 1POV0 1VBB4 2RS14 3P4SA 2H88A
chains in the Genus database with same CATH topology
1HRV4 2RR14 1MQTD 1NCQD 4Q4Y4 1RMU4 1RUJ4 1HRI4 4Q4V4 1COV4 2X5ID 1PIV4 1BEV4 3JD74 1AR84 1PO14 4Q4X4 4PDWD 4Q4W4 2HWC4 1AR64 1VBE4 2RS34 2RS54 1RUI4 3J8F4 1RUC4 1R094 1K5MD 3JBG4 4RHV4 1PVC4 1EAH4 1OOPD 1AR94 1D4M4 2R064 1VBD4 1HXS4 2R044 2RMU4 1RUD4 1AR74 2RS14 1H8TD 2PLV4 2HWB4 1ASJ4 1NA1D 1RHI4 1RUG4 1RUE4 1EV14 1RVF4 1Z7S4 4GB34 1R084 1RUH4 1VBC4 1AL24 1POV0 1RUF4 1VBB4 2RM24 1VBA4 1PO24 2R074 1VRH4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRV 4;  2RR1 4;  1MQT D;  1NCQ D;  4Q4Y 4;  1RMU 4;  1RUJ 4;  1HRI 4;  4Q4V 4;  1COV 4;  2X5I D;  1PIV 4;  1BEV 4;  3JD7 4;  1AR8 4;  1PO1 4;  4Q4X 4;  4PDW D;  4Q4W 4;  2HWC 4;  1AR6 4;  1VBE 4;  2RS3 4;  2RS5 4;  1RUI 4;  3J8F 4;  1RUC 4;  1R09 4;  1K5M D;  3JBG 4;  4RHV 4;  1PVC 4;  1EAH 4;  1OOP D;  1AR9 4;  1D4M 4;  2R06 4;  1VBD 4;  1HXS 4;  2R04 4;  2RMU 4;  1RUD 4;  1AR7 4;  2RS1 4;  1H8T D;  2PLV 4;  2HWB 4;  1ASJ 4;  1NA1 D;  1RHI 4;  1RUG 4;  1RUE 4;  1EV1 4;  1RVF 4;  1Z7S 4;  4GB3 4;  1R08 4;  1RUH 4;  1VBC 4;  1AL2 4;  1POV 0;  1RUF 4;  1VBB 4;  2RM2 4;  1VBA 4;  1PO2 4;  2R07 4;  1VRH 4; 
#chains in the Genus database with same CATH topology
 1HRV 4;  4YTN A;  4Q4Y 4;  2WDV A;  2R7F A;  2WDR A;  1ZOY A;  2X5I D;  1PIV 4;  3AEF A;  3JD7 4;  1NEK A;  3AE8 A;  2HWC 4;  1AR6 4;  3AE5 A;  2RS5 4;  1RUI 4;  1RUC 4;  1PVC 4;  3AEC A;  1AR9 4;  2R06 4;  4YSX A;  1HXS 4;  1H8T D;  3P4R A;  3VR9 A;  1Z7S 4;  2WS3 A;  4GB3 4;  1R08 4;  3SFD A;  1VBC 4;  5C3J A;  1VRH 4;  2RR1 4;  3CIR A;  1RMU 4;  3P4P A;  1HRI 4;  3AE1 A;  1KFY A;  1XHX A;  1ZP0 A;  1AR8 4;  1PO1 4;  3SFE A;  1VBE 4;  3J8F 4;  1XI1 A;  2WDQ A;  4RHV 4;  1NEN A;  1VBD 4;  2ACZ A;  2R04 4;  2HWB 4;  1RUG 4;  2FBW A;  1EV1 4;  2H89 A;  1RUH 4;  4KX6 A;  1AL2 4;  2WU5 A;  1RUF 4;  2WU2 A;  3VRB A;  4YTP A;  1VBA 4;  1PO2 4;  3AE6 A;  2R07 4;  2PLV 4;  1KF6 A;  1MQT D;  2PZS A;  2WP9 A;  4Q4V 4;  3AEA A;  3GQK A;  3GQH A;  2PY5 A;  1R09 4;  3JBG 4;  1OOP D;  1L0V A;  1D4M 4;  3AE2 A;  3AE9 A;  4YSZ A;  1ASJ 4;  1NA1 D;  1RHI 4;  3AE4 A;  3AE3 A;  2PYL A;  2RM2 4;  3AEG A;  2PW9 A;  2PYJ A;  2RMU 4;  1NCQ D;  3ABV A;  2B76 A;  4YT0 A;  1RUJ 4;  3AE7 A;  1COV 4;  3P4Q A;  1BEV 4;  1YQ3 A;  4Q4X 4;  4PDW D;  4Q4W 4;  2RS3 4;  3FI7 A;  1YQ4 A;  2EX3 A;  3AEE A;  1K5M D;  3AED A;  3VR8 A;  1EAH 4;  2WQY A;  1RUD 4;  1AR7 4;  4YXD A;  4YSY A;  3AEB A;  3SUC A;  5C2T A;  1RVF 4;  1XHZ A;  1RUE 4;  3VRA A;  4YTM A;  1POV 0;  1VBB 4;  2RS1 4;  3P4S A;  2H88 A; 
#chains in the Genus database with same CATH homology
 1HRV 4;  2RR1 4;  1MQT D;  1NCQ D;  4Q4Y 4;  1RMU 4;  1RUJ 4;  1HRI 4;  4Q4V 4;  1COV 4;  2X5I D;  1PIV 4;  1BEV 4;  3JD7 4;  1AR8 4;  1PO1 4;  4Q4X 4;  4PDW D;  4Q4W 4;  2HWC 4;  1AR6 4;  1VBE 4;  2RS3 4;  2RS5 4;  1RUI 4;  3J8F 4;  1RUC 4;  1R09 4;  1K5M D;  3JBG 4;  4RHV 4;  1PVC 4;  1EAH 4;  1OOP D;  1AR9 4;  1D4M 4;  2R06 4;  1VBD 4;  1HXS 4;  2R04 4;  2RMU 4;  1RUD 4;  1AR7 4;  2RS1 4;  1H8T D;  2PLV 4;  2HWB 4;  1ASJ 4;  1NA1 D;  1RHI 4;  1RUG 4;  1RUE 4;  1EV1 4;  1RVF 4;  1Z7S 4;  4GB3 4;  1R08 4;  1RUH 4;  1VBC 4;  1AL2 4;  1POV 0;  1RUF 4;  1VBB 4;  2RM2 4;  1VBA 4;  1PO2 4;  2R07 4;  1VRH 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...