2R064

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r06400
2R074 1VRH4 2RS14 4Q4X4 1HRV4 1RVF4 1AL24 1ASJ4 4Q4V4 1EV14 1RUI4 4GB34 1RUJ4 1AR74 1MQTD 1AR84 2RR14 3J8F4 1VBB4 4Q4W4 2R064 1R094 2X5ID 1VBC4 1R084 1HRI4 1PO14 2R044 1NCQD 1RUE4 2RM24 1RUC4 1VBD4 1HXS4 1D4M4 1VBE4 4RHV4 1PO24 1COV4 1PIV4 1RHI4 1RMU4 2RS54 4Q4Y4 2HWB4 2RS34 1RUD4 1RUH4 1AR94 2HWC4 4PDWD 3JBG4 1NA1D 1AR64 1PVC4 1RUG4 1OOPD 1VBA4 1Z7S4 2PLV4 1K5MD 1EAH4 3JD74 1RUF4 1BEV4 1H8TD 1POV0 2RMU4
chains in the Genus database with same CATH superfamily
3AE8A 4Q4X4 3AEAA 3AE4A 1HRV4 2WS3A 2WU5A 3AE3A 4Q4V4 1ZOYA 2B76A 1MQTD 3VRBA 4YSXA 3AE6A 3SUCA 1RUE4 1HXS4 1D4M4 1VBE4 4YT0A 1PO24 1COV4 1RHI4 1XI1A 1XHZA 3AEEA 4Q4Y4 2RS34 3P4SA 3AEGA 3VRAA 2ACZA 3JBG4 3CIRA 1OOPD 1EAH4 3AECA 1BEV4 1POV0 3VR9A 2R074 2RS14 2R7FA 4YSYA 4YTNA 2H89A 1NENA 4GB34 4YSZA 1YQ4A 2RR14 1VBB4 1R094 3FI7A 1R084 1XHXA 2R044 1NCQD 2PYLA 3AE5A 1PIV4 2HWB4 3AE7A 1AR94 4PDWD 1NA1D 1VBA4 3AE2A 3GQHA 1Z7S4 2PLV4 2FBWA 4KX6A 2EX3A 1RVF4 1KF6A 1AR74 1KFYA 1L0VA 2R064 1ZP0A 3AE9A 3SFEA 1RUC4 1VBD4 4RHV4 3AE1A 2WDVA 1RMU4 2PW9A 2WDRA 3P4PA 1K5MD 3AEFA 2PZSA 1RUF4 1H8TD 5C2TA 2RMU4 1VRH4 2WDQA 1AL24 1ASJ4 4YXDA 1EV14 1RUJ4 3J8F4 1AR84 2PY5A 3VR8A 4Q4W4 2WP9A 2X5ID 1VBC4 1HRI4 3AEBA 1PO14 2RM24 5C3JA 3ABVA 3GQKA 3P4RA 4YTMA 1YQ3A 2RS54 2WQYA 2H88A 3P4QA 3SFDA 1RUD4 1RUH4 2HWC4 4YTPA 1AR64 1PVC4 1NEKA 1RUG4 2WU2A 3AEDA 2PYJA 3JD74 1RUI4
chains in the Genus database with same CATH topology
2R074 1VRH4 2RS14 4Q4X4 1HRV4 1RVF4 1AL24 1ASJ4 4Q4V4 1EV14 1RUI4 4GB34 1RUJ4 1AR74 1MQTD 1AR84 2RR14 3J8F4 1VBB4 4Q4W4 2R064 1R094 2X5ID 1VBC4 1R084 1HRI4 1PO14 2R044 1NCQD 1RUE4 2RM24 1RUC4 1VBD4 1HXS4 1D4M4 1VBE4 4RHV4 1PO24 1COV4 1PIV4 1RHI4 1RMU4 2RS54 4Q4Y4 2HWB4 2RS34 1RUD4 1RUH4 1AR94 2HWC4 4PDWD 3JBG4 1NA1D 1AR64 1PVC4 1RUG4 1OOPD 1VBA4 1Z7S4 2PLV4 1K5MD 1EAH4 3JD74 1RUF4 1BEV4 1H8TD 1POV0 2RMU4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R07 4;  1VRH 4;  2RS1 4;  4Q4X 4;  1HRV 4;  1RVF 4;  1AL2 4;  1ASJ 4;  4Q4V 4;  1EV1 4;  1RUI 4;  4GB3 4;  1RUJ 4;  1AR7 4;  1MQT D;  1AR8 4;  2RR1 4;  3J8F 4;  1VBB 4;  4Q4W 4;  2R06 4;  1R09 4;  2X5I D;  1VBC 4;  1R08 4;  1HRI 4;  1PO1 4;  2R04 4;  1NCQ D;  1RUE 4;  2RM2 4;  1RUC 4;  1VBD 4;  1HXS 4;  1D4M 4;  1VBE 4;  4RHV 4;  1PO2 4;  1COV 4;  1PIV 4;  1RHI 4;  1RMU 4;  2RS5 4;  4Q4Y 4;  2HWB 4;  2RS3 4;  1RUD 4;  1RUH 4;  1AR9 4;  2HWC 4;  4PDW D;  3JBG 4;  1NA1 D;  1AR6 4;  1PVC 4;  1RUG 4;  1OOP D;  1VBA 4;  1Z7S 4;  2PLV 4;  1K5M D;  1EAH 4;  3JD7 4;  1RUF 4;  1BEV 4;  1H8T D;  1POV 0;  2RMU 4; 
#chains in the Genus database with same CATH topology
 3AE8 A;  4Q4X 4;  3AEA A;  3AE4 A;  1HRV 4;  2WS3 A;  2WU5 A;  3AE3 A;  4Q4V 4;  1ZOY A;  2B76 A;  1MQT D;  3VRB A;  4YSX A;  3AE6 A;  3SUC A;  1RUE 4;  1HXS 4;  1D4M 4;  1VBE 4;  4YT0 A;  1PO2 4;  1COV 4;  1RHI 4;  1XI1 A;  1XHZ A;  3AEE A;  4Q4Y 4;  2RS3 4;  3P4S A;  3AEG A;  3VRA A;  2ACZ A;  3JBG 4;  3CIR A;  1OOP D;  1EAH 4;  3AEC A;  1BEV 4;  1POV 0;  3VR9 A;  2R07 4;  2RS1 4;  2R7F A;  4YSY A;  4YTN A;  2H89 A;  1NEN A;  4GB3 4;  4YSZ A;  1YQ4 A;  2RR1 4;  1VBB 4;  1R09 4;  3FI7 A;  1R08 4;  1XHX A;  2R04 4;  1NCQ D;  2PYL A;  3AE5 A;  1PIV 4;  2HWB 4;  3AE7 A;  1AR9 4;  4PDW D;  1NA1 D;  1VBA 4;  3AE2 A;  3GQH A;  1Z7S 4;  2PLV 4;  2FBW A;  4KX6 A;  2EX3 A;  1RVF 4;  1KF6 A;  1AR7 4;  1KFY A;  1L0V A;  2R06 4;  1ZP0 A;  3AE9 A;  3SFE A;  1RUC 4;  1VBD 4;  4RHV 4;  3AE1 A;  2WDV A;  1RMU 4;  2PW9 A;  2WDR A;  3P4P A;  1K5M D;  3AEF A;  2PZS A;  1RUF 4;  1H8T D;  5C2T A;  2RMU 4;  1VRH 4;  2WDQ A;  1AL2 4;  1ASJ 4;  4YXD A;  1EV1 4;  1RUJ 4;  3J8F 4;  1AR8 4;  2PY5 A;  3VR8 A;  4Q4W 4;  2WP9 A;  2X5I D;  1VBC 4;  1HRI 4;  3AEB A;  1PO1 4;  2RM2 4;  5C3J A;  3ABV A;  3GQK A;  3P4R A;  4YTM A;  1YQ3 A;  2RS5 4;  2WQY A;  2H88 A;  3P4Q A;  3SFD A;  1RUD 4;  1RUH 4;  2HWC 4;  4YTP A;  1AR6 4;  1PVC 4;  1NEK A;  1RUG 4;  2WU2 A;  3AED A;  2PYJ A;  3JD7 4;  1RUI 4; 
#chains in the Genus database with same CATH homology
 2R07 4;  1VRH 4;  2RS1 4;  4Q4X 4;  1HRV 4;  1RVF 4;  1AL2 4;  1ASJ 4;  4Q4V 4;  1EV1 4;  1RUI 4;  4GB3 4;  1RUJ 4;  1AR7 4;  1MQT D;  1AR8 4;  2RR1 4;  3J8F 4;  1VBB 4;  4Q4W 4;  2R06 4;  1R09 4;  2X5I D;  1VBC 4;  1R08 4;  1HRI 4;  1PO1 4;  2R04 4;  1NCQ D;  1RUE 4;  2RM2 4;  1RUC 4;  1VBD 4;  1HXS 4;  1D4M 4;  1VBE 4;  4RHV 4;  1PO2 4;  1COV 4;  1PIV 4;  1RHI 4;  1RMU 4;  2RS5 4;  4Q4Y 4;  2HWB 4;  2RS3 4;  1RUD 4;  1RUH 4;  1AR9 4;  2HWC 4;  4PDW D;  3JBG 4;  1NA1 D;  1AR6 4;  1PVC 4;  1RUG 4;  1OOP D;  1VBA 4;  1Z7S 4;  2PLV 4;  1K5M D;  1EAH 4;  3JD7 4;  1RUF 4;  1BEV 4;  1H8T D;  1POV 0;  2RMU 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...