2R074

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r07400
3JBG4 1HRI4 1Z7S4 1RUH4 1ASJ4 1EAH4 1RUI4 1VBD4 4RHV4 1RUE4 2HWC4 1AR94 2PLV4 1AR64 4PDWD 1BEV4 1K5MD 3JD74 1R084 1RUG4 1NCQD 2RR14 2X5ID 4GB34 1H8TD 1PO14 2RM24 1RUJ4 4Q4Y4 1PVC4 1AR74 1NA1D 1VBC4 1AR84 1VRH4 2HWB4 2R064 1EV14 1AL24 1OOPD 1PIV4 1R094 1COV4 1RHI4 1HXS4 1RMU4 4Q4W4 1VBB4 1HRV4 2RS34 1POV0 1D4M4 4Q4X4 1MQTD 1PO24 1RUF4 3J8F4 2RS14 2RS54 2RMU4 1RVF4 2R044 1RUC4 1VBE4 4Q4V4 1VBA4 1RUD4 2R074
chains in the Genus database with same CATH superfamily
3JBG4 1ASJ4 2R7FA 1RUE4 2HWC4 3JD74 3AE9A 2X5ID 2RM24 1RUJ4 3AEGA 4Q4Y4 1AR74 2WP9A 1VRH4 3VRBA 1XHZA 3P4PA 2RS34 4Q4X4 4YXDA 1PO24 1L0VA 2RS54 3AE4A 2RMU4 3AEAA 2R044 3SUCA 3VRAA 1KFYA 2H89A 1VBA4 2PZSA 1Z7S4 3AEFA 4YSXA 3AECA 1R084 1H8TD 1PO14 2PW9A 3AEDA 1AR84 3AEEA 2WDRA 1OOPD 4YT0A 1PIV4 1R094 1RHI4 4Q4W4 2WS3A 1RUF4 1YQ4A 1ZP0A 2EX3A 4YTPA 3AE1A 1RUC4 2WU5A 5C2TA 5C3JA 1RUH4 1VBD4 4RHV4 2H88A 2FBWA 3AEBA 1BEV4 3AE5A 4GB34 2PY5A 1XHXA 3AE3A 3AE7A 2WQYA 2R064 1VBC4 2WDQA 2HWB4 1XI1A 3SFEA 1EV14 1AL24 1COV4 1NENA 3ABVA 1RMU4 3GQHA 1VBB4 3CIRA 1HRV4 1D4M4 1YQ3A 2WU2A 4KX6A 3J8F4 4YSYA 3AE8A 4YTNA 1RUD4 2R074 3FI7A 3P4QA 1HRI4 1RUI4 1EAH4 1ZOYA 1AR94 2PLV4 1AR64 4PDWD 3SFDA 1K5MD 1KF6A 1NCQD 1RUG4 2RR14 2PYLA 3P4RA 3P4SA 1PVC4 1NA1D 4YSZA 3AE2A 1HXS4 3AE6A 1POV0 2WDVA 3VR8A 1MQTD 3VR9A 1NEKA 2RS14 1RVF4 2PYJA 1VBE4 2ACZA 4Q4V4 4YTMA 2B76A 3GQKA
chains in the Genus database with same CATH topology
3JBG4 1HRI4 1Z7S4 1RUH4 1ASJ4 1EAH4 1RUI4 1VBD4 4RHV4 1RUE4 2HWC4 1AR94 2PLV4 1AR64 4PDWD 1BEV4 1K5MD 3JD74 1R084 1RUG4 1NCQD 2RR14 2X5ID 4GB34 1H8TD 1PO14 2RM24 1RUJ4 4Q4Y4 1PVC4 1AR74 1NA1D 1VBC4 1AR84 1VRH4 2HWB4 2R064 1EV14 1AL24 1OOPD 1PIV4 1R094 1COV4 1RHI4 1HXS4 1RMU4 4Q4W4 1VBB4 1HRV4 2RS34 1POV0 1D4M4 4Q4X4 1MQTD 1PO24 1RUF4 3J8F4 2RS14 2RS54 2RMU4 1RVF4 2R044 1RUC4 1VBE4 4Q4V4 1VBA4 1RUD4 2R074
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JBG 4;  1HRI 4;  1Z7S 4;  1RUH 4;  1ASJ 4;  1EAH 4;  1RUI 4;  1VBD 4;  4RHV 4;  1RUE 4;  2HWC 4;  1AR9 4;  2PLV 4;  1AR6 4;  4PDW D;  1BEV 4;  1K5M D;  3JD7 4;  1R08 4;  1RUG 4;  1NCQ D;  2RR1 4;  2X5I D;  4GB3 4;  1H8T D;  1PO1 4;  2RM2 4;  1RUJ 4;  4Q4Y 4;  1PVC 4;  1AR7 4;  1NA1 D;  1VBC 4;  1AR8 4;  1VRH 4;  2HWB 4;  2R06 4;  1EV1 4;  1AL2 4;  1OOP D;  1PIV 4;  1R09 4;  1COV 4;  1RHI 4;  1HXS 4;  1RMU 4;  4Q4W 4;  1VBB 4;  1HRV 4;  2RS3 4;  1POV 0;  1D4M 4;  4Q4X 4;  1MQT D;  1PO2 4;  1RUF 4;  3J8F 4;  2RS1 4;  2RS5 4;  2RMU 4;  1RVF 4;  2R04 4;  1RUC 4;  1VBE 4;  4Q4V 4;  1VBA 4;  1RUD 4;  2R07 4; 
#chains in the Genus database with same CATH topology
 3JBG 4;  1ASJ 4;  2R7F A;  1RUE 4;  2HWC 4;  3JD7 4;  3AE9 A;  2X5I D;  2RM2 4;  1RUJ 4;  3AEG A;  4Q4Y 4;  1AR7 4;  2WP9 A;  1VRH 4;  3VRB A;  1XHZ A;  3P4P A;  2RS3 4;  4Q4X 4;  4YXD A;  1PO2 4;  1L0V A;  2RS5 4;  3AE4 A;  2RMU 4;  3AEA A;  2R04 4;  3SUC A;  3VRA A;  1KFY A;  2H89 A;  1VBA 4;  2PZS A;  1Z7S 4;  3AEF A;  4YSX A;  3AEC A;  1R08 4;  1H8T D;  1PO1 4;  2PW9 A;  3AED A;  1AR8 4;  3AEE A;  2WDR A;  1OOP D;  4YT0 A;  1PIV 4;  1R09 4;  1RHI 4;  4Q4W 4;  2WS3 A;  1RUF 4;  1YQ4 A;  1ZP0 A;  2EX3 A;  4YTP A;  3AE1 A;  1RUC 4;  2WU5 A;  5C2T A;  5C3J A;  1RUH 4;  1VBD 4;  4RHV 4;  2H88 A;  2FBW A;  3AEB A;  1BEV 4;  3AE5 A;  4GB3 4;  2PY5 A;  1XHX A;  3AE3 A;  3AE7 A;  2WQY A;  2R06 4;  1VBC 4;  2WDQ A;  2HWB 4;  1XI1 A;  3SFE A;  1EV1 4;  1AL2 4;  1COV 4;  1NEN A;  3ABV A;  1RMU 4;  3GQH A;  1VBB 4;  3CIR A;  1HRV 4;  1D4M 4;  1YQ3 A;  2WU2 A;  4KX6 A;  3J8F 4;  4YSY A;  3AE8 A;  4YTN A;  1RUD 4;  2R07 4;  3FI7 A;  3P4Q A;  1HRI 4;  1RUI 4;  1EAH 4;  1ZOY A;  1AR9 4;  2PLV 4;  1AR6 4;  4PDW D;  3SFD A;  1K5M D;  1KF6 A;  1NCQ D;  1RUG 4;  2RR1 4;  2PYL A;  3P4R A;  3P4S A;  1PVC 4;  1NA1 D;  4YSZ A;  3AE2 A;  1HXS 4;  3AE6 A;  1POV 0;  2WDV A;  3VR8 A;  1MQT D;  3VR9 A;  1NEK A;  2RS1 4;  1RVF 4;  2PYJ A;  1VBE 4;  2ACZ A;  4Q4V 4;  4YTM A;  2B76 A;  3GQK A; 
#chains in the Genus database with same CATH homology
 3JBG 4;  1HRI 4;  1Z7S 4;  1RUH 4;  1ASJ 4;  1EAH 4;  1RUI 4;  1VBD 4;  4RHV 4;  1RUE 4;  2HWC 4;  1AR9 4;  2PLV 4;  1AR6 4;  4PDW D;  1BEV 4;  1K5M D;  3JD7 4;  1R08 4;  1RUG 4;  1NCQ D;  2RR1 4;  2X5I D;  4GB3 4;  1H8T D;  1PO1 4;  2RM2 4;  1RUJ 4;  4Q4Y 4;  1PVC 4;  1AR7 4;  1NA1 D;  1VBC 4;  1AR8 4;  1VRH 4;  2HWB 4;  2R06 4;  1EV1 4;  1AL2 4;  1OOP D;  1PIV 4;  1R09 4;  1COV 4;  1RHI 4;  1HXS 4;  1RMU 4;  4Q4W 4;  1VBB 4;  1HRV 4;  2RS3 4;  1POV 0;  1D4M 4;  4Q4X 4;  1MQT D;  1PO2 4;  1RUF 4;  3J8F 4;  2RS1 4;  2RS5 4;  2RMU 4;  1RVF 4;  2R04 4;  1RUC 4;  1VBE 4;  4Q4V 4;  1VBA 4;  1RUD 4;  2R07 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...