1AR64

P1/mahoney poliovirus, double mutant v1160i +p1095s
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 2
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar6400
1D4M4 3J8F4 1VBD4 1EAH4 3JD74 1POV0 1AR94 2RR14 1RUJ4 1COV4 1VRH4 4RHV4 4Q4W4 1RHI4 1H8TD 1RUG4 1RUF4 1RVF4 2R044 1HRI4 1AL24 2PLV4 2R074 1AR64 2RS34 2RS54 4Q4Y4 4PDWD 2RMU4 3JBG4 1HRV4 1VBB4 2HWB4 1RUD4 1RUC4 1Z7S4 1OOPD 4Q4V4 2X5ID 1PO14 1VBA4 2RM24 1K5MD 1VBC4 1NCQD 4GB34 1HXS4 1BEV4 1MQTD 1PO24 1NA1D 1PVC4 1RUI4 2HWC4 2R064 1PIV4 1ASJ4 1RMU4 1EV14 1R094 1R084 1RUE4 1AR74 1RUH4 2RS14 1AR84 4Q4X4 1VBE4
chains in the Genus database with same CATH superfamily
1VBD4 5C2TA 3JD74 3AE9A 2RR14 3AE5A 2WDVA 1RUJ4 4YTNA 2WU2A 4YSZA 1RVF4 2R044 1HRI4 2PLV4 1AR64 2RMU4 3AE6A 3JBG4 1VBB4 2WQYA 1RUD4 3GQHA 3AEAA 1K5MD 4GB34 1HXS4 1BEV4 1PO24 1NA1D 1PIV4 1RMU4 3AEBA 3ABVA 3VR8A 4Q4X4 2B76A 3J8F4 1EAH4 1POV0 3P4RA 1NEKA 3AE8A 1RUG4 2H88A 2RS34 1AL24 3AEFA 4Q4Y4 2EX3A 3AE4A 2WU5A 2R7FA 2PZSA 1VBA4 2FBWA 4YT0A 2PY5A 1VBC4 3AECA 4YTPA 1RUI4 2R064 1ASJ4 1R084 1RUE4 1XHZA 1KFYA 2RS14 3AE7A 3AE3A 2PW9A 3CIRA 3SFDA 1AR94 1COV4 1VRH4 1RHI4 4YSXA 2WP9A 2WS3A 2ACZA 3GQKA 4YTMA 3P4PA 3VRBA 5C3JA 1RUC4 1OOPD 3AE1A 3FI7A 2RM24 3SUCA 3AEDA 3VRAA 2PYLA 4YXDA 1PVC4 2HWC4 4YSYA 3AEEA 1EV14 1ZP0A 1L0VA 1AR84 3AE2A 1D4M4 3VR9A 3P4SA 4RHV4 4Q4W4 1H8TD 1YQ3A 1ZOYA 1RUF4 2R074 2RS54 4PDWD 1HRV4 3P4QA 4KX6A 2HWB4 1KF6A 1Z7S4 4Q4V4 2X5ID 1PO14 2WDQA 3SFEA 1XI1A 3AEGA 1NCQD 1YQ4A 1XHXA 1MQTD 2PYJA 1NENA 2H89A 1R094 1AR74 2WDRA 1RUH4 1VBE4
chains in the Genus database with same CATH topology
1D4M4 3J8F4 1VBD4 1EAH4 3JD74 1POV0 1AR94 2RR14 1RUJ4 1COV4 1VRH4 4RHV4 4Q4W4 1RHI4 1H8TD 1RUG4 1RUF4 1RVF4 2R044 1HRI4 1AL24 2PLV4 2R074 1AR64 2RS34 2RS54 4Q4Y4 4PDWD 2RMU4 3JBG4 1HRV4 1VBB4 2HWB4 1RUD4 1RUC4 1Z7S4 1OOPD 4Q4V4 2X5ID 1PO14 1VBA4 2RM24 1K5MD 1VBC4 1NCQD 4GB34 1HXS4 1BEV4 1MQTD 1PO24 1NA1D 1PVC4 1RUI4 2HWC4 2R064 1PIV4 1ASJ4 1RMU4 1EV14 1R094 1R084 1RUE4 1AR74 1RUH4 2RS14 1AR84 4Q4X4 1VBE4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4M 4;  3J8F 4;  1VBD 4;  1EAH 4;  3JD7 4;  1POV 0;  1AR9 4;  2RR1 4;  1RUJ 4;  1COV 4;  1VRH 4;  4RHV 4;  4Q4W 4;  1RHI 4;  1H8T D;  1RUG 4;  1RUF 4;  1RVF 4;  2R04 4;  1HRI 4;  1AL2 4;  2PLV 4;  2R07 4;  1AR6 4;  2RS3 4;  2RS5 4;  4Q4Y 4;  4PDW D;  2RMU 4;  3JBG 4;  1HRV 4;  1VBB 4;  2HWB 4;  1RUD 4;  1RUC 4;  1Z7S 4;  1OOP D;  4Q4V 4;  2X5I D;  1PO1 4;  1VBA 4;  2RM2 4;  1K5M D;  1VBC 4;  1NCQ D;  4GB3 4;  1HXS 4;  1BEV 4;  1MQT D;  1PO2 4;  1NA1 D;  1PVC 4;  1RUI 4;  2HWC 4;  2R06 4;  1PIV 4;  1ASJ 4;  1RMU 4;  1EV1 4;  1R09 4;  1R08 4;  1RUE 4;  1AR7 4;  1RUH 4;  2RS1 4;  1AR8 4;  4Q4X 4;  1VBE 4; 
#chains in the Genus database with same CATH topology
 1VBD 4;  5C2T A;  3JD7 4;  3AE9 A;  2RR1 4;  3AE5 A;  2WDV A;  1RUJ 4;  4YTN A;  2WU2 A;  4YSZ A;  1RVF 4;  2R04 4;  1HRI 4;  2PLV 4;  1AR6 4;  2RMU 4;  3AE6 A;  3JBG 4;  1VBB 4;  2WQY A;  1RUD 4;  3GQH A;  3AEA A;  1K5M D;  4GB3 4;  1HXS 4;  1BEV 4;  1PO2 4;  1NA1 D;  1PIV 4;  1RMU 4;  3AEB A;  3ABV A;  3VR8 A;  4Q4X 4;  2B76 A;  3J8F 4;  1EAH 4;  1POV 0;  3P4R A;  1NEK A;  3AE8 A;  1RUG 4;  2H88 A;  2RS3 4;  1AL2 4;  3AEF A;  4Q4Y 4;  2EX3 A;  3AE4 A;  2WU5 A;  2R7F A;  2PZS A;  1VBA 4;  2FBW A;  4YT0 A;  2PY5 A;  1VBC 4;  3AEC A;  4YTP A;  1RUI 4;  2R06 4;  1ASJ 4;  1R08 4;  1RUE 4;  1XHZ A;  1KFY A;  2RS1 4;  3AE7 A;  3AE3 A;  2PW9 A;  3CIR A;  3SFD A;  1AR9 4;  1COV 4;  1VRH 4;  1RHI 4;  4YSX A;  2WP9 A;  2WS3 A;  2ACZ A;  3GQK A;  4YTM A;  3P4P A;  3VRB A;  5C3J A;  1RUC 4;  1OOP D;  3AE1 A;  3FI7 A;  2RM2 4;  3SUC A;  3AED A;  3VRA A;  2PYL A;  4YXD A;  1PVC 4;  2HWC 4;  4YSY A;  3AEE A;  1EV1 4;  1ZP0 A;  1L0V A;  1AR8 4;  3AE2 A;  1D4M 4;  3VR9 A;  3P4S A;  4RHV 4;  4Q4W 4;  1H8T D;  1YQ3 A;  1ZOY A;  1RUF 4;  2R07 4;  2RS5 4;  4PDW D;  1HRV 4;  3P4Q A;  4KX6 A;  2HWB 4;  1KF6 A;  1Z7S 4;  4Q4V 4;  2X5I D;  1PO1 4;  2WDQ A;  3SFE A;  1XI1 A;  3AEG A;  1NCQ D;  1YQ4 A;  1XHX A;  1MQT D;  2PYJ A;  1NEN A;  2H89 A;  1R09 4;  1AR7 4;  2WDR A;  1RUH 4;  1VBE 4; 
#chains in the Genus database with same CATH homology
 1D4M 4;  3J8F 4;  1VBD 4;  1EAH 4;  3JD7 4;  1POV 0;  1AR9 4;  2RR1 4;  1RUJ 4;  1COV 4;  1VRH 4;  4RHV 4;  4Q4W 4;  1RHI 4;  1H8T D;  1RUG 4;  1RUF 4;  1RVF 4;  2R04 4;  1HRI 4;  1AL2 4;  2PLV 4;  2R07 4;  1AR6 4;  2RS3 4;  2RS5 4;  4Q4Y 4;  4PDW D;  2RMU 4;  3JBG 4;  1HRV 4;  1VBB 4;  2HWB 4;  1RUD 4;  1RUC 4;  1Z7S 4;  1OOP D;  4Q4V 4;  2X5I D;  1PO1 4;  1VBA 4;  2RM2 4;  1K5M D;  1VBC 4;  1NCQ D;  4GB3 4;  1HXS 4;  1BEV 4;  1MQT D;  1PO2 4;  1NA1 D;  1PVC 4;  1RUI 4;  2HWC 4;  2R06 4;  1PIV 4;  1ASJ 4;  1RMU 4;  1EV1 4;  1R09 4;  1R08 4;  1RUE 4;  1AR7 4;  1RUH 4;  2RS1 4;  1AR8 4;  4Q4X 4;  1VBE 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...