3JBG4

Complex of poliovirus with vhh pvss21e
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Five of Five VHHs Neutralizing Poliovirus Bind the Receptor-Binding Site.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Virus/immune system
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 3jbg400
1RUH4 4Q4Y4 1RMU4 1VRH4 1ASJ4 1RUF4 1AR84 1RUI4 1VBE4 1NCQD 1VBB4 1AR74 1PVC4 2R074 1POV0 1HRI4 1COV4 1EAH4 1AR94 1VBC4 1MQTD 3JD74 4RHV4 1H8TD 1PO24 1NA1D 2PLV4 2R044 1AL24 2HWC4 1RUG4 1PO14 1RVF4 1RUD4 2RR14 4Q4X4 4GB34 3JBG4 1R084 2RM24 1RUC4 1HRV4 1BEV4 4Q4W4 1Z7S4 1OOPD 1K5MD 1AR64 1HXS4 1EV14 1PIV4 2R064 1RUJ4 3J8F4 2HWB4 2RS14 1D4M4 2RS34 4Q4V4 2X5ID 1VBD4 1R094 1VBA4 2RS54 1RUE4 2RMU4 1RHI4 4PDWD
chains in the Genus database with same CATH superfamily
3AEGA 1RUH4 1HRV4 3AE5A 3FI7A 2H88A 3SFDA 1HRI4 1VBC4 2ACZA 2HWC4 1NEKA 1ZOYA 1YQ3A 2RM24 4Q4W4 3P4QA 1OOPD 1XHZA 3AE6A 4YSYA 3J8F4 1RUJ4 2RS14 2X5ID 1RUE4 2WQYA 2WU2A 4Q4Y4 1RUF4 1NCQD 3AEAA 1AR94 3AE3A 1H8TD 3AE8A 1PO24 5C3JA 2WP9A 1PO14 1RVF4 1RUD4 3AE9A 4GB34 2PZSA 1YQ4A 2WDQA 4YTNA 2H89A 2PYLA 3ABVA 4YTMA 3GQHA 4YXDA 2RS34 3AE7A 1KFYA 2RMU4 1RMU4 1VRH4 1XHXA 1AR84 1RUI4 2R074 1AR74 1PVC4 1COV4 1EAH4 3P4PA 2PW9A 1XI1A 4RHV4 3SUCA 4YSXA 1RUG4 3P4RA 2WU5A 4Q4X4 3P4SA 3VR9A 1R084 2R7FA 1RUC4 3SFEA 1K5MD 1NENA 1KF6A 1EV14 1PIV4 1ZP0A 2WDVA 1R094 1VBA4 3AE4A 3VRBA 3AECA 1RHI4 4YTPA 2PYJA 1ASJ4 1VBE4 1VBB4 3AEEA 1POV0 3VR8A 4YSZA 1MQTD 3JD74 1NA1D 1L0VA 2FBWA 2PLV4 1AL24 2R044 3CIRA 2EX3A 2RR14 3JBG4 2PY5A 3AE2A 3AEFA 5C2TA 2WS3A 3AE1A 3AEBA 1BEV4 4YT0A 3VRAA 1Z7S4 3GQKA 1AR64 1HXS4 3AEDA 2R064 2WDRA 2HWB4 1D4M4 4Q4V4 2B76A 1VBD4 2RS54 4KX6A 4PDWD
chains in the Genus database with same CATH topology
1RUH4 4Q4Y4 1RMU4 1VRH4 1ASJ4 1RUF4 1AR84 1RUI4 1VBE4 1NCQD 1VBB4 1AR74 1PVC4 2R074 1POV0 1HRI4 1COV4 1EAH4 1AR94 1VBC4 1MQTD 3JD74 4RHV4 1H8TD 1PO24 1NA1D 2PLV4 2R044 1AL24 2HWC4 1RUG4 1PO14 1RVF4 1RUD4 2RR14 4Q4X4 4GB34 3JBG4 1R084 2RM24 1RUC4 1HRV4 1BEV4 4Q4W4 1Z7S4 1OOPD 1K5MD 1AR64 1HXS4 1EV14 1PIV4 2R064 1RUJ4 3J8F4 2HWB4 2RS14 1D4M4 2RS34 4Q4V4 2X5ID 1VBD4 1R094 1VBA4 2RS54 1RUE4 2RMU4 1RHI4 4PDWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUH 4;  4Q4Y 4;  1RMU 4;  1VRH 4;  1ASJ 4;  1RUF 4;  1AR8 4;  1RUI 4;  1VBE 4;  1NCQ D;  1VBB 4;  1AR7 4;  1PVC 4;  2R07 4;  1POV 0;  1HRI 4;  1COV 4;  1EAH 4;  1AR9 4;  1VBC 4;  1MQT D;  3JD7 4;  4RHV 4;  1H8T D;  1PO2 4;  1NA1 D;  2PLV 4;  2R04 4;  1AL2 4;  2HWC 4;  1RUG 4;  1PO1 4;  1RVF 4;  1RUD 4;  2RR1 4;  4Q4X 4;  4GB3 4;  3JBG 4;  1R08 4;  2RM2 4;  1RUC 4;  1HRV 4;  1BEV 4;  4Q4W 4;  1Z7S 4;  1OOP D;  1K5M D;  1AR6 4;  1HXS 4;  1EV1 4;  1PIV 4;  2R06 4;  1RUJ 4;  3J8F 4;  2HWB 4;  2RS1 4;  1D4M 4;  2RS3 4;  4Q4V 4;  2X5I D;  1VBD 4;  1R09 4;  1VBA 4;  2RS5 4;  1RUE 4;  2RMU 4;  1RHI 4;  4PDW D; 
#chains in the Genus database with same CATH topology
 3AEG A;  1RUH 4;  1HRV 4;  3AE5 A;  3FI7 A;  2H88 A;  3SFD A;  1HRI 4;  1VBC 4;  2ACZ A;  2HWC 4;  1NEK A;  1ZOY A;  1YQ3 A;  2RM2 4;  4Q4W 4;  3P4Q A;  1OOP D;  1XHZ A;  3AE6 A;  4YSY A;  3J8F 4;  1RUJ 4;  2RS1 4;  2X5I D;  1RUE 4;  2WQY A;  2WU2 A;  4Q4Y 4;  1RUF 4;  1NCQ D;  3AEA A;  1AR9 4;  3AE3 A;  1H8T D;  3AE8 A;  1PO2 4;  5C3J A;  2WP9 A;  1PO1 4;  1RVF 4;  1RUD 4;  3AE9 A;  4GB3 4;  2PZS A;  1YQ4 A;  2WDQ A;  4YTN A;  2H89 A;  2PYL A;  3ABV A;  4YTM A;  3GQH A;  4YXD A;  2RS3 4;  3AE7 A;  1KFY A;  2RMU 4;  1RMU 4;  1VRH 4;  1XHX A;  1AR8 4;  1RUI 4;  2R07 4;  1AR7 4;  1PVC 4;  1COV 4;  1EAH 4;  3P4P A;  2PW9 A;  1XI1 A;  4RHV 4;  3SUC A;  4YSX A;  1RUG 4;  3P4R A;  2WU5 A;  4Q4X 4;  3P4S A;  3VR9 A;  1R08 4;  2R7F A;  1RUC 4;  3SFE A;  1K5M D;  1NEN A;  1KF6 A;  1EV1 4;  1PIV 4;  1ZP0 A;  2WDV A;  1R09 4;  1VBA 4;  3AE4 A;  3VRB A;  3AEC A;  1RHI 4;  4YTP A;  2PYJ A;  1ASJ 4;  1VBE 4;  1VBB 4;  3AEE A;  1POV 0;  3VR8 A;  4YSZ A;  1MQT D;  3JD7 4;  1NA1 D;  1L0V A;  2FBW A;  2PLV 4;  1AL2 4;  2R04 4;  3CIR A;  2EX3 A;  2RR1 4;  3JBG 4;  2PY5 A;  3AE2 A;  3AEF A;  5C2T A;  2WS3 A;  3AE1 A;  3AEB A;  1BEV 4;  4YT0 A;  3VRA A;  1Z7S 4;  3GQK A;  1AR6 4;  1HXS 4;  3AED A;  2R06 4;  2WDR A;  2HWB 4;  1D4M 4;  4Q4V 4;  2B76 A;  1VBD 4;  2RS5 4;  4KX6 A;  4PDW D; 
#chains in the Genus database with same CATH homology
 1RUH 4;  4Q4Y 4;  1RMU 4;  1VRH 4;  1ASJ 4;  1RUF 4;  1AR8 4;  1RUI 4;  1VBE 4;  1NCQ D;  1VBB 4;  1AR7 4;  1PVC 4;  2R07 4;  1POV 0;  1HRI 4;  1COV 4;  1EAH 4;  1AR9 4;  1VBC 4;  1MQT D;  3JD7 4;  4RHV 4;  1H8T D;  1PO2 4;  1NA1 D;  2PLV 4;  2R04 4;  1AL2 4;  2HWC 4;  1RUG 4;  1PO1 4;  1RVF 4;  1RUD 4;  2RR1 4;  4Q4X 4;  4GB3 4;  3JBG 4;  1R08 4;  2RM2 4;  1RUC 4;  1HRV 4;  1BEV 4;  4Q4W 4;  1Z7S 4;  1OOP D;  1K5M D;  1AR6 4;  1HXS 4;  1EV1 4;  1PIV 4;  2R06 4;  1RUJ 4;  3J8F 4;  2HWB 4;  2RS1 4;  1D4M 4;  2RS3 4;  4Q4V 4;  2X5I D;  1VBD 4;  1R09 4;  1VBA 4;  2RS5 4;  1RUE 4;  2RMU 4;  1RHI 4;  4PDW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...