2PYLA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
571
structure length
571
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTAC(2DA))-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 161
structure length 571
sequence length 571
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pylA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pylA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pylA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pylA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pylA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pylA06
2EX3A 1SKSA 4CK2A 1EETA 1UAXA 3TWHA 2BE2A 1KVCA 3AO1A 3SI6A 4FLWA 4N47A 1LW2A 3PO4A 4CIFA 2HW3A 2KW4A 2IAJA 1RT2A 1W0HA 2Z1GA 4CEAA 1TV6A 3OYEA 1U49A 3DM2A 3FFIA 1T05A 4KI6A 3OJSA 3AVKA 4M3ZA 1KVAA 4M3WA 2D0BA 4FLYA 3MXJA 3HJFA 4CJFA 2D5RA 3KLHA 2E6MA 1TL3A 3O4NA 4CGDA 3AVIA 3KTQA 1LWFA 4QCLA 2KFNA 1EP4A 4NCAA 4CHPA 4HUGA 3TAQA 4FYDA 1C1CA 1DTQA 4W5RA 3C6TA 1HNVA 4LSLA 1NJYA 2IC3A 4Q0BA 2NUBA 4AHRA 1CXUA 4AILC 4FJIA 4FK4A 2HHQA 1KLNA 2Y1IA 1BHLA 1Q9YA 1BISA 1SUQA 4G1QA 2X78A 4KREA 1VSHA 4Z4IA 1RDAA 4FJ9A 1BQNA 3ZSZA 3L3VA 4PWDA 1WSFA 3QO9A 3TAGA 3RR8A 2X74A 3THVA 3TABA 4NYFA 1VSMA 4E7KA 3VQPA 5HP1A 3AV9A 1SL0A 4M3XA 1RBVA 4L8RB 3PX0A 3U3YA 2HB5A 3L3UA 3LDSA 1Z25A 2DFHA 5HROA 3VQ9A 4F2SA 4M3RA 4CK1A 3NCIA 2OPPA 4J2EA 2BDPA 4HUEA 2IS3A 1ZBIA 2IGIA 4Z4EA 3L2UA 1T03A 4DTXA 3WNEA 1Q9XA 3SQ4A 1X9SA 1C1BA 4CHQA 2ETJA 1A5WA 3DOKA 3KKRA 3QESA 1JLAA 1QS4A 1IKYA 1L3UA 5FDLA 3KLEA 1WAFA 3NHGA 5HRSA 1ZBFA 3AVHA 2P5GA 5HRRA 3DLBA 4DTJA 1O1WA 1JXBA 1LAWA 4DQQA 1VSJA 4CJKA 3RRHA 3KK1A 1FK9A 1Y97A 3HSTB 2D0AA 2YKMA 4LSNA 3LAMA 3NH1A 2IOCA 5HBMA 4PUOA 3VN5A 3QERA 4JRQA 3SUOA 4F3TA 1C0MA 2OPRA 2ITGA 4DSEA 2G8HA 4KV8A 4Q5VA 1NJWA 4EZ9A 2PYLA 4IG3A 2YV0X 3AVLA 4CF8A 4OPKA 3U6FA 4EZ6A 1TK0A 4KRFA 3AA5X 1C1AA 4GVMA 3HL8A 3V9ZA 2VG7A 3PY8A 1RT5A 2KTQA 4K8XA 2HHTA 1LWCA 2B4JA 2JLEA 1S5JA 1ZBUA 2RPIA 3NGYA 4KTWA 1QQCA 1ASVA 1K6YA 1LAVA 3ZSRA 4CF0A 4CJWA 1L3SA 4DTNA 4CEFA 3C94A 4OKEA 4CEQA 3D0PA 3OJUA 4EP4A 2YNFA 5J2NA 1Q8IA 3HT3A 3SCXA 4I2PA 4RW7A 1HNIA 3S3OA 1ASWA 4PA1A 4KHSA 4Z4GA 3L8BA 4E89A 1TK5A 2IDOA 5DK5A 1BGXT 3VQCA 4CGIA 4EP5A 3T19A 3F9KA 1NKCA 2HNDA 2KQ2A 4AHSA 4CHOA 2VWKA 3V1RA 3SQ1A 1RT6A 1NK9A 1I39A 1L3VA 4HCCA 4PQUA 2HHUA 1RTJA 3OYBA 1X1PA 4NYNA 1JLBA 1HYSA 4O0JA 4MFBA 3ZSYA 2DFFA 4F3OA 4IG0A 3SPZA 3KKSA 1NK6A 2PY5A 4C8LA 3M8QA 3TR8A 1EKEA 3TI0A 1C0UA 3CFPA 4DSKA 3MAQA 4J2BA 4CEZA 1ITGA 1J9AA 4C8MA 3K5OA 4CJEA 1U4BA 3SPYA 1EXQA 1YTAA 1TKZA 3AA2A 3LPTA 3HM9A 4CJ5A 4FM0A 1U47A 4FVMA 4I2QA 4RW4A 3V4IA 1A5VA 1NK0A 2D0CA 3O4QA 3ZT2A 4H4MA 2G8VA 4KB0A 4I7FA 4DFJA 4CEDA 3OYKA 4FK0A 3AVGA 4RG8A 2P51A 2XY7A 3V9WA 4DTOA 1CZBA 5KRSA 1N5YA 1TAUA 3CM5A 3SUQA 3DOLA 1B9FA 3RRGA 4O0IA 1VRUA 4B9LA 4DTUA 5KRTA 1S1UA 4GMJB 3VQ6A 3OYCA 4NCBA 1VSFA 4I9LA 4JS4A 3S3NA 3K2PA 3JYTA 3ASMA 4AHCA 2B6AA 2VG6A 3L2QA 3K5LA 4BDZA 2OZMA 3LWLA 4CEEA 1FXXA 1RCHA 4KFBA 3VQ5A 4CK3A 3LZIA 4BACA 1KSPA 4YFUA 4DWIA 4AHTA 4DFKA 3DMJA 3L2RA 2PYJA 3M8PA 4CIGA 4HCBA 2BANA 1X9MA 4FZXC 4E7HA 3VQ8A 1NK7A 1JKHA 3KIOA 1EX4A 2HHWA 3KLIA 4FJMA 4FW2A 5C24A 4FJGA 3ZSOA 1JLEA 4FM1A 4LY7A 2G8WA 4DMNA 2DTUA 1KTQA 3VQEA 4W5TA 2VWJA 1XI1A 3B6PA 3OYGA 2AJQA 3DLHA 4OVLA 1WSIA 4C8OA 1KCFA 1VSKA 2FBTA 3K5MA 3EY1A 1KLMA 1X9WA 3MECA 4UQGA 3B6OA 4Z4FA 3HPOA 4ZTFA 4ID1A 4FZZA 3QNOA 3AVCA 4O5BA 4QAGA 4M42A 3A2FA 3QLHA 4CFAA 4CJSA 2A1SA 2YNHA 4IKFA 5FRNA 1R0AA 4CF2A 1BI4A 1VSIA 3NGZA 3O3GA 2E4LA 3SZ2A 1C6VA 4E7IA 3O3FA 1SV5A 4KO0A 4LH5A 5C25A 3DLRA 2G8KA 4FW1A 4DQSA 3DI6A 4CF1A 4K8ZA 3MEGA 4BWJA 3IRXA 3LP2A 1WSEA 4C8NA 4DSFA 3V1QA 2X6NA 3C6UA 3PX4A 1DLOA 1GOBA 1TL1A 4CFCA 1I3AA 3DRRA 1WSJA 4N5SA 4E7LA 1HMVA 1TAQA 1IKVA 3NDKA 3QEXA 4CJVA 1XC9A 1J5OA 1QTMA 3OYMA 2HMIA 4FXDA 4B08A 3DRSA 3QEWA 4OKKA 1UOCA 3AVNA 4CJRA 3CQ8A 5SWMA 4AH9A 4DF4A 1T8EA 1RT7A 3V9SA 3LAKA 4DS5A 1JLFA 3SJJA 2E6LA 3DLEA 3P5JA 4Z4HA 3I8DA 1QE1A 2P5OA 4OGEA 1UWBA 5C42A 2GBZA 3O3HA 2O4GA 3RR7A 1WSHA 1IKWA 1HQEA 4IFYA 4H4OA 3ZSXA 2PW9A 4DG1A 1KFDA 2Z1HA 2ZD1A 2ZQBA 3AVJA 3HP9A 1B92A 4CJQA 4E7JA 3RMCA 5DMRA 4HTUA 1NJXA 3AO2A 5FROA 4CEOA 3AA4A 3MEEA 4CGJA 4HHTA 1CZ9A 4DTSA 2RF2A 3S3MA 4O55A 3HPHA 4M3UA 3IAYA 1S1WA 3ZSVA 4FLTA 4ICLA 1XHZA 4IBNA 4DQPA 1QSYA 4CJ4A 3TAPA 3CG7A 1TK8A 1C0TA 3VQBA 4Z0UA 1QSLA 4KPYA 4CESA 1WNSA 5JS2A 2ATQA 2KZMA 5KI6A 1RT1A 1GOAA 4CHNA 5HRPA 1QHTA 4ID5A 4N56A 2HHSA 1WN7A 3KK3A 2G8FA 3PX6A 3UIQA 4FJ5A 2X6SA 1HQUA 2RKIA 4QOZB 1BI4B 1KVBA 4H8KA 4KHUA 1RDCA 1S9GA 4AHUA 1NK5A 3ZT3A 3AVAA 2G8UA 3ISNC 3MXIA 4B9MA 1FKOA 4W5OA 3ZT1A 4DLEA 3DLKA 3OS1A 1G15A 3KD5E 4Y1CA 3AA3A 3D45A 4OJRA 2Z1IA 3NAEA 3OYHA 4FJHA 4I9QA 1BIZA 1SL1A 4RW6A 3HK2A 1WAJA 4KTZA 4F4KA 1JXEA 5CYMA 1CLQA 1CXQA 1ZBLA 3QIPA 4ELTA 3SNNA 3MXMA 3LALA 3L2VA 4B9VA 3HP6A 3QETA 1RT4A 1NKBA 4BE0A 3H08A 2HNYA 3AVMA 1A5XA 3I0RA 3NF9A 1JLCA 4CGHA 3KK2A 3TAFA 2Z1JA 4CIEA 4DU4A 1VK0A 3LPUA 4KB1A 5FRMA 2F8SA 1SL2A 4CE9A 3T1AA 1HYVA 2HVHA 2HVIA 3KLGA 1D5AA 4DTRA 4DTMA 1HYZA 4E19A 3OYNA 4B9SA 5EU7A 4FJJA 4M41A 4CHZA 1UA0A 4FLXA 3K58A 1YT3A 4JLHA 3V6DA 3SUNA 2Q3SA 3P83D 3V9XA 4IDKA 3KJVA 4OLAA 3ZT0A 3F73A 4J2AA 1FKPA 1IG9A 4YNQA 3DYAA 1NK8A 4CJPA 5KGXA 1ZBHA 1S1TA 4MQ3A 3OYFA 3ZCMA 4RW9A 5HLFA 2XY5A 4PY5A 1NOYA 4DSIA 4BDPA 4F8RA 2R7YA 4IFVA 3WNFA 3PV8A 1TVRA 3V1OA 3V9UA 1BIUA 1BL3A 4HVJA 3EYZA 4KTQA 4B9TA 1RTHA 4FM2A 1U48A 3CM6A 1RBSA 1RDBA 2I5JA 4DFPA 1L5UA 1TKXA 2OPQA 4DTPA 3OVNA 3PO5A 3JSMA 4FJKA 3KLFA 2JGUA 1S6QA 3AO3A 4E1NA 2OYQA 1NKEA 3K5NA 1RILA 2RN2A 1U45A 3HO1A 4CGFA 2PZSA 3AO5A 3LZJA 4N41A 3V81A 4B3OA 2KZZA 4DQIA 4ELVA 1NOZA 3ZT4A 1J54A 3LANA 1KFSA 1UA1A 1QSSA 3T3FA 1TKDA 3EZ5A 2P1JA 1BCOA 3QIOA 5J2MA 3G0ZA 3IS9A 2DFEA 4W5NA 2XRIA 2WONA 3ZSQA 1BQMA 3SYZA 2EHGA 3DLGA 3K57A 2DY4A 3TAMA 3QNNA 2KFZA 1REVA 2YHAA 4B8AB 4M3TA 5JS1A 3TAEA 4M45A 3QEPA 4OKJA 2O4IA 4KAZA 5CY4A 3P1GA 3VA3A 3NH0A 4O44A 1IKXA 5CYQA 1VSEA 4CEBA 4BDYA 4DS4A 1WLJA 2YNGA 4JRPA 1IO2A 2W42A 4BE1A 4E3SA 3NFAA 4AHVA 3K59A 4FLVA 3FI7A 1VSLA 3ZSWA 4CECA 4KHWA 4FJXA 4N76A 3BGRA 2BGGA 4WE1A 1W9HA 1S1VA 3NF7A 2XHBA 1RBTA 3VA0A 1T7PA 2XY8A 1D9DA 3SQ0A 3RWUA 3OS0A 3M8RA 4KHNA 1RBRA 3M8SA 1RTDA 4CHYA 4CJUA 3HVRA 2XY6A 1RTIA 4CJ3A 4DF8A 4FLZA 2F96A 4CF9A 3SQ2A 4KI4A 1F21A 4DQRA 3G10A 4O4GA 2F8TA 1LV5A 1D8YA 4CJLA 4DSJA 2VG5A 5T7BA 3SV3A 3C95A 3VQQA 4FJ7A 1VRTA 3ALYA 4OLBA 4LD0A 4FZYA 3LP1A 5E41A 1RT3A 3QEVA 3SUPA 1SKRA 3LP3A 5CZ2A 2OPSA 2FBVA 5I42A 2FBXA 4NCGA 3OY9A 4DU1A 4FCYA 1DTTA 4B9UA 4ZTJA 4JS5A 1LWEA 2HNZA 4KHYA 4FJLA 3L2WA 1VSDA 4BWMA 1S9EA 1LW0A 3AVBA 1XWLA 4CFDA 3NGIA 3E01A 4E1MA 1JLGA 2Y1JA 1JLQA 3RMBA 3QINA 1NK4A 4ZHRA 1HRHA 1ZYQA 1D9FA 2R7FA 2QKKA 3CYMA 3NF6A 4M3YA 3VQAA 4C8KA 3RMAA 2QXFA 3VQ7A 1U04A 3WNGA 3VQ4A 4CERA 5I3UA 3DRPA 4DLGA 2B5JA 5SZTA 2YKNA 1RBUA 4OPJA 3KD1E 1HPZA 1IH7A 2OZSA 4DU3A 2LSNA 3LWMA 4Y1DA 3WNHA 1Z26A 5KGWA 1N6QA 1TGOA 1J53A 5J1EA 1HJRA 3TANA 3SV4A 4LH4A 3OYDA 2FC0A 3TARA 4E0DA 4HUFA 4DSLA 4J2DA 3OYLA 4FJNA 3MEDA 3HYFA 2FBYA 3RMDA 4FK2A 1YVUA 3IG1A 3OS2A 3ITHA 4B9NA 4BE2A 3QEIA 3NH2A 3OYJA 4FLUA 1JL2A 4KHQA 2QKBA 3NE6A 2G8IA 3LP0A 1RNHA 1BCMA 1L3TA 4CJTA 1YTUA 2HHVA 1MU2A 1WSGA 4TSXA 3HVTA 4KKOA 5J2QA 4ELUA 2OA8A 5K14A 2HHXA 2GUIA 3NF8A 4B8CA 3U3GA 3NBPA 2XO7A 5KTQA 4F2RA 1JL1A 1GOCA 1RDDA 1S1XA 2YHBA 2A1RA 4CFBA 4R5PA 2YNIA 1XHXA 3OYIA 1KRPA 3RTVA 4Z4CA 4W5QA 1S6PA 4CCHA 3OYAA 2ZE2A 3CFOA 3VQDA 4XIUA 4RW8A 1SKWA 5D3GA 3AVFA 3HXMA 1B9DA 2GV9A 1ASUA 5CZ1A 4OGCA 3BDPA 4FJ8A 3HPGA 3CFRA 4GW6A 2QK9A 4DFMA 3AO4A 3S9HA 3PUFA 1NJZA 2WOMA 3I0SA 1TKTA 5HRNA 5J2PA 3ULDA 4CGGA
chains in the Genus database with same CATH superfamily
5AQNA 5KAFZ 1G1XB 2BE2A 3AO1A 5J2UB 1SZTA 5KMGB 4FWPA 1LW2A 4N47A 3BVOA 2Y69B 3T7ZA 2QSAA 4QE9A 1TV6A 3DM2A 1U49A 3DXKB 3IJ4A 5CA1B 3OJSA 4M3ZA 3ZETA 1PM9A 4B3RK 4WBNB 2DYRC 3ABMC 1QVFU 3QF7A 4CJFA 3NVKA 3E2EA 2D5RA 4QCLA 4NKGB 3AVIA 4GY2B 3SBTA 1Y4MA 2E1YA 2AGAA 2HHHK 1N36K 4NCAA 5CB4B 3VEYA 4FYDA 2Q36A 3CC4V 1C1CA 2DQ0A 2A42A 2QWNA 1S3XA 4OPAA 2NUBA 3K03A 1CXUA 2IH1C 4JZ2A 1FJGB 2HHQA 2UU9K 5BZBA 2ZR3A 2Y1IA 3N2KA 4KH6A 3CC7V 1SUQA 1Q9YA 2OCHA 3K0GA 4FMTA 5A2QN 3CXCU 4BW9A 3CRAA 1NGBA 1VSHA 2X78A 4JKFA 1BQNA 4KREA 1OCCB 1W97L 1WSFA 3QO9A 1EM1A 4ZI7B 1GLEG 3CB2A 3RYHA 5IJ0A 3E9PA 3TABA 4BRHA 1VSMA 4E7KA 4V19S 1HNZB 1NJIO 3AV9A 1XNRK 5BRHA 1DTOA 4QNHB 3U3YA 3PX0A 1MABG 3WG7C 2A5XA 3L3UA 2DFHA 4JKDA 4CZZA 3A8TA 1AJPA 2X7RB 4F2SA 1P7GA 4J2EA 3TXSA 4QIWF 1YJ9V 2YCHA 1ZBIA 2IGIA 3HBTA 3WNEA 1WLEA 4BRAA 4LFAK 4KBOA 2FF3B 3DOKA 4DV4K 1AL24 2WDVA 1L3UA 5FDLA 1H2SB 3KLEA 4PHTX 2IU3A 5IWAK 4NTXA 4UVCA 2HR3A 3OTOO 2ZR2A 1QVFM 1YQ3A 2PF4E 5AQLA 1V9PA 1JXBA 1LAWA 2O8BB 4CH6A 1CP9A 1GLJO 1M1KO 4GLXA 5HOOA 1HXS4 2IOCA 3RW0A 4X65O 5HBMA 1VQMV 4H37A 4LH6A 1U2VB 3QERA 2P9PA 1SESA 1N32O 4K0KK 2GUPA 2ITGA 5AJ3K 3C3SA 4DSEA 3VQVA 4KV8A 1NJWA 1XUQA 2HOEA 3ZBHA 2IVPA 4IG3A 4BRCA 2WP9A 4UV8A 2FYUH 1R3IC 3NMUA 3UO2A 3QDKA 1ZL8A 3VENA 4GVMA 2CTRA 2XAHA 2VG7A 3PY8A 1RT5A 4QGPA 2HHTA 3O6WA 5FLXN 1Q7YO 2JLEA 1S5JA 1ZBUA 4K43A 1OCRC 1L3SA 1NGIA 5M1NA 4CEFA 4DTNA 2QWNB 1IXMA 3C94A 4P2ZA 4K42A 3OD4A 2JDIG 1KUQA 1ATNA 2YNFA 1Q8IA 2LW1A 2UUAB 4EP4A 2O8CA 4K41A 1HNIA 1ASWA 2EILB 2CE4A 3JD3A 2GTSA 2X0LA 1IBMO 2DPNA 1BGXT 3CCMV 4M63C 2QA4V 4M7YA 1R73A 4CHOA 4PQUA 1RT6A 3TETA 4JV5K 1RTJA 1B06A 1X1PA 4DR7O 3RYHB 3CJHA 1FFTB 1H2NA 4MFBA 3VEXA 2DFFA 1RUD4 3OGIB 2E2NA 4IG0A 3SPZA 1VQ9V 3FR0A 3GBTA 5KHHA 3H45C 3CFPA 1Q82O 3WU2Z 4YOXA 4WQ4C 4CEZA 3RVZA 2EZOA 2F23A 3KVGA 1AJNA 2NRVA 1YTAA 3G6EN 3SPYA 1JCHA 2KSDA 1XMQK 4UY8O 3SPJA 4JF3A 3JALB 4I2QA 4RW4A 3WEEA 3O4QA 2WLMA 2ZNJA 4LF6O 2N05A 1MZEA 3C65A 3RYFA 2O8EB 3WB0A 1PO24 2CGLA 3L75H 3AVGA 5M1PA 4BRMA 4FK0A 2V7YA 3I55N 3V9WA 1PKXA 5AQIA 4DTOA 4JI3K 4G9ZA 3K9SA 1D5NA 3O1BA 1B9FA 3RRGA 1VRUA 4DTUA 1S1UA 1LOTB 3EL2A 4JS4A 5AQRA 3K2PA 3JYTA 5KUMA 3W3DA 4LFCO 2B6AA 5B1NA 4BDZA 4M7XA 3LWLA 4MTFA 2HWC4 1FXXA 3VQ5A 4CK3A 4JHDA 3CJ1A 4F4LA 4DWIA 3OTFA 1P49A 1DGSA 4LFBB 2CGOA 2O8FB 4DR3K 4GKJK 4HCBA 4KH5A 2HVJC 2A9HA 2ARHA 1JKHA 3OTOB 4KH4A 3H9VA 2UXCO 1EO1A 5H1SQ 4YOVA 2JEXA 4A61A 4B3SB 3LDDA 1JLEA 3JAWB 2ZGZA 3NXSA 5HFLA 3QB0A 1FFXA 4JN4A 4LY7A 4NB4A 3VQEA 1N34K 3D8CA 3B6PA 3DLHA 3CCJV 1NZ6A 1XDCA 2WSSG 3FAVB 4YJ2B 3K5MA 1KCFA 1KLMA 4OXSA 3EZWA 1X9WA 5KQDA 3G25A 3J7AP 3E86A 4JTDB 1VQ7N 1DT9A 4BR9A 3CJHB 3ASNC 2QI2A 3QNOA 3PIOL 2OIEA 3LNNA 4JAUA 4PA7A 4PKHA 1IZ3A 3ZRXA 2NNUA 4Z4GA 3O3GA 1EN4A 3E8BA 3GOIA 1SQVH 1C6VA 4H0VB 1SV5A 4KXRA 3DLRA 5LP6C 2VYPA 2NZTA 1V54C 4FW1A 4CZJA 4DQSA 3DI6A 4CF1A 2G8KA 4K8ZA 4GYCB 3MEGA 5MLCQ 4IO9L 4KHPB 1WSEA 4A5BA 1NA1D 3P4QA 1M57B 2X6NA 4BRLA 1R3KC 3ASOC 1GOBA 3QICA 1XNQK 5BR8K 3I56N 4JPRA 2QWQA 1HMVA 4B3MB 3LDLA 1V55C 4H44B 1RP3B 4J9ZB 3FZHA 4IL6Z 4H5RA 4FXDA 1NGEA 5BRDA 3SYCA 3SPIA 3E89A 2Q67A 4DR6O 1NGDA 4OKKA 4DYLA 3BPZA 3R1XA 1UOCA 2QWPA 3CQ8A 3P30A 2VQEK 4CS4A 1RT7A 1JLFA 4Z4HA 3C90A 3G67A 3I8DA 1AR4A 4YTNA 2HF3A 3EKSA 2P5OA 4MTOA 4JI0O 2GBZA 2LP7A 2O4GA 1JFFB 4O4IA 4IFYA 2CGNA 4FO0A 3OUFA 4H4OA 3L73H 2PW9A 4JHDB 1GM9A 3H1LH 4I50A 5C2DA 1FXHA 3RMCA 5JCOA 2WDQA 1XL4A 5IDJA 1M90W 2PI4A 5BMVB 4DTSA 4H0LB 1BHBA 1TUEB 3B4SA 1NVPD 4YOWA 3W7SA 3ZRSA 3J7YP 1S1WA 1K73W 1WPXA 3VRBA 3RYIA 4ICLA 4BGBA 1QSYA 2PI5A 1GN3A 1IURA 3WXJA 4C1NK 1FFXB 3E83A 3ZYYX 5FPMA 3T1YO 1SZXA 4AF1A 2A3ZA 1IV0A 4DCHA 4CHNA 1M4UA 5HRPA 3AG2B 3NR7A 4B3TB 3CJCA 4JYCA 1NTMH 1QHTA 1IBLK 4MW3A 3ENBA 2HHSA 2ETNA 4NTYA 2RM24 3OHRA 1JJ2U 4K0KO 3W7XA 4MO5A 3PX6A 4QS7A 5B5EZ 4CZHA 1MZFA 3ABVA 4EHUA 1I0HA 2WLLA 5FPRA 1RDCA 4U7BA 1QNMA 3AVAA 3ZT3A 3MXIA 4CBUA 2WLIB 2RDCA 2OANA 4PA9A 3JBG4 2CTWA 3AE2A 1SC5B 2NRRA 1K4DC 4JKGA 3AE7A 1Q6IA 3CIPA 1N33B 2IJIA 4MVMA 2Z1IA 2QWQB 5D5PA 4LF7O 1SL1A 1R094 4LF8K 3IMXA 5CYMA 1ZBLA 3D2EA 4O2BA 4JI8B 1TAEA 2QWPB 2QTSA 2HNYA 4UVBA 3CPWU 2DWDC 1VQ8V 3PSFA 1FYJA 4Q6GA 3TAFA 4KB1A 3TPQA 2F8SA 4CE9A 1BA1A 4X66O 2HVHA 3DC5A 1HYZA 4E19A 4B9SA 3CCUV 5EU7A 4CHZA 2QM7A 3WFVA 1YT3A 1BS3A 2DW4A 1Q6UA 4I50B 2WBNA 1ZUQA 1XMQO 3P83D 2Q73A 3APQA 3ZT0A 4PDLA 4DR6B 3B77A 4OX9B 3BFRA 1JCGA 1HR0K 1NK8A 1HRI4 4DV6B 2ZE8A 1F7YA 5TKWA 3E9LA 5IYZB 5KLVH 4JKBA 5KGXA 3OYFA 1JJ2M 3RYIB 4MDAA 3E8HA 3E8GA 4DSIA 3WG7B 4JI3O 3CD6V 1NI8A 2FMLA 3JD2A 1S76D 3D36A 1RTHA 1U48A 1RBSA 2I5JA 1L5UA 3PO5A 4YY3O 4FJKA 1KFYA 5KHIA 2QJ1A 3JSMA 4JI1O 3KZIZ 3K5NA 3DTUB 3EKUA 3LZJA 3AO5A 4TV8A 3V81A 1BSMA 2ZM6K 4DQIA 1AP5A 4X20B 1NOZA 2UUBK 2R074 3LANA 1NWKA 3IFRA 3CCRN 1PD3A 3S3XA 2P1JA 3EZ5A 3T3FA 3G0ZA 5FL7G 4UCRA 4DR3O 4W5NA 1KBHA 2FL4A 2BTFA 4NXMK 2Y69C 2YIBA 3D7EO 3KCXA 4YOYA 3CPWM 1E3MA 4Q4X4 2E5LB 3OW2U 3THYA 2DY4A 4LH7A 4DW0A 2RS54 3D2EB 3CEIA 3QEPA 4X88A 5AZIB 3I33A 2CTQA 4ISGA 1PNKA 1JVMA 4EFEA 4DR5O 3VA3A 3GDQA 4CEBA 3RSEA 1VSEA 2ASPA 2YNGA 4JRPA 3JCZA 4ISFA 2W42A 4BE1A 4CD1A 4E3SA 4YSYA 4PA4A 1OCRB 1HLUA 1ESVA 4PA6A 3OT7A 4AQYB 1RUH4 3UKRB 5EC2C 4DV1O 3BGRA 1GLAG 4L8JA 1PNMA 3NF7A 5ITZB 2VS0A 1GN4A 2Q2RA 2XHBA 5IY5B 2XY8A 5CE3A 5CN0A 1E4FT 4YORA 3M8RA 2NLXA 4BRIA 4WFBL 3M8SA 3GB7C 1S5HC 4KHNA 3VBBA 4DV3O 4CJUA 5LHGA 3HVRA 1RTIA 3LUTB 3E9OA 5JQGA 4FLZA 4CJ3A 2XY6A 3J8F4 2P9IA 3ML0A 1G99A 2HFEC 4TUYA 1KC8W 1N4CA 4R8CA 1BHAA 4PHZA 4J41A 1BWFO 4RUEA 1FJGK 3C95A 4BIOA 5F1XA 3SJHA 4OLBA 3DLLL 2E3CA 3IGAC 1OVYA 3LM2A 4J42A 3HB3B 2KG7A 4QPKA 4LNUB 1SKRA 2D4WA 1S72V 3LP3A 1XL6A 3OY9A 2ZXWB 1Y74A 3W7WA 4ZTJA 4FJLA 1HNZK 1VSDA 1S9EA 3AVBA 2QGNA 2W40A 1K34A 1QBZA 4RTFD 5BREA 2YI8A 4ZHRA 3OW2M 2A0LA 3LSQA 3TTCA 2D0PA 4C8KA 3RMAA 1EN5A 4JI7O 3WXIA 4CERA 3SFEA 3CJAA 1B3QA 3N4QA 1OCZC 4TSFG 5IYCO 4CZLA 5SZTA 3SPHA 3KD1E 1RGIA 5LHIA 2VQFB 2OZSA 3LM9A 1SQQH 4XDLA 1AR74 1YEWA 1Z26A 1HJRA 1AR94 3SV4A 3OYDA 3IFXA 3ZMUA 1Q86W 5KHJA 3FZFA 3OYLA 4J2DA 4FJNA 1ZP0A 1AJQA 5CMUA 4FK2A 3IG1A 4YTMA 3OS2A 2XTAA 3ITHA 5AQPA 4GUNA 5LL6Z 4BE2A 3QEIA 3OYJA 4RWTA 4G27B 1JL2A 1Z05A 5EYPA 5C10A 3EEQA 1BCMA 2VRZA 1MSWD 3IC9A 1RUI4 2Q8VA 4CJTA 1VBE4 4H5NA 2WAMA 4HNAB 5GIPA 3QNEA 2EILC 5J2QA 2Q6AA 4EFBA 3QBXA 4ELUA 2OA8A 1R3JC 5LMNK 2IIRA 1BOTO 5K14A 1I94B 4J7KA 3U3GA 3ZCCA 3NBPA 1L1FA 1TUUA 2QXLA 1KKCA 5DM6V 1WA8A 1XHXA 4CCHA 5LA6B 2ZIOA 4HYOA 5JQGB 2P9IB 3P4IA 3JD0A 2CH5A 1DGKN 5HFMA 3AVFA 4DR5B 2UUAK 5B1BC 2R9AA 3ZN1A 1HNWO 3H6EA 4LF8O 1I5YA 4TWKA 5JH7B 2LO1A 3HPGA 5AQYA 3CS5A 1GLDG 3WXLA 1NJZA 3U8XA 2ZWHA 4DR4K 4DV1B 1RUE4 4RWUA 5LGNA 2AZ0A 3TWHA 4GNIA 3SI6A 4CIFA 2HW3A 1GN2A 1V4SA 2R72A 2HKOA 4KI6A 2E2QA 3ASOB 1QVGU 1YTFB 1OH7A 4M3WA 1QU7A 4FFBA 5KX5A 3AK1A 2FSJA 1BUPA 1V55B 1TL3A 4DUZB 3KWIA 3E1YA 3BCCH 3CCEV 1F4NA 5LYJA 1EP4A 1YQ4A 4YIPA 4W5RA 3DXMB 1NJYA 3QTCA 4AHRA 1Y6XA 2WA4A 3K06A 4FJIA 4PL8A 4FK4A 2X6AA 4FJCC 1KLNA 1BHLA 4FWMA 3F7YC 3JAKA 4G1QA 4BC4A 1NJIW 2Q5ZA 4FWRA 4FJ9A 2O8EA 5E1AC 2YUAA 2BTQA 1SA0B 5BPMA 3RR8A 4O5FA 5EYPB 1KYOF 3C7NB 4IYHA 3CMEN 1DLBA 1SL0A 1N8RO 4M3XA 4ZBMA 3CI5A 3LDSA 5LJVA 4N23A 1Z25A 1GN6A 3AG3B 3H1VX 3NCIA 4YXWG 2OPPA 1E79G 1OV9A 2BDPA 4LFBK 1XQ8A 2IS3A 4DUYK 3L2UA 1T5EA 1T03A 5C93A 5AQFA 3SQ4A 1WA8B 5DN6G 1JA8A 4DV5O 1QS4A 4ZOLA 1M1KW 1AILA 5AQWA 4YOTA 3NHGA 4A57A 3A5MC 3AVHA 2P5GA 1OJHA 3G6EV 1QVGM 5C12A 3DLBA 1VEWA 4DTJA 4DR2O 4CZIA 2F7TA 3VQXA 2A7WA 1X3NA 4CJKA 1RDUA 1SQBH 1FK9A 1RUC4 2D0AA 2HBJA 1GM8A 4R79A 2CH7A 2LGQA 3VN5A 4O2AA 1C0MA 3CMAN 4YOUA 1BCCH 3THOA 1Q7YW 2G8HA 3BHPA 1VQLV 2EBOA 4YHHB 3JD4A 3RT3C 4UVAA 5EC1C 3I55V 1Q90D 1ROPA 2PYLA 5IT9N 4FFBB 2D2CB 5KX5B 3ENHA 4OPKA 4EZ6A 1OOPD 3AA5X 3FKSG 1C1AA 3V9ZA 2KTQA 5DECA 3G6BA 4K8XA 4IFEA 4KTWA 4KHPK 3NGYA 1ZC6A 2RPIA 2R064 1QQCA 1ASVA 1K6YA 4X1KA 5JWPA 1RUG4 2P4KA 3K0DA 4RO2A 4ZHQA 1RMU4 3G71N 1SKVA 2GHYA 4IHJB 3F7VC 4UCOA 3D0PA 1VQPN 4B3MK 1F23A 5M1FA 1YIJN 3SCXA 4RW7A 4NTWA 2F4VB 3L8BA 4GVEA 3VQCA 3DGEA 4YJ3B 4I6MB 3AAPA 3DAWA 3ZX2A 2LFRA 2QM8A 3F9KA 3EHBB 4JI5O 2HNDA 4AHSA 4B1UB 2XAQA 2VWKA 5CA0A 3V1RA 1Q82W 4DQ8A 1I39A 3SQ1A 1HUXA 1RSOA 5J2PA 1HYSA 3B40A 2NRHA 2I7PA 3SYOA 1VRH4 2ASOA 2ZJQL 1KMIZ 3KKSA 4C8LA 1EKEA 4X1IB 4DV2O 2Q68A 3MAQA 4X1YB 4J2BA 2YJFA 1J9AA 3I8BA 2Q9LA 4LP8A 1TYQB 2A06H 3VPZA 1WB8A 2WLJA 4OPHA 2EULA 3C6AA 3UT5B 1LR1A 1VQ7V 4NLBA 3AG2C 3HM9A 3RVCA 4CJ5A 3V4IA 3HKEB 1A5VA 3SYPA 4ZOLB 4H4MA 2G8VA 2YICA 1EQYA 1PNLA 4H0OA 3DSQA 3J7AU 2P9NB 4JI2B 3CE2A 5EIBD 3AEFA 2KB1A 2Z5UA 2M6YA 3JASB 3ZMZA 2XY7A 4XBFA 1CZBA 1NGGA 5KRSA 4LR3A 1N5YA 1TAUA 2B1GA 2WPDG 3ZRVA 5LBQA 1OCOB 1H2LA 2LFSA 2UUCB 3JS6A 4B3TK 1Y66A 5KRTA 3G4SN 3I56V 4A2AA 4NCBA 1VSFA 3O08A 5AQSA 3ZEUA 3RFRA 1MOFA 2VG6A 3L2QA 3AK3A 3GQKA 4YSXA 2QWMA 3G80A 2OZMA 1S22A 1Y76A 1RCHA 5KA5A 1XMOO 2QEXV 3THWA 1L0VA 4YFUA 2HJFC 5LMNO 4MVOA 3CHWA 1B6QA 4U7OA 3A0BZ 3LSSA 4IOXA 3L2RA 1Q3EA 4UUJC 1ZLZA 3MCAB 4CIGA 1H8HG 2HLDG 1N33K 3D6RA 4FJMA 4LCUC 2B1IA 4DR1O 1SQPH 4FW2A 3M8AA 3ZSOA 2X5ID 4B1YB 3CX5F 3ID6A 1AR64 1KTQA 1XI1A 3OYGA 1IDSA 4JI8K 3KCYA 1S0VA 3KZBA 4LF5K 1VSKA 5JCOC 4UQGA 5J2TA 4X62K 2RJZA 4AM7A 2UXDO 3HPOA 1TVKB 4ZTFA 1RVF4 1ZAUA 1OH5A 4FZZA 2PUSA 1RFQA 3J81O 4BQZA 1CEZA 1GRJA 2A1SA 4JZGA 1YCIA 5LMUO 3LDEA 3FD9A 1VQKV 3H3NO 4IJAA 2E4LA 4E7IA 2O57A 3O3FA 3Q7CA 5C25A 5GTIZ 4GKKO 4LC9B 1E1QG 3ULEA 4HBNA 4Z2WA 4BWJA 3IRXA 4DSFA 1WB9A 2ATKC 3MDSA 3PX4A 1DLOA 4CFCA 4JGSA 1AI7A 1I3AA 4DV6K 2LQTA 2PFUA 4IYIA 3HKDA 3JARB 1IKVA 1O13A 1NKDA 2XUMA 1SS3A 2P9SB 4XH4A 5AQKA 3VETA 1WAZA 1J5OA 1T3VA 1QTMA 2HMIA 1FW6A 3DRSA 3QEWA 3JATA 3BA8A 4IT5A 2V7ZA 4PJ0Z 4X64B 1AR84 3J80N 3PN1A 2NNWA 2Y0IA 3RYCA 2UYTA 4AH9A 3CXHF 1WBDA 3SJJA 5IJ9A 3VQYA 1NU1H 1OCZB 1I08A 5AQXA 3SK3A 4JI4B 1GLFO 4LF4K 3GL1A 1R6NA 4O4HA 4PKIA 3ZSXA 4DG1A 3AVJA 3ZETB 4CJQA 3HP9A 1B92A 5DMRA 3CCLV 4LF9K 3AO2A 3O8MA 4JK9A 5FROA 4IEIA 4CEOA 4CGJA 1LUWA 4E1JA 3CXCM 1SQGA 2RF2A 3SYAA 1HKCA 2K9PA 4EFHA 5A2QO 1SETA 3B8NA 2ZF5O 3OE7G 2E5LK 4FLTA 4WFHA 1SS6A 3BUZB 5LOVA 4NXNK 1VQ4N 2GSMB 4EAHD 3TAPA 5IY5C 1TK8A 4Z0UA 1GH6A 3CQYA 1GKFA 3N2KB 4DV7O 2ATQA 4UXNA 5HL7L 5B3SB 1HJOA 1GOAA 3WUHA 4CBWA 3A5NC 1VQOV 4ID5A 3VF6A 3L72H 4JI6O 3B09A 3KK3A 2OTLN 5IJ0B 2GTDA 4PDMA 4WF9V 3E22A 1BQ0A 2X6SA 2P22C 4H8KA 2FKXA 5B1BB 1PP9H 2IW5A 4DR1B 2G8UA 3MK6A 4BC2A 4B9MA 4W5OA 2ZXWC 3ZT1A 1VP7A 4PELA 4FPPA 3D36C 4HWIA 4JTCB 2WTUA 1G15A 1HP8A 4IGGA 3NAEA 1MMMA 4I9QA 1BIZA 3HK2A 4RW6A 1WAJA 1QQOA 3JAMN 1CLQA 2O8CB 1BZKA 3LALA 4B9VA 1BEV4 3QBWA 1U6ZA 1NKBA 2QKCA 4DV0K 4QPJA 4CH5A 4JYAK 1YUWA 3RYCB 3H08A 3AVMA 1CZAN 1HKBA 2GELA 1JCFA 3B2EE 5AQUA 1NTZH 4WFAL 3AEIA 3SDLA 1BE3H 4CZEA 2WS3A 2ZDIA 2P9PB 4P9PA 1HYVA 4O8UA 5H6QA 2Q7HA 4DTRA 5FLXO 4DTMA 1KP2A 1Q43A 1HNXO 4O4HB 5TISZ 4M41A 1VQ5N 2E20A 4FLXA 1RUF4 5L3GA 3E35A 1KAZA 1MDUB 3SUNA 4WCEV 3DC6A 5F2RA 1ZL8B 5JJEB 1GK9A 4LWSA 2ACZA 1K8KA 2UXBO 3FB6C 2VQFK 1H1VA 1ZOYA 2ITDC 2NLJC 4CJPA 3WT0A 1S1TA 3FZLA 3ZCMA 2ILMA 3U4LA 3ZX0A 5LOVB 4PY5A 5C2TA 4H5TA 4J7JA 3BZCA 2AP1A 2ZQMA 3U9ZA 3VEOA 3PV8A 2D3OW 4X65B 3LSUA 4LBEC 1YI2V 2W0XA 4UB8Z 3MN7A 1N32B 3CCQN 5EXWA 3EYZA 4KTQA 2VGNA 4FFKA 3CP1A 5KUKA 4FIPC 3OGCC 3A5OC 1N34O 1VQ6V 1SZ2A 2OPQA 2JGUA 3QO7A 3ZMSA 3OR7C 2OYQA 2JWKA 4GV9A 3O80A 4JKEA 3E22B 1AI4A 3OFNG 3HO1A 2HVIA 4CGFA 3MD0A 2PZSA 3K04A 3HI0A 1I94K 4N41A 2KZZA 4B3RO 4PL7A 1W59A 5H6RA 5BY1A 3AG1B 1QSSA 1D2DA 3JAMO 3CCSV 3ZHRA 1BCOA 3QIOA 5J2MA 3IS9A 2DFEA 1ZTEA 2GWJA 1XILA 1EAH4 2HHHO 1N36O 2WONA 3ZSQA 1XREA 1IBMB 2AHZA 4XH5A 3ZN0A 2EHGA 1HDJA 3WEEB 2F9WA 3OA9A 3HR0A 4R50A 4Y0WA 3TAMA 4FWNA 3J7ZO 5JS1A 3P4RA 3ZEDA 3FZMA 4TQFA 2UU9O 3RYFB 4DR7B 5E26A 3P1GA 5KPTA 4KAZA 1K97A 1IKXA 4DS4A 4BDYA 3CWBH 3OR6C 1OVQA 4RQEA 4X62O 1IO2A 1WLJA 3VEWA 3AECA 3ETDA 4AHVA 4WQ5A 3AY9A 3K59A 4KHWA 3ZSWA 1UFIA 4FJXA 4N76A 1M5IA 2Q31A 4WE1A 5AQMA 1NG9A 3KWGA 2QKAA 3IUCA 2QKSA 1XNRO 3T2MA 3TSQA 4IO8A 1T7PA 3LL3A 5LGUA 4DUZK 1J5EK 5CBHA 3OS0A 3O9SA 1QLEB 5ADXH 1EN6A 1KU9A 4LF6B 2F96A 4LWSB 5B1OA 5AQVA 4DQRA 3G10A 2P7TC 3TTDA 4A59A 2F8TA 1YHQV 4LFAO 4CJLA 1H8EG 2WU2A 2VG5A 4DV4O 3VF2A 4FJ7A 4J9YB 3AG3C 1GMGA 1V4TA 4BVOA 4LD0A 5IWAO 3LP1A 5GADP 3AEEA 4EIAA 4J80A 1N0JA 1GLBG 5I42A 1J95A 4NCGA 4ICGA 4DU1A 4LFCB 1POV0 1K33A 2F93B 4JS5A 4F6RA 3T1HK 4KHYA 3TSPA 3SPGA 1JOYA 2H8PC 4CBXA 4E1MA 4W4KA 1NK4A 4GX5A 1JLQA 1RDWX 3CC7N 1J6ZA 3ABUA 5EY4A 1ZYQA 2JIZG 3HKCA 2FSKA 2DOSA 3NF6A 4ISEA 4LF4O 3VQAA 2WC9A 2KKZA 1LCUA 4DHYA 1BL8A 3WNGA 2UXCB 3DRPA 4DLGA 2YDEA 4H0TB 4LF9O 2JVDA 1RBUA 4OPJA 3F2KA 2B76A 1OH8A 4H03B 2RNBA 2IM9A 1S77D 5KGWA 3TU5A 3TARA 3TANA 4LH4A 4DSLA 2E2PA 3S41A 4RAIA 1YITV 3MEDA 1ZX3A 3RMDA 1YVUA 1YJWN 1YJ9N 2HP8A 5B8HA 4K35A 3VERA 2PAVA 4BR6A 3AG7A 1XBLA 3NE6A 2W6LA 3LP0A 4PDRA 4I4TA 5B66Z 4BG8A 1W7AA 1IBKK 4C7UA 4B3RB 1KD1O 3CCVN 1MU2A 3OEHG 4JV5O 3TTFA 4AM6A 4YHHK 1ZSPA 4TSXA 1KAXA 3HVTA 5C0YA 4BR2A 5AR0A 3WB1A 2QR4A 2GUIA 2EIKC 4B8CA 4O4IB 4IZ9A 1F4MA 4F2RA 3L71H 2K1EA 1GOCA 1S1XA 2A1RA 5GAGP 4KFMA 4CFBA 2YEVA 3H1JH 2YNIA 3OYIA 3RTVA 4BW5A 4Z4CA 1S6PA 1YF5L 1VQMN 4FK5C 2JEUA 2ZE2A 1SKWA 3STZC 4RW8A 4FWQA 4GZRB 4D7TA 3HXMA 3CC2V 2F4VK 3BDPA 1MWMA 2OCEA 3CFRA 3LNMB 1PO14 3VF4A 2P90A 3ZHQA 2EX3A 1SKSA 1EETA 4JYAO 1KVCA 4JI0B 3SUQA 5CR4A 2KW4A 3RN4A 2XAJA 5L3CA 1W0HA 2IAJA 2E2OA 3W7TA 3PO4A 4R7CA 3GG4A 1KVAA 1W0KG 1N0NA 3HJFA 3MXJA 3CCMN 2HEPA 5BPNA 2A3QA 3U9DA 2OT5A 3KTQA 2KFNA 1LWFA 1VF6A 4LFAB 5GONA 1T6DA 1OCOC 4B9QA 3Q4HA 1AB3A 2WLLB 4O8KA 4PA3A 2QWOA 3CYOA 3C6HA 3AEGA 5JVHL 1DEJA 4KP4A 5C8YA 4JKGB 4AILC 4GKJO 4ZKIA 4JI2K 4P30A 1G4YB 3T1YB 3QMLA 2R9RB 2Q7EA 4Z4IA 5GW7A 1RDAA 1N8RW 3SBGA 4PWDA 2AA4A 5JJJB 4QS8A 4O2BB 5EX5A 1H38A 1I5XA 4K0KB 3THVA 2UUCK 3G71V 1VQPV 4BC3A 5K1PA 4BRKA 4HAMA 4BR5A 3L70H 2HSTA 3VQPA 5HP1A 1YIJV 1WJZA 1RBVA 3SAGA 5DM7L 2GTAA 4HZ3A 2BOCC 3PIPL 5HROA 3IC7A 3VQ9A 3N27A 2EWSA 4WF9L 4CJ7A 1QQNA 3QFPA 2D1KA 1NU0A 5B1AB 2CGKA 3KKYA 4DTXA 1Q9XA 3KG2A 1C1BA 1E4GT 4CHQA 2RMU4 4LF7B 4ZIBA 1IKYA 1WAFA 4FPAA 3VESA 2HBLA 3ZS8C 1YJNN 4JEPA 1ZBFA 1LUVA 1NVPB 1XNQO 3L0QA 5BR8O 2NRXA 3JD74 3O9TA 2E76B 3JXUA 1VSJA 2JK5C 3X2QB 4JV5B 4LSNA 3TXQA 2YKMA 3T4DA 4I55A 1NH2D 3NH1A 4PUOA 3SUOA 4X66B 4F3TA 2OPRA 2VQEO 3C3TA 2OIGA 1MQTD 4CS2A 4Q5VA 2QM4A 3RGBA 2D0OA 2HVKC 3LDOA 3LDNA 2YV0X 4CF8A 3U6FA 1XMQB 4PI2A 3CCJN 1TK0A 4KRFA 2I7NA 2IJHA 3HL8A 5AQOA 1M56C 1J5EO 4B7KA 4TV8B 5GONB 3G4SV 1US6A 2B4JA 4FL9A 1NGHA 5BXZA 1LAVA 3HM8A 4CF0A 4BRDA 4CJWA 2R044 2QE7G 4CEQA 3AEDA 5GIOA 1YAGA 2MK3A 4E4EA 4I2PA 1JR9A 2Q1NA 1ZXOA 4PA1A 4JI3B 1NBMG 1X9JA 1TK5A 5DK5A 3THYB 1IXBA 4DK1A 4CGIA 4EP5A 2QTOA 4PV1B 1XUPO 3SAFA 4X64K 1NK9A 4YY3B 1PPJH 1L3VA 2HHUA 1K9MO 4QE7A 4UCUA 4JI1B 3OYBA 4NYNA 1JLBA 2FBWA 1AROP 4H5WA 3RSEB 3T1HO 3ZSYA 4H13B 4KUMA 2XNDG 2PY5A 3VMFB 4MTXA 5CA3A 1IBLO 3TR8A 4BVPA 4DSKA 5AFUH 4C8MA 3QO5A 5AFUA 3K5OA 4CJEA 3MHHC 1VHXA 1VIBA 3E8FA 1TKZA 1BG3A 4DR3B 5B3SC 1Z7S4 5AZJA 3MWTA 3ZLJA 4DO2A 1QHAA 4NYKA 3HKBA 1U47A 3CHXA 1BQZA 1NK0A 3AE4A 2D0CA 2JJ2G 3ZT2A 4MVQA 3FLCO 1SQXH 2BSKA 1S5LZ 3ETEA 4TUYB 2N04A 4DFJA 2F95B 1SQKA 2RQ6A 4RG8A 2P51A 1JMKC 3VR9A 5C2FA 3UCSC 2W6JG 3JCUZ 4O0IA 2KG7B 4GMJB 3VQ6A 3SJQC 2XAGA 3GVMA 3JSLA 3O1WA 4J10A 3UKUA 1Y74B 4QS9A 2Q97A 1FPOA 3W0LA 3A0HZ 3FYEB 3K5LA 1FXKA 4MVUA 4Z1VA 4CEEA 4WFEA 3FB8C 2E1ZA 1KSPA 4DV3B 2JWLA 2OWOA 3VGMA 4AHTA 4DFKA 4FWKA 2EINB 2WLKA 4B1VA 3DXRA 2GUZA 1Q81O 3VRAA 3ID8A 1W2BU 2BANA 1X9MA 4FZXC 4E7HA 3VQ8A 2WQYA 2EZPA 3KIOA 4XEIA 3WB2A 4FJGA 1C0FA 3A0IX 3GE1A 1HR0O 4W5TA 2GX9A 2KHOA 4DB3A 4BWAA 4OVLA 3FZKA 4PI0A 2VQEB 4JK8A 4C8OA 2FBTA 3OAAG 1K8AO 1YXBA 4Z4FA 2E8AA 1HW7A 4CI6A 3AE3A 3IDHA 4ID1A 5AQJA 3SGIA 3AVCA 3CRCA 1VQ4V 3QLHA 1Q18A 2PTMA 1O9GA 1OZ0A 4M42A 1H2MA 4CF2A 2ZJPL 4J11A 1BI4A 4JI7B 3BA9A 1XQSC 2X6BA 4A5AA 4I0XA 3NGZA 3CJBA 4KO0A 4LH5A 4BR4A 4BRGA 3GQHA 3JSNA 1C0GA 5AZJB 2ZM6O 1VQ8N 1FAFA 3HKBB 3TGUH 3L6QA 2UUBO 5CBGA 4E7LA 3ETGA 1WSJA 3PLAA 3OTOK 3OUSA 1TAQA 3QEXA 1XC9A 3FYIB 4UCSA 3SAHA 3OYMA 4NXMO 5LGTA 3CCUN 4B08A 4B3SK 3STLC 4CD3A 4FSVA 4X65K 3AG1C 4CJRA 4A62A 3ATVA 5SWMA 3R66A 3ZHTA 1N32K 3ATUA 1T8EA 3MN5A 1BO5O 5LHHA 3LAKA 2F1MA 4DS5A 1MNGA 3DLEA 3P5JA 3UQ8A 4L87A 4W4LA 4X8AA 2F43G 5C42A 4BG9A 5CBFA 1R1BA 1HQEA 4YXDA 3W7UA 1W0JG 1AP6A 1KFDA 2Z1HA 2ZD1A 5L3BA 4HTLA 4E7JA 3CD6N 4P9OA 2CK3G 1WOQA 1KKDA 3BY5A 1NJXA 3DXRB 4D6TH 1ATSA 1CZ9A 4HHTA 3S3MA 5LYJB 3CJ7A 5D5QA 3HPHA 2Y48A 2ITMA 3K0SA 3M1FA 1HNWB 4LF8B 3ZSVA 1SAZA 2Y0PA 3BY6A 5GTHZ 1XHZA 4MW8A 4IBNA 2DJVA 4JNEA 4DQPA 1VQ5V 3EXAA 4Q20A 3CG7A 3VQWA 1HWYA 3OEEG 3CSXA 1C0TA 5H9CA 1FJGO 3HSCA 4CESA 1WNSA 3JD1A 1QSLA 4DR7K 3JAKB 3CRMA 1QLEC 3AAQA 5KI6A 1RT1A 2EIKB 1IJJA 2BTQB 4JKHA 3SJBC 3DXKA 3H1QA 1WN7A 1XC3A 2NR5A 3S3WA 3ZX3A 2XOKG 3UIQA 4GV6A 2QDOA 4CS3A 1SERA 4ILGB 1HNZO 5E79Z 2RKIA 3AGKA 1BI4B 1KVBA 4F6EA 4BRFA 1NK5A 3CCQV 1MWKA 1VF7A 3ISNC 3M3ZA 3A5LC 2E75B 5L3DA 1FKOA 4LF6K 1HR0B 1DKGD 1QR9A 3DLKA 4JKCA 3BAAA 2H3GX 3AA3A 4FOEA 2A40A 2Z0AA 2ZD9A 3OYHA 4FJHA 4CC5A 1X4TA 1ATRA 4BY9C 1JXEA 2Q4PA 1VBC4 1CXQA 3UB5A 4Q4Y4 4ZI7A 1Y67A 1NGFA 1QZ5A 4F9OA 3L2VA 3HP6A 4GB34 1NLVA 1KB9F 1MSDA 4RHV4 1K5MD 1DK1A 2DMXA 5KQ8A 5AQZA 4LFCK 1JLCA 2CUGA 4CGHA 3LDQA 1L8DA 3KK2A 2Z1JA 4CIEA 5FRMA 1VK0A 5IT9O 2YXHA 1FXVA 1NR7A 2CH7B 3CQXA 1SL2A 4O2AB 4ABMA 2YI9A 3T1AA 3KLGA 1D5AA 3VGLA 2GEMA 1SQFA 4FJJA 2UUBB 1PL4A 1UA0A 1H2GA 3ZX6A 1S72N 5BN8A 4DV5B 5LJWA 2UXCK 3V9XA 4IDKA 4JD2A 2ADPA 3MN9A 1IG9A 4WQ5C 3LDPA 1ZBHA 4X1KB 3JYCA 2ZT9B 4DR2B 2V1DA 1NR1A 4ZHQB 2XY5A 2YJEA 4TQDA 3HOSA 2ZCEA 3O9RA 4BDPA 2R7YA 2DN9A 2UUAO 4IFVA 3WNFA 3AE5A 3V1OA 1U2VA 1UJWB 1BIUA 4CH4A 4HVJA 4UCVA 2P6JA 2HBKA 2L6LA 5CA0B 2E74B 4DR4O 1TKXA 1RSOB 3AO3A 4E1NA 2Q0AA 3I5DA 1WP7A 1RILA 2EIJC 2KQXA 4MLEA 2ZINA 5AG2A 3FFKB 3ZT4A 1PIV4 1KFSA 3P3PA 1QQMA 2VWBA 1TKDA 2CTPA 2IVOA 4IDHA 4MVZA 4LC1A 3AG4B 3T1CA 2XRIA 1BQMA 4DR6K 2FTKA 3N2GA 2ZE5A 2P9KA 1WPBA 4OX9K 3DLGA 1EV14 1UPGA 4JI5B 3VTIA 1REVA 5EOYA 2YHAA 1I7FA 2PGGA 3SYQA 3TAEA 4M45A 1IVSA 1BDGA 3O5BA 5CY4A 4BRQA 1MG1A 4DKWA 3NH0A 2OTJN 5CYQA 5GAHP 3E66A 4B9LA 4JASA 4JI0K 5TKYA 1M56B 3U0ZA 3BABA 4DV2B 1NEKA 2X6CA 1VSLA 2BGGA 1S1VA 3VTHA 3ZMTA 2CH6A 1YJWV 3ZEUB 1RBTA 3WQTA 3RWUA 1RFYA 3JALA 1Y76B 1RBRA 3THWB 1RTDA 4UFZA 2UXXA 4PDWD 1XOUA 3QG5A 3VOUA 4FWOA 3GWKC 4NVPA 1QLNA 4JD2B 3CCVV 4LFBO 2P9UA 1F21A 4CF9A 4KI4A 2O8DA 4DUYO 4O4GA 2EIMB 1D8YA 1IX9A 2YI1A 1BA0A 3O9UA 5I9EB 1SF9A 5DM6L 4DSJA 3SV3A 3AK2A 3RBZA 3A8YA 2VCPA 4JKAA 3T1YK 4GCZA 4RUFA 4B3SO 3CCEN 5B1AC 1RM1B 5E41A 1RT3A 3QEVA 3CETA 3ICXA 3AEAA 2OPSA 3AE6A 1QR8A 1DTTA 5BRFA 2HNZA 3L2WA 2W6IG 5J2TB 4BWMA 1NGJA 2ZE6A 3NGIA 2Y1JA 1XMOB 3E01A 1JLGA 4U67L 3BF3A 2H88A 3QINA 5LMNB 3K08A 1HRHA 4AQYK 5KAIZ 4FWLA 1D9FA 2QKKA 3CYMA 2O8FA 3BEHA 4M3YA 3B8MA 3X2QC 3VQ7A 3VQ4A 1COV4 2CDYA 2B5JA 3N4PA 2YKNA 5LXTA 3ULEB 4LF7K 4ASUG 1HPZA 3JAWA 3P38A 4CVNE 4DU3A 3LWMA 4KHPO 4Y1DA 3WNHA 1OH6A 2H3OA 2JGDA 1TGOA 1J53A 2YHYA 3N2GB 5L3EA 2P9KB 4E0DA 3P31A 2FC0A 3HRGA 2RS34 3J80O 1A32A 3FAVA 4YJ2A 2V7QG 3HKDB 4B3MO 1KD1W 4DR4B 2ODMA 4EHTA 2UXDB 1VF6C 4MVRA 5JMVA 4CC6A 3L4IA 3JATB 5IE9A 3CCRV 4PDVA 4X66K 2FB5A 2BTOA 5LMUB 3P3NA 5KHGA 2ASMA 1WSGA 4GKKB 2B5UA 4WFBV 4KKOA 1ORQC 5IJ9B 5JVDA 2Y4TA 3H1HH 2HHXA 1NENA 5JLHA 4CZGA 3NF8A 2PLV4 5L3FA 5KTQA 1RDDA 4GT1A 5H5NA 4WFFA 3ENOA 3OYAA 2P9UB 2MW2B 3CFOA 3VQDA 4XIUA 2O8DB 3PJSK 1VQLN 1P90A 1YDXA 2XT9A 1YVNA 3APOA 2GV9A 1ASUA 1YF2A 4YIOA 5IYDO 1K3EA 4OGCA 5CZ1A 5JVGL 4GW6A 3AE8A 4DFMA 3AO4A 3PUFA 4BC5A 3QVNA 5HRNA 3UE5A 1TKTA 2XAFA 1AI5A 4YY3K 4CGGA 2GWKA 4NO7A 2W0FC 4DXWA 4CK2A 1UAXA 4JI1K 1RHI4 4J7ZA 4FLWA 1EWRA 1D4XA 1KAYA 3SMSA 1JFFA 1TA8A 1RT2A 3OYEA 1YJNV 1ZBSA 2Z1GA 4B3TO 4U3FH 3FFIA 4CEAA 1T05A 3AVKA 2PBDA 1K4CC 2D0BA 1R6TA 4FLYA 2DQ3A 3O65A 4G2KA 4GX2A 1HKGA 3SMPA 5C3JA 4DUYB 4J8FA 3KLHA 2E6MA 5BMVA 3O4NA 4CGDA 4MS2A 4BRNA 1NGCA 4CHPA 4HUGA 3TAQA 1DTQA 5LXTB 3C6TA 1HNVA 4LSLA 4Q0BA 2IC3A 3DWLA 1QZ6A 1CPYA 2KKWA 2NRZA 2BUPA 2QTDA 5JLFA 2HJDA 4FWSA 2RS14 1ZWIC 2JGDB 1EZVH 4BGAA 2Q7GA 2RCVA 1N33O 4DV7B 2OCCB 3H1IH 1BISA 1P7BA 1T44A 3IKMA 4DR5K 1VQNN 4BR0A 3ZMVA 3ZSZA 4FZ0A 2EINC 3L3VA 1NNEA 4JI6B 3J8AA 3TAGA 2X74A 4JI8O 3FGUA 1YVWA 3SR2C 3WQUA 4DV1K 4LF5O 4YDUA 4RCHA 3PSIA 1EFRG 4NYFA 1JCEA 5AQGA 4I5SA 1YSCA 4L8RB 2HB5A 2JRIA 2M7WA 4L3QA 4K25A 4MO4A 2EJ7A 4JK7A 1P4RA 3ZRWA 5F2VO 4M3RA 2WLIA 4CK1A 5JVDB 4DV3K 2UXNA 1NCQD 4HUEA 5FPDA 4Z4EA 2A41A 4PKGA 1X9SA 4GX0A 2ETJA 5KPZA 1A5WA 3QESA 3KKRA 1JLAA 4MLHA 5ADXA 1K8KB 4UB6Z 2JS3A 5H2FZ 3H46O 1CXZB 2H94A 4OX9O 5BPLA 2P06A 5HRSA 2Q69A 1AI6A 4DV6O 5HRRA 2QEXN 1O1WA 2YXLA 3RRHA 4DQQA 3MX2A 1GTOA 3KK1A 1Y97A 3HSTB 5FNVA 1YXQA 3LAMA 5BN9A 3ABKB 5LY3A 4JRQA 3CC4N 4IOCL 1HNXB 1H8TD 2W41A 4O4LA 4JAXA 4EZ9A 4JI7K 2BH1A 3AVLA 5FPEA 4YSZA 2QWRA 3MX5A 4H0PA 1M9NA 2ZKOA 2UXBB 4MT8A 3M6GA 2DYSC 1LWCA 3VEVA 5E84A 4B7EA 3ZSRA 5C15A 3AEBA 5IYZA 2AW9A 3K9JA 3TSUA 4FPBA 4OKEA 3ABLC 2GDSA 3OJUA 4H5VA 5J2NA 3TJTA 3HT3A 1K9MW 3U11A 1R59O 3S3OA 4BREA 1VQKN 4KHSA 1FXKC 3WXKA 1NM1A 4E89A 1BT8A 2IDOA 2YIDA 2E5LO 4XDKA 3AARA 3T19A 4NXNO 2ZGYA 1NKCA 3R65A 2KQ2A 3H01A 3OM3B 1N34B 2YXYA 4HCCA 1NT2B 1ASJ4 2AZ2A 2JS5A 3CPEA 4H0YB 4O0JA 5J9PC 3CRQA 4U3JA 1IG8A 4F3OA 1NK6A 1GLLO 3M8QA 4MTGA 3TI0A 4YT0A 1OHHG 1S3JA 1C0UA 4BROA 4X20A 4CH3A 4D7SA 3MHSC 3ZRWB 3MWPA 1ITGA 4AQYO 3BRCA 1U4BA 1R084 5AQHA 1EXQA 4IXCA 3AA2A 2YIBD 2HHHB 1N36B 3LPTA 1TUYA 4FM0A 4FVMA 4B1WB 1E1RG 3NVMA 3OBYA 3AE1A 1HNWK 3CMEV 1GAXA 3T4ZA 3EN9A 3GWOA 4KB0A 2YS8A 4I7FA 5AZIA 2UU9B 4NLCA 2BOBC 4CEDA 2DYRB 3ABMB 4LF5B 1G6UA 3OYKA 3UKMA 3MN6A 1FS0G 4X62B 3CCLN 3WXMB 2EIJB 3CM5A 5EBMC 3QFUA 3DOLA 2ADQB 4XH1A 2XASA 5FNVB 5JICA 3BP8A 2IU0A 1K5QA 3UKRA 3OYCA 1P84F 4DV0O 4I9LA 5F0XA 3EO3A 3CJ9A 3S3NA 3ASMA 4AHCA 5ITZA 1KQSU 1XNRB 4EEQA 4F6RB 1Q81W 4NB5A 4O4LB 1L0LH 1OKJA 2G38A 2ITCC 2QM1A 3LZIA 1BU6O 4KFBA 4BACA 4OGQB 2H89A 1D4M4 1KF6A 2QWRB 2AHYA 4DK0A 1AR1B 3DMJA 3HKCB 2PYJA 2QA4N 4IJNA 3M8PA 3K9KA 1VQON 3P4SA 1NK7A 3RVYA 5ELZA 4NR1A 2V51B 4DV4B 1EX4A 2HHWA 3KLIA 3CMAV 1K8AW 2EJRA 2Q0OC 5C24A 2G8WA 4MVSA 1NQTA 5IWAB 1TUBA 2VQFO 4FM1A 2RHKA 3EE9A 3FE1A 4CW7B 1KXPA 4WQ4A 4DMNA 4LNUA 2VWJA 1VQ9N 1R6KA 1HRV4 2AJQA 1WSIA 3EY1A 2LGWA 1X59A 4JYBA 3MECA 3B6OA 1YTFD 5CHIA 2F66C 4U7NA 4OO1J 4JAVA 4QAGA 4U3JB 4O5BA 4O4JA 3A2FA 4I4TB 3SPCA 4CFAA 4LF4B 4CJSA 2YNHA 4IKFA 5FRNA 1B04A 4I9WA 1R0AA 2KLAA 1ILYA 3SLCA 1VSIA 3HZ6A 3MDQA 3SZ2A 3CERA 1N6QA 4Q4W4 5LL6Y 4LF9B 2BCCH 3FB7C 1AVMA 3CIRA 1LNQA 4DV5K 3ZJZA 3MCPA 3O9OA 3LP2A 4C8NA 1I94O 1COWG 3AGRA 3V1QA 2L35A 3C6UA 3ZHVA 1PVC4 2P9LA 3MMVA 1Z6RA 1TL1A 1URFA 3DRRA 4NXNB 3D2FA 3VOVA 1EZJA 2YEVB 4B1ZA 4N5SA 4DR2K 3NDKA 1NS1A 3O4WA 4CJVA 1KQSM 1HPMA 2HWB4 5EK0A 3Q7BA 3K9AA 4YTPA 1WUAA 4BAYA 3AVNA 3FB5C 5EBWC 4DF4A 1Z5WA 3V9SA 2C2AA 3SJCC 3AG4C 4HNAA 2P67A 2WLNA 2E6LA 1NMNA 4JYYA 5EVZA 3KHYA 3EFFK 1QE1A 4OGEA 5GINA 1UWBA 5AQTA 3U10A 3R9PA 4UCTA 1QCEA 3ZHSA 3O3HA 3RR7A 1OCCC 1WSHA 1NGAA 1IKWA 2HMPA 1NMDA 1DF4A 4Z1MG 2YSUB 2ZQBA 1YI2N 1HX1A 5LA6A 4ILHA 4HTUA 3AA4A 1JX9A 3MEEA 3L9DA 4DUZO 2WWWA 4O55A 2WU5A 2NRWA 1VQ6N 3Q4HB 2LJ2A 4M3UA 3IAYA 2QWOB 1K7DA 4WCEL 3LDCA 2A79B 5JH7A 4JI5K 1TUBB 4BRPA 4CJ4A 1M90O 5C8YB 5FPOA 4DV0B 3VQBA 3OMIB 4JYAB 4KPYA 4H33A 1MA1A 5LP6A 1THZA 5JS2A 2KZMA 1K73O 4B1XB 2HF4A 3CRRA 3CCSN 3DJCA 2RR14 3BZKA 1WB7A 4KX6A 4GX1A 1DF5A 4Z94A 4DV2K 4N56A 4BIZA 2EIMC 4QJFB 3QO8A 2G8FA 3O9QA 4GV3A 1PV0A 4O4JB 4AI8A 4FJ5A 3OMNB 4X9QA 2YIAA 5EZYA 1HQUA 4QOZB 1RPOA 4KHUA 4JI4K 1S9GA 4AHUA 1RM1C 3DXMA 3K79A 1SRYA 4I7ZB 1L0NH 1F51A 1KECA 1O9HA 4GKJB 4DLEA 1R3LC 3FFQA 3OS1A 2P9LB 3KD5E 3P39A 4Y1CA 3D45A 4OJRA 2F9TA 5JJNB 3D2FB 1H2KA 4DRXA 4KTZA 4F4KA 5M1QA 3FX7A 1SA0A 4ELTA 3QIPA 2NN4A 3SNNA 3MXMA 3HPLC 3QETA 1GLCG 3SUCA 1RT4A 3C7NA 4BE0A 1A5XA 3I0RA 3NF9A 3R8EA 2CGJA 4IOAL 4DU4A 2P4VA 4I55B 3LPUA 1XMOK 1K92A 1YHQN 3M99B 5IYBO 3M5RA 2V52B 1IBKO 3OYNA 4EB6A 2B9ZA 1VMGA 4YHHO 4IIJA 3VGKA 2OTJV 4CBCA 3K58A 4JLHA 2RE2A 3TK1A 3V6DA 5A9GA 2LW7A 3ABTA 5EIBC 2Q3SA 4DR1K 3SFDA 3KJVA 4OLAA 3F73A 2QWLA 1T6CA 2WUSA 2E88A 4J2AA 2Z3YA 1FKPA 1PL0A 3ZIAG 4YNQA 3DYAA 1XNQB 1VBA4 1Q6HA 3ASNB 5BR8B 4MQ3A 4WFGA 3UM7A 4RW9A 5HLFA 2IVNA 2GBOA 1ENVA 4CZFA 1NOYA 2A6AA 4TV9A 1BGYH 4F8RA 4A5UB 1VBD4 2UXDK 3P32A 2QW9A 5LP6B 1TVRA 4H0XB 3CF5L 1RUJ4 1V54B 2F4VO 3V9UA 3ETQA 1BL3A 3F9MA 3OBWA 3R6MA 4WYBA 4B9TA 4FM2A 3THXA 1FKAO 1EBOA 3CM6A 1RDBA 2YX6A 5LMUK 4WFNL 4DFPA 2RN9A 2WA3A 4DTPA 3OVNA 4PD4F 2ZJRL 4FVUA 4Q4V4 3KLFA 1S6QA 4GKKK 1FD9A 1NKEA 1MA9B 4TOIA 1AR5A 4G28B 1J5EB 5EZYB 2RN2A 1YITN 3D3IA 1P8ZA 1U45A 4B3OA 4ELVA 3TCUA 4TT3G 4UV9A 1J54A 5K1XA 1JQ0A 1K5SA 1UA1A 2R70A 2ZE7A 4IHJA 4N21A 2VGMA 4EKWA 3SYZA 5M1OA 4YJ3A 2OTLV 4I6MA 3K57A 2KFZA 4DRXB 3QNNA 4B8AB 4M3TA 2BSKB 4DW1A 2O4IA 2IJJA 2WLHA 4OKJA 3VEZA 4JI2O 5DEDA 4WFAV 4BR7A 2FF6A 2DE0X 1EWQA 4KL1A 2IH3C 3T1HB 4O44A 1GO3F 1JJOA 2DYSB 1IBLB 4MSWC 3NFAA 4X1IA 4FLVA 4MDBA 3FI7A 4X1YA 4CECA 2UUCO 1W2BM 1TYQA 3BEXA 1W9HA 1NH2B 2Y4UA 2FXUA 2OCCC 3CC2N 3ABLB 1Z2GA 3UKUB 2ZNIA 1X3MA 3UT5A 4EB6B 3VA0A 4IIJB 3L74H 3SQ0A 1D9DA 1FXKB 4C23A 3HKEA 1GM7A 1KP3A 4CHYA 3F5WC 4DF8A 4R6ZA 3SQ2A 4BQLA 2P9NA 2GUZB 2W6KA 1LV5A 5T7BA 3JASA 1IBMK 4C1NI 3VQQA 1M93A 1Y64A 5KPRA 4DV7K 3AE9A 3K3WA 2YC0A 1VRTA 3ALYA 2ZDIC 1VBB4 4TV9B 4CZMA 4E2LA 4FZYA 1KC8O 1M57C 5KHKA 3R3LA 3EVKA 4JI6K 1Q5OA 4FOIA 5CZ2A 3HOTA 3SUPA 3H1KH 2FBVA 2FBXA 1IBKB 4FCYA 5KMGA 5J2UA 2FSNA 4B9UA 1LWEA 3THXB 1LW0A 1XWLA 4CFDA 1U96A 4BIUA 2WDRA 4X89A 3RMBA 5CA1A 4IWVA 4WBNA 4JTAB 2WFBA 2IJKA 2R7FA 2AXTZ 3OMAB 2QXFA 3T69A 3UO3A 1Z5VA 1U04A 1XEQA 4I0XB 5CB4A 5I3UA 4RQFA 2FLOA 3ABKC 3F5TA 1NTKH 3H3OB 5AQQA 1IH7A 2LSNA 3BF1A 3M7MX 5J1EA 4JAAA 2ZIMA 3HTVA 1U97A 4HUFA 2IBZH 2Q0UA 3HYFA 2FBYA 2V4DA 3D3QA 3C0BA 5BR9A 4FZ1A 2HBMA 3KK7A 4B9NA 3EE8A 3SJAC 2Q0RA 3NH2A 1TVKA 2YHXA 4FLUA 4KHQA 2QKBA 3VR8A 2G8IA 2CAZC 1RNHA 1NBWA 4X64O 1VF5B 1Q86O 1L3TA 1VARA 5GAEP 1YTUA 1HNXK 2HHVA 1RPRA 2R9IA 1VQNV 4IEEA 2DTUA 1YZBA 3J81N 2ZM6B 4XDJA 3A0RA 1VAZA 2UXBK 4JI4O 4CZKA 2DWEC 2XO7A 2NRTA 1JL1A 2HG5C 2YHBA 4ILJA 1BMFG 2YHWA 1WBBA 4R5PA 1KRPA 3JARA 3ZHUA 4W5QA 4YDUC 2P9SA 4K3AA 4NXMB 5D3GA 5FPNA 2JJ1G 2N74A 2J4RA 2BE3A 1B9DA 4FJ8A 5M1KA 3B8AX 3L4QA 5KA6A 2QK9A 3S9HA 2O8BA 4A2BA 1WP8A 1JPXA 2WOMA 3RWRD 2RMKB 3I0SA 5EBLC 3ULDA 1G8MA 3P4PA
chains in the Genus database with same CATH topology
2BE2A 3AO1A 5J2UB 5KMGB 4N47A 1LW2A 1TV6A 1U49A 3DM2A 3OJSA 5CA1B 4M3ZA 4WBNB 3QF7A 4CJFA 2D5RA 4QCLA 3AVIA 4NCAA 5CB4B 4FYDA 1C1CA 2NUBA 1CXUA 1FJGB 2HHQA 2Y1IA 3N2KA 1Q9YA 1SUQA 2X78A 4KREA 4BW9A 1VSHA 1BQNA 1WSFA 3QO9A 4ZI7B 3CB2A 3RYHA 5IJ0A 3TABA 1VSMA 4E7KA 1HNZB 3AV9A 3PX0A 3U3YA 3L3UA 2DFHA 4F2SA 4J2EA 1ZBIA 2IGIA 3WNEA 3DOKA 1L3UA 5FDLA 1H2SB 3KLEA 1V9PA 1JXBA 1LAWA 4CH6A 4GLXA 2IOCA 5HBMA 4LH6A 3QERA 2ITGA 4DSEA 3VQVA 4KV8A 1NJWA 4IG3A 4GVMA 2VG7A 3PY8A 1RT5A 2HHTA 2JLEA 1S5JA 1ZBUA 1L3SA 4DTNA 4CEFA 3C94A 4EP4A 2YNFA 1Q8IA 2UUAB 1HNIA 1ASWA 1BGXT 4CHOA 4PQUA 1RT6A 1RTJA 1X1PA 3RYHB 4MFBA 2DFFA 4IG0A 3SPZA 5KHHA 3CFPA 4CEZA 3SPYA 1YTAA 3JALB 4I2QA 4RW4A 3O4QA 2ZNJA 3RYFA 3WB0A 4FK0A 3AVGA 3V9WA 4DTOA 1B9FA 3RRGA 1VRUA 4DTUA 1S1UA 4JS4A 3K2PA 3JYTA 2B6AA 4BDZA 3LWLA 1FXXA 3VQ5A 4CK3A 4DWIA 3OTFA 1P49A 1DGSA 4LFBB 4HCBA 1JKHA 3OTOB 4B3SB 1JLEA 3JAWB 4LY7A 1FFXA 3VQEA 3B6PA 3DLHA 4YJ2B 1KCFA 1X9WA 3K5MA 1KLMA 3QNOA 3LNNA 4Z4GA 3O3GA 1C6VA 1SV5A 3DLRA 5LP6C 2G8KA 4FW1A 4DQSA 3DI6A 4CF1A 4K8ZA 4GYCB 3MEGA 4KHPB 1WSEA 2X6NA 1GOBA 1HMVA 4B3MB 4FXDA 4OKKA 3BPZA 1UOCA 3CQ8A 4CS4A 1RT7A 1JLFA 4Z4HA 3I8DA 2P5OA 2GBZA 2O4GA 1JFFB 4O4IA 4IFYA 4H4OA 2PW9A 4I50A 3RMCA 5JCOA 4DTSA 5BMVB 1S1WA 3RYIA 4ICLA 1QSYA 1FFXB 4CHNA 1M4UA 5HRPA 4B3TB 1QHTA 2HHSA 3PX6A 5FPRA 1RDCA 3ZT3A 3AVAA 3MXIA 1N33B 2Z1IA 5D5PA 1SL1A 5CYMA 1ZBLA 4O2BA 4JI8B 1TAEA 2HNYA 4Q6GA 3TAFA 4KB1A 2F8SA 4CE9A 2HVHA 1HYZA 4E19A 4B9SA 5EU7A 4CHZA 1YT3A 4I50B 3P83D 3ZT0A 4DR6B 4OX9B 1NK8A 4DV6B 5KGXA 5IYZB 3OYFA 3RYIB 4DSIA 1RTHA 1U48A 1RBSA 2I5JA 1L5UA 3PO5A 4FJKA 5KHIA 2QJ1A 3JSMA 3K5NA 3LZJA 3AO5A 4TV8A 3V81A 4DQIA 4X20B 1NOZA 3LANA 3T3FA 3EZ5A 2P1JA 3G0ZA 4UCRA 4W5NA 2YIBA 2E5LB 2DY4A 4LH7A 3QEPA 3VA3A 4EFEA 4CEBA 1VSEA 2YNGA 4JRPA 2W42A 4BE1A 4E3SA 4AQYB 3BGRA 4L8JA 3NF7A 5ITZB 2XHBA 2XY8A 3M8RA 4KHNA 3M8SA 4CJUA 3HVRA 2XY6A 1RTIA 4CJ3A 5JQGA 4FLZA 4TUYA 4PHZA 3C95A 4OLBA 2E3CA 4LNUB 1SKRA 3LP3A 3OY9A 4ZTJA 4FJLA 1VSDA 1S9EA 3AVBA 2YI8A 4ZHRA 4C8KA 3RMAA 4CERA 5SZTA 3KD1E 2VQFB 2OZSA 1YEWA 1Z26A 1HJRA 3SV4A 3OYDA 4J2DA 5KHJA 3OYLA 4FJNA 4FK2A 3IG1A 3OS2A 3ITHA 4BE2A 3QEIA 3OYJA 1JL2A 5EYPA 1BCMA 4CJTA 4HNAB 5J2QA 4EFBA 4ELUA 2OA8A 5K14A 1I94B 3U3GA 3NBPA 1XHXA 4CCHA 5LA6B 2ZIOA 5JQGB 3AVFA 4DR5B 2R9AA 3HPGA 5JH7B 1NJZA 4DV1B 3TWHA 3SI6A 4CIFA 2HW3A 2R72A 4KI6A 4M3WA 4FFBA 5KX5A 1TL3A 4DUZB 5LYJA 1EP4A 4W5RA 1NJYA 3QTCA 4AHRA 4FJIA 4FK4A 1KLNA 1BHLA 3JAKA 4G1QA 4FJ9A 2BTQA 1SA0B 3RR8A 5EYPB 1SL0A 4M3XA 3LDSA 1Z25A 3NCIA 2OPPA 2BDPA 1XQ8A 2IS3A 3L2UA 1T5EA 1T03A 3SQ4A 1QS4A 4ZOLA 3NHGA 3AVHA 2P5GA 3DLBA 4DTJA 3VQXA 4CJKA 1FK9A 2D0AA 3VN5A 4O2AA 1C0MA 3THOA 2G8HA 3BHPA 4YHHB 2PYLA 4FFBB 4OPKA 5KX5B 4EZ6A 3AA5X 1C1AA 3V9ZA 2KTQA 4K8XA 4KTWA 3NGYA 2RPIA 1QQCA 1ASVA 1K6YA 4X1KA 4ZHQA 1SKVA 4IHJB 4UCOA 3D0PA 3SCXA 4RW7A 2F4VB 3L8BA 3VQCA 4YJ3B 3F9KA 2HNDA 4AHSA 5CA0A 2VWKA 3V1RA 3SQ1A 1I39A 1RSOA 1HYSA 1KMIZ 3KKSA 4C8LA 1EKEA 4X1IB 3MAQA 4J2BA 4X1YB 1J9AA 3UT5B 3HM9A 4CJ5A 3V4IA 3HKEB 1A5VA 4ZOLB 4H4MA 2G8VA 3DSQA 4JI2B 5EIBD 3JASB 2XY7A 1CZBA 5KRSA 4LR3A 1N5YA 1TAUA 2UUCB 5KRTA 4NCBA 1VSFA 3RFRA 2VG6A 3L2QA 2OZMA 1RCHA 4YFUA 3L2RA 1Q3EA 4CIGA 4FJMA 4FW2A 3ZSOA 1KTQA 1XI1A 3OYGA 1VSKA 5JCOC 4UQGA 5J2TA 2RJZA 3HPOA 1TVKB 4ZTFA 1ZAUA 4FZZA 2PUSA 2A1SA 4E7IA 2E4LA 3O3FA 5C25A 4HBNA 4BWJA 3IRXA 4DSFA 3PX4A 1DLOA 4CFCA 1I3AA 3HKDA 3JARB 1IKVA 1J5OA 1QTMA 2HMIA 3DRSA 3QEWA 3JATA 3BA8A 4X64B 3PN1A 3RYCA 4AH9A 3SJJA 5IJ9A 3VQYA 4JI4B 4O4HA 3ZSXA 4DG1A 3AVJA 4CJQA 3HP9A 1B92A 5DMRA 3AO2A 5FROA 4CEOA 4CGJA 1SQGA 2RF2A 4FLTA 5LOVA 3TAPA 1TK8A 4Z0UA 3N2KB 2ATQA 1GOAA 4ID5A 3KK3A 5IJ0B 3E22A 2X6SA 2P22C 4H8KA 4DR1B 2G8UA 4B9MA 4W5OA 3ZT1A 1G15A 3NAEA 4I9QA 1BIZA 3HK2A 4RW6A 1WAJA 1CLQA 3LALA 4B9VA 1NKBA 4CH5A 3RYCB 3H08A 3AVMA 3B2EE 1HYVA 2Q7HA 4DTRA 4DTMA 1Q43A 4O4HB 4M41A 4FLXA 3SUNA 5JJEB 4CJPA 1S1TA 3ZCMA 5LOVB 4PY5A 3PV8A 4X65B 1N32B 4KTQA 3EYZA 2OPQA 2JGUA 2OYQA 3E22B 2HVIA 3HO1A 4CGFA 2PZSA 4N41A 2KZZA 1QSSA 1BCOA 3QIOA 5J2MA 3IS9A 2DFEA 2WONA 3ZSQA 1IBMB 2EHGA 3TAMA 5JS1A 3ZEDA 4TQFA 3RYFB 4DR7B 4KAZA 3P1GA 1IKXA 4DS4A 4BDYA 1WLJA 1IO2A 4AHVA 3K59A 4KHWA 3ZSWA 4FJXA 4N76A 1M5IA 4WE1A 1T7PA 3OS0A 1KU9A 4LF6B 2F96A 4DQRA 3G10A 2F8TA 4CJLA 2VG5A 4FJ7A 4LD0A 3LP1A 5I42A 4DU1A 4NCGA 4LFCB 2F93B 4JS5A 4F6RA 4KHYA 4E1MA 1NK4A 1JLQA 1ZYQA 3HKCA 3NF6A 3VQAA 3WNGA 2UXCB 3DRPA 4DLGA 2JVDA 1RBUA 4OPJA 2IM9A 5KGWA 3TARA 3TANA 4LH4A 4DSLA 3MEDA 3RMDA 1YVUA 3NE6A 3LP0A 4I4TA 4B3RB 1MU2A 4TSXA 3HVTA 3WB1A 2GUIA 4B8CA 4O4IB 4F2RA 1GOCA 1S1XA 2A1RA 4CFBA 2YNIA 3OYIA 3RTVA 4Z4CA 1S6PA 2ZE2A 1SKWA 4RW8A 4D7TA 3HXMA 3BDPA 3CFRA 2EX3A 1SKSA 1EETA 1KVCA 4JI0B 2KW4A 2IAJA 3PO4A 1W0HA 1KVAA 3HJFA 3MXJA 2HEPA 3KTQA 2KFNA 1LWFA 4LFAB 5GONA 5C8YA 4AILC 3T1YB 2Q7EA 4Z4IA 1RDAA 4PWDA 5JJJB 4O2BB 3THVA 4K0KB 5K1PA 5HP1A 3VQPA 1RBVA 5HROA 3VQ9A 4DTXA 1Q9XA 1C1BA 4CHQA 4LF7B 4ZIBA 1IKYA 1WAFA 3ZS8C 1ZBFA 1VSJA 4JV5B 4LSNA 2YKMA 4I55A 3NH1A 4PUOA 3SUOA 4X66B 4F3TA 2OPRA 4CS2A 4Q5VA 2QM4A 3RGBA 2YV0X 4CF8A 3U6FA 1XMQB 4PI2A 1TK0A 4KRFA 3HL8A 4TV8B 5GONB 2B4JA 1LAVA 4CJWA 4CF0A 4CEQA 4I2PA 4PA1A 4JI3B 1TK5A 5DK5A 4DK1A 4CGIA 4EP5A 1NK9A 4YY3B 1L3VA 2HHUA 4UCUA 4JI1B 3OYBA 4NYNA 1JLBA 3ZSYA 2PY5A 3TR8A 4DSKA 4C8MA 3K5OA 4CJEA 1TKZA 4DR3B 3HKBA 1U47A 3CHXA 1NK0A 2D0CA 3ZT2A 4TUYB 4DFJA 2F95B 2RQ6A 4RG8A 2P51A 1JMKC 4O0IA 4GMJB 3VQ6A 3JSLA 3K5LA 4CEEA 1KSPA 4DV3B 2OWOA 4AHTA 4DFKA 2BANA 1X9MA 4FZXC 4E7HA 3VQ8A 3KIOA 3WB2A 4FJGA 4W5TA 4BWAA 4OVLA 4PI0A 2VQEB 4C8OA 2FBTA 4Z4FA 1HW7A 4ID1A 3SGIA 3AVCA 4M42A 3QLHA 2PTMA 1O9GA 4CF2A 1BI4A 3NGZA 4JI7B 3BA9A 4KO0A 4LH5A 3JSNA 3HKBB 4E7LA 1WSJA 1TAQA 3QEXA 1XC9A 4UCSA 3OYMA 4B08A 4CJRA 5SWMA 1T8EA 3LAKA 2F1MA 4DS5A 3DLEA 3P5JA 3UQ8A 5C42A 1HQEA 1KFDA 2Z1HA 2ZD1A 4E7JA 1NJXA 4HHTA 1CZ9A 3S3MA 5LYJB 5D5QA 3HPHA 1HNWB 4LF8B 3ZSVA 1XHZA 4IBNA 4DQPA 3CG7A 3VQWA 1C0TA 3CSXA 1QSLA 4CESA 1WNSA 3JAKB 5KI6A 1RT1A 2BTQB 3SJBC 1WN7A 3UIQA 4CS3A 2RKIA 1BI4B 1KVBA 1NK5A 1VF7A 3ISNC 1FKOA 1HR0B 3DLKA 3BAAA 3AA3A 3OYHA 4FJHA 4CC5A 1X4TA 1JXEA 1CXQA 4ZI7A 3L2VA 3HP6A 1JLCA 4CGHA 3KK2A 1L8DA 2Z1JA 4CIEA 5FRMA 1VK0A 1SL2A 4O2AB 2YI9A 3T1AA 3KLGA 1D5AA 1SQFA 4FJJA 2UUBB 1UA0A 4DV5B 3V9XA 4IDKA 1IG9A 1ZBHA 4X1KB 4DR2B 4ZHQB 2XY5A 4TQDA 2ZCEA 4BDPA 2R7YA 4IFVA 3WNFA 3V1OA 1BIUA 4CH4A 4HVJA 4UCVA 5CA0B 1TKXA 3AO3A 4E1NA 2Q0AA 1RILA 2ZINA 3ZT4A 1KFSA 1TKDA 2XRIA 1BQMA 3N2GA 1WPBA 3DLGA 4JI5B 1REVA 2YHAA 1I7FA 2PGGA 3TAEA 4M45A 5CY4A 3NH0A 5CYQA 4B9LA 3U0ZA 3BABA 4DV2B 1VSLA 2BGGA 1S1VA 1RBTA 3RWUA 3JALA 1RBRA 1RTDA 4UFZA 3QG5A 4NVPA 4CF9A 4KI4A 1F21A 4O4GA 1D8YA 4DSJA 3SV3A 5E41A 1RT3A 3QEVA 3ICXA 2OPSA 1DTTA 2HNZA 3L2WA 5J2TB 4BWMA 3NGIA 2Y1JA</