2R064

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r06400
3JBG4 3JD74 1AR84 2RS34 1AL24 1VRH4 2R044 4Q4X4 1RUE4 1D4M4 1PVC4 1RUH4 1ASJ4 1Z7S4 2X5ID 2RMU4 1HRV4 1RHI4 1VBD4 1H8TD 1VBB4 1RVF4 1RUJ4 1RUC4 1VBE4 2HWB4 1OOPD 1PO14 1RUI4 2PLV4 1MQTD 2R064 2RS54 1AR94 1AR64 1BEV4 1HXS4 2RS14 4GB34 1R084 1RUD4 4Q4V4 1POV0 2R074 1RUF4 1R094 1RMU4 1PO24 3J8F4 1NCQD 4RHV4 1PIV4 4Q4W4 1VBA4 4Q4Y4 2RR14 1AR74 1EAH4 1COV4 1VBC4 1EV14 2RM24 1RUG4 1NA1D 1K5MD 1HRI4 2HWC4 4PDWD
chains in the Genus database with same CATH superfamily
2RS34 3AE3A 2HWC4 1XHXA 1KF6A 2R044 2R7FA 4YTMA 1RUH4 2X5ID 1HRV4 1VBB4 1NEKA 2B76A 3P4QA 4YTPA 1VBE4 1YQ4A 3AE1A 4YXDA 5C3JA 3VR8A 2WU5A 2H89A 1RUF4 2H88A 3ABVA 3AEAA 1NCQD 4RHV4 2WDRA 2WDQA 3P4RA 2WQYA 3SFEA 1AR74 1VBC4 3JD74 1RUE4 1ASJ4 2RMU4 2PYJA 1RHI4 4YT0A 2FBWA 1RVF4 3AEFA 1PO14 1RUI4 1AR94 1HXS4 3AE7A 4GB34 4YSYA 2PZSA 1PO24 2WS3A 2ACZA 4Q4Y4 2PYLA 3FI7A 1RUG4 1HRI4 1XI1A 1VRH4 1NENA 3VRAA 3GQHA 3P4SA 3AEGA 1YQ3A 2HWB4 3VRBA 1OOPD 4YSZA 3AEBA 1BEV4 4Q4V4 1R084 1RUD4 2PY5A 3AEEA 3J8F4 1VBA4 2WP9A 1EAH4 3AE5A 4KX6A 3AE9A 1NA1D 3AECA 3JBG4 1AR84 3P4PA 1AL24 4Q4X4 1D4M4 1PVC4 3SFDA 1Z7S4 4YSXA 2WDVA 3AE4A 3SUCA 1VBD4 1H8TD 3VR9A 1ZP0A 1RUJ4 1ZOYA 1RUC4 2WU2A 2R064 2PLV4 1MQTD 3CIRA 2RS54 1KFYA 1AR64 3AE8A 5C2TA 2RS14 1L0VA 2PW9A 1POV0 4YTNA 2R074 3AE2A 1R094 1RMU4 1PIV4 3AE6A 3GQKA 4Q4W4 2EX3A 1COV4 1EV14 2RM24 1XHZA 1K5MD 2RR14 3AEDA 4PDWD
chains in the Genus database with same CATH topology
3JBG4 3JD74 1AR84 2RS34 1AL24 1VRH4 2R044 4Q4X4 1RUE4 1D4M4 1PVC4 1RUH4 1ASJ4 1Z7S4 2X5ID 2RMU4 1HRV4 1RHI4 1VBD4 1H8TD 1VBB4 1RVF4 1RUJ4 1RUC4 1VBE4 2HWB4 1OOPD 1PO14 1RUI4 2PLV4 1MQTD 2R064 2RS54 1AR94 1AR64 1BEV4 1HXS4 2RS14 4GB34 1R084 1RUD4 4Q4V4 1POV0 2R074 1RUF4 1R094 1RMU4 1PO24 3J8F4 1NCQD 4RHV4 1PIV4 4Q4W4 1VBA4 4Q4Y4 2RR14 1AR74 1EAH4 1COV4 1VBC4 1EV14 2RM24 1RUG4 1NA1D 1K5MD 1HRI4 2HWC4 4PDWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JBG 4;  3JD7 4;  1AR8 4;  2RS3 4;  1AL2 4;  1VRH 4;  2R04 4;  4Q4X 4;  1RUE 4;  1D4M 4;  1PVC 4;  1RUH 4;  1ASJ 4;  1Z7S 4;  2X5I D;  2RMU 4;  1HRV 4;  1RHI 4;  1VBD 4;  1H8T D;  1VBB 4;  1RVF 4;  1RUJ 4;  1RUC 4;  1VBE 4;  2HWB 4;  1OOP D;  1PO1 4;  1RUI 4;  2PLV 4;  1MQT D;  2R06 4;  2RS5 4;  1AR9 4;  1AR6 4;  1BEV 4;  1HXS 4;  2RS1 4;  4GB3 4;  1R08 4;  1RUD 4;  4Q4V 4;  1POV 0;  2R07 4;  1RUF 4;  1R09 4;  1RMU 4;  1PO2 4;  3J8F 4;  1NCQ D;  4RHV 4;  1PIV 4;  4Q4W 4;  1VBA 4;  4Q4Y 4;  2RR1 4;  1AR7 4;  1EAH 4;  1COV 4;  1VBC 4;  1EV1 4;  2RM2 4;  1RUG 4;  1NA1 D;  1K5M D;  1HRI 4;  2HWC 4;  4PDW D; 
#chains in the Genus database with same CATH topology
 2RS3 4;  3AE3 A;  2HWC 4;  1XHX A;  1KF6 A;  2R04 4;  2R7F A;  4YTM A;  1RUH 4;  2X5I D;  1HRV 4;  1VBB 4;  1NEK A;  2B76 A;  3P4Q A;  4YTP A;  1VBE 4;  1YQ4 A;  3AE1 A;  4YXD A;  5C3J A;  3VR8 A;  2WU5 A;  2H89 A;  1RUF 4;  2H88 A;  3ABV A;  3AEA A;  1NCQ D;  4RHV 4;  2WDR A;  2WDQ A;  3P4R A;  2WQY A;  3SFE A;  1AR7 4;  1VBC 4;  3JD7 4;  1RUE 4;  1ASJ 4;  2RMU 4;  2PYJ A;  1RHI 4;  4YT0 A;  2FBW A;  1RVF 4;  3AEF A;  1PO1 4;  1RUI 4;  1AR9 4;  1HXS 4;  3AE7 A;  4GB3 4;  4YSY A;  2PZS A;  1PO2 4;  2WS3 A;  2ACZ A;  4Q4Y 4;  2PYL A;  3FI7 A;  1RUG 4;  1HRI 4;  1XI1 A;  1VRH 4;  1NEN A;  3VRA A;  3GQH A;  3P4S A;  3AEG A;  1YQ3 A;  2HWB 4;  3VRB A;  1OOP D;  4YSZ A;  3AEB A;  1BEV 4;  4Q4V 4;  1R08 4;  1RUD 4;  2PY5 A;  3AEE A;  3J8F 4;  1VBA 4;  2WP9 A;  1EAH 4;  3AE5 A;  4KX6 A;  3AE9 A;  1NA1 D;  3AEC A;  3JBG 4;  1AR8 4;  3P4P A;  1AL2 4;  4Q4X 4;  1D4M 4;  1PVC 4;  3SFD A;  1Z7S 4;  4YSX A;  2WDV A;  3AE4 A;  3SUC A;  1VBD 4;  1H8T D;  3VR9 A;  1ZP0 A;  1RUJ 4;  1ZOY A;  1RUC 4;  2WU2 A;  2R06 4;  2PLV 4;  1MQT D;  3CIR A;  2RS5 4;  1KFY A;  1AR6 4;  3AE8 A;  5C2T A;  2RS1 4;  1L0V A;  2PW9 A;  1POV 0;  4YTN A;  2R07 4;  3AE2 A;  1R09 4;  1RMU 4;  1PIV 4;  3AE6 A;  3GQK A;  4Q4W 4;  2EX3 A;  1COV 4;  1EV1 4;  2RM2 4;  1XHZ A;  1K5M D;  2RR1 4;  3AED A;  4PDW D; 
#chains in the Genus database with same CATH homology
 3JBG 4;  3JD7 4;  1AR8 4;  2RS3 4;  1AL2 4;  1VRH 4;  2R04 4;  4Q4X 4;  1RUE 4;  1D4M 4;  1PVC 4;  1RUH 4;  1ASJ 4;  1Z7S 4;  2X5I D;  2RMU 4;  1HRV 4;  1RHI 4;  1VBD 4;  1H8T D;  1VBB 4;  1RVF 4;  1RUJ 4;  1RUC 4;  1VBE 4;  2HWB 4;  1OOP D;  1PO1 4;  1RUI 4;  2PLV 4;  1MQT D;  2R06 4;  2RS5 4;  1AR9 4;  1AR6 4;  1BEV 4;  1HXS 4;  2RS1 4;  4GB3 4;  1R08 4;  1RUD 4;  4Q4V 4;  1POV 0;  2R07 4;  1RUF 4;  1R09 4;  1RMU 4;  1PO2 4;  3J8F 4;  1NCQ D;  4RHV 4;  1PIV 4;  4Q4W 4;  1VBA 4;  4Q4Y 4;  2RR1 4;  1AR7 4;  1EAH 4;  1COV 4;  1VBC 4;  1EV1 4;  2RM2 4;  1RUG 4;  1NA1 D;  1K5M D;  1HRI 4;  2HWC 4;  4PDW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...