4Q4V4

Crystal structure of coxsackievirus a24v
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
57
Chain Sequence
GAQVSSQKVGATVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
total genus 2
structure length 57
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4v400
1HRI4 1RUH4 1RVF4 1EAH4 1AL24 1MQTD 1D4M4 2RR14 3JD74 4Q4Y4 1COV4 1NA1D 1RUJ4 1RMU4 1RUC4 2R064 1AR84 1RUE4 2PLV4 1OOPD 1RUF4 1VBB4 4Q4X4 1ASJ4 3J8F4 2RS34 1RHI4 1R084 1HRV4 1HXS4 2RM24 1VBC4 2R044 2RMU4 1RUD4 2HWB4 4PDWD 2R074 2RS54 4GB34 1POV0 2HWC4 1VBE4 4RHV4 1RUI4 4Q4W4 1AR74 1RUG4 1PO24 1AR64 1PO14 1BEV4 1VBA4 1AR94 2RS14 1PVC4 1R094 3JBG4 1EV14 4Q4V4 1VBD4 1VRH4 1PIV4 1H8TD 1K5MD 2X5ID 1Z7S4 1NCQD
chains in the Genus database with same CATH superfamily
1HRI4 1EAH4 3P4RA 3VRBA 2PLV4 1RUE4 2EX3A 1OOPD 1RUF4 3VR8A 1RHI4 1VBC4 2R044 3CIRA 1RUD4 2PYJA 2WP9A 1POV0 3AE1A 1VBE4 3AEGA 3AE6A 1NEKA 4Q4W4 3VR9A 3VRAA 2B76A 3JBG4 2RS14 4YXDA 4Q4V4 1VRH4 1K5MD 3AE4A 3AE9A 4GB34 4YTNA 1NCQD 1RUH4 1AL24 1YQ3A 1COV4 1NA1D 1KF6A 2FBWA 1AR84 4Q4X4 3AECA 2PW9A 3AEEA 2RS54 3SUCA 3ABVA 2WDQA 1XI1A 1ZP0A 2H88A 3AE2A 1RUG4 1AR64 3SFDA 1AR94 1PVC4 2WQYA 3AE3A 4YSYA 1Z7S4 1YQ4A 2RR14 3AEFA 1MQTD 3AE7A 4YT0A 1RMU4 3SFEA 2WS3A 2PY5A 1VBB4 1ASJ4 3GQHA 2RS34 3J8F4 1HRV4 2WU5A 1HXS4 1XHXA 2WDRA 3AEBA 1KFYA 2R7FA 2PZSA 1NENA 1RUI4 2WU2A 3P4QA 1AR74 3P4PA 1VBA4 1EV14 4KX6A 4YSXA 4YTPA 1D4M4 2X5ID 3FI7A 5C3JA 3GQKA 1RVF4 2PYLA 3JD74 4Q4Y4 1RUJ4 2WDVA 1RUC4 2R064 3AE8A 3AE5A 1L0VA 1R084 2ACZA 3P4SA 2RM24 2RMU4 4PDWD 2HWB4 2R074 5C2TA 2HWC4 3AEAA 1XHZA 1ZOYA 4RHV4 4YTMA 2H89A 1PO24 1PO14 1BEV4 1R094 1VBD4 1PIV4 1H8TD 4YSZA 3AEDA
chains in the Genus database with same CATH topology
1HRI4 1RUH4 1RVF4 1EAH4 1AL24 1MQTD 1D4M4 2RR14 3JD74 4Q4Y4 1COV4 1NA1D 1RUJ4 1RMU4 1RUC4 2R064 1AR84 1RUE4 2PLV4 1OOPD 1RUF4 1VBB4 4Q4X4 1ASJ4 3J8F4 2RS34 1RHI4 1R084 1HRV4 1HXS4 2RM24 1VBC4 2R044 2RMU4 1RUD4 2HWB4 4PDWD 2R074 2RS54 4GB34 1POV0 2HWC4 1VBE4 4RHV4 1RUI4 4Q4W4 1AR74 1RUG4 1PO24 1AR64 1PO14 1BEV4 1VBA4 1AR94 2RS14 1PVC4 1R094 3JBG4 1EV14 4Q4V4 1VBD4 1VRH4 1PIV4 1H8TD 1K5MD 2X5ID 1Z7S4 1NCQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRI 4;  1RUH 4;  1RVF 4;  1EAH 4;  1AL2 4;  1MQT D;  1D4M 4;  2RR1 4;  3JD7 4;  4Q4Y 4;  1COV 4;  1NA1 D;  1RUJ 4;  1RMU 4;  1RUC 4;  2R06 4;  1AR8 4;  1RUE 4;  2PLV 4;  1OOP D;  1RUF 4;  1VBB 4;  4Q4X 4;  1ASJ 4;  3J8F 4;  2RS3 4;  1RHI 4;  1R08 4;  1HRV 4;  1HXS 4;  2RM2 4;  1VBC 4;  2R04 4;  2RMU 4;  1RUD 4;  2HWB 4;  4PDW D;  2R07 4;  2RS5 4;  4GB3 4;  1POV 0;  2HWC 4;  1VBE 4;  4RHV 4;  1RUI 4;  4Q4W 4;  1AR7 4;  1RUG 4;  1PO2 4;  1AR6 4;  1PO1 4;  1BEV 4;  1VBA 4;  1AR9 4;  2RS1 4;  1PVC 4;  1R09 4;  3JBG 4;  1EV1 4;  4Q4V 4;  1VBD 4;  1VRH 4;  1PIV 4;  1H8T D;  1K5M D;  2X5I D;  1Z7S 4;  1NCQ D; 
#chains in the Genus database with same CATH topology
 1HRI 4;  1EAH 4;  3P4R A;  3VRB A;  2PLV 4;  1RUE 4;  2EX3 A;  1OOP D;  1RUF 4;  3VR8 A;  1RHI 4;  1VBC 4;  2R04 4;  3CIR A;  1RUD 4;  2PYJ A;  2WP9 A;  1POV 0;  3AE1 A;  1VBE 4;  3AEG A;  3AE6 A;  1NEK A;  4Q4W 4;  3VR9 A;  3VRA A;  2B76 A;  3JBG 4;  2RS1 4;  4YXD A;  4Q4V 4;  1VRH 4;  1K5M D;  3AE4 A;  3AE9 A;  4GB3 4;  4YTN A;  1NCQ D;  1RUH 4;  1AL2 4;  1YQ3 A;  1COV 4;  1NA1 D;  1KF6 A;  2FBW A;  1AR8 4;  4Q4X 4;  3AEC A;  2PW9 A;  3AEE A;  2RS5 4;  3SUC A;  3ABV A;  2WDQ A;  1XI1 A;  1ZP0 A;  2H88 A;  3AE2 A;  1RUG 4;  1AR6 4;  3SFD A;  1AR9 4;  1PVC 4;  2WQY A;  3AE3 A;  4YSY A;  1Z7S 4;  1YQ4 A;  2RR1 4;  3AEF A;  1MQT D;  3AE7 A;  4YT0 A;  1RMU 4;  3SFE A;  2WS3 A;  2PY5 A;  1VBB 4;  1ASJ 4;  3GQH A;  2RS3 4;  3J8F 4;  1HRV 4;  2WU5 A;  1HXS 4;  1XHX A;  2WDR A;  3AEB A;  1KFY A;  2R7F A;  2PZS A;  1NEN A;  1RUI 4;  2WU2 A;  3P4Q A;  1AR7 4;  3P4P A;  1VBA 4;  1EV1 4;  4KX6 A;  4YSX A;  4YTP A;  1D4M 4;  2X5I D;  3FI7 A;  5C3J A;  3GQK A;  1RVF 4;  2PYL A;  3JD7 4;  4Q4Y 4;  1RUJ 4;  2WDV A;  1RUC 4;  2R06 4;  3AE8 A;  3AE5 A;  1L0V A;  1R08 4;  2ACZ A;  3P4S A;  2RM2 4;  2RMU 4;  4PDW D;  2HWB 4;  2R07 4;  5C2T A;  2HWC 4;  3AEA A;  1XHZ A;  1ZOY A;  4RHV 4;  4YTM A;  2H89 A;  1PO2 4;  1PO1 4;  1BEV 4;  1R09 4;  1VBD 4;  1PIV 4;  1H8T D;  4YSZ A;  3AED A; 
#chains in the Genus database with same CATH homology
 1HRI 4;  1RUH 4;  1RVF 4;  1EAH 4;  1AL2 4;  1MQT D;  1D4M 4;  2RR1 4;  3JD7 4;  4Q4Y 4;  1COV 4;  1NA1 D;  1RUJ 4;  1RMU 4;  1RUC 4;  2R06 4;  1AR8 4;  1RUE 4;  2PLV 4;  1OOP D;  1RUF 4;  1VBB 4;  4Q4X 4;  1ASJ 4;  3J8F 4;  2RS3 4;  1RHI 4;  1R08 4;  1HRV 4;  1HXS 4;  2RM2 4;  1VBC 4;  2R04 4;  2RMU 4;  1RUD 4;  2HWB 4;  4PDW D;  2R07 4;  2RS5 4;  4GB3 4;  1POV 0;  2HWC 4;  1VBE 4;  4RHV 4;  1RUI 4;  4Q4W 4;  1AR7 4;  1RUG 4;  1PO2 4;  1AR6 4;  1PO1 4;  1BEV 4;  1VBA 4;  1AR9 4;  2RS1 4;  1PVC 4;  1R09 4;  3JBG 4;  1EV1 4;  4Q4V 4;  1VBD 4;  1VRH 4;  1PIV 4;  1H8T D;  1K5M D;  2X5I D;  1Z7S 4;  1NCQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...