3JBG4

Complex of poliovirus with vhh pvss21e
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords Capsid protein VP1
publication title Five of Five VHHs Neutralizing Poliovirus Bind the Receptor-Binding Site.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 3jbg400
2R074 2RS54 1HXS4 1RUJ4 4RHV4 1Z7S4 1MQTD 2X5ID 1K5MD 1VRH4 1VBB4 2PLV4 1ASJ4 2HWB4 2RS34 1POV0 1AR84 2RMU4 4Q4V4 1AL24 1RUI4 4Q4Y4 1AR94 4PDWD 1EV14 1BEV4 1AR74 1RVF4 2HWC4 4GB34 1RUF4 2RM24 1D4M4 1R084 1VBA4 1H8TD 1R094 1HRV4 3JD74 1VBD4 1AR64 1PO24 4Q4X4 4Q4W4 1RUE4 1NCQD 1VBE4 1RUG4 2R044 2RS14 1EAH4 1HRI4 1NA1D 1PVC4 1VBC4 1PIV4 1PO14 2RR14 1RMU4 1RHI4 1OOPD 2R064 1RUD4 1COV4 3J8F4 1RUH4 1RUC4 3JBG4
chains in the Genus database with same CATH superfamily
3SFEA 4YSXA 1RUJ4 1Z7S4 1MQTD 3CIRA 4YSYA 1VBB4 2PLV4 3VR9A 2RMU4 1AR84 2WQYA 1AR74 2WS3A 4YXDA 1ZP0A 2H89A 2WP9A 3P4RA 2WU5A 1VBA4 3JD74 1RUE4 3AE5A 2R044 2RS14 3AE6A 3AE9A 1VBC4 2ACZA 1PO14 2RR14 1OOPD 1COV4 1NEKA 1RUC4 3VRBA 3ABVA 1HXS4 4RHV4 1XI1A 2WDVA 1K5MD 3VRAA 1XHZA 1ASJ4 4Q4V4 2WDQA 3AEDA 1RUI4 3AE3A 4PDWD 1EV14 2PYLA 4GB34 2PY5A 1D4M4 1YQ4A 3AECA 3VR8A 2PYJA 1NCQD 2B76A 1NA1D 1PVC4 5C2TA 3J8F4 4KX6A 3AE7A 3AE1A 2X5ID 3SFDA 1VRH4 2RS34 4YTNA 1AR94 1BEV4 3AEEA 1L0VA 2HWC4 2H88A 1RUF4 2RM24 2WU2A 1H8TD 1HRV4 2PZSA 1VBD4 2R7FA 1AR64 1PO24 4YSZA 4Q4W4 4YTPA 1RUG4 3AEGA 1PIV4 1RMU4 3GQHA 3AEFA 1RUD4 3AE8A 3AEAA 3FI7A 1RUH4 3JBG4 2R074 1ZOYA 2RS54 2FBWA 1KF6A 3AE2A 3GQKA 2HWB4 1POV0 1AL24 3P4QA 4YT0A 4Q4Y4 3P4SA 3P4PA 3AEBA 1KFYA 1RVF4 3SUCA 1NENA 1R084 1R094 1YQ3A 3AE4A 4YTMA 4Q4X4 1VBE4 1EAH4 1HRI4 2PW9A 1RHI4 1XHXA 2R064 2WDRA 5C3JA 2EX3A
chains in the Genus database with same CATH topology
2R074 2RS54 1HXS4 1RUJ4 4RHV4 1Z7S4 1MQTD 2X5ID 1K5MD 1VRH4 1VBB4 2PLV4 1ASJ4 2HWB4 2RS34 1POV0 1AR84 2RMU4 4Q4V4 1AL24 1RUI4 4Q4Y4 1AR94 4PDWD 1EV14 1BEV4 1AR74 1RVF4 2HWC4 4GB34 1RUF4 2RM24 1D4M4 1R084 1VBA4 1H8TD 1R094 1HRV4 3JD74 1VBD4 1AR64 1PO24 4Q4X4 4Q4W4 1RUE4 1NCQD 1VBE4 1RUG4 2R044 2RS14 1EAH4 1HRI4 1NA1D 1PVC4 1VBC4 1PIV4 1PO14 2RR14 1RMU4 1RHI4 1OOPD 2R064 1RUD4 1COV4 3J8F4 1RUH4 1RUC4 3JBG4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R07 4;  2RS5 4;  1HXS 4;  1RUJ 4;  4RHV 4;  1Z7S 4;  1MQT D;  2X5I D;  1K5M D;  1VRH 4;  1VBB 4;  2PLV 4;  1ASJ 4;  2HWB 4;  2RS3 4;  1POV 0;  1AR8 4;  2RMU 4;  4Q4V 4;  1AL2 4;  1RUI 4;  4Q4Y 4;  1AR9 4;  4PDW D;  1EV1 4;  1BEV 4;  1AR7 4;  1RVF 4;  2HWC 4;  4GB3 4;  1RUF 4;  2RM2 4;  1D4M 4;  1R08 4;  1VBA 4;  1H8T D;  1R09 4;  1HRV 4;  3JD7 4;  1VBD 4;  1AR6 4;  1PO2 4;  4Q4X 4;  4Q4W 4;  1RUE 4;  1NCQ D;  1VBE 4;  1RUG 4;  2R04 4;  2RS1 4;  1EAH 4;  1HRI 4;  1NA1 D;  1PVC 4;  1VBC 4;  1PIV 4;  1PO1 4;  2RR1 4;  1RMU 4;  1RHI 4;  1OOP D;  2R06 4;  1RUD 4;  1COV 4;  3J8F 4;  1RUH 4;  1RUC 4;  3JBG 4; 
#chains in the Genus database with same CATH topology
 3SFE A;  4YSX A;  1RUJ 4;  1Z7S 4;  1MQT D;  3CIR A;  4YSY A;  1VBB 4;  2PLV 4;  3VR9 A;  2RMU 4;  1AR8 4;  2WQY A;  1AR7 4;  2WS3 A;  4YXD A;  1ZP0 A;  2H89 A;  2WP9 A;  3P4R A;  2WU5 A;  1VBA 4;  3JD7 4;  1RUE 4;  3AE5 A;  2R04 4;  2RS1 4;  3AE6 A;  3AE9 A;  1VBC 4;  2ACZ A;  1PO1 4;  2RR1 4;  1OOP D;  1COV 4;  1NEK A;  1RUC 4;  3VRB A;  3ABV A;  1HXS 4;  4RHV 4;  1XI1 A;  2WDV A;  1K5M D;  3VRA A;  1XHZ A;  1ASJ 4;  4Q4V 4;  2WDQ A;  3AED A;  1RUI 4;  3AE3 A;  4PDW D;  1EV1 4;  2PYL A;  4GB3 4;  2PY5 A;  1D4M 4;  1YQ4 A;  3AEC A;  3VR8 A;  2PYJ A;  1NCQ D;  2B76 A;  1NA1 D;  1PVC 4;  5C2T A;  3J8F 4;  4KX6 A;  3AE7 A;  3AE1 A;  2X5I D;  3SFD A;  1VRH 4;  2RS3 4;  4YTN A;  1AR9 4;  1BEV 4;  3AEE A;  1L0V A;  2HWC 4;  2H88 A;  1RUF 4;  2RM2 4;  2WU2 A;  1H8T D;  1HRV 4;  2PZS A;  1VBD 4;  2R7F A;  1AR6 4;  1PO2 4;  4YSZ A;  4Q4W 4;  4YTP A;  1RUG 4;  3AEG A;  1PIV 4;  1RMU 4;  3GQH A;  3AEF A;  1RUD 4;  3AE8 A;  3AEA A;  3FI7 A;  1RUH 4;  3JBG 4;  2R07 4;  1ZOY A;  2RS5 4;  2FBW A;  1KF6 A;  3AE2 A;  3GQK A;  2HWB 4;  1POV 0;  1AL2 4;  3P4Q A;  4YT0 A;  4Q4Y 4;  3P4S A;  3P4P A;  3AEB A;  1KFY A;  1RVF 4;  3SUC A;  1NEN A;  1R08 4;  1R09 4;  1YQ3 A;  3AE4 A;  4YTM A;  4Q4X 4;  1VBE 4;  1EAH 4;  1HRI 4;  2PW9 A;  1RHI 4;  1XHX A;  2R06 4;  2WDR A;  5C3J A;  2EX3 A; 
#chains in the Genus database with same CATH homology
 2R07 4;  2RS5 4;  1HXS 4;  1RUJ 4;  4RHV 4;  1Z7S 4;  1MQT D;  2X5I D;  1K5M D;  1VRH 4;  1VBB 4;  2PLV 4;  1ASJ 4;  2HWB 4;  2RS3 4;  1POV 0;  1AR8 4;  2RMU 4;  4Q4V 4;  1AL2 4;  1RUI 4;  4Q4Y 4;  1AR9 4;  4PDW D;  1EV1 4;  1BEV 4;  1AR7 4;  1RVF 4;  2HWC 4;  4GB3 4;  1RUF 4;  2RM2 4;  1D4M 4;  1R08 4;  1VBA 4;  1H8T D;  1R09 4;  1HRV 4;  3JD7 4;  1VBD 4;  1AR6 4;  1PO2 4;  4Q4X 4;  4Q4W 4;  1RUE 4;  1NCQ D;  1VBE 4;  1RUG 4;  2R04 4;  2RS1 4;  1EAH 4;  1HRI 4;  1NA1 D;  1PVC 4;  1VBC 4;  1PIV 4;  1PO1 4;  2RR1 4;  1RMU 4;  1RHI 4;  1OOP D;  2R06 4;  1RUD 4;  1COV 4;  3J8F 4;  1RUH 4;  1RUC 4;  3JBG 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...