1AR64

P1/mahoney poliovirus, double mutant v1160i +p1095s
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 2
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar6400
1RUD4 3JBG4 4PDWD 4GB34 4Q4V4 1EV14 1AL24 1BEV4 1AR74 1AR94 1RUH4 1RUI4 1COV4 2HWC4 1Z7S4 4Q4X4 1H8TD 1POV0 1AR84 2X5ID 4Q4W4 1RUJ4 1HRI4 2HWB4 3JD74 2PLV4 1K5MD 4Q4Y4 1HRV4 1VBB4 2RS34 1HXS4 1RHI4 1VBD4 1RUF4 2R064 1VBE4 4RHV4 2RS14 1NA1D 2RM24 1VBA4 1NCQD 2R074 1D4M4 1AR64 1PO14 1VRH4 2RS54 3J8F4 1PIV4 1RVF4 2RMU4 1RUG4 1EAH4 1OOPD 2R044 1RUE4 1RMU4 1R084 1RUC4 1VBC4 2RR14 1PO24 1R094 1PVC4 1ASJ4 1MQTD
chains in the Genus database with same CATH superfamily
3AEEA 4Q4V4 1XHXA 1EV14 1AL24 3P4QA 1AR74 3SUCA 1XHZA 1Z7S4 1NENA 3AE2A 1POV0 3AEFA 1HRI4 2WU5A 4YT0A 1HXS4 1RHI4 2R064 1RUF4 3AECA 1XI1A 4RHV4 4YTNA 1NEKA 2RM24 1VBA4 2ACZA 2R074 1AR64 1PO14 3J8F4 1RVF4 2RMU4 1RUG4 2PYLA 2R044 1VBC4 2WQYA 2WS3A 1PO24 1RUC4 1R094 1PVC4 2WDRA 3CIRA 3ABVA 3SFDA 2H89A 1BEV4 3AE5A 1RUH4 1COV4 3VRAA 2HWB4 1K5MD 2RS34 3AEAA 2FBWA 3VR8A 1VBE4 2PYJA 3P4SA 1YQ3A 1YQ4A 1VRH4 2RS54 1PIV4 3AE1A 3VRBA 3AE7A 1EAH4 3AE9A 3GQKA 3AEBA 2WDQA 4Q4Y4 4YSZA 4YTPA 2WU2A 4PDWD 4GB34 3AE4A 1KF6A 3VR9A 2B76A 2HWC4 3AE3A 4Q4X4 4Q4W4 1HRV4 1VBD4 4YXDA 1ZP0A 4YSXA 2PY5A 3SFEA 1NCQD 1D4M4 4KX6A 2EX3A 3AE8A 2H88A 2RR14 3AEGA 1MQTD 2WP9A 1RUD4 3JBG4 3GQHA 2WDVA 3P4PA 5C3JA 1AR94 1RUI4 1H8TD 2X5ID 1AR84 1RUJ4 3JD74 2PLV4 2PW9A 1VBB4 3AE6A 3P4RA 1KFYA 4YSYA 2PZSA 1L0VA 2RS14 1NA1D 3AEDA 4YTMA 5C2TA 2R7FA 1OOPD 1RUE4 1RMU4 1R084 3FI7A 1ZOYA 1ASJ4
chains in the Genus database with same CATH topology
1RUD4 3JBG4 4PDWD 4GB34 4Q4V4 1EV14 1AL24 1BEV4 1AR74 1AR94 1RUH4 1RUI4 1COV4 2HWC4 1Z7S4 4Q4X4 1H8TD 1POV0 1AR84 2X5ID 4Q4W4 1RUJ4 1HRI4 2HWB4 3JD74 2PLV4 1K5MD 4Q4Y4 1HRV4 1VBB4 2RS34 1HXS4 1RHI4 1VBD4 1RUF4 2R064 1VBE4 4RHV4 2RS14 1NA1D 2RM24 1VBA4 1NCQD 2R074 1D4M4 1AR64 1PO14 1VRH4 2RS54 3J8F4 1PIV4 1RVF4 2RMU4 1RUG4 1EAH4 1OOPD 2R044 1RUE4 1RMU4 1R084 1RUC4 1VBC4 2RR14 1PO24 1R094 1PVC4 1ASJ4 1MQTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUD 4;  3JBG 4;  4PDW D;  4GB3 4;  4Q4V 4;  1EV1 4;  1AL2 4;  1BEV 4;  1AR7 4;  1AR9 4;  1RUH 4;  1RUI 4;  1COV 4;  2HWC 4;  1Z7S 4;  4Q4X 4;  1H8T D;  1POV 0;  1AR8 4;  2X5I D;  4Q4W 4;  1RUJ 4;  1HRI 4;  2HWB 4;  3JD7 4;  2PLV 4;  1K5M D;  4Q4Y 4;  1HRV 4;  1VBB 4;  2RS3 4;  1HXS 4;  1RHI 4;  1VBD 4;  1RUF 4;  2R06 4;  1VBE 4;  4RHV 4;  2RS1 4;  1NA1 D;  2RM2 4;  1VBA 4;  1NCQ D;  2R07 4;  1D4M 4;  1AR6 4;  1PO1 4;  1VRH 4;  2RS5 4;  3J8F 4;  1PIV 4;  1RVF 4;  2RMU 4;  1RUG 4;  1EAH 4;  1OOP D;  2R04 4;  1RUE 4;  1RMU 4;  1R08 4;  1RUC 4;  1VBC 4;  2RR1 4;  1PO2 4;  1R09 4;  1PVC 4;  1ASJ 4;  1MQT D; 
#chains in the Genus database with same CATH topology
 3AEE A;  4Q4V 4;  1XHX A;  1EV1 4;  1AL2 4;  3P4Q A;  1AR7 4;  3SUC A;  1XHZ A;  1Z7S 4;  1NEN A;  3AE2 A;  1POV 0;  3AEF A;  1HRI 4;  2WU5 A;  4YT0 A;  1HXS 4;  1RHI 4;  2R06 4;  1RUF 4;  3AEC A;  1XI1 A;  4RHV 4;  4YTN A;  1NEK A;  2RM2 4;  1VBA 4;  2ACZ A;  2R07 4;  1AR6 4;  1PO1 4;  3J8F 4;  1RVF 4;  2RMU 4;  1RUG 4;  2PYL A;  2R04 4;  1VBC 4;  2WQY A;  2WS3 A;  1PO2 4;  1RUC 4;  1R09 4;  1PVC 4;  2WDR A;  3CIR A;  3ABV A;  3SFD A;  2H89 A;  1BEV 4;  3AE5 A;  1RUH 4;  1COV 4;  3VRA A;  2HWB 4;  1K5M D;  2RS3 4;  3AEA A;  2FBW A;  3VR8 A;  1VBE 4;  2PYJ A;  3P4S A;  1YQ3 A;  1YQ4 A;  1VRH 4;  2RS5 4;  1PIV 4;  3AE1 A;  3VRB A;  3AE7 A;  1EAH 4;  3AE9 A;  3GQK A;  3AEB A;  2WDQ A;  4Q4Y 4;  4YSZ A;  4YTP A;  2WU2 A;  4PDW D;  4GB3 4;  3AE4 A;  1KF6 A;  3VR9 A;  2B76 A;  2HWC 4;  3AE3 A;  4Q4X 4;  4Q4W 4;  1HRV 4;  1VBD 4;  4YXD A;  1ZP0 A;  4YSX A;  2PY5 A;  3SFE A;  1NCQ D;  1D4M 4;  4KX6 A;  2EX3 A;  3AE8 A;  2H88 A;  2RR1 4;  3AEG A;  1MQT D;  2WP9 A;  1RUD 4;  3JBG 4;  3GQH A;  2WDV A;  3P4P A;  5C3J A;  1AR9 4;  1RUI 4;  1H8T D;  2X5I D;  1AR8 4;  1RUJ 4;  3JD7 4;  2PLV 4;  2PW9 A;  1VBB 4;  3AE6 A;  3P4R A;  1KFY A;  4YSY A;  2PZS A;  1L0V A;  2RS1 4;  1NA1 D;  3AED A;  4YTM A;  5C2T A;  2R7F A;  1OOP D;  1RUE 4;  1RMU 4;  1R08 4;  3FI7 A;  1ZOY A;  1ASJ 4; 
#chains in the Genus database with same CATH homology
 1RUD 4;  3JBG 4;  4PDW D;  4GB3 4;  4Q4V 4;  1EV1 4;  1AL2 4;  1BEV 4;  1AR7 4;  1AR9 4;  1RUH 4;  1RUI 4;  1COV 4;  2HWC 4;  1Z7S 4;  4Q4X 4;  1H8T D;  1POV 0;  1AR8 4;  2X5I D;  4Q4W 4;  1RUJ 4;  1HRI 4;  2HWB 4;  3JD7 4;  2PLV 4;  1K5M D;  4Q4Y 4;  1HRV 4;  1VBB 4;  2RS3 4;  1HXS 4;  1RHI 4;  1VBD 4;  1RUF 4;  2R06 4;  1VBE 4;  4RHV 4;  2RS1 4;  1NA1 D;  2RM2 4;  1VBA 4;  1NCQ D;  2R07 4;  1D4M 4;  1AR6 4;  1PO1 4;  1VRH 4;  2RS5 4;  3J8F 4;  1PIV 4;  1RVF 4;  2RMU 4;  1RUG 4;  1EAH 4;  1OOP D;  2R04 4;  1RUE 4;  1RMU 4;  1R08 4;  1RUC 4;  1VBC 4;  2RR1 4;  1PO2 4;  1R09 4;  1PVC 4;  1ASJ 4;  1MQT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...