1AR64

P1/mahoney poliovirus, double mutant v1160i +p1095s
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
60
Chain Sequence
b'GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 2
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar6400
3J8F4 1RUF4 2RS34 1AR74 1R094 2R044 1K5MD 1VBE4 2RS14 2RM24 1MQTD 2HWB4 1PO14 1Z7S4 1ASJ4 1PVC4 3JBG4 2R064 1RUC4 1PIV4 1POV0 1AR84 1PO24 1RUG4 4Q4Y4 4Q4W4 4Q4V4 1AL24 2R074 3JD74 2PLV4 1HRI4 1AR94 1RUI4 1VBA4 4GB34 4RHV4 2RMU4 4PDWD 1RUH4 1VBB4 1BEV4 1EAH4 1R084 1NCQD 1H8TD 1OOPD 1RMU4 1RUD4 1RUJ4 1VBD4 2X5ID 1RHI4 1D4M4 1EV14 1NA1D 1HRV4 2RS54 2RR14 1RVF4 1VRH4 1COV4 1VBC4 4Q4X4 2HWC4 1HXS4 1AR64 1RUE4
chains in the Genus database with same CATH superfamily
2RS34 1KF6A 4YXDA 2RS14 3P4SA 1ASJ4 1L0VA 3AE3A 1AR84 1PO24 2WP9A 3AECA 4Q4V4 3ABVA 1VBA4 4PDWD 1EAH4 1XHXA 1NCQD 2WS3A 1RMU4 1RUD4 1VBD4 3AE6A 3AEGA 3AE4A 1NA1D 3SFEA 2RS54 1RVF4 1VRH4 3AE2A 1XHZA 2H89A 3J8F4 4YTNA 1AR74 2WDVA 1K5MD 3P4RA 2RM24 1MQTD 2HWB4 1PO14 1Z7S4 5C3JA 1POV0 1ZP0A 4YTMA 2WQYA 1AL24 1RUI4 4GB34 4YSXA 4RHV4 2WDQA 1RUH4 3SFDA 1R084 3CIRA 2X5ID 1RHI4 3VR8A 3AEAA 5C2TA 1HXS4 2PYJA 1R094 2R044 2WU2A 2ACZA 2H88A 2PY5A 3JBG4 2R064 3AE7A 1RUG4 4Q4W4 2R074 3VR9A 2PLV4 1HRI4 1AR94 3SUCA 3AEBA 3AE8A 2RMU4 2PZSA 1BEV4 3VRAA 4YSZA 1OOPD 1RUJ4 3AE9A 1NEKA 2PW9A 1HRV4 4YTPA 1YQ4A 3GQKA 4Q4X4 2WDRA 1ZOYA 2HWC4 3P4PA 4YT0A 1RUE4 1RUF4 1VBE4 3AE5A 2FBWA 3AEDA 1PVC4 2PYLA 2EX3A 1RUC4 1PIV4 3P4QA 3AEEA 4Q4Y4 4YSYA 3JD74 1XI1A 2B76A 3GQHA 1VBB4 3FI7A 3VRBA 1H8TD 3AE1A 2R7FA 4KX6A 1D4M4 1EV14 1YQ3A 1NENA 1KFYA 2RR14 1COV4 1VBC4 3AEFA 1AR64 2WU5A
chains in the Genus database with same CATH topology
3J8F4 1RUF4 2RS34 1AR74 1R094 2R044 1K5MD 1VBE4 2RS14 2RM24 1MQTD 2HWB4 1PO14 1Z7S4 1ASJ4 1PVC4 3JBG4 2R064 1RUC4 1PIV4 1POV0 1AR84 1PO24 1RUG4 4Q4Y4 4Q4W4 4Q4V4 1AL24 2R074 3JD74 2PLV4 1HRI4 1AR94 1RUI4 1VBA4 4GB34 4RHV4 2RMU4 4PDWD 1RUH4 1VBB4 1BEV4 1EAH4 1R084 1NCQD 1H8TD 1OOPD 1RMU4 1RUD4 1RUJ4 1VBD4 2X5ID 1RHI4 1D4M4 1EV14 1NA1D 1HRV4 2RS54 2RR14 1RVF4 1VRH4 1COV4 1VBC4 4Q4X4 2HWC4 1HXS4 1AR64 1RUE4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J8F 4;  1RUF 4;  2RS3 4;  1AR7 4;  1R09 4;  2R04 4;  1K5M D;  1VBE 4;  2RS1 4;  2RM2 4;  1MQT D;  2HWB 4;  1PO1 4;  1Z7S 4;  1ASJ 4;  1PVC 4;  3JBG 4;  2R06 4;  1RUC 4;  1PIV 4;  1POV 0;  1AR8 4;  1PO2 4;  1RUG 4;  4Q4Y 4;  4Q4W 4;  4Q4V 4;  1AL2 4;  2R07 4;  3JD7 4;  2PLV 4;  1HRI 4;  1AR9 4;  1RUI 4;  1VBA 4;  4GB3 4;  4RHV 4;  2RMU 4;  4PDW D;  1RUH 4;  1VBB 4;  1BEV 4;  1EAH 4;  1R08 4;  1NCQ D;  1H8T D;  1OOP D;  1RMU 4;  1RUD 4;  1RUJ 4;  1VBD 4;  2X5I D;  1RHI 4;  1D4M 4;  1EV1 4;  1NA1 D;  1HRV 4;  2RS5 4;  2RR1 4;  1RVF 4;  1VRH 4;  1COV 4;  1VBC 4;  4Q4X 4;  2HWC 4;  1HXS 4;  1AR6 4;  1RUE 4; 
#chains in the Genus database with same CATH topology
 2RS3 4;  1KF6 A;  4YXD A;  2RS1 4;  3P4S A;  1ASJ 4;  1L0V A;  3AE3 A;  1AR8 4;  1PO2 4;  2WP9 A;  3AEC A;  4Q4V 4;  3ABV A;  1VBA 4;  4PDW D;  1EAH 4;  1XHX A;  1NCQ D;  2WS3 A;  1RMU 4;  1RUD 4;  1VBD 4;  3AE6 A;  3AEG A;  3AE4 A;  1NA1 D;  3SFE A;  2RS5 4;  1RVF 4;  1VRH 4;  3AE2 A;  1XHZ A;  2H89 A;  3J8F 4;  4YTN A;  1AR7 4;  2WDV A;  1K5M D;  3P4R A;  2RM2 4;  1MQT D;  2HWB 4;  1PO1 4;  1Z7S 4;  5C3J A;  1POV 0;  1ZP0 A;  4YTM A;  2WQY A;  1AL2 4;  1RUI 4;  4GB3 4;  4YSX A;  4RHV 4;  2WDQ A;  1RUH 4;  3SFD A;  1R08 4;  3CIR A;  2X5I D;  1RHI 4;  3VR8 A;  3AEA A;  5C2T A;  1HXS 4;  2PYJ A;  1R09 4;  2R04 4;  2WU2 A;  2ACZ A;  2H88 A;  2PY5 A;  3JBG 4;  2R06 4;  3AE7 A;  1RUG 4;  4Q4W 4;  2R07 4;  3VR9 A;  2PLV 4;  1HRI 4;  1AR9 4;  3SUC A;  3AEB A;  3AE8 A;  2RMU 4;  2PZS A;  1BEV 4;  3VRA A;  4YSZ A;  1OOP D;  1RUJ 4;  3AE9 A;  1NEK A;  2PW9 A;  1HRV 4;  4YTP A;  1YQ4 A;  3GQK A;  4Q4X 4;  2WDR A;  1ZOY A;  2HWC 4;  3P4P A;  4YT0 A;  1RUE 4;  1RUF 4;  1VBE 4;  3AE5 A;  2FBW A;  3AED A;  1PVC 4;  2PYL A;  2EX3 A;  1RUC 4;  1PIV 4;  3P4Q A;  3AEE A;  4Q4Y 4;  4YSY A;  3JD7 4;  1XI1 A;  2B76 A;  3GQH A;  1VBB 4;  3FI7 A;  3VRB A;  1H8T D;  3AE1 A;  2R7F A;  4KX6 A;  1D4M 4;  1EV1 4;  1YQ3 A;  1NEN A;  1KFY A;  2RR1 4;  1COV 4;  1VBC 4;  3AEF A;  1AR6 4;  2WU5 A; 
#chains in the Genus database with same CATH homology
 3J8F 4;  1RUF 4;  2RS3 4;  1AR7 4;  1R09 4;  2R04 4;  1K5M D;  1VBE 4;  2RS1 4;  2RM2 4;  1MQT D;  2HWB 4;  1PO1 4;  1Z7S 4;  1ASJ 4;  1PVC 4;  3JBG 4;  2R06 4;  1RUC 4;  1PIV 4;  1POV 0;  1AR8 4;  1PO2 4;  1RUG 4;  4Q4Y 4;  4Q4W 4;  4Q4V 4;  1AL2 4;  2R07 4;  3JD7 4;  2PLV 4;  1HRI 4;  1AR9 4;  1RUI 4;  1VBA 4;  4GB3 4;  4RHV 4;  2RMU 4;  4PDW D;  1RUH 4;  1VBB 4;  1BEV 4;  1EAH 4;  1R08 4;  1NCQ D;  1H8T D;  1OOP D;  1RMU 4;  1RUD 4;  1RUJ 4;  1VBD 4;  2X5I D;  1RHI 4;  1D4M 4;  1EV1 4;  1NA1 D;  1HRV 4;  2RS5 4;  2RR1 4;  1RVF 4;  1VRH 4;  1COV 4;  1VBC 4;  4Q4X 4;  2HWC 4;  1HXS 4;  1AR6 4;  1RUE 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...