2PYLA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC(2DA))-3'
total genus 161
structure length 571
sequence length 571
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pylA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pylA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pylA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pylA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pylA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pylA06
3HPOA 1J5OA 2KZZA 4RW4A 1U4BA 4B9MA 2YKMA 4CEDA 3HYFA 3NGYA 3IAYA 4R5PA 3DLGA 3QEVA 1VSHA 5C25A 1W0HA 4KAZA 4N47A 1JLEA 1RT1A 4KV8A 4FM0A 1SL1A 4KTQA 4J2EA 1IKVA 4Z4FA 1GOAA 1BIZA 1L3UA 1BCOA 2XRIA 4W5OA 4I9QA 1IG9A 4EZ9A 1CLQA 1SKSA 3K59A 4FZXC 3KJVA 4B9NA 4DQPA 2KFNA 4PY5A 4CJ5A 4CIGA 4F2RA 2YV0X 4GMJB 4AILC 3ZSZA 4ZTFA 4O44A 4FJNA 1JXBA 4AHRA 1QSLA 2XY8A 1RT6A 1X9MA 1RDDA 1IKXA 4N56A 2F8TA 1HNVA 1HMVA 1KVBA 4OPJA 1NK4A 4DF8A 3O3FA 3EZ5A 4FJ7A 4DTXA 1QQCA 2VG6A 3AVLA 2DFFA 4E1MA 3LPTA 4BE2A 3OYIA 3G0ZA 3V1RA 2HVHA 4F8RA 1J53A 1HQEA 4Z0UA 2HHVA 3NE6A 3P1GA 3FFIA 3NF7A 4PWDA 1LV5A 3MAQA 4CJWA 1SL0A 3LZIA 1Q8IA 3HK2A 1ASVA 1QE1A 4CEAA 4ELVA 2G8FA 5C42A 4PQUA 1LAWA 4OKKA 3U3GA 4NCBA 3LALA 3HL8A 3HVRA 4O4GA 4K8ZA 3LANA 3LPUA 1RT3A 3KLIA 3ZSXA 4CESA 2DY4A 2RN2A 5I3UA 3IG1A 3KK3A 3OS0A 1EXQA 2ZE2A 3C94A 3KLHA 3NHGA 2G8HA 2IDOA 1HPZA 4DTJA 3SQ1A 4AHUA 3ULDA 1TGOA 3OY9A 4F2SA 4HUEA 1JKHA 3SUPA 3AVCA 1L3SA 1NJXA 1U45A 4CK2A 3H08A 2FBYA 5FRMA 2E6MA 4FZZA 4DU1A 4HCBA 2YKNA 3ZSYA 2G8UA 4CGHA 4CJUA 4BE0A 2NUBA 1MU2A 3HXMA 2YNFA 3VQPA 1LW0A 3OYEA 1K6YA 4E7LA 2YNIA 1JL2A 4NCGA 2B4JA 1JXEA 2FC0A 1C1AA 4DQIA 1L5UA 4ICLA 4IFVA 1X9WA 1KSPA 3D45A 3VQ7A 4DWIA 3T3FA 4FM1A 4DLEA 3AVIA 5C24A 4ID5A 4OLAA 3HP6A 4I7FA 3RMDA 3I0SA 1TL1A 3WNEA 3QEWA 2Y1JA 3ZT2A 1ZBFA 4CF8A 3PO4A 1VSKA 2B6AA 4KHSA 3DOLA 4EZ6A 1EKEA 4Z4EA 4FK0A 4M3TA 4L8RB 3VQCA 4FW1A 3HPHA 1S6PA 1RDAA 4FLVA 2W42A 1B9FA 3ZT0A 1UA0A 1D5AA 2E6LA 3VQBA 4CK3A 3CFRA 1Z26A 2R7FA 1C6VA 2YNHA 2A1SA 4PA1A 2HHTA 1YVUA 4C8NA 2FBXA 2QK9A 1CZBA 4FYDA 3OS2A 1NJZA 1QHTA 3AV9A 3PUFA 3K2PA 4H4MA 4DU4A 1S1UA 3LP1A 1BHLA 3KK2A 2G8IA 1TV6A 4QOZB 4Q5VA 3A2FA 4Q0BA 3NF8A 3K57A 1C1BA 1RTDA 3ISNC 3KIOA 3BGRA 4AHCA 3OYJA 3VQ8A 1B9DA 3PV8A 1JLGA 4M3RA 3C6UA 3WNFA 2P5GA 4KHNA 4CIFA 2XY6A 2PW9A 1YT3A 4E1NA 1G15A 4E0DA 1S6QA 2FBVA 4W5TA 1NK0A 2WOMA 1RTIA 4CGFA 2Y1IA 3DRPA 4NYNA 3OYLA 4CEEA 1WN7A 1RTJA 4CCHA 4FJ5A 2OZMA 3IS9A 4CF9A 4B9SA 1FXXA 4CHQA 1WSIA 4CJKA 4JRQA 1S1TA 1EX4A 1TK8A 2AJQA 3I0RA 1CXUA 3DMJA 3ZCMA 1HQUA 4KB0A 5HRNA 2YHAA 4CJVA 4NYFA 4DSFA 4CJRA 4CF2A 4Z4HA 3RWUA 2ZD1A 1NKCA 3DLHA 1VSMA 1KRPA 1U47A 4DMNA 3OYFA 1DTQA 2EHGA 1KLMA 3VQ4A 3V6DA 4CGGA 4CHYA 4LSNA 1JLCA 4H8KA 2R7YA 3HM9A 1RTHA 4IDKA 2XY7A 2HHWA 3QLHA 5HRRA 1NK6A 1RT7A 1LAVA 2FBTA 4BE1A 2BDPA 4M3ZA 1TVRA 3DLRA 4C8MA 3V81A 4FJ9A 4W5NA 4E7KA 3TAPA 2IS3A 3NBPA 4CHPA 4EP4A 1U49A 4RW8A 4QAGA 3T19A 3QEPA 1GOCA 1SKRA 3O3GA 1JLBA 1BIUA 3P5JA 1TL3A 2E4LA 2HNYA 1BISA 3SUNA 2IC3A 2OPSA 3WNHA 5FROA 4CEBA 4CGIA 3SI6A 2Z1IA 5J2MA 4FJXA 3NH0A 3TAGA 4IG3A 4IG0A 4HUFA 2HHQA 1S1WA 4NCAA 3OYNA 3RR8A 4FJIA 4FXDA 2VWKA 4CE9A 3CFOA 3L2RA 4O0JA 4FLXA 3JYTA 2O4IA 1KFSA 5J2QA 4KHYA 3OYKA 3BDPA 1ITGA 2PZSA 1C0TA 3NH1A 4CGDA 2I5JA 5KGWA 3RMAA 4O0IA 4ELTA 3QEXA 2XO7A 1TKDA 4OLBA 4LY7A 4E19A 4CJLA 4BWMA 4YNQA 3LP3A 1TK5A 5FRNA 4RG8A 1KCFA 1VSIA 1RT5A 4I2PA 4KFBA 4B9TA 4CEFA 1IKYA 2HHUA 1IKWA 3TAQA 4DSEA 5KI6A 3V9SA 1T7PA 3VQDA 1WAFA 4CEZA 4HHTA 1TAUA 4DTSA 3V9WA 4DQSA 3MEEA 2OA8A 1BI4B 2LSNA 4PUOA 4QCLA 2O4GA 1X1PA 4RW6A 4AHSA 1JLQA 4M3UA 1JL1A 1TKZA 5SZTA 3SQ2A 3LZJA 4DTNA 3PX0A 4CERA 3L8BA 2JLEA 4AHTA 2XY5A 4FK2A 2HMIA 1Q9YA 1VK0A 3ZSQA 4CGJA 3TARA 3MEDA 2OYQA 2VG7A 3VQAA 3SNNA 1RILA 3KD5E 3AO5A 1NK5A 1Q9XA 4CEQA 1LWCA 4DFPA 3AVHA 4Z4CA 1BQMA 1WLJA 3LAMA 1UWBA 3EYZA 4DLGA 3PX6A 4GW6A 1S9GA 3HJFA 1NOZA 2YHBA 4CJPA 5J1EA 4FVMA 3CM6A 4OJRA 4OGCA 4DU3A 2ETJA 3K5LA 4W5RA 3QNNA 1BCMA 3C95A 3DLKA 4DTRA 2KW4A 4M45A 1RT4A 3T1AA 4WE1A 3VA3A 3NFAA 2P5OA 4C8OA 2XHBA 4ZTJA 1I39A 2JGUA 4J2DA 1NJYA 3U6FA 4DTMA 1RNHA 1QSSA 1ASWA 1S1XA 1UOCA 5DMRA 3M8RA 1RT2A 3S3MA 4C8LA 4DSIA 2DTUA 4CJEA 4B9LA 3VQEA 2Q3SA 5CY4A 4KB1A 2VG5A 4B9VA 2IOCA 4CFAA 1VSDA 3ALYA 4LD0A 4TSXA 3ZT4A 4I9LA 3SQ0A 1WAJA 1C1CA 4CJ3A 1HYSA 3PY8A 3QESA 1YTUA 3HT3A 4CJ4A 1U48A 4F3TA 3CFPA 1RDBA 4RW9A 4N5SA 5KRSA 4OVLA 1FK9A 3PX4A 4IFYA 4CFDA 3K5OA 1GOBA 3DRSA 3OYHA 3V9XA 2Z1JA 3MECA 3QERA 5J2NA 3AVNA 4IKFA 2OZSA 4B8AB 4FLTA 3ZSVA 4DS4A 2D5RA 4DFKA 1N5YA 3I8DA 3KLGA 2BANA 3M8QA 1EP4A 3AA4A 2DFHA 2YNGA 3KKSA 4DTUA 4DFJA 1KLNA 3RRGA 1EETA 3NCIA 3C6TA 1T8EA 1TAQA 1QS4A 1WSJA 1RBTA 2KTQA 3ITHA 4CHZA 4KPYA 3FI7A 3DM2A 4OKEA 3RTVA 4CJSA 3B6PA 1QSYA 4DQRA 4K8XA 1A5WA 1RBSA 3V1OA 3TAFA 3CM5A 2ZQBA 3V9UA 2P51A 4KI6A 3MXJA 4KI4A 1R0AA 3L3UA 1B92A 3OYMA 3OJSA 1A5VA 3AVFA 4W5QA 3SYZA 4DFMA 1REVA 1VSEA 1IH7A 4ID1A 5JS2A 5HRPA 3OYBA 4BACA 3SPZA 3F9KA 3QIPA 4FW2A 3OJUA 1VRUA 4IBNA 1A5XA 3ZSWA 2QKKA 3AO4A 3E01A 1I3AA 4FJHA 4Z4GA 4JS5A 1BGXT 3AVGA 4DQQA 1FKPA 4M42A 1S9EA 3VQQA 4BDPA 1LW2A 1LWFA 4KTZA 4E7HA 4CJQA 3D0PA 3SUOA 2IGIA 4CFCA 3SCXA 2F8SA 4BDZA 3TWHA 3QEIA 3HSTB 1IO2A 2Z1HA 1TK0A 4M3XA 3NAEA 4CF0A 3HPGA 3OYAA 4M41A 5HLFA 3LAKA 3AA5X 1XHXA 4I2QA 4B8CA 4DTPA 3OYGA 5JS1A 1WNSA 1WSEA 2X6NA 2HNZA 2RF2A 3QINA 4RW7A 2G8VA 2GV9A 4J2BA 4Y1CA 1KVCA 4E89A 2HB5A 1F21A 2WONA 3NF6A 4H4OA 1QTMA 3AVAA 3AVMA 1ZYQA 4B08A 5HP1A 3CYMA 3TANA 3LDSA 2KFZA 2IAJA 3AA2A 1D9FA 1X9SA 1RCHA 3G10A 3SPYA 4AHVA 1XHZA 1XWLA 3HP9A 4GVMA 2X6SA 2QKBA 4M3YA 3OVNA 1J9AA 4FLZA 3OYDA 3L2WA 5CZ2A 3SJJA 3KKRA 2HNDA 3F73A 1NK7A 4KREA 4DSKA 3HVTA 2P1JA 3L2QA 1NKEA 3V9ZA 1Y97A 3SV4A 3AVJA 2HHSA 4CK1A 3V4IA 5CZ1A 1Z25A 2OPQA 4N76A 4MQ3A 1VRTA 4Y1DA 3OS1A 4F4KA 5CYQA 4OKJA 4DG1A 1VSLA 3MXMA 2ATQA 3KTQA 2OPPA 1D9DA 4CF1A 3ZSOA 5DK5A 2G8WA 4N41A 3LWMA 4HTUA 1XC9A 4HVJA 1WSGA 3EY1A 3S3OA 3AO2A 2B5JA 4O55A 1UAXA 4JRPA 2QXFA 3QIOA 1O1WA 5K14A 4ZHRA 1BQNA 1JLFA 3CG7A 4CJFA 4OPKA 3O3HA 3MXIA 3S9HA 5HRSA 1ZBHA 2RKIA 3TAMA 4LH4A 3NGZA 4KHUA 3P83D 1JLAA 3QO9A 3AVKA 4CIEA 4FJLA 1NK9A 1KVAA 3KK1A 3OYCA 4G1QA 4M3WA 3THVA 4CEOA 3B6OA 4HCCA 4C8KA 3DLBA 4FJMA 3ZT1A 4FCYA 1SUQA 4FJKA 3M8SA 1ZBLA 5T7BA 4BWJA 1VSFA 4FM2A 1L3TA 1TKTA 1C0MA 2EX3A 2ITGA 4E7JA 1HJRA 4FLWA 3RMBA 4BDYA 4CFBA 3U3YA 4O5BA 2A1RA 3NF9A 4KHWA 1T05A 4LSLA 3WNGA 3AO3A 1NOYA 3DRRA 4J2AA 2HVIA 5EU7A 1RDCA 2DFEA 3S3NA 3RR7A 3RMCA 3LWLA 3TI0A 4DF4A 3VQ6A 1XI1A 2D0CA 4CHNA 4DSJA 3V1QA 3IRXA 4AH9A 4F3OA 1NJWA 2VWJA 4FLUA 1RBRA 3M8PA 5HBMA 3KLEA 3VA0A 3TR8A 5KTQA 4EP5A 2G8KA 4DSLA 4B3OA 4E3SA 1FKOA 2GBZA 3DYAA 3MEGA 1T03A 4FJJA 2Z1GA 3ZSRA 1WSHA 3ASMA 5HROA 3K58A 1C0UA 4E7IA 1N6QA 3AVBA 1HRHA 3NH2A 2PYJA 3TABA 4MFBA 1HYVA 1D8YA 3QETA 4JS4A 4LH5A 1VSJA 3TAEA 1J54A 4DTOA 1RBUA 5KGXA 4FZYA 3LP2A 1SL2A 2HW3A 1UA1A 3L2VA 1ASUA 3VQ5A 1HYZA 1S1VA 2D0AA 1HNIA 4KKOA 3K5NA 5E41A 4B9UA 1DTTA 3LP0A 3L2UA 3CQ8A 3K5MA 3NGIA 1CZ9A 3VQ9A 2F96A 1WSFA 3SQ4A 4YFUA 1KFDA 1BI4A 3KLFA 1ZBUA 3L3VA 2PY5A 3O4NA 5FDLA 3SV3A 4KRFA 4OGEA 1RBVA 1KTQA 2X74A 3UIQA 1TKXA 3AA3A 3SZ2A 3SUQA 1NKBA 4CHOA 3O4QA 2OPRA 1W9HA 4KHQA 2D0BA 1L3VA 3DI6A 1NK8A 3JSMA 1BL3A 3ZT3A 2BE2A 4FJGA 1U04A 5CYMA 4UQGA 1LWEA 3RRHA 3NDKA 1SKWA 2X78A 3PO5A 2RPIA 5KRTA 4FLYA 4DS5A 2HHXA 1S5JA 4Z4IA 3HO1A 2KQ2A 4ELUA 4KO0A 3KD1E 4CJTA 3DLEA 4CECA 4HUGA 2BGGA 3DOKA 1YTAA 1DLOA 5J2PA 4JLHA 1CXQA 4KTWA 5D3GA 2KZMA 2PYLA 4XIUA 3QNOA 4FJ8A 2GUIA 3AO1A 3VN5A 1ZBIA 1SV5A 5I42A 4FK4A 5SWMA
chains in the Genus database with same CATH superfamily
2KZZA 4MTGA 4RW4A 1AJQA 1I7FA 4DV3K 4B9MA 4CEDA 1AR64 1R3JC 3HYFA 4JPRA 4CZJA 3SJHA 5L3DA 4JHDA 3SBTA 5GIOA 4B3TB 1RT1A 4Z4FA 4FM0A 2E75B 3H1VX 1P90A 4X65K 4TOIA 4J2EA 1IV0A 4GB34 1BCOA 2XRIA 3WB2A 3N2GA 1IG9A 1K5MD 2CTPA 1WLEA 2LGWA 4RQFA 3K59A 2DYRB 2WDVA 1K7DA 2IVPA 1KC8O 1EQYA 4PY5A 4CJ5A 2RHKA 4B1WB 4F2RA 4BRFA 2ADQB 2VYPA 2ZGZA 4FJNA 4DR6K 1QSLA 3VETA 1RT6A 3APOA 1IKXA 5EXWA 3AAQA 1YCIA 3ASNC 1VQLV 4DXWA 1HKGA 3P4QA 3CRRA 4JI8O 4KHPO 4A57A 4DTXA 2VG6A 2IJHA 3ETQA 3W3DA 3AVLA 3LPTA 1VBE4 3OYIA 3V1RA 1J53A 5C93A 2HLDG 1HQEA 3M5RA 3R9PA 3FFIA 3NE6A 3OW2M 2HHVA 4PWDA 3MAQA 3SJBC 2JK5C 2JVDA 4NVPA 5EIBC 1N32O 1Q8IA 4A5AA 3AG7A 2LO1A 1RMU4 3QTCA 3K3WA 1QE1A 5B1OA 4I50A 3JD4A 4BR6A 4E4EA 2ZE8A 2G8FA 3CCEN 1LAWA 5AQPA 3J7AU 2A5XA 2V7ZA 5ITZB 3D2EB 3T1HO 1Z5WA 4BRDA 2JS3A 3ZSXA 1RT3A 2FSKA 4B3MO 5LHIA 1OCRC 4DV4O 3VEYA 3K9AA 4X1IA 4D6TH 4GLXA 2YDEA 3KK3A 1N36K 1EXQA 3KLHA 1UJWB 3C94A 3NHGA 2G8HA 4PL7A 1NGBA 3M99B 4FFKA 3TSPA 3SYPA 3ULDA 3OY9A 1ZXOA 3T4DA 3K9JA 3UKUB 3CWBH 1OJHA 4NTYA 3WG7B 1L3SA 3SK3A 3GG4A 1U45A 1AI7A 4UCUA 1NM1A 3H08A 2FBYA 1VBA4 4LF6K 3DXRA 4K41A 4UVCA 4BY9C 3OGCC 1FYJA 4DV6K 4CGHA 2NUBA 4LF4B 4U7NA 5H9CA 4YSZA 2A0LA 4NCGA 2B4JA 1JXEA 2FC0A 2B1GA 5KX5A 4DK1A 4O4IA 2FSJA 4IFVA 3VQ7A 4YXWG 3KG2A 3Q7CA 4DWIA 4FM1A 1JPXA 3AGKA 5C24A 4BR4A 4DV2K 1Q9XA 1TL1A 1V55B 5EZYA 3QEWA 3ZT2A 1ZBFA 4IIJB 1PO24 4OX9B 1QR8A 1Z7S4 3H1IH 3O9OA 4M3TA 1GH6A 5M1QA 4FW1A 5BMVB 1NVPB 1S6PA 1GM8A 4FLVA 2W42A 1VQ4N 3E9PA 4LF4K 3ZYYX 3AE5A 4CZMA 3CC7V 4U3JA 2EILB 3T2MA 2YNHA 4JK8A 2XAJA 1KAZA 5FPRA 1YVUA 2FBXA 4JEPA 1Z05A 2O8DB 3PUFA 3K2PA 4BAYA 1JCFA 2EZOA 3LP1A 4ILGB 1GN6A 1J5EO 4BGAA 5J2TA 4JKFA 3NF8A 5CBHA 3K57A 1RTDA 3ISNC 1WB9A 3HKEB 4O8UA 2ZJQL 1NWKA 3VQ8A 2ZR3A 1RP3B 2E3CA 3WNFA 4KHNA 4U7OA 4B3SO 1MSDA 4LNUA 5E1AC 2PW9A 1YT3A 4CC5A 2H8PC 1NGHA 1XNQK 2P9LA 1TYQA 4DSIA 5C2DA 1S6QA 1NK0A 1HR0O 2V7YA 3P39A 5AQTA 4CEEA 1SQPH 2CTRA 3OTOB 1NBWA 3CCJN 5J2UA 2CGNA 4HTLA 3CCJV 5KMGB 1S1TA 4DR2K 2AJQA 3I0RA 1XMOO 3CYOA 2DQ0A 4AF1A 4CF2A 1YJ9V 4B3MK 4ZHQB 1JVMA 3F7VC 2WA3A 3JD2A 4DMNA 3V6DA 2QTSA 2WBNA 1HP8A 4CGGA 1AJNA 3M7MX 1DTOA 3HKEA 3JAMN 1V9PA 3HSCA 1GN2A 4JN4A 1Q82O 1RT7A 2FBTA 3SPJA 3R8EA 1XOUA 4FJ9A 2CH6A 4W5NA 2ZINA 1AB3A 2QWQA 4EP4A 3C90A 5EK0A 1NGCA 4ICGA 3T4ZA 4QAGA 2P22C 2QEXV 4GX1A 3O3GA 1OH8A 4GZRB 1WUAA 5LYJA 2KKWA 2D2CB 3SJCC 2HMPA 4PHTX 3U9ZA 5E84A 3TAGA 1J5EK 2HHQA 3BVOA 2R70A 4YOTA 3BCCH 1EZVH 5EYPA 3VBBA 3L2RA 4B1VA 3JYTA 1BA0A 4F9OA 4GKJK 1F23A 1ITGA 3NH1A 5KX5B 1H2MA 1N34O 2I5JA 4ELTA 1YI2V 4O0IA 4JI5K 4OLBA 2HHHK 1NS1A 4E19A 3LP3A 3H3OB 3CMEV 1VQON 3O9QA 4BVPA 1VSIA 4JI2O 1NGAA 4B9TA 2A06H 4WFBV 1NJIO 2LW1A 4B3RB 1YDXA 3N27A 4LFBB 3AEBA 3V9SA 5ITZA 1WAFA 5F0XA 4DTSA 3CCMV 5CMUA 4TUYA 3H45C 2ZJPL 4PDWD 4RW6A 4QS7A 3KZBA 2NRVA 3QFUA 1TKZA 4WQ5C 4CERA 2DOSA 3IC7A 3HB3B 3L8BA 3B8NA 4AHTA 4K0KK 4EFEA 3A5NC 1GO3F 2W6JG 1W0JG 2D0PA 4CGJA 4X1IB 2VG7A 3AG1C 5JQGB 3U4LA 4PV1B 1K4DC 4ZOLA 4H0VB 4BC5A 3K06A 1Q3EA 2RJZA 3BY6A 1LWCA 2GWKA 2I7NA 3AVHA 4Z4CA 1BQMA 4DR1K 1XNQO 5ADXA 5EOYA 1SZTA 1Z5VA 3RWRD 4EFBA 2RS34 1XBLA 5J1EA 4B3SK 3RYHA 3C0BA 4OJRA 3EVKA 3C7NA 4NTWA 2Q7EA 3WT0A 4W5RA 1WJZA 2XAGA 2PLV4 3H1JH 3VA3A 2RNBA 1Y4MA 1YZBA 4X20A 1YJNV 2CDYA 4A2AA 4C8OA 2JGUA 1PNKA 1Q5OA 4P30A 3RYCA 4TQFA 3CC4V 1H2SB 3M8RA 4I0XA 1ATRA 3S3MA 4B9LA 2Q3SA 4QE7A 2NRRA 2YXLA 3DSQA 4MO5A 1KAYA 4JKGB 1VEWA 4LD0A 1S72N 3JAKA 2HJFC 4HAMA 4C1NI 4W4LA 2WTUA 4I9LA 4B9QA 3SQ0A 5C15A 1YAGA 4WFAL 4JI4K 1YTUA 1VAZA 3CQYA 4ISEA 1NLVA 3UT5B 4N5SA 5KRSA 2KHOA 4MDBA 4YHHO 3PIOL 4A5BA 1GOBA 2UYTA 2GBOA 4IKFA 2D1KA 2P9SB 2B5UA 3MECA 5J2NA 2OZSA 3ZSVA 3AEIA 1VBC4 5B3SC 3I8DA 4X66B 2HHSA 1EP4A 3AA4A 2DFHA 4DFJA 1KLNA 1OOPD 5C2TA 3C6TA 5AQHA 1LUWA 1QS4A 4GKJB 2E74B 4CHZA 4YOWA 4X64B 2FSNA 3ZRWA 1J95A 4CJSA 4JAXA 4KX6A 4WFEA 5IYCO 4B3SB 5JMVA 3VF6A 4DQRA 1KKCA 2G38A 2F43G 4BIUA 1F7YA 1RBSA 1MNGA 3RGBA 2P51A 2IIRA 4KI4A 3RFRA 3FFKB 4DV3O 4CH4A 3OJSA 3AVFA 3SYZA 4DV7K 3O65A 1IH7A 5J2UB 1RUI4 3BZCA 4BACA 1VF7A 1AJPA 5FNVB 1Q7YW 3QIPA 1VRUA 2ILMA 1MWKA 3CPEA 4IBNA 2AHZA 3ZSWA 2ZM6K 1AR74 1XREA 4JS5A 3AVGA 1Q82W 4CH6A 1FKPA 4DUZK 4DQQA 3JD1A 1HNXK 3ABMB 2CTWA 4WFNL 2R9IA 2Q68A 4O2BA 1XNRK 1SQGA 4YIOA 4J11A 3JCUZ 1MZEA 1VBB4 1N8RO 3UKRA 3TU5A 1RSOA 4JI8B 4KHPB 1NA1D 1JR9A 1XEQA 5FLXO 3TWHA 1OCCB 3AEAA 1TK0A 4O4IB 1MWMA 4CF0A 2E1YA 4FWLA 3K04A 4M41A 3THYB 2RE2A 4I50B 3AA5X 4MVSA 4B8CA 1ZAUA 2DJVA 2WLNA 2X6NA 4CZGA 5IE9A 4J2BA 3D2EA 2EULA 3SPIA 4E89A 1F21A 3NF6A 3I56V 1YHQV 1QTMA 3ID8A 4UV9A 3IGAC 4ZOLB 5FL7G 2GX9A 5IJ9B 1YXQA 3FKSG 1ESVA 4EHTA 1HNZO 2LFRA 3I8BA 2VQFK 1RCHA 3G10A 1AI4A 3SPYA 2Z3YA 4AHVA 3CXCM 2QKBA 4TWKA 4M3YA 4DHYA 4DR5K 5CZ2A 3IFRA 4G28B 4KREA 1KQSM 4DV7B 4DSKA 1COV4 3HVTA 3QBWA 3MN9A 1SF9A 4DV1O 2A6AA 1YEWA 3M8AA 3B2EE 1O9HA 1HNXB 1TUUA 1MG1A 4YDUC 2BSKB 3ZMTA 2Q97A 4B1XB 2ZE5A 1VQMN 1VRTA 4GUNA 4ILHA 4J10A 5CYQA 1M90W 3JD74 4DG1A 2OPPA 1D9DA 4LFCB 4LFAB 4CF1A 2BTFA 2G8WA 4KH6A 5DK5A 3J7ZO 1Q81O 1EO1A 2QWNA 5EBLC 4J8FA 3S3WA 3CMAV 3JATB 3Q4HA 3AO2A 4JRPA 5MLCQ 1O1WA 4ZHRA 1ZBHA 1JCEA 1Q43A 3AK1A 5CA0B 5BR8O 4X62B 4NB4A 3RN4A 2RKIA 3SAGA 4LH4A 4CH3A 3SFDA 4CC6A 1JLAA 5C2FA 1XQ8A 2YI8A 3B77A 1NK9A 3AECA 3AK2A 5C8YA 3O08A 4G1QA 4I9WA 2IJIA 3UM7A 4C8KA 3I5DA 4JTAB 3K79A 4NO7A 3CEIA 4CZZA 2W40A 3AARA 1VQOV 3THYA 4CZEA 2K1EA 5M1FA 1TKTA 1C0MA 1HJRA 4CFBA 3TETA 2UXBK 3CJHB 1VQ9V 1Y66A 1HWYA 4O4JA 2PI5A 4LSLA 1DF4A 1NOYA 2HVIA 2WA4A 2UXCB 3LDEA 4DYLA 4EEQA 3LWLA 1YF2A 2NNUA 2AZ2A 5AQKA 1XI1A 3VQ6A 1R59O 3AG2B 3RYFB 1GLJO 3J7YP 1N33B 3CI5A 3K0SA 4DSJA 4IOAL 1NJWA 3AE2A 4FLUA 5HBMA 5GTIZ 1SS6A 1G4YB 4B3OA 4E3SA 3AEFA 1FKOA 4PKHA 2GBZA 2O8CB 2CH7A 2X7RB 5CB4A 1RFYA 1FJGB 4BG8A 2JWKA 1GTOA 3OTOO 2Z1GA 4C7UA 5CBGA 4JKBA 3J81N 3GE1A 4PA3A 2V4DA 2QM8A 4E7IA 2FXUA 1N33K 4H5WA 4MFBA 3OD4A 4JS4A 1HNZB 3CE2A 2VQFB 1RBUA 4XH1A 1SL2A 3JS6A 1UA1A 1SETA 2OTLV 4ISGA 1US6A 1S1VA 2D0AA 1HNIA 3FB5C 5AQMA 1XNRB 2ZR2A 3HKDB 1S22A 3LP0A 2JGDB 3K5MA 2E20A 4UVBA 4UCSA 5KAIZ 1PPJH 1S3XA 4X65B 1ZL8A 1P8ZA 3M1FA 1GAXA 1WPBA 1OVYA 3O4NA 1VQNN 1C0FA 1KTQA 3WU2Z 3ZMUA 1J6ZA 1TKXA 3SZ2A 3UIQA 1VRH4 4K25A 4PKIA 1QLEC 5GONA 1N34B 1IVSA 3CC2N 1BL3A 4A59A 1RDUA 4LF9B 1U04A 1U2VA 1RUJ4 1LOTB 4LFAO 3ZHRA 4LFCO 1LWEA 3L73H 2F4VO 2RPIA 5JVHL 1MZFA 1EN4A 1SQQH 2HHXA 4O8KA 4Z4IA 3SPGA 2FKXA 5JJEB 1CPYA 1QVFM 3DXRB 3WB0A 2QWPA 4E1JA 3VQXA 2ADPA 2X6CA 1NGFA 4KO0A 3O1WA 4HYOA 4CECA 2LFSA 5BPMA 3A8TA 3AE3A 4BVOA 1OCRB 4LWSB 5D3GA 4LF8K 2AP1A 2YCHA 2O8DA 2GUIA 4F6RA 1GKFA 4JKGA 2KQXA 1YSCA 1ZBIA 5CA1A 5I42A 3BDPA 3O8MA 5ELZA 2IVOA 3A0HZ 1GM7A 3P4PA 3WQTA 1QLEB 1AILA 1KQSU 2HF3A 5C25A 4KAZA 2YC0A 1SESA 4ZBMA 1D4XA 5HFMA 1MA9B 2N04A 1M5IA 5KHHA 1GOAA 2P9NA 1X3NA 5F2RA 2CGKA 1L3UA 5C3JA 4EZ9A 4H37A 5EZYB 1CLQA 2UU9B 4DV5O 1D4M4 4FZXC 4JI1O 3W0LA 2IJKA 4DV4B 4B9NA 4CW7B 3VGMA 3EXAA 2QDOA 4AI8A 2O57A 2JDIG 4QE9A 4DR1O 3DTUB 2H3GX 4O44A 3ZSZA 1QVGM 2XY8A 5JICA 1K5SA 4RHV4 1SC5B 3R66A 3EEQA 2GEMA 1FD9A 3DLLL 1FXHA 2QWLA 1KVBA 2KG7A 4OPJA 3RYFA 3EZ5A 1HDJA 3I56N 3T7ZA 3OAAG 2DFFA 4CS2A 5EYPB 3G0ZA 3G6EN 2C2AA 3H9VA 2O8EB 2ZCEA 2AA4A 2FF6A 5C10A 3APQA 4Y0WA 1TUYA 1KECA 4MW8A 1ASVA 3HK2A 1RUF4 3SJQC 2UXBB 3U10A 4JK7A 5C42A 4Q6GA 1SS3A 4OKKA 4LF6B 3U3GA 3LALA 5IT9O 3CCVN 4YY3B 3HL8A 3VRBA 5AZIA 3ULEB 4O4GA 1P4RA 4K8ZA 2FTKA 2J4RA 3LANA 1BZKA 3KLIA 4CESA 1AVMA 1RM1C 2RN2A 4OPAA 4IHJB 3MN7A 3QO5A 3EO3A 4GKJO 4YOUA 3SAFA 5BXZA 1VQMV 5AQIA 3CXHF 1IBLB 1NGIA 2VQEK 3AEEA 3IMXA 3SQ1A 5CB4B 1TGOA 2UXDO 1N4CA 3VERA 4F2SA 1JCGA 5BMVA 5LJVA 1HNZK 3AVCA 2O8FA 2HOEA 1M9NA 1XC3A 4C1NK 5K1XA 1GK9A 4UCVA 3C6AA 2B76A 1JMKC 4HCBA 3LDCA 4JI4O 2G8UA 3AE6A 2HBLA 3J8F4 4PA6A 3OYEA 4E7LA 1K6YA 1U2VB 5B1AB 4DR7O 2YNIA 4UY8O 2KLAA 2W6IG 1C1AA 3CIPA 2E5LB 1L5UA 1X9WA 4LF5K 2CK3G 1KSPA 1T44A 2QWRB 4ASUG 2LP7A 4WFFA 4H5VA 4ID5A 4MLEA 3HP6A 3RMDA 3W7XA 2P6JA 4JI0K 4KHSA 3C3TA 4Z4EA 2F66C 1ILYA 4Q4Y4 2Q0AA 3I55V 1RDAA 2YHWA 3H01A 1UA0A 5LMNB 3OT7A 5BN8A 5LJWA 2E6LA 4DUZO 1NGJA 3VQBA 1Z26A 4BRHA 4BRAA 2NRWA 4U7BA 4DR2O 4DR7B 4PA1A 1HR0B 4C8NA 4KBOA 3AV9A 4H4MA 3ABLC 1BUPA 4DU4A 3KK2A 1M56C 3A8YA 4OX9K 4LF5O 4FWKA 4H03B 2ZXWC 3A2FA 4JI6B 2YEVB 3R65A 2XAQA 3DC5A 3SBGA 2HWC4 3KIOA 3BGRA 4AHCA 1B9DA 2W6LA 5IDJA 3C6UA 4JKHA 2P5GA 3VPZA 2YXYA 4CBXA 1J5EB 4DV0O 1IBKB 4BRCA 1VQ5V 3TGUH 1G15A 4N21A 4IOCL 3D3IA 4JD2A 2WOMA 4J9ZB 1PP9H 2Y1IA 3DRPA 4WCEL 5A2QN 4FJ5A 2ASPA 4CCHA 3HR0A 3WFVA 3IS9A 2OZMA 1R6TA 4FMTA 5KQ8A 4JI2K 4OXSA 1EX4A 1XL6A 1XDCA 2GUPA 4JKCA 1ZTEA 1E4GT 2YHAA 5HRNA 1IBKK 1CZAN 1IZ3A 1QLNA 3D8CA 4GCZA 4UXNA 3SGIA 1DTQA 2EHGA 4U67L 2R7YA 3OR7C 5JVDA 3O4WA 4IDKA 5GAHP 1SKVA 2HHWA 3MDSA 2HSTA 1JFFB 4M3ZA 3VGKA 3OUFA 4E7KA 1OH5A 3NBPA 3ABUA 4MTFA 4RW8A 1I5XA 1H2GA 4UB8Z 1NCQD 1HKCA 2I7PA 3TTFA 3GWOA 1BIUA 4DV6O 1Y64A 4CD1A 4IFEA 3SUNA 3SYOA 3D2FB 4FOEA 1VQ9N 1QNMA 2N74A 2Z1IA 5J2MA 5AQSA 3NH0A 4H44B 4HUFA 3JSNA 1S1WA 1ZLZA 1YQ3A 2ZNJA 4FXDA 3OYNA 4FJIA 1W7AA 1N32B 4IIJA 2VWKA 5KHKA 2P9KB 4IEEA 4K0KO 4O0JA 3A0IX 4FLXA 1KFSA 2ODMA 5B3SB 5J2QA 4QGPA 3JXUA 4Q20A 5KGWA 2OIEA 4EB6A 3QEXA 2XO7A 2NR5A 4BWMA 4CJLA 2R9AA 3OUSA 3VQWA 4YNQA 5GONB 1IDSA 4RG8A 1TUEB 3K0GA 1RT5A 5IT9N 2YHYA 2ZWHA 3ZRWB 4CZHA 3MMVA 1Y76B 2XAHA 1HUXA 3VQDA 4HHTA 1K4CC 3S3XA 1ZC6A 1M90O 1TAUA 3MEEA 2H89A 3E89A 2LSNA 3JCZA 5LMUO 4YTPA 1X1PA 1XMQB 1MABG 4AHSA 5A2QO 5AJ3K 5SZTA 4TV8B 4MVRA 2IBZH 3G25A 3S41A 5LP6B 2HBKA 4R7CA 2DE0X 3B8AX 3FGUA 3G4SN 4FK2A 2MW2B 2NLXA 3SNNA 3KD5E 2EIMB 3H1QA 1RILA 3FB6C 4CEQA 3ETDA 3WEEA 1RUG4 4BC2A 2WLLA 1P84F 3JASA 3LAMA 1DT9A 3FZLA 1EN5A 3CRMA 4JI7B 1S9GA 4DLGA 3PX6A 2UUCO 4LC1A 2YHBA 4OGCA 2ZXWB 3CM6A 5AQQA 2OTJN 2AXTZ 2KW4A 3U0ZA 3AG1B 1NMDA 5LMUK 3NFAA 2P5OA 1KAXA 4ZTJA 1W2BM 1QR9A 1I39A 5CE3A 1EV14 1W59A 1RNHA 1QSSA 1Y67A 3THWA 4C8LA 3ZBHA 3ENHA 3VQEA 1FJGK 3IFXA 1FAFA 1WA8A 1OZ0A 4F4LA 2B1IA 2UUCB 1VSDA 3ALYA 4TSXA 1IG8A 1HYSA 4FZ1A 3PY8A 4F3TA 3HT3A 1U48A 3JARB 1R3KC 3CFPA 3LDDA 1KBHA 4YSYA 1XUQA 4OVLA 3PX4A 4IFYA 3V9XA 1HR0K 3GB7C 2Z1JA 3AVNA 1Q86O 3RVYA 1N32K 3VOVA 1N5YA 1R3IC 1IXBA 2BANA 4FFBA 3M8QA 1GRJA 2CUGA 2KSDA 5JVGL 3RRGA 4O4LA 4AM7A 1T8EA 1TAQA 1NH2D 3E8BA 3ITHA 2GUZA 3W7UA 4KPYA 3FI7A 5D5PA 3K0DA 1JJOA 2Q7HA 2FF3B 4KXRA 4A61A 3O6WA 1QSYA 3ZX0A 4X66O 2WDRA 3V1OA 1RHI4 3CM5A 3V9UA 4FWPA 3T1HK 3P32A 2HWB4 4TV9B 3VEZA 1ZL8B 2E5LK 1REVA 1VSEA 5HRPA 2H94A 5JS2A 3SPZA 4FW2A 4IEIA 1LR1A 1A5XA 3TTDA 2QKKA 3AO4A 4O2AB 4FJHA 2IM9A 1BGXT 4I7ZB 1H1VA 1QCEA 2ZF5O 4WYBA 1LW2A 4E7HA 4CJQA 3UKUA 3SUOA 2IGIA 1VQ8V 3DWLA 4CS4A 1H2KA 3ABTA 4XDLA 4XBFA 1X59A 5CA3A 3SLCA 4BDZA 2L35A 2WLJA 3HSTB 1IO2A 3IKMA 3VEVA 4WBNA 3NAEA 5BR8K 4X89A 3HPGA 3OYAA 4YTMA 4WQ4C 3JD0A 1D5NA 3P4SA 3THXA 3CJ1A 1NENA 2OWOA 3VF4A 4DTPA 3OYGA 1WOQA 3C7NB 1WNSA 1FFXB 3OMNB 1NI8A 4NR1A 4RW7A 2G8VA 3LDLA 2GV9A 1JFFA 1RUC4 2CGLA 5IJ0B 4Y1CA 2HB5A 4D7TA 4H4OA 4DV1B 4YY3K 1ZYQA 3F7YC 1BSMA 3CCUV 2HJDA 5HP1A 4O5FA 5AZJB 4PDVA 3TANA 2JJ2G 3AA2A 1QQMA 4I0XB 3BRCA 1RUD4 1NT2B 1G99A 4H0TB 3ATUA 1XHZA 1XWLA 1MQTD 3TXQA 4X64K 5AR0A 4YSXA 4FLZA 4PELA 3OYDA 3RBZA 5L3EA 3O9RA 2V51B 3F73A 5KPTA 1NK7A 4JAUA 4A5UB 4YJ2A 1OH6A 4U3FH 2Y48A 4MVMA 1IBMK 1S5LZ 2UUBO 3SV4A 3T1CA 1ZX3A 2XAFA 3B4SA 3SAHA 4CK1A 2XNDG 1V54B 4X20B 3NVKA 2GTDA 4TQDA 1QVGU 2OPQA 4MVUA 2VCPA 3T1YB 4JI1B 3J8AA 1YIJN 4LNUB 3ZRVA 4Y1DA 1BMFG 4UCRA 4AQYB 4B3RO 4F4KA 1F4MA 2CH7B 4OKJA 1VSLA 4JZ2A 2ATQA 1NNEA 1RM1B 3MD0A 1IJJA 1DK1A 3H1LH 3LWMA 2JEXA 4HTUA 4F6RB 3EY1A 3X2QB 1XMQO 4TV8A 3OHRA 4BIOA 2B5JA 4O55A 2F9TA 4OPKA 1NJYA 4GV3A 3MXIA 3ZS8C 4Q4W4 4JI0B 2QM1A 4BGBA 3TAMA 4B3RK 1I94O 3P83D 3AVKA 4FJLA 2IH1C 5IY5C 4JYCA 2KB1A 2F1MA 3OYCA 4M3WA 3THVA 5DM6V 4HCCA 4MVQA 1Q7YO 3SYCA 1Z2GA 3DLBA 4FJMA 1JOYA 4DRXA 2UXBO 3ZETB 3ZMZA 1ZBLA 4A62A 4BWJA 2QWPB 1VQ6V 2XTAA 2ATKC 1AI6A 2EX3A 3LM9A 4IJNA 1NBMG 4H33A 4JYYA 4O5BA 1K73O 3NF9A 2WSSG 3FZKA 1R3LC 1HLUA 3AO3A 4J2AA 1RVF4 4EIAA 2O8BA 1RDCA 2DWDC 2P7TC 2DFEA 1SRYA 2E2PA 1K5QA 1VP7A 4FWMA 3S3NA 4NXNK 4K43A 4X1KA 2D0CA 2WLMA 2EINB 4F3OA 3VR8A 1WA8B 5LYJB 5B1AC 2Q67A 5KTQA 4DSLA 1XL4A 3CJ7A 1CEZA 2Q31A 2BTOA 4PKGA 1N33O 3ZHVA 3W7TA 3ZX3A 3N2GB 3F2KA 3LDNA 3VQVA 3F5TA 1VQPV 2F93B 1C0UA 2OTJV 3OEEG 3AVBA 5KAFZ 3NH2A 3TABA 2Q0OC 4YXDA 4RQEA 3O9TA 3P31A 4JYBA 3AEGA 3TAEA 1FKAO 2VS0A 3L72H 3H1HH 4YOYA 4H0PA 4CJWA 2F23A 1ASUA 4B9UA 2OTLN 4KKOA 3K5NA 4CZKA 4DR4O 3EL2A 3ATVA 5IWAK 1WPXA 2Q73A 3D36C 1CZ9A 1PL4A 4DW1A 1FXVA 2QWMA 1V55C 4O4HA 4BRQA 2WPDG 2UUAB 2EIJC 4TUYB 1XNQB 3KLFA 1ASJ4 3B09A 3N2KB 4OGEA 1VQNV 1IBMO 3QDKA 4CJ7A 2D4WA 3AA3A 1FPOA 4IL6Z 1JA8A 3CCRN 4KL1A 3QVNA 4KHQA 2D0BA 1COWG 3CRQA 2JEUA 1HNWB 3DI6A 4DR3K 1NK8A 3C6HA 3JSMA 5JCOA 2YICA 3ZJZA 4WFAV 4BREA 3OR6C 3QF7A 2V1DA 5CYMA 3CMEN 3RRHA 3CCLV 2P9NB 3NDKA 3PO5A 5M1KA 2WP9A 4K0KB 3QO8A 5KRTA 4FLYA 1HJOA 4DS5A 3VMFB 2QA4N 3HO1A 4CFCA 2QA4V 3CCMN 3IDHA 3CPWU 2K9PA 5A9GA 4BC4A 1DEJA 3DLEA 4BRPA 1XNRO 4QIWF 1JJ2M 2BGGA 2YIBA 4JLHA 3T1YK 2WU5A 5BY1A 3VR9A 4XIUA 1YITV 3QNOA 4LF9K 4FJ8A 4ZI7A 4GYCB 3AO1A 2BOCC 2VQFO 3HTVA 4JYAO 1AP5A 5SWMA 3HPOA 1J5OA 4BROA 5HOOA 3OW2U 1U4BA 4QNHB 2YKMA 1WB8A 1T5EA 3P38A 3IAYA 4R5PA 3SDLA 5E26A 3DLGA 3WUHA 3IC9A 1VSHA 2QWRA 1NEKA 1X3MA 4N47A 2CAZC 2RS14 5B1BB 1IKVA 3JALB 2GELA 2VQEB 1BIZA 4W5OA 1HRI4 4I9QA 1A32A 5DN6G 1WAZA 1B04A 2EWSA 2A3QA 1TA8A 3G71V 4UUJC 3JAMO 4DQPA 3GL1A 4GX5A 4FL9A 4X1YA 3KHYA 4CIGA 4KH5A 4GMJB 1O13A 1NTZH 1SQKA 5TKWA 1X9MA 1VQ4V 2W6KA 4HBNA 4B7KA 1HNVA 1HMVA 3RVCA 5AQYA 4FPBA 1NK4A 3CC7N 1W0KG 4Q4V4 5IJ9A 5AQFA 3EZWA 3OJUA 4FJ7A 1RPRA 4GVEA 1QQCA 4RUFA 3THOA 5B5EZ 1ZP0A 2A41A 4FVUA 2X5ID 4FZ0A 2HVHA 2Q8VA 4RWUA 3N2KA 4F8RA 3G6EV 4J7KA 4YOXA 3P1GA 3NF7A 1NGDA 1SL0A 3P3NA 2F9WA 3UE5A 3H1KH 1QQNA 2F7TA 2EIJB 1N0JA 3HKDA 4G2KA 4CEAA 4PA9A 2Q6AA 3FB8C 1M57B 3ETGA 4Z2WA 3HPLC 3HVRA 3SFEA 5GTHZ 1ENVA 4HNAB 1HKBA 3R6MA 4BQLA 2YHXA 5I3UA 4BW5A 3UQ8A 1HNXO 3IG1A 5IYZA 1JQ0A 4QS9A 4PHZA 5CA0A 3KK7A 2IDOA 4I6MB 4YJ3A 2ITDC 2OANA 3E1YA 1HPZA 4DTJA 3ZLJA 1K73W 4AHUA 4DV7O 5LA6B 1GN4A 1BO5O 2P9KA 4HUEA 4PA7A 1NGEA 5AQXA 4K42A 3WXMB 3EFFK 4LP8A 5AFUA 1XILA 5D5QA 2E6MA 3LDQA 4H0OA 4D7SA 4DU1A 3ABLB 3QG5A 4PD4F 3DXMB 3ZSYA 2EINC 4BE0A 2FB5A 3BA8A 1OCOB 1HX1A 2YNFA 2CE4A 1VQ7N 3ZHSA 2CGOA 1JL2A 4DR2B 2UUAK 3PSFA 4J7ZA 1K8AO 2R044 1Y76A 2QM7A 2QWQB 3D45A 3J80O 4RUEA 3T3FA 3LSQA 1M1KW 3K08A 5AQOA 3DXMA 1QQOA 4DLEA 1BQ0A 4I55B 1PIV4 3WNEA 2AW9A 4JV5O 4UFZA 4CF8A 3UKMA 1U96A 2B6AA 3DOLA 4EZ6A 1EKEA 1QBZA 4L8RB 1K8KA 5AFUH 3J7AP 3STZC 1HNWO 5C8YB 4CK3A 1YHQN 4P2ZA 2E1ZA 3E9LA 1F4NA 4KUMA 1C6VA 2A1SA 4DB3A 2R7FA 1M57C 2HHTA 5CA1B 1Q18A 1CZBA 1U6ZA 1SZXA 3OS2A 4HWIA 2QK9A 3K9KA 1FFXA 1VF6C 3JATA 2EBOA 2R064 1HW7A 4NXMO 1M1KO 2NZTA 2G8IA 1TV6A 3RYCB 5FPNA 1KC8W 4Q5VA 4Q0BA 3ZN0A 4TSFG 2PFUA 4IJAA 1BCCH 4DV0K 4JTCB 2Q2RA 3L4IA 2DYSC 3J81O 3TTCA 4GNIA 1F51A 4M3RA 3CCVV 4NXNB 3DGEA 3FFQA 2XY6A 1VQPN 4FWQA 4E1NA 1KU9A 2VGMA 3B8MA 3ICXA 4KFMA 1AR4A 4DR3B 3H3NO 2RMU4 1RTIA 1VF6A 2QWOA 3OYLA 4WF9L 1BG3A 2DQ3A 2OCCC 4CF9A 1FXXA 4WFBL 1JJ2U 1WSIA 1FFTB 1PV0A 5GIPA 2DYRC 2O8BB 1VMGA 3ZCMA 3STLC 2YIAA 3DXKA 4CJVA 4QPJA 2XUMA 1P7GA 2WLHA 1E1RG 4GX2A 2P9LB 4Z4HA 5F1XA 3BFRA 4CJRA 4GV9A 1NKCA 5LGTA 2ZM6O 1KLMA 2ZIMA 2NNWA 4CHYA 3SMPA 4LSNA 2NLJC 4B3TO 1JLCA 2E2NA 4H8KA 1RTHA 4G27B 5HRRA 1NK6A 3TXSA 1LAVA 4BE1A 1EAH4 1QU7A 3V81A 3LNMB 3FE1A 3RYIB 4JI4B 2Y69B 2IS3A 3BF1A 4CHPA 1U49A 2ZGYA 1SKRA 4MSWC 3QEPA 1WP7A 3CHXA 1GOCA 1VQ6N 1JLBA 2N05A 3CC4N 4FWOA 3EHBB 2E4LA 4IT5A 1BISA 2IC3A 1ATSA 1RSOB 3U11A 2OPSA 3CCQV 3L70H 3WNHA 2HG5C 4LF7K 4LFBK 4BRNA 3I55N 4FJXA 3A0BZ 3WXKA 3O80A 3PSIA 4IG0A 1S72V 4M63C 1KFYA 4NCAA 5AQVA 3RR8A 2WUSA 2P06A 4CE9A 4YDUA 3Q4HB 4H0LB 3OYKA 1NZ6A 2E88A 4X65O 1HNWK 1C0TA 1YXBA 3CERA 3RMAA 2Q5ZA 4LY7A 3VOUA 3E86A 1WBBA 3JBG4 1TUBB 2YUAA 3C3SA 4I2PA 1K34A 1IKYA 2HHUA 1KXPA 3TAQA 4DSEA 3HKCB 1T7PA 3H6EA 4CEZA 5LHGA 1X4TA 4EHUA 1WP8A 3G71N 1YQ4A 1H2LA 2CH5A 1BI4B 2OA8A 4PUOA 4QCLA 3GQKA 3DAWA 2WLKA 4M3UA 1GMGA 2BE3A 4DV0B 1KD1W 4IO8A 3LZJA 4DTNA 3PX0A 5JJNB 2ZKOA 4E2LA 1L0LH 1VF5B 3FZFA 1R084 2H88A 2O8EA 4I6MA 1Q6HA 3FD9A 4H0XB 2JLEA 4IDHA 5LP6A 1IBLO 2HMIA 5KMGA 3AE4A 1Q9YA 1VK0A 4FJCC 3ZSQA 3TARA 1L0VA 1KP3A 2Q69A 1OV9A 1ATNA 3AO5A 1GLCG 1THZA 4DFPA 5GW7A 4PDRA 1R094 1UWBA 2A79B 1M56B 4GW6A 3WG7C 2A40A 1N0NA 1BQZA 3K5LA 2ZT9B 1BU6O 4DR4B 4J80A 3C95A 3T1AA 3BPZA 3J80N 1RT4A 4WE1A 2EIMC 4GKKO 4YORA 1KD1O 3SR2C 1QVFU 4LH6A 3VRAA 4KTQA 2IU0A 2XHBA 5JVDB 5J2TB 2RDCA 1L0NH 4DTMA 3BEXA 1ASWA 5LOVB 1FXKB 4OPHA 1UOCA 5DMRA 1Q6UA 2Q7GA 4WQ4A 4CJEA 1VARA 4DW0A 1I0HA 5AZJA 5CY4A 4KB1A 4B9VA 2EIKC 2Z5UA 2IOCA 1LUVA 5KA5A 2HHHO 4LF8O 4CFAA 2GTAA 3TCUA 1K3EA 1YF5L 1PL0A 1YITN 4CJ3A 2E8AA 3D2FA 3E2EA 5BR8B 3E22A 4L8JA 2NN4A 1SZ2A 3OTFA 2RCVA 3LDPA 2WU2A 4LBEC 4ILJA 3CIRA 4CFDA 3K5OA 1OVQA 3DRSA 4FIPC 4DCHA 4NCBA 4B8AB 4FLTA 2UXDB 1K33A 5LP6C 4NTXA 2D5RA 4DQ8A 4CVNE 4DS4A 3KLGA 4DFKA 1K9MO 3CCLN 3GQHA 3CSXA 4DO2A 4EKWA 2YNGA 4X62K 2E2OA 3NCIA 1OKJA 1WSJA 2DPNA 3HOTA 3ASOC 5H6RA 4DR7K 3DM2A 3RTVA 4NXNO 2VWBA 1A5WA 1BE3H 1ZSPA 3TAFA 5BR9A 2DN9A 3MXJA 1R0AA 5B1BC 1B92A 2P9IA 4FSVA 3OYMA 4DFMA 1A5VA 5EY4A 4CH5A 5GAEP 4W5QA 2Y4TA 3P4RA 4ID1A 4CZIA 3OYBA 5B1NA 3MHHC 4K3AA 1LCUA 3F9KA 4LF7B 5KUKA 2RM24 2ZE6A 4Z4GA 3E01A 1WBDA 2X6AA 2P9IB 3FYEB 5BPLA 4JGSA 4JKAA 4FOIA 4BIZA 3KZIZ 2WAMA 3L74H 3O1BA 3SCXA 1VQ8N 2ZM6B 5FPDA 2F8SA 2EILC 1RUE4 1EZJA 5BRFA 2Z1HA 4WQ5A 1H2NA 3IJ4A 2GSMB 5HLFA 2FBWA 4ZKIA 3L75H 4CD3A 3N4PA 3RYIA 4B1YB 1YJWN 5JS1A 1RDWX 4TT3G 4QPKA 2WC9A 4XEIA 3LM2A 2HNZA 3L9DA 3D6RA 4HZ3A 2WONA 3ZHUA 1S5HC 3AG3C 4N23A 3P4IA 1R1BA 3AVMA 3HOSA 3A5LC 3HM8A 2ZJRL 1EWQA 3FAVB 1IX9A 5LGUA 3L6QA 2QW9A 3CYMA 3AE1A 3OFNG 1OCOC 3THWB 5AQUA 4LFAK 4LFCK 4YJ3B 3OM3B 4GVMA 1KF6A 4RWTA 4GKKB 4JYAB 5EX5A 1J9AA 3SJJA 3SYAA 3O9SA 3DC6A 4JAVA 1V4SA 3KKRA 4MS2A 3L2QA 1UFIA 1VQ7V 3ZEDA 3V9ZA 1Y97A 4LF4O 1NKEA 3AVJA 3HBTA 5B8HA 3CD6N 1BDGA 2R9RB 1K97A 4KH4A 3X2QC 1Z25A 4N76A 2R72A 2HR3A 2FLOA 2HBMA 1R6NA 3OS1A 4JYAK 3MXMA 3AE8A 4JI7K 4J9YB 3A5MC 3E8GA 1OCZC 2RQ6A 4LF9O 3ZSOA 4EAHD 4N41A 3CETA 3AE9A 1ORQC 2Q4PA 1XC9A 3MX2A 1UPGA 1PVC4 4HVJA 3S3OA 2GTSA 4BC3A 3QIOA 1TKDA 2JIZG 1BQNA 4X9QA 1JLFA 3CG7A 4J7JA 4CJFA 5HRSA 4B1UB 3NGZA 4XDJA 1XQSC 5DECA 3OTOK 4I55A 3KWGA 3T1HB 1KVAA 4QS8A 2GDSA 1URFA 1ZWIC 2P90A 3KK1A 4CEOA 3B6OA 3OBYA 1QHAA 1K8KB 4BQZA 4FCYA 4RAIA 4DV1K 4FJKA 3ZX6A 3ENOA 3M8SA 3A5OC 3D36A 1VSFA 4FM2A 4CBCA 3ZETA 3UT5A 1AR1B 2HF4A 1L3TA 2F4VB 3RMBA 5L3CA 4BRIA 2A1RA 2ZDIC 3ASOB 2VGNA 2PI4A 3WNGA 5L3BA 2KKZA 3E35A 1HXS4 2P4VA 5EU7A 3VEOA 1FXKC 3A0RA 5IWAO 4MT8A 3ZMSA 1NMNA 1QZ6A 2BH1A 4IO9L 1HPMA 2RS54 4IGGA 1EM1A 4NKGB 4RO2A 3EE8A 4ISFA 3V1QA 5FPEA 4AH9A 1XMQK 2CGJA 1RBRA 2BTQB 3M8PA 4EFHA 3VA0A 4O4HB 3TR8A 1Q86W 4LCUC 4EP5A 4Z94A 1BL8A 4DV5B 3CCSN 2ZDIA 1I5YA 3MEGA 2OT5A 4IYIA 3NR7A 3R1XA 2QWOB 3ZSRA 2JRIA 4JZGA 3ASMA 5HROA 4WBNB 5BN9A 4PI0A 5BREA 3GWKC 1KMIZ 2PYJA 2A42A 5JH7A 3U8XA 1NTMH 3SJAC 4JI3O 5AQJA 4LH5A 3MCPA 2UUBK 1J54A 2P9SA 4FZYA 3LP2A 1VQLN 3VQ5A 3AGRA 4JAAA 3ZIAG 5CR4A 1KYOF 4BRMA 1EN6A 5LMUB 3L2UA 3CQ8A 3NGIA 3VQ9A 1WSFA 4GV6A 1MA1A 4YFUA 1KFDA 2A9HA 2D3OW 2PY5A 1Z6RA 3L3VA 2IVNA 3SV3A 4KRFA 4YY3O 1VIBA 1Q81W 1R6KA 3CB2A 2X74A 3SUQA 3MHSC 1NKBA 1KUQA 3ZEUA 4CHOA 3O4QA 2OPRA 1HRV4 2P9UA 1MOFA 2UUCK 2QJ1A 1ZOYA 3JAWA 1G8MA 2BE2A 3PJSK 1NQTA 3EN9A 1OHHG 4IXCA 2IJJA 1YUWA 3OBWA 1RPOA 3ZEUB 1O9GA 4CI6A 5FPMA 4ELUA 1P49A 1EBOA 3CCQN 3BP8A 1SQXH 3VF2A 3CJ9A 3FR0A 4CJTA 3KD1E 4I4TB 3L4QA 4HUGA 4FO0A 3E8HA 5M1PA 5LMNO 4M42A 2O8FB 2D0OA 1CXQA 4KTWA 4V19S 2KZMA 2PYLA 3QBXA 3OMIB 4NB5A 1SV5A 4DR5O 3U9DA 2NRTA 4IYHA 4O4LB 4FK4A 3BZKA 1N36B 1IXMA 2EJ7A 5KHGA 4FWSA 3SPCA 1K8AW 2LGQA 3NGYA 1H8TD 5J9PC 3QEVA 5GADP 1W0HA 1JLEA 4KV8A 1SL1A 1PM9A 1YTFD 2P4KA 5BPNA 3UB5A 4MVOA 1D8YA 4XH5A 4IHJA 1SKSA 1W97L 5GINA 3KJVA 3JARA 5KHJA 2KFNA 4B3MB 2ZIOA 4NLBA 3GDQA 2YV0X 4AILC 3AG4C 4ZTFA 5LL6Z 1JXBA 4AHRA 2PTMA 3NVMA 1POV0 2RMKB 1RDDA 4N56A 3O9UA 2F8TA 3VTIA 4DF8A 3O3FA 3AAPA 4JNEA 3WQUA 1MDUB 4R6ZA 3GBTA 3OE7G 4E1MA 4BE2A 1OCCC 2XOKG 1I94B 4Z0UA 4X62O 3CQXA 1LV5A 3FB7C 3LZIA 1E79G 3LUTB 4BRGA 2IU3A 5EIBD 2KG7B 3F5WC 4JI2B 4ELVA 3B40A 1JCHA 3W7SA 1FJGO 4YHHK 4YT0A 3LL3A 4GT1A 4PQUA 3HKBB 3GVMA 5FLXN 1PD3A 3EE9A 5H2FZ 4JK9A 3LPUA 2DY4A 2XT9A 3ZHTA 3MK6A 5AQZA 3AG2C 3ZMVA 4JV5B 3K03A 5LXTA 2MK3A 2BTQA 3OS0A 2ZE2A 3ZCCA 5H6QA 2ITMA 1GLDG 4JKDA 1G6UA 3WEEB 5EBMC 5FNVA 2WLIB 5HL7L 1JKHA 1GN3A 3SUPA 2L6LA 1NJXA 2WWWA 1YJ9N 4CK2A 4FWRA 4X66K 3VEWA 4O4JB 1BHBA 5FRMA 4LF7O 5AQRA 4NXMB 4FZZA 3L0QA 2YKNA 5CN0A 3CJBA 1U97A 4CJUA 1NU1H 4PL8A 5L3GA 1MU2A 3HXMA 3VQPA 1LW0A 4DUYK 3IUCA 4DQIA 3ZRSA 1BEV4 3AE7A 4ICLA 3HKCA 3JYCA 5EVZA 4FK5C 4JHDB 4RCHA 3AVIA 1VQKV 3TSQA 1S77D 4BRLA 4OLAA 3SPHA 2XASA 4CS3A 4I7FA 5LY3A 2M6YA 2EIKB 2Q0RA 3I0SA 2Y1JA 3QFPA 4L3QA 1VSKA 3PO4A 1YJWV 4FK0A 2RR14 3VQCA 4GKKK 3VQYA 3VTHA 1SQBH 3HPHA 1B9FA 2V7QG 3ZT0A 1D5AA 4GY2B 3CFRA 3ETEA 4AQYO 3BA9A 3CMAN 3EKSA 2ZNIA 4TV9A 1IBMB 4FYDA 3G67A 3E22B 1SQFA 1NJZA 2NRHA 1VHXA 1QHTA 3PLAA 4H5RA 1S1UA 4W4KA 2YX6A 1BHLA 4G9ZA 1CP9A 4QOZB 4BR0A 2QGNA 5BZBA 4DV2B 3HKBA 1C1BA 2HKOA 3WXJA 1NG9A 1IBLK 2Y0PA 3LDOA 3OYJA 2YI9A 3UO2A 1FW6A 3PV8A 1JLGA 1BS3A 4CIFA 3SMSA 3MWPA 5AQNA 5AZIB 3ULEA 4B1ZA 2Q0UA 2A7WA 4O2BB 4E0DA 4W5TA 2FBVA 2QKAA 1BA1A 4LR3A 3UO3A 2EZPA 2GHYA 4CGFA 2B9ZA 4NYNA 2UXDK 3AG4B 1WN7A 1RTJA 1NR7A 4DUZB 1NVPD 4B9SA 1RFQA 4CHQA 5AQGA 2JGDA 3AEDA 4CJKA 4JRQA 1NGGA 1TK8A 4KP4A 1CXUA 2Q9LA 3P3PA 3DMJA 1HQUA 5KUMA 4DR6B 4KB0A 3CHWA 4UVAA 2WS3A 1BT8A 4NYFA 4DSFA 3RWUA 2ZD1A 3DLHA 4X1KB 2AZ0A 1VSMA 4PI2A 1KRPA 3E83A 1R73A 1U47A 5GAGP 3OYFA 3VQ4A 5KPZA 1TAEA 2E5LO 3CJAA 3HM9A 4MLHA 2QTDA 2XY7A 3O5BA 3F9MA 1ZBSA 3QLHA 2EJRA 1SAZA 4IZ9A 2BDPA 3ABKC 1L1FA 1TVRA 3DLRA 2AGAA 4FWNA 4C8MA 3QICA 3Q7BA 5JLFA 3K9SA 4IWVA 3TAPA 2OCEA 2H3OA 3T19A 1XMOB 1YVNA 2QE7G 2IH3C 5L3FA 3P5JA 5JCOC 1TL3A 2HNYA 4CEBA 5FROA 2GWJA 4CGIA 3SI6A 2W0XA 2ACZA 4LWSA 5JWPA 2O8CA 3FLCO 4IG3A 3MDQA 2Y69C 3G6BA 2YXHA 2P67A 4U3JB 3RVZA 3CFOA 1MMMA 3ABMC 1XUPO 4NYKA 3CJHA 3FZHA 2O4IA 2WFBA 4KHYA 4AQYK 4J41A 3CJCA 2VRZA 2UXXA 4X88A 5FPOA 1K9MW 2PZSA 1IURA 2A3ZA 4CGDA 5BRDA 1YI2N 2R074 3CCSV 3HZ6A 1H38A 1TK5A 3WB1A 4FFBB 4WF9V 2P9UB 4NXMK 5FRNA 1KCFA 4KFBA 1SA0A 1TVKB 4MW3A 2QTOA 4CEFA 5H1SQ 1IKWA 2GUZB 5KI6A 5AQWA 1L8DA 5LL6Y 3V9WA 4DQSA 2O4GA 1C0GA 4JI5O 4JF3A 1DKGD 1JLQA 1N34K 1T6CA 1IBKO 3BAAA 1JL1A 3SQ2A 2Z0AA 4ABMA 4M7XA 4JV5K 2DW4A 2DMXA 3EKUA 5DM6L 1RGIA 4DV2O 4MO4A 2XY5A 4JI8K 4KHPK 4UV8A 3MEDA 2OYQA 2WLIA 1KKDA 3VQAA 2QSAA 3TJTA 1NK5A 4H5TA 4DR6O 5BRHA 4LFBO 1WLJA 2UUAO 3EYZA 3HJFA 5B66Z 2VQEO 5IYZB 3E66A 3BABA 2X0LA 1NOZA 4CJPA 4CZFA 3CCRV 3CF5L 4LF8B 4FVMA 4DU3A 3WXLA 2ETJA 3VEXA 5ADXH 3QNNA 1BCMA 4HNAA 1YVWA 3ZHQA 2P9PA 3BEHA 3DLKA 4DTRA 4Z1VA 4M45A 4YIPA 1K92A 5CBFA 3JALA 4OX9O 1G1XB 4J2DA 1BWFO 5DEDA 3U6FA 2QM4A 1V54C 1S1XA 5M1OA 3UKRB 5CHIA 3RW0A 1RT2A 1OH7A 4B3TK 4BR2A 2DTUA 1S0VA 3OEHG 3D7EO 3JD3A 2FYUH 4XH4A 2VG5A 3BUZB 2M7WA 4MDAA 3CCUN 2YEVA 3DXKB 3RSEA 1BHAA 5M1NA 5KHIA 5C12A 4O2AA 4DV4K 1LNQA 3ZT4A 1XMOK 3MN6A 4R79A 1WAJA 1C1CA 2Y4UA 3HI0A 2V52B 4CJ4A 3CRCA 3QESA 4JI0O 1VBD4 4NLCA 4I4TA 1RDBA 4RW9A 3SUCA 4LF6O 3BF3A 3CCEV 1GLLO 1FK9A 4UCOA 3OYHA 4PA4A 3QERA 4R50A 1TVKA 3LSUA 3ML0A 4R8CA 4OO1J 4DUYO 5AQLA 3KKSA 4DTUA 4CBUA 4DR3O 4WFGA 3N4QA 1W2BU 3OGIB 1EETA 2ASOA 3TPQA 2KTQA 4A2BA 5F2VO 3ASNB 1N36O 1RBTA 5LHHA 4OKEA 3BY5A 2YIBD 4Z1MG 3B6PA 4K8XA 3SYQA 1TUBA 5TKYA 2ZQBA 4XDKA 1H8EG 4KI6A 5JLHA 3UCSC 1NU0A 3L3UA 1PKXA 4YHHB 5DM7L 4JI5B 3MWTA 4BR5A 5KPRA 3G4SV 2Q36A 4DR4K 2BCCH 1GLAG 2WQYA 1KB9F 4I5SA 1NH2B 1PO14 3CXCU 5JJJB 2AHYA 3QNEA 1I3AA 2YS8A 4B7EA 1S9EA 3VQQA 2W41A 4BDPA 1AI5A 3WXIA 1LWFA 4KTZA 3D0PA 3CRAA 4BWAA 3JAWB 3HRGA 3GOIA 2P9PB 2DWEC 5LOVA 5KLVH 1S3JA 4FPAA 1WB7A 2Q1NA 4JKEA 2UXCK 3BHPA 3QEIA 1AR94 4UCTA 3DJCA 4RTFD 4M3XA 1DLBA 3ID6A 4LC9B 1B6QA 2E76B 3AG3B 1GM9A 2YSUB 4P9OA 4DV6B 1D2DA 2BUPA 5KA6A 3LAKA 3NXSA 4QJFB 1XHXA 4MVZA 3T1YO 4I2QA 1WSEA 3QINA 2RF2A 3RYHB 4BR7A 1P7BA 2OCCB 1Q6IA 1KVCA 3AVAA 3OMAB 4JI7O 4BW9A 4B08A 5HFLA 3P30A 2ETNA 2KFZA 3LDSA 2IAJA 1Y74A 3FAVA 1FXKA 5LGNA 5KQDA 3THXB 1D9FA 1X9SA 3E8FA 1YTFB 3HP9A 2QR4A 2X6SA 3M6GA 1Q90D 1M93A 3OVNA 4K35A 5IJ0A 3MCAB 2HEPA 3R3LA 5I9EB 3L2WA 1AP6A 4X1YB 2HNDA 4JI1K 2YJFA 1E3MA 2ZQMA 3E9OA 2PF4E 1V4TA 3VGLA 2P1JA 3LNNA 1NR1A 1DGSA 3TK1A 5JH7B 5K1PA 1NTKH 2BSKA 4DR1B 1VQ5N 3ENBA 2UXNA 2ZE7A 1DGKN 2QXLA 3V4IA 3CD6V 1T6DA 2WLLB 1BOTO 5CZ1A 1SA0B 4MQ3A 1NJIW 2UU9O 4YTNA 5EBWC 4H13B 4YJ2B 4YOVA 3KTQA 2PGGA 2X6BA 1E1QG 3JASB 1FS0G 2IW5A 1T3VA 1WSGA 1PNLA 5LA6A 3PIPL 2BOBC 1ROPA 2HVKC 2HBJA 3VESA 2OCHA 4LF5B 1UAXA 2QXFA 5K14A 4OGQB 1GLBG 4MTXA 3CS5A 3RT3C 3O3HA 3S9HA 3AY9A 1NKDA 1BGYH 5TISZ 2WDQA 4KHUA 4JTDB 3L71H 3QO9A 4CIEA 4H0YB 2F4VK 4F6EA 1MSWD 1I08A 1AROP 1CXZB 1PNMA 3AK3A 5LBQA 3ZT1A 4BRKA 2QKSA 4J42A 4PDMA 1SUQA 2YI1A 3G80A 5T7BA 1VQKN 3KCYA 1N8RW 1QZ5A 4H5NA 2HVJC 2QEXN 1Y6XA 3KWIA 2ITGA 3NMUA 4E7JA 5EC2C 4FLWA 4BDYA 3U3YA 2NRXA 4Q4X4 4KHWA 1T05A 3FZMA 3I33A 2YJEA 3ABVA 2FL4A 2QWNB 2OIGA 2PAVA 3DRRA 4L87A 3PN1A 3CX5F 3QMLA 3QB0A 3RR7A 3RMCA 4ZI7B 1DF5A 4DKWA 3D3QA 4DF4A 3TI0A 4JASA 4CHNA 4ZHQA 3IRXA 2QKCA 2QI2A 1KP2A 3JAKB 4WCEV 3RSEB 4JD2B 1M4UA 2VWJA 4X8AA 1H8HG 5IY5B 3KLEA 1B06A 2CTQA 2HP8A 2E2QA 3C65A 2G8KA 4JI3K 3LSSA 1AL24 3DYAA 4ZIBA 3MN5A 3KCXA 2JJ1G 2UUBB 1T03A 4FJJA 5IYBO 2JS5A 4UB6Z 3M3ZA 2PBDA 2YIDA 1WSHA 1I94K 3QO7A 2UXCO 1S76D 3K58A 1N6QA 1HRHA 3FX7A 5LXTB 2HFEC 1SQVH 3KKYA 1HYVA 4JI6K 5IYDO 5E79Z 4BG9A 3QETA 4GX0A 1YIJV 1SERA 1VSJA 4DTOA 3FYIB 5KGXA 4DUYB 4DV5K 1B3QA 2HW3A 2F95B 1EWRA 4DV3B 3L2VA 4PJ0Z 3ABKB 1HYZA 5E41A 3CPWM 3H46O 1DTTA 1Y74B 2UU9K 3KVGA 1JX9A 1EFRG 2F96A 4C23A 1GLFO 3SQ4A 1BI4A 2FMLA 1ZBUA 5FDLA 5EC1C 4DK0A 4WFHA 2ITCC 2W0FC 1RBVA 2RN9A 5H5NA 5IWAB 2Y0IA 3ZRXA 4LH7A 2LW7A 3ZX2A 1W9HA 1L3VA 3OA9A 3ZN1A 3CC2V 5AG2A 3T69A 4CZLA 5LMNK 4PDLA 1GLEG 3ZT3A 2ARHA 4FJGA 4JI6O 2JWLA 4UQGA 1TYQB 3TSUA 1SKWA 4FPPA 4DRXB 4DR5B 2X78A 1YJNN 2LQTA 3MX5A 3W7WA 2LJ2A 4JI3B 1S5JA 2NRZA 4MTOA 4AM6A 4CBWA 2KQ2A 1ZUQA 2PUSA 1AR84 4EB6B 4P9PA 2HHHB 1OCZB 4M7YA 2ASMA 3DOKA 1AR5A 1YTAA 1DLOA 4BR9A 5J2PA 3JSLA 1E4FT 3CP1A 2DYSB 5JQGA 1X9JA 4IOXA 1RUH4 3VN5A 5C0YA 2ZD9A 4X64O 3VENA
chains in the Genus database with same CATH topology
2KZZA 4RW4A 1I7FA 4B9MA 4CEDA 3HYFA 4B3TB 1RT1A 4Z4FA 4FM0A 4J2EA 4TOIA 1BCOA 2XRIA 3WB2A 3N2GA 1IG9A 3K59A 4PY5A 4CJ5A 4F2RA 4FJNA 1QSLA 1RT6A 1IKXA 4DTXA 2VG6A 3ETQA 3AVLA 3LPTA 3OYIA 3V1RA 1J53A 1HQEA 2HHVA 3NE6A 3FFIA 4PWDA 3MAQA 3SJBC 2JVDA 5EIBC 4NVPA 4CJWA 1Q8IA 3QTCA 1QE1A 4I50A 2G8FA 1LAWA 5ITZB 1Z5WA 3ZSXA 1RT3A 4X1IA 4GLXA 3KK3A 2G8HA 1EXQA 3KLHA 3C94A 3NHGA 3ULDA 3OY9A 1L3SA 1U45A 4UCUA 3H08A 2FBYA 4CGHA 2NUBA 4LF4B 4NCGA 2B4JA 1JXEA 2FC0A 5KX5A 4DK1A 4O4IA 4IFVA 3VQ7A 4DWIA 4FM1A 5C24A 1Q9XA 1TL1A 5EZYA 3QEWA 3ZT2A 1ZBFA 4IIJB 4OX9B 4M3TA 4FW1A 5BMVB 1S6PA 2W42A 4FLVA 4U3JA 2YNHA 5FPRA 1YVUA 2FBXA 3PUFA 3K2PA 3LP1A 5J2TA 3NF8A 3K57A 1RTDA 3ISNC 3HKEB 3VQ8A 2E3CA 3WNFA 4KHNA 4LNUA 2PW9A 1YT3A 4CC5A 1S6QA 1NK0A 4CEEA 3OTOB 5J2UA 5KMGB 1S1TA 2AJQA 3I0RA 4CF2A 4ZHQB 4DMNA 3V6DA 4CGGA 3M7MX 3HKEA 1V9PA 1RT7A 2FBTA 4FJ9A 4W5NA 2ZINA 4EP4A 4QAGA 2P22C 3O3GA 5LYJA 2KKWA 3SJCC 3TAGA 2HHQA 2R70A 5EYPA 3L2RA 3JYTA 1ITGA 3NH1A 5KX5B 2I5JA 4ELTA 4O0IA 4OLBA 4E19A 3LP3A 1VSIA 4B9TA 4B3RB 4LFBB 3V9SA 5ITZA 1WAFA 4DTSA 4TUYA 4RW6A 1TKZA 4CERA 3L8BA 4AHTA 4EFEA 4CGJA 4X1IB 2VG7A 5JQGB 4ZOLA 1Q3EA 2RJZA 1LWCA 3AVHA 4Z4CA 1BQMA 1Z5VA 3RWRD 4EFBA 5J1EA 3RYHA 4OJRA 2Q7EA 4W5RA 3VA3A 4X20A 4C8OA 2JGUA 3RYCA 1Q5OA 4TQFA 1H2SB 3M8RA 3S3MA 4B9LA 2Q3SA 2YXLA 3DSQA 4LD0A 3JAKA 4I9LA 3SQ0A 1YTUA 3UT5B 4N5SA 5KRSA 1GOBA 4IKFA 3MECA 5J2NA 2OZSA 3ZSVA 3I8DA 4X66B 2HHSA 1EP4A 3AA4A 2DFHA 4DFJA 1KLNA 3C6TA 1QS4A 4GKJB 4CHZA 4X64B 4CJSA 4B3SB 4DQRA 1RBSA 3RGBA 2P51A 4KI4A 3RFRA 4CH4A 3OJSA 3AVFA 3SYZA 1IH7A 5J2UB 4BACA 1VF7A 5FNVB 3QIPA 3OJUA 1VRUA 4IBNA 3ZSWA 4JS5A 3AVGA 4DQQA 4CH6A 1FKPA 4M42A 4O2BA 1SQGA 1RSOA 4JI8B 4KHPB 3TWHA 1TK0A 4O4IB 4CF0A 4M41A 4I50B 3AA5X 4B8CA 1ZAUA 2X6NA 4J2BA 4E89A 1F21A 3NF6A 1QTMA 4ZOLB 5IJ9B 1RCHA 3G10A 3SPYA 4AHVA 2QKBA 4M3YA 5CZ2A 4KREA 4DV7B 4DSKA 3HVTA 1YEWA 3B2EE 1O9HA 1HNXB 1VRTA 5CYQA 4DG1A 2OPPA 1D9DA 4LFCB 4LFAB 4CF1A 2G8WA 5DK5A 3JATB 3AO2A 4JRPA 1O1WA 4ZHRA 1ZBHA 1Q43A 5CA0B 4X62B 2RKIA 4LH4A 4CH3A 4CC6A 1JLAA 1XQ8A 2YI8A 1NK9A 5C8YA 4G1QA 4C8KA 1TKTA 1C0MA 1HJRA 4CFBA 4O4JA 4LSLA 1NOYA 2HVIA 2UXCB 4EEQA 3LWLA 3VQ6A 1XI1A 3RYFB 1N33B 4DSJA 1NJWA 4FLUA 5HBMA 4B3OA 4E3SA 1FKOA 2GBZA 5CB4A 1FJGB 2Z1GA 2V4DA 4E7IA 4MFBA 4JS4A 1HNZB 2VQFB 1RBUA 1SL2A 1UA1A 1S1VA 2D0AA 1HNIA 1XNRB 3HKDB 3LP0A 3K5MA 4UCSA 4X65B 1WPBA 3O4NA 1KTQA 3UIQA 1TKXA 3SZ2A 5GONA 1N34B 1BL3A 4LF9B 1U04A 1LWEA 2RPIA 2HHXA 4Z4IA 5JJEB 3WB0A 3VQXA 4KO0A 4CECA 5D3GA 2GUIA 4F6RA 1ZBIA 5I42A 5CA1A 3BDPA 5C25A 4KAZA 4KTQA 1M5IA 5KHHA 1GOAA 1L3UA 4EZ9A 5EZYB 1CLQA 2UU9B 4FZXC 4DV4B 4B9NA 3ZSZA 4O44A 2XY8A 1KVBA 4OPJA 3RYFA 3EZ5A 2DFFA 4CS2A 5EYPB 3G0ZA 2ZCEA 3HK2A 1ASVA 2UXBB 3U10A 5C42A 4Q6GA 4OKKA 3U3GA 4LF6B 3LALA 4YY3B 3HL8A 4O4GA 4K8ZA 3LANA 3KLIA 4CESA 2RN2A 4IHJB 1IBLB 3SQ1A 5CB4B 1TGOA 4F2SA 5BMVA 3AVCA 5K1XA 4UCVA 1JMKC 4HCBA 2G8UA 3OYEA 4E7LA 1K6YA 2YNIA 1C1AA 2E5LB 1L5UA 1X9WA 1KSPA 4ID5A 3HP6A 3RMDA 4KHSA 4Z4EA 2F66C 2Q0AA 1RDAA 1UA0A 5LMNB 2E6LA 3VQBA 1Z26A 4DR7B 4PA1A 1HR0B 4C8NA 3AV9A 4H4MA 4DU4A 3KK2A 4JI6B 3A2FA 3KIOA 3BGRA 4AHCA 1B9DA 3C6UA 2P5GA 1J5EB 1IBKB 1G15A 2WOMA 2Y1IA 3DRPA 4FJ5A 4CCHA 2OZMA 3IS9A 1EX4A 5HRNA 2YHAA 3SGIA 1DTQA 2EHGA 2R7YA 5JVDA 4IDKA 1SKVA 2HHWA 1JFFB 4M3ZA 4E7KA 3NBPA 4RW8A 1BIUA 3SUNA 2Z1IA 5J2MA 3NH0A 4HUFA 3JSNA 1S1WA 2ZNJA 4FXDA 3OYNA 4FJIA 1N32B 4IIJA 2VWKA 5KHKA 4O0JA 4FLXA 1KFSA 5J2QA 5KGWA 4EB6A 3QEXA 2XO7A 4CJLA 4BWMA 4YNQA 2R9AA 3VQWA 5GONB 4RG8A 1RT5A 1TAUA 3VQDA 4HHTA 3MEEA 2LSNA 1X1PA 1XMQB 4AHSA 5SZTA 4TV8B 5LP6B 4FK2A 3SNNA 3KD5E 1RILA 4CEQA 3JASA 3LAMA 4DLGA 3PX6A 4JI7B 1S9GA 2YHBA 4OGCA 3CM6A 2KW4A 3U0ZA 3NFAA 2P5OA 4ZTJA 1I39A 1RNHA 1QSSA 4C8LA 3VQEA 1VSDA 2UUCB 3ALYA 4TSXA 1HYSA 3PY8A 4F3TA 3HT3A 1U48A 3JARB 3CFPA 4OVLA 3PX4A 4IFYA 3V9XA 2Z1JA 3AVNA 1N5YA 2BANA 4FFBA 3M8QA 3RRGA 4O4LA 1T8EA 1TAQA 3ITHA 4KPYA 3FI7A 5D5PA 1JJOA 2Q7HA 1QSYA 3V1OA 3CM5A 3V9UA 4TV9B 1REVA 3SPZA 1VSEA 5HRPA 5JS2A 4FW2A 1A5XA 2QKKA 3AO4A 4O2AB 4FJHA 2IM9A 1BGXT 1LW2A 4E7HA 4CJQA 3SUOA 2IGIA 4CFCA 4CS4A 4BDZA 3HSTB 1IO2A 4WBNA 3NAEA 3HPGA 3OYAA 2OWOA 4DTPA 3OYGA 1WNSA 1FFXB 4RW7A 2G8VA 2GV9A 1JFFA 5IJ0B 4Y1CA 2HB5A 4D7TA 4H4OA 4DV1B 1ZYQA 5HP1A 3TANA 3AA2A 3BRCA 1NT2B 1XHZA 1XWLA 4FLZA 3OYDA 3F73A 1NK7A 4YJ2A 3SV4A 4CK1A 4X20B 4TQDA 2OPQA 3T1YB 4JI1B 4LNUB 4Y1DA 4F4KA 4UCRA 4AQYB 4OKJA 1VSLA 2ATQA 3LWMA 4HTUA 4F6RB 3EY1A 4TV8A 4O55A 2B5JA 4OPKA 1NJYA 3MXIA 3ZS8C 4JI0B 3TAMA 3P83D 3AVKA 4FJLA 2F1MA 3OYCA 4M3WA 3THVA 4HCCA 3DLBA 4FJMA 4DRXA 1ZBLA 4BWJA 2EX3A 4O5BA 3NF9A 3AO3A 4J2AA 1RDCA 2DFEA 3S3NA 4X1KA 2D0CA 4F3OA 5LYJB 5KTQA 4DSLA 2BTOA 3N2GB 3VQVA 2F93B 1C0UA 3AVBA 3NH2A 3TABA 3TAEA 1ASUA 4B9UA 4KKOA 3K5NA 1CZ9A 4O4HA 2UUAB 3KLFA 4TUYB 1XNQB 3N2KB 4OGEA 3AA3A 4KL1A 4KHQA 2D0BA 1HNWB 3DI6A 1NK8A 3JSMA 5JCOA 3QF7A 5CYMA 3RRHA 3NDKA 3PO5A 4K0KB 5KRTA 4FLYA 4DS5A 3HO1A 3DLEA 2BGGA 2YIBA 4JLHA 4XIUA 3QNOA 4FJ8A 4ZI7A 4GYCB 3AO1A 5SWMA 3HPOA 1J5OA 1U4BA 2YKMA 1T5EA 3IAYA 4R5PA 3DLGA 1VSHA 4N47A 2CAZC 1IKVA 3JALB 2VQEB 1BIZA 4W5OA 4I9QA 1B04A 1TA8A 4DQPA 4X1YA 4CIGA 4GMJB 1X9MA 4HBNA 1HNVA 1HMVA 1NK4A 5IJ9A 4FJ7A 1QQCA 3THOA 2HVHA 4F8RA 3N2KA 3P1GA 3NF7A 1SL0A 3HKDA 4CEAA 3HVRA 4HNAB 5I3UA 3UQ8A 3IG1A 5IYZA 4PHZA 5CA0A 2IDOA 4YJ3A 1HPZA 4DTJA 4AHUA 5LA6B 4HUEA 5D5QA 2E6MA 4D7SA 4DU1A 3QG5A 3ZSYA 4BE0A 3BA8A 2YNFA 1JL2A 4DR2B 3D45A 3T3FA 4DLEA 4I55B 3WNEA 4UFZA 4CF8A 2B6AA 3DOLA 4EZ6A 1EKEA 4L8RB 5C8YB 4CK3A 2R7FA 1C6VA 2A1SA 2HHTA 5CA1B 2QK9A 1CZBA 3OS2A 1FFXA 3JATA 1HW7A 2G8IA 1TV6A 3RYCB 4Q5VA 4Q0BA 4M3RA 4NXNB 2XY6A 3FFQA 4E1NA 1KU9A 3ICXA 4DR3B 1RTIA 3OYLA 4CF9A 1FXXA 1WSIA 3ZCMA 2YIAA 4CJVA 4CJRA 4Z4HA 1NKCA 1KLMA 2ZIMA 4CHYA 4LSNA 1JLCA 4H8KA 1RTHA 5HRRA 1NK6A 1LAVA 4BE1A 3V81A 3RYIB 4JI4B 2IS3A 4CHPA 1U49A 1SKRA 3QEPA 1GOCA 3CHXA 1JLBA 2E4LA 1BISA 2IC3A 2OPSA 3WNHA 3U11A 4FJXA 4IG0A 4NCAA 3RR8A 4CE9A 3OYKA 1C0TA 3RMAA 4LY7A 1TUBB 4I2PA 1IKYA 2HHUA 3TAQA 4DSEA 3HKCB 1T7PA 4CEZA 1X4TA 2OA8A 1BI4B 4PUOA 4QCLA 4M3UA 4DV0B 3LZJA 4DTNA 3PX0A 5JJNB 2JLEA 5LP6A 2HMIA 5KMGA 1Q9YA 1VK0A 3ZSQA 3TARA 3AO5A 4DFPA 1UWBA 4GW6A 3K5LA 4DR4B 3C95A 3T1AA 3BPZA 1RT4A 4WE1A 3SR2C 4LH6A 2XHBA 5JVDB 5J2TB 4DTMA 1ASWA 5LOVB 1UOCA 5DMRA 2Q7GA 4CJEA 5CY4A 4KB1A 4B9VA 2IOCA 4CFAA 4CJ3A 5BR8B 3E22A 4L8JA 3OTFA 4CFDA 3K5OA 3DRSA 4NCBA 4B8AB 4FLTA 2UXDB 4DS4A 5LP6C 2D5RA 4DFKA 3KLGA 3CSXA 2YNGA 3NCIA 1WSJA 3DM2A 3RTVA 1A5WA 3TAFA 3MXJA 1R0AA 1B92A 3OYMA 4DFMA 1A5VA 4W5QA 4CH5A 4ID1A 3OYBA 3F9KA 4LF7B 4Z4GA 3E01A 3SCXA 2ZM6B 2F8SA 2Z1HA 5HLFA 3RYIA 5JS1A 2HNZA 2WONA 3AVMA 3CYMA 4YJ3B 4GVMA 4GKKB 4JYAB 1J9AA 3SJJA 3KKRA 3L2QA 3ZEDA 3V9ZA 1Y97A 1NKEA 3AVJA 1Z25A 4N76A 2R72A 3OS1A 3MXMA