2R064

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r06400
1VBE4 1RUI4 1RUG4 1POV0 1Z7S4 1RMU4 1AR74 1RUH4 4Q4V4 1R094 1D4M4 1BEV4 1VBD4 2HWB4 1RVF4 4Q4W4 1PO14 1ASJ4 1RUF4 1VBC4 2HWC4 1HRV4 1K5MD 4RHV4 2R064 1EV14 1MQTD 1EAH4 1VBB4 3JD74 1AR64 2RMU4 3JBG4 2RR14 2RS34 2R074 2RS54 1COV4 1NCQD 4Q4X4 1VRH4 1HXS4 2R044 1RUJ4 2RM24 4Q4Y4 1RUE4 1PVC4 2PLV4 1RHI4 1NA1D 1HRI4 3J8F4 1AR94 1AL24 1RUD4 2X5ID 4PDWD 1PO24 4GB34 1R084 1PIV4 1H8TD 1VBA4 1RUC4 2RS14 1OOPD 1AR84
chains in the Genus database with same CATH superfamily
1YQ4A 3P4PA 1XHZA 5C3JA 3P4RA 3GQHA 4RHV4 1VBB4 2PYLA 1L0VA 2RS34 2PZSA 4Q4X4 3AEGA 1ZOYA 2PLV4 2X5ID 4YXDA 3P4QA 3AECA 4GB34 1NENA 1PIV4 1H8TD 1VBA4 2ACZA 3P4SA 3AE2A 1RUG4 2WU5A 1POV0 1D4M4 3AE4A 3VRAA 3VR9A 1RUF4 2HWC4 2WS3A 1EV14 1KFYA 4YTNA 3AE6A 3JD74 3SFEA 2RMU4 2WU2A 2RR14 3JBG4 3VR8A 1NCQD 1VRH4 2WQYA 2R044 1RUJ4 1XHXA 2RM24 3GQKA 2R7FA 4Q4Y4 1RUE4 3FI7A 3AEBA 1R084 3AEAA 2WDQA 4YTPA 1ZP0A 2WDRA 3VRBA 1AR74 1VBD4 2WDVA 3AE3A 1PO14 3AE9A 1ASJ4 4YSXA 1VBC4 1HRV4 2R064 1MQTD 1EAH4 4KX6A 2EX3A 1COV4 1YQ3A 3AE8A 1HXS4 3AEDA 2FBWA 3J8F4 2PYJA 1RHI4 1NA1D 1HRI4 1RUD4 1KF6A 2PW9A 4YSZA 2PY5A 1PO24 3AEFA 3AE1A 1RUC4 2H88A 1AR84 1VBE4 1RUI4 2WP9A 1Z7S4 1RMU4 1RUH4 4Q4V4 1R094 3AEEA 4Q4W4 1BEV4 2HWB4 1RVF4 1K5MD 2H89A 1XI1A 5C2TA 1AR64 2RS54 2R074 3ABVA 3SFDA 1PVC4 2B76A 3AE7A 1AR94 1AL24 3SUCA 4PDWD 4YTMA 4YT0A 4YSYA 1NEKA 2RS14 3AE5A 3CIRA 1OOPD
chains in the Genus database with same CATH topology
1VBE4 1RUI4 1RUG4 1POV0 1Z7S4 1RMU4 1AR74 1RUH4 4Q4V4 1R094 1D4M4 1BEV4 1VBD4 2HWB4 1RVF4 4Q4W4 1PO14 1ASJ4 1RUF4 1VBC4 2HWC4 1HRV4 1K5MD 4RHV4 2R064 1EV14 1MQTD 1EAH4 1VBB4 3JD74 1AR64 2RMU4 3JBG4 2RR14 2RS34 2R074 2RS54 1COV4 1NCQD 4Q4X4 1VRH4 1HXS4 2R044 1RUJ4 2RM24 4Q4Y4 1RUE4 1PVC4 2PLV4 1RHI4 1NA1D 1HRI4 3J8F4 1AR94 1AL24 1RUD4 2X5ID 4PDWD 1PO24 4GB34 1R084 1PIV4 1H8TD 1VBA4 1RUC4 2RS14 1OOPD 1AR84
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBE 4;  1RUI 4;  1RUG 4;  1POV 0;  1Z7S 4;  1RMU 4;  1AR7 4;  1RUH 4;  4Q4V 4;  1R09 4;  1D4M 4;  1BEV 4;  1VBD 4;  2HWB 4;  1RVF 4;  4Q4W 4;  1PO1 4;  1ASJ 4;  1RUF 4;  1VBC 4;  2HWC 4;  1HRV 4;  1K5M D;  4RHV 4;  2R06 4;  1EV1 4;  1MQT D;  1EAH 4;  1VBB 4;  3JD7 4;  1AR6 4;  2RMU 4;  3JBG 4;  2RR1 4;  2RS3 4;  2R07 4;  2RS5 4;  1COV 4;  1NCQ D;  4Q4X 4;  1VRH 4;  1HXS 4;  2R04 4;  1RUJ 4;  2RM2 4;  4Q4Y 4;  1RUE 4;  1PVC 4;  2PLV 4;  1RHI 4;  1NA1 D;  1HRI 4;  3J8F 4;  1AR9 4;  1AL2 4;  1RUD 4;  2X5I D;  4PDW D;  1PO2 4;  4GB3 4;  1R08 4;  1PIV 4;  1H8T D;  1VBA 4;  1RUC 4;  2RS1 4;  1OOP D;  1AR8 4; 
#chains in the Genus database with same CATH topology
 1YQ4 A;  3P4P A;  1XHZ A;  5C3J A;  3P4R A;  3GQH A;  4RHV 4;  1VBB 4;  2PYL A;  1L0V A;  2RS3 4;  2PZS A;  4Q4X 4;  3AEG A;  1ZOY A;  2PLV 4;  2X5I D;  4YXD A;  3P4Q A;  3AEC A;  4GB3 4;  1NEN A;  1PIV 4;  1H8T D;  1VBA 4;  2ACZ A;  3P4S A;  3AE2 A;  1RUG 4;  2WU5 A;  1POV 0;  1D4M 4;  3AE4 A;  3VRA A;  3VR9 A;  1RUF 4;  2HWC 4;  2WS3 A;  1EV1 4;  1KFY A;  4YTN A;  3AE6 A;  3JD7 4;  3SFE A;  2RMU 4;  2WU2 A;  2RR1 4;  3JBG 4;  3VR8 A;  1NCQ D;  1VRH 4;  2WQY A;  2R04 4;  1RUJ 4;  1XHX A;  2RM2 4;  3GQK A;  2R7F A;  4Q4Y 4;  1RUE 4;  3FI7 A;  3AEB A;  1R08 4;  3AEA A;  2WDQ A;  4YTP A;  1ZP0 A;  2WDR A;  3VRB A;  1AR7 4;  1VBD 4;  2WDV A;  3AE3 A;  1PO1 4;  3AE9 A;  1ASJ 4;  4YSX A;  1VBC 4;  1HRV 4;  2R06 4;  1MQT D;  1EAH 4;  4KX6 A;  2EX3 A;  1COV 4;  1YQ3 A;  3AE8 A;  1HXS 4;  3AED A;  2FBW A;  3J8F 4;  2PYJ A;  1RHI 4;  1NA1 D;  1HRI 4;  1RUD 4;  1KF6 A;  2PW9 A;  4YSZ A;  2PY5 A;  1PO2 4;  3AEF A;  3AE1 A;  1RUC 4;  2H88 A;  1AR8 4;  1VBE 4;  1RUI 4;  2WP9 A;  1Z7S 4;  1RMU 4;  1RUH 4;  4Q4V 4;  1R09 4;  3AEE A;  4Q4W 4;  1BEV 4;  2HWB 4;  1RVF 4;  1K5M D;  2H89 A;  1XI1 A;  5C2T A;  1AR6 4;  2RS5 4;  2R07 4;  3ABV A;  3SFD A;  1PVC 4;  2B76 A;  3AE7 A;  1AR9 4;  1AL2 4;  3SUC A;  4PDW D;  4YTM A;  4YT0 A;  4YSY A;  1NEK A;  2RS1 4;  3AE5 A;  3CIR A;  1OOP D; 
#chains in the Genus database with same CATH homology
 1VBE 4;  1RUI 4;  1RUG 4;  1POV 0;  1Z7S 4;  1RMU 4;  1AR7 4;  1RUH 4;  4Q4V 4;  1R09 4;  1D4M 4;  1BEV 4;  1VBD 4;  2HWB 4;  1RVF 4;  4Q4W 4;  1PO1 4;  1ASJ 4;  1RUF 4;  1VBC 4;  2HWC 4;  1HRV 4;  1K5M D;  4RHV 4;  2R06 4;  1EV1 4;  1MQT D;  1EAH 4;  1VBB 4;  3JD7 4;  1AR6 4;  2RMU 4;  3JBG 4;  2RR1 4;  2RS3 4;  2R07 4;  2RS5 4;  1COV 4;  1NCQ D;  4Q4X 4;  1VRH 4;  1HXS 4;  2R04 4;  1RUJ 4;  2RM2 4;  4Q4Y 4;  1RUE 4;  1PVC 4;  2PLV 4;  1RHI 4;  1NA1 D;  1HRI 4;  3J8F 4;  1AR9 4;  1AL2 4;  1RUD 4;  2X5I D;  4PDW D;  1PO2 4;  4GB3 4;  1R08 4;  1PIV 4;  1H8T D;  1VBA 4;  1RUC 4;  2RS1 4;  1OOP D;  1AR8 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...