2PYLA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC(2DA))-3'
total genus 161
structure length 571
sequence length 571
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pylA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pylA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pylA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pylA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pylA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pylA06
2RF2A 4CGGA 4C8KA 3HYFA 4M41A 4FJMA 3CFRA 4IG0A 3ASMA 3K5OA 1SKWA 3DRRA 4CHNA 4FJNA 3EY1A 5JS1A 2AJQA 4CF1A 1C0MA 1GOBA 2FC0A 4UQGA 3MAQA 3KK1A 3SI6A 4KAZA 3NF7A 4LH4A 1UAXA 3NFAA 1YT3A 4CFCA 3S3OA 1D8YA 1S5JA 1ZYQA 4DF4A 1CLQA 1SL2A 3B6PA 3QNOA 5CYQA 1FK9A 3FFIA 3KKRA 1TL3A 1NJWA 2YNIA 3OYKA 2YNHA 3PY8A 3BGRA 4LD0A 4DTSA 2F8SA 4FLTA 1BQMA 1RBVA 1S6PA 3LZIA 4Z4IA 2QXFA 4CECA 4H4OA 5I42A 1A5VA 3G10A 1HMVA 4AHRA 3KD1E 1TKTA 1WSGA 1WSEA 4YFUA 4LSNA 3AA2A 4BE0A 1T05A 3P5JA 1BIZA 1FKPA 2FBVA 4CEZA 4B9TA 3IG1A 3DI6A 4CFBA 5HRSA 1ZBHA 2X6SA 1SKRA 2YNFA 4BE1A 3M8QA 1U49A 4CIGA 3LP0A 1WSHA 1UA0A 1S9GA 2QKKA 2FBXA 4JS4A 3QEPA 4KHNA 4MQ3A 4FXDA 1RBRA 4CIEA 4CJKA 1RBUA 3MECA 1TK8A 4DQQA 4CEDA 1XC9A 1BI4B 5FRNA 3T1AA 1EXQA 3ZSYA 5T7BA 3I0SA 3SQ1A 4RW8A 3VQ9A 3U3YA 1IKWA 2D0BA 1LAVA 1ZBLA 3K2PA 3KTQA 3OYIA 3OVNA 4DTMA 4EZ9A 3HO1A 1LW2A 4CEEA 4Z0UA 3C6UA 2EX3A 3WNFA 3K5LA 3V9UA 3OYJA 3QETA 3DOLA 2HHSA 4CEAA 2OPSA 3HPHA 4CJEA 4W5NA 3AVHA 2D0AA 4FJIA 4PWDA 4B9SA 4KPYA 1HYSA 1QE1A 3PX6A 4NCBA 3NE6A 3AO4A 3L2UA 1NK0A 3PUFA 4RW7A 2ZQBA 3LAKA 1HQEA 4CJSA 3RR7A 3O3HA 4C8NA 1KLMA 4M3XA 3AVGA 1NK5A 4ELVA 4JRPA 3AA3A 4CJUA 1BHLA 4BE2A 4FM0A 3HP6A 1RT6A 4I2PA 3V1RA 1S1UA 4IDKA 2OYQA 5DK5A 4KHUA 1REVA 2ATQA 3F9KA 4Z4CA 2FBYA 3ZT0A 1DTTA 4CEBA 4CJLA 4DQPA 3V4IA 2E6MA 3CFPA 1JLGA 3VQBA 4DLEA 1EETA 4FJLA 3NHGA 1L5UA 4FLUA 2JLEA 4CHQA 1VSEA 4B8CA 3C6TA 1N5YA 2HNDA 4DQSA 4K8ZA 3AVLA 1WSFA 3VQPA 3L2RA 3V9SA 5J2PA 1NK6A 4CF0A 3RMCA 3AVFA 4E0DA 1X9MA 3K5MA 4QCLA 1HQUA 3VQ8A 4J2BA 3OYAA 4Z4FA 2KZZA 1RTIA 3ZT3A 4CE9A 4YNQA 2GBZA 4H8KA 3NH2A 3ZCMA 3HT3A 4K8XA 4HCCA 3PX4A 3SUNA 1KSPA 2F8TA 2KFNA 5HP1A 1VSKA 4Q5VA 2VG5A 4IFVA 2X6NA 1G15A 3HVRA 3OYHA 2VWKA 4RW6A 3SV3A 4CJ4A 3L8BA 3RRGA 3V6DA 1QS4A 2XY6A 4OKJA 1FXXA 4OJRA 1UOCA 3AO3A 2E4LA 1HRHA 1ITGA 1KFDA 3NF8A 4E7KA 1JLAA 3DOKA 4L8RB 4AHVA 1ASWA 1TGOA 3OS2A 1CZBA 3MEDA 4DFPA 1TV6A 4CHOA 3SV4A 4MFBA 4OLBA 5EU7A 3MXJA 1LWFA 1W9HA 2YKMA 3F73A 2IDOA 2GV9A 3QEXA 4F3OA 4CF8A 4CF2A 3OYEA 2HHQA 1ASVA 3L3VA 3THVA 5C24A 1NK9A 1Q9YA 2Q3SA 1EKEA 1F21A 2A1SA 1Q8IA 4AHUA 4KHSA 3VQ6A 4KRFA 1U47A 4Y1DA 1JLEA 3ZSWA 2XY7A 1NOYA 1QSLA 1C1CA 3L2QA 2R7FA 4OPKA 2OZMA 3DRPA 2KQ2A 4PQUA 2G8HA 1HPZA 3U6FA 2HVIA 2DFFA 3PV8A 5FDLA 2IAJA 2X78A 4KV8A 4O0JA 5HROA 2P5GA 4FZYA 3QEIA 3V9ZA 3KLHA 4F3TA 5KGXA 4DQIA 4AHTA 4O5BA 4B9NA 2HHWA 4RW9A 1NJYA 2HHUA 1GOCA 1S1XA 2RKIA 1R0AA 3HPOA 3EZ5A 1TKZA 4FZXC 3D0PA 3NBPA 5HRPA 4LH5A 3SCXA 3RR8A 3O3GA 4Z4EA 4DWIA 5KGWA 2Y1JA 2FBTA 3RMDA 1J9AA 2Z1GA 5C25A 3O3FA 4CJPA 3CFOA 1RDAA 1C1BA 5CY4A 4NYFA 3OYMA 1XI1A 1I39A 1RDDA 3OYDA 4B08A 3AVAA 4JRQA 3ZT4A 3KD5E 2OZSA 4ZHRA 1RT7A 3ZT1A 4CGHA 3TAMA 2IC3A 1RT1A 3KLFA 4DQRA 4E7JA 2WOMA 3S3MA 4ELTA 3OJSA 1W0HA 3TAPA 3AO1A 1SL1A 4KHWA 1Y97A 3LWMA 3DLKA 2DFHA 3CYMA 4I7FA 4DTJA 4DFMA 1TK0A 2G8UA 4CGFA 1BCMA 1J5OA 5HRRA 3O4QA 5J2QA 3NH1A 1JKHA 3L2VA 4I9LA 2HMIA 4FK2A 3BDPA 1WN7A 3AVJA 1VSFA 5C42A 4FK4A 1CXQA 1BCOA 1BIUA 3ITHA 4I2QA 3DLEA 2B5JA 3P1GA 1S1VA 3K5NA 3AVBA 1VSIA 4DSJA 1K6YA 4ID1A 2OPRA 3MEGA 1RNHA 4M3UA 3LPTA 2I5JA 3RRHA 3ZSVA 1X9SA 1I3AA 4N41A 4B9VA 1KVBA 1JLFA 3KJVA 2KZMA 4KTQA 3OYNA 1TAQA 4LY7A 1X1PA 1YVUA 1KVCA 4FJGA 5DMRA 1RTJA 2D5RA 4CFAA 3QO9A 4CEQA 4EP5A 2P51A 4W5RA 1KLNA 4O4GA 1LWCA 1CZ9A 4C8OA 3AA4A 1GOAA 2RPIA 1QQCA 1XHXA 2B4JA 3OYBA 2G8IA 2DFEA 4IG3A 4LSLA 4OVLA 2DTUA 4CEFA 1TVRA 4JS5A 3JYTA 3FI7A 4DS5A 1KFSA 1VRUA 5KI6A 2ETJA 4CGDA 3KLGA 1KRPA 3AVNA 4FVMA 4KB1A 5JS2A 3KKSA 1NK7A 1SKSA 1A5XA 3V9WA 1A5WA 3TABA 2F96A 2HNYA 4ID5A 3VQCA 1BQNA 3QIPA 2IGIA 4W5TA 1JLQA 4CESA 4B9LA 3OY9A 1C0UA 1WSIA 4RW4A 2YHAA 4AHCA 4KFBA 3QLHA 4NCGA 5CZ1A 3V9XA 1D5AA 3K57A 1BISA 3LPUA 4FYDA 4CK2A 3RWUA 4J2EA 1TAUA 1CXUA 3AVKA 1BGXT 3TR8A 4GVMA 3AV9A 3VA0A 4DSFA 4BACA 1NK8A 5SZTA 5FROA 2QK9A 1RT5A 5KRSA 5CZ2A 1S1TA 3SUQA 2A1RA 3NAEA 2BGGA 3LZJA 4EZ6A 4Y1CA 4HUFA 1JLCA 3CG7A 3C95A 3SQ0A 3K59A 4FJ5A 4BDYA 1EP4A 3I0RA 1U48A 1YTUA 4DU3A 4KKOA 5SWMA 4CJ3A 1ASUA 3NGZA 3DLHA 4CHYA 3NF6A 4E3SA 2KW4A 3VQ7A 1SL0A 4H4MA 5HBMA 3K58A 1C6VA 1RTHA 3HSTB 4GW6A 5K14A 4DU4A 2XY5A 3MXIA 4F2RA 3AVCA 4FJ7A 1RT3A 4FLWA 1IKYA 3HK2A 3NH0A 4IBNA 4OGEA 3HXMA 1S9EA 4XIUA 4QOZB 1B9FA 2IS3A 4HVJA 3KK3A 1U45A 1LV5A 4FW1A 4J2AA 3NCIA 3A2FA 4KREA 3UIQA 2PYJA 2B6AA 3U3GA 2Z1JA 1Z25A 3SPYA 1RBTA 1YTAA 4E7LA 4I9QA 2OA8A 3PO4A 4M42A 4B3OA 1RCHA 3L2WA 1JL1A 1HYZA 5FRMA 1B92A 2PY5A 4DMNA 4DTPA 4E1NA 3AVMA 2PYLA 3VQQA 2BE2A 3OS0A 4CK1A 4R5PA 4CJQA 5KRTA 3OYCA 1BL3A 1ZBUA 1BI4A 1IH7A 4B8AB 4E89A 3AO5A 3KLIA 1KCFA 4DTOA 4DSIA 1IG9A 3D45A 5J1EA 4DF8A 2PW9A 4N5SA 3MXMA 4FCYA 4DG1A 2YHBA 2VG6A 4CJFA 3HP9A 4Z4GA 3TAGA 4AH9A 1T7PA 3CQ8A 5J2NA 4DS4A 4KO0A 4AHSA 2W42A 3O4NA 3SQ2A 1S1WA 3C94A 4PY5A 4CJRA 1RDCA 1RT2A 1U04A 2JGUA 4N56A 1TKXA 1NOZA 4DTXA 4B9MA 4BWJA 1O1WA 2DY4A 2XHBA 3TWHA 2YV0X 1LAWA 4ICLA 3M8PA 4KI4A 3WNEA 1LW0A 3ZSXA 4FLZA 1TK5A 3IAYA 3IRXA 1WNSA 2GUIA 3LP3A 1IKVA 4RG8A 3V81A 1RT4A 4DU1A 3SJJA 1RBSA 2G8FA 4B9UA 4GMJB 2HHTA 3VQAA 3SYZA 3TAQA 4CHPA 3DLBA 5I3UA 2Y1IA 1D9DA 1SV5A 3TANA 2VG7A 4CFDA 4CCHA 4OKKA 3DMJA 3MEEA 4QAGA 1RILA 2O4GA 2YKNA 3ZSQA 3QERA 3HL8A 3DYAA 2E6LA 4Z4HA 1X9WA 1WSJA 3LP2A 4NYNA 3WNHA 3RMAA 4KTWA 4E19A 1MU2A 1HYVA 1N6QA 4ZTFA 3ISNC 4DSLA 3VQEA 3ZSZA 3QNNA 2LSNA 1T03A 1QSYA 4FJ9A 4FM2A 1B9DA 1IKXA 4CJVA 1NJZA 4M3RA 2ZE2A 1VSMA 5CYMA 1D9FA 4OGCA 4CIFA 2XO7A 4OKEA 4DTUA 4E7IA 2EHGA 3H08A 3V1OA 5KTQA 2HNZA 3DM2A 4KHYA 2HW3A 1VSDA 2Z1IA 1QTMA 1L3UA 2VWJA 1S6QA 3VQ5A 3WNGA 3PX0A 3QEWA 1QHTA 1NKBA 3L3UA 4TSXA 2OPQA 4G1QA 3TI0A 1U4BA 2KFZA 3OYGA 3KLEA 4HUGA 4CJWA 1UWBA 4KB0A 4FM1A 3M8SA 4FJXA 3E01A 4IKFA 3ZSOA 2OPPA 4OPJA 3SPZA 3LP1A 1ZBIA 3KK2A 2XY8A 3TAEA 4BWMA 3EYZA 2G8WA 4C8MA 2HVHA 3P83D 3NF9A 3CM5A 4W5QA 3DLGA 4HTUA 4E7HA 3B6OA 3VA3A 3OYLA 3M8RA 1WLJA 3ZSRA 3I8DA 1NK4A 1L3TA 3S3NA 2P5OA 4FLXA 4DSKA 4FZZA 4O44A 1RTDA 1C1AA 3OS1A 3PO5A 2Z1HA 2RN2A 3LDSA 4M3WA 2XRIA 1Z26A 1HJRA 1NJXA 3QIOA 4ZTJA 3SZ2A 3RMBA 1QSSA 2KTQA 3TAFA 4OLAA 4HCBA 1JXBA 1VRTA 3HPGA 5HRNA 3SUOA 1L3SA 4M3TA 4DFJA 4CJ5A 3HJFA 4AILC 4KHQA 1TL1A 4CK3A 4BDPA 3T19A 1VSHA 1XWLA 1UA1A 1J53A 1ZBFA 4CERA 3QEVA 4F2SA 1HNVA 1VSJA 4FJ8A 2HHXA 1TKDA 3V1QA 4IFYA 5E41A 1WAJA 3QESA 1JXEA 1DTQA 4WE1A 3AA5X 4JLHA 3VQDA 2G8VA 3T3FA 2BDPA 3LAMA 2BANA 1NKCA 4FJKA 4CGJA 4FJJA 1VSLA 4CGIA 3TARA 4ELUA 3QINA 4FK0A 2HHVA 3OYFA 5D3GA 1DLOA 4FJHA 1C0TA 3DLRA 4KI6A 4CEOA 3LANA 2YNGA 4BDZA 3AO2A 1XHZA 3NDKA 1NKEA 1IO2A 1EX4A 1VK0A 2WONA 4W5OA 3HVTA 4E1MA 4M3YA 2X74A 4O0IA 2PZSA 5HLFA 4NCAA 4Q0BA 2D0CA 1FKOA 1KVAA 4CJTA 4DLGA 2ZD1A 2HB5A 3ALYA 3RTVA 3CM6A 4FLVA 4DTNA 2P1JA 3AVIA 3JSMA 1Q9XA 3KIOA 2R7YA 4HHTA 3SQ4A 3SUPA 1JL2A 4KTZA 4M3ZA 2QKBA 1KTQA 4C8LA 1T8EA 3LWLA 1HNIA 4J2DA 4DFKA 1RDBA 3NGYA 1J54A 4CF9A 4F4KA 4FW2A 4HUEA 2NUBA 3ZT2A 4F8RA 4PUOA 1SUQA 3VQ4A 4FLYA 3G0ZA 3S9HA 3SNNA 1LWEA 3HM9A 3LALA 2G8KA 2O4IA 3IS9A 5J2MA 3VN5A 3DRSA 4M45A 4PA1A 4N47A 4DSEA 1L3VA 4O55A 4CHZA 4EP4A 1WAFA 2ITGA 1JLBA 3OJUA 3ULDA 3NGIA 4N76A 4DTRA 2IOCA
chains in the Genus database with same CATH superfamily
2ZJRL 2H89A 1YQ3A 4FL9A 1GAXA 4C8KA 1N8RW 4JI7O 1OH6A 3EKSA 3CFRA 4X89A 3SJHA 2HKOA 3K5OA 2LFSA 5KX5B 1ZSPA 2YUAA 2CGJA 3J8F4 4IYIA 1BG3A 2RN9A 3ZHUA 3FB6C 2X6CA 3OTOO 5JH7B 4I55A 2OCCB 2FC0A 3MAQA 4Z1VA 2QA4V 4KAZA 1JJ2U 1VBC4 2AZ0A 4JI0B 1OCOC 3HKEA 2WLKA 4MVSA 1S5JA 2QDOA 5BR8O 1R3KC 1CLQA 4Q4Y4 3QNOA 5CYQA 5H2FZ 3KKRA 4J42A 4E2LA 5JQGB 3OYKA 3BGRA 1BHAA 4F6EA 3K9KA 5ITZA 3LZIA 2QXFA 4CECA 2VQEB 4JI5O 4JD2A 2DQ0A 1TKTA 5AQXA 3AA2A 4K25A 4CEZA 2FBVA 2QM8A 3CS5A 2UUBB 2W6IG 5KMGA 1VQ9V 4CFBA 1SKRA 3M8QA 3LP0A 2RMKB 4IFEA 1ZAUA 4I0XB 2Q7EA 3OTOB 4DV2B 3P39A 1WSHA 3O1BA 4GCZA 3QEPA 5C8YB 4KHNA 2ZM6O 4FXDA 1EWQA 3K9AA 1X59A 4UB8Z 1YIJV 3T1AA 3UT5B 1EXQA 2P9PB 3CSXA 3OR7C 5T7BA 3EHBB 4DV5O 4DV7B 1LAVA 1ZBLA 1S72N 3HO1A 3OYIA 2P9UB 4DTMA 1WPXA 4CEEA 3C6UA 2EX3A 4RWUA 2CDYA 3K5LA 1HR0B 3WNFA 3V9UA 1M1KO 1HNZK 4WF9L 1HXS4 2KQXA 4IO8A 2DYRB 3HKBB 4BR5A 3AVHA 2D0AA 1SAZA 2ITDC 4B9SA 4BY9C 5A2QO 4RAIA 4NCBA 3FZFA 3PX6A 4H0TB 3AO4A 4QNHB 2ZQBA 2NRZA 4ABMA 2WU2A 1N0NA 1NGCA 2OIGA 1JX9A 5FLXO 3AE1A 2GSMB 4JRPA 2A9HA 5LA6A 1XMOK 2RQ6A 4JKEA 3CXCM 1Z5WA 3AE7A 3AG2B 1NH2D 4X20A 2YEVB 4IDKA 1REVA 5IE9A 2EIJC 1PO24 2ATQA 2WPDG 1E4FT 2FBYA 5IY5B 3ZT0A 4CEBA 3CYOA 3CRAA 2PI5A 1TAEA 1CEZA 2E6MA 4DW1A 1FFTB 1EETA 1ZXOA 3MK6A 3VOVA 4DLEA 3T1HB 4D7TA 2CGOA 4GX0A 3DXMA 4JZGA 1VSEA 3ZN0A 3RYFA 3A0RA 3UT5A 3WB2A 2W0FC 2HNDA 2P9PA 3VQPA 2ZGYA 4DQSA 4J8FA 1V55C 3ZX2A 2XAJA 1Y66A 4LF7B 1HLUA 4LFCB 4J2BA 2KZZA 2JS3A 1VQ5N 1SA0B 1M56C 5JH7A 2YEVA 4K8XA 3VQVA 3P4RA 3APQA 2EBOA 5HP1A 4IFVA 2X6NA 3CHXA 4DR5O 4NXNB 2VWKA 3ABLC 1X3MA 3RRGA 1QS4A 5LL6Z 3B8NA 5FPOA 4OKJA 3VEOA 5C2FA 2D1KA 1UOCA 4E7KA 1HRHA 5JQGA 1ZTEA 1H2MA 1KAXA 1KQSM 4CBCA 1JLAA 4J11A 4CS3A 1Z05A 3OS2A 1YHQV 1B6QA 4JK8A 4CHOA 2CTPA 3FAVA 5EU7A 3MXJA 4A5UB 2A0LA 2Q7HA 4BC3A 3F73A 3STLC 3QEXA 4F3OA 4CF8A 2AW9A 3BVOA 5B3SB 1NBWA 5C24A 2Q3SA 1EKEA 3D6RA 5EOYA 3VQ6A 3WXMB 3J7AU 1JLEA 1Y74A 2QM7A 2XY7A 1NOYA 2GX9A 3Q7CA 4OPKA 3IUCA 4QS9A 4TWKA 4U7OA 2KQ2A 4YXDA 1BQZA 4KHWA 3ZIAG 2X78A 4KV8A 4O0JA 2P5GA 4YOXA 1Q86O 2X6AA 3AE4A 3R1XA 1YTFD 2V51B 3IJ4A 2B76A 1EZVH 4IIJA 3ATVA 1SQQH 2JEUA 1YDXA 1R0AA 3HPOA 3D0PA 2WLIA 5BRFA 4GX1A 2CGKA 2E3CA 2Y69C 3RMDA 3VQYA 1OCRC 3SPGA 4BREA 5C25A 4NXMB 3CFOA 1RDAA 1C1BA 4OX9K 1XI1A 1RDDA 1ZP0A 4JRQA 3N2GB 4ZHRA 1YUWA 3WU2Z 3SK3A 4CGHA 1NR1A 3TAMA 2IC3A 2RR14 1RT1A 4F4LA 4JI6B 1GLEG 2H94A 4ELTA 3VEVA 2XOKG 1W0HA 2HWC4 5IWAB 2UXDO 2HHHK 1VQ5V 4JKFA 5KHJA 3CYMA 4GY2B 4HBNA 3FFQA 1TK0A 2ADPA 3E2EA 1BCMA 2YHWA 4JI2O 5J2QA 1J5OA 3VQWA 2F4VO 2HMIA 2IBZH 3BDPA 2LP7A 3G80A 1YJNV 3X2QB 1CXQA 3ITHA 4FWMA 4I2QA 2O8BA 1YEWA 2LGQA 2B5JA 1S1VA 2R9AA 2CE4A 3OMAB 3G71N 1K6YA 4DSJA 2OPRA 1F4MA 4M3UA 1O13A 2F93B 2EIKC 3TGUH 5C2DA 4YOWA 2PBDA 3ZSVA 3RRHA 1X9SA 4FWLA 1FS0G 3ZHQA 1X9JA 2YJEA 3KJVA 1SS3A 3A0HZ 4LH7A 1GLBG 1HKCA 2LO1A 4P9PA 2DOSA 1VBD4 2NRTA 2GTSA 3ZRSA 1RUG4 2HVKC 4MO4A 2ASOA 3SGIA 1XUQA 1RTJA 4CFAA 3ABMC 4CEQA 3P30A 3ZEUB 4O4GA 4F6RB 1CZ9A 4XH5A 2ASPA 4CZGA 2UXBK 1TVKA 3JCZA 4BRKA 5HOOA 1BDGA 2P22C 1N32O 4LSLA 1TVRA 4JI6O 5F1XA 3FI7A 1KFSA 1N33O 1SZTA 1FXKA 4ZI7B 5JS2A 4LFAO 1K34A 1NJIW 3CX5F 4OO1J 3VQCA 2HNYA 2GEMA 3CP1A 4OPHA 4X20B 1HR0K 4RW4A 4YXWG 2YHAA 4DR3O 4QIWF 4KFBA 4NCGA 2WFBA 1D5AA 3VF2A 3CCEN 1Z7S4 3LPUA 4PDWD 1M5IA 1P49A 2NRHA 2ZNIA 1QVGM 3RWUA 1TAUA 3CCVN 4GVMA 1VQKV 3KKYA 2YDEA 2R9RB 4DV5K 4DR6B 3S41A 3WXKA 3TSQA 4JI5B 2X7RB 2FL4A 2DWDC 1RT5A 5CZ2A 3SUQA 4B1UB 2XNDG 4CZMA 5DM6V 1K9MW 2A1RA 4EZ6A 4IZ9A 3CC4N 4HUFA 5L3EA 3CD6N 1S3XA 4FJ5A 4DV4K 4WBNA 1VQ4V 3I0RA 1WA8B 4TV8A 4DU3A 2CTRA 2P9UA 4B3SB 1Y6XA 2Q4PA 3JAKA 3CJHB 5GONB 1C6VA 3L4QA 3WEEB 5CMUA 2PAVA 3WB0A 2HG5C 4LF6O 1US6A 1NLVA 3ETQA 4YHHK 1YITN 3HK2A 3NH0A 3VENA 1VQPN 4B3RO 4I0XA 3ZEUA 2IS3A 4X64O 2O8DA 5LMNB 4HVJA 4FVUA 1GTOA 3LUTB 5GAHP 3KK3A 4JYAK 4FW1A 1GN3A 4NTXA 3OBYA 1JJ2M 4QGPA 3CIRA 3U3GA 1NMNA 2IJHA 4I9QA 2KLAA 3PO4A 4JAXA 4PA9A 1NVPD 3CRMA 1JL1A 1HYZA 1BT8A 1HR0O 5KHIA 3K79A 2PY5A 2PYLA 4ZBMA 5J2UB 2UUAO 2IVNA 2BE2A 4EEQA 4R5PA 4DR3B 3ENBA 5KRTA 4ISGA 2CK3G 1BI4A 1YXQA 1LR1A 5KQ8A 1NGFA 3EXAA 3KLIA 5KPRA 4DTOA 4DV6K 4I55B 2B9ZA 1XILA 1BS3A 4X1YB 1GN6A 2ODMA 4NR1A 2YJFA 3RWRD 4N5SA 1R59O 4FCYA 1IVSA 2UYTA 4GV6A 2YHBA 3B4SA 5B1NA 1VQ7V 2V4DA 2UXDB 3QB0A 3MN6A 3AARA 2ZJQL 1T7PA 2W40A 1AROP 5J2NA 1IBMK 3QBWA 5LGUA 3CCEV 3SQ2A 3ZMSA 1S1WA 2ATKC 2KHOA 3C94A 1LCUA 3ULEA 4N56A 1QU7A 1RUI4 4BW9A 2RCVA 3E22B 4B9MA 2QJ1A 2HBMA 4KI4A 2DWEC 4D7SA 3CPEA 4X64B 3WNEA 4B1VA 3TSUA 2D2CB 4O2AB 4RG8A 2KKZA 2GUIA 1EN5A 1BWFO 2G8FA 4OLAA 1RT4A 3JATA 4OPAA 4DU1A 1QQOA 2HHTA 3VQAA 3SYZA 3TAQA 1K5MD 5I3UA 2E5LO 3J8AA 2E5LK 3TANA 4CCHA 4OKKA 3BF3A 3SJBC 1RILA 3QMLA 3MX2A 5C10A 4XDLA 2B1IA 5AZJA 3ENHA 2IVPA 1X9WA 1KC8W 4E19A 3CJBA 4UCTA 2Y0PA 1ZLZA 1BA0A 3ZSZA 1QSYA 3CMAV 5AQRA 4FJ9A 3SR2C 2EZPA 4XEIA 3SYOA 1B9DA 1IKXA 3CI5A 1ATRA 1FD9A 5CYMA 4WQ5C 1AJPA 4OKEA 4E7IA 4GV3A 2F23A 3H08A 3F7VC 4D6TH 3DXKB 4ZKIA 1L3UA 4B7KA 4DV5B 2UUBO 1T6DA 3VQ5A 3WNGA 3CPWM 4O4IB 4DB3A 1Q6UA 3QEWA 1ZUQA 3N2KB 4JEPA 5AZJB 3ZHTA 3WEEA 1U4BA 4HUGA 1J6ZA 4CZLA 1UWBA 5MLCQ 3HKDA 4JASA 1S3JA 2QTSA 1H2NA 3KVGA 5FPMA 3UQ8A 3K9JA 4Y0WA 2OIEA 3FZKA 5BN9A 5BZBA 3UKRB 4EB6B 1EV14 4IIJB 1AI7A 5L3FA 3K04A 5AQTA 4BR7A 3DLGA 2UXCK 3VA3A 1VQ9N 4EHTA 3BA9A 2E2PA 4FZZA 1L3TA 4DSKA 3P38A 3WXJA 5AQFA 1G6UA 2EIKB 3MDSA 3OS1A 1NVPB 1K97A 2RN2A 1JCHA 3O80A 5LMUK 4IT5A 4X1KA 1RP3B 3AG7A 3CXCU 1FJGB 1HJRA 2W6LA 3D2EA 3GG4A 3QIOA 1NJXA 2QKCA 4KBOA 5BR9A 3JSLA 5LYJA 3O4WA 2ILMA 1IBKO 1GLCG 4DFJA 4OX9B 5LXTA 5B1OA 4BDPA 4JI3K 1WBDA 3BY6A 4UY8O 1VAZA 3H1KH 5FNVA 1XWLA 1UA1A 1ZBFA 2HHXA 2A06H 3DTUB 3QFPA 1JXEA 1FXKB 5EYPA 4DV4O 1WB9A 3AA5X 4JLHA 5L3CA 4EAHD 2G8VA 5C3JA 2BANA 1YAGA 1NKCA 4R7CA 3H3OB 4O4HB 1OCRB 4PA6A 4CS2A 4ELUA 3OYFA 4BRGA 4X1KB 1RUF4 4FJHA 5L3GA 1C0TA 5AQJA 4CEOA 4NTWA 1U2VB 1GRJA 3J80N 1J5EB 4BDZA 1XHZA 4UVBA 1BL8A 1Q3EA 3CERA 5BPLA 1R6NA 3ICXA 4YDUC 1EX4A 1NKEA 1JPXA 4FOEA 3HZ6A 5LP6A 3HPLC 4K0KO 4Q0BA 2UXCO 1FKOA 5FNVB 4RQEA 2HB5A 1XL4A 3N4PA 3F9MA 3ALYA 2BTFA 5A9GA 3RTVA 4MVQA 4ZI7A 3CM6A 4DTNA 3AVIA 1WPBA 3JSMA 2PLV4 2R064 2R7YA 1NGDA 4M7YA 4HHTA 2DPNA 4M3ZA 4C8LA 1T8EA 1E1RG 2E74B 4B1YB 1SZXA 4DFKA 2XUMA 1Z5VA 3JCUZ 3NGYA 5IYDO 2VCPA 1K92A 4FW2A 5CA0A 4BVPA 1BHBA 3G0ZA 1D4M4 2O4IA 5J2MA 3UE5A 2ZF5O 4M45A 4PA1A 4J7ZA 1L3VA 3CJCA 3OJUA 1RFQA 1JLBA 3MDQA 1DF4A 4DFMA 4FYDA 4CGGA 1YQ4A 1YVNA 4DCHA 3H1LH 4DV7K 1A32A 3U11A 3UKMA 2HEPA 5ITZB 4FWSA 3HYFA 4O5FA 4FJMA 4CZZA 1Q7YO 3U10A 4LC9B 4XDKA 2YHYA 1SKWA 2W6JG 3JASA 4NB5A 3LDEA 4FJNA 1H8TD 3ABKC 4LFBB 5IJ0A 2XAHA 1BZKA 3BPZA 3EY1A 1C0MA 4DV6B 1GOBA 3JBG4 1HNZO 1MMMA 1KF6A 1NTKH 4LF6B 2YCHA 2GUZB 3KK7A 3OUFA 3SAFA 3ABKB 1UAXA 1YT3A 4CFCA 1D8YA 1VIBA 1G4YB 3ETGA 1ZYQA 4DF4A 4DKWA 1SL2A 4QPJA 2WBNA 4JHDB 4QS7A 2GBOA 1AILA 2FSKA 1NJWA 2F4VK 2F8SA 3ML0A 2YNHA 4LD0A 1AR5A 3C90A 1KD1W 4CBXA 1S6PA 3HSCA 2Y48A 4H4OA 1A5VA 3G10A 4E4EA 1WSGA 2XASA 2FTKA 4I4TB 4YFUA 1W2BM 5FPEA 4JAUA 1BIZA 3SMSA 3HBTA 4B9TA 5LL6Y 2QWQB 3IG1A 2OTJN 3PJSK 4JKBA 4B3MK 5HRSA 2P67A 2I7PA 2YNFA 4MTXA 1U49A 1ZBSA 4DV6O 3C0BA 1KFYA 4Z1MG 2WDRA 1S9GA 4JKGA 4B3SO 4B3TO 2DE0X 1CP9A 4CIEA 1XC9A 1BI4B 4MLEA 4BIOA 3HKDB 3ZRWB 3UCSC 1QQNA 3VQ9A 1SKSA 4GKJK 3OVNA 4H33A 1YJ9V 1Q18A 1V4SA 1XC3A 3OYJA 4CE9A 3PLAA 2OPSA 4W5NA 2F95B 1TUEB 1L0NH 1VF5B 2RHKA 4JYAO 3D7EO 2DY4A 3QO5A 2JGDA 4KPYA 2PGGA 4RUEA 4JNEA 4YJ2A 1HYSA 4MW3A 4JAVA 5C93A 3L2UA 4X1YA 4BRFA 1L8DA 4O4JB 4CJSA 2NRWA 3EZWA 1XMQO 4C8NA 4B3TB 3AVGA 1NK5A 4ELVA 1FXKC 2QKSA 2L35A 2P7TC 2XAQA 4JI0O 1BHLA 4FM0A 2ZM6K 2WQYA 1BO5O 4EFBA 2IIRA 4I2PA 2ZNJA 3D2FA 4DV3B 4K35A 4FWNA 1YI2N 4KHUA 4DR4B 2O8FB 2E75B 3K0GA 1AR74 4YJ3A 3F9KA 4IEIA 4Z4CA 3W7TA 1IXBA 3FKSG 2YXYA 4CJLA 5B1BB 4DQPA 4FJLA 3VQBA 1Q82O 2Q5ZA 4BAYA 3NHGA 3FX7A 1DLBA 2VS0A 2M7WA 4DV1O 2OCEA 1L5UA 1RUE4 2JLEA 5JMVA 4CHQA 1N5YA 1H2SB 2ZXWC 2PI4A 2PTMA 2ZE8A 3AVLA 2O8DB 2HOEA 1GM8A 5J2PA 5AQGA 4BR2A 1VQNN 4I4TA 1OZ0A 3RYIB 4O4LA 3E22A 4E0DA 1X9MA 3QTCA 1HQUA 2HF4A 4DK0A 3VQ8A 4CZJA 3OYAA 1ZL8B 1NR7A 3SJQC 2UU9K 4YNQA 1L0VA 2P6JA 1OCOB 4H8KA 3TPQA 3HT3A 4HCCA 3AY9A 3PX4A 3ZN1A 4WCEL 1R3JC 4H37A 2GTAA 4Q5VA 3LNNA 2VG5A 3HVRA 2W0XA 3G67A 3OYHA 1AP5A 3AK2A 1TYQA 4RW6A 2UU9O 3SV3A 1R73A 4NLBA 2V1DA 1RPOA 4FPAA 4K43A 3V6DA 2O8EB 1QBZA 3ZMVA 1DT9A 1KFDA 3ABVA 2CH7A 1EQYA 4KXRA 4RTFD 4AHVA 4WFBL 1CZBA 1OOPD 4DFPA 5CA1A 3SV4A 4MFBA 3UB5A 1RSOB 3A8TA 4IEEA 1LWFA 2F1MA 2IDOA 2GV9A 2P9KA 1OVQA 5CBFA 4LFCO 4DR1O 1V4TA 3BZKA 3SUCA 4YSXA 2BTOA 4HZ3A 3RYCB 4O8KA 3L3VA 3THVA 1Q9YA 4NXNK 1Q8IA 1KP3A 4AHUA 5KUMA 3KWGA 4KHSA 4KH5A 1Z6RA 3E8BA 5TKYA 5EBWC 3HB3B 4J80A 4Y1DA 1IJJA 3GQHA 4CBWA 2HSTA 1QSLA 5AQUA 5GADP 2E20A 1SERA 5LOVB 4PQUA 2A3ZA 1F23A 4PKHA 4FZYA 4CJQA 3GQKA 1DEJA 1RUH4 3QEIA 2KG7B 3KLHA 3J7AP 5BXZA 4F3TA 2IJKA 4DQ8A 4KHPO 2MK3A 4O5BA 4IOXA 2WLLA 4B9NA 5JICA 1NJYA 1YI2V 1GOCA 5C8YA 3EZ5A 3VRBA 4WBNB 4FZXC 3MWTA 4B3RB 3NBPA 5EIBC 1GLLO 1K73W 5LMNO 4CZKA 2E2QA 3W7SA 3O3GA 4DWIA 3P4IA 3VOUA 5KGWA 4I6MB 3CCLV 2Z5UA 4BC5A 3AE3A 5M1KA 3JXUA 4NYFA 4LFAK 4DR5B 3JALB 4NXNO 3AVAA 1WJZA 2OZSA 4X65O 3DGEA 1RT7A 3AG4C 4MS2A 3ZT1A 5DM7L 3ZRXA 2P9KB 2Q69A 2GELA 3SMPA 4UCRA 4BW5A 3KLFA 1YJWN 3MX5A 3OJSA 4O4HA 2F9WA 3AO1A 1SQFA 1Y97A 5IWAK 1E3MA 4OX9O 1XMOO 3IDHA 4I7FA 4DTJA 3AEAA 1VQMN 2VYPA 3T1YK 4RHV4 4CGFA 2IU0A 1QQMA 1KYOF 2QE7G 3HKEB 2QM1A 3H1QA 4B3MO 2JVDA 4X66B 1WN7A 1VSFA 3O1WA 5C42A 3VEXA 2IM9A 4LF9B 4CH3A 3T1CA 3WFVA 4DV2O 3OEHG 2GUPA 3DC6A 2I5JA 1XNRB 1AVMA 1AJNA 4DV3K 4N41A 4J7KA 4DR4K 2ITMA 1YZBA 1JLFA 2H3GX 3N2GA 3AEDA 4YSYA 4LF8B 3OYNA 5J2TA 3CCQN 3E9LA 2Q0RA 1X1PA 1IBLB 3WXIA 1KVCA 2YSUB 2YIAA 3VGMA 5IT9N 3OYCA 3CCLN 1KLNA 3QO9A 3VR9A 2P51A 4W5RA 4IJNA 3CCMN 4B3MB 4YHHO 3T7ZA 3B77A 1GOAA 3N4QA 3QDKA 3WT0A 1N34B 4PI0A 2DFEA 3M7MX 3L0QA 4OVLA 4CEFA 4JS5A 5BREA 1VRUA 4CGDA 2ETJA 1KRPA 3E9PA 3HOSA 3SPHA 4KB1A 1SKVA 5KA6A 3DLLL 2F96A 1BQNA 3RVCA 4W5TA 2IGIA 4IXCA 4B9LA 1MZEA 5LHHA 4AQYO 4UCOA 3TSPA 3DJCA 3QLHA 1CXZB 4KH6A 3V9XA 2EIMC 5B1AC 5BMVA 5JCOA 4J2EA 3CRQA 3JD2A 3R65A 1CXUA 1BGXT 2A40A 1KMIZ 3AV9A 1TA8A 5AQLA 3OGIB 2JWLA 5AJ3K 5AQQA 1IBKB 1NK8A 4LFBO 4Q6GA 2CH5A 3THXB 5JWPA 4WFGA 3BZCA 3DWLA 4BRPA 5KRSA 4BR9A 1S1TA 4LF4B 5JLHA 4ILHA 2A3QA 1P7GA 3W7XA 3K59A 3KZIZ 5LGNA 2QTDA 4BDYA 1U48A 3NGZA 3DLHA 5DN6G 1AB3A 3PIPL 4B3SK 1B06A 3C3SA 3CC7V 2ZD9A 1SL0A 2Q9LA 3K58A 2XY5A 4F2RA 3APOA 1K5SA 3FD9A 1GLDG 4H5NA 3RVZA 1RT3A 1IKYA 2VQFO 3JYCA 3NVKA 3U4LA 3ABMB 4XH1A 3RW0A 4HNAA 4PDLA 4DV0B 2ZM6B 1HPMA 3VMFB 3RYFB 4H5VA 1U45A 2DYSB 2FSJA 1M93A 3E83A 4LFAB 3R66A 2NLXA 2WLMA 1EN4A 1ILYA 1G1XB 1BA1A 1Z25A 2RE2A 3C6HA 4FMTA 1NU1H 2OA8A 4M42A 2JEXA 1RCHA 2P9NA 3A5LC 2HLDG 4Q20A 3FAVB 1JA8A 5FRMA 4FWOA 4YOUA 4DTPA 4N23A 3VQQA 4TV9B 4LF4O 3OS0A 3H45C 3FZHA 4CK1A 4JTDB 1LUWA 4J7JA 2XAGA 4BC2A 1BL3A 1TUYA 1IH7A 1ZBUA 4WFBV 4HWIA 4B8AB 4BG9A 2JRIA 3OUSA 3AO5A 2R044 3M8AA 1KCFA 1IG9A 3D45A 3J80O 5J1EA 4ICGA 1YJWV 1R1BA 1MZFA 4I50B 1S5HC 4M63C 4HTLA 3ZMUA 3L71H 1OVYA 2RS34 3HKBA 5EZYB 4AHSA 1PIV4 3D3QA 4K42A 5GAGP 2EZOA 1BGYH 4FFBB 1RT2A 2D0PA 4MTGA 1TKXA 1NOZA 4IYHA 4JZ2A 1IV0A 2WLLB 2XHBA 1SRYA 2A79B 5EY4A 4PD4F 3M8PA 4DV0O 1LW0A 4MLHA 5KHKA 3LP3A 3DXMB 1IKVA 3WG7B 4WFAV 3RBZA 3N27A 3V81A 2AJQA 3MCAB 1KB9F 4CHPA 1Q43A 4Z94A 3GBTA 5BRHA 4QAGA 4I50A 1M4UA 1VQ7N 2UUCK 2V52B 2QWPB 3G71V 2YC0A 3QERA 1K8KB 3LDDA 4ZHQA 4X62K 3LP2A 3C65A 4KTWA 2JS5A 1MU2A 1N6QA 2ZXWB 1P4RA 3LSSA 4X64K 3VQEA 3QNNA 4YT0A 3TK1A 4FM2A 5B1BC 2LW1A 1KXPA 1ESVA 3K08A 4M3RA 4CJVA 1NJZA 1VSMA 4X65K 2P9NB 1XDCA 1FAFA 1XL6A 2Y0IA 4TUYA 3RSEB 2RJZA 1V9PA 2WLNA 4U7NA 1SQGA 3DM2A 2HHHO 3DXRA 2JWKA 5AQOA 5M1QA 2UXDK 3CC7N 1QTMA 5JVDA 2BE3A 4G2KA 2VWJA 5GIOA 3JD1A 1QHAA 2JDIG 4TSXA 1NKBA 3SFDA 2OPQA 4G1QA 3TI0A 1K3EA 4BRHA 2GHYA 3CQXA 4K41A 3M8SA 3ABUA 4IKFA 4OXSA 3O8MA 3A5NC 4LP8A 3EL2A 4CZFA 1ZBIA 4O4LB 3OR6C 4BWMA 3NF9A 4E7HA 4IOAL 3EE9A 5LJWA 5F0XA 3M8RA 3ZSRA 5KMGB 4FLXA 4DV7O 1ATNA 1XQSC 4JTCB 4O44A 1XNQK 4W4LA 3K03A 2Z1HA 1VQON 1G99A 4M3WA 2BOBC 1Z26A 4YY3O 2O8FA 1MABG 1NQTA 2KTQA 3VGKA 1JFFB 3QF7A 3TAFA 2WP9A 3N2KA 1HRV4 4FWQA 3HJFA 3DC5A 2ZIMA 4DUYB 4AILC 4KHQA 1FYJA 4XH4A 1VMGA 1NA1D 3T19A 1M57C 1FW6A 4CERA 1VSJA 1TKDA 3V1QA 4IFYA 2NRVA 3AG4B 1YTFB 2RDCA 4BWAA 3EKUA 3QESA 3W3DA 2BDPA 3T3FA 3MHHC 1NNEA 4UXNA 4LF7O 4FJKA 3CMEN 1H2KA 3LSQA 2WC9A 4FK0A 4BIZA 1DLOA 2FYUH 4BVOA 2Q97A 3LDCA 3LANA 5I9EB 3NDKA 4JGSA 3BAAA 4QJFB 5BR8B 1VK0A 2WONA 4M3YA 4E1MA 3RFRA 1KAYA 2X74A 4O0IA 1N33B 3ZHVA 1D5NA 1KVAA 4K3AA 2ZD1A 1GO3F 5E84A 3P4QA 3O5BA 4YSZA 1RVF4 3X2QC 2H8PC 5CN0A 5CB4A 2E1YA 3SQ4A 1URFA 5IYBO 3OW2U 1JL2A 3B8MA 4KTZA 3RVYA 3SUPA 2O57A 5M1FA 1RDBA 1J54A 4DR3K 4F4KA 3ZHSA 2HMPA 3SNNA 4FLYA 4MDBA 1NEKA 1Y74B 4GV9A 1NGAA 1TUUA 3DRSA 4JHDA 4QE7A 3J7ZO 1PKXA 4N47A 3VEYA 4DSEA 2ITGA 4B9QA 4GNIA 4BRQA 2QK9A 4ZIBA 5E79Z 4N76A 2IOCA 4H0VB 3G4SN 3H1HH 2Y69B 4P2ZA 2QXLA 4X1IB 5D5PA 5K1XA 4M41A 5K1PA 3CMAN 4IG0A 5CHIA 1Y76A 4LWSB 4EHUA 4UVAA 3H1IH 1J95A 3VQXA 3DRRA 1SC5B 4CHNA 1K4DC 1N36B 5KPTA 2Q0AA 3JD3A 1VQ6V 4MDAA 4EIAA 1RDWX 4UQGA 2A5XA 4CVNE 4CC6A 1H38A 5JJJB 4IL6Z 4LH4A 3NFAA 3S3OA 3NR7A 1AI6A 4MW8A 2E76B 1EM1A 1E1QG 4BR4A 1IURA 3LDPA 4NLCA 4F9OA 4H03B 3FFIA 1TL3A 1R084 4B3RK 1JCGA 1YVWA 4DTSA 2CH6A 3CCSN 2LW7A 4FLTA 1BQMA 1COWG 1RBVA 3BUZB 4Z4IA 2QTOA 1EZJA 5I42A 1H2LA 4JF3A 5IWAO 1MOFA 5H6RA 1WSEA 5B3SC 4BE0A 1T05A 3DI6A 2KG7A 1ZBHA 2X6SA 3ID8A 3ZRVA 3VTHA 3TTCA 4BE1A 3ZBHA 5AQHA 3JAMN 1KU9A 4TT3G 1Y67A 2EJRA 4JS4A 3P3PA 4CJKA 2EINB 3AEFA 1TK8A 2ADQB 4CEDA 2Y4TA 3ZJZA 1IDSA 1T6CA 4JI4B 3CJ7A 1WP7A 4RW8A 3L74H 3U3YA 1IKWA 2FF6A 4H13B 4NXMK 2P9SA 4RO2A 4B1WB 4FPPA 3E9OA 4RQFA 3KTQA 4HAMA 2Y4UA 3QETA 1RUJ4 2K1EA 2P4VA 3E66A 3CCRV 1HDJA 2MW2B 5E1AC 4CEAA 3AECA 1HNWK 3B40A 1COV4 4JV5B 1S72V 3BEXA 5EYPB 5HFMA 1GM9A 4FPBA 1QE1A 1NK0A 1BEV4 1E79G 4I5SA 3WQTA 3OTOK 4RW7A 4DV2K 5B5EZ 2Q73A 3I55N 1VQNV 1KKCA 1HQEA 3RR7A 3O3HA 1TYQB 1KLMA 1MNGA 5LMUB 3LL3A 4DUZK 4BE2A 4A2AA 2ZKOA 3HP6A 5KLVH 2ZCEA 1S1UA 1HW7A 2OYQA 4JKAA 5DK5A 4X62B 2LJ2A 1V54C 4H0LB 4W4KA 1DTTA 2B1GA 3OT7A 3DSQA 4DUZO 3G25A 2UUAK 3QG5A 2YIBA 2QEXN 4GB34 1VQPV 4JI8K 3ZCCA 4B8CA 4YY3K 2HBKA 3THYA 3L2RA 1VBB4 1HUXA 4CF0A 3TU5A 3RMCA 2AXTZ 4QCLA 2R074 3K5MA 3FYIB 5CA0B 2D3OW 3HI0A 2VRZA 1NZ6A 5IDJA 4DR7O 1N34O 4C23A 4Z4FA 5H9CA 1C0FA 3IMXA 3NH2A 4IJAA 1KP2A 1L0LH 4PDRA 3W7WA 4IWVA 4L3QA 4KHPK 2Q1NA 3JAWA 4UCUA 4LNUA 3TJTA 3AGKA 3UKUB 3ASNC 3ASOB 4FFBA 2F43G 1G15A 1C0GA 2NNWA 2ASMA 3GVMA 4CJ4A 1AL24 2NZTA 2XY6A 2H3OA 2WAMA 2QWNB 4LF5K 3AO3A 4NYKA 2EINC 2ZWHA 1VQMV 1R6TA 1W7AA 3DOKA 4L8RB 4DYLA 1ASWA 3L70H 3AE6A 5IT9O 4PV1B 1W9HA 2YKMA 2UXXA 1Q5OA 1NWKA 3OM3B 2ZE7A 1GLJO 2BSKA 1SQVH 5IYZA 3THWB 3KZBA 1YCIA 3BCCH 1FFXA 1F21A 3H6EA 3AGRA 4JI5K 4EFHA 5LMUO 1OHHG 2M6YA 2P06A 3E8HA 3H9VA 2RNBA 2O8EA 1R6KA 1WAZA 1JVMA 3L2QA 3JATB 3DRPA 2H88A 2WS3A 1HPZA 1PP9H 4H0PA 3U6FA 3PV8A 2HVIA 1RMU4 4RUFA 5HROA 3KHYA 4DR2O 4DR2K 1S5LZ 3QICA 5FPRA 4DQIA 2OCCC 3VBBA 3CCMV 3CC2V 4AHTA 3CJ9A 4BGAA 4MVZA 3VPZA 3CF5L 1KC8O 1VQ8V 4RW9A 2C2AA 2HHUA 3JD4A 4LCUC 1DKGD 3OGCC 2FB5A 4JYBA 2RKIA 3O9RA 3RYHA 4CJ7A 3OW2M 4IOCL 1K9MO 1WOQA 2CAZC 3M6GA 1WB7A 5HRPA 1R3LC 4LH5A 4CW7B 3RR8A 4Z4EA 1DTOA 2Y1JA 5C0YA 3THXA 1RM1C 3O3FA 5BPMA 1EFRG 3SDLA 4DUYK 4LBEC 3EO3A 3DAWA 3OYMA 3OYDA 3WXLA 3ZT4A 5KUKA 4NKGB 1HNXK 4TUYB 3H01A 1KBHA 2E2NA 5JCOC 3D3IA 4E7JA 3SBGA 3S3MA 3AE9A 1Q6HA 2OT5A 4GX2A 4X88A 3LWMA 3AE2A 2DFHA 1FFXB 4ILGB 1H8HG 3VESA 5J2UA 2O8CA 2CGNA 3ZYYX 2W6KA 5HRRA 3OMNB 3L2VA 4I9LA 5LMNK 4FK2A 3AE8A 1Q81W 3HTVA 1BCOA 1BIUA 3DLEA 2AZ2A 3P1GA 1POV0 3K5NA 5JJEB 1RGIA 2P9LB 4I6MA 1VSIA 5IYCO 1RNHA 2QA4N 1GLFO 4GKJB 1I3AA 1VQ8N 2CTQA 5GAEP 3C6AA 1VRH4 2X5ID 1QLNA 1KVBA 2UUCO 1DGSA 4K0KB 4DW0A 4A57A 4KTQA 4AF1A 4PA3A 5EXWA 1QZ6A 4LY7A 1CPYA 1QZ5A 1D2DA 3LDLA 4GVEA 4FJGA 2FSNA 2Q0OC 4PI2A 1T5EA 1HWYA 4DR1K 5BN8A 1LWCA 4C1NI 3G6EN 4C8OA 1GK9A 4BROA 1PO14 3T1YO 1RPRA 1VEWA 5EZYA 1XHXA 5AFUH 2JK5C 4B3TK 1R3IC 2VWBA 2AGAA 3JYTA 3K0SA 3GDQA 4DS5A 4CZIA 3CB2A 4JYCA 2NRXA 4UV8A 1WP8A 3I33A 5KI6A 2JIZG 3AVNA 3EFFK 3ZMTA 4FVMA 1XMQB 4UUJC 5GINA 1T44A 5LA6B 1NK7A 1A5XA 1NI8A 1A5WA 3TABA 2F4VB 4ID5A 4BQZA 3WQUA 1YJNN 4KH4A 1RUD4 2EILB 1W97L 4DO2A 2YXLA 3OY9A 4LF5B 1C0UA 1IBLO 1WSIA 2N74A 2P9SB 4Z2WA 3O65A 2WLJA 2ZR2A 4AHCA 5CZ1A 3CCUN 4CK2A 1U97A 4KX6A 4PELA 1BMFG 3TR8A 4FWRA 3RSEA 3O9TA 4BRIA 2W41A 4FZ1A 1Y64A 4PL8A 3ZETB 2V7YA 5C12A 4DSFA 2RS14 3E8FA 5SZTA 4MO5A 3P31A 2A7WA 4KP4A 1P84F 1NH2B 4I7ZB 3IC7A 4DV1K 4L87A 4ILJA 2BGGA 4Y1CA 3G6EV 3VF4A 1IG8A 1JLCA 1H1VA 2ZR3A 1RUC4 1K33A 4Q4V4 4YY3B 1EP4A 3OHRA 3MHSC 2QWRB 5AQIA 4YIOA 4Q4X4 2FMLA 4HYOA 4JKCA 4E3SA 5KQDA 2HBLA 3BFRA 5HBMA 5GW7A 3F5WC 3BRCA 4G27B 1KAZA 4MSWC 2IH1C 1QNMA 1RTHA 3HSTB 5BRDA 3E86A 1AR1B 4UFZA 4FLWA 4DUYO 1QCEA 3O9OA 1TUBB 3SPIA 3HXMA 1S9EA 3QO7A 4QOZB 1NGJA 1B9FA 3D36A 1E4GT 5LBQA 4JI1K 3MMVA 3GWKC 1LV5A 3ZEDA 1YITV 1T3VA 3A2FA 3KWIA 1PPJH 3NCIA 5CA3A 4CS4A 3UIQA 1XOUA 1JJOA 2A6AA 4I9WA 2B6AA 2Z1JA 1KUQA 2O8BB 2RM24 4KHPB 1RBTA 1F51A 2LGWA 1YTAA 4J10A 4E7LA 4LH6A 1K8AO 4B3OA 1AR94 3L2WA 2E88A 4JV5K 1MG1A 1IBLK 4JI8B 1B92A 2P9IA 1XNQO 2WTUA 2Q2RA 3AVMA 3KG2A 4FFKA 1OKJA 5LYJB 4AQYB 3C7NB 2ZJPL 2YI1A 3CMEV 3LDNA 3L6QA 4JI7K 1Q7YW 3QO8A 3S3XA 4HNAB 4JI1O 4CC5A 4YOVA 4DSIA 1I5YA 1GH6A 2WSSG 4DF8A 2PW9A 3ZS8C 4DUZB 3O6WA 4DG1A 1NGEA 3HP9A 3TAGA 3FB8C 2Q8VA 2Q0UA 4FOIA 5AZIB 4DS4A 3TTDA 3FLCO 3O4NA 1MSDA 5FL7G 4MT8A 4CJRA 4PY5A 1U04A 2N05A 3WB1A 2VGNA 2KSDA 2QM4A 4JI3O 5GTHZ 1O1WA 3CRCA 4ICLA 3QFUA 3CETA 2B5UA 5HFLA 4FLZA 2ITCC 1WNSA 2D4WA 2QKAA 1TVKB 3CEIA 3PIOL 1AR84 3SJJA 3L75H 5ADXA 5JVGL 3EE8A 3DLBA 4ZOLB 1N32B 1SV5A 1M56B 4CFDA 3CCUV 4DHYA 3BEHA 4BR6A 3DMJA 3MEEA 2EULA 1BOTO 1JR9A 1AJQA 1SETA 3C7NA 3FGUA 4YJ2B 2O4GA 4NO7A 3ZSQA 3HL8A 2JGDB 3DYAA 2E6LA 3OAAG 2WUSA 1WSJA 2DYSC 3WNHA 3RMAA 1U96A 4ZTFA 4AI8A 1GKFA 3E89A 3SPCA 4DSLA 3U9DA 1K73O 1GLAG 1EWRA 2LSNA 4DV4B 4LF7K 2ZE2A 1HNXO 1D9FA 4OGCA 4CIFA 3L73H 2XO7A 4BRLA 4MVMA 5KTQA 3AG2C 4X1IA 4KHYA 2HW3A 5EC1C 3MN5A 3U8XA 2WU5A 1S6QA 2WA4A 4BRDA 1PM9A 4P30A 1QHTA 1MSWD 4GKKO 2HVJC 4V19S 3LM9A 2KFZA 3OYGA 1BCCH 3UO3A 3AEEA 1N4CA 3T4DA 4CJWA 2NNUA 4KB0A 4MTFA 2AP1A 3AK3A 3E01A 4FJXA 4GT1A 2OPPA 4OPJA 4YTNA 3LP1A 3OD4A 3KK2A 4LFBK 3VRAA 1EBOA 2YHXA 3EYZA 2G8WA 2PF4E 4C8MA 4BC4A 3CM5A 4W5QA 4HTUA 4DR6O 2DYRC 2VGMA 3OYLA 1NK4A 2BH1A 2X0LA 3AEIA 2P90A 2P4KA 3JD0A 3GOIA 1RTDA 1TUBA 3E8GA 1VHXA 3ZX3A 3PO5A 3LDSA 2YX6A 1YF2A 4JKGB 3DXRB 1BQ0A 1GN2A 1J5EK 4R8CA 4ZTJA 1Q82W 2FBWA 3B09A 2YIBD 4UVCA 1NM1A 4HCBA 2DMXA 1JXBA 1VRTA 1L3SA 5KPZA 3E35A 3T1HO 5IJ9A 4CJ5A 2PUSA 3A0BZ 5AFUA 2UUCB 5DECA 3SAHA 1IZ3A 3ATUA 5KAFZ 1J53A 4F2SA 3QEVA 4BGBA 4FJ8A 3R6MA 3T1HK 1K8KA 5BMVB 1WAJA 4UV9A 1I94B 1DTQA 4KL1A 4WE1A 3VQDA 4LF8K 1VQ6N 3LAMA 4O8UA 3M3ZA 3VETA 3D36C 4CGJA 2BUPA 1RM1B 3LDQA 3TARA 4JI7B 5KHHA 3I5DA 5D3GA 3NMUA 3AG1C 3L72H 3H1VX 3DLRA 4DV1B 4A59A 4XDJA 1NTMH 2ZINA 5AR0A 1IX9A 1W0KG 2YNGA 3AO2A 3CWBH 1FJGK 4BQLA 2YS8A 3FFKB 3E1YA 3JASB 3EVKA 3A5MC 5HLFA 2VQEK 3C3TA 4G28B 4DV3O 1IBMB 1ZL8A 3VTIA 4DLGA 1NBMG 5DM6L 4GKJO 4CD3A 2D0OA 2YI9A 4FLVA 4R50A 5GTIZ 1KQSU 3TTFA 4A2BA 3BF1A 2Q68A 2E8AA 4ASUG 1R094 5FPDA 1GM7A 4YOTA 3THYB 5FLXN 3LWLA 4FZ0A 3CD6V 4JI2B 1W2BU 4HUEA 2NUBA 1NGGA 4NB4A 5B8HA 1SUQA 4PUOA 4ISFA 5AQNA 3S9HA 1I0HA 3FYEB 3HOTA 2GWKA 3LALA 3MN9A 5A2QN 4TOIA 2E5LB 2G8KA 1N32K 4Q4W4 5GONA 1RSOA 4FK5C 1NG9A 1WAFA 1HP8A 2KKWA 3NGIA 4DTRA 3DXKA 2RF2A 5AQVA 2Q6AA 3ASMA 1DGKN 4NTYA 1XUPO 5JS1A 3HKCA 4CF1A 4C1NK 4PKIA 3KK1A 3SI6A 3S3WA 5LP6C 2UXCB 1BU6O 3NF7A 2RS54 3ZX6A 2J4RA 2OTLV 3AAQA 2ZE6A 5AG2A 1VF7A 4TV9A 3ZMZA 3HR0A 3PN1A 3B6PA 4WQ5A 5HL7L 5E26A 2CH7B 1FK9A 3PY8A 1V55B 2YNIA 4WFAL 3ZLJA 3TETA 4FO0A 1U6ZA 3R3LA 1HMVA 5J9PC 2XTAA 3MWPA 4AHRA 3KD1E 3JARB 4IHJB 3VEWA 4LSNA 4GKKK 3P5JA 1FKPA 2IJJA 4DRXA 2HHHB 3FB5C 1S22A 5AZIA 4MTOA 1HX1A 5IY5C 1NGIA 3O9UA 1M1KW 4A5AA 2RMU4 4A5BA 4CIGA 4X65B 4BIUA 4ZOLA 3ULEB 1NJIO 1UA0A 2QKKA 2UXBO 1JMKC 2FBXA 3P4PA 1SQPH 3QNEA 4MQ3A 1RBRA 1RBUA 2YXHA 3MECA 4DQQA 4JTAB 1X4TA 3OA9A 5FRNA 3G6BA 4JYYA 4WFHA 1MA9B 1WB8A 3P4SA 1WBBA 3ZSYA 1K4CC 3HKCB 3I0SA 3SQ1A 1LNQA 2D0BA 2WDQA 1SESA 3K2PA 3UKRA 4EZ9A 1LW2A 4Z0UA 1HKGA 4JD2B 4FIPC 1UFIA 3DOLA 2HHSA 1OCZC 4YJ3B 5BY1A 3HPHA 4A62A 4CJEA 1QVGU 1N34K 1HNWO 4FJIA 3KCYA 4PA4A 4PWDA 3AE5A 2XT9A 3JAWB 3BHPA 1SQKA 2O8CB 3Q4HA 3AK1A 3AG1B 3NE6A 2BSKB 4PJ0Z 3T1YB 1YJ9N 1VARA 3PUFA 3LAKA 4X66O 3RGBA 1VQLN 1N36K 3M1FA 3W7UA 4MVRA 1VQOV 2HBJA 2Q31A 1ZWIC 1I5XA 2EJ7A 2HR3A 4M3XA 3AA3A 4CJUA 2A42A 2HWB4 1RT6A 2IW5A 2L6LA 2NR5A 1XNRO 3V1RA 4PDMA 1OH8A 3B2EE 1XNRK 1NENA 4JKHA 2WWWA 5EVZA 5L3DA 5LGTA 2QSAA 3V4IA 3CFPA 1JLGA 1FKAO 2Z3YA 3K9SA 1ENVA 2BOCC 4U3JB 4FLUA 3ZHRA 3F2KA 1PVC4 1J5EO 1MWMA 3ZRWA 3C6TA 5AQKA 2BTQA 3GB7C 4K8ZA 2EWSA 1WSFA 4X66K 3V9SA 1K5QA 1NK6A 1N8RO 5M1OA 1WLEA 2ZDIC 4DRXB 3AVFA 4PHTX 3FR0A 4B7EA 5JLFA 4DR6K 1RTIA 4O2AA 1OJHA 1AR4A 2QWOB 3A8YA 3IC9A 5AQYA 3ZT3A 2GBZA 4TQDA 4YOYA 4H0XB 1ZX3A 4DR4O 4JV5O 3ZCMA 2QGNA 3D2FB 4CZHA 4PA7A 1F7YA 5JVHL 3SUNA 1KSPA 2F8TA 2KFNA 2IVOA 1VSKA 2QWRA 5ADXH 1KKDA 1PNLA 3WG7C 3HM8A 3H3NO 4JK7A 1MDUB 1RHI4 2CUGA 2XAFA 3L8BA 3FZMA 2OCHA 1FXXA 4OJRA 2QEXV 2E1ZA 2E4LA 1ITGA 3ID6A 3NF8A 1AR64 1MWKA 2VQFB 3QBXA 5IJ9B 1TGOA 2QWLA 3MEDA 1HNWB 1QVFU 1TV6A 5JVDB 1W0JG 4BRCA 4OLBA 2ARHA 5CBHA 3U9ZA 3L4IA 2GDSA 2GUZA 4H5RA 2R72A 3SBTA 1FXHA 3PSFA 4BRMA 3L9DA 4CF2A 3ABTA 3CCVV 2N04A 4H0YB 1NTZH 5AQMA 3K06A 3OYEA 2HHQA 1ASVA 1NKDA 3AG3B 1NK9A 4LF9O 4JI4K 2A1SA 3TXQA 4LNUB 3UKUA 4CD1A 1VBE4 4KRFA 2YICA 3D2EB 5AQPA 1U47A 1PNKA 3GL1A 5EC2C 3ZSWA 3O9SA 2R7FA 1C1CA 2DN9A 4J9YB 3CCJV 4H5TA 3JALA 1WA8A 4TV8B 1ATSA 2QR4A 5LJVA 2G8HA 2OZMA 1Z2GA 1L1FA 2NLJC 4GKKB 2DFFA 3O08A 5FDLA 2IAJA 4BRAA 1QR8A 1SS6A 3OTFA 4TSFG 3V9ZA 4PL7A 5LP6B 4BG8A 5KGXA 3AEBA 4M7XA 2GTDA 1ROPA 4J41A 2HHWA 1MQTD 2F9TA 1S77D 1S1XA 1GN4A 1OCCC 1ORQC 1TKZA 4JI2K 4DR7K 3D8CA 3P3NA 3SCXA 3LM2A 3JAKB 2FBTA 3THOA 4WQ4C 1J9AA 3UM7A 2Z1GA 4CJPA 1VQLV 5H6QA 5KA5A 1I94O 1P8ZA 5CY4A 1I39A 4IDHA 5LOVA 4B08A 1Y76B 4LWSA 3KD5E 3AEGA 4DR2B 1D4XA 2DQ3A 4CBUA 1LUVA 1PL4A 1M9NA 1VP7A 2ZQMA 4JI6K 4DQRA 2WOMA 1SL1A 2V7QG 3TAPA 1M57B 1M90W 3DLKA 2F7TA 2G8UA 3SYAA 3O4QA 3NH1A 1JKHA 5CBGA 3AVJA 4FK4A 4WYBA 5TISZ 4ZHQB 3AVBA 1NU0A 1S76D 4ID1A 3MEGA 3ETDA 1NGBA 3LPTA 3LNMB 3K3WA 1Y4MA 4CH4A 4UB6Z 3CIPA 4B9VA 3W0LA 1M90O 2QWOA 4BR0A 1WUAA 4U3FH 1I08A 3U0ZA 3T4ZA 4B1ZA 2KZMA 5AQZA 3CCRN 1B04A 4KFMA 4R79A 1DK1A 1TAQA 4N21A 2LQTA 3CXHF 4GX5A 2BTQB 1YVUA 4E1JA 1Q81O 5DMRA 3SAGA 5H5NA 2D5RA 4EP5A 4YTMA 3A5OC 3VEZA 4O4IA 1KD1O 4WCEV 3CCQV 2FLOA 3AA4A 4QS8A 4RWTA 4U67L 3TCUA 2RPIA 5EBMC 1Q6IA 4JYAB 2OTJV 2IJIA 1QQCA 5B66Z 2B4JA 3OYBA 2G8IA 4IG3A 1S0VA 2DTUA 1AI4A 3I8BA 4FSVA 4QE9A 3SYQA 3VERA 1W59A 4FWKA 2IH3C 1HNXB 3KLGA 4EB6A 3CCSV 3CC4V 3I56V 3BP8A 2ZE5A 4NVPA 4MVUA 2P9IB 2QI2A 3ENOA 3KKSA 1XREA 4H0OA 3RYCA 4U7BA 3V9WA 3RT3C 4IGGA 4FWPA 3JAMO 1VQ4N 3QIPA 1YXBA 5C15A 1JLQA 4CESA 2UUAB 1PNMA 5LY3A 1OH5A 5CA1B 4X62O 3K57A 1BISA 3SLCA 4EFEA 3G4SV 1JFFA 3CJ1A 4KUMA 2ACZA 3AVKA 1Q86W 2Q7GA 2CGLA 3FB7C 3VA0A 4BACA 1QLEC 5LXTB 5FROA 4JI4O 4K0KK 3J81O 1RFYA 3PSIA 2VQEO 3NAEA 2QWNA 3LZJA 4DK1A 2QWMA 2V7ZA 4X9QA 5EIBD 2QWQA 3JD74 1FXVA 3CG7A 2JJ1G 1ZC6A 3C95A 3SQ0A 5C2TA 1FJGO 3GE1A 3MCPA 3J81N 1YTUA 4KKOA 5SWMA 4CJ3A 3BABA 3K0DA 1ASUA 3CJAA 4CHYA 3T2MA 2WLHA 3RYIA 3NF6A 2KW4A 4PDVA 3FE1A 2GWJA 3VQ7A 1OV9A 4H4MA 4DU4A 4GW6A 5K14A 4FJ7A 4YIPA 3MXIA 4WFNL 3SFEA 3AVCA 5CB4B 5CE3A 2PFUA 5KAIZ 1QVFM 1I94K 3CQYA 3ZETA 3A0IX 4IBNA 1VF6A 1BE3H 3IFXA 4OGEA 3CCJN 3OBWA 4XIUA 3HRGA 2WDVA 1QR9A 3SYPA 4AM6A 2BCCH 4LF5O 4BRNA 1JQ0A 1OCCB 1KECA 4J2AA 1NMDA 1U2VA 4KREA 2OANA 4DR5K 2PYJA 4LF4K 3J7YP 3SPYA 1EN6A 5H1SQ 4RCHA 4CH6A 1HKBA 4DMNA 1UJWB 4E1NA 4NXMO 1B3QA 5F2VO 2DW4A 4AM7A 3MN7A 3VGLA 3H46O 1K7DA 1UPGA 4E89A 1BUPA 1FPOA 1X3NA 4A61A 2AHZA 4LF9K 3AG3C 3MXMA 4PHZA 1AP6A 1XMOB 1ZOYA 4JI0K 1K8AW 2VG6A 4CJFA 1GMGA 4C7UA 4Z4GA 1PV0A 2CTWA 3CJHA 3F7YC 4X8AA 1IBMO 4ISEA 4AH9A 2I7NA 3CQ8A 1I7FA 3VF6A 1XMQK 3M99B 1N36O 4KO0A 2W42A 3SJAC 2UUBK 1JOYA 1RDCA 4L8JA 4R6ZA 2JGUA 2ZDIA 4G9ZA 3R8EA 4DTXA 1XBLA 3STZC 4UCSA 1VF6C 3CRRA 4CH5A 2ZGZA 4BWJA 3NVMA 5LHIA 2YV0X 3TWHA 1LAWA 2HFEC 3SJCC 4QPKA 3ZSXA 1NCQD 1SA0A 2Q67A 2OWOA 1TK5A 3IAYA 3IRXA 4LC1A 2P9LA 4LR3A 5BR8K 1RBSA 4B9UA 4GMJB 1QLEB 1SZ2A 2FXUA 2Y1IA 1D9DA 2ZIOA 3TXSA 3BA8A 2VG7A 2HP8A 3M5RA 1JCFA 1HNZB 1YSCA 3WUHA 4DR7B 5KHGA 4WF9V 1IXMA 2YKNA 1SF9A 2R70A 4FJCC 5EK0A 3FZLA 4JK9A 5CR4A 4YHHB 3CPWU 4Z4HA 2EIMB 5B1AB 1H2GA 1YF5L 4NYNA 1HYVA 3I55V 1BSMA 1MA1A 3ISNC 2UXNA 5F2RA 3IKMA 4AQYK 5EX5A 4JI3B 4LF8O 1T03A 1JCEA 3OEEG 1SQXH 1G8MA 2UXBB 5IJ0B 4YORA 2HJFC 3NXSA 4DR1B 4H44B 1XNQB 3I56N 3QVNA 4DTUA 4JAAA 2ETNA 2DJVA 4JPRA 2EHGA 2HNZA 3OE7G 3V1OA 1VQKN 2OTLN 1ASJ4 1VSDA 2Z1IA 3H1JH 1RDUA 5DEDA 3AAPA 3BY5A 2KB1A 3OFNG 3PX0A 1IBKK 4JI1B 3SYCA 4TQFA 3KCXA 4GZRB 3L3UA 5JJNB 2QWPA 3ABLB 2F66C 2JJ2G 2WLIB 2R9IA 1P7BA 4JN4A 3KLEA 4FM1A 3ASOC 3ASNB 5AQSA 3ZSOA 3SPZA 3LSUA 1F4NA 1EAH4 2XY8A 3TAEA 4EKWA 2HVHA 3P83D 1AI5A 3B6OA 4XBFA 1OCZB 4WFEA 1WLJA 3I8DA 3CE2A 2AHYA 2P5OA 3S3NA 4U3JA 3LDOA 5M1PA 1C1AA 2AA4A 5IYZB 2NRRA 4J9ZB 3THWA 2Z0AA 4O2BA 2E2OA 3EN9A 2XRIA 5BPNA 1NS1A 2YIDA 3VR8A 4DV0K 3SZ2A 2EILC 3RMBA 3RN4A 1QSSA 4O4JA 4JKDA 1SQBH 3HPGA 5HRNA 3SUOA 4LFCK 4M3TA 2YI8A 4YTPA 1OH7A 1V54B 5D5QA 3IGAC 5KX5A 2EIJB 1TL1A 4CK3A 1N0JA 5TKWA 3JSNA 3UO2A 1XQ8A 1VSHA 1VBA4 5AQWA 1HNVA 4B1XB 3Q7BA 5ELZA 3EEQA 5E41A 3T69A 1NGHA 4LF6K 5LHGA 1YHQN 3Q4HB 2FKXA 1YIJN 4YDUA 1PL0A 3SPJA 3MD0A 4FJJA 1VSLA 2FF3B 3R9PA 4CGIA 3QINA 2HHVA 2QW9A 4IO9L 4KI6A 1THZA 2K9PA 4GLXA 2HJDA 1O9HA 4UCVA 2UU9B 1CZAN 2Q36A 4PKGA 1IO2A 3IFRA 4W5OA 3HVTA 3ZX0A 3GWOA 2PZSA 4NCAA 2IU3A 3B8AX 2D0CA 3O9QA 4CJTA 1NT2B 4O2BB 3CC2N 4WQ4A 4P9OA 3RYHB 5L3BA 4CI6A 5GIPA 1H8EG 2P1JA 4OGQB 1Q9XA 2WA3A 4F6RA 3KIOA 2LFRA 4GUNA 2X6BA 2QKBA 2ZT9B 1KTQA 2HF3A 5FPNA 3OMIB 1HJOA 1HNIA 3CHWA 4H5WA 4J2DA 1EO1A 3F5TA 4CF9A 2G38A 3ZT2A 4F8RA 4CZEA 2VQFK 3VQ4A 3ETEA 3JARA 4IHJA 4JI8O 1LWEA 1HRI4 3HM9A 1Q90D 1LOTB 1PD3A 2A41A 5EBLC 4GYCB 3IS9A 3VN5A 4MVOA 5M1NA 1XEQA 1O9GA 3P32A 4O55A 4CHZA 3JS6A 4EP4A 1N33K 4DXWA 3ULDA 1P90A 5J2TB 2NN4A 1DF5A 4WFFA
chains in the Genus database with same CATH topology
4C8KA 3CFRA 3K5OA 5KX5B 5JH7B 4I55A 2FC0A 3MAQA 4KAZA 4JI0B 3HKEA 1S5JA 1CLQA 3QNOA 5CYQA 3KKRA 5JQGB 3OYKA 3BGRA 5ITZA 3LZIA 2QXFA 4CECA 2VQEB 1TKTA 3AA2A 4CEZA 2FBVA 2UUBB 4CFBA 5KMGA 1SKRA 3M8QA 3LP0A 1ZAUA 2Q7EA 3OTOB 4DV2B 1WSHA 3QEPA 5C8YB 4KHNA 4FXDA 3T1AA 3UT5B 1EXQA 3CSXA 5T7BA 4DV7B 1LAVA 1ZBLA 3HO1A 3OYIA 4DTMA 4CEEA 3C6UA 2EX3A 3WNFA 3K5LA 1HR0B 3V9UA 3HKBB 3AVHA 2D0AA 4B9SA 4NCBA 3PX6A 3AO4A 2ZQBA 4JRPA 5LA6A 2RQ6A 1Z5WA 4X20A 4IDKA 1REVA 2ATQA 2FBYA 3ZT0A 4CEBA 1TAEA 2E6MA 4DLEA 1EETA 3T1HB 4D7TA 1VSEA 3RYFA 3UT5A 3WB2A 4DQSA 2HNDA 3VQPA 4LF7B 4LFCB 4J2BA 2KZZA 1SA0B 5JH7A 4K8XA 3VQVA 5HP1A 4IFVA 2X6NA 3CHXA 4NXNB 2VWKA 3RRGA 1QS4A 5FPOA 4OKJA 1UOCA 4E7KA 1HRHA 5JQGA 1JLAA 4CS3A 3OS2A 4CHOA 5EU7A 3MXJA 2Q7HA 3F73A 3QEXA 4F3OA 4CF8A 5C24A 2Q3SA 1EKEA 3VQ6A 1JLEA 2XY7A 1NOYA 4OPKA 2KQ2A 4KHWA 2X78A 4KV8A 4O0JA 2P5GA 4IIJA 1R0AA 3HPOA 3D0PA 2E3CA 3RMDA 3VQYA 5C25A 4NXMB 3CFOA 1RDAA 1C1BA 1XI1A 1RDDA 4JRQA 3N2GB 4ZHRA 4CGHA 3TAMA 2IC3A 1RT1A 4JI6B 4ELTA 1W0HA 5IWAB 5KHJA 3CYMA 4HBNA 3FFQA 1TK0A 1J5OA 1BCMA 5J2QA 3VQWA 2HMIA 3BDPA 1CXQA 3ITHA 4I2QA 1YEWA 2B5JA 1S1VA 2R9AA 4DSJA 1K6YA 2OPRA 4M3UA 2F93B 3RRHA 3ZSVA 1X9SA 3KJVA 4LH7A 3SGIA 1RTJA 4CFAA 4CEQA 4O4GA 4F6RB 1CZ9A 1TVKA 2P22C 4LSLA 1TVRA 3FI7A 1KFSA 4ZI7B 5JS2A 3VQCA 2HNYA 4X20B 4RW4A 2YHAA 4KFBA 4NCGA 1D5AA 3LPUA 1M5IA 1P49A 3RWUA 2ZNIA 1TAUA 4GVMA 4DR6B 4JI5B 1RT5A 5CZ2A 3SUQA 2A1RA 4EZ6A 4HUFA 4FJ5A 4WBNA 3I0RA 4TV8A 4DU3A 4B3SB 3JAKA 5GONB 1C6VA 3WB0A 3ETQA 3HK2A 3NH0A 2IS3A 5LMNB 4HVJA 3KK3A 4FW1A 3U3GA 4I9QA 3PO4A 1JL1A 1HYZA 5KHIA 2PY5A 2PYLA 5J2UB 2BE2A 4EEQA 4R5PA 4DR3B 5KRTA 1BI4A 3KLIA 4DTOA 4I55B 4X1YB 4N5SA 3RWRD 4FCYA 2YHBA 2UXDB 2V4DA 1T7PA 5J2NA 3SQ2A 1S1WA 3C94A 4N56A 4BW9A 4B9MA 3E22B 2QJ1A 4KI4A 4D7SA 4X64B 3WNEA 4O2AB 4RG8A 4OLAA 2GUIA 2G8FA 2HHTA 1RT4A 3JATA 4DU1A 3VQAA 3SYZA 3TAQA 5I3UA 3TANA 4CCHA 4OKKA 3SJBC 1RILA 1X9WA 4E19A 4UCTA 3ZSZA 1QSYA 4FJ9A 3SR2C 1B9DA 1IKXA 5CYMA 4OKEA 4E7IA 3H08A 1L3UA 4DV5B 3VQ5A 3WNGA 3QEWA 4O4IB 3N2KB 1U4BA 4HUGA 1UWBA 3HKDA 3UQ8A 4EB6B 4IIJB 3DLGA 3VA3A 3BA9A 4FZZA 1L3TA 4DSKA 1G6UA 3OS1A 2RN2A 4X1KA 1HJRA 3QIOA 1FJGB 1NJXA 3JSLA 5LYJA 4DFJA 4OX9B 5LXTA 4BDPA 1XWLA 5FNVA 1UA1A 1ZBFA 2HHXA 1JXEA 5EYPA 2G8VA 3AA5X 4JLHA 2BANA 1NKCA 4O4HB 4CS2A 4ELUA 3OYFA 4X1KB 4FJHA 1C0TA 4CEOA 4BDZA 1J5EB 1XHZA 1Q3EA 1NKEA 3ICXA 1EX4A 5LP6A 4Q0BA 1FKOA 5FNVB 2HB5A 3ALYA 3RTVA 4ZI7A 3CM6A 4DTNA 3AVIA 1WPBA 3JSMA 2R7YA 4HHTA 4M3ZA 4C8LA 1T8EA 4DFKA 1Z5VA 3NGYA 4FW2A 5CA0A 3G0ZA 2O4IA 5J2MA 4M45A 4PA1A 1L3VA 3OJUA 1JLBA 4DFMA 4FYDA 4CGGA 3U11A 2HEPA 5ITZB 3HYFA 4FJMA 3U10A 1SKWA 3JASA 4FJNA 3EY1A 4LFBB 5IJ0A 3BPZA 1C0MA 4DV6B 1GOBA 4LF6B 1UAXA 1YT3A 4CFCA 1D8YA 1ZYQA 4DF4A 1SL2A 2F8SA 1NJWA 2YNHA 4LD0A 1S6PA 4H4OA 1A5VA 3G10A 1WSGA 4I4TB 4YFUA 1BIZA 4B9TA 3IG1A 5HRSA 2YNFA 1U49A 1S9GA 4CIEA 1XC9A 1BI4B 3HKDB 3VQ9A 3OVNA 3OYJA 2OPSA 4W5NA 2F95B 4KPYA 2PGGA 1HYSA 4YJ2A 3L2UA 4X1YA 1L8DA 4O4JB 4CJSA 4C8NA 4B3TB 3AVGA 1NK5A 4ELVA 1BHLA 4FM0A 4EFBA 4I2PA 2ZNJA 4DV3B 4KHUA 4DR4B 4YJ3A 3F9KA 4Z4CA 4CJLA 4DQPA 4FJLA 3VQBA 3NHGA 1L5UA 2JLEA 4CHQA 1N5YA 1H2SB 2PTMA 3AVLA 5J2PA 4I4TA 3RYIB 4O4LA 3E22A 4E0DA 1X9MA 3QTCA 1HQUA 3VQ8A 4DK0A 3OYAA 4YNQA 4H8KA 3HT3A 4HCCA 3PX4A 4Q5VA 3LNNA 2VG5A 3HVRA 3OYHA 4RW6A 3SV3A 3V6DA 1KFDA 4AHVA 1CZBA 4DFPA 5CA1A 3SV4A 4MFBA 1LWFA 2F1MA 2IDOA 2GV9A 2BTOA 3RYCB 3L3VA 3THVA 1Q9YA 1Q8IA 4AHUA 4KHSA 4Y1DA 1QSLA 5LOVB 4PQUA 4FZYA 3QEIA 3KLHA 4F3TA 4O5BA 4B9NA 1NJYA 1GOCA 5C8YA 3EZ5A 4WBNB 4FZXC 4B3RB 3NBPA 5EIBC 3O3GA 4DWIA 5KGWA 4NYFA 4DR5B 3JALB 3AVAA 2OZSA 1RT7A 3ZT1A 3KLFA 4UCRA 3OJSA 4O4HA 3AO1A 1SQFA 1Y97A 4I7FA 4DTJA 4CGFA 3HKEB 2JVDA 4X66B 1WN7A 1VSFA 5C42A 2IM9A 4LF9B 4CH3A 2I5JA 1XNRB 4N41A 1JLFA 3N2GA 4LF8B 3OYNA 5J2TA 1X1PA 1IBLB 1KVCA 2YIAA 1KLNA 3QO9A 2P51A 4W5RA 4B3MB 1GOAA 1N34B 4PI0A 2DFEA 3M7MX 4OVLA 4CEFA 4JS5A 1VRUA 4CGDA 2ETJA 1KRPA 4KB1A 1SKVA 2F96A 1BQNA 4W5TA 2IGIA 4B9LA 4UCOA 3QLHA 3V9XA 5BMVA 5JCOA 4J2EA 1CXUA 1BGXT 1KMIZ 3AV9A 1TA8A 1IBKB 1NK8A 4Q6GA 5KRSA 1S1TA 4LF4B 3K59A 4BDYA 1U48A 3NGZA 3DLHA 1SL0A 2XY5A 3K58A 4F2RA 1RT3A 1IKYA 4HNAA 4DV0B 2ZM6B 3RYFB 1U45A 1M93A 4LFAB 1Z25A 2OA8A 4M42A 1RCHA 5FRMA 4DTPA 3VQQA 4TV9B 3OS0A 4CK1A 4CJQA 3OYCA 1BL3A 1ZBUA 1IH7A 4B8AB 3AO5A 1KCFA 1IG9A 3D45A 5J1EA 4I50B 3HKBA 5EZYB 4AHSA 1RT2A 4FFBB 1TKXA 1NOZA 2XHBA 3M8PA 1LW0A 5KHKA 3LP3A 3V81A 1IKVA 2AJQA 4CHPA 1Q43A 4QAGA 4I50A 1M4UA 3QERA 4ZHQA 3LP2A 4KTWA 2JS5A 1MU2A 1N6QA 3VQEA 3QNNA 4FM2A 4CJVA 1NJZA 4M3RA 1VSMA 4TUYA 2RJZA 1V9PA 1SQGA 3DM2A 1QTMA 5JVDA 2VWJA 1NKBA 4TSXA 2OPQA 4G1QA 3TI0A 3M8SA 4IKFA 1ZBIA 4O4LB 4BWMA 3NF9A 4E7HA 3M8RA 3ZSRA 5KMGB 4FLXA 4O44A 2Z1HA 4M3WA 1Z26A 2KTQA 1JFFB 3QF7A 3TAFA 3N2KA 3HJFA 4AILC 2ZIMA 4DUYB 4KHQA 3T19A 4CERA 1VSJA 1TKDA 3V1QA 4IFYA 3QESA 4BWAA 2BDPA 3T3FA 4FJKA 4FK0A 1DLOA 3LANA 3NDKA 5BR8B 3BAAA 1VK0A 2WONA 4M3YA 4E1MA 3RFRA 2X74A 4O0IA 1N33B 1KVAA 2ZD1A 3SQ4A 5CB4A 3SUPA 1JL2A 4KTZA 1RDBA 1J54A 4F4KA 3SNNA 4FLYA 3DRSA 4N47A 4DSEA 2ITGA 2QK9A 4ZIBA 4N76A 2IOCA 4X1IB 5D5PA 5K1XA 4M41A 5K1PA 4IG0A 3VQXA 3DRRA 4CHNA 1N36B 2Q0AA 4UQGA 4CC6A 5JJJB 4LH4A 3NFAA 3S3OA 3FFIA 1TL3A 4DTSA 4FLTA 1BQMA 1RBVA 4Z4IA 5I42A 1WSEA 4BE0A 1T05A 3DI6A 1ZBHA 2X6SA 4BE1A 1KU9A 4JS4A 4CJKA 1TK8A 4CEDA 4JI4B 4RW8A 3U3YA 1IKWA 3KTQA 3QETA 4CEAA 4JV5B 5EYPB 1QE1A 1NK0A 4RW7A 1HQEA 3RR7A 3O3HA 1KLMA 5LMUB 4BE2A 3HP6A 2ZCEA 1S1UA 1HW7A 2OYQA 5DK5A 4X62B 1DTTA 3DSQA 3QG5A 2YIBA 4B8CA 3L2RA 4CF0A 3RMCA 4QCLA 3K5MA 5CA0B 4Z4FA 3NH2A 3JAWA 4UCUA 4LNUA 4FFBA 1G15A 4CJ4A 2XY6A 3AO3A 3DOKA 4L8RB 1ASWA 1W9HA 2YKMA 1Q5OA 5IYZA 1F21A 1FFXA 3L2QA 3JATB 3DRPA 1HPZA 3U6FA 2HVIA 3PV8A 5HROA 5FPRA 4DQIA 4AHTA 4RW9A 2HHUA 2RKIA 3RYHA 2CAZC 5HRPA 4LH5A 3RR8A 4Z4EA 2Y1JA 3O3FA 3OYMA 3OYDA 3ZT4A 4TUYB 5JCOC 4E7JA 3S3MA 3LWMA 2DFHA 1FFXB 5J2UA 5HRRA 3L2VA 4I9LA 4FK2A 1BCOA 1BIUA 3DLEA 3P1GA 3K5NA 5JJEB 1VSIA 1RNHA 4GKJB 1I3AA 1KVBA 1DGSA 4K0KB 4KTQA 4LY7A 4FJGA 4PI2A 1T5EA 1LWCA 4C8OA 5EZYA 1XHXA 3JYTA 4DS5A 3CB2A 5KI6A 3AVNA 4FVMA 1XMQB 1NK7A 5LA6B 1A5XA 1A5WA 3TABA 2F4VB 4ID5A 3OY9A 2YXLA 4LF5B 1C0UA 1WSIA 4AHCA 5CZ1A 4CK2A 3TR8A 4DSFA 5SZTA 2BGGA 4Y1CA 1JLCA 4YY3B 1EP4A 4E3SA 5HBMA 3BRCA 3HSTB 1RTHA 4UFZA 4FLWA 1TUBB 3HXMA 1S9EA 4QOZB 1B9FA 1LV5A 3ZEDA 3NCIA 3A2FA 3UIQA 4CS4A 2B6AA 1JJOA 2Z1JA 4KHPB 1RBTA 1YTAA 4E7LA 4LH6A 4B3OA 3L2WA 4JI8B 1B92A 3AVMA 5LYJB 4AQYB 4HNAB 4CC5A 4DSIA 4DF8A 2PW9A 3ZS8C 4DUZB 4DG1A 3HP9A 3TAGA 4DS4A 3O4NA 4PY5A 4CJRA 1U04A 3WB1A 2QM4A 1O1WA 4ICLA 4FLZA 1WNSA 1TVKB 3SJJA 3DLBA 4ZOLB 1N32B 1SV5A 4CFDA 3DMJA 3MEEA 4YJ2B 2O4GA 3ZSQA 3HL8A 3DYAA 2E6LA 1WSJA 3WNHA 3RMAA 4ZTFA 4DSLA 2LSNA 4DV4B 2ZE2A 1D9FA 4OGCA 4CIFA