2R074

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r07400
1RUI4 1RHI4 1EAH4 2R064 4Q4X4 2RMU4 2PLV4 1R084 1RUH4 1EV14 1ASJ4 1AR94 1HRV4 2X5ID 2HWC4 1BEV4 3JD74 2RS54 4Q4Y4 1RUD4 1Z7S4 1PO14 1AR74 1D4M4 1RUC4 1AR84 2RM24 2RS34 3J8F4 4PDWD 1HXS4 4Q4V4 1K5MD 1NA1D 1R094 1VBC4 4Q4W4 1VBD4 2RS14 4GB34 1RUJ4 1H8TD 1PIV4 1AL24 1POV0 1VRH4 2HWB4 1VBB4 1RUE4 1PVC4 2R074 1VBA4 1RVF4 1RUG4 3JBG4 2RR14 1RUF4 1RMU4 1PO24 1MQTD 1VBE4 2R044 1OOPD 1HRI4 1COV4 1NCQD 4RHV4 1AR64
chains in the Genus database with same CATH superfamily
1RUI4 1EAH4 3P4RA 1R084 1NEKA 2R7FA 3VRAA 1ASJ4 1AR94 2HWC4 3AECA 3AE7A 3AE3A 2B76A 3SFDA 1PO14 3J8F4 4YTPA 1R094 4Q4W4 4YTNA 4YXDA 2WP9A 1RUJ4 2PW9A 1XHZA 2FBWA 1VRH4 3P4SA 4YTMA 2PYLA 1RVF4 1RUF4 1VBE4 1XHXA 1AR64 3AEDA 3AEFA 1RHI4 4YT0A 2PLV4 3AE6A 1XI1A 2PYJA 4Q4Y4 3P4PA 1AR74 1KF6A 4YSZA 4PDWD 3AE2A 1K5MD 1NA1D 1VBC4 2H88A 2RS14 3P4QA 1AL24 1RUE4 2PY5A 3AE1A 1NCQD 4RHV4 2R064 2ACZA 2WS3A 4KX6A 2H89A 3AE9A 2X5ID 1BEV4 2RS54 2WDRA 1Z7S4 3AE8A 1D4M4 1RUC4 2RM24 1YQ3A 2RS34 2PZSA 1HXS4 3SUCA 4YSYA 1VBD4 4GB34 1H8TD 3AEEA 3CIRA 1ZP0A 1VBB4 3VRBA 2R074 1VBA4 1RUG4 1RMU4 2R044 3GQHA 1OOPD 1HRI4 1PVC4 1COV4 2WU2A 3VR8A 2WU5A 4Q4X4 2RMU4 3FI7A 1RUH4 1EV14 1HRV4 4YSXA 3JD74 1RUD4 1AR84 4Q4V4 3GQKA 3ABVA 1L0VA 2WQYA 3AEBA 3AE5A 5C2TA 1PIV4 1NENA 1POV0 2HWB4 3VR9A 2EX3A 5C3JA 3JBG4 3AEAA 1KFYA 2RR14 1YQ4A 1PO24 1MQTD 1ZOYA 3AEGA 3AE4A 2WDQA 2WDVA 3SFEA
chains in the Genus database with same CATH topology
1RUI4 1RHI4 1EAH4 2R064 4Q4X4 2RMU4 2PLV4 1R084 1RUH4 1EV14 1ASJ4 1AR94 1HRV4 2X5ID 2HWC4 1BEV4 3JD74 2RS54 4Q4Y4 1RUD4 1Z7S4 1PO14 1AR74 1D4M4 1RUC4 1AR84 2RM24 2RS34 3J8F4 4PDWD 1HXS4 4Q4V4 1K5MD 1NA1D 1R094 1VBC4 4Q4W4 1VBD4 2RS14 4GB34 1RUJ4 1H8TD 1PIV4 1AL24 1POV0 1VRH4 2HWB4 1VBB4 1RUE4 1PVC4 2R074 1VBA4 1RVF4 1RUG4 3JBG4 2RR14 1RUF4 1RMU4 1PO24 1MQTD 1VBE4 2R044 1OOPD 1HRI4 1COV4 1NCQD 4RHV4 1AR64
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUI 4;  1RHI 4;  1EAH 4;  2R06 4;  4Q4X 4;  2RMU 4;  2PLV 4;  1R08 4;  1RUH 4;  1EV1 4;  1ASJ 4;  1AR9 4;  1HRV 4;  2X5I D;  2HWC 4;  1BEV 4;  3JD7 4;  2RS5 4;  4Q4Y 4;  1RUD 4;  1Z7S 4;  1PO1 4;  1AR7 4;  1D4M 4;  1RUC 4;  1AR8 4;  2RM2 4;  2RS3 4;  3J8F 4;  4PDW D;  1HXS 4;  4Q4V 4;  1K5M D;  1NA1 D;  1R09 4;  1VBC 4;  4Q4W 4;  1VBD 4;  2RS1 4;  4GB3 4;  1RUJ 4;  1H8T D;  1PIV 4;  1AL2 4;  1POV 0;  1VRH 4;  2HWB 4;  1VBB 4;  1RUE 4;  1PVC 4;  2R07 4;  1VBA 4;  1RVF 4;  1RUG 4;  3JBG 4;  2RR1 4;  1RUF 4;  1RMU 4;  1PO2 4;  1MQT D;  1VBE 4;  2R04 4;  1OOP D;  1HRI 4;  1COV 4;  1NCQ D;  4RHV 4;  1AR6 4; 
#chains in the Genus database with same CATH topology
 1RUI 4;  1EAH 4;  3P4R A;  1R08 4;  1NEK A;  2R7F A;  3VRA A;  1ASJ 4;  1AR9 4;  2HWC 4;  3AEC A;  3AE7 A;  3AE3 A;  2B76 A;  3SFD A;  1PO1 4;  3J8F 4;  4YTP A;  1R09 4;  4Q4W 4;  4YTN A;  4YXD A;  2WP9 A;  1RUJ 4;  2PW9 A;  1XHZ A;  2FBW A;  1VRH 4;  3P4S A;  4YTM A;  2PYL A;  1RVF 4;  1RUF 4;  1VBE 4;  1XHX A;  1AR6 4;  3AED A;  3AEF A;  1RHI 4;  4YT0 A;  2PLV 4;  3AE6 A;  1XI1 A;  2PYJ A;  4Q4Y 4;  3P4P A;  1AR7 4;  1KF6 A;  4YSZ A;  4PDW D;  3AE2 A;  1K5M D;  1NA1 D;  1VBC 4;  2H88 A;  2RS1 4;  3P4Q A;  1AL2 4;  1RUE 4;  2PY5 A;  3AE1 A;  1NCQ D;  4RHV 4;  2R06 4;  2ACZ A;  2WS3 A;  4KX6 A;  2H89 A;  3AE9 A;  2X5I D;  1BEV 4;  2RS5 4;  2WDR A;  1Z7S 4;  3AE8 A;  1D4M 4;  1RUC 4;  2RM2 4;  1YQ3 A;  2RS3 4;  2PZS A;  1HXS 4;  3SUC A;  4YSY A;  1VBD 4;  4GB3 4;  1H8T D;  3AEE A;  3CIR A;  1ZP0 A;  1VBB 4;  3VRB A;  2R07 4;  1VBA 4;  1RUG 4;  1RMU 4;  2R04 4;  3GQH A;  1OOP D;  1HRI 4;  1PVC 4;  1COV 4;  2WU2 A;  3VR8 A;  2WU5 A;  4Q4X 4;  2RMU 4;  3FI7 A;  1RUH 4;  1EV1 4;  1HRV 4;  4YSX A;  3JD7 4;  1RUD 4;  1AR8 4;  4Q4V 4;  3GQK A;  3ABV A;  1L0V A;  2WQY A;  3AEB A;  3AE5 A;  5C2T A;  1PIV 4;  1NEN A;  1POV 0;  2HWB 4;  3VR9 A;  2EX3 A;  5C3J A;  3JBG 4;  3AEA A;  1KFY A;  2RR1 4;  1YQ4 A;  1PO2 4;  1MQT D;  1ZOY A;  3AEG A;  3AE4 A;  2WDQ A;  2WDV A;  3SFE A; 
#chains in the Genus database with same CATH homology
 1RUI 4;  1RHI 4;  1EAH 4;  2R06 4;  4Q4X 4;  2RMU 4;  2PLV 4;  1R08 4;  1RUH 4;  1EV1 4;  1ASJ 4;  1AR9 4;  1HRV 4;  2X5I D;  2HWC 4;  1BEV 4;  3JD7 4;  2RS5 4;  4Q4Y 4;  1RUD 4;  1Z7S 4;  1PO1 4;  1AR7 4;  1D4M 4;  1RUC 4;  1AR8 4;  2RM2 4;  2RS3 4;  3J8F 4;  4PDW D;  1HXS 4;  4Q4V 4;  1K5M D;  1NA1 D;  1R09 4;  1VBC 4;  4Q4W 4;  1VBD 4;  2RS1 4;  4GB3 4;  1RUJ 4;  1H8T D;  1PIV 4;  1AL2 4;  1POV 0;  1VRH 4;  2HWB 4;  1VBB 4;  1RUE 4;  1PVC 4;  2R07 4;  1VBA 4;  1RVF 4;  1RUG 4;  3JBG 4;  2RR1 4;  1RUF 4;  1RMU 4;  1PO2 4;  1MQT D;  1VBE 4;  2R04 4;  1OOP D;  1HRI 4;  1COV 4;  1NCQ D;  4RHV 4;  1AR6 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...