4Q4V4

Crystal structure of coxsackievirus a24v
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
57
Chain Sequence
GAQVSSQKVGATVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 2
structure length 57
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4v400
1EAH4 1VBD4 1RUJ4 2RS34 2X5ID 2RS14 2RS54 2PLV4 1HRV4 4Q4X4 4GB34 1AR74 1EV14 1AR84 1PIV4 2HWB4 1RHI4 4PDWD 1POV0 1RMU4 3JD74 2RM24 1VBE4 1AL24 1NCQD 3J8F4 1BEV4 1K5MD 1RUC4 1PO14 4Q4Y4 1H8TD 1VRH4 1ASJ4 1HXS4 1RUF4 2RMU4 1AR94 1NA1D 2R064 1RUD4 2R074 3JBG4 1AR64 1PVC4 1OOPD 1R084 1RUE4 1VBB4 4Q4V4 2HWC4 1RUH4 2R044 4Q4W4 4RHV4 1RUI4 1VBC4 1R094 1D4M4 1COV4 2RR14 1VBA4 1HRI4 1MQTD 1PO24 1Z7S4 1RUG4 1RVF4
chains in the Genus database with same CATH superfamily
2RS34 3FI7A 3SFDA 5C3JA 2RS14 3AE5A 2PLV4 2PYJA 1PIV4 2HWB4 1L0VA 1ZOYA 5C2TA 1PO14 2H88A 2R064 3VRAA 4YTMA 1RUH4 4Q4W4 1NEKA 1COV4 2PW9A 3GQKA 1EAH4 1VBD4 1RUJ4 2WP9A 1ZP0A 4GB34 1XI1A 1AR84 3P4RA 4YT0A 1RHI4 3SFEA 1NENA 1POV0 3JD74 2RM24 1VBE4 2H89A 1K5MD 4YTPA 4Q4Y4 1HXS4 1YQ4A 2PY5A 1KFYA 1PVC4 3AE8A 2HWC4 1VBC4 1HRI4 1PO24 1Z7S4 3J8F4 4YXDA 1YQ3A 2RS54 1EV14 3AEBA 3VRBA 2WDVA 3AEFA 4PDWD 3AEGA 3P4PA 1RMU4 2B76A 1AL24 2WU2A 1NCQD 1BEV4 3AE6A 1H8TD 3AECA 1VRH4 1ASJ4 2WU5A 2EX3A 3GQHA 2RMU4 1RUD4 3AE3A 4YSYA 3ABVA 1AR64 1VBB4 1OOPD 1R084 4Q4V4 2ACZA 2R044 1R094 2R7FA 3AEDA 1MQTD 3AEEA 4YSZA 1RVF4 2X5ID 4KX6A 3AE1A 1HRV4 4Q4X4 1AR74 3P4QA 3VR9A 3AE9A 1XHZA 3SUCA 2FBWA 2WDQA 1RUC4 3AEAA 1KF6A 3AE2A 3P4SA 2PZSA 1RUF4 1AR94 1NA1D 2R074 2WDRA 3AE7A 3JBG4 1RUE4 3AE4A 2WQYA 4RHV4 1XHXA 4YTNA 3VR8A 1RUI4 2WS3A 4YSXA 1D4M4 2RR14 1VBA4 2PYLA 3CIRA 1RUG4
chains in the Genus database with same CATH topology
1EAH4 1VBD4 1RUJ4 2RS34 2X5ID 2RS14 2RS54 2PLV4 1HRV4 4Q4X4 4GB34 1AR74 1EV14 1AR84 1PIV4 2HWB4 1RHI4 4PDWD 1POV0 1RMU4 3JD74 2RM24 1VBE4 1AL24 1NCQD 3J8F4 1BEV4 1K5MD 1RUC4 1PO14 4Q4Y4 1H8TD 1VRH4 1ASJ4 1HXS4 1RUF4 2RMU4 1AR94 1NA1D 2R064 1RUD4 2R074 3JBG4 1AR64 1PVC4 1OOPD 1R084 1RUE4 1VBB4 4Q4V4 2HWC4 1RUH4 2R044 4Q4W4 4RHV4 1RUI4 1VBC4 1R094 1D4M4 1COV4 2RR14 1VBA4 1HRI4 1MQTD 1PO24 1Z7S4 1RUG4 1RVF4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAH 4;  1VBD 4;  1RUJ 4;  2RS3 4;  2X5I D;  2RS1 4;  2RS5 4;  2PLV 4;  1HRV 4;  4Q4X 4;  4GB3 4;  1AR7 4;  1EV1 4;  1AR8 4;  1PIV 4;  2HWB 4;  1RHI 4;  4PDW D;  1POV 0;  1RMU 4;  3JD7 4;  2RM2 4;  1VBE 4;  1AL2 4;  1NCQ D;  3J8F 4;  1BEV 4;  1K5M D;  1RUC 4;  1PO1 4;  4Q4Y 4;  1H8T D;  1VRH 4;  1ASJ 4;  1HXS 4;  1RUF 4;  2RMU 4;  1AR9 4;  1NA1 D;  2R06 4;  1RUD 4;  2R07 4;  3JBG 4;  1AR6 4;  1PVC 4;  1OOP D;  1R08 4;  1RUE 4;  1VBB 4;  4Q4V 4;  2HWC 4;  1RUH 4;  2R04 4;  4Q4W 4;  4RHV 4;  1RUI 4;  1VBC 4;  1R09 4;  1D4M 4;  1COV 4;  2RR1 4;  1VBA 4;  1HRI 4;  1MQT D;  1PO2 4;  1Z7S 4;  1RUG 4;  1RVF 4; 
#chains in the Genus database with same CATH topology
 2RS3 4;  3FI7 A;  3SFD A;  5C3J A;  2RS1 4;  3AE5 A;  2PLV 4;  2PYJ A;  1PIV 4;  2HWB 4;  1L0V A;  1ZOY A;  5C2T A;  1PO1 4;  2H88 A;  2R06 4;  3VRA A;  4YTM A;  1RUH 4;  4Q4W 4;  1NEK A;  1COV 4;  2PW9 A;  3GQK A;  1EAH 4;  1VBD 4;  1RUJ 4;  2WP9 A;  1ZP0 A;  4GB3 4;  1XI1 A;  1AR8 4;  3P4R A;  4YT0 A;  1RHI 4;  3SFE A;  1NEN A;  1POV 0;  3JD7 4;  2RM2 4;  1VBE 4;  2H89 A;  1K5M D;  4YTP A;  4Q4Y 4;  1HXS 4;  1YQ4 A;  2PY5 A;  1KFY A;  1PVC 4;  3AE8 A;  2HWC 4;  1VBC 4;  1HRI 4;  1PO2 4;  1Z7S 4;  3J8F 4;  4YXD A;  1YQ3 A;  2RS5 4;  1EV1 4;  3AEB A;  3VRB A;  2WDV A;  3AEF A;  4PDW D;  3AEG A;  3P4P A;  1RMU 4;  2B76 A;  1AL2 4;  2WU2 A;  1NCQ D;  1BEV 4;  3AE6 A;  1H8T D;  3AEC A;  1VRH 4;  1ASJ 4;  2WU5 A;  2EX3 A;  3GQH A;  2RMU 4;  1RUD 4;  3AE3 A;  4YSY A;  3ABV A;  1AR6 4;  1VBB 4;  1OOP D;  1R08 4;  4Q4V 4;  2ACZ A;  2R04 4;  1R09 4;  2R7F A;  3AED A;  1MQT D;  3AEE A;  4YSZ A;  1RVF 4;  2X5I D;  4KX6 A;  3AE1 A;  1HRV 4;  4Q4X 4;  1AR7 4;  3P4Q A;  3VR9 A;  3AE9 A;  1XHZ A;  3SUC A;  2FBW A;  2WDQ A;  1RUC 4;  3AEA A;  1KF6 A;  3AE2 A;  3P4S A;  2PZS A;  1RUF 4;  1AR9 4;  1NA1 D;  2R07 4;  2WDR A;  3AE7 A;  3JBG 4;  1RUE 4;  3AE4 A;  2WQY A;  4RHV 4;  1XHX A;  4YTN A;  3VR8 A;  1RUI 4;  2WS3 A;  4YSX A;  1D4M 4;  2RR1 4;  1VBA 4;  2PYL A;  3CIR A;  1RUG 4; 
#chains in the Genus database with same CATH homology
 1EAH 4;  1VBD 4;  1RUJ 4;  2RS3 4;  2X5I D;  2RS1 4;  2RS5 4;  2PLV 4;  1HRV 4;  4Q4X 4;  4GB3 4;  1AR7 4;  1EV1 4;  1AR8 4;  1PIV 4;  2HWB 4;  1RHI 4;  4PDW D;  1POV 0;  1RMU 4;  3JD7 4;  2RM2 4;  1VBE 4;  1AL2 4;  1NCQ D;  3J8F 4;  1BEV 4;  1K5M D;  1RUC 4;  1PO1 4;  4Q4Y 4;  1H8T D;  1VRH 4;  1ASJ 4;  1HXS 4;  1RUF 4;  2RMU 4;  1AR9 4;  1NA1 D;  2R06 4;  1RUD 4;  2R07 4;  3JBG 4;  1AR6 4;  1PVC 4;  1OOP D;  1R08 4;  1RUE 4;  1VBB 4;  4Q4V 4;  2HWC 4;  1RUH 4;  2R04 4;  4Q4W 4;  4RHV 4;  1RUI 4;  1VBC 4;  1R09 4;  1D4M 4;  1COV 4;  2RR1 4;  1VBA 4;  1HRI 4;  1MQT D;  1PO2 4;  1Z7S 4;  1RUG 4;  1RVF 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...