2PYLA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTAC(2DA))-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 161
structure length 571
sequence length 571
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pylA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pylA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pylA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pylA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pylA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pylA06
2HNDA 3HM9A 4DTRA 1U4BA 4FZZA 3LP2A 2IAJA 2EX3A 3QEXA 2IS3A 4FLVA 4M41A 4DQIA 1TAUA 4Z4CA 1X9SA 5FRMA 1BGXT 3NGYA 1DTQA 1CXQA 4IFYA 3ZSZA 4DMNA 3NDKA 1EKEA 4BDZA 3SYZA 3K5OA 4M3TA 1S1UA 3OYCA 2BDPA 1JLEA 4FM1A 4BWJA 3ZT3A 4B9TA 4FW1A 1J9AA 1S6QA 4LH5A 4I9LA 1NJXA 3KLGA 4DTOA 3SQ0A 1X1PA 1WSIA 1RTIA 3HPOA 1KFSA 4KV8A 3BGRA 4KRFA 2VG7A 1Q9YA 3H08A 1K6YA 2RPIA 1VSHA 1TVRA 3ISNC 3I0SA 4MFBA 3HP6A 4K8XA 4CGDA 1C0UA 1A5VA 2ATQA 4DTUA 4FJ7A 2RKIA 4DLGA 4KAZA 4DSKA 2P1JA 2HHQA 4FJ5A 1ASVA 3KK2A 1ASUA 3PV8A 3THVA 2FC0A 5HBMA 3KTQA 1JLQA 1CLQA 4CFBA 1T03A 1RTJA 4FK0A 3LP1A 4GW6A 4AILC 3TANA 4BWMA 1TKXA 4DU4A 4CIGA 2X6SA 3ASMA 1BIUA 2HW3A 4DFKA 3HXMA 4FVMA 3G10A 3OVNA 4CJEA 1WSJA 3VQBA 3AO2A 3AVIA 3FFIA 3TR8A 3TWHA 4RW6A 4HTUA 5J2MA 4KPYA 3NGIA 3QEWA 3OYDA 4J2BA 4CEBA 1VSKA 1KSPA 1HJRA 3BDPA 1BISA 1C0TA 3LPUA 5CYMA 1HNIA 3OYIA 1X9MA 2E4LA 3UIQA 2DFEA 4CFAA 1WAFA 3ALYA 3DOKA 3SV4A 4Y1CA 3SI6A 3CFRA 3NH0A 3HO1A 4CGHA 4CEAA 3OS2A 4I9QA 3PX4A 5K14A 3V9WA 2PW9A 3AO4A 1QQCA 1G15A 1S1VA 3NH1A 4DWIA 4W5NA 4NCBA 4W5TA 1D5AA 1F21A 5KTQA 1RDAA 3VQ9A 2HMIA 3B6PA 3QNOA 1ZBHA 1XI1A 1RILA 4Z4HA 1U45A 1WSEA 3RTVA 2YHBA 3DRSA 4M45A 3EY1A 3ZSXA 4B9UA 3MEDA 2BGGA 1TKTA 4CEEA 1HMVA 4O4GA 3EYZA 3TAFA 3TARA 5CZ1A 5KGWA 4DS4A 4FLYA 3F9KA 1REVA 1JLGA 1NJWA 5KRSA 2HHXA 4CESA 3KD1E 1DTTA 4IG3A 2D0CA 1NK9A 2LSNA 1SV5A 3SCXA 1ZBFA 4FLXA 2ETJA 2IGIA 2IOCA 2OPQA 4BACA 4PWDA 1C6VA 4DSLA 4DF4A 3HVTA 1ITGA 5EU7A 4H4MA 1BQMA 3K57A 3NF9A 4DSEA 4IBNA 3RRGA 4AHSA 5E41A 3V1OA 5HLFA 1JKHA 3CYMA 1N5YA 2HHWA 3SQ4A 4DFJA 3S3MA 4O0JA 4CEDA 1JLBA 3AA4A 4IFVA 4CJ5A 1TK0A 2QKBA 3VQDA 4K8ZA 4LSNA 4OGEA 3ZSQA 3U6FA 3VQ6A 1Q9XA 2KFNA 2RN2A 4E7HA 1TGOA 1BHLA 4GMJB 4CHQA 2VG5A 3O3GA 2XY5A 4C8NA 3HVRA 1TKZA 1QE1A 2FBTA 3L3VA 3VQ4A 3EZ5A 4JS4A 3M8QA 3OYJA 5CY4A 4W5RA 3AA2A 3DLKA 2OZSA 1LAVA 3VQPA 4NYFA 1B92A 4M3ZA 1TK5A 2DTUA 1RTDA 1FXXA 4E1NA 3CM6A 1U04A 1JL2A 4FJXA 4KHWA 3IRXA 4BDYA 2A1SA 2QXFA 1KVAA 4C8KA 4ID1A 2PYJA 4N47A 4CJVA 1HRHA 5SWMA 3O4QA 2XO7A 4CIFA 3K5NA 2B6AA 4CK1A 4B08A 1KCFA 1RT6A 3LWMA 3PO5A 4HUEA 4BDPA 4E89A 4CEOA 3TAPA 2PZSA 4M3WA 3SQ1A 3VA3A 3AO1A 4KHSA 3L2QA 3D0PA 3QLHA 4C8LA 4CGJA 3OYEA 1IKYA 1IH7A 4DQSA 3SJJA 4CJLA 2ZQBA 2DY4A 5J2NA 4ELVA 4E0DA 3ZSYA 2JGUA 4CJSA 3PX0A 1NJZA 3VQ8A 2R7FA 3K59A 4O44A 3OY9A 3OYBA 1EX4A 5DK5A 4H8KA 4E1MA 3AVCA 3S3NA 3V9ZA 1HYSA 1GOCA 3AV9A 2X6NA 3QNNA 2Z1GA 5KGXA 4OGCA 4ID5A 4DTSA 4FK2A 1CXUA 4KO0A 1LWFA 3LP0A 4HCBA 1FKPA 4E7IA 2G8HA 1Z26A 4AHUA 1S6PA 1DLOA 3O3FA 2HNYA 1UA0A 3VQ7A 4CIEA 1RT2A 4DQPA 3OYGA 1IO2A 4DTJA 1BQNA 2G8KA 1RDDA 3C94A 3NGZA 1SL2A 2G8IA 3WNGA 3LZJA 4FJGA 1T05A 1RBRA 3QINA 3DYAA 3NE6A 1NKBA 4DU3A 4FXDA 2KZZA 1RT5A 3RMDA 1QSYA 1A5XA 1VSFA 3K5LA 1XWLA 1XHXA 1A5WA 3QESA 3DLBA 3P83D 3RMCA 4DSJA 2IDOA 3LANA 2B4JA 1S1WA 4IKFA 3V9SA 4JS5A 3U3YA 4RW4A 3K58A 2B5JA 4DSIA 4KKOA 4C8MA 3L2UA 3AVLA 1IG9A 3CG7A 1RT4A 4MQ3A 4N56A 3OS1A 3M8PA 1ASWA 5HP1A 1ZBLA 4B8CA 4HVJA 4FJNA 4CJ4A 4FJHA 4B9LA 1NKEA 4CHZA 4ICLA 3T19A 3HYFA 1J53A 3C6TA 3NBPA 3ZSRA 5C24A 4DF8A 1KLNA 2GV9A 4FLUA 1QSLA 1NKCA 2OPSA 1KFDA 4KHNA 3TAQA 2Z1IA 3QERA 4OLAA 4AHRA 4JRQA 4B9MA 4M3YA 4FJLA 4AHTA 2HVIA 1EXQA 1O1WA 4E19A 2YKMA 2YNGA 4E3SA 1Q8IA 4M3UA 4KHYA 1D9DA 3DLEA 3AVNA 3ZSOA 1U49A 3OJUA 2G8WA 4DTXA 3AO3A 4B8AB 1I3AA 3M8SA 2P5GA 3NFAA 3OJSA 1S5JA 4FLWA 4YFUA 4B9NA 1RDCA 1R0AA 3VA0A 2XHBA 2DFHA 1Z25A 3V1RA 4I7FA 3T3FA 4KHQA 5C42A 4CF9A 4FCYA 3AO5A 2DFFA 4EZ9A 2Y1JA 2ZD1A 4LSLA 4FJJA 2RF2A 3HJFA 3O3HA 3VQ5A 3QETA 2OZMA 1XC9A 4Z4GA 4M3XA 5JS1A 4CJPA 3D45A 1RBSA 1QTMA 3HPGA 3AVKA 3PX6A 3V1QA 3VQAA 4CERA 3HT3A 3HP9A 3QEVA 4KB1A 4CECA 1XHZA 2X78A 3LWLA 2KTQA 4I2QA 4FZYA 1HQUA 1FK9A 2EHGA 4DTMA 4KREA 3WNFA 1U47A 1SKWA 3WNHA 1TV6A 4WE1A 4KTQA 3RMBA 2PYLA 3NF6A 2YHAA 4PA1A 4RW9A 1X9WA 3CM5A 1B9FA 4F8RA 1HNVA 3SUPA 1J5OA 3DLGA 2D0BA 4W5QA 3ULDA 2HHUA 3MEEA 4F4KA 1IKXA 4CGFA 4R5PA 3CQ8A 3WNEA 2W42A 2G8VA 1YTUA 2HHVA 3P5JA 4HUGA 4OLBA 1LW0A 4CF0A 3DOLA 1BCOA 2OPRA 4FK4A 1L3UA 5FDLA 3ZT0A 3MEGA 4J2EA 1EP4A 3OYMA 1WN7A 4CCHA 4Y1DA 3LZIA 2P5OA 1LW2A 5C25A 4CGIA 4CGGA 5FRNA 3SQ2A 4FW2A 2R7YA 1WSGA 3ZSWA 3SNNA 1JL1A 1RTHA 1EETA 2VWKA 3V81A 4DTPA 2HVHA 1QSSA 2FBVA 4NCGA 3I0RA 2ITGA 3AVHA 3PO4A 3DMJA 2G8FA 3F73A 4IDKA 4F2SA 2IC3A 1UAXA 1UA1A 4IG0A 4PY5A 4CFDA 4JRPA 3VQEA 4AHVA 3OYLA 4N76A 3SUQA 2X74A 2HHSA 5HRSA 1KRPA 1IKWA 4M3RA 3VQCA 5HROA 2VWJA 4DSFA 3VN5A 3OYFA 4ZHRA 4FJMA 4EZ6A 1L3SA 4NCAA 1W0HA 4KHUA 3KLIA 4W5OA 1VSEA 3KKRA 1HYZA 4O0IA 2O4GA 2E6MA 3DLHA 4B9SA 4J2AA 4LY7A 1SL0A 4ZTJA 3RWUA 3IG1A 3HL8A 4AH9A 3OYKA 4OKKA 3L2RA 1BCMA 3MECA 1HYVA 3QEPA 4B9VA 1YT3A 1RBVA 1SKSA 1TL3A 4Q5VA 1VSLA 1BL3A 1KLMA 1RBUA 2OYQA 3L8BA 3RR8A 4BE0A 2A1RA 2Q3SA 5I42A 1NOYA 4EP4A 1WSHA 4HHTA 4F3TA 5SZTA 1S1XA 1L3TA 2OA8A 4CEQA 2HNZA 2E6LA 1VSJA 3DRRA 5KI6A 3AVGA 4CJRA 3MXMA 1N6QA 4H4OA 1LAWA 1W9HA 4CJUA 4CEZA 3I8DA 4CHOA 4KTWA 4UQGA 4Z4EA 1BI4B 1TKDA 4HCCA 1CZBA 4DU1A 4FYDA 4M42A 1WAJA 4DFPA 3SZ2A 3KKSA 1TL1A 3AVFA 4OPKA 4YNQA 3LDSA 3A2FA 4I2PA 3U3GA 4RW7A 3V4IA 2XY8A 4E7JA 2FBYA 5FROA 3AA3A 3IS9A 3AVMA 2OPPA 3KLHA 3C6UA 3SPZA 3PY8A 2BANA 3FI7A 1LWEA 1WNSA 1RBTA 3TABA 1NK4A 3JSMA 4F3OA 3NH2A 3AA5X 1SUQA 1SKRA 1RT3A 1JLCA 4FJ9A 1J54A 4OPJA 4DS5A 2BE2A 1S9GA 2KW4A 2Y1IA 1ZBIA 4HUFA 4PUOA 4RW8A 1S9EA 4QCLA 1NK5A 1ZBUA 4BE1A 4DLEA 1VSDA 5J2PA 2FBXA 1JLAA 5J2QA 3MAQA 4PQUA 2XRIA 4DTNA 1D9FA 2Z1HA 4CF2A 1C1AA 1GOAA 1C1CA 2KQ2A 3MXIA 1T7PA 1T8EA 3SUOA 4CJ3A 3TAEA 1U48A 2GBZA 3ZCMA 3SPYA 4FLZA 1RT1A 3V9UA 4C8OA 2YNFA 1CZ9A 3LP3A 3KJVA 1HQEA 2Z1JA 4KB0A 1VSIA 4NYNA 5HRPA 3AVAA 4CF1A 2G8UA 3NF8A 1I39A 3HK2A 5KRTA 3M8RA 3VQQA 5DMRA 1D8YA 3LAMA 2F8SA 3ZSVA 2KZMA 4FM0A 1HPZA 3DI6A 3DRPA 1SL1A 4FJIA 4GVMA 2KFZA 3CFPA 3V6DA 4EP5A 1KVBA 4QOZB 4CHNA 2YKNA 1BIZA 1C1BA 4OJRA 3NCIA 4L8RB 2YNHA 1VRUA 3G0ZA 3TI0A 1NK0A 4AHCA 1GOBA 1KTQA 4DG1A 4Q0BA 3CFOA 3KIOA 2WOMA 3OS0A 4TSXA 3OYHA 4CF8A 1UWBA 3NAEA 4N5SA 4OKJA 4XIUA 4DQQA 4CHYA 4E7KA 4DQRA 5D3GA 1JLFA 2YV0X 4B3OA 2QKKA 1BI4A 2I5JA 2YNIA 3HSTB 4CK3A 4ELTA 4CJFA 3RMAA 3L2VA 4OVLA 4CJTA 4LH4A 4QAGA 1UOCA 3SUNA 1RDBA 2HB5A 2O4IA 1RCHA 1WSFA 2P51A 4CK2A 2D5RA 3S3OA 1ZYQA 4RG8A 4F2RA 1JXEA 2XY6A 3S9HA 4FZXC 1KVCA 4CJKA 3KK1A 3RRHA 4KI6A 5JS2A 3IAYA 1NK8A 4G1QA 2GUIA 4FJKA 1FKOA 3QIPA 5HRRA 3ZT4A 4N41A 4OKEA 4FM2A 3C95A 4KI4A 2AJQA 2D0AA 4BE2A 3ITHA 1NJYA 4Z4IA 2QK9A 1TK8A 3QO9A 1VSMA 4JLHA 3MXJA 5I3UA 4O55A 1VRTA 3SV3A 1NK6A 3OYNA 3LPTA 1L3VA 1L5UA 5HRNA 1NOZA 3AVJA 1B9DA 1LWCA 3P1GA 3ZT2A 2HHTA 4E7LA 1Y97A 3AVBA 3B6OA 2JLEA 3LALA 3QIOA 1TAQA 1C0MA 2VG6A 4KFBA 4LD0A 3OYAA 5J1EA 3KLEA 4ELUA 1MU2A 4ZTFA 1RNHA 4J2DA 4CE9A 1RT7A 4O5BA 2XY7A 3ZT1A 3DM2A 1JXBA 1YVUA 3E01A 1NK7A 5CYQA 1QS4A 3KLFA 4KTZA 3L2WA 3L3UA 3NF7A 1VK0A 2ZE2A 3KK3A 4CHPA 4Z0UA 3V9XA 3TAGA 2F8TA 4FLTA 1WLJA 3DLRA 3TAMA 3HPHA 3KD5E 4FJ8A 5T7BA 2NUBA 3LAKA 4CJWA 3JYTA 4Z4FA 5CZ2A 3K2PA 3RR7A 2WONA 1IKVA 3T1AA 2PY5A 1LV5A 4DFMA 3K5MA 4CFCA 3O4NA 2F96A 1QHTA 4CJQA 1S1TA 3NHGA 3PUFA 4CEFA 1YTAA 3QEIA
chains in the Genus database with same CATH superfamily
1Z2GA 2D3OW 3ID6A 2EX3A 4UVBA 4FLVA 4DQIA 3BZKA 4LFCK 2P67A 3CJ7A 3L73H 1X9SA 3APOA 4LFAB 3E9PA 4MTOA 3ZSZA 1V4TA 1D5NA 3K5OA 1S1UA 5H2FZ 4GY2B 1S6QA 3O9UA 4LH5A 4I9LA 3AEIA 3QF7A 1WSIA 1Y66A 4FZ0A 3BGRA 3T1HB 1JOYA 1VQPN 5B1BC 1VSHA 3ISNC 3THWA 4PI2A 4H0LB 2WA3A 3CWBH 1XOUA 1A5VA 1U6ZA 4ILGB 1BT8A 3WFVA 3H3OB 4DLGA 1VQ5N 4QPJA 4KAZA 5C8YA 4FJ5A 1ZAUA 4J42A 3W7SA 4C1NI 4B3MO 3KK2A 3PV8A 1AB3A 4CFBA 4R8CA 3DXRB 1RTJA 4IIJA 1T03A 3LP1A 5GONA 3R9PA 1VQ8N 2WLNA 1KYOF 2A5XA 4CIGA 2X6SA 4O4JA 1SKRA 2R9IA 4X66O 3QO8A 1BIUA 4FWSA 3IC9A 1Q86O 3VQXA 4DFKA 3UT5B 4BC3A 3K04A 4X1IB 1DTOA 4DR5O 3AO2A 5CE3A 3A8YA 1VSKA 3LDPA 1GLAG 2LFSA 3LPUA 1C0TA 2X7RB 3D36A 5JVDA 2B76A 3ABMB 1TVKB 4JKGB 4WFNL 3T69A 5BRHA 1NR1A 2E4LA 3UIQA 3ZN0A 1JCGA 3SV4A 4I0XA 1BMFG 4JGSA 3CFRA 4B3RO 2CE4A 4CEAA 3OS2A 4I9QA 5K14A 3V9WA 3ZX3A 1KQSM 1QQCA 1G15A 1S1VA 1K92A 4NTXA 5KA6A 3CD6N 3PJSK 4H5WA 1OCZB 2E2OA 5KTQA 4JI2O 2HR3A 2P9NA 3J7AP 5F0XA 5LJWA 4F6RB 3RTVA 4JF3A 5B1NA 2YHBA 3AG2C 3AY9A 5BPLA 1TKTA 2YJEA 1DGSA 3ML0A 4UVAA 2FL4A 4LFCO 3W3DA 4DCHA 5LMNK 1L0VA 2ASPA 2GBOA 1SQPH 2XNDG 4NLBA 1TAEA 3IMXA 5ITZB 4YJ3A 2IVPA 1V55B 5DM7L 3KD1E 1BL8A 1BCCH 5BRDA 3JXUA 1NK9A 1P4RA 1SV5A 4H5RA 4FLXA 2IGIA 4DV2B 4BACA 2O8DA 1JCHA 3E89A 2WU2A 3P4QA 1MOFA 1VQ9N 5TKWA 2F1MA 4A59A 4X89A 5AQLA 3K57A 4IBNA 1NGAA 5AQNA 5D5PA 3CQXA 1IBKK 4AHSA 5E41A 5HLFA 4YSYA 3DLLL 4EIAA 3AG7A 4M7YA 3SQ4A 1PNLA 3S3MA 2RMU4 4O0JA 4CEDA 1K33A 4UV8A 1JLBA 2DQ3A 3AA4A 2NRHA 3QB0A 1TK0A 4LSNA 4OGEA 1KAXA 4IHJA 1Q9XA 4H5TA 4BROA 3O3GA 4CS2A 4K35A 4YY3B 1QE1A 1TKZA 2FBTA 4IFEA 5B8HA 3FZLA 5F1XA 3OYJA 4JS4A 2E74B 1GLFO 2Q7EA 4GKKK 3C3SA 3GDQA 1B6QA 1F23A 2K9PA 3ABLB 2DTUA 1VHXA 1FXXA 3GOIA 5AJ3K 3ULEA 2NRZA 1QZ5A 3AE4A 1CP9A 4X64B 2H94A 2A79B 5FNVB 5DEDA 2QXFA 3IRXA 2ZD9A 4ID1A 3SYCA 4N47A 1VF7A 3ZLJA 4DV5B 3PO5A 1V54C 3B09A 4HUEA 1PNKA 1WP7A 3HR0A 4E89A 3TAPA 1AR94 3E83A 3SQ1A 1SA0A 3BY6A 3L2QA 1IG8A 2ZXWC 2NN4A 1H8TD 2CUGA 4CGJA 3RYFA 2Q67A 4GUNA 1IH7A 3C6AA 4CJLA 4KH6A 3TCUA 3JCZA 4ELVA 4E0DA 2JGUA 2VQEB 2YJFA 5LMNO 4FWNA 4PDLA 4CZFA 4BW5A 5KMGB 3K59A 1EX4A 4H8KA 2WQYA 4UB6Z 4A5AA 5C2FA 4JK7A 1U96A 2Z1GA 4OGCA 3RN4A 3AG1B 2RS54 4WBNB 3TPQA 4HCBA 2DN9A 3CCRN 4MVQA 2H3GX 3HKBA 1DLOA 3CERA 5AFUH 3QICA 3WUHA 3THXA 3WG7C 1AI6A 4FMTA 4HZ3A 4FFBB 1SL2A 2WC9A 2G8IA 2RJZA 1T05A 1RBRA 3DYAA 4PA4A 1NKBA 4DU3A 3CMAV 2KZZA 1IBKO 3IJ4A 4JAXA 1R3JC 1HDJA 1QSYA 5FL7G 5M1QA 1DGKN 3QESA 1UPGA 2ZDIA 3CETA 1SQGA 2XAGA 3QBWA 2IDOA 4YOWA 5I9EB 1NT2B 5AQQA 2E76B 4IKFA 2PGGA 3OGIB 3K58A 3BABA 4MSWC 5LXTB 4DV0B 5M1PA 4KKOA 2O8CA 4I9WA 2A40A 4BC2A 4Q4W4 1IG9A 3CG7A 2BOBC 2HHHO 4GKKO 1ASWA 3M8PA 4B8CA 3SBTA 2JIZG 1QNMA 5HP1A 2QA4N 4FJHA 4B9LA 3NR7A 4CHZA 2GTAA 2FTKA 4ICGA 1PPJH 2FSNA 3HYFA 3NBPA 4WQ5A 3T19A 3CCSV 3ZETB 4CHQA 4FLUA 3JS6A 1NKCA 2OPSA 4JZ2A 4PA9A 3GWKC 3X2QB 1TYQA 2OANA 3CI5A 3TAQA 3QERA 1MZEA 5AQTA 3U11A 4AHRA 3JSLA 1VBD4 5D5QA 3JD4A 4FOEA 4B9MA 4N23A 4AHTA 1XL6A 2WLHA 3OR6C 5AQUA 4LFBB 4KHYA 4WFHA 3ZSOA 3CC7N 2HBJA 4H44B 3OD4A 3Q4HB 2G8WA 4JV5K 3OR7C 4BREA 1KKDA 3VR9A 1S5JA 1Q81W 1LNQA 1OHHG 2R72A 1N32O 1S5HC 4IEEA 4QS9A 5HFLA 4DV6K 1KC8O 1N36K 1OV9A 2DFHA 4AQYK 3K3WA 4DYLA 3T3FA 1JFFB 3C90A 4NB5A 1N4CA 3JARA 1HKBA 2DFFA 5C42A 2KKZA 4FCYA 1HNWK 3T1YK 2NLXA 4DV1K 4PA6A 3VQ5A 4RUFA 1RSOA 3CCEN 1VMGA 3ZYYX 4M3XA 5AQPA 3D45A 3AVKA 3PX6A 2K1EA 2YXYA 4CERA 2UXCB 2FMLA 1CEZA 5KPRA 3HT3A 4KB1A 2R044 2EINB 2Z0AA 3LWLA 4LNUA 1HQUA 4FWKA 3MHHC 1PP9H 3PIPL 4LFAK 4ZHQA 4H0PA 4RQFA 4HNAA 4D7TA 3A8TA 3P39A 1K9MO 4FJLA 4BWAA 1WP8A 2JS5A 4TV9A 3ZCCA 3ZRWA 1HNVA 1S3JA 1X59A 2Q9LA 2HKOA 3DLGA 3T1HK 2LFRA 4W5QA 1K5QA 5JWPA 2XASA 2G8VA 3WNEA 2HHVA 4JK8A 2N04A 2O8EA 1LW0A 1OCOB 2HJDA 2P06A 1T3VA 2OPRA 3C6HA 4JD2B 1L3UA 2CH7B 5EIBC 3OYMA 1FW6A 1K5SA 3EXAA 2DOSA 2A06H 3IFXA 1C0FA 4JKHA 4GV3A 3VGKA 1VQ4N 4FW2A 4PDWD 4TT3G 3RYHA 1S77D 1JL1A 3JAMN 1EETA 2FSJA 3V81A 4RAIA 3CC4N 2JDIG 1KFYA 3I0RA 3WEEA 3PO4A 5GW7A 3DMJA 3FZFA 2KKWA 4MVUA 5KUKA 2Q2RA 3D3IA 4JV5O 1K8AO 5L3CA 4IG0A 4BRAA 4ZIBA 5CA3A 2DWEC 3DAWA 1QZ6A 3SPIA 3JD1A 1N36O 2WLLA 4DV6O 2GTDA 4X20B 4AQYO 3LDOA 5HROA 4DSFA 3GQKA 3VETA 2Y4TA 3DTUB 2AHZA 5B1AC 1HNWO 3T1YO 4NCAA 4KHUA 4DV1O 3KLIA 3MMVA 4DR2K 1HYZA 2F23A 2VGNA 2EIJC 2B1GA 3WXKA 2E88A 4B1YB 4B9SA 4LY7A 3CPWU 1SL0A 4ZTJA 4KP4A 1HXS4 3OYKA 3E9LA 4F4LA 2Y69C 1BCMA 2W40A 3K9JA 3U8XA 1Y67A 1DKGD 1HYVA 3E22A 2F9WA 3ZX6A 1BQZA 3H9VA 3JAKB 3ABUA 1RBVA 1SKSA 3ZEUA 3HKEB 4LFAO 1RBUA 1VSLA 5AQWA 5LP6A 2PI5A 1VIBA 1NOYA 1WSHA 4F3TA 1L3TA 2ZT9B 4ZI7B 1M5IA 4CEQA 3K0SA 2OA8A 1MA1A 3SJQC 1N6QA 5IJ0B 1W9HA 4PV1B 2BOCC 4CEZA 3I8DA 4FOIA 1K4DC 4KTWA 1TUBB 3JAWA 3CCUV 1YTFD 3KVGA 3T1HO 4Z4EA 3SJHA 1VQ6V 4BGBA 5EIBD 1NJIW 1B3QA 1HKCA 4YNQA 3A2FA 3U3GA 2NRXA 3FYIB 1OCRB 3DSQA 1XUPO 3IS9A 3AVMA 1NMNA 1Q82O 3C6UA 3SPZA 4UY8O 3SPHA 2BANA 2P9UA 3AARA 1LWEA 1WNSA 5KHHA 5FPRA 3VMFB 3TABA 2P9LB 2QJ1A 4XH1A 1NK4A 4FIPC 1GM9A 4JKFA 3NH2A 5CMUA 3ZHQA 5L3FA 1EQYA 1RT3A 2Q5ZA 1VQMV 3Q7BA 1WOQA 2F93B 3D36C 1NEKA 2BE2A 2KW4A 1EN4A 4YY3K 4PUOA 4QIWF 3HZ6A 5JICA 3G6EN 4BE1A 3BF3A 3WXJA 3D3QA 5CBHA 5AR0A 4QGPA 5IYBO 4UUJC 1AR1B 2Z1HA 1C1AA 1GOAA 3AG4C 1C1CA 5ADXA 1T7PA 3MWTA 1AR4A 3G80A 1SQFA 4L8JA 2YNFA 4X64K 1Z6RA 2ITMA 4NYNA 1C0GA 1VQPV 5IYDO 1I39A 1OH6A 3B2EE 5DECA 3LSQA 4DK0A 3L9DA 4DXWA 4DR2O 1Q86W 1JJOA 4FM0A 4JK9A 2XY5A 4GVMA 1VQ5V 3JSNA 1ATSA 4EP5A 3N2GA 4YOXA 1ENVA 1ZL8B 1BE3H 3G71N 1ROPA 2IH3C 3BUZB 5A2QO 5AQMA 4GV6A 2YIBA 2V7QG 1RFQA 3MN7A 1LUWA 4YOUA 1BIZA 4L8RB 2YNHA 2PI4A 3FGUA 1AILA 4YTMA 2BUPA 4Q0BA 4YDUA 3A5LC 2QXLA 3KHYA 3OS0A 5LJVA 1RUI4 5BR9A 3JD74 5CA0B 1KB9F 3OEEG 2PBDA 2YX6A 3OUFA 3UKUA 3HSTB 4CK3A 1XBLA 2KG7B 5IYZB 1EZJA 2LW1A 2GHYA 2D0PA 5MLCQ 4OVLA 5AZIB 4GT1A 1Y74A 1RDBA 2L35A 3FZKA 1S22A 1Z7S4 2BH1A 1RCHA 1WSFA 1R084 2P51A 3MDQA 4O2BB 2Y48A 4JI0B 2D5RA 3S3OA 5CBFA 2JK5C 4RG8A 1ZYQA 3CD6V 3ZX2A 4BC5A 3S9HA 2ZGZA 1KVCA 4FPBA 3RRHA 2YCHA 5EXWA 3SYQA 4BRMA 4KI6A 2IVNA 3BA8A 5HRRA 3D2FB 3M3ZA 1M90O 4YY3O 1YCIA 3ITHA 1Y4MA 1NJYA 4NTWA 2VS0A 4TUYA 1X4TA 3BA9A 3MXJA 2GSMB 2HVKC 1NGCA 1AR64 1L3VA 3HRGA 4GVEA 1Z05A 4MVRA 3P1GA 1LWCA 2V51B 1Y97A 3AVBA 3F7VC 3JATA 2HSTA 1SQQH 1NGFA 2JLEA 3QIOA 1SZTA 1TAQA 4R79A 4X64O 2E2QA 1D4M4 3EEQA 3ZEDA 4ELUA 4DR6B 1NZ6A 2EULA 2O8BB 3UT5A 1ZTEA 4CE9A 3FD9A 1RT7A 3SGIA 1VQ9V 2V52B 1R3IC 1NK7A 1OZ0A 3E01A 3GL1A 3KWIA 4LFBK 2QWQB 2X5ID 1NU0A 4B1ZA 3KK3A 3CJHA 1FXKB 1BA0A 2IM9A 5EK0A 1IZ3A 3CPEA 1X9WA 1Z5VA 3AG3B 1IXMA 5IJ9B 1SRYA 3KD5E 1H1VA 2QE7G 1G99A 2NUBA 2WONA 1RVF4 4KUMA 4WCEL 1GO3F 1SZ2A 3D2EA 1US6A 4CZKA 4BVPA 1F51A 3ZIAG 1YHQN 3CJ1A 4CEFA 4QE9A 4U7BA 2OCCC 3FFQA 4BRPA 3EO3A 4FZZA 2RM24 2ZDIC 1TAUA 1T5EA 2PFUA 1PD3A 2ZKOA 4Z4CA 1BGXT 3C3TA 1DTQA 5GIOA 2ZINA 4RQEA 3NDKA 4BDZA 5LHGA 4DS5A 4I4TA 2BDPA 2P4KA 3PN1A 1FD9A 3WXIA 3KLGA 4JI1B 5KPZA 1RTIA 4RWTA 1TUEB 4KRFA 4KV8A 3HKDB 1M93A 4BC4A 3ZMVA 1OVQA 3IGAC 4WQ5C 4FZ1A 3VEOA 1NTKH 4BRFA 4X65K 3THOA 4X88A 4CGDA 1C0UA 4FJ7A 4H37A 1I08A 2P1JA 4NTYA 1B04A 3B4SA 5H9CA 5LL6Y 3OBYA 1ASUA 4OPAA 1U45A 1JLQA 3KTQA 4FK0A 3AK1A 4LR3A 1F7YA 4BWMA 1MABG 1XILA 3UCSC 5EBMC 2HW3A 5EYPB 4D7SA 3M7MX 1YJ9N 2IJIA 4HAMA 1K8KA 4CBCA 2P9IA 3GG4A 4GX2A 3M6GA 3TWHA 4LFBO 3WXMB 4DUZK 4Y0WA 1YSCA 4HTUA 3THYA 4KPYA 4JYCA 4J2BA 3VOUA 4BRDA 4B1UB 4CBXA 5A9GA 2Q1NA 5AZJB 4PDMA 1WAFA 5LA6B 3ALYA 3EKUA 3SI6A 1MQTD 2RR14 2A42A 2EILB 3SYOA 4EKWA 1E4GT 3NH0A 3E66A 1VF5B 2BTOA 4IO8A 3PX4A 1KD1O 4B1XB 1YDXA 1N33K 3NH1A 4LP8A 4W5TA 1D5AA 4LF4B 3DXKA 1Q6HA 4ASUG 2ZE7A 2GWJA 3LL3A 1RP3B 4DRXB 5CB4A 4B7KA 3OW2U 4M45A 2ACZA 1G6UA 4JTCB 2YUAA 4MTXA 2UXCO 1M57B 1JQ0A 3QFUA 3EYZA 3TAFA 5CZ1A 4DV4B 3ZRSA 3HBTA 1Y64A 1QVFM 4UCSA 3CEIA 3O8MA 4CZJA 1NJWA 1KC8W 1J5EB 4CESA 3F9MA 4BW9A 1FKAO 4QS8A 1TUYA 4FWPA 4IG3A 2LQTA 1YF2A 2QWPB 4WBNA 1MWKA 2LSNA 4OPHA 2D4WA 3MN9A 4NVPA 3H3NO 2IVOA 1VEWA 4QE7A 4X1KA 3CC7V 3HVTA 3VENA 4FFKA 1ITGA 4X65O 4U7NA 3NF9A 4IOAL 4J8FA 3H6EA 3L72H 4O5FA 2Y0PA 2ZE5A 4UCRA 3V1OA 5L3EA 1HUXA 2YXLA 4G2KA 1L1FA 4IFVA 3CP1A 3WB2A 4CJ5A 2QKBA 1XMQK 1VQNN 3ABTA 4WFGA 2YIAA 1E79G 1MNGA 3U6FA 3VQ6A 1M1KO 1Q6UA 1TGOA 3CCEV 2XAFA 3ZHTA 4MVSA 1K9MW 2CH5A 2VG5A 2ZR3A 1NGDA 3L3VA 4CD1A 3HVRA 3EZ5A 1NWKA 3QNEA 2HF3A 3P4RA 5CY4A 3AA2A 3DLKA 3P31A 4DUZO 2X6BA 5B1BB 1R094 2P9SA 4WFFA 1GLBG 5AQOA 1BU6O 1BSMA 3K0GA 4E1NA 1L0NH 3O80A 2PF4E 3OE7G 4I55B 4JI4B 1JL2A 3VOVA 2A1SA 4C8KA 3S3XA 2XO7A 1HRHA 4AM6A 3K5NA 2B6AA 4CK1A 4DV6B 4NXNK 1RT6A 3LWMA 4BDPA 2O8FB 5B1OA 1N33O 2PZSA 4CEOA 4JYAK 5C2TA 3EHBB 3AO1A 4KHSA 4UCTA 2GUZA 3T1YB 4DV1B 1RGIA 3DJCA 2Q0RA 4PL8A 3O08A 2RDCA 4C8LA 3OYEA 5J2NA 3VRAA 1NJIO 3ZSYA 1R73A 3LUTB 1K8AW 1FXVA 2QWOB 3N4QA 3VESA 1MSDA 4O44A 1JFFA 3OYBA 4UVCA 5DK5A 1ZSPA 3AVCA 1VQ4V 2KB1A 2Q69A 4RTFD 2H8PC 3O1WA 3T4DA 3CXCU 3QNNA 4FK2A 1XQ8A 4J7KA 4NKGB 4KO0A 3CC4V 1FKPA 4MDBA 2G8HA 4O4IB 1Z26A 4JHDB 3PSFA 2HNYA 4O4LB 1RT2A 3C0BA 2DW4A 1U2VA 3RSEB 3IDHA 4DTJA 2G8KA 1BQNA 5H1SQ 1RDDA 3WNGA 3LZJA 4FJGA 1WBDA 2WA4A 3QINA 3LM9A 3FAVB 4DV3K 3AG2B 3LSUA 5AQHA 1RT5A 4UCUA 1VSFA 1A5WA 3CMEN 1XMQO 4DSJA 4JI0K 3LANA 4BR9A 3GVMA 4LBEC 2DJVA 3SDLA 4JS5A 3U3YA 1BS3A 2B5JA 4C8MA 3RYIA 1SZXA 5KHGA 1H8HG 4MW3A 2JJ1G 1RT4A 4MQ3A 2FYUH 2B5UA 4WCEV 2ODMA 2L6LA 2BCCH 1GN4A 1HLUA 1FFXB 2B1IA 2W0FC 3A0RA 3CX5F 4EFEA 1J53A 2BGGA 2WAMA 5C24A 4YOYA 1XNRB 1Q82W 4KHNA 3HI0A 2Z1IA 3TU5A 4B1VA 3J81O 2AZ2A 4DR6K 3U10A 4M3YA 3ETDA 4JYAO 1EXQA 2RS14 1O1WA 5LMUB 2Y0IA 1H2KA 1GLJO 3MK6A 2YEVB 3AVNA 4DR2B 5LGUA 2Q31A 1ZOYA 1RM1C 3TETA 4DTXA 1YJWN 3VR8A 2P5GA 3NFAA 1NI8A 2H3OA 4YJ2A 1NLVA 4FLWA 4YDUC 4YFUA 3OJSA 4YTPA 1RDCA 1QVGU 1G1XB 3WT0A 1YEWA 2N05A 1H2LA 4IO9L 4X20A 1Z25A 5GAGP 3PLAA 4I7FA 3I8BA 2UXBB 3AO5A 4EB6B 1WBBA 2BTQA 1NBMG 3HJFA 1WA8B 1GLLO 3QETA 2AW9A 2UXDB 3IUCA 1DEJA 2R70A 5J2UB 2LO1A 1V54B 1QTMA 3HPGA 2OTJN 1IV0A 1H38A 3CRMA 1L0LH 2HF4A 3VQAA 3A5OC 3HP9A 3QEVA 2HOEA 3OFNG 1ZC6A 3O65A 5EC1C 2KTQA 2ZXWB 5LYJA 4GX1A 5J2TB 2EHGA 4WFEA 2WDRA 3FB5C 3ABKC 1PV0A 3T7ZA 3E8HA 3FFKB 2QEXN 4BR0A 3I56N 2PYLA 2YI8A 3NF6A 4KTQA 2MW2B 4PA1A 3OHRA 4PKIA 5JQGA 4A2AA 1YIJN 2ITDC 3J81N 4JI0O 1B9FA 3CM5A 4JI1K 5KA5A 1BG3A 4F8RA 4BRNA 2HVIA 1J5OA 5BR8B 2D0BA 2DYSC 4KXRA 1ZBSA 1SC5B 1IKXA 2HHUA 1EAH4 4RHV4 1QR9A 3P5JA 3G71V 4BR7A 2AA4A 3K03A 4CF0A 1BCOA 4CZHA 2WLIA 2F66C 3WG7B 3P30A 3ZT0A 1XNQK 3IKMA 3ZJZA 2XAHA 5GIPA 4H0OA 4Y1DA 3LZIA 2GELA 5FLXN 2YICA 1QR8A 2YIBD 3CHXA 4P2ZA 3VEWA 4CGIA 1POV0 3SQ2A 2QWNB 3SLCA 1WSGA 5F2VO 2XAQA 3ZSWA 4JI5B 4DR6O 3ZMUA 3I55N 2DWDC 2HVHA 5AFUA 5IDJA 3GB7C 1BWFO 2CTWA 4JI8B 3O9SA 1M90W 3F73A 3RW0A 4TOIA 2W6KA 1UAXA 4KH4A 3AAQA 4PY5A 4CFDA 4F6EA 4JRPA 4AHVA 3SPCA 4TV8A 1V9PA 4H03B 1MA9B 5HRSA 4ISFA 4M3RA 1GLCG 3W7WA 2VWJA 2ZWHA 5EOYA 1WB8A 1N8RO 1AR84 2EIMC 1CZAN 3TXSA 3O6WA 4DHYA 3KKRA 4O0IA 2O4GA 3TJTA 2OIGA 2E1YA 1XL4A 2E6MA 3VF2A 4BG9A 5IWAK 3RYCB 1JJ2M 4LF4K 3SJCC 2ZF5O 4A61A 1WAZA 2Z3YA 3HL8A 5IY5C 3HOTA 3VQVA 3SJBC 2Q36A 2P4VA 2W6IG 1TL3A 1YI2V 2UUCB 4Q5VA 4DV4K 3LNMB 2OYQA 4MTFA 4UFZA 4I6MB 3ASNC 2Q3SA 4IT5A 1S1XA 1J5EK 4BRCA 2E6LA 1VSJA 3DRRA 4O8KA 4DR3B 1RDWX 3TK1A 4H4OA 5BN9A 4JI1O 3L75H 4KX6A 5CA0A 5BMVA 1XEQA 4UQGA 5EZYB 4DV7K 4DFPA 4LCUC 1QHAA 3KKSA 1TL1A 2KG7A 3AVFA 4OPKA 2QDOA 1BA1A 4I2PA 3EKSA 4RW7A 2XY8A 4E7JA 4JI3B 2ADPA 3FB7C 5CA1B 3H1HH 1XNQO 2RN9A 4Q6GA 3FI7A 2NNUA 1GH6A 2WWWA 1S0VA 4PHZA 2KHOA 2CGOA 4JKDA 3DC5A 1SUQA 2KSDA 1YHQV 1J54A 1JLCA 1ATNA 2CK3G 2NRVA 5C10A 4XBFA 1ZBIA 1YXBA 4HUFA 4CBWA 3H01A 1X3NA 4LF5K 1QLEC 3VBBA 5LHIA 4DLEA 4BIOA 5J2PA 4JI7K 3H1LH 1JLAA 1R6NA 2XRIA 1NMDA 3SMSA 1EBOA 1RFYA 3MXIA 1O13A 3VEZA 1AI7A 3SUOA 3TAEA 3OTFA 1HRI4 1UJWB 1YTFB 1NVPD 4JI4K 2Q73A 1HQEA 3E1YA 4KB0A 1D4XA 1S3XA 3U9ZA 2G8UA 3E8GA 2HWB4 5KRTA 4CC5A 5DMRA 1P7GA 1JCFA 2QR4A 2QWQA 2F8SA 4NLCA 3DRPA 2KZMA 3DI6A 4JAVA 4LF4O 5KQ8A 3JASB 5KX5A 2WTUA 4FJIA 3JAMO 3WB1A 3JALB 3V6DA 5L3DA 1LOTB 1KVBA 1T6DA 4ISGA 2D1KA 1SQVH 2DQ0A 2F95B 4ZOLA 3NCIA 4DV4O 2CGJA 2BSKB 4IYHA 4O2AB 4UXNA 4H5VA 4BY9C 4KBOA 1J5EO 1KTQA 1KD1W 3QTCA 3CFOA 3ENBA 1YZBA 1YJ9V 2WOMA 3KIOA 4TSXA 2ZQMA 1UWBA 3NAEA 1K73O 1Q18A 4JNEA 3HKCB 1NKDA 3SYAA 4OKJA 5B1AB 1GMGA 4DV7O 3UQ8A 4WQ4A 4EEQA 1HNZB 5AQZA 4DR4K 1FAFA 2QKKA 1BI4A 1YF5L 2E20A 2YNIA 4CJFA 2EIJB 3L2VA 4X65B 2M7WA 4PA7A 5KHIA 4CJTA 3OTOB 4K0KB 2A9HA 1UOCA 2Y69B 2HB5A 1D2DA 4CBUA 5BN8A 3CHWA 3PIOL 1B06A 4CJKA 3KK1A 1Y76A 3THWB 5H5NA 4LF9K 2Q68A 5JS2A 3OUSA 4G1QA 4FJKA 2JGDA 4WFAL 2ADQB 3QIPA 3ZT4A 4N41A 2ILMA 1AROP 3UKRA 5C8YB 1I5YA 4LF5O 5LOVA 3OMNB 4FPPA 4JI7O 1N0NA 3QO9A 3L6QA 4O55A 5I3UA 3G4SN 4IIJB 1AP6A 5GONB 4DUZB 1NOZA 2P9PB 5BPMA 5LGNA 1VQ7N 4CS4A 3R1XA 1BGYH 1SKVA 4O4JB 2P9KB 5DM6L 4UB8Z 2FKXA 4KL1A 4JI4O 1C0MA 4K41A 4KFBA 4PKGA 1XNRK 3HPLC 5EYPA 4L3QA 3OEHG 4J11A 1RNHA 5JJJB 2R074 4O5BA 5JH7A 1E1QG 1M1KW 1N34B 4NXMB 1N33B 1QS4A 3L71H 2ZJQL 4CD3A 5LMUK 5JVDB 3L2WA 3L3UA 3W7XA 3NF7A 2ZE2A 2H88A 3HM8A 2QKSA 1W2BM 2HBMA 2B9ZA 1HW7A 4I0XB 3VRBA 3CRCA 1F4MA 1WLJA 3DLRA 5LA6A 5T7BA 4GKJK 1VQNV 3AG4B 1EFRG 3T1AA 3BHPA 4DFMA 3RBZA 3R3LA 2P9NB 2UXBK 3AEBA 1NNEA 1EO1A 3IFRA 1OCCC 4CJQA 1RHI4 2UXDK 5E84A 4JTAB 1H2GA 3QEIA 2DY4A 3ETQA 3LP2A 2IAJA 2OCEA 3QEXA 4DR4O 2A3QA 1E1RG 3NGYA 4DMNA 1CXQA 1MSWD 2NNWA 3OYCA 3M1FA 3SFDA 1JLEA 3ZT3A 4B3TB 4BWJA 4B9TA 1XUQA 1J9AA 3J8AA 4DTOA 1XREA 4WYBA 2O8DB 1CPYA 3JD0A 4I50A 1XMQB 2RE2A 2JJ2G 4LF9O 1Q9YA 3KZIZ 1K6YA 2CAZC 4FSVA 2AP1A 2Q7HA 4DW1A 1QCEA 3I0SA 4MFBA 4XH5A 3CE2A 4A5UB 5BR8K 4EHUA 1ILYA 4K8XA 2WU5A 4DTUA 5H6QA 3OMIB 1COV4 5JVHL 3WU2Z 4IZ9A 3AE1A 2E3CA 5HBMA 1CLQA 4IHJB 3OT7A 3TANA 4MVZA 3QDKA 2RMKB 1XNRO 4DU4A 1QBZA 3MDSA 4F9OA 3ASMA 1PIV4 4UCOA 3BF1A 2GX9A 4FVMA 4NXNB 3G10A 4JI5K 1WSJA 3C7NA 3SJAC 4JYAB 3FZHA 1AP5A 3AVIA 3FFIA 1R3LC 5LMUO 5JCOA 4RW6A 3BEHA 3OAAG 3TR8A 3ULEB 3NGIA 3VEVA 4JI8K 1VRH4 2IIRA 3BDPA 3F2KA 4NB4A 1H2SB 2F4VB 3G25A 5CYMA 5L3GA 1X9MA 4DO2A 3EE8A 3F5TA 4Z2WA 4BR4A 4CFAA 5FPNA 3CMEV 3DOKA 3A0BZ 4Y1CA 3GE1A 3L0QA 1E4FT 5M1KA 3HO1A 1NGEA 4CGHA 1SA0B 3EZWA 3AGKA 3CJAA 1VQ8V 3CSXA 2UXBO 4O4HA 3L74H 4DUYK 2AHYA 3RYFB 4MVOA 4PD4F 1F21A 1SETA 3BVOA 3EFFK 1RDAA 3VQ9A 2UXNA 1ZBHA 2UXDO 2AXTZ 1N0JA 1XI1A 1RILA 1WSEA 5KAFZ 3P4IA 2XAJA 4Z4HA 5JVGL 3DRSA 1XMOB 3DXMB 4CEEA 1HMVA 3I33A 4O4GA 3TARA 4DS4A 4FLYA 5DN6G 1REVA 3OBWA 1JX9A 1T6CA 4YHHB 1JLGA 1HKGA 4H5NA 4DV3B 5C15A 2UUCK 2IW5A 3E8BA 1DTTA 2D0CA 3THXB 1ZBFA 2ETJA 3JCUZ 2IOCA 2FBWA 2CGLA 4DR3K 1W7AA 2P90A 4O4LA 3ID8A 2R9RB 5GTIZ 1C6VA 5ADXH 1VQKN 1F4NA 2UUAB 4AI8A 1BHBA 5BR8O 2QI2A 4FWQA 3C65A 5EU7A 3H1IH 3R8EA 4XEIA 4DSEA 1K5MD 1OH7A 4LF8B 2QSAA 1L8DA 2OCCB 1NQTA 4JI3K 1JKHA 3CYMA 1GN6A 4A62A 3E35A 4JKAA 4ISEA 3O1BA 1RMU4 4K8ZA 4LH6A 3DWLA 3N2KB 3DXRA 3LDQA 3JYCA 3TTCA 3M99B 4KFMA 1E3MA 2OTJV 3CJCA 2QWLA 3VQ4A 3WQTA 2VRZA 2XT9A 3KCYA 4JI5O 1ZLZA 4FJCC 4W5RA 3T1CA 1FJGB 4X1IA 1LAVA 3ENOA 4NYFA 4JI8O 3VQPA 3D6RA 3NVKA 1TK5A 1RTDA 1TYQB 3NVMA 2YXHA 1COWG 3VPZA 1SESA 2QEXV 3I56V 4KHWA 4RCHA 4JKGA 1TVKA 4UCVA 2XUMA 4DR1B 1YIJV 1ESVA 4B08A 1KCFA 2WP9A 1PVC4 2CDYA 1BZKA 4HYOA 1ORQC 4IEIA 5M1NA 4DUYO 3ETEA 4YSZA 3O9QA 4NYKA 1JVMA 4FVUA 2WPDG 1IBMK 1ZXOA 1YITN 3CMAN 1IKYA 4DQSA 1NH2D 1NG9A 1FPOA 3VF6A 3N4PA 1Y6XA 4F6RA 2LGWA 1NGHA 3LDLA 3PX0A 2YI9A 2Q0OC 2IJHA 3JARB 4PDRA 4WFAV 3VQ8A 2R7FA 2WDVA 3OY9A 4FPAA 4XDKA 1ASJ4 4E1MA 1I7FA 2ZE8A 2RHKA 4QPKA 3S3NA 5J9PC 2UUCO 1HYSA 1RSOB 4GX0A 2YSUB 3S3WA 5ITZA 1WA8A 4ID5A 3I55V 4DTSA 1CXUA 3LP0A 2X6AA 5B3SC 1N8RW 4AHUA 4K42A 4DR3O 2ZM6K 3O3FA 1UA0A 4CIEA 4LNUB 3E9OA 3CPWM 5DM6V 1IO2A 3C94A 3NGZA 3B40A 3R65A 1P8ZA 2EWSA 3O4WA 1HNZK 4ZHQB 1URFA 3ZS8C 4FWOA 3TSUA 4FXDA 2HBKA 1IVSA 2FF3B 3A0HZ 3ATUA 4BR2A 4P9PA 4DR7B 3RMDA 4JI3O 4JAAA 4JAUA 3OTOK 1A5XA 4K0KK 3FYEB 1XHXA 4TV9B 1XNQB 3N27A 3ZRWB 4MT8A 3SR2C 2YHYA 3VQWA 2B4JA 3V9SA 2P22C 4RW4A 4IOCL 4DSIA 3CXHF 3JD2A 5B5EZ 3CCRV 4N56A 3OS1A 1NTZH 1ZBLA 4FJNA 4HVJA 2NLJC 2Q4PA 5AQXA 4J9YB 1NKEA 1OH5A 1M56C 1NM1A 3C6TA 1KUQA 3ZSRA 4BQZA 2GV9A 2VWBA 3RYHB 1KFDA 4IJNA 4B3SK 3DGEA 4OLAA 5FNVA 2WLJA 1KQSU 3WEEB 4JRQA 3LM2A 1WPBA 1A32A 4ILHA 4BRHA 1FXHA 1THZA 1M9NA 4GYCB 1SS3A 4Z1VA 2YKMA 3H1JH 3B8AX 3FLCO 4MDAA 3KCXA 4NXMK 4E19A 1N34K 1D9DA 1IBMO 1K97A 4NO7A 1IDSA 4BVOA 3OJUA 1U49A 5IWAB 4B8AB 1I3AA 2WLLB 4B9NA 1VQLN 1R0AA 3MN5A 1JA8A 3WB0A 2XHBA 2QA4V 3V1RA 1AR74 4RUEA 3BEXA 4LF6K 4CF9A 5KMGA 2Y1JA 2ZD1A 4FJJA 4Z1MG 1R3KC 3O3HA 2OZMA 4Z4GA 4CZGA 2F43G 3FKSG 5EVZA 3QMLA 1BO5O 1XHZA 2PUSA 4DV7B 2X78A 4I2QA 1HNZO 3ZEUB 1OVYA 2DYRC 1SQXH 1G8MA 3CJBA 4FFBA 4DTMA 4KREA 3WNFA 3P4SA 4YOVA 2KQXA 4WE1A 2FF6A 3OTOO 4K0KO 5AQRA 4H33A 3RMBA 3LDEA 4B3TK 2YHAA 3JAWB 4JYYA 1DT9A 4E7HA 5EZYA 3FX7A 4JKBA 2QWRB 3MEEA 4CGFA 3KKYA 4F4KA 1HPMA 1K73W 1YQ4A 1YTUA 2W42A 1W59A 5LXTA 4W4KA 4OLBA 3IC7A 2GTSA 3DOLA 3ZMTA 4L87A 2EJRA 4LF5B 2P9UB 4JI7B 4PKHA 1P49A 4KHPK 3MEGA 4BRIA 4ABMA 2Q0AA 1WN7A 3CQYA 2IBZH 3MWPA 1OH8A 3SK3A 3F7YC 5IYCO 3ZHVA 4B3SO 4CGGA 5KPTA 3W7UA 3ZETA 5FRNA 3BP8A 5BRFA 1RTHA 3SAGA 1EN6A 4DTPA 4UV9A 1QSSA 4NCGA 4NXMO 1N34O 1FFTB 5JLFA 3E86A 3CCVN 1LCUA 2IC3A 3EL2A 3ZRVA 1BEV4 1IURA 5JJNB 3ZN1A 3AK2A 5IE9A 2CTRA 2F4VK 3Q4HA 5LP6C 1SERA 3ZMZA 4N76A 3SBGA 1GRJA 3SUQA 1S72N 3CB2A 2X74A 2YC0A 2YHXA 1IKWA 3VQCA 3W7TA 3CCMN 1NU1H 4R7CA 3AE9A 4ZHRA 3CCLN 4FJMA 2ZIOA 3KWGA 3CIPA 5HOOA 1W0HA 4W5OA 1VSEA 4Q20A 4K43A 3K0DA 3N2GB 3JASA 4I7ZB 2V7YA 3DLHA 2ZGYA 3FZMA 3H1VX 1BHAA 3G4SV 3HB3B 3IG1A 1AR5A 5E79Z 4OKKA 3L2RA 3RWUA 2JRIA 1J95A 1XMOK 3AE7A 1EN5A 1VQ7V 4KHQA 4DR4B 3QEPA 3RWRD 1WPXA 4B9VA 2A7WA 5JJEB 1RM1B 4OX9B 1BUPA 2AZ0A 5FPMA 1CXZB 1Q43A 1HNXB 2RCVA 3L8BA 4J80A 2A1RA 1VQMN 2E2PA 4YHHK 5I42A 5SZTA 4B3TO 4CJRA 4X1YB 1GLEG 4U3JB 4LWSB 4R50A 5LHHA 1LAWA 3OGCC 4B1WB 3HKCA 4EAHD 4PJ0Z 2QTSA 4FYDA 3UKUB 4M42A 3AECA 1Q7YO 4TSFG 4LF9B 3SZ2A 2UUAK 4C23A 3AGRA 3LDSA 1Y74B 3APQA 4CH6A 2EJ7A 2RQ6A 2E5LK 1IBLB 2FBYA 2Z5UA 5FROA 1PO24 4KHPO 4ILJA 4LF8K 2QKAA 1SS6A 3H45C 4JD2A 1RBTA 2CH7A 3JSMA 4D6TH 4YSXA 1K3EA 5JCOC 3ABKB 3AA5X 1NGIA 3TTDA 3AEAA 4XDLA 1S9GA 4TUYB 3KZBA 5BREA 2Y1IA 2JS3A 1KF6A 1S9EA 4QCLA 1ZBUA 4NXNO 1VSDA 5AQYA 4G27B 2FXUA 4IXCA 2DYSB 3VTHA 4DTNA 1D9FA 4CF2A 4MW8A 1FJGK 3JATB 2P9PA 2EIKC 5GTHZ 4CJ3A 1GTOA 2GBZA 2P9KA 3LNNA 4FLZA 2F4VO 1KAYA 1RT1A 4DKWA 3SPYA 4C8OA 2OTLN 4YT0A 4M7XA 1CZ9A 1GN2A 1KECA 2Z1JA 1DK1A 4DR1K 3ASOC 4GKJB 5CHIA 1X3MA 5FLXO 3LDDA 3M8RA 3CJHB 4X9QA 1D8YA 3LAMA 1NBWA 1HPZA 1SL1A 2KFZA 3L4QA 1QU7A 3CFPA 2CGNA 3P4PA 4QOZB 3UO2A 3QVNA 2F9TA 1VAZA 2YKNA 3H46O 4JZGA 3G6EV 1XMOO 3H1QA 4CW7B 3D2EB 1C1BA 5FPDA 4H0XB 1KXPA 4DK1A 3JAKA 1VRUA 4G9ZA 4YHHO 3HKEA 4DV3O 3TI0A 4AHCA 1NK0A 2ZR2A 4DB3A 1YVNA 3NMUA 3ZHSA 1NENA 4ZI7A 4DQQA 3OW2M 1O9HA 5IJ0A 1NVPB 4DQRA 1JLFA 2EIMB 5D3GA 4B3OA 2UUAO 1TUBA 1AL24 2I5JA 4I4TB 4CH4A 4HTLA 4HWIA 2IH1C 2NRTA 2E5LO 4QAGA 3SYPA 5IY5B 4LF8O 3U4LA 3SUNA 4DR7K 2W0XA 4EHTA 1ZWIC 3CCJN 4F2RA 1JXEA 2XY6A 1WJZA 4FZXC 1TUUA 5KUMA 4WF9L 3IAYA 3ASNB 2P9LA 4YORA 4W4LA 4CS3A 1FKOA 2Q97A 1WUAA 2FB5A 2W6LA 4KI4A 1VP7A 2WS3A 3ABMC 5FPOA 1EZVH 3MX2A 5AG2A 1L5UA 3SV3A 1NR7A 3OYNA 1RPRA 2OT5A 3LPTA 4IJAA 4CVNE 1FJGO 5HRNA 2ITCC 3AVJA 3ZT2A 2HHTA 4U67L 1QLNA 1TA8A 4Q4Y4 4PA3A 1S5LZ 1YAGA 3MD0A 2IU0A 4EFBA 3LALA 2VG6A 1OCZC 5J1EA 1X9JA 4JKCA 4A57A 3KLEA 4DR1O 1MU2A 4ZTFA 5L3BA 1K8KB 1VQKV 2P9IB 2HHHK 1GKFA 4H0VB 1W2BU 3THYB 4C1NK 1P90A 1O9GA 4HBNA 4CH3A 1JXBA 3DM2A 5CYQA 3KLFA 1YJNN 2H89A 4KTZA 4DUYB 1PKXA 1DF5A 2GUPA 1HR0K 1VK0A 3R6MA 2C2AA 4JEPA 4Z0UA 2YDEA 3V9XA 1QLEB 2F8TA 1QQOA 1OKJA 1V55C 3TAMA 3HPHA 4IYIA 1ZL8A 3RR7A 2LW7A 1IKVA 1SQKA 5EC2C 2PY5A 1GM8A 1OJHA 3K9SA 3OM3B 3K5MA 3DXKB 3O9TA 4MO5A 2F96A 4E4EA 4CFCA 1RUD4 1QHTA 1AJNA 5CB4B 3K79A 1IX9A 5M1OA 2HG5C 3ZHUA 3BCCH 1U97A 1I94B 2HNDA 3HM9A 3AAPA 4DTRA 3DXMA 2Q7GA 5AQJA 1H2NA 3STLC 2IS3A 3STZC 4B9QA 2HLDG 3A5MC 4M41A 5C3JA 4QJFB 5FRMA 4IFYA 4BAYA 1PL0A 3CC2N 4M3TA 1EKEA 3SYZA 5IYZA 5HFMA 3B77A 4FM1A 4DR7O 2CH6A 4FW1A 5AZIA 1NJXA 3AEGA 3CXCM 3G6BA 4A2BA 3SQ0A 4X1KB 1X1PA 2LJ2A 3HPOA 4B7EA 1KFSA 4O2BA 2VG7A 5JMVA 3H08A 2RPIA 1TVRA 3ABLC 1YITV 3RVYA 4Q4V4 3HP6A 4YTNA 3BFRA 5BZBA 1YXQA 4N21A 2ATQA 2OCHA 1PO14 2RKIA 2HHQA 3D2FA 4DSKA 3MCPA 1ASVA 3Q7CA 4H0YB 4GLXA 3WXLA 3THVA 2UU9B 2FC0A 3UO3A 4YXDA 1NCQD 4JN4A 4GW6A 4AILC 2WDQA 3N2KA 4QNHB 1EV14 1TKXA 4JI6B 1VF6A 5C93A 1P84F 3HXMA 3OVNA 4CJEA 3LDCA 2O8BA 3AE8A 2Q8VA 2P9SB 3VQBA 3EVKA 3OA9A 1Q90D 5J2MA 1HR0O 1N32K 2HP8A 3QEWA 3OYDA 1IBMB 4CEBA 1KSPA 1HJRA 3CRRA 3H1KH 1BISA 1T44A 2J4RA 2VYPA 3P38A 5IWAO 5GINA 1FXKA 1HNIA 3OYIA 1WB7A 3HTVA 1RUE4 2DFEA 3AEEA 3D7EO 1FS0G 3AG1C 1YUWA 1XC3A 3MN6A 5IJ9A 4JYBA 2A6AA 2YIDA 2PW9A 3J8F4 4JTDB 3AO4A 2GUZB 3FR0A 1VBC4 4DWIA 4W5NA 3SUCA 1W97L 5EX5A 4NCBA 4IOXA 2M6YA 4H0TB 1S76D 3J7ZO 4CC6A 3B6PA 2QM8A 3QNOA 2HMIA 5BPNA 4IDHA 1WLEA 2ZM6B 3ZSXA 3EY1A 4B9UA 1OOPD 3MEDA 1HRV4 2UUBB 2ASMA 1QVGM 5KGWA 3F5WC 4PHTX 3F9KA 4OX9K 4ZBMA 1KBHA 1WB9A 3AEFA 5KRSA 1HNXK 2HHXA 2NRRA 3L70H 3SPJA 1NA1D 2V4DA 2P7TC 4DW0A 3M5RA 3SCXA 2OPQA 4MLEA 1U2VB 4PWDA 4V19S 2HVJC 4DSLA 4DF4A 3O5BA 3HKDA 3GWOA 5HL7L 4LC1A 3RGBA 4H4MA 1OCCB 1BQMA 2Y4UA 1EWQA 3RRGA 3TXQA 1VQLV 5LGTA 3X2QC 2UYTA 2HBLA 1N5YA 1IBLK 3RVZA 3UM7A 4ZKIA 3ZRXA 4DFJA 1P7BA 3VTIA 1VQON 2HHWA 3GQHA 2HFEC 3VQDA 3ZSQA 2KFNA 4BG8A 1VBB4 3TGUH 3RYIB 1BHLA 2RN2A 3CS5A 4X62B 1KAZA 2F7TA 4GMJB 4C8NA 4B3SB 2I7PA 4FL9A 3TSQA 4CI6A 4MTGA 3VERA 3CCQN 4J10A 2YI1A 3A0IX 3M8QA 5FPEA 4IGGA 3UE5A 2OZSA 1VBA4 4R6ZA 1KP3A 1B92A 5GADP 4M3ZA 5KAIZ 4A5BA 3CM6A 1U04A 3QG5A 5KHKA 2Q6AA 2A3ZA 5C12A 4FJXA 4P9OA 3AK3A 1UFIA 4BDYA 1KVAA 2PYJA 4CJVA 1GN3A 3VQYA 4LF7B 3O4QA 2ZNJA 1M4UA 5AZJA 4CIFA 2JEUA 5SWMA 4YXWG 4M3WA 1QQMA 2VGMA 3FB8C 4LF6B 3VA3A 1KP2A 3B8NA 2VQFB 3R66A 2EINC 3D0PA 3QLHA 2Q0UA 5KLVH 1BDGA 3QFPA 2WLKA 3AE6A 1GLDG 4YJ2B 3SJJA 2ZQBA 4OXSA 3RT3C 4DRXA 4CJSA 4WF9V 1NJZA 2WLMA 4JKEA 2R9AA 1HX1A 2BTQB 1ZP0A 4OX9O 4YJ3B 4BRLA 3V9ZA 4G28B 3KG2A 1HNXO 2JEXA 2UXXA 1GOCA 2X6NA 3AV9A 2GEMA 5KGXA 3J7YP 4XDJA 1ATRA 1LWFA 4E7IA 3RVCA 5K1XA 1AJQA 1S6PA 2QWPA 3W0LA 4DQPA 1OCOC 3VQ7A 2ZIMA 5LYJB 3PSIA 1R6KA 3CCVV 3U9DA 3OYGA 3SAHA 5BY1A 3G67A 4BRQA 4BIUA 2R064 3NE6A 1RPOA 4GZRB 1S72V 4PI0A 5JQGB 1IBLO 4I5SA 3CCMV 3K5LA 1XWLA 4KHPB 5CBGA 2ZJRL 4DV2K 3MHSC 3DLBA 3CCLV 3MCAB 4OGQB 3P83D 3RMCA 2V1DA 1NH2B 3K08A 1S1WA 2EBOA 1DLBA 1MG1A 1GK9A 2QWRA 4J9ZB 3L2UA 2WLIB 2GWKA 3O9RA 3AVLA 2W6JG 4X8AA 3T4ZA 1MZFA 1Q7YW 2ZCEA 5K1PA 4IL6Z 4B3MB 2JWLA 3L4IA 3J80O 5AQGA 2QM1A 4CJ4A 1NGJA 1V4SA 4YIPA 3QO5A 1KKCA 1VARA 1RUG4 4ICLA 1XQSC 3EE9A 1KLNA 4DF8A 3E2EA 1QSLA 2XOKG 4X66B 4I55A 2WUSA 4P30A 3WQUA 4GKJO 1J6ZA 2O8FA 4DR5B 4E3SA 2JWKA 2YNGA 4O8UA 1Q8IA 2IU3A 2QTOA 4M3UA 4E2LA 3DLEA 1NTMH 3AO3A 1I0HA 3M8SA 4TV8B 5EBWC 2AGAA 4MO4A 4B3RB 4DV5K 3VA0A 1QVFU 4K3AA 2FSKA 2QWOA 4EZ9A 1IXBA 4LSLA 1SF9A 2RF2A 4JI2B 5LY3A 3E8FA 1XC9A 1R6TA 2D2CB 3UKMA 5JS1A 4CJPA 1RBSA 1OCRC 1XDCA 2MK3A 3HKBB 3QBXA 3V1QA 2ETNA 4O4IA 4JHDA 4CECA 2VQEK 1I94K 4LFCB 3ATVA 3RSEA 3ETGA 4FZYA 3J80N 1FK9A 5TKYA 4WFBL 1SKWA 1U47A 1YJWV 2OTLV 4GNIA 3WNHA 1TV6A 2E5LB 3FAVA 4OO1J 2YHWA 4X1YA 5BMVB 4DV2O 3BAAA 4RW9A 4U3JA 4LWSA 5EY4A 4FK5C 4CZZA 3SPGA 2LGQA 3SUPA 2CTQA 3ULDA 3A5NC 4R5PA 3CQ8A 2O8CB 4PL7A 5B3SB 4FWMA 3ABVA 4HUGA 2I7NA 3TSPA 3U0ZA 4FK4A 1R59O 5FDLA 4AM7A 2IJJA 4YIOA 1EP4A 3ZX0A 4BQLA 4J2EA 2UU9K 4CCHA 2A0LA 3P32A 2P5OA 1FFXA 1LW2A 1AI4A 5C25A 3BRCA 2CGKA 4DV0K 2R7YA 3ZMSA 3ICXA 1QQNA 4JI6K 3SNNA 2CTPA 2VWKA 5LBQA 3AE2A 4DQ8A 2FBVA 1H8EG 2ITGA 3AVHA 4BR6A 2G8FA 5A2QN 4E1JA 3RFRA 4MLHA 3GBTA 4IDKA 4F2SA 4BR5A 1YI2N 1UA1A 2YEVA 4CZIA 5IT9O 3VEXA 3HSCA 1RUJ4 5JLHA 2EZPA 3VQEA 3OYLA 1YQ3A 1MWMA 2E2NA 4DV5O 2HHSA 3CCJV 5M1FA 4BRGA 1KRPA 1M56B 1RUH4 3B8MA 1MDUB 4U7OA 3LDNA 4Q4X4 3VN5A 2PTMA 5KHJA 1LR1A 3OYFA 1AI5A 1L3SA 4EZ6A 2E1ZA 2G38A 3BZCA 5KX5B 3FE1A 4EB6A 2DMXA 4LC9B 1SAZA 3KK7A 3FB6C 4J2AA 2QM7A 1JPXA 4K25A 4AH9A 2VQEO 5J2UA 1I94O 1W0JG 5LMNB 1MMMA 1W0KG 4ZOLB 1Z5WA 2N74A 3BPZA 1JMKC 3NXSA 3ZHRA 4C7UA 5H6RA 2NR5A 1YT3A 4MS2A 2ASOA 2UUBK 1DF4A 4GX5A 5J2TA 1BL3A 1KLMA 4BGAA 2QTDA 3RR8A 4BE0A 3SMPA 1PNMA 3CCSN 4EP4A 1ZX3A 1G4YB 4HNAB 4HHTA 3JBG4 4JASA 2HNZA 2OWOA 3CJ9A 5KI6A 3AVGA 3MXMA 4GCZA 1LUVA 4CJUA 3OMAB 2UXCK 1PM9A 4CHOA 4H13B 1YJNV 4EFHA 1Q6IA 4TQDA 1BI4B 1FYJA 1ZUQA 1CZBA 4DU1A 1WAJA 1TKDA 4HCCA 4IWVA 2NZTA 2PLV4 1KU9A 2QWMA 2HEPA 3BY5A 1IBKB 3V4IA 2O8EB 1VF6C 3O9OA 4AF1A 2D0OA 1NS1A 2ZNIA 3VF4A 3AA3A 5IT9N 3KLHA 2OPPA 3AE5A 3PY8A 2DYRB 2UU9O 4BRKA 1Y76B 5C0YA 3CIRA 4F3OA 2W41A 3CRAA 5CR4A 1AVMA 2JGDB 4U3FH 1JR9A 5AQKA 4CZMA 4DV0O 2P6JA 3UKRB 4Z94A 4FJ9A 4JI6O 4MVMA 2NRWA 4X62K 5EBLC 1FXKC 5LOVB 4OPJA 2ZE6A 2KLAA 1RUC4 2QWNA 2O57A 4RW8A 1NK5A 4GKKB 2HHHB 1RDUA 3AG3C 5J2QA 2FBXA 1EM1A 5ELZA 3MAQA 4PQUA 2PAVA 1KMIZ 1Q81O 3CC2V 2KQ2A 1HR0B 4YOTA 2HJFC 1T8EA 1U48A 3ZCMA 1IJJA 3V9UA 5AQSA 2BTFA 3LP3A 4QS7A 3KJVA 2QKCA 4PELA 5JH7B 3P3PA 1VSIA 3JD3A 5HRPA 2QM4A 4LF7K 3AVAA 4CF1A 5GAEP 3NF8A 5C2DA 3HK2A 2E8AA 4FO0A 4PDVA 4WQ4C 3VQQA 2V7ZA 5AQFA 3VEYA 3ZSVA 2VQFK 2DE0X 4CH5A 1NGGA 1NGBA 4CHNA 3MECA 3RYCA 1N32B 1HJOA 5AQVA 2ZM6O 3UB5A 2DPNA 3CYOA 1I5XA 3DC6A 3E22B 2UUBO 4TQFA 4OJRA 3EN9A 4J7ZA 2QW9A 2YS8A 4BIZA 2X0LA 5LP6B 3G0ZA 4J41A 1GOBA 2E75B 4FWRA 4DG1A 2VCPA 4I6MA 2RNBA 3CF5L 4GV9A 3OYHA 5AQIA 3S41A 1JCEA 4CF8A 4RO2A 3T2MA 4N5SA 1GAXA 4XIUA 3K9KA 4CHYA 4E7KA 4CZLA 3CRQA 2YV0X 1U4BA 3D8CA 4ELTA 1YVWA 3J7AU 3RMAA 2ZJPL 4JPRA 1GM7A 1BQ0A 4LH4A 2RS34 4CZEA 2LP7A 4M63C 2O4IA 2BE3A 5B66Z 4I50B 3ENHA 4CK2A 1AJPA 1HWYA 2HWC4 4J7JA 5CA1A 4FWLA 2EZOA 1PL4A 2WFBA 3MX5A 1RUF4 2GDSA 1NK8A 2GUIA 2OIEA 1K7DA 4X62O 4OKEA 4FM2A 3C95A 2AJQA 2D0AA 4BE2A 4Z4IA 2QK9A 3P3NA 1TK8A 1VSMA 4JLHA 1VRTA 3TTFA 1NK6A 4B3MK 4KH5A 2EILC 3VGMA 3AEDA 2QGNA 1B9DA 3HOSA 2JVDA 3LSSA 4E7LA 1BOTO 5BXZA 1Q5OA 3B6OA 5CN0A 4RWUA 2IJKA 3K9AA 2X6CA 4LD0A 3OYAA 1VBE4 3K06A 2ARHA 4X66K 3C7NB 1HP8A 4LF7O 4J2DA 1K34A 4WFBV 2XY7A 3ZT1A 1YVUA 4TWKA 4LF6O 4CJ7A 1M57C 4DR5K 2VQFO 3CCUN 1R1BA 1JJ2U 1SQBH 4JV5B 5TISZ 5LL6Z 1VQ6N 4CHPA 2ATKC 5E26A 3SAFA 3SFEA 5E1AC 2WBNA 2HMPA 3TAGA 2FLOA 4FLTA 1Q3EA 1VQOV 1N36B 3JALA 4XH4A 4FJ8A 1EWRA 3LAKA 3ZBHA 4AQYB 4CJWA 3JYTA 4Z4FA 5CZ2A 2EIKB 3K2PA 4B3RK 4O4HB 2WSSG 1H2MA 1HNWB 1LV5A 4NR1A 3AE3A 2A41A 3O4NA 3VGLA 3QO7A 5KQDA 2BSKA 3I5DA 5GAHP 5F2RA 2XTAA 4O2AA 3CCQV 4JI2K 1K4CC 1S1TA 3ASOB 4LH7A 3PUFA 3M8AA 3NHGA 1YTAA 4GB34
chains in the Genus database with same CATH topology
2EX3A 4FLVA 4DQIA 1X9SA 4LFAB 3ZSZA 3K5OA 1S1UA 1S6QA 4LH5A 4I9LA 3QF7A 1WSIA 3BGRA 3T1HB 1VSHA 3ISNC 4PI2A 1A5VA 4DLGA 4KAZA 5C8YA 4FJ5A 1ZAUA 3KK2A 3PV8A 4CFBA 1T03A 1RTJA 4IIJA 3LP1A 5GONA 4CIGA 2X6SA 4O4JA 1BIUA 3VQXA 4DFKA 3UT5B 4X1IB 3AO2A 1VSKA 3LPUA 1C0TA 5JVDA 1TVKB 2E4LA 3UIQA 3SV4A 3CFRA 4CEAA 3OS2A 4I9QA 5K14A 3V9WA 1QQCA 1G15A 1S1VA 5KTQA 4F6RB 3RTVA 2YHBA 1TKTA 1DGSA 1TAEA 5ITZB 4YJ3A 3KD1E 1NK9A 1SV5A 4FLXA 2IGIA 4DV2B 4BACA 2F1MA 3K57A 4IBNA 5D5PA 4AHSA 5E41A 5HLFA 3SQ4A 3S3MA 4O0JA 4CEDA 1JLBA 3AA4A 1TK0A 4OGEA 1Q9XA 4IHJA 3O3GA 4CS2A 4YY3B 1QE1A 1TKZA 2FBTA 4JS4A 3OYJA 2Q7EA 2DTUA 1FXXA 4X64B 3IRXA 5FNVB 2QXFA 4ID1A 4N47A 1VF7A 4DV5B 3PO5A 4HUEA 4E89A 3TAPA 3SQ1A 1SA0A 3L2QA 4CGJA 3RYFA 1IH7A 4CJLA 4ELVA 4E0DA 2JGUA 2VQEB 3K59A 5KMGB 1EX4A 4H8KA 2Z1GA 4OGCA 4WBNB 4HCBA 3HKBA 1DLOA 4FFBB 1SL2A 2G8IA 2RJZA 1T05A 1RBRA 3DYAA 1NKBA 4DU3A 2KZZA 1QSYA 3QESA 1SQGA 2IDOA 1NT2B 4IKFA 2PGGA 3K58A 3BABA 5LXTB 4DV0B 4KKOA 1IG9A 3CG7A 3M8PA 1ASWA 5HP1A 4B8CA 4FJHA 4B9LA 4CHZA 3T19A 3HYFA 3NBPA 4FLUA 1NKCA 2OPSA 3TAQA 3QERA 3U11A 4AHRA 3JSLA 5D5QA 4B9MA 4AHTA 4LFBB 4KHYA 3ZSOA 2G8WA 1S5JA 2R72A 2DFHA 3T3FA 1JFFB 5C42A 4KHQA 3JARA 4FCYA 2DFFA 3VQ5A 1RSOA 4M3XA 3D45A 3AVKA 3PX6A 4CERA 2UXCB 3HT3A 4KB1A 3LWLA 4LNUA 1HQUA 4ZHQA 4HNAA 4D7TA 4BWAA 2JS5A 4TV9A 1HNVA 3DLGA 4W5QA 2G8VA 3WNEA 2HHVA 1LW0A 2OPRA 1L3UA 5EIBC 3OYMA 4FW2A 3RYHA 1JL1A 1EETA 3V81A 3I0RA 3PO4A 3DMJA 2KKWA 4IG0A 4ZIBA 4X20B 5HROA 4DSFA 4NCAA 4KHUA 3KLIA 1HYZA 4B9SA 4LY7A 1SL0A 4ZTJA 3OYKA 1BCMA 1HYVA 3E22A 3JAKB 1RBVA 1SKSA 3HKEB 1VSLA 1RBUA 5LP6A 1NOYA 1WSHA 4F3TA 1L3TA 2OA8A 4CEQA 4ZI7B 1M5IA 1N6QA 5IJ0B 3I8DA 1W9HA 4CEZA 4KTWA 1TUBB 3JAWA 4Z4EA 5EIBD 4YNQA 3A2FA 3U3GA 3DSQA 3IS9A 3AVMA 3C6UA 3SPZA 2BANA 1LWEA 1WNSA 5KHHA 5FPRA 3TABA 1NK4A 2QJ1A 3NH2A 1SKRA 1RT3A 2F93B 2BE2A 2KW4A 4PUOA 4BE1A 2Z1HA 1C1AA 1GOAA 1C1CA 1T7PA 1SQFA 4L8JA 2YNFA 4NYNA 1I39A 3B2EE 4DK0A 1JJOA 4FM0A 4GVMA 3JSNA 4EP5A 3N2GA 2YIBA 1BIZA 4L8RB 2YNHA 4Q0BA 3OS0A 5CA0B 3HSTB 4CK3A 5IYZB 4OVLA 1RDBA 1RCHA 1WSFA 2P51A 3S3OA 4O2BB 4JI0B 2D5RA 1ZYQA 4RG8A 3S9HA 1KVCA 3RRHA 4KI6A 3BA8A 5HRRA 3ITHA 1NJYA 4TUYA 1X4TA 3BA9A 3MXJA 1L3VA 3P1GA 1LWCA 1Y97A 3AVBA 3JATA 2JLEA 3QIOA 1TAQA 3ZEDA 4ELUA 4DR6B 3UT5A 4CE9A 1RT7A 3SGIA 1NK7A 3E01A 3KK3A 2IM9A 1Z5VA 5IJ9B 3KD5E 2NUBA 2WONA 4CEFA 3FFQA 4FZZA 1TAUA 1T5EA 4Z4CA 1BGXT 4BDZA 1DTQA 4DS5A 2ZINA 3NDKA 4I4TA 2BDPA 3PN1A 3KLGA 4JI1B 1RTIA 4KRFA 4KV8A 3HKDB 1M93A 3THOA 4CGDA 1C0UA 4FJ7A 2P1JA 1B04A 1ASUA 3KTQA 1JLQA 4FK0A 4LR3A 4BWMA 2HW3A 5EYPB 4D7SA 3M7MX 3TWHA 4KPYA 4HTUA 4J2BA 1WAFA 5LA6B 3ALYA 3SI6A 3NH0A 2BTOA 3PX4A 3NH1A 4W5TA 1D5AA 4LF4B 4DRXB 5CB4A 4M45A 1G6UA 3TAFA 3EYZA 5CZ1A 4DV4B 4UCSA 1NJWA 1J5EB 4CESA 4BW9A 4IG3A 4WBNA 2LSNA 4NVPA 4X1KA 3HVTA 1ITGA 3NF9A 4UCRA 3V1OA 2YXLA 4CJ5A 2QKBA 4IFVA 3WB2A 2YIAA 3U6FA 3VQ6A 1TGOA 2VG5A 3HVRA 3L3VA 3EZ5A 5CY4A 3AA2A 3DLKA 4E1NA 1JL2A 4I55B 4JI4B 2A1SA 4C8KA 2XO7A 1HRHA 3K5NA 2B6AA 4CK1A 4DV6B 1RT6A 3LWMA 4BDPA 4CEOA 2PZSA 3AO1A 4KHSA 4UCTA 3T1YB 4DV1B 4C8LA 3OYEA 5J2NA 3ZSYA 4O44A 3OYBA 1JFFA 5DK5A 3AVCA 3QNNA 4FK2A 1XQ8A 4KO0A 1FKPA 2G8HA 4O4IB 1Z26A 2HNYA 4O4LB 1RT2A 2G8KA 4DTJA 1BQNA 1RDDA 3WNGA 3LZJA 4FJGA 3QINA 1RT5A 4UCUA 1VSFA 1A5WA 4DSJA 3LANA 4JS5A 3U3YA 2B5JA 4C8MA 3RYIA 5KHGA 1RT4A 4MQ3A 1FFXB 4EFEA 1J53A 2BGGA 5C24A 1XNRB 4KHNA 2Z1IA 3U10A 4M3YA 1EXQA 1O1WA 5LMUB 3AVNA 4DR2B 4DTXA 2P5GA 3NFAA 3OJSA 4YJ2A 4FLWA 4YFUA 1RDCA 1YEWA 4X20A 1Z25A 4I7FA 2UXBB 3AO5A 4EB6B 2BTQA 3HJFA 3QETA 2UXDB 2R70A 5J2UB 1QTMA 3HPGA 3VQAA 3HP9A 3QEVA 2KTQA 5LYJA 5J2TB 2EHGA 4KTQA 2PYLA 2YI8A 3NF6A 1X9WA 4PA1A 5JQGA 3CM5A 1B9FA 4F8RA 1J5OA 5BR8B 2D0BA 2HHUA 1IKXA 3P5JA 4CF0A 1BCOA 2F66C 3ZT0A 4Y1DA 3LZIA 3CHXA 2YIBD 4CGIA 3SQ2A 1WSGA 3ZSWA 4JI5B 2HVHA 4JI8B 3F73A 4TOIA 1UAXA 4PY5A 4CFDA 4JRPA 4AHVA 4TV8A 1V9PA 5HRSA 4M3RA 2VWJA 3KKRA 4O0IA 2O4GA 2E6MA 3RYCB 3SJCC 3HL8A 3VQVA 3SJBC 1TL3A 4Q5VA 2UUCB 2OYQA 4UFZA 2Q3SA 1S1XA 2E6LA 1VSJA 3DRRA 4DR3B 4H4OA 5CA0A 5BMVA 4UQGA 5EZYB 4DFPA 3KKSA 1TL1A 3AVFA 4OPKA 4I2PA 4RW7A 2XY8A 4E7JA 4JI3B 5CA1B 4Q6GA 3FI7A 4PHZA 1SUQA 1JLCA 1J54A 1ZBIA 4HUFA 4DLEA 5J2PA 1JLAA 2XRIA 3MXIA 3SUOA 3TAEA 3OTFA 1HQEA 4KB0A 2G8UA 5KRTA 4CC5A 5DMRA 2F8SA 2KZMA 3DRPA 3DI6A 4FJIA 3JASB 5KX5A 3WB1A 3JALB 3V6DA 1KVBA 2F95B 4ZOLA 3NCIA 4O2AB 1KTQA 3QTCA 3CFOA 3KIOA 2WOMA 4TSXA 3NAEA 1UWBA 3HKCB 4OKJA 3UQ8A 4EEQA 1HNZB 2QKKA 1BI4A 2YNIA 4CJFA 3L2VA 4X65B 5KHIA 4CJTA 3OTOB 4K0KB 1UOCA 2HB5A 4CJKA 3KK1A 5JS2A 4G1QA 4FJKA 3QIPA 3ZT4A 4N41A 5C8YB 5LOVA 3QO9A 5I3UA 4O55A 4IIJB 5GONB 4DUZB 1NOZA 4CS4A 1SKVA 4O4JB 4KL1A 1C0MA 4KFBA 5EYPA 1RNHA 5JJJB 4O5BA 5JH7A 4NXMB 1N34B 1N33B 1QS4A 5JVDB 3L2WA 3L3UA 3NF7A 2ZE2A 1HW7A 1WLJA 3DLRA 5LA6A 5T7BA 3T1AA 3BHPA 4DFMA 4CJQA 3QEIA 2DY4A 3ETQA 3LP2A 2IAJA 3QEXA 3NGYA 4DMNA 1CXQA 3OYCA 1JLEA 3ZT3A 4B3TB 4BWJA 4B9TA 1J9AA 4DTOA 4I50A 1XMQB 1Q9YA 1K6YA 2CAZC 2Q7HA 3I0SA 4MFBA 4K8XA 4DTUA 2E3CA 5HBMA 1CLQA 4IHJB 3TANA 4DU4A 3ASMA 4UCOA 4FVMA 4NXNB 3G10A 1WSJA 3SJAC 4JYAB 3AVIA 3FFIA 3TR8A 5JCOA 4RW6A 3NGIA 3BDPA 1H2SB 2F4VB 5CYMA 1X9MA 4CFAA 3DOKA 4Y1CA 3HO1A 4CGHA 1SA0B 3CSXA 4O4HA 3RYFB 1F21A 1RDAA 3VQ9A 1ZBHA 1XI1A 1RILA 4Z4HA 1U45A 1WSEA 3DRSA 1XMOB 4CEEA 1HMVA 4O4GA 3TARA 4DS4A 4FLYA 1REVA 4YHHB 1JLGA 4DV3B 1DTTA 2D0CA 1ZBFA 2ETJA 2IOCA 4O4LA 1C6VA 2UUAB 5EU7A 4DSEA 4LF8B 1L8DA 1JKHA 3CYMA 4K8ZA 4LH6A 3N2KB 3VQ4A 4W5RA 1LAVA 1FJGB 4X1IA 4NYFA 3VQPA 1TK5A 1RTDA 4KHWA 1TVKA 4UCVA 4DR1B 4B08A 1KCFA 1IKYA 4DQSA 4F6RA 3PX0A 2YI9A 3JARB 3VQ8A 2R7FA 3OY9A 4E1MA 1I7FA 3S3NA 1HYSA 5ITZA 4ID5A 4DTSA 1CXUA 3LP0A 4AHUA 1UA0A 3O3FA 4CIEA 4LNUB 1IO2A 3C94A 3NGZA 4ZHQB 3ZS8C 4FXDA 4DR7B 3RMDA 1A5XA 1XHXA 4TV9B 1XNQB 3SR2C 3VQWA 2B4JA 3V9SA 2P22C 4RW4A 4DSIA 4N56A 3OS1A 1ZBLA 4FJNA 4HVJA 1NKEA 3C6TA 3ZSRA 2GV9A 3RYHB 1KFDA 4OLAA 5FNVA 4JRQA 1WPBA 4FJLA 2HVIA 4GYCB 4E19A 2YKMA 1D9DA 1U49A 3OJUA 5IWAB 4B8AB 1I3AA 4B9NA 1R0AA 3WB0A 2XHBA 3V1RA 4CF9A 5KMGA 2Y1JA 2ZD1A 4FJJA 3O3HA 2OZMA 4Z4GA 1XHZA 2PUSA 4DV7B 2X78A 4I2QA 4DTMA 4FFBA 4KREA 3WNFA 4WE1A 3RMBA 2YHAA 3JAWB 5EZYA 3MEEA 4F4KA 4CGFA 1YTUA 2W42A 5LXTA 4OLBA 3DOLA 4LF5B 4JI7B 1P49A 3MEGA 2Q0AA 1WN7A 4CGGA 5FRNA 1RTHA 4DTPA 1QSSA 4NCGA 2IC3A 5JJNB 5LP6C 4N76A 3SUQA 3CB2A 2X74A 1IKWA 3VQCA 4ZHRA 4FJMA 2ZIOA 1W0HA 4W5OA 1VSEA 3N2GB 3JASA 3DLHA 3RWUA 3IG1A 3L2RA 4OKKA 4DR4B 3QEPA 3RWRD 4B9VA 5JJEB 4OX9B 1Q43A 1HNXB 3L8BA 2A1RA 5I42A 5SZTA 4CJRA 4X1YB 4U3JB 1LAWA 3HKCA 4FYDA 4M42A 4LF9B 3SZ2A 3LDSA 4CH6A 2RQ6A 1IBLB 2FBYA 5FROA 1RBTA 3JSMA 5JCOC 3AA5X 1S9GA 4TUYB 2Y1IA 1S9EA 4QCLA 1ZBUA 1VSDA 4DTNA 1D9FA 4CF2A 3JATB 4CJ3A 2GBZA 3LNNA 4FLZA 1RT1A 3SPYA 4C8OA 1CZ9A 2Z1JA 4GKJB