2PYLA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC(2DA))-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 161
structure length 571
sequence length 571
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pylA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pylA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pylA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pylA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pylA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pylA06
4Z4HA 1BIZA 1U45A 1W9HA 1C0UA 5T7BA 4FJNA 1D9FA 4JRPA 4AHVA 4DTNA 2DFEA 4FK4A 4RW4A 1RBTA 3AA5X 4B9UA 4B9SA 2LSNA 1Q9XA 5HRRA 4Y1CA 3A2FA 3K5LA 1IKYA 1X1PA 4CJ3A 4YFUA 4FJ9A 3ZSOA 3LWMA 3TARA 4FM2A 1EKEA 2OPQA 1RDAA 3L2WA 1NK5A 1NK0A 1WN7A 4M3XA 3DI6A 1ASVA 1XI1A 1T03A 2FBVA 1RTDA 4CGIA 1JLQA 3KLGA 1RT7A 2VG6A 2XO7A 3NF7A 2HHSA 1ZYQA 4KB1A 4MFBA 4F4KA 1IO2A 3KLIA 4CJRA 1QTMA 4C8OA 1RNHA 4EZ6A 4I9QA 1CXUA 3C95A 4M45A 1UAXA 3KTQA 2G8IA 3VQBA 2XY6A 3OYFA 3HVRA 4CJTA 3HM9A 3C94A 1B9FA 4CERA 2QXFA 3L2VA 3HP6A 3THVA 4CF0A 4O4GA 3AVFA 2BGGA 2HHTA 3TABA 3T19A 2I5JA 3WNEA 1BCMA 3AO4A 5EU7A 5J2NA 3AVHA 1L3TA 3O3FA 3RR8A 4IFVA 4AHTA 5J2MA 3G10A 3SQ1A 3NH0A 3L2RA 1BIUA 3VQQA 2F8TA 4CJVA 1RDCA 4DQRA 1CZ9A 4PWDA 3OYHA 1J9AA 3ZT1A 4HUGA 4DU3A 2JLEA 4CJWA 3KK2A 3NGYA 4E1MA 1LV5A 3AO3A 3LAMA 4DSIA 1S1WA 1LW2A 3M8SA 3AVAA 4Z0UA 1ITGA 2D0AA 2X6SA 4FLUA 2OPSA 1U4BA 4FZXC 4KHNA 2F96A 1S6QA 4DQQA 2OZSA 1YTAA 1CXQA 4FZYA 4CESA 1NJWA 4FW1A 3V81A 3NGZA 3O3HA 3L2UA 1SL1A 4PY5A 3LWLA 4B8CA 2XY8A 1U47A 3MXMA 2B5JA 1Z25A 1TL3A 1NK8A 4F2SA 1RDDA 1MU2A 4H4OA 1EETA 1YVUA 2YHAA 2IDOA 2YNGA 3KD5E 3HYFA 3T1AA 2B6AA 2FBYA 4E7IA 2YHBA 4CJEA 4QOZB 1NK6A 4CJPA 4DLGA 2KW4A 3ZSVA 1KCFA 4DTJA 3DLEA 3KJVA 1SKRA 4DSJA 2DFHA 4H8KA 4AH9A 1JXEA 5KI6A 2G8HA 3C6UA 4E3SA 1U04A 1C0MA 3DYAA 4RW6A 4N76A 3DRSA 4CEDA 3K5OA 2R7YA 2O4IA 3M8PA 2HB5A 3O3GA 2XY5A 4FJGA 1FXXA 1TK5A 3TWHA 3AVBA 5HP1A 2QKBA 1BISA 1RTIA 1VSDA 3KKSA 4NCGA 3NFAA 4OKEA 3QEPA 2BANA 1GOAA 2RF2A 2KFZA 3DMJA 4DG1A 3TANA 4YNQA 1O1WA 4FJ7A 4CEEA 2XHBA 4B9LA 3LP0A 1UOCA 3DLRA 3VQAA 1NKEA 3VQ9A 2BDPA 4C8LA 1KVCA 3HT3A 4F8RA 4WE1A 2EX3A 4DQIA 4FLZA 4C8NA 3S9HA 5FROA 1TKDA 1IG9A 1FK9A 3AVMA 4DSEA 2OPRA 4FJ5A 4J2BA 2YNIA 1HNIA 4Z4CA 3RTVA 1NKCA 3AA4A 3ZT2A 3IS9A 1S1TA 4B9TA 3HK2A 3MEDA 2D0CA 4NCBA 4AILC 1TL1A 4R5PA 4FJKA 1NK4A 2PW9A 4GVMA 5HBMA 1RDBA 2D0BA 5KGWA 3OS1A 4ZTJA 3OYMA 2G8FA 4KAZA 1A5VA 2FBTA 3M8QA 4FK2A 2E4LA 4OGEA 4RG8A 3HP9A 3VQPA 1JLBA 2FBXA 3OYBA 1I39A 3CM5A 4BE2A 4DFMA 1BQNA 1CZBA 4JLHA 4KB0A 1NJYA 1D9DA 5K14A 4B9VA 1BGXT 4ICLA 3HPOA 4M3UA 1XHXA 2HNYA 3SYZA 4CFCA 3DLGA 3V9SA 4G1QA 4ID1A 3KK3A 5DK5A 3SUQA 2E6MA 3QEXA 3RMDA 3L3VA 2Q3SA 4F3TA 4W5OA 2HHWA 1S5JA 5CYQA 3P83D 4DFKA 3RR7A 2VWKA 5CYMA 1UA0A 3V9XA 2HVIA 4E7JA 2A1RA 1TKXA 1DTTA 2PYLA 2GUIA 4GW6A 3OYAA 3VA0A 2OPPA 4M41A 4FW2A 3AV9A 3U3GA 1BHLA 3DOKA 1WSIA 4KO0A 3RMAA 2DFFA 3PY8A 1DLOA 3AO1A 3V9UA 3SJJA 1VSEA 4M3TA 1TVRA 3PV8A 1JL2A 4DTUA 5HRPA 1ASWA 1K6YA 3L2QA 4DWIA 2KFNA 4BWJA 4FLWA 3TAMA 2RPIA 4CFAA 5FRMA 3OYKA 4CHNA 4DSLA 4M3YA 4NYNA 3NF8A 3LP3A 2KZMA 3NDKA 3RWUA 2OYQA 4B8AB 4B9NA 4CJQA 4AHRA 4CECA 3LDSA 1Z26A 2IGIA 3AO2A 3DRRA 2E6LA 1SL0A 3EZ5A 1JLFA 4CHZA 4KPYA 4NYFA 4KHWA 3SUNA 1HPZA 4LH5A 3PX4A 3KK1A 4LSLA 4MQ3A 1T7PA 4DSFA 3TAEA 4ELVA 4ZTFA 1C0TA 1VRTA 4CJFA 5I3UA 1ASUA 3V1OA 1LWEA 3ALYA 3PO5A 4M3ZA 3RRGA 3ISNC 2G8WA 2IAJA 4DF4A 3SQ4A 3VQ8A 1U48A 2P1JA 1NOYA 1HQUA 5KRTA 1EX4A 2YKNA 3O4QA 3P5JA 3QERA 3OYNA 1S9GA 4CCHA 4KI4A 4M3WA 3CQ8A 3QESA 4N56A 5HLFA 1FKPA 1RT5A 3OYCA 3L8BA 3DRPA 2HHXA 4QCLA 1NK7A 2P5OA 4FLXA 1KVAA 3DM2A 4ID5A 4CHPA 4DTOA 4J2EA 3IG1A 2ZQBA 3V4IA 3S3MA 4CIEA 4AHUA 4J2DA 1TKZA 2W42A 2HW3A 4DS4A 2O4GA 1IKWA 1RT4A 4LD0A 3WNHA 4KRFA 3OYLA 1TAUA 1YT3A 4CEZA 4FJHA 2D5RA 4E1NA 3K59A 4JS4A 1QSLA 3VA3A 4F3OA 3ZCMA 1IKVA 4DSKA 2Z1JA 4FYDA 4C8KA 3RMBA 3BDPA 1JL1A 4FVMA 2HMIA 3OY9A 1HRHA 2IS3A 3NH1A 1BQMA 4DLEA 1J54A 3S3NA 4CJSA 4W5NA 1NKBA 1S1UA 2G8UA 3MEEA 1HJRA 4DF8A 4AHSA 1EP4A 4DTXA 1J5OA 3QLHA 3DLHA 1B9DA 3KD1E 1REVA 2X74A 5KGXA 3OJUA 1KLNA 4EZ9A 4FJXA 4FXDA 4CGDA 1X9SA 3PUFA 1BI4A 3LP1A 2X6NA 4CEQA 3QEWA 1TK8A 4FLVA 3D45A 2G8KA 2R7FA 3SPZA 1JLEA 1JXBA 1SV5A 1ZBUA 1N5YA 1WLJA 2YV0X 4Z4FA 3NF6A 3I8DA 3FI7A 3TAPA 4Z4IA 4O0JA 3I0SA 4B08A 4LH4A 1LWFA 4FJMA 3AVGA 1S1XA 4PUOA 4I2PA 1LAWA 2HNZA 1RCHA 1WSGA 4KKOA 4OPKA 4N5SA 3HJFA 3K58A 3AA2A 4UQGA 3AVCA 2OZMA 3ITHA 5CZ1A 1Q8IA 1SUQA 1FKOA 3HPGA 3HXMA 3LZJA 3QNOA 4KHQA 1RTJA 4FJJA 1ZBLA 4CGFA 3OJSA 2X78A 4CJLA 1S9EA 1NJXA 4DTMA 2VG5A 2VWJA 4M3RA 1VSIA 3ZSZA 4CEBA 1SL2A 3QIPA 3K5MA 2XRIA 4DTRA 2QK9A 1S1VA 4IDKA 4CIFA 3AVKA 4PA1A 4FJLA 3DLBA 3ZT3A 1SKSA 1VSFA 4HCBA 1HYVA 4ZHRA 2P5GA 4CF1A 3HSTB 4CJUA 4IFYA 4O44A 3QO9A 1BI4B 4JRQA 4Z4EA 3LANA 4XIUA 2GBZA 1A5WA 3ULDA 2PZSA 5E41A 4OKKA 2HVHA 3LP2A 4DQSA 3PX0A 1RTHA 3SUOA 3F9KA 4RW9A 1RT2A 1UA1A 4Z4GA 1UWBA 3KKRA 3QEVA 3RRHA 3RMCA 4O5BA 3I0RA 3CG7A 1NOZA 1VSHA 2NUBA 3DLKA 5I42A 1TGOA 1HYSA 3ZSXA 3T3FA 2ATQA 2YKMA 4N41A 1C1BA 4F2RA 3CM6A 1ZBIA 1QSSA 4IBNA 4CEFA 5CZ2A 5C25A 1JLGA 1CLQA 4W5RA 4DU1A 3KIOA 4E19A 3KLEA 4C8MA 4OKJA 2A1SA 1L3SA 5HROA 1KFSA 3CFRA 1WSJA 2Z1GA 2Y1IA 4OPJA 3SNNA 1U49A 3K5NA 5DMRA 4CGGA 5HRNA 4ELUA 3HVTA 4BDYA 4OJRA 1RT6A 4E7KA 1QQCA 3VQ4A 3TAQA 1W0HA 3NE6A 4BE0A 3VQEA 4BDPA 2WONA 3ZSQA 3OYEA 1QS4A 2RKIA 2WOMA 1GOCA 4KHUA 4E7LA 4DTSA 4CHOA 4Q5VA 4CFBA 3VQCA 3SV4A 4CEOA 4PQUA 1KRPA 3KLFA 3NGIA 3V1QA 3V9ZA 4CJ4A 1GOBA 1KLMA 4EP4A 1SKWA 1RT1A 4LSNA 2ETJA 4BE1A 2AJQA 4HUEA 1KTQA 1F21A 1Y97A 1C6VA 3B6OA 1Q9YA 1XHZA 3OS0A 2PYJA 1YTUA 3O4NA 4DFPA 3TAGA 1LAVA 4H4MA 4E89A 4CK3A 3OYIA 4ELTA 1HMVA 4HUFA 4FZZA 3L3UA 1TK0A 3M8RA 3TAFA 4CE9A 1XWLA 4CGJA 5JS2A 3SPYA 4FJ8A 3EY1A 1HYZA 1D5AA 4CHQA 3U6FA 4W5TA 4IKFA 3MECA 1N6QA 3V6DA 1WNSA 3QEIA 1BL3A 5SWMA 4OLAA 4KTZA 3QETA 3MAQA 1J53A 1T8EA 2EHGA 4FM0A 1RBUA 1WAFA 3AVIA 1TV6A 4CF2A 4W5QA 3AVJA 2YNHA 2P51A 3VQ6A 4DTPA 3NAEA 3K2PA 1RBSA 4KTQA 2F8SA 4FJIA 4FK0A 2KQ2A 4EP5A 5C42A 4BWMA 2DTUA 4CGHA 4GMJB 3NH2A 4FM1A 4DU4A 5FRNA 3V9WA 1I3AA 4CK2A 1G15A 1ZBHA 1RBRA 4O0IA 4B3OA 3VQDA 2IC3A 1LWCA 1C1AA 3BGRA 3H08A 5C24A 4DMNA 5KRSA 3NCIA 4KI6A 4RW7A 5JS1A 3ASMA 4HCCA 1KVBA 2KTQA 3TI0A 1IKXA 1JKHA 3AO5A 3NF9A 1JLCA 4CF8A 3IRXA 4FCYA 4BACA 3SZ2A 5J2PA 5SZTA 3ZT0A 3NBPA 4KTWA 3LPTA 4DQPA 1HNVA 3TR8A 3ZT4A 4KREA 1QHTA 1VSJA 4LY7A 4IG0A 4BDZA 1JLAA 4OVLA 3QIOA 3P1GA 3KLHA 3CYMA 1L3UA 2JGUA 1WSHA 3HL8A 5FDLA 4E7HA 4CF9A 3FFIA 3DOLA 3WNGA 2KZZA 4K8XA 4CFDA 3OYDA 1ZBFA 1TAQA 2Y1JA 2ITGA 3AVLA 2DY4A 2FC0A 1VSLA 2YNFA 2Z1HA 2B4JA 1VSMA 3LPUA 3V1RA 2IOCA 1WAJA 3U3YA 5KTQA 3QNNA 4E0DA 3VQ5A 1L5UA 2OA8A 3MXIA 4OGCA 2QKKA 1KSPA 4O55A 4Q0BA 1XC9A 4NCAA 4KV8A 5D3GA 2VG7A 3OS2A 3SI6A 3MEGA 1X9WA 1VK0A 3G0ZA 4FLTA 3QINA 3UIQA 1LW0A 3CFOA 3MXJA 4I7FA 3LZIA 4CIGA 3LALA 3CFPA 2ZD1A 4HVJA 1A5XA 4RW8A 4CJKA 4J2AA 1NK9A 1B92A 4B9MA 5J2QA 4DS5A 1WSEA 3S3OA 1QSYA 3AA3A 2HNDA 4QAGA 1D8YA 3LAKA 4I9LA 3VQ7A 2HHVA 1RBVA 4JS5A 4M42A 2ZE2A 3AVNA 3OVNA 5CY4A 2BE2A 1VSKA 3WNFA 3ZSWA 3ZSYA 4L8RB 1R0AA 1KFDA 4KHYA 4N47A 4CHYA 3OYGA 3EYZA 4HTUA 2HHUA 3K57A 1RT3A 1T05A 1QE1A 3SQ0A 4CK1A 4K8ZA 4HHTA 3SUPA 2PY5A 1IH7A 4DFJA 1S6PA 3OYJA 4KHSA 2HHQA 1DTQA 3JYTA 3JSMA 4CJ5A 4FLYA 4I2QA 4AHCA 3D0PA 1X9MA 4IG3A 2G8VA 4CEAA 1EXQA 3HPHA 1NJZA 2GV9A 1C1CA 3B6PA 2XY7A 1VRUA 1TKTA 4Y1DA 2RN2A 3HO1A 3IAYA 1WSFA 3SCXA 1HQEA 1RILA 2Z1IA 5HRSA 1BCOA 4KFBA 3SV3A 3SQ2A 3E01A 3ZSRA 3C6TA 3VN5A 4TSXA 3F73A 3NHGA 3PX6A 3PO4A 4OLBA 5J1EA 1L3VA
chains in the Genus database with same CATH superfamily
1Q7YW 3QDKA 2HMPA 3IMXA 1C0UA 2VQEK 1D9FA 2FF6A 1NTZH 1VQ4V 2DFEA 4PDMA 4CZMA 4Z2WA 4DTNA 4M63C 3MWTA 4B9UA 3MMVA 4B7EA 3AG4C 3CD6V 2ASMA 1LUWA 1X1PA 3O9RA 4TQDA 2JGDB 4EHUA 1M56C 1FXKA 3B8NA 3LWMA 1SS6A 3TARA 4JV5O 1RDAA 1BS3A 3C65A 4XEIA 2PGGA 3JSLA 5IYBO 3DTUB 5FPDA 3ETQA 1H2SB 4Q4Y4 2XO7A 2VG6A 2QWNB 2IJKA 3SDLA 5B3SB 2JS3A 1E4FT 1IO2A 3KLIA 1QTMA 1CXUA 3C95A 1UAXA 4B3SO 2JJ2G 5KX5A 2ZE7A 3JAMN 2O8FB 1AROP 1CXZB 2R9AA 2D0OA 3AVFA 4LF8O 3SR2C 2Q73A 4ZHQB 2I5JA 1XNQK 4OO1J 1Q43A 2QWLA 3IC7A 3AO4A 3CC2V 5BREA 5LGUA 5EU7A 3AVHA 3BP8A 1YJNV 3HR0A 1A32A 3RVZA 3S3WA 1VQON 2Q67A 5J2MA 3G10A 1R73A 2GELA 1ZWIC 2F8TA 1W59A 1L0VA 2GUZA 3OYHA 5AQMA 4HUGA 1LV5A 2JLEA 4TT3G 3KK2A 3DC6A 4ISGA 4J7JA 4G28B 4JYAB 4I4TB 2CH6A 1T3VA 2GSMB 2LFRA 4K35A 4MTGA 1ITGA 2X6SA 3LDEA 2X6BA 1P7GA 2ZNJA 3ZRWB 1YTAA 3KK7A 4X66O 2UUBO 2YC0A 4QS9A 2EJRA 2RHKA 3OBYA 1SESA 3V81A 1NJWA 1GMGA 4H5RA 1EBOA 3IDHA 1OH6A 1OCOC 2XY8A 5C15A 1H2KA 3FR0A 3EE9A 1FFXB 1U47A 3WXLA 5IYDO 2B5JA 4J10A 3AE5A 4F2SA 4QNHB 1OV9A 1RDDA 1MU2A 1YVUA 4H13B 5C2FA 1GN4A 3KD5E 1MNGA 2NZTA 3MD0A 4MVMA 2FBYA 3HKBA 3G4SN 4K25A 4CJEA 2G8HA 5CB4B 4CJPA 1NK6A 1W7AA 4DLGA 2QWRB 4R6ZA 2UXDO 3ZSVA 3DLEA 1PD3A 4DSJA 2WSSG 2DFHA 5AQKA 2V7ZA 3S41A 3EL2A 1VQ6N 1JXEA 2RNBA 4H0YB 4E3SA 4X20A 3DYAA 4MDAA 4N76A 3KVGA 3K5OA 1BQZA 2EJ7A 2F7TA 2WUSA 3FGUA 3MCPA 4NTWA 4AQYK 1TK5A 4CD1A 2ZQMA 4BGBA 4NXNK 1BISA 1RTIA 1VSDA 2JJ1G 1WA8A 1XMOO 2HBLA 4NCGA 1Q90D 2EIJB 3VEOA 3SAFA 5EYPA 3ZMVA 3VQWA 2X6CA 1GOAA 5AR0A 4FFBB 2QTDA 3TANA 4FJ7A 1R3JC 4WBNB 1O1WA 4B9LA 3HPLC 1TUBA 4A2AA 5GAHP 3ZEUB 3C6HA 1OH7A 4C8LA 2BDPA 3VQ9A 4IYHA 4CH5A 3P3PA 1Y76B 5FPRA 4GKJO 3TJTA 4JI6B 3ZIAG 2WU2A 4JAUA 1YITV 3BY6A 3TTFA 3CJCA 2OPRA 2X6AA 3JD0A 3QICA 4IEEA 3RTVA 1NKCA 5BXZA 2P9KA 3HKEA 3ZT2A 4JEPA 5BMVB 2ZR2A 3BAAA 4X64K 3ZRVA 1VF7A 4K0KB 3VERA 1TVKB 3L75H 4IOXA 4M7XA 2PW9A 4UUJC 2ZD9A 5FNVB 4LH6A 2G8FA 3WXKA 3OYMA 1HDJA 1FPOA 3M8QA 4OGEA 1ASJ4 1M1KO 3HP9A 2DN9A 3T1HB 3H3NO 5AQGA 2FBXA 3PSFA 4O2AA 3AE9A 1I39A 3CRQA 4LF5O 3MN6A 2QWPA 3KZBA 1NGGA 1EN6A 4JLHA 3HM8A 1NJYA 2UXDK 1D9DA 1E79G 4ICLA 2FB5A 3JD3A 4JI7B 2G8KA 4CFCA 3DLGA 4A57A 3BZCA 3CJHB 4ILHA 3BRCA 4B3RB 4PL8A 1HXS4 2DMXA 1PKXA 4DYLA 2Q3SA 4I7ZB 1NU0A 1S5JA 3WEEB 1MSDA 2HHWA 3AEAA 4O8UA 2VWKA 1T6DA 4Z1VA 3V9XA 2W6KA 2HVIA 4EB6A 3AE3A 1VQMN 2PYLA 2GUIA 1AR64 4HWIA 1NGFA 1SQKA 4FPAA 3AV9A 1VF6C 3WQTA 2LQTA 1BHLA 1WSIA 3FYEB 4KO0A 4DR5K 3RMAA 1DLOA 3K06A 1Q81W 5KMGA 3AO1A 5HL7L 3V9UA 5B1AB 5EOYA 2ZDIA 4DTUA 3B40A 5DM6L 3CCLN 5HRPA 2B76A 1ASWA 1HNWO 3P4IA 3OYKA 4CHNA 4M3YA 1VF5B 4DR4O 1POV0 3ID6A 1Q6HA 5BRDA 3RWUA 1X3MA 1BT8A 1L1FA 1HR0B 4DUZK 3LM9A 3AGKA 1DT9A 4AHRA 1BCCH 3CX5F 1Z26A 1Y6XA 4F4LA 3AO2A 3H3OB 4P9OA 5FLXN 4NYFA 5M1PA 3FD9A 1JFFB 1T44A 4JGSA 4JI8K 1T7PA 3TAEA 3QNEA 1C0TA 2MK3A 1LWEA 4OX9B 2Q6AA 2ZJRL 3CJ1A 1KD1O 1OCRB 3SPIA 3T4ZA 3M1FA 3SQ4A 1VBB4 2E1YA 2P1JA 1HQUA 2OTLV 1XNRO 5IT9O 2IM9A 1S9GA 4KI4A 4M3WA 1NR7A 2YX6A 4IO8A 4BRPA 5HLFA 3HOSA 1FKPA 1IXMA 3ZN1A 2LJ2A 3BF1A 1YEWA 4FLXA 3E8BA 1N34O 1AB3A 4LF7B 1KVAA 3DM2A 1KC8O 1QLEC 1NJIW 4A61A 3S3MA 2B1IA 4WFNL 1CZAN 3SPHA 1YTFB 2A79B 2QGNA 5F2RA 1KECA 4JKGA 4B1ZA 4DS4A 2O4GA 3LL3A 5GW7A 3WNHA 1TAUA 1DGSA 1DK1A 5AZIA 4BVOA 4WQ5C 3AK2A 3CC7V 4DR3O 3R3LA 3K59A 4JS4A 1QSLA 3VA3A 4F3OA 4UY8O 2QE7G 3QO7A 1R084 4UVAA 4C1NI 2R044 3SJHA 4DR1B 1NGBA 4IWVA 2Z1JA 1IX9A 2IH1C 3B77A 3OGCC 5AQZA 4FYDA 3OAAG 1ZUQA 4BR0A 2HMIA 1GTOA 1HRHA 2IS3A 5GTHZ 1VQ8V 4CJSA 4W5NA 1N32B 2A41A 1S1UA 2QA4N 1RMU4 3AECA 1HJRA 2YHWA 4H44B 4DTXA 4RTFD 1Y66A 1WBDA 5KPRA 3FAVA 4O4HB 3TU5A 4FXDA 2P9LA 3ABMB 3LP1A 2X6NA 4YY3O 3D45A 2XUMA 1JXBA 1SV5A 4JI0O 2RS54 2N04A 4ZI7B 1KAYA 3NF6A 3I8DA 1P49A 4O0JA 1BA0A 4LH4A 3ENHA 2FYUH 1YSCA 1S1XA 4H0VB 4I2PA 4E4EA 1RCHA 4KKOA 4ABMA 4JYAK 3AA2A 3DXRB 3BZKA 1SQGA 4FWOA 5CZ1A 3HPGA 2E2OA 2RM24 3W7TA 5LHGA 2EWSA 1S76D 3OJSA 1ZBLA 2X78A 1K73O 3VRBA 1P90A 1THZA 3ZHTA 1NJXA 1Z2GA 4ILJA 1VSIA 1EM1A 1N34K 1K8KB 2RS34 2EIJC 3W7WA 2WA3A 4FZ1A 2EINC 1MSWD 4JK9A 3FZLA 3O9QA 3SMPA 2Q8VA 4YSXA 1HYVA 2A3QA 5HOOA 1NH2D 3HSTB 3UKUB 1K92A 3F2KA 1BI4B 4B1UB 1KF6A 4DV2K 4Z4EA 2Q0AA 2GBZA 4HNAB 2PZSA 2O8DB 1URFA 3LP2A 4DQSA 3STZC 1KYOF 4YOWA 1RTHA 3C90A 1BDGA 2YSUB 1UA1A 5EIBC 1D4M4 4IIJA 1ATNA 1VSHA 4TV8B 5EK0A 2FF3B 3ZSXA 4DV0O 1FKAO 3T3FA 2Q97A 5AQHA 1QZ6A 1PM9A 4JI2B 1C1BA 1S77D 1IVSA 1OCZB 4MW8A 2HBJA 4IBNA 4OPHA 5CZ2A 1QSSA 2BSKB 3BA9A 1G1XB 1CLQA 4Z94A 3OE7G 3KIOA 1YHQN 1M93A 4E19A 3E66A 4GT1A 3ZMTA 1DEJA 4YIOA 1Q3EA 4LF6O 1L3SA 2QEXN 5C12A 4JI0K 4G2KA 2Z5UA 5LMNB 3SNNA 4C7UA 5HRNA 2O8BB 4EFBA 4ELUA 3O08A 4E7KA 1QVFU 3VQ4A 2VS0A 1XUPO 4XDKA 1YCIA 1KAXA 1W0HA 2WLHA 2RR14 4FPBA 5FPMA 1IXBA 1EZJA 2RKIA 1GOCA 4KHUA 5KPZA 4E7LA 4CHOA 4H5WA 3HB3B 2X7RB 4PQUA 4JKEA 1VBE4 4IHJA 4Z4GA 4CJ4A 4K3AA 2YIAA 4LSNA 2AJQA 3AK3A 4DRXA 1BHBA 1C6VA 3B6OA 3THXB 2PYJA 3O4NA 3OEEG 2YI9A 1MABG 3FZKA 4KBOA 3N2GB 2ZKOA 2O8CB 3AEBA 5LP6B 2HBKA 4HUFA 4P30A 3VEXA 4KUMA 5B1AC 2ZIMA 1JCGA 4DCHA 3TK1A 4CGJA 1S72N 1H1VA 2FXUA 1WLEA 3FB7C 3RYCB 5CMUA 5A2QO 4BIZA 3AG1B 4BC3A 3AG3B 4JTAB 1MA9B 1AVMA 1WNSA 3V6DA 3OUFA 1BA1A 1QQOA 2RJZA 3FFKB 1SAZA 4YHHB 4UCTA 3QETA 2BTQA 3WB1A 3OGIB 1WB7A 2QDOA 3MAQA 1YI2V 1W97L 1WAFA 4EIAA 1TV6A 3CC4V 1XMQB 1C0FA 1YQ3A 2P51A 2ARHA 5EC1C 3RBZA 3CMAV 1V9PA 4RAIA 4X8AA 5BR8K 4M7YA 3J80O 4U7NA 2XAFA 3G71V 2A6AA 3NH2A 4GMJB 1I0HA 4BG9A 1VQLN 3CPWM 4JHDB 2Q5ZA 4H0LB 1YAGA 2I7PA 3A5MC 2AGAA 1HJOA 4B1XB 1XEQA 4FWPA 4WFFA 4KI6A 1OCRC 1HKCA 4X62K 2VQFO 3ASMA 4J41A 1N36B 4K43A 3T1YB 3A5NC 2EILB 3L72H 1IKXA 4JKFA 4RQEA 2IH3C 3G6BA 1JLCA 2CTWA 5AFUH 4CF8A 4BACA 4FCYA 2P9UB 1HR0K 2CAZC 3ZT0A 4XDJA 4LCUC 3ZT4A 4RWTA 1FFTB 5C8YB 1RFYA 1VSJA 4UVBA 4FWSA 4KH4A 4JI3B 1WUAA 1BU6O 1NZ6A 3KLHA 1WSHA 1ZX3A 2LFSA 4I55A 1OVYA 4DV3O 4IO9L 3BABA 1GLFO 2E88A 3ID8A 5C2DA 4BR6A 4K8XA 4Q6GA 1F7YA 2R064 3ETDA 3KG2A 1Q6IA 4YTPA 2ITGA 4OX9K 3AVLA 1SZTA 2DY4A 3FB6C 2B4JA 4CS3A 4O2BA 2BTFA 2IOCA 4IFEA 2H89A 5KHGA 5KTQA 2HWB4 3O80A 2A0LA 3CCVN 1AP5A 4KV8A 1VF6A 2Y0PA 4UCOA 3SI6A 2NRTA 2WAMA 4FLTA 1IBLB 2E5LB 1W0KG 3LZIA 3VOUA 4A5UB 3LALA 4LF7K 4LBEC 1IBMO 1SS3A 3ABMC 2PFUA 4JI5O 1HPMA 3P32A 4LF9B 3MN5A 1M1KW 4QE7A 4DV1B 2UUAO 3A5LC 2HHVA 5D5QA 2Y48A 4DR2B 4UCVA 3AGRA 5CY4A 2YJEA 1SC5B 2NNWA 1KFDA 4KHYA 4CHYA 3DAWA 1J5EO 2JGDA 3OYGA 3EYZA 2ZGYA 5AQTA 3ZRSA 4CK1A 3J8AA 4DR1K 1VBC4 4HHTA 1YF2A 1NS1A 1S6PA 2HHQA 1G6UA 4JI1O 2IJHA 1X9JA 3JSMA 4I2QA 1N32K 4CC5A 3CCJN 4IG3A 2OIGA 1MWKA 4RQFA 2G8VA 1R6NA 4CEAA 4MVRA 2NRVA 1EXQA 2QWNA 2ADPA 2GV9A 3HZ6A 3B6PA 3ICXA 4Y1DA 3IAYA 3SYAA 1WSFA 4FOIA 2Z1IA 4WFBL 2YS8A 4PA6A 3E01A 1HKGA 1N33B 3VN5A 2DWDC 2HLDG 4CBCA 4DUYB 1U45A 3O6WA 4ZHQA 3JS6A 2WA4A 1Q86O 4FJNA 4AHVA 3SYOA 3AA5X 3P3NA 3A2FA 3K5LA 1IKYA 4GNIA 4CJ3A 5AQQA 1I94O 2WFBA 2GX9A 4YFUA 1SZ2A 4WQ5A 1NK5A 3L2WA 1NK0A 1U2VB 1WN7A 1BEV4 1OCZC 1AR84 1T03A 1OJHA 3VF2A 1SA0B 3FYIB 1TUYA 1MDUB 3CPEA 3ABUA 4R8CA 4DV5O 2IJJA 3THWB 4I4TA 4I5SA 1RT7A 2DYSB 4PI0A 1KD1W 2AA4A 4MFBA 2YEVB 2KQXA 3LDCA 4C1NK 4CJRA 3CD6N 3RGBA 3ZRWA 4I9QA 4GKKO 5AQXA 4M45A 5C10A 3KTQA 2BOCC 2F4VB 2G8IA 1F4NA 2XY6A 4XDLA 5GONB 3HVRA 1ESVA 1B9FA 1ZL8B 4WFHA 2DJVA 4GV3A 1PP9H 4CF0A 2ZIOA 3ABVA 1FFXA 3CCMN 3LSSA 3E89A 1KC8W 3ATVA 1BCMA 4KL1A 4JI2K 3OMAB 4CZZA 3SJBC 1CEZA 3A0IX 2GEMA 4BWAA 2IW5A 2HEPA 5CB4A 2QWRA 4JI4O 4L87A 3NH0A 4Q4X4 4PL7A 3K9AA 2QI2A 1CZ9A 3PSIA 4PWDA 2H94A 3A0HZ 5GIOA 5LMNK 4BGAA 4DU3A 3AE4A 4BR7A 5LP6C 3AO3A 5IWAB 1B6QA 3K9SA 3VEVA 3M8SA 3CC2N 5AQOA 5C93A 4KHNA 1S6QA 3CIPA 4BG8A 4DQQA 1BWFO 3JD4A 4FFBA 5LMUO 2UUCB 3N4PA 4FZYA 4JASA 4J9YB 3AG3C 4WBNA 1GLDG 3NGZA 3O3HA 1KMIZ 4RWUA 3WB0A 5L3DA 4WFGA 3ZEUA 2CH5A 4B8CA 3ZBHA 2P9NB 3CCVV 1Y76A 2IVNA 2G38A 3MXMA 3CERA 1TL3A 1ZTEA 1EETA 2YHAA 4CZHA 1BQ0A 1Q82O 2IDOA 1RUE4 1HRI4 3HYFA 4UCSA 1NGEA 3T1AA 1RPOA 2JRIA 4Z1MG 4X9QA 2ITCC 2YHBA 4XH4A 2HHHB 5BMVA 3LSUA 1SKRA 5AQNA 3KJVA 2VQEO 4H8KA 4AH9A 5KI6A 3C6UA 1U04A 2IIRA 1TVKA 3JAWB 3O3GA 1UFIA 4BC4A 5FNVA 2CGKA 5HP1A 4X1IB 3KKSA 2QKBA 1EO1A 5BPMA 4AI8A 2IU0A 3HI0A 1BZKA 3QEPA 1BGYH 4EKWA 1VQPV 2RF2A 1XMQK 2IVOA 2NRHA 3DMJA 4YNQA 1QNMA 1QZ5A 1VBD4 2VGNA 3R1XA 1Z7S4 3DLLL 2YICA 3RT3C 3VQAA 2CDYA 4JYBA 3ENBA 3H1KH 1KVCA 1NKEA 2LW7A 5GTIZ 3L74H 1SERA 2NR5A 3CEIA 4X65B 2ZNIA 2E8AA 4F8RA 3S9HA 5KLVH 3CJHA 5FROA 1TKDA 2EZOA 1BL8A 1AR4A 3VEWA 4AM6A 1NEKA 2YNIA 3WEEA 4Z4CA 3N2KB 5C2TA 4LF4B 4I0XA 2DYRC 3AA4A 2QM8A 4IJAA 4CZGA 1S1TA 1N36K 1XNQO 4BQZA 3CIRA 1VMGA 2JDIG 4NCBA 4AILC 3VGLA 4X89A 5LOVB 3ATUA 1QCEA 1TUEB 1RDBA 5KGWA 5EC2C 4PELA 4JI3K 1A5VA 1HX1A 1YITN 2E4LA 2QKSA 3VQPA 2E2PA 1AR94 4J7ZA 2UXBB 3OFNG 2XAJA 2P06A 3PIPL 5CR4A 3OYBA 4GV6A 1RVF4 2ZJPL 5BPLA 5K14A 3OW2M 4M3UA 2HNYA 2LO1A 3SYZA 3V9SA 4MTFA 2QW9A 4DV6B 4QE9A 5ITZB 4F3TA 3R8EA 4W5OA 3JATB 2Q4PA 1OOPD 3VR9A 1H8HG 5IJ0B 2E1ZA 3UB5A 3VF4A 1NH2B 5CYQA 3P83D 2P7TC 2R70A 1IBKB 5CYMA 1UA0A 1IBLK 2L35A 3S3XA 1DTTA 4GW6A 2E5LK 3VA0A 5CBFA 3SJCC 4CVNE 3CCMV 3P39A 1G4YB 4BRIA 3QFPA 3JXUA 2DFFA 4F6EA 5LXTB 4M3TA 4WCEV 4BRQA 3C0BA 3PV8A 4DR2K 1K6YA 3L2QA 2KFNA 3TAMA 5C3JA 1OH8A 1PNKA 1QQNA 3NF8A 3TXQA 3NDKA 3MHSC 3QVNA 2P9SB 4B3MK 1NT2B 3NR7A 4AQYO 2OIEA 4YJ3B 3CRAA 4NXNO 3CQYA 3LDSA 1EWQA 4JZ2A 1RDWX 2IGIA 4GX0A 4I6MB 2E6LA 3EZ5A 1JLFA 1YXBA 4KHWA 2JEUA 3AEGA 4LH5A 5B1NA 4TV9B 3EZWA 4DSFA 1IV0A 4ELVA 5I3UA 1VRTA 4CJFA 3PO5A 4JF3A 1V4TA 4M3ZA 1BSMA 2F66C 4JPRA 4HTLA 2ACZA 2IAJA 1O9HA 1N33K 1E1QG 1E4GT 4UV9A 4CS4A 3VQ8A 3SGIA 4DUYK 3KCYA 3QERA 3P5JA 4O4HA 4FIPC 5LL6Y 4CCHA 2DPNA 3CQ8A 1NKDA 5GIPA 4N56A 1XC3A 3L8BA 1JPXA 4JAVA 3DRPA 4X64O 2P5OA 4BIUA 4ZI7A 4CHPA 4DTOA 1EFRG 2LW1A 3IG1A 5EZYB 4EFEA 3V4IA 3T2MA 2XAQA 3VTIA 1RT4A 5K1XA 4LD0A 4KRFA 2GTAA 2HP8A 3OYLA 2GTSA 4WF9V 4CH4A 1HUXA 5M1KA 2OTLN 3DXRA 2CGLA 4E1NA 2WQYA 3EO3A 3Q7BA 1YXQA 1IKVA 1BG3A 1SKVA 1B04A 4C8KA 3ZHQA 1BQMA 4DLEA 5IDJA 3S3NA 1DF4A 1SQBH 2F4VK 2FKXA 2Y0IA 4LFCB 2A40A 1GLJO 2N05A 4AHSA 5LA6B 1VRH4 3QLHA 1REVA 1PL4A 4ICGA 1TK8A 1BI4A 4CEQA 3CC7N 2R7FA 1MA1A 5GAEP 4HNAA 1JLEA 1ZBUA 2CK3G 1HW7A 4H0TB 3UKMA 4BRMA 2O8DA 1N5YA 4DR5O 1AJPA 1WLJA 4Z4FA 5LYJB 4KX6A 3E2EA 4TUYB 2ZXWB 3TAPA 1YIJV 1RUJ4 1VQ8N 3O9OA 2P22C 3CB2A 2PI5A 4J8FA 1LAWA 2HNZA 4A5AA 5IWAK 4IYIA 3K58A 4YDUA 2OZMA 3WG7B 2BSKA 2PUSA 3FX7A 1SUQA 3HXMA 3QNOA 3BF3A 4DUZO 5H6QA 5J2TB 4FJJA 4CGFA 3JASB 1S9EA 3C3TA 5EY4A 2WLMA 2OWOA 4DTMA 2UUCK 4M3RA 4GB34 3ZSZA 4UCUA 4CEBA 3QIPA 3K5MA 2O8BA 1S1VA 4JI8O 2Q7EA 3BPZA 3AVKA 3EE8A 4PA1A 3U10A 1SKSA 3DLBA 4HCBA 4PKHA 4ZHRA 4CC6A 2D4WA 4DQ8A 4IFYA 3H1JH 2UU9B 3L0QA 2B5UA 3QO9A 4DW0A 4O44A 4JRQA 3LANA 4PV1B 4XIUA 3SLCA 3ULDA 1Q86W 1O9GA 3FZHA 2FSJA 2ITDC 4OKKA 5EBMC 4BR2A 3SUOA 1S5HC 3OTOB 2HHHK 1UWBA 4ZOLB 2AW9A 4IZ9A 3RRHA 4O5BA 1GN2A 3CG7A 3QEVA 3AE2A 2NUBA 3IFXA 4JAAA 4PJ0Z 3DLKA 5AG2A 2UXCB 3GE1A 3THXA 1CPYA 3LDLA 1AILA 3ENOA 1ZBIA 1RUF4 1WPBA 3MCAB 3N2GA 1JLGA 3K0GA 4W5RA 2O8CA 4MVUA 5LP6A 3K04A 3RYHB 4FWRA 2KG7B 4JN4A 3J7ZO 1I5YA 3KLEA 1B06A 2A1SA 5HROA 1S3JA 1L0LH 1Z5WA 3BY5A 1PPJH 2QM7A 4OPJA 4G27B 3MK6A 1U49A 4CGGA 3RYCA 4OJRA 1RT6A 1PL0A 1QQCA 3EVKA 1XILA 3TAQA 3EFFK 4X65K 5MLCQ 4U7OA 3VQEA 3ABKC 3ZSQA 3D36C 2D1KA 1VQ9V 3G80A 3KHYA 4H5VA 2YJFA 3THYB 3SFDA 2KKZA 2V51B 5KHIA 3AAPA 4YXDA 4CEOA 3F5WC 4LF4K 1KRPA 4LFAK 4X1YB 5GAGP 1U97A 5KHHA 3JAKB 4EP4A 1LUVA 2ETJA 4BE1A 1SETA 4HUEA 4BRGA 1H2NA 1KTQA 5I9EB 1Y74B 3RN4A 2ZM6B 3L71H 4FWQA 1Q9YA 4JHDA 3OS0A 1YTUA 3CRRA 3OYIA 3CCRV 1HMVA 3GVMA 4J11A 4PDVA 4FZZA 1COV4 3L3UA 2R72A 2UXBK 1HNXB 5B3SC 2PAVA 4YOUA 3M8RA 3TTCA 2P9UA 2QSAA 4JYAO 3TETA 1XWLA 4CE9A 3SPYA 5CA0B 3EY1A 4FJ8A 1HYZA 3I56V 1XBLA 5AZJB 1IZ3A 4RUEA 2HWC4 3VGMA 1N6QA 3P4RA 3N4QA 1YUWA 4MLEA 1BL3A 5SWMA 3X2QB 3JALA 1J53A 1HKBA 2EHGA 2P9PB 3AVIA 4KH5A 3PIOL 1O13A 4CF2A 3D2FB 1V55B 3AVJA 4YOXA 1IBKK 3VQ6A 3OMNB 1Q82W 2F95B 4FK0A 5C42A 1QR8A 1GO3F 4BWMA 5J2UB 4DV2O 1FJGB 3U9ZA 2K1EA 4IXCA 1SQVH 1ZBHA 2HKOA 1RP3B 3K9JA 2JK5C 3VQDA 1QR9A 3H08A 3SYPA 1YI2N 1QVGM 4IEIA 3CC4N 4BY9C 1KVBA 2NRWA 3NF9A 4IL6Z 5KX5B 4Q4V4 3CMAN 3R6MA 2Q69A 4H5TA 4J42A 2LP7A 3LPTA 4FWLA 4TWKA 3ZRXA 2AP1A 1EN4A 4LY7A 3Q4HB 4O4JB 3G71N 2WP9A 2FTKA 4JYYA 1ZLZA 2HR3A 1L3UA 4DV7B 4QS7A 5FDLA 2E74B 3WNGA 1KB9F 1M90W 3AE8A 2EULA 1EWRA 2PI4A 3ZN0A 1ZBFA 3M5RA 2Y1JA 2WLIB 2ZT9B 2H3OA 3DXKB 3QO8A 2Z1HA 4A62A 2LGWA 2ZR3A 1VSMA 2BH1A 3VQ5A 2HJDA 4QPKA 3O5BA 3MXIA 4Q0BA 2M6YA 2WDVA 5J9PC 3QB0A 2VG7A 3MEGA 3AY9A 4I9WA 2Q7GA 1NMNA 2HF4A 3MXJA 3QINA 3CPWU 4CIGA 3UIQA 3JCUZ 4BIOA 1B92A 3GOIA 4DS5A 1WSEA 1EN5A 4PA3A 2IU3A 3LDNA 3LAKA 1H8EG 2YHYA 1OZ0A 1X59A 4I9LA 1NGAA 4QAGA 4JS5A 4AM7A 3PX4A 2JIZG 4KHPB 3OVNA 3CCUV 1VSKA 2HSTA 5LL6Z 2D0PA 4N47A 1T6CA 2EIKB 3K57A 1RT3A 1T05A 3SUPA 1U2VA 1IH7A 1JQ0A 3AEFA 3OYJA 4KHSA 4CJ5A 1SA0A 4FLYA 4JI7O 3P4QA 3JD1A 1NLVA 4LFCK 4BRNA 4B3RO 1U6ZA 5IJ9B 3THWA 1IBMB 4I50B 3THOA 2ASPA 2P9IB 1NJZA 4C23A 2YEVA 1C1CA 5JVHL 1GRJA 2RN2A 3HKDB 3SCXA 1MZEA 4FOEA 2EIMB 5BR8O 2C2AA 2KSDA 5GONA 3C6TA 4OLBA 3VR8A 4UVCA 3PO4A 4YSYA 5J1EA 1L3VA 1ZL8A 1YQ4A 2P90A 1NTKH 5CE3A 1NM1A 1TUBB 4GZRB 4FZ0A 1P8ZA 1GN3A 4BRAA 4X62O 4FK4A 4JI6K 4ZBMA 1WP8A 4B9SA 1BE3H 2HFEC 2E75B 1NG9A 3FZFA 4J7KA 4JKCA 3NMUA 4FJ9A 4WFEA 3WXJA 3PN1A 1HR0O 4PHTX 4FM2A 3OA9A 1QBZA 3WQUA 3HKEB 3E9LA 4UFZA 1VAZA 4GV9A 3E83A 4M3XA 5L3BA 1ASVA 3L73H 1XI1A 3DI6A 5JLFA 5IYCO 2FBVA 3ULEB 2WBNA 4PKIA 1M4UA 1HNZB 1RTDA 3Q7CA 4CGIA 1V4SA 2M7WA 4K0KK 4LNUA 1JLQA 5F0XA 5DM7L 3KLGA 5LGTA 3NF7A 1KKCA 1ZYQA 4KB1A 2HHSA 3U11A 4DR7B 4OPAA 1J6ZA 4X1KB 4OX9O 2UU9K 4EZ6A 1RNHA 3F7VC 1Q7YO 3T1HK 3H1VX 3ETEA 3WXIA 3VQXA 3QF7A 4U3FH 3C94A 4FL9A 2JS5A 3HM9A 4CERA 4Y0WA 2QWMA 2P9NA 3HOTA 2FMLA 2QWPB 3THVA 2V7YA 2BGGA 2HHTA 2UXCK 4JI7K 3WNEA 3TPQA 4O8KA 3SAGA 4MVSA 3IC9A 3CXHF 2A3ZA 1NMDA 5J2NA 4UB6Z 3O3FA 4IFVA 4LF7O 1YVNA 2ASOA 4DV5B 3BFRA 3O9TA 4AHTA 1MG1A 5JJJB 4MVQA 4BR5A 2CGJA 4CJVA 4FK5C 1RDCA 2RQ6A 4MDBA 2Z3YA 4DQRA 5C0YA 2V1DA 1J9AA 5TISZ 1NA1D 2CH7A 3JAWA 4E1MA 2FSKA 2QTSA 3SBTA 1S1WA 3ML0A 2A06H 2F1MA 4DR1O 1LW2A 1NGCA 3AVAA 4Z0UA 3QO5A 1KU9A 1U4BA 4J9ZB 2F96A 3GQKA 2OZSA 1RUG4 4HAMA 4GVEA 3A0RA 1N32O 4CESA 4FW1A 5B8HA 1SL1A 2IBZH 3QBWA 4PY5A 4LFBB 3LWLA 2W6JG 4FPPA 3A0BZ 5KUKA 2ZM6K 1NK8A 2Q1NA 4H4OA 1K5QA 3O1WA 3CRCA 2QWQB 3CRMA 3N2KA 3E22B 4E7IA 4BVPA 3I55V 2VYPA 2BTOA 3MWPA 5EX5A 4DTJA 2WWWA 5IT9N 1VP7A 1AI4A 2RN9A 2NRRA 3K3WA 3RYFA 2BUPA 2Q0RA 5LHHA 1K33A 3OD4A 4RW6A 5CHIA 3SMSA 3L70H 1FXHA 2HB5A 3U0ZA 4FJGA 4U67L 1FXXA 3AVBA 4DKWA 3OR6C 3OUSA 4BAYA 1H38A 1MQTD 3QTCA 4NTXA 1S0VA 1BMFG 4OKEA 5JH7B 3JARB 2D2CB 5KAFZ 2CE4A 3D36A 2KHOA 3LP0A 1IURA 4FWKA 1UOCA 3DLRA 4DV4B 5BN8A 4YIPA 3HT3A 4WE1A 1LR1A 4DQIA 2FL4A 1JCFA 4FLZA 1FJGK 3G6EV 2PBDA 1KAZA 3C3SA 5ITZA 4B3TB 1FK9A 4O4IB 3AVMA 3AK1A 3JATA 4RCHA 3J7YP 4DSEA 4FJ5A 5IJ0A 4J2BA 1JR9A 1CP9A 1TYQB 4NXMB 3VRAA 2Q0OC 3M6GA 4BQLA 5JLHA 2YDEA 3IS9A 3FZMA 1RM1B 3DGEA 3D7EO 1VQPN 4B9TA 3HK2A 3MEDA 4JI2O 3M7MX 4BC2A 1TL1A 1WPXA 4R5PA 3MX2A 4FJKA 5LXTA 1T5EA 5LY3A 1NK4A 4YTMA 4GVMA 5HBMA 1RGIA 4YXWG 2D0BA 3OS1A 5IYZB 4ZTJA 2YIDA 2PF4E 3OT7A 4DR6B 2FBTA 4FK2A 1JX9A 4R7CA 4DV7K 3UQ8A 3AAQA 4RG8A 4YTNA 5KHJA 2RCVA 3ZEDA 1Q6UA 3I8BA 1AI7A 5LMNO 2P9SA 4LP8A 5CBHA 4CZKA 5M1NA 2O8FA 3R65A 5H5NA 3CM5A 2O8EB 4YJ3A 4B9QA 4I6MA 3PJSK 2EIKC 1DF5A 1NGJA 1BGXT 4CBWA 1KUQA 1XHXA 1XQSC 4G1QA 3JAMO 3KWGA 3RMDA 1NCQD 4TV9A 1HRV4 4DFKA 1YF5L 4E7JA 2A1RA 4BR4A 3BCCH 3MDQA 4YDUC 3ZX2A 2QKCA 4FW2A 3JD2A 1RFQA 2EIMC 3CCSV 1TVRA 2R9RB 1JL2A 2W6LA 2AXTZ 3KKYA 4N23A 5ELZA 2ZGZA 4DWIA 2UXNA 2DOSA 4FLWA 4BWJA 2RPIA 4O4LB 5FRMA 1XUQA 3GG4A 4WQ4C 5FPNA 4DSLA 1E1RG 4NYNA 5EZYA 1LCUA 1NGDA 5JVDB 1AR5A 4JKAA 2OYQA 5F2VO 4JV5B 3IFRA 3VOVA 5JCOC 4B8AB 4CJQA 4CECA 4IIJB 4QS8A 3QBXA 2JWKA 1SL0A 4YSZA 3PLAA 4WCEL 1OCCB 5F1XA 2ETNA 1DLBA 1XMQO 3AE7A 4MQ3A 2IJIA 1R1BA 2VCPA 3H46O 4CZFA 4ZTFA 1GLBG 2BOBC 4H0PA 1ASUA 3H1HH 3ALYA 3OW2U 3RRGA 1B3QA 3ISNC 4H33A 1Q81O 1VQ5V 2G8WA 4B3SB 4HBNA 3STLC 3VBBA 4DF4A 2H3GX 5LA6A 1U48A 1SF9A 1FYJA 4QIWF 3O4QA 2YKNA 5KRTA 5E1AC 4JNEA 1GLLO 5L3GA 4LF8B 3W3DA 1UJWB 3QESA 5EBWC 1N36O 3L6QA 4K42A 3CP1A 1RT5A 3UKRB 3OYCA 1PNLA 3AG1C 2WLJA 4ID5A 5LYJA 2WU5A 2UXXA 4TUYA 2ZQBA 4CIEA 4AHUA 1D2DA 3ZLJA 3F7YC 3VQYA 3SJQC 1OHHG 2HW3A 1IKWA 4JI3O 3UT5B 3ZETB 1RUI4 1D4XA 1I5XA 1N4CA 1IG8A 1YT3A 1HNZK 3J7AP 1SQXH 4U7BA 2KB1A 2D5RA 4FJHA 3MX5A 5B66Z 5AQWA 2XAGA 3ZCMA 5J2TA 4DR7K 4DSKA 1G99A 1YVWA 3JASA 5A2QN 1JJOA 4X88A 2VRZA 1J54A 3H9VA 4OGQB 1K7DA 2DQ0A 4X66B 2UUBB 1ATRA 2G8UA 5KHKA 1K73W 3CJ7A 1J5OA 1EP4A 3DLHA 3KD1E 3ZHSA 4FJXA 4LWSB 1KLNA 2EILC 4EZ9A 4KXRA 4TSFG 3RSEB 4CGDA 4WF9L 3R9PA 3W0LA 3PUFA 3U9DA 1IBLO 2E5LO 4YHHK 3QEWA 2WPDG 4BRKA 1R3LC 2VWBA 3VETA 1XQ8A 1K9MO 2XOKG 3J80N 5JICA 3FLCO 4DV1O 4ZOLA 4P2ZA 2N74A 4Z4IA 4DR2O 2UXDB 2FBWA 4B08A 4FJMA 1FXVA 3ZHRA 2B1GA 1TA8A 1KQSM 3BA8A 5L3FA 1L0NH 1R59O 1WSGA 4BR9A 4OPKA 1YZBA 2HJFC 4N5SA 4UQGA 3SYCA 1PIV4 3ITHA 4B3MO 3CCQV 1FKOA 4GY2B 1NU1H 3RYHA 4KHQA 1RTJA 4PA4A 4R79A 1XMOB 2KG7A 4H5NA 2ODMA 3T1YK 4MTXA 3W7UA 3BVOA 2CGOA 3B09A 2XRIA 2QK9A 4IDKA 4CIFA 1YIJN 4LFBK 4DW1A 3ZT3A 1K97A 1NGIA 2YIBD 4GX5A 3QMLA 4CF1A 1NNEA 5B1BB 1RPRA 3KZIZ 3AEIA 3VTHA 4GKJB 3THYA 1K4DC 1N33O 5E41A 4MW3A 3TTDA 2HVHA 1XREA 2RS14 3F9KA 4X1YA 4DUYO 3A5OC 2NN4A 3KKRA 3J81O 3JAKA 3I0RA 1NOZA 2CGNA 1TGOA 5I42A 1HYSA 1K3EA 1Y74A 2YKMA 3WXMB 2DE0X 2WS3A 5LHIA 2ZWHA 3U4LA 1JFFA 2OTJV 3WT0A 4E2LA 3H6EA 3CYOA 1RM1C 1PNMA 5C25A 4JK8A 2O57A 5FLXO 3QG5A 2RMKB 3HKCB 1ZOYA 1KFSA 2JEXA 2Z1GA 3UO2A 3CFRA 4LF9K 1SQPH 5AZJA 4LF5B 4DV1K 2Y4UA 3DJCA 4GLXA 4DV4K 5M1FA 1HWYA 4B7KA 1FAFA 3M99B 5CBGA 2ATKC 4D7SA 3APQA 2QM1A 2MW2B 1LNQA 2F4VO 1R094 1M5IA 5JJNB 2P9PA 4B3TK 5BRHA 1H2GA 5TKYA 4DTSA 1AL24 1UPGA 4PA9A 5JQGB 3D2FA 3VQCA 4L3QA 4NXMK 3SV4A 3NGIA 3V1QA 4CH3A 3CXCM 1PO14 1KLMA 1SKWA 4MTOA 3TSPA 5J2UA 3JBG4 3DC5A 2OCCB 4U3JB 2ZJQL 2OANA 4DFPA 3TAGA 1LAVA 4F6RB 1N0NA 3UE5A 3K03A 2GWKA 4E89A 4DR6K 1FD9A 4XH5A 1VQ9N 3SBGA 4ZKIA 3OBWA 1U96A 3K0SA 1HNWB 2DYSC 1TK0A 2CTRA 4YJ2B 3ZHUA 2WLLB 4DR4B 3D3IA 2Y4TA 5IWAO 1Y67A 3ZS8C 2ZE6A 3E9PA 1COWG 4JD2B 1D5AA 4CHQA 4RO2A 3MECA 4O4JA 3Q4HA 3OR7C 5GINA 4YOYA 2WTUA 4H37A 1QLEB 3QEIA 1AR74 2UYTA 2W6IG 2UUCO 3D8CA 1BOTO 4FM0A 1WP7A 4PHZA 5AQSA 3CCRN 1JJ2M 2NNUA 2WLIA 2YNHA 4WFAV 3UO3A 4DTPA 3NAEA 4KTQA 3AE6A 3DXKA 1YJWV 4FJIA 1OCCC 2ZE5A 3E8GA 2KQ2A 4EP5A 1H8TD 4BRHA 1V54B 3O65A 2DTUA 4CGHA 3TSQA 2EZPA 3GL1A 3I56N 5D5PA 3DXMB 4DU4A 3CMEV 4CK2A 2KLAA 4O0IA 1XNRB 2HHHO 1C1AA 5C24A 2V52B 3SPCA 5KRSA 2JVDA 4RW7A 3RYIB 3WB2A 5DEDA 4GYCB 3ZHVA 4A59A 3TI0A 1GAXA 3AO5A 4DHYA 1K8KA 1TUUA 2W41A 3IRXA 1P4RA 1JA8A 3SZ2A 1N34B 2F23A 5A9GA 5E26A 5SZTA 4JV5K 4KREA 3IUCA 3LSQA 1VQ7V 5B5EZ 1HNVA 1PVC4 3P4SA 4CZEA 3EEQA 3UKUA 4BRDA 4IG0A 3OMIB 3IJ4A 4QPJA 1JLAA 3P1GA 4OVLA 3CYMA 1C0GA 2JGUA 4E7HA 2KZZA 2CUGA 4DV2B 4MVZA 4YORA 4DR3B 4CFDA 1TAQA 4ILGB 1K8AO 2J4RA 1ILYA 4TV8A 3SAHA 5KAIZ 2FC0A 4X65O 3V1RA 3LPUA 4B3SK 5L3CA 4CJ7A 3U3YA 4TOIA 4NYKA 4NLBA 5IJ9A 4I50A 3C7NB 1KSPA 4O55A 3SPGA 2P9IA 5BZBA 4LF4O 5D3GA 4LFAO 4LF8K 3OS2A 3VENA 3HKDA 4N21A 4B1WB 1X9WA 2GHYA 1VK0A 3G0ZA 2EINB 2QWOB 3AE1A 5H1SQ 4YY3B 4I7FA 1VBA4 3H1LH 3AARA 4JI0B 5CA1B 4HVJA 4CJKA 2EBOA 4B9MA 5J2QA 1RDUA 3OTFA 3S3OA 1QSYA 4WQ4A 4NR1A 4QJFB 3CJBA 4IJNA 4CH6A 4DXWA 1QVGU 4LC9B 4BROA 4M42A 2ITMA 3AVNA 5AQPA 4KH6A 4EEQA 5JCOA 4LH7A 2UXBO 4EHTA 1QLNA 1F51A 4K41A 1FS0G 3BEHA 2WDRA 2YIBA 3O8MA 4PA7A 3UCSC 1QE1A 3LDDA 1VEWA 1PO24 2OCHA 4K8ZA 2Q68A 3ASNB 3E9OA 1L8DA 1DTQA 3F5TA 3JYTA 3ULEA 1H2LA 1NWKA 5AFUA 2WLKA 4AHCA 4X66K 3G25A 1X9MA 2UUBK 4DV6O 5BRFA 3D3QA 1K5MD 3ZJZA 2RE2A 1IBKO 4X1KA 3CCUN 2XY7A 2AHZA 1VRUA 1GLCG 3CCEN 3HO1A 3O9UA 1E3MA 4RHV4 1BCOA 4KFBA 5AQFA 5BY1A 3SQ2A 1Y4MA 2OT5A 1ZXOA 3ZSRA 2HG5C 3F73A 4TSXA 1I7FA 4MVOA 3VPZA 4FFKA 5B1BC 1SQQH 3WFVA 4Z4HA 1BIZA 1G8MA 1P84F 3BHPA 5E79Z 5LGNA 1W9HA 5T7BA 4JRPA 3OHRA 3D2EB 4DV0B 1RBTA 4RW4A 1N8RO 1JCEA 2LSNA 1Q9XA 2XTAA 4Y1CA 5HRRA 1AI5A 4D7TA 5FL7G 3ZSOA 2QTOA 1EKEA 2OPQA 4I0XB 1XMOK 2KKWA 1GM7A 2Y69B 3SFEA 3JCZA 3IGAC 3UM7A 5BR8B 4FVUA 4LF6B 3KCXA 3L4QA 2Q9LA 3MN7A 3I5DA 1DTOA 4CBXA 3L4IA 1XDCA 1VQOV 4F4KA 1GKFA 1RSOB 3ABTA 2NRXA 4L8JA 1H2MA 4OXSA 3J81N 4C8OA 4X62B 2PTMA 3K79A 4GKJK 3TGUH 3IKMA 3VQBA 3FKSG 2P6JA 3OYFA 5H6RA 4CJTA 2A42A 1NVPD 2GBOA 2IVPA 5ADXA 2QXFA 3L2VA 5C8YA 3HP6A 4O4GA 4B1YB 4FMTA 1EQYA 3T19A 3TABA 4PDWD 3AEEA 4LC1A 4DV6K 1WBBA 3JYCA 5KA5A 1OVQA 5M1QA 1L3TA 3RR8A 4CZLA 2QWQA 4JKDA 5JMVA 3E22A 1S22A 1QQMA 1FXKB 3SQ1A 1W2BU 5IE9A 2OCCC 4BRLA 4R50A 3L2RA 1BIUA 3VQQA 3NXSA 3EKUA 3SPJA 3FFQA 4J80A 3ZT1A 4CJWA 3NGYA 4LF5K 3EHBB 1Q5OA 3LAMA 1ZC6A 4DSIA 5K1PA 3CQXA 3H1QA 3E35A 4NLCA 2D0AA 5E84A 4FLUA 2OPSA 3RFRA 3G4SV 4FZXC 5JH7A 3JARA 1CXQA 4BRFA 4LFCO 1VQ6V 3L2UA 4BC5A 3HBTA 3MHHC 1K9MW 3T69A 2ZF5O 5EVZA 1AJQA 3LNNA 1Z25A 2QXLA 1P7BA 4O4IA 4DB3A 2YNGA 3LDOA 1Q18A 2I7NA 5KA6A 1TYQA 2B6AA 5AQUA 3ZX6A 2P4VA 1V54C 4IGGA 4QOZB 1RUC4 2KW4A 3O4WA 1KCFA 5IY5B 4JZGA 5AQYA 2VQFB 5M1OA 1HNWK 4JI6O 1K5SA 2GUZB 4DR4K 3WU2Z 4FWNA 1C0MA 4GX2A 3LDPA 3LM2A 3DRSA 3WUHA 3A8TA 2HF3A 3U8XA 4CEDA 4EAHD 3M8PA 4PKGA 2R7YA 2XY5A 2Q7HA 2GTDA 2O4IA 3TWHA 5IYZA 3CSXA 3NFAA 2BANA 2DQ3A 2P67A 2WC9A 3G67A 4DV3B 2HVJC 3I55N 4K0KO 2KFZA 4DG1A 2BE3A 4CEEA 2XHBA 2O8EA 3CE2A 2LGQA 4E1JA 5KQ8A 3E8FA 2UU9O 2EX3A 3DSQA 4MSWC 3CCEV 4C8NA 3T1HO 4BW9A 2QKAA 3SK3A 2ZXWC 4YT0A 1IG9A 4CS2A 3L9DA 4JYCA 1HNIA 3P31A 3OTOO 1XNRK 3VMFB 1ORQC 1KP2A 3FB5C 3HKBB 4W4LA 4UV8A 1DKGD 4XH1A 1EZVH 4A5BA 2DWEC 3WG7C 2W0XA 2UXCO 2E20A 3CJAA 2D0CA 1ROPA 4X20B 4F9OA 4P9PA 3P4PA 4JI5B 2Q36A 4CZIA 2UUAB 5KPTA 4B3RK 4KAZA 3G6EN 1J95A 1WA8B 1KFYA 4O4LA 4FO0A 1D5NA 5EYPB 1VQMV 4D6TH 3VQVA 1JLBA 4DR3K 2R074 4JAXA 1J5EB 5H9CA 5JVDA 4BE2A 4DFMA 1BQNA 1CZBA 4KB0A 1W2BM 1M57B 4QGPA 4JI1B 4B9VA 4JTDB 3HPOA 3CCLV 3SUQA 3ASNC 2OCEA 5DM6V 4ID1A 5DK5A 3KK3A 2E2NA 2E6MA 3QEXA 3L3VA 2YXYA 3SJAC 3APOA 2P9KB 2NLJC 4H0XB 3RR7A 3J8F4 1TKXA 4YY3K 5CA3A 3VESA 3OYAA 3EXAA 2OPPA 1JOYA 4M41A 2ZM6O 1EAH4 4J2EA 4H03B 1NI8A 2V7QG 1X3NA 3U3GA 3DOKA 4PI2A 3VEYA 3PY8A 2GWJA 1F4MA 3SJJA 3ETGA 1VSEA 5CN0A 3ABLB 3M8AA 3VEZA 1SRYA 3OEHG 3B8MA 3ZMZA 1HNXO 3UKRA 4CFAA 2E2QA 1W0JG 1FW6A 3ZX3A 3LP3A 2KZMA 4BRCA 2F93B 4O2AB 1I94B 1ATSA 4DK1A 5BR9A 3OTOK 3RW0A 1BUPA 3JSNA 3HSCA 4WYBA 4B9NA 1TAEA 4NTYA 3UT5A 3ZETA 3GQHA 4JK7A 2YXHA 3DRRA 4CHZA 4KPYA 3CCSN 3SUNA 2Y69C 3SYQA 1NQTA 3TXSA 1HPZA 1IDSA 1JCHA 3CETA 4LSLA 3ZMUA 3LUTB 4B1VA 5BPNA 3W7SA 3KK1A 1KP3A 2D3OW 2RDCA 3V1OA 4HYOA 3LNMB 3GWOA 1PV0A 4EB6B 2B9ZA 1KXPA 1WB9A 3RVYA 4GKKB 4Q4W4 2BCCH 2A7WA 3GWKC 1FJGO 1NOYA 4G9ZA 4LWSA 1EX4A 4X1IA 1Z05A 2F9WA 5KMGB 3RSEA 3K0DA 3J7AU 1NR1A 5GADP 3OYNA 5LJVA 4DV0K 3E8HA 1HLUA 4MT8A 1VQNN 3CWBH 2HHXA 2XASA 5FPOA 1NK7A 4QCLA 4PDRA 3CHXA 3X2QC 2QA4V 4J2DA 5JJEB 1TKZA 2W42A 3P30A 2X5ID 1QHAA 4JI4B 1VQ5N 3QFUA 4CW7B 4DV7O 1R6TA 4LF6K 1FXKC 1V55C 1ZSPA 1K8AW 4CEZA 1Z5VA 1BO5O 2A5XA 4A2BA 1KBHA 1NGHA 3B4SA 2ZCEA 3HRGA 1RUH4 3RMBA 3BDPA 1JL1A 4FVMA 2GUPA 2CTQA 3FB8C 4FJCC 3OY9A 3NH1A 3ASOB 3CF5L 2HOEA 1HNXK 2WDQA 1GN6A 5LMUB 5LOVA 2Q0UA 5EIBD 1HP8A 2QR4A 3LDQA 1NKBA 3MEEA 4DF8A 3OM3B 4IOAL 1YDXA 1OH5A 1B9DA 1SZXA 1NBWA 2X74A 5KGXA 3OJUA 3EN9A 1X9SA 3C6AA 1RHI4 3DWLA 4FLVA 3JALB 3SPZA 2ZINA 4IOCL 4CD3A 4KFMA 4MO5A 2YV0X 3I33A 3FI7A 4FSVA 2WLNA 3E86A 3TSUA 5KQDA 4KHPO 4JKGB 2VQEB 3I0SA 1LWFA 2V4DA 5L3EA 2DYRB 1GM9A 3AVGA 4PUOA 3SUCA 5AZIB 2YI8A 2YCHA 3FE1A 3KWIA 4EFHA 3HJFA 1S5LZ 5IY5C 1ENVA 3AVCA 5EBLC 5JVGL 4UCRA 1Q8IA 3LZJA 2Q31A 5EXWA 3F9MA 4CJLA 1QVFM 4ISEA 1R3IC 3HKCA 3D6RA 2HBMA 3ZYYX 4CI6A 2VG5A 4DK0A 2VWJA 1GH6A 3AG2B 2VGMA 2QM4A 1SL2A 3BUZB 4DTRA 5DECA 5H2FZ 1DGKN 3EKSA 4FJLA 1X4TA 1MZFA 1VSFA 3NVMA 3H1IH 1S3XA 1I08A 3FAVB 2P5GA 4CJUA 3NVKA 2F43G 2P9LB 4NO7A 4ASUG 1YHQV 4FWMA 3GDQA 3R66A 1AP6A 1A5WA 1N0JA 2JWLA 3CCQN 1VHXA 3RVCA 5KUMA 5JQGA 2K9PA 2CTPA 4LR3A 3MN9A 2QEXV 3PX0A 4RW9A 1RT2A 2ZE8A 4B3MB 1N8RW 3RMCA 3AG4B 1SQFA 5ADXH 3JD74 2VQFK 2W40A 5TKWA 1NENA 1M56B 1M9NA 2AHYA 1XNQB 2ATQA 5DN6G 4N41A 1Y64A 4U3JA 4F2RA 3CM6A 1WB8A 4F6RA 4CEFA 4MS2A 1VQKN 1ZAUA 4DU1A 3N27A 1VIBA 3A8YA 1IJJA 1XOUA 4C8MA 2YUAA 1KQSU 4OKJA 4YJ2A 5AQIA 4DV3K 2AZ2A 2WLLA 1HNZO 1WSJA 1Z6RA 3VGKA 2Y1IA 3K5NA 5DMRA 4JD2A 3HVTA 4BDYA 4DR7O 4CBUA 4KHPK 4AF1A 3NE6A 4BREA 4BE0A 4BDPA 2OTJN 2WONA 3OYEA 1QS4A 1ZP0A 2WOMA 2HVKC 3AEDA 3CHWA 2F9TA 1MWMA 4CFBA 4Q5VA 1M57C 3ZMSA 3KLFA 1YJ9N 4CZJA 1S72V 3V9ZA 4JKHA 1GOBA 2A9HA 1RT1A 4W4KA 4XBFA 4YHHO 1F21A 1JMKC 1Y97A 3DXMA 2P4KA 1XHZA 1IBMK 2YXLA 1VARA 1VQNV 4JI5K 2UUAK 4H4MA 1VQ4N 4Q20A 5JWPA 4CK3A 3O1BA 4ELTA 3RYIA 4JKBA 1YTFD 1NTMH 1R6KA 2NLXA 1US6A 2RMU4 3W7XA 3ABLC 3TAFA 2AZ0A 1WOQA 1J5EK 1F23A 4GUNA 1NBMG 5JS2A 3ZX0A 1VQLV 1MOFA 3BEXA 4MO4A 4AQYB 3U6FA 4W5TA 1AJNA 4IKFA 4NXNB 3CJ9A 1WAZA 2XAHA 4NB4A 4JI1K 4H0OA 4OLAA 3T1YO 2YI1A 4KTZA 2R9IA 1OCOB 1T8EA 1RBUA 3CI5A 4LFBO 3M3ZA 4W5QA 4IHJB 3K2PA 1RBSA 2F8SA 2XNDG 3ZCCA 2E76B 3CS5A 2FSNA 5HFLA 4ZIBA 1GK9A 3MDSA 4DRXB 1NVPB 3C7NA 4FM1A 5FRNA 3V9WA 2X0LA 1BHAA 1I3AA 4LNUB 5LJWA 1G15A 4RUFA 3CXCU 1RBRA 4ISFA 4O5FA 3NCIA 2IC3A 1LWCA 4TQFA 2XT9A 3BGRA 4DMNA 4B3OA 4KP4A 1QU7A 2E3CA 2QWOA 5JS1A 4HCCA 1YJNN 2KTQA 1JKHA 5AQRA 5CA1A 4PDLA 4WFAL 4X64B 2ZDIC 5J2PA 1I94K 5BN9A 3AG7A 4GCZA 1YJWN 3NBPA 4KTWA 3B2EE 4IT5A 4DO2A 1GLAG 3E1YA 3TR8A 4DQPA 1QHTA 2PLV4 2ADQB 4BDZA 1WJZA 3QIOA 3T1CA 1NJIO 2YHXA 3CMEN 3HL8A 2DW4A 4CF9A 3FFIA 3DOLA 2BTQB 4YOVA 1ZBSA 5AQJA 1KKDA 4DV5K 1R3KC 3OYDA 5AJ3K 4LF9O 4UB8Z 2H88A 2QJ1A 4DV4O 3GBTA 1K4CC 1VSLA 2YNFA 4GKKK 4V19S 1EV14 1WAJA 1LOTB 4B3TO 3QNNA 1L5UA 4MLHA 2OA8A 4E0DA 1VQ7N 1JJ2U 4OGCA 2CH7B 2QKKA 3K9KA 1XC9A 4NCAA 3ASOC 4NXMO 1XL6A 4GX1A 3RWRD 3O9SA 1XL4A 5B1OA 4JTCB 1JVMA 2GDSA 4PD4F 1LW0A 3CFOA 1K34A 3CFPA 2ZD1A 4J2AA 1A5XA 4RW8A 1GLEG 1NK9A 5LBQA 4HZ3A 4DR5B 2NRZA 3AA3A 3CCJV 2HNDA 1D8YA 4IDHA 4JI4K 3VQ7A 1M90O 1RBVA 4DR6O 2ZE2A 1VQKV 3GB7C 3D2EA 1MMMA 3WNFA 2BE2A 1OKJA 1AR1B 4YOTA 3T7ZA 3ZSYA 2Z0AA 3ZSWA 1R0AA 4I55B 4L8RB 4HTUA 4WFBV 3P38A 2HHUA 3K08A 4NB5A 3H45C 2ILMA 4NVPA 3H01A 3SQ0A 4DUZB 2PY5A 4LFAB 4DFJA 5AQVA 3T4DA 1RUD4 3TCUA 5LMUK 3D0PA 1GM8A 4O2BB 5HFMA 3RYFB 3HTVA 4UXNA 4BW5A 4JI8B 3HPHA 1RSOA 2H8PC 5AQLA 3AG2C 4NKGB 1TKTA 3VF6A 1YJ9V 1HQEA 1RILA 5HRSA 1AI6A 3SV3A 3B8AX 2FLOA 2W0FC 5FPEA 3PX6A 3NHGA 2Q2RA 5CA0A 3ABKB 2L6LA
chains in the Genus database with same CATH topology
1C0UA 1D9FA 4DTNA 2DFEA 4B9UA 1X1PA 4TQDA 3LWMA 3TARA 1RDAA 2PGGA 3JSLA 3ETQA 1H2SB 2XO7A 2VG6A 1IO2A 3KLIA 1QTMA 1CXUA 3C95A 1UAXA 5KX5A 2R9AA 3AVFA 3SR2C 4ZHQB 2I5JA 1Q43A 3AO4A 5EU7A 3AVHA 5J2MA 3G10A 2F8TA 3OYHA 4HUGA 1LV5A 2JLEA 3KK2A 4JYAB 4I4TB 1ITGA 2X6SA 2ZNJA 1YTAA 1NJWA 3V81A 2XY8A 1FFXB 1U47A 2B5JA 4F2SA 1RDDA 1MU2A 1YVUA 3KD5E 2FBYA 3HKBA 4CJEA 5CB4B 4CJPA 1NK6A 4DLGA 3ZSVA 3DLEA 4DSJA 2DFHA 1JXEA 4E3SA 4X20A 3DYAA 4N76A 3K5OA 1TK5A 1BISA 1RTIA 1VSDA 4NCGA 5EYPA 3VQWA 1GOAA 4FFBB 3TANA 4FJ7A 4WBNB 1O1WA 4B9LA 1TUBA 4C8LA 2BDPA 3VQ9A 4CH5A 5FPRA 4JI6B 2OPRA 3RTVA 1NKCA 3HKEA 3ZT2A 5BMVB 3BAAA 1VF7A 4K0KB 1TVKB 2PW9A 5FNVB 4LH6A 2G8FA 3OYMA 3M8QA 4OGEA 3HP9A 3T1HB 2FBXA 4O2AA 1I39A 4JLHA 1NJYA 1D9DA 4ICLA 4JI7B 2G8KA 4CFCA 3DLGA 3BRCA 4B3RB 2Q3SA 2HHWA 1S5JA 2VWKA 3V9XA 2HVIA 4EB6A 2PYLA 2GUIA 3AV9A 1BHLA 1WSIA 4KO0A 3RMAA 1DLOA 5KMGA 3AO1A 3V9UA 4DTUA 5HRPA 1ASWA 3OYKA 4CHNA 4M3YA 3RWUA 1HR0B 4AHRA 1Z26A 3AO2A 4NYFA 1JFFB 1T7PA 3TAEA 1C0TA 1LWEA 4OX9B 3SQ4A 2P1JA 1HQUA 2IM9A 1S9GA 4KI4A 4M3WA 5HLFA 1FKPA 1YEWA 4FLXA 1KVAA 3DM2A 4LF7B 4J2EA 3S3MA 4DS4A 2O4GA 3WNHA 1TAUA 1DGSA 4JS4A 3K59A 4F3OA 1QSLA 3VA3A 4DR1B 2Z1JA 4FYDA 2HMIA 1HRHA 2IS3A 4CJSA 4W5NA 1N32B 1S1UA 1HJRA 4DTXA 4O4HB 4FXDA 3LP1A 2X6NA 3D45A 1JXBA 1SV5A 4ZI7B 3NF6A 3I8DA 1P49A 4O0JA 4LH4A 1S1XA 4I2PA 1RCHA 4KKOA 3AA2A 1SQGA 5CZ1A 3HPGA 1ZBLA 3OJSA 2X78A 1NJXA 1VSIA 1HYVA 3HSTB 1BI4B 4Z4EA 2Q0AA 2GBZA 4HNAB 2PZSA 3LP2A 4DQSA 1RTHA 1UA1A 5EIBC 4IIJA 1VSHA 4TV8B 3ZSXA 3T3FA 4JI2B 1C1BA 1QSSA 4IBNA 5CZ2A 3BA9A 1CLQA 3KIOA 1M93A 4E19A 1Q3EA 1L3SA 5LMNB 3SNNA 5HRNA 4EFBA 4ELUA 4E7KA 3VQ4A 1W0HA 2RKIA 1GOCA 4KHUA 4E7LA 4CHOA 4PQUA 4IHJA 4CJ4A 2YIAA 4LSNA 2AJQA 4DRXA 1C6VA 3B6OA 2PYJA 3O4NA 2YI9A 3N2GB 5LP6B 4HUFA 2ZIMA 4CGJA 3RYCB 3V6DA 1WNSA 2RJZA 4YHHB 4UCTA 3QETA 2BTQA 3WB1A 3MAQA 1WAFA 1TV6A 1XMQB 2P51A 1V9PA 3NH2A 4GMJB 4KI6A 3ASMA 1N36B 3T1YB 1IKXA 1JLCA 4CF8A 4FCYA 4BACA 2CAZC 3ZT0A 3ZT4A 5C8YB 1VSJA 4JI3B 3KLHA 1WSHA 4I55A 3BABA 4K8XA 4Q6GA 2ITGA 3AVLA 2DY4A 2B4JA 4CS3A 4O2BA 2IOCA 5KHGA 5KTQA 4KV8A 4UCOA 3SI6A 4FLTA 1IBLB 2E5LB 3LZIA 3LALA 4LF9B 4DV1B 2HHVA 5D5QA 4DR2B 4UCVA 5CY4A 1KFDA 4KHYA 4CHYA 3OYGA 3EYZA 4CK1A 4HHTA 1S6PA 2HHQA 1G6UA 3JSMA 4I2QA 4CC5A 4IG3A 2G8VA 4CEAA 1EXQA 2GV9A 3B6PA 3ICXA 4Y1DA 3IAYA 1WSFA 2Z1IA 3E01A 1N33B 3VN5A 4DUYB 1U45A 4ZHQA 4FJNA 4AHVA 3AA5X 3A2FA 3K5LA 1IKYA 4YFUA 4CJ3A 1NK5A 3L2WA 1NK0A 1WN7A 1T03A 1SA0B 4I4TA 1RT7A 4PI0A 4MFBA 4CJRA 3RGBA 4I9QA 4M45A 3KTQA 2F4VB 2G8IA 2XY6A 5GONB 3HVRA 1B9FA 4CF0A 2ZIOA 1FFXA 1BCMA 4KL1A 3SJBC 4BWAA 5CB4A 2HEPA 3NH0A 1CZ9A 4PWDA 4DU3A 5LP6C 3AO3A 5IWAB 3M8SA 4KHNA 1S6QA 4DQQA 4FFBA 2UUCB 4FZYA 4WBNA 3NGZA 3O3HA 1KMIZ 3WB0A 4B8CA 3MXMA 1TL3A 1EETA 2YHAA 2IDOA 3HYFA 4UCSA 3T1AA 2YHBA 2HHHB 5BMVA 1SKRA 3KJVA 4H8KA 4AH9A 5KI6A 3C6UA 1U04A 1TVKA 3JAWB 3O3GA 5FNVA 5HP1A 2QKBA 4X1IB 3KKSA 3QEPA 2RF2A 3DMJA 3VQAA 1NKEA 1KVCA 4F8RA 2ZNIA 4X65B 3S9HA 5FROA 1TKDA 2YNIA 4Z4CA 3N2KB 4LF4B 3AA4A 1S1TA 4NCBA 4AILC 5LOVB 1RDBA 5KGWA 1A5VA 2E4LA 3VQPA 2UXBB 3OYBA 5K14A 4M3UA 2HNYA 3SYZA 3V9SA 4DV6B 5ITZB 4F3TA 4W5OA 3JATB 5IJ0B 5CYQA 3P83D 2R70A 1IBKB 5CYMA 1UA0A 1DTTA 4GW6A 3VA0A 3SJCC 2DFFA 5LXTB 4M3TA 3PV8A 1K6YA 3L2QA 2KFNA 3TAMA 3NF8A 3NDKA 1NT2B 4YJ3B 3LDSA 2IGIA 2E6LA 3EZ5A 1JLFA 4KHWA 4LH5A 4TV9B 4DSFA 4ELVA 5I3UA 1VRTA 4CJFA 3PO5A 4M3ZA 2F66C 2IAJA 1O9HA 3VQ8A 4CS4A 3SGIA 3QERA 3P5JA 4O4HA 4CCHA 3CQ8A 4N56A 3L8BA 3DRPA 2P5OA 4ZI7A 4CHPA 4DTOA 3IG1A 5EZYB 4EFEA 3V4IA 1RT4A 5K1XA 4LD0A 4KRFA 3OYLA 4CH4A 4E1NA 1IKVA 1SKVA 1B04A 4C8KA 1BQMA 4DLEA 3S3NA 4LFCB 4AHSA 5LA6B 3QLHA 1REVA 1TK8A 1BI4A 4CEQA 2R7FA 4HNAA 1JLEA 1ZBUA 1HW7A 1N5YA 1WLJA 4Z4FA 5LYJB 4TUYB 3TAPA 2P22C 3CB2A 1LAWA 2HNZA 3K58A 2OZMA 2PUSA 1SUQA 3QNOA 3HXMA 5J2TB 4FJJA 4CGFA 3JASB 1S9EA 2OWOA 4DTMA 4M3RA 3ZSZA 4UCUA 4CEBA 3QIPA 3K5MA 1S1VA 2Q7EA 3BPZA 3AVKA 4PA1A 1SKSA 3U10A 3DLBA 4HCBA 4ZHRA 4CC6A 4IFYA 4O44A 2UU9B 3QO9A 4JRQA 3LANA 4XIUA 3ULDA 1O9GA 4OKKA 3SUOA 3OTOB 4Z4GA 1UWBA 4ZOLB 3QEVA 3RRHA 4O5BA 3CG7A 2NUBA 3DLKA 2UXCB 1ZBIA 1WPBA 3N2GA 1JLGA 4W5RA 5LP6A 3RYHB 3KLEA 2A1SA 5HROA 1Z5WA 4OPJA 1U49A 4CGGA 3RYCA 4OJRA 1RT6A 1QQCA 3TAQA 3VQEA 3ZSQA 5KHIA 4CEOA 1KRPA 4X1YB 5KHHA 3JAKB 4EP4A 2ETJA 4BE1A 4HUEA 1KTQA 2ZM6B 1Q9YA 3OS0A 1YTUA 3OYIA 1HMVA 4FZZA 3L3UA 2R72A 1HNXB 3M8RA 4CE9A 1XWLA 3SPYA 4FJ8A 5CA0B 3EY1A 1HYZA 1N6QA 1BL3A 5SWMA 3JALA 1J53A 2EHGA 3AVIA 4CF2A 3AVJA 3VQ6A 2F95B 4FK0A 5C42A 4BWMA 5J2UB 1FJGB 1ZBHA 3VQDA 3H08A 1KVBA 3NF9A 5KX5B 3LPTA 4LY7A 4O4JB 1L3UA 4DV7B 5FDLA 3WNGA 1ZBFA 2Y1JA 2Z1HA 1VSMA 3VQ5A 3MXIA 4Q0BA 2VG7A 3MEGA 3QINA 2Q7GA 3MXJA 3UIQA 4CIGA 1B92A 4DS5A 1WSEA 4QAGA 3LAKA 4I9LA 4JS5A 4KHPB 3OVNA 1VSKA 4N47A 3K57A 1RT3A 1T05A 3SUPA 1IH7A 3OYJA 4KHSA 4CJ5A 1SA0A 4FLYA 5IJ9B 1IBMB 4I50B 3THOA 1NJZA 1C1CA 2RN2A 3HKDB 3SCXA 5GONA 3C6TA 4OLBA 3PO4A 5J1EA 1L3VA 1TUBB 4FK4A 4B9SA 4FJ9A 3PN1A 4FM2A 3HKEB 4UFZA 4M3XA 3DI6A 1ASVA 1XI1A 2FBVA 1M4UA 1HNZB 1RTDA 4CGIA 4LNUA 1JLQA 3KLGA 3NF7A 2HHSA 1ZYQA 4KB1A 3U11A 4DR7B 4X1KB 4EZ6A 1RNHA 3VQXA 3QF7A 3HM9A 3C94A 2JS5A 4CERA 3THVA 2BGGA 2HHTA 3WNEA 5J2NA 3O3FA 4IFVA 4DV5B 4AHTA 5JJJB 4CJVA 1RDCA 2RQ6A 4DQRA 1J9AA 3JAWA 4E1MA 1S1WA 1LW2A 2F1MA 3AVAA 4Z0UA 1KU9A 1U4BA 2F96A 2OZSA 4CESA 4FW1A 1SL1A 4PY5A 4LFBB 3LWLA 1NK8A 4H4OA 3N2KA 3E22B 4E7IA 2BTOA 4DTJA 2G8HA 3RYFA 4RW6A 4FJGA 2HB5A 3U0ZA 1FXXA 3AVBA 3QTCA 4OKEA 5JH7B 3JARB 3LP0A 1UOCA 3DLRA 4DV4B 3HT3A 4WE1A 4DQIA 4FLZA 5ITZA 4B3TB 1FK9A 4O4IB 3AVMA 4DSEA 3JATA 4FJ5A 4J2BA 5IJ0A 4NXMB 3IS9A 4B9TA 3HK2A 3MEDA 3M7MX 1TL1A 4R5PA 4FJKA 5LXTA 1T5EA 1NK4A 4GVMA 5HBMA 3OS1A 2D0BA 5IYZB 4ZTJA 4DR6B 2FBTA 4FK2A 3UQ8A 4RG8A 5KHJA 3ZEDA 3CM5A 4YJ3A 1BGXT 1XHXA 4G1QA 3RMDA 4TV9A 4DFKA 4E7JA 2A1RA 4FW2A 1TVRA 1JL2A 4DWIA 4BWJA 4FLWA 2RPIA 4O4LB 5FRMA 4DSLA 4NYNA 5EZYA 5JVDB 2OYQA 4B8AB 4JV5B 5JCOC 4CJQA 4CECA 4IIJB 1SL0A 4MQ3A 4ZTFA 1ASUA 3ALYA 3RRGA 3ISNC 2G8WA 4B3SB 4HBNA 4DF4A 5LA6A 1U48A 5KRTA 3O4QA 2YKNA 4LF8B 3QESA 1RT5A 3OYCA 4ID5A 5LYJA 4TUYA 2ZQBA 4CIEA 4AHUA 3VQYA 2HW3A 1IKWA 3UT5B 1YT3A 4FJHA 2D5RA 3ZCMA 5J2TA 4DSKA 3JASA 1JJOA 1J54A 4X66B 2UUBB 2G8UA 5KHKA 1J5OA 1EP4A 3DLHA 3KD1E 4FJXA 1KLNA 4EZ9A 4CGDA 3PUFA 3QEWA 1XQ8A 4ZOLA 4Z4IA 2UXDB 4B08A 4FJMA 1TA8A 3BA8A 1WSGA 4OPKA 4N5SA 4UQGA 3ITHA 1FKOA 3RYHA 4KHQA 1RTJA 1XMOB 2XRIA 2QK9A 4IDKA 4CIFA 3ZT3A 2YIBD 4CF1A 4GKJB 5E41A 2HVHA 3F9KA 4X1YA 3KKRA 3JAKA 3I0RA 1NOZA 5I42A 1TGOA 1HYSA 2YKMA 1JFFA 5C25A 3QG5A 3HKCB 1KFSA 3CFRA 2Z1GA 4LF5B 4GLXA 4D7SA 1M5IA 5JJNB 4DTSA 5JQGB 3VQCA 3SV4A 3NGIA 3V1QA 4CH3A 1KLMA 1SKWA 5J2UA 4U3JB 4DFPA 3TAGA 1LAVA 4F6RB 4E89A 1HNWB 1TK0A 4YJ2B 4DR4B 3ZS8C 1D5AA 4CHQA 3MECA 4O4J