2PYJA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
567
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTA(DOC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 173
structure length 567
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pyjA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pyjA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pyjA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pyjA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pyjA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pyjA06
1LAVA 2OA8A 2IAJA 4E7HA 3QEWA 3QEPA 4KTQA 2G8HA 1TL1A 2F96A 3QETA 4MFBA 1DLOA 1F21A 4C8NA 2X6NA 4KI4A 3V6DA 1EKEA 3LAKA 3NGYA 4CHOA 1JLEA 4FLUA 2IGIA 3T3FA 3VQ6A 4CESA 4DTRA 3G10A 3KTQA 3ISNC 3AO4A 3V1OA 4MQ3A 3NAEA 2YKMA 3HPOA 4M3YA 1JLCA 1U45A 1CXQA 1L3UA 4B8CA 3LAMA 1QSSA 2E6LA 1KRPA 4KPYA 4PY5A 1BI4B 3OYCA 3DLEA 1QQCA 3MECA 3PX6A 4CGJA 2DFFA 2HVIA 4IG0A 1IKYA 1LW0A 4B9VA 2KZZA 4ID1A 2XY7A 3SYZA 1FKOA 4QOZB 4LD0A 4ZHRA 5KTQA 3V9XA 2G8WA 2HHWA 1B9FA 4FLTA 3QEVA 3B6OA 4PWDA 4E19A 2OPPA 3M8RA 5I42A 1JLFA 3NH2A 3ZCMA 3AV9A 4AHRA 1TV6A 3LPUA 3S3NA 1TAUA 4AHSA 1WSEA 4H4MA 4FJ9A 4ZTJA 1EX4A 1A5XA 4CJVA 1KVBA 4Y1CA 3V9WA 1VSKA 2ATQA 5CY4A 4CEQA 3OS1A 3K57A 4DWIA 4F3OA 4QCLA 3SQ1A 1WNSA 3HPHA 4FJMA 4E1MA 3OS2A 3TAQA 4RW7A 4BWJA 4FJ8A 3U3GA 3D45A 3DOLA 3U3YA 4G1QA 3DOKA 1BCOA 4O4GA 3MEEA 1J54A 4FVMA 2YKNA 3QEIA 4CERA 4O5BA 3CQ8A 1Q9XA 4DLGA 3BGRA 4BE2A 4CF9A 4DF4A 1NK9A 1B9DA 3AVCA 3K5LA 3PX4A 1SL0A 1TAQA 5FDLA 3NGIA 4AHTA 2RKIA 4DSJA 2D5RA 1Q8IA 3K58A 3KKRA 4CIGA 4NYFA 3VQEA 4C8MA 4LSLA 4B9LA 2WOMA 1B92A 1LWFA 3AVBA 4ICLA 5JS1A 4K8ZA 3L2RA 3OYAA 2X6SA 2E4LA 1QHTA 2DFEA 4OPJA 2HHTA 1IKVA 3V1RA 3O3GA 1TKDA 1L3VA 3HYFA 4OKJA 1KTQA 1VSHA 3VQ8A 1C0MA 4H4OA 4CE9A 4EP4A 3OS0A 4OVLA 4BE1A 1S5JA 4BE0A 1ZYQA 3SQ0A 4CF2A 3OYLA 4L8RB 5J2NA 4FLWA 3L2VA 1JL1A 3EYZA 3NH1A 3KK3A 2KQ2A 2QXFA 5FROA 3OJUA 4FJ7A 2R7FA 2XY6A 3KK2A 1VK0A 4FW2A 4IFVA 4DU3A 1L3TA 1ASUA 4CHNA 4HUEA 4F4KA 1W9HA 4CFDA 2PYJA 2XO7A 3ZSYA 1RTHA 3VA0A 3TAEA 1RTDA 4I2QA 1KCFA 4B9NA 4O44A 2PW9A 3VQAA 3DLKA 3VQBA 1EETA 2IDOA 4CEFA 3DLHA 4GVMA 1HQEA 4N76A 1RBSA 4KHUA 3I0SA 1L3SA 1CLQA 3V9ZA 2P51A 1JLGA 3V4IA 1U04A 4CK3A 4Z4FA 1NK5A 2BGGA 3NF7A 4DTNA 1SKWA 1NK4A 1RBRA 4DMNA 2VG6A 4Z0UA 1J5OA 2DTUA 1KVAA 1BHLA 1XI1A 3P83D 1TGOA 1C1CA 4F2SA 3CG7A 3VQQA 4CJ3A 3B6PA 3RRHA 1X9MA 1KLNA 1C1BA 3TANA 4CFCA 2IS3A 5CYMA 4DU1A 4DTXA 4C8KA 3U6FA 4DFPA 1JXEA 1BQNA 3O3HA 4B08A 1REVA 3K5NA 3EY1A 4O0JA 3M8SA 5D3GA 3HP6A 3OYFA 4Y1DA 2VG5A 2YV0X 3NF6A 3TWHA 1RDBA 1SUQA 1HNVA 3KLEA 4BDZA 3RMCA 1X9SA 3K5MA 1YVUA 2LSNA 4CHPA 3LZJA 3DM2A 3AA5X 3S3OA 4CECA 1S6PA 5C24A 4RW6A 3AVHA 1WAJA 2HHVA 2OPSA 3BDPA 1VRTA 1SKSA 1NKBA 3NBPA 3H08A 3ZSXA 3DLBA 3OYDA 4B9UA 5KRSA 4FZYA 5FRNA 4CJEA 4E0DA 2B5JA 4CJUA 1RBTA 3KIOA 3KLIA 1NJWA 5KI6A 4CGHA 1TKZA 4W5OA 2RF2A 1RT6A 4R5PA 3JSMA 3IRXA 1QE1A 1C0UA 4CGIA 1IH7A 1TVRA 4E89A 4CEBA 4TSXA 2ITGA 2YHAA 4CK2A 4NCBA 1EP4A 4M45A 4DTMA 3AO5A 1RTIA 3OJSA 1U47A 4OJRA 4NYNA 1WAFA 1J53A 1RBUA 3AO2A 4HHTA 3QNNA 3RMDA 4Q0BA 3LPTA 2D0CA 2FC0A 2ZQBA 2WONA 4I7FA 3OYIA 3L3UA 1JL2A 3V9UA 5J1EA 3PX0A 3LALA 4M3XA 3KJVA 4FM1A 3RTVA 3TABA 4M3ZA 3NGZA 2XRIA 2AJQA 1GOBA 1JLBA 5JS2A 2KZMA 4CJRA 4CJFA 3T1AA 4I9LA 4RW4A 3SCXA 3WNFA 4KHSA 3LWLA 2Z1IA 1BISA 2O4IA 2DFHA 4FM0A 3HT3A 4KTZA 1T8EA 3AVLA 2R7YA 4M3UA 2DY4A 1ASWA 5HRSA 2Y1JA 1XC9A 2OYQA 1BQMA 1D5AA 3K59A 4KTWA 4KB1A 2Q3SA 3OYEA 3CM5A 3QLHA 5CZ2A 2PYLA 4CJ5A 5E41A 1NJYA 3UIQA 1S9GA 4DSIA 2HNYA 4B9SA 4I9QA 5HRNA 1U49A 1S9EA 4W5RA 3SPZA 2B4JA 4DQQA 4KI6A 4M42A 4CF1A 3OY9A 4HUGA 4DFMA 4Z4EA 4DFKA 4KHNA 2HHSA 1KVCA 1ASVA 4C8LA 3IS9A 4FJGA 2GUIA 1NK8A 3G0ZA 3S9HA 1XHZA 4DTPA 3ZT0A 3F73A 4H8KA 3RR7A 2P5GA 1CZBA 3AA3A 3HXMA 1QSLA 3AA2A 4OLBA 4I2PA 2HB5A 5J2PA 4CJTA 1UOCA 3LWMA 1BGXT 3MXMA 1KFSA 3SUNA 4B9TA 1TL3A 4HTUA 2I5JA 3SUQA 3AVNA 5KGXA 4IKFA 3OYMA 3KKSA 4JS5A 4E7LA 1LW2A 1JLAA 1VSMA 1DTQA 4DSKA 2ETJA 2ZE2A 3ZT3A 1VSEA 3C6UA 1RT3A 4Z4HA 2W42A 3SZ2A 3WNGA 3ALYA 3ZT1A 3NFAA 3QIPA 3TI0A 1A5VA 3AO3A 4CGDA 5HRPA 4BWMA 3OYJA 2BANA 1VSDA 3LP0A 1ZBLA 3ASMA 4CJLA 3KLHA 4DSEA 2E6MA 4FXDA 3T19A 3NDKA 4KB0A 1NK7A 3VQCA 4FJIA 4DG1A 1T7PA 1HYZA 4RW8A 4PQUA 4FJNA 1QTMA 3SUPA 1YT3A 3K5OA 2JLEA 4IDKA 4CJQA 4C8OA 3S3MA 4KFBA 2Z1JA 4FJJA 1KLMA 1D9FA 3QNOA 2G8FA 1S1UA 4W5NA 1BL3A 2QKKA 4AHCA 3HJFA 1ZBFA 1UWBA 4M3RA 3ZSVA 4BDYA 1K6YA 5HROA 3L2UA 4JS4A 4M41A 4AH9A 1BIZA 5CZ1A 4YNQA 1SL2A 4ELUA 5KGWA 3NF8A 3PO4A 5HBMA 4J2AA 4KAZA 1IG9A 2EX3A 4F3TA 4DFJA 3QO9A 1J9AA 3TAMA 3AVIA 3A2FA 4KV8A 4FCYA 3SV4A 3PV8A 4FJLA 4M3WA 2KTQA 1T05A 4EZ9A 4CIEA 2BE2A 1D8YA 4FLZA 3SQ4A 1ZBHA 1S1WA 3AVGA 1VSFA 1HQUA 2OPQA 3VQDA 4LY7A 3NCIA 4F2RA 4OLAA 1RNHA 1CXUA 3AO1A 1VSIA 4DQSA 2HVHA 3HL8A 4O55A 1RILA 4CK1A 4J2EA 4E3SA 3SJJA 2PY5A 4DQPA 1C6VA 1RT4A 5T7BA 3HP9A 1HYSA 3SQ2A 1LWEA 2YHBA 1X9WA 1ITGA 4DS5A 1SKRA 1FXXA 1LAWA 2HNDA 3MEGA 1HJRA 4N5SA 1TK5A 4BDPA 4FK4A 3DRSA 2XY5A 3CFPA 3IG1A 2G8VA 1GOAA 3WNHA 1RT2A 1O1WA 3MEDA 3NH0A 4RG8A 4JRQA 3V9SA 2VWKA 4GW6A 1RDAA 4CEAA 4DTJA 2P5OA 4DQRA 1W0HA 3QESA 3HSTB 1NJXA 3CM6A 3VA3A 3QINA 1QS4A 1FK9A 1JKHA 4OKEA 4UQGA 2FBTA 3M8PA 2GBZA 1YTAA 3ZSWA 3KD1E 2GV9A 3E01A 5I3UA 4LH4A 1RBVA 4CEEA 3JYTA 5HRRA 1L5UA 1BCMA 1MU2A 4IBNA 1NJZA 4HVJA 4AHUA 3NE6A 1WSIA 1HRHA 4J2BA 1IKXA 5C42A 3OYGA 3OYKA 3F9KA 1T03A 4DQIA 3HVTA 1RT5A 3RMAA 1RDCA 4FJHA 4Z4IA 1KSPA 3HO1A 1RDDA 5HP1A 5K14A 3LP3A 5EU7A 4CJKA 4E7JA 3SNNA 4FW1A 3LP1A 2NUBA 3ZSQA 4CFAA 3TAFA 2YNHA 3ZSZA 4CIFA 1HMVA 1C1AA 4ZTFA 4FJXA 1TKTA 4KO0A 3C94A 5J2MA 3I0RA 1DTTA 4GMJB 4E1NA 3TARA 3AVJA 1HPZA 3ITHA 3O4QA 4ID5A 4NCGA 1XHXA 2YNIA 3CFOA 4QAGA 4FJKA 3TR8A 3RR8A 4YFUA 1Z25A 4B8AB 4XIUA 2XHBA 4CHZA 1VRUA 3DLGA 3ZT2A 4CJWA 1SV5A 1LWCA 2PZSA 5SWMA 5DMRA 3L8BA 3NF9A 1Y97A 4JRPA 2O4GA 3OYNA 3KLFA 4IFYA 4HCBA 4KRFA 1S6QA 4CJSA 1NK0A 4Q5VA 2RPIA 3TAPA 4CHYA 4RW9A 2HW3A 2IOCA 1IKWA 2FBXA 4CF0A 3ZT4A 4LH5A 4AHVA 4HCCA 4CEDA 3WNEA 1SL1A 3LP2A 2QKBA 4FZXC 1WSFA 2IC3A 1RCHA 4DF8A 1R0AA 4N56A 3AVKA 1U4BA 4ELTA 5DK5A 5CYQA 3SV3A 1TK0A 3I8DA 4PUOA 2G8IA 2Z1GA 1UA0A 1N6QA 1Q9YA 1NOYA 4WE1A 4BACA 3QERA 1WSJA 3P1GA 1UAXA 4O0IA 4FYDA 3RRGA 2KFNA 1C0TA 2P1JA 1I39A 3L3VA 3SI6A 3PY8A 3L2WA 1JXBA 1NKCA 4B9MA 3HK2A 2G8KA 1HYVA 1X1PA 1HNIA 4Z4CA 2BDPA 4NCAA 1CZ9A 2JGUA 1RT7A 4OKKA 3O4NA 3FFIA 1KFDA 3LDSA 3LZIA 2G8UA 1S1XA 1U48A 2EHGA 4LSNA 4M3TA 4CEZA 3FI7A 3ZSOA 4DTUA 2YNGA 3P5JA 4CJPA 2X74A 2HNZA 4E7KA 2A1RA 1NK6A 4FJ5A 2YNFA 1GOCA 4KKOA 1S1VA 1TKXA 3CFRA 2HHXA 1TK8A 4FK0A 5J2QA 1VSLA 2F8SA 3MAQA 3ZSRA 3QEXA 4FLYA 4CGFA 3VQ4A 4DLEA 3DYAA 3K2PA 2Y1IA 4N41A 4DSLA 4KHQA 4DS4A 3MXJA 4EP5A 1WLJA 1NKEA 3KLGA 2FBVA 1JLQA 3D0PA 1ZBUA 2F8TA 3VQ7A 1G15A 1YTUA 3RMBA 1WSGA 2ZD1A 3V1QA 4CGGA 2A1SA 2OPRA 3MXIA 2XY8A 4FLVA 4CEOA 4Z4GA 3EZ5A 4CFBA 2OZMA 4OGCA 2D0AA 3QIOA 2VG7A 3OYHA 4HUFA 1BIUA 4KHYA 1WSHA 4W5TA 4J2DA 5FRMA 3HPGA 3PO5A 4AILC 4DSFA 1Z26A 4CCHA 3O3FA 1FKPA 3C95A 4OGEA 3NHGA 3TAGA 4KHWA 4DU4A 4EZ6A 3DRPA 3CYMA 1BI4A 2HMIA 4CHQA 4FM2A 3DI6A 1EXQA 1RT1A 3OVNA 2FBYA 4FZZA 1WN7A 3HVRA 3SUOA 3AA4A 1NOZA 4K8XA 1XWLA 2Z1HA 1D9DA 4N47A 4FLXA 2X78A 5C25A 3AVAA 3VQ9A 3VQPA 3LANA 1I3AA 4W5QA 1VSJA 3C6TA 3V81A 3OYBA 1QSYA 3THVA 3L2QA 2RN2A 3VN5A 4CF8A 2OZSA 4B3OA 5KRTA 3KD5E 1S1TA 4PA1A 4ELVA 4JLHA 3RWUA 2HHQA 2HHUA 3M8QA 3AVMA 3SPYA 1A5WA 3KK1A 1LV5A 3VQ5A 2B6AA 3DMJA 5SZTA 3IAYA 1IO2A 2KFZA 3HM9A 4IG3A 2D0BA 4DTOA 4F8RA 4DTSA 1N5YA 1ZBIA 4KREA 3ULDA 3DLRA 5HLFA 1UA1A 3PUFA 2VWJA 2QK9A 2KW4A 3DRRA 4FK2A 4E7IA 4OPKA 3AVFA 1RTJA 4CJ4A
chains in the Genus database with same CATH superfamily
1LAVA 2NNWA 3LDLA 3QEPA 5B8HA 3QETA 4H03B 3ZMUA 1U96A 3SPHA 4C8NA 4D7SA 4CHOA 4FFKA 4BIUA 4FLUA 2NRWA 2QGNA 3JCZA 3CCEN 2GUZB 5FPDA 2WQYA 4YSZA 2DYSB 4DO2A 1BWFO 4Z1VA 4DYLA 4DV7K 3HPOA 3PN1A 1U45A 2ZINA 1CXQA 2F7TA 1L3UA 4H5TA 1P7BA 4GLXA 4PY5A 4IEEA 1GM9A 1BI4B 3FR0A 2DFFA 5AQWA 3ZMVA 3HKEA 1VBB4 2E2QA 2HWB4 5D5PA 3O9RA 3LUTB 2XY7A 2H3GX 4QOZB 1WBDA 4LD0A 3CMEN 1WPXA 2HHWA 3B8AX 3H1LH 3UQ8A 1OCRB 3CCMN 5I42A 3LDCA 3NH2A 4LFAO 3ZCMA 4C1NI 4U67L 2QEXN 1TV6A 4DV5K 4JI8O 4JKHA 5IE9A 3ZBHA 4DW0A 1WSEA 5F1XA 4FJ9A 4ZTJA 1EX4A 4CJVA 3V9WA 1VSKA 4LF8B 5CY4A 1GLEG 1T3VA 3HPHA 3C6AA 2QWOA 2YXLA 4RW7A 1T6DA 4BWJA 4UB6Z 3DOLA 4WQ4C 3I8BA 1DGSA 4G1QA 2FXUA 2F66C 4O4GA 1YJWV 4FVMA 3H1IH 4I5SA 4O5BA 3CQ8A 5GIOA 1H2MA 3BGRA 4G27B 2P9NA 3CPEA 1B9DA 3K9KA 3QFPA 4BE2A 4DF4A 5AQPA 3K08A 1P90A 2IW5A 5IT9N 1I5XA 3RYCA 5LHGA 3CMAV 4DV0O 2Z3YA 1ENVA 2RKIA 3HI0A 1XMQK 4DSJA 2D5RA 4CH3A 1AB3A 3K58A 3VENA 1EZVH 1COV4 3M99B 1CEZA 1V55B 1MG1A 3DGEA 2HHHK 3CCLV 4ICLA 1JA8A 3G71V 1IBKB 5M1PA 4GV3A 3DXMB 2E4LA 1QHTA 5AQXA 3IC7A 5EC2C 5LBQA 1IKVA 3V1RA 4OPJA 3O3GA 3AG4C 4JI0K 4DR1K 1RSOA 1R73A 4H0VB 3VQ8A 1EWQA 4V19S 4ZOLA 3IDHA 4AQYK 2R044 1OV9A 2RMU4 1S5JA 4IIJB 3OYLA 4L8RB 2NR5A 5JVHL 3L2VA 1V9PA 2DQ3A 3ZYYX 5AQMA 1BO5O 3OJUA 1R3IC 3ZN0A 2P9LA 4NYKA 3VRAA 4IFVA 2E75B 1N0NA 2LGWA 3TXQA 3HRGA 3H1KH 4HUEA 3JASA 4CFDA 2PYJA 4DR7B 5EIBC 2WTUA 3O9UA 3ZRSA 4FWRA 3CRAA 1HWYA 5FNVB 2NRHA 4PDMA 4H0OA 3WG7C 3QVNA 4BC2A 1NCQD 5ITZA 5TKYA 5DECA 3TK1A 3VQAA 3OMNB 4JI5K 5IWAB 3EL2A 4CZHA 2B1IA 5H5NA 5KHKA 4DV3K 5EX5A 1MNGA 2JVDA 4CD3A 3J80N 5C10A 4KHUA 3ZHRA 1U04A 1Z5VA 4X8AA 3FKSG 4JKEA 4DMNA 2O8FA 2GX9A 4O4LB 2RJZA 1KVAA 4BW9A 3ABMC 2CH5A 3P83D 3VEZA 1C1CA 1HX1A 3Q7CA 3VEWA 4ZI7B 1C1BA 3AECA 2KQXA 4LNUB 4XDKA 2E5LO 1BQNA 1X4TA 5EYPB 5CA0A 3M8SA 2X6CA 1AI6A 2RDCA 4IHJB 4N23A 4DK1A 2Q7GA 4DV4B 4YJ2A 2PF4E 1TA8A 2YV0X 1MOFA 3NF6A 4GNIA 2FBWA 4H44B 4MVZA 1KF6A 4BDZA 1X3MA 1X9SA 5KMGA 5BRDA 4IWVA 4X9QA 3SR2C 1VQ5V 1NTMH 1YVUA 2ZE5A 4JI7K 3AA5X 4CECA 4GX2A 1S6PA 1KP2A 3AE9A 4RW6A 1BE3H 4GX0A 1N33O 3E9PA 2HHVA 3VQXA 1KAXA 2XOKG 3NXSA 4H5RA 5C2FA 4PA6A 5GTHZ 3NBPA 3H08A 3ZSXA 3DLBA 3OW2M 4B9UA 3SPGA 3P4PA 3DC6A 4P9OA 4E0DA 2Q9LA 1S72N 3KIOA 1UPGA 3CCUN 4O8KA 3KCYA 4FSVA 4IEIA 3P38A 4R5PA 4AM6A 3CPWU 3R6MA 1FW6A 1PNKA 4LH6A 2YHAA 1T5EA 1Z5WA 1JCFA 1GAXA 2YJFA 3HOTA 1RDWX 3SPJA 4GY2B 2ZJPL 1U47A 4OJRA 3RMDA 3ZEDA 4HHTA 1W7AA 4BRGA 1IBLO 1CP9A 5L3DA 5IDJA 3OYIA 1URFA 5BPLA 3LALA 4FM1A 2V7YA 4PDLA 4W4KA 3L75H 1JLBA 1GOBA 1QR8A 3I55N 1OH6A 4FVUA 3TSPA 3RWRD 3G6EV 5C3JA 4RW4A 4MTXA 3WNFA 1L1FA 2HVJC 3LWLA 2Z1IA 1BISA 3FZHA 3NR7A 4JK8A 1GMGA 4FM0A 3CCSV 1DK1A 4KTZA 1T8EA 2OYQA 4KTWA 1D5AA 3GBTA 4BY9C 4CJ7A 3J7ZO 5CZ2A 2PYLA 2HR3A 1ZC6A 4YTPA 1NJYA 2VQEB 4DUZK 4DSIA 4JI6B 4YY3B 1S9EA 2JWKA 4M63C 4G9ZA 1RDUA 4UY8O 4Q4V4 3OEEG 5M1QA 1N34O 4KI6A 4NXNO 4YDUA 4M42A 3OY9A 5AR0A 4PDVA 2DYRC 5B5EZ 4K0KB 2ZWHA 1QQNA 3LNNA 1KVCA 4B1XB 3SFEA 4IL6Z 3L4IA 4FJGA 3FYEB 1XHZA 1G99A 2W6KA 3IUCA 5AG2A 4H8KA 2E8AA 2CK3G 1BGYH 3AA3A 4FPAA 4B3TO 2WUSA 3FLCO 4NXMK 4I2PA 1GH6A 5L3GA 1YXQA 1Z6RA 5LOVA 1NVPD 3LSSA 1NGIA 2QWPA 3SUNA 4O5FA 3L70H 4B7EA 4DV1K 3P30A 1Y74A 3KKSA 3WXLA 1SQXH 2ETJA 3ZT3A 4B3SB 1NGDA 4JKAA 1PL4A 2W0XA 1PV0A 1YJ9V 1IXBA 5I9EB 4YDUC 3HKEB 3RGBA 4JPRA 3NFAA 4FO0A 4XBFA 3AO3A 1SF9A 3ZT1A 1TYQA 3TI0A 4BWMA 3OYJA 3ZCCA 3U0ZA 4R8CA 5M1FA 4GV9A 4IJNA 4DV2O 4FXDA 1I5YA 3WXKA 1CXZB 3OA9A 5GINA 3VQCA 3CIRA 4RW8A 5E84A 1FFXA 1QTMA 1H2SB 5BN8A 5EZYA 3K5OA 4CJQA 4FJJA 4F6RA 2NZTA 3CC7N 2Q2RA 2P6JA 1VP7A 1KLMA 3RYHA 1D9FA 3KK7A 2G8FA 1QVFM 4ZBMA 4W5NA 1HLUA 2F4VK 4AHCA 1M93A 2QWOB 1Z05A 4I4TA 1ZBFA 3W7XA 3FZFA 2XAHA 4H0YB 4M3RA 4BDYA 5HROA 1D2DA 1GLJO 3OBYA 3RSEB 3L2UA 1MA1A 3AG4B 3IMXA 5GAGP 4LF5O 1SL2A 4ZHQA 2WFBA 1AJQA 1XNQB 4DUYO 3I56N 5HBMA 4KAZA 4KHPB 2LQTA 3P3NA 3S3WA 5M1NA 3MN7A 2EX3A 3ATUA 1KMIZ 3TAMA 1SQPH 3A2FA 5JVDA 3AVIA 2CGOA 3RYCB 2CE4A 2OCCC 3B09A 4QS9A 3PV8A 2IH1C 4DR7O 4UCVA 1BG3A 1D8YA 4CS4A 3E86A 4FOEA 1HR0B 2OPQA 3NCIA 1VQ9N 2VGNA 4A59A 2VRZA 3AO1A 4DQSA 3AE8A 3HL8A 4O55A 3AE7A 1RILA 4B3MK 4BG8A 1BSMA 1XMOK 1F4MA 1E4FT 3UKUA 3ZRWA 1K73O 2Z5UA 3SMPA 1TUBA 3VF2A 3AEBA 4DS5A 2ILMA 1LAWA 2HNDA 4BDPA 3P4QA 5AZJA 4JYYA 4GKJO 3NVKA 1VIBA 3SBTA 4LF4O 2G8VA 4ZOLB 1GOAA 3TSQA 2QKCA 4LF9B 4CBUA 1JOYA 3H9VA 3MEDA 4UXNA 2VWKA 4JI1B 3APQA 1HNXB 4DR6O 4J42A 1K7DA 5F0XA 4X65O 3JSNA 4YJ3A 1MMMA 1JKHA 4UQGA 2WLHA 4LFBB 3KD1E 3JASB 5GAEP 4FWNA 4HWIA 4LH4A 4JV5B 4WF9L 1WP7A 5ITZB 3R65A 4IBNA 3E22A 1R084 2A5XA 3WB1A 2JWLA 3NE6A 3DXKA 4W4LA 5LMUB 1WSIA 4J2BA 1MZEA 1NM1A 3C65A 3VF6A 4EAHD 4LF7B 1RT5A 3R9PA 3RMAA 3HO1A 4FJHA 2UXCK 1GN4A 3K0GA 5K14A 4LC9B 4E7JA 4FW1A 1GK9A 1NQTA 4NB5A 5GONA 2DQ0A 4FZ1A 3TAFA 1K73W 2FSKA 2HF3A 2Q0AA 3P32A 3SMSA 3OE7G 3GQKA 1SAZA 3TETA 1TKTA 3CJ1A 2L35A 4K42A 1DTTA 4GMJB 1THZA 4E1NA 3AVJA 3ZETA 2YNIA 4I50A 3SJCC 3MWTA 5CA0B 1D5NA 4WCEV 4Q4W4 3L4QA 1W0JG 4CHZA 3VF4A 3SJHA 1QLNA 1SV5A 5B3SC 4JRPA 1BA1A 3HM8A 3CJ7A 3B4SA 4JKCA 1EN6A 1I94O 4CJSA 1NK0A 3CJBA 5KMGB 2Y48A 4RW9A 3G4SN 1VQON 3RFRA 2Q5ZA 3ZT4A 4CF0A 2KKZA 3UM7A 3GE1A 4AHVA 4X1YA 3HOSA 1PIV4 4FZXC 3T1YB 4RQEA 2IC3A 3AY9A 1K5QA 1S5HC 5CB4B 4A5AA 4DF8A 3FAVB 1R0AA 3LSQA 3AVKA 1OHHG 5BR9A 4ELTA 3H01A 5KAIZ 3I8DA 5C2DA 1VHXA 2W0FC 4CD1A 1NOYA 2P7TC 1JCHA 3P1GA 2ZDIA 1S72V 2CGKA 4RUFA 4KBOA 4X66O 3CCUV 3SI6A 2UUBO 2UXBK 1JQ0A 2W6LA 4BRNA 1NKCA 5EBMC 4PHTX 3CC4N 4RAIA 3O1WA 1RT7A 2EJ7A 3LZIA 3O4NA 5L3BA 1U48A 2EHGA 4JN4A 4LSNA 3FI7A 4TQFA 4DTUA 2YNGA 4EFBA 4JHDA 3P5JA 1PNLA 4CJPA 4FJ5A 1DT9A 5EVZA 4EKWA 4YHHK 2A6AA 1YITN 1BOTO 4OX9K 2DYRB 1BQ0A 2QWQA 5LMNO 3QFUA 4MS2A 1I08A 5J2QA 1VSLA 2P22C 1OCOC 1SQFA 3ZSRA 3CSXA 3VQ4A 3F5WC 4DLEA 4J80A 4BC3A 4DV6K 4DS4A 4EP5A 1P49A 3JYCA 3WB2A 2HJDA 1BA0A 2FBVA 2QM8A 1ZBUA 2F8TA 2X6AA 5B1NA 3M6GA 5LGNA 5H6QA 4WFGA 2NRTA 4CGGA 4M7YA 3MXIA 5A2QN 1AP5A 4PKHA 3AE4A 1RM1C 2DOSA 2UXDO 3ETGA 4B3RB 2OZMA 1Y66A 4UUJC 2D0AA 4D6TH 2QWRB 5JJJB 2QSAA 3TJTA 1BIUA 1WSHA 1OJHA 3PO5A 1AL24 1Z26A 3O3FA 2FKXA 1VQ8N 3C95A 3DRPA 3OMAB 3CYMA 1BI4A 2R074 3DI6A 1GN3A 3FZMA 3W7SA 3RT3C 1FPOA 2V1DA 4DV7B 4KH6A 1KQSU 3H1HH 1XWLA 5LOVB 1NU1H 2QWPB 3C3SA 2HF4A 4FLXA 2X78A 1HNWK 4JI2B 1AR1B 3VQPA 1Y74B 3ZN1A 1NKDA 4X62K 5KUMA 4JI3K 1U2VB 1S1TA 1OCCC 4FMTA 1YTFD 4GKKB 4AM7A 3RWUA 4A2AA 2A0LA 1ZOYA 3ID8A 3SPYA 2ZM6O 1A5WA 4I55A 5SZTA 1TYQB 4NLCA 1EO1A 2KFZA 1KAZA 3HM9A 4DV5B 1OCZC 1YJWN 5HOOA 1AR84 4DTOA 3RYIB 1VF6A 2OCCB 2EIMC 4GVEA 4FPBA 1EAH4 1FFXB 5L3FA 1ATRA 4YT0A 5EZYB 2XNDG 4AI8A 2E2PA 4F6RB 3E35A 1NBWA 2YS8A 2YCHA 3WXIA 1HJOA 4B1YB 4WCEL 5FRMA 4H5WA 3SUCA 3QTCA 4E7HA 2G8HA 1TL1A 1P8ZA 1RPOA 4I4TB 4MFBA 1DLOA 1Q7YO 4KI4A 2X6NA 2MW2B 3LAKA 3CCLN 5FLXO 3G71N 5IJ0A 5FPOA 1HNZB 3ZIAG 2EINC 4ZHQB 3G10A 4JI1O 1XMQB 3ASNC 3V1OA 4MQ3A 2ACZA 1NBMG 5JVDB 3B2EE 1QSSA 3LAMA 2E6LA 1KRPA 2JS3A 4IOCL 1MWKA 4KPYA 4LF6K 3ML0A 3OYCA 3DLEA 5GTIZ 3M5RA 3S41A 3PX6A 4CGJA 2DMXA 3K06A 1IKYA 1VQ9V 4YSXA 1LW0A 3QMLA 4B9VA 2KZZA 4DCHA 4JI0B 2RS34 2E1YA 2H88A 4DR1B 3UKUB 3UO3A 3ZRWB 3THYB 4CC5A 4G2KA 5AQHA 2OPPA 5BR8K 1GLLO 3M8RA 4AQYB 3AV9A 5AZJB 4WBNA 1VBD4 1BCCH 1TAUA 3H1VX 5FNVA 3DXRB 2GTAA 2X7RB 3ZMTA 2WBNA 3FGUA 3CEIA 3UCSC 1BT8A 5DM6V 1RUG4 3SQ1A 4MDAA 4NTYA 2A42A 4JAVA 1Q7YW 3OS2A 2Q67A 3TAQA 3G67A 1R6NA 2KHOA 4GYCB 4FJ8A 1XNRO 3U3YA 4YJ3B 1PVC4 2HBLA 3GB7C 2A06H 1J54A 4NTXA 2YKNA 3O9OA 3UB5A 4BIZA 1Q9XA 4JI5B 1NK9A 3J8F4 3CRMA 4WQ5A 1AVMA 1W97L 3AVCA 4DR5K 5FLXN 3K5LA 4DV3B 2OANA 3PX4A 3E22B 5B3SB 3OTOO 3DXKB 3BY5A 3KKRA 4CIGA 1ZTEA 3CP1A 4C8MA 4BAYA 2YI1A 4B1WB 4LSLA 4B9LA 1K4DC 2WOMA 2B76A 1B92A 5JS1A 4K8ZA 3ABKC 2V7ZA 4IOAL 3ASOC 1ZX3A 1H8HG 3O6WA 5C12A 2ZJQL 1VQ5N 2HLDG 5H9CA 5BREA 3EE9A 2DFEA 1Q5OA 4H0LB 4X20A 3AEIA 4QNHB 2YHWA 3HYFA 3TGUH 4CZKA 3ZETB 3JD1A 2PUSA 4JASA 2Q31A 4EIAA 1DTOA 3O4WA 4BRLA 3L74H 2AW9A 4WQ5C 1VRH4 5J2TA 4BE1A 4BE0A 5CR4A 2BOCC 3ABUA 5J2NA 1X9JA 3UT5A 5E26A 1YQ4A 3KK3A 2KQ2A 3LDOA 4FJ7A 4JI7B 4FW2A 3VERA 3J7AP 4F4KA 1W9HA 4J11A 1VQOV 3X2QC 4JYAO 3VA0A 3TAEA 1RTDA 4X1YB 2OCEA 4O44A 4JZ2A 1O9HA 2ZE6A 3DLKA 1WB9A 3CX5F 1U6ZA 1HQEA 4JTAB 1OCOB 1M56C 1NWKA 2YIBD 3V9ZA 2P51A 1XL6A 4ABMA 1NK5A 3K0DA 2OTJV 1PD3A 2YICA 1XI1A 2UU9K 1TGOA 3CC4V 2ASMA 3CG7A 1YUWA 3VQQA 4EB6A 2HBKA 4IT5A 4YOYA 1K34A 1RM1B 4DKWA 3TANA 1NH2B 2IS3A 5CYMA 3U6FA 3E8FA 4DFPA 1JXEA 4JHDB 3VPZA 3EY1A 1VEWA 3K5NA 4X89A 5JH7A 3MCAB 4C23A 4YXDA 4YSYA 3SBGA 5D3GA 2EBOA 5KQDA 5BY1A 1Q43A 2QWQB 1YITV 3T1HO 5AQJA 2VG5A 4TV8A 1R6TA 3KZBA 1RDBA 4ILGB 5FPRA 5IY5C 1HNVA 4YOXA 3KLEA 2BOBC 2O8EA 3C6HA 2ADPA 5AFUH 1ILYA 3K5MA 2WLIA 4JI2O 2ASOA 3DM2A 3S3OA 1B3QA 2A40A 2ZQMA 3WUHA 2YJEA 1WAJA 4DR3O 4DUZB 3VEOA 4GKKO 5H1SQ 3UKRA 1GN2A 1XDCA 3ZHUA 4B9QA 5EBLC 5FRNA 3CCJV 5IT9O 1PKXA 3R3LA 1OCCB 1RBTA 2QTDA 4PHZA 2N74A 3THOA 1N32O 5KI6A 4CGHA 4WFBL 4DV5O 1NJWA 1K8AO 2O8DB 3AEAA 4Y0WA 4DR4O 2ZCEA 4MVQA 3WQTA 4CGIA 5DM6L 1FJGK 1TVRA 2BTFA 4ASUG 4BQZA 1VQ8V 1OOPD 1YJ9N 2Q69A 4CK2A 4NCBA 4DTMA 1OCZB 3AO5A 4FWOA 1RTIA 4WQ4A 4J41A 2H3OA 2P67A 1R6KA 1GM7A 4G28B 2EIMB 4U7NA 1RBUA 3A5NC 4DV1B 3AO2A 3FZLA 4EEQA 2JEXA 3QNNA 1J5EK 4Q0BA 2O8BA 2ZQBA 3CWBH 3QB0A 4JD2A 2UUAK 1JL2A 2PLV4 4M3ZA 2AJQA 1RP3B 1PO14 3CIPA 1AR5A 5GAHP 3P4RA 2JS5A 1HNZO 2WLJA 1S0VA 1K8KA 3H3NO 3A0BZ 3C3TA 4BROA 1IBMK 2RQ6A 1HRV4 3DTUB 4I55B 2DFHA 3HT3A 3CF5L 3AVLA 4ICGA 2R7YA 1HRI4 2EINB 1XC9A 2DWEC 4GCZA 5KHJA 1BQMA 4H5NA 4KB1A 4KRFA 1ZBSA 2Q3SA 4JK9A 2YX6A 3BEHA 2QI2A 3OW2U 3CM5A 4O4JA 1WLEA 3QLHA 3RSEA 3JCUZ 1QLEC 3VEVA 2EJRA 1V4TA 1LR1A 4B9SA 2AA4A 1U49A 3SJAC 2VQFO 1VQKV 1RGIA 1K8AW 5AQFA 1YIJN 4TV9A 5FL7G 4CF1A 2FYUH 3J80O 2ZIOA 4DFMA 2BTQA 1XC3A 4Q4Y4 4KHNA 5AQOA 2CUGA 3O1BA 4C8LA 3IS9A 4U3FH 2QK9A 2P5GA 4DTPA 4QPKA 4MW3A 4BR0A 4F9OA 2CGNA 5IJ0B 3PJSK 4U3JA 5EIBD 2DW4A 2VCPA 3LWMA 1UOCA 5LY3A 1BGXT 1TL3A 3GQHA 5AZIA 2GHYA 4BRQA 2Q7HA 4PDRA 3OYMA 4IKFA 4E7LA 4DSKA 2ZE2A 1IXMA 4JYBA 1VSEA 1RT3A 1CZAN 4LFAK 4WFEA 3TSUA 4B3MB 4BVOA 2W42A 3SZ2A 4JI8K 4TSFG 1XMOB 1IJJA 2ZGZA 3CB2A 4CGDA 2RS14 2BANA 3LP0A 1ZBLA 3KLHA 1PL0A 4WFHA 3DWLA 3ENOA 1GN6A 3T19A 3ZRVA 3ID6A 3L9DA 2A3QA 1Q18A 1T7PA 5KPRA 4WBNB 1ZUQA 3BA8A 2JLEA 4IDKA 4C8OA 1GRJA 4JI4O 4BR9A 1X3NA 3QNOA 3ZMZA 4I6MA 3ABKB 4HYOA 3ASOB 5BPMA 4BR4A 2ZF5O 1PNMA 5EC1C 4LFCO 5JMVA 4DV0K 3HJFA 2ETNA 4JS4A 4TT3G 4AH9A 3LDQA 3LNMB 2CDYA 4YNQA 1P4RA 4ZKIA 2F95B 4XDJA 2YUAA 1F4NA 2BH1A 3BAAA 3VMFB 4KV8A 3SV4A 4FCYA 4FJLA 4CH6A 2P9IA 3K79A 2UXCB 2P9SA 4EZ9A 1KKCA 3QBWA 4FLZA 3AVGA 1VSFA 2WC9A 3ICXA 1R3JC 3HBTA 3TTCA 3X2QB 4E3SA 3SJJA 1S3XA 2PY5A 1F23A 4DQPA 1RT4A 4YORA 1HYSA 3HP9A 1MQTD 3SGIA 1H2LA 2P4VA 4QGPA 3EZWA 3JS6A 1Y4MA 2O57A 2WLMA 3FYIB 4JTCB 4X20B 5KHIA 1GKFA 2YHBA 1X9WA 1ITGA 1LNQA 3MEGA 1H1VA 3UO2A 4BIOA 2QA4N 1M56B 2IBZH 3CRRA 3F5TA 3CCRV 1QVFU 3SYPA 2PFUA 3J8AA 4IO9L 4MTGA 5J2TB 3W3DA 5CB4A 3FAVA 3SJBC 3OR6C 5L3CA 3UT5B 1RDAA 2RE2A 4CEAA 3QESA 3CM6A 1JX9A 3ULEB 3CCQN 1SESA 4OKEA 3UE5A 1OH7A 4XDLA 2FBTA 3M8PA 2GBZA 3ZSWA 5KHGA 3E01A 3STZC 1RBVA 1COWG 2FF3B 4CEEA 1MU2A 5LL6Z 4HVJA 2QWNB 2UXXA 3MK6A 4RWUA 5IY5B 5KX5A 2ATKC 2E5LK 4OGQB 4LP8A 1BUPA 1B06A 1ZL8A 4RWTA 5HP1A 2Y69C 4QE9A 4CJKA 1WA8A 2H89A 3B8MA 4CFAA 4CIFA 2Y0IA 3BPZA 4X1IB 1C1AA 1HMVA 4FJXA 4L87A 4KO0A 1K5MD 4NTWA 4EB6B 3I0RA 5J2MA 4YHHB 2KG7A 3TARA 1HPZA 1QNMA 3Q4HA 3IGAC 4OX9B 1XHXA 3CFOA 4IZ9A 4WF9V 5IJ9A 2GTDA 4PI0A 3JSLA 3OM3B 4MVRA 5JH7B 4K43A 3TR8A 5JICA 3RVYA 1Z25A 1SS3A 5BZBA 1N33K 2XHBA 2JEUA 3ZT2A 5SWMA 4DV6B 4TV8B 1LWCA 5DMRA 4HCBA 3NF9A 1EZJA 4O4HA 2QXLA 4H5VA 4O2AA 3KLFA 1SQBH 5H6RA 2UUCK 5B1OA 2QWRA 2O8EB 3LDPA 4TUYA 1F7YA 4YTNA 3LM9A 3DC5A 2IOCA 2WLIB 1IKWA 4BC5A 1Q81O 1QVGM 4LH5A 3LDEA 3U4LA 1EV14 2CH6A 1R3KC 1EN4A 3LP2A 4FWMA 3E2EA 2QKBA 4KH5A 1LUVA 1RCHA 4BGBA 4CW7B 3UKRB 2AHZA 1NENA 4LF8O 4N56A 1U4BA 4BG9A 5DK5A 1TK0A 1IZ3A 2CGLA 2G8IA 2FLOA 1J95A 4BACA 1IBLK 3ZS8C 2KFNA 1H2NA 2P1JA 1JCEA 4HZ3A 1BHBA 4FWPA 4JZGA 4UCTA 3VETA 3HK2A 2XT9A 1XEQA 2BSKA 2G8KA 1U2VA 2LO1A 3OEHG 3SYCA 3A8YA 3CI5A 5FPNA 2JGUA 2E20A 2NRXA 3FFIA 2LJ2A 1QLEB 2I7NA 3LM2A 2YHYA 5ADXH 5JLFA 4MVSA 1HNWB 2O8BB 2A1RA 4RQFA 4E7KA 4JD2B 4X62B 1NA1D 1S1VA 3RYIA 2HEPA 1BZKA 2F8SA 4CGFA 1IBKO 1K33A 3RVZA 1K8KB 1Q81W 2QJ1A 5LXTA 3MXJA 3AG7A 1MWMA 1N34K 1NGEA 3D0PA 4NXNK 4MT8A 2P90A 5LA6A 1YTUA 3B8NA 3RMBA 2ZD1A 2QKAA 5C0YA 1QCEA 2A1SA 2OPRA 3FFKB 1SQQH 3ZX2A 4O4JB 4CEOA 4WYBA 2D0PA 3JAWB 4R7CA 1US6A 1S22A 3EZ5A 2LGQA 5TKWA 3WEEA 1LUWA 4OGCA 4B3TK 1SS6A 4TOIA 2A79B 4U7BA 1TUYA 3A0HZ 4TV9B 4AILC 3U9ZA 4DSFA 2EULA 3ATVA 3KVGA 2BTQB 1YIJV 1WB7A 3NHGA 2ITMA 4DU4A 4KHWA 4JGSA 1SETA 2JRIA 2ZD9A 4CHQA 4FM2A 2UXNA 4L3QA 1QHAA 3JD4A 2YC0A 1RVF4 3JD0A 4U3JB 3SUOA 5IWAO 1N0JA 4K8XA 1NOZA 2IM9A 3THWA 1NZ6A 1IV0A 5C25A 3WG7B 2WU5A 3THYA 4LF6B 5AZIB 4CVNE 4JAXA 4W5QA 2K1EA 4DV2K 1ROPA 3CERA 3THVA 4B3OA 3VN5A 2OZSA 3BABA 5KRTA 4JLHA 3DXRA 2HHQA 3M8QA 3HB3B 2A41A 3KK1A 1LV5A 5CN0A 2B6AA 4CZMA 3IAYA 1IO2A 5BR8B 3VGLA 3CQXA 1D4M4 2XAQA 3AG1C 3P4SA 1R3LC 3GOIA 4B1VA 3ABMB 2D0BA 3BY6A 3LDDA 3CCVN 4LCUC 3WU2Z 4WFAL 2PAVA 1VARA 4DV4O 4DTSA 1N5YA 4KREA 5KUKA 1YJNV 2QE7G 3ULDA 1IVSA 1UA1A 4LF5K 4DUYK 4E7IA 4FK2A 5GADP 1YVWA 2ZNJA 1E1QG 2H8PC 1KKDA 5CA3A 1VQ7V 4I6MB 2IAJA 1WOQA 4CJ4A 5AFUA 2NLJC 2HSTA 4KTQA 4KP4A 4DRXA 1F21A 3I33A 1KBHA 1EKEA 1JLEA 2IGIA 2EIJC 3VQ6A 2ZKOA 4RCHA 4BREA 1QZ6A 3KTQA 1JCGA 1IG8A 3ISNC 4JYCA 3NAEA 3THXA 3MN5A 4DK0A 4FOIA 2M7WA 4M3YA 2CH7B 4Z2WA 1XUPO 2Q1NA 2EZOA 2P9IB 4B8CA 4BRCA 2P9SB 2FL4A 3G80A 3MECA 1QQCA 4PKIA 2CTRA 4U7OA 4GKJK 3QG5A 4LF4K 3CHXA 3OUFA 2R064 4BGAA 2G8WA 4ZHRA 5KTQA 3V9XA 2RS54 3O80A 1ZP0A 4CZJA 5CBHA 4DR6K 4K25A 4PWDA 1OKJA 5KAFZ 4X65K 1JLFA 5A2QO 3BA9A 1EM1A 2QTOA 3LPUA 1GM8A 4CZIA 3K03A 4HAMA 1A5XA 2QA4V 1XQSC 4DWIA 4F3OA 2WS3A 2Y69B 3OS1A 2CTPA 1BEV4 4CBWA 1WNSA 3U8XA 3JARA 1WAZA 1SC5B 4OX9O 4P2ZA 2FSNA 1FXKC 4B1ZA 2R9IA 2WPDG 5JCOC 5KA6A 3D45A 2BTOA 1R1BA 1QBZA 2OIGA 1OH5A 2OTJN 1BCOA 4MVOA 4FL9A 3CCQV 2FB5A 5AQQA 1PPJH 3OGCC 2VQEO 4CERA 4JNEA 4CBCA 4JI6O 4YY3O 4CF9A 3Q7BA 3HKCA 5TISZ 2ZJRL 4PA9A 3J7YP 1SL0A 4QS8A 4OPAA 1TAQA 2JK5C 4K0KO 3N2KA 3HTVA 1GLCG 5E79Z 4NYFA 5KX5B 3VQEA 5JQGA 2ZXWC 3BF1A 1JFFB 1SA0B 5BRFA 1ZL8B 4KH4A 2EWSA 2UU9B 1K97A 1WA8B 3FZKA 4DQ8A 2ARHA 1P84F 2YI8A 4XEIA 2HHTA 3SFDA 2W6IG 1L3VA 1I94K 2WAMA 2KG7B 2CAZC 4UVCA 4YXWG 1KTQA 3Q4HB 3GL1A 4UCRA 3K0SA 1U97A 5IJ9B 4CE9A 4EP4A 4B3SO 1NTZH 4N21A 1N8RO 2DPNA 1EBOA 2W41A 1H2GA 3SQ0A 4CF2A 2GBOA 1N36B 5LJWA 4FLWA 3CCJN 1YAGA 5DM7L 4K3AA 3NH1A 1YZBA 2QXFA 4O4HB 4FK5C 4FZ0A 4O2AB 2XY6A 5LL6Y 1VK0A 4TUYB 4UVBA 4X62O 2O8DA 1ASUA 5KPTA 1SZ2A 2XO7A 1RTHA 4X66K 3HKBA 1KCFA 5HFMA 2UUBK 1VBC4 1FXHA 4BRIA 4KL1A 4B9NA 2EZPA 2PW9A 3VQBA 2YHXA 1EETA 2IDOA 3P4IA 2H94A 4GVMA 5K1XA 4UB8Z 1RBSA 1G8MA 2RMKB 5B66Z 1W59A 1E3MA 3I0SA 1FJGB 1L3SA 1CLQA 3SYOA 2BGGA 1JLGA 4A57A 4CK3A 4Z4FA 4KX6A 4DTNA 1SKWA 1GTOA 1WUAA 2IJHA 1NK4A 4XH1A 3E8HA 1RBRA 3VOVA 3ZHSA 1HPMA 2VG6A 1TVKA 1KUQA 5LMNK 1J5OA 2BSKB 1J5EB 1XNQO 2RHKA 1QQMA 4KHPO 1M1KO 4CJ3A 3B6PA 5IYZA 2UUAB 4NO7A 1KLNA 3PSIA 4DU1A 4C8KA 1HUXA 2E3CA 2IJJA 1N8RW 1WP8A 3O3HA 4B08A 3AG2C 2Y0PA 4O0JA 1HR0O 1HKCA 1E79G 2HBJA 3KWGA 3HP6A 2PI5A 5FPMA 1VQKN 1YEWA 2FSJA 2OIEA 2AGAA 2HWC4 1X59A 1SUQA 4UCSA 2UXDK 4PDWD 1YI2N 3AGRA 5LXTB 2NNUA 2LSNA 3LZJA 4D7TA 4CZGA 4IOXA 5C24A 4EHUA 1DKGD 4J7KA 4UCOA 5LA6B 1OVQA 3AVHA 3AE1A 3T1CA 2GEMA 2OPSA 3BDPA 3FD9A 1SKSA 1NKBA 1M4UA 3EN9A 4O2BB 1NGBA 4LF9O 3ZLJA 4FZYA 1MABG 4CJEA 4Z1MG 2E74B 3WEEB 3BHPA 5KPZA 4CJUA 1HNXO 2VYPA 3OYNA 3KLIA 2GWKA 1KU9A 2HMPA 2RF2A 3R8EA 1RT6A 3JSMA 1UFIA 3IRXA 1QE1A 2WLNA 4LFBO 5LHHA 4E89A 3AG1B 3JD2A 4X64K 4TSXA 1M1KW 2XASA 2HHHB 1EP4A 4ZIBA 2B9ZA 1KP3A 4JV5O 2WU2A 1WJZA 5BPNA 3JBG4 1WAFA 3LPTA 2FC0A 2NRZA 2ZM6K 5LMUO 4I7FA 3THWB 4IO8A 3L3UA 3AAQA 3V9UA 2AXTZ 4CS2A 5FPEA 4LF7O 1EQYA 3RTVA 4M3XA 2GUPA 4LFAB 1NGHA 4PKGA 4H0TB 4JI8B 4CJRA 4IFEA 3VQWA 3VQVA 4WFBV 4I9LA 4CI6A 4KHSA 2RM24 3QDKA 2EIJB 3A8TA 5MLCQ 3FFQA 3O9SA 3H1JH 4CH4A 3E89A 5CBGA 3K59A 2RN9A 3RVCA 2DWDC 1RUE4 3C7NA 2ADQB 3N2GB 5E41A 1S9GA 1PO24 2E2NA 4P9PA 2NRVA 4I9QA 4IXCA 4JEPA 5HRNA 4DW1A 3CCVV 1R094 4M7XA 4W5RA 1JPXA 3SPZA 4DQQA 1WBBA 3E9OA 4DV0B 2KSDA 2LW1A 4DFKA 1FKAO 2HHSA 4Z94A 1SZTA 2GWJA 1ASVA 4LH7A 4DRXB 2GUIA 3S9HA 3T1YO 3ZT0A 1AROP 3R1XA 3VEYA 4CZFA 4PV1B 3N4PA 4BRAA 3ABLC 5J2PA 4CJTA 4MW8A 3M3ZA 3DSQA 4A62A 3VR8A 3E8BA 1RUF4 4HTUA 3THXB 3SUQA 1GLFO 1FXVA 5KGXA 1H38A 1VSMA 1ZSPA 5CA1A 3RBZA 3CCRN 3C6UA 1JJ2M 1RUH4 1QU7A 2EILC 2Q0UA 1K9MO 3WNGA 1M57C 3O8MA 3QIPA 4ILHA 1S3JA 2WP9A 3TXSA 5HRPA 1VSDA 5CHIA 4I7ZB 3ASMA 5ADXA 1VF5B 4Q6GA 3ULEA 4IJAA 3QNEA 3NDKA 4KB0A 2QKSA 4FJIA 1XNRK 4JKDA 4DG1A 1HYZA 1GLBG 3W7WA 3D2EA 2ZXWB 1YT3A 4RO2A 2UYTA 2Z1JA 4KFBA 1NMNA 1PM9A 3B40A 3BCCH 2WLLA 4L8JA 2YSUB 2QWNA 3JARB 4A5UB 1BL3A 2QKKA 2WDRA 2E2OA 3OTOK 2YXYA 1K6YA 4M41A 1XL4A 2OT5A 3AEDA 3ABTA 1LCUA 3AE5A 1N36O 5CZ1A 1Q90D 5L3EA 4ELUA 3AE2A 4EHTA 3PO4A 4J2AA 4B3RO 1IG9A 4J7JA 3HKCB 4X1IA 5A9GA 1VMGA 1GLDG 3WB0A 3PIPL 2WLKA 4F3TA 2X6BA 1J9AA 2E5LB 3CS5A 1S76D 4M3WA 2QTSA 5GW7A 3H3OB 4CIEA 2BE2A 3N2KB 3SQ4A 1AR64 1K9MW 5JQGB 3VQDA 1HQUA 2I7PA 4F2RA 1RNHA 1W2BM 1YXBA 3HR0A 1CXUA 1S77D 2LP7A 2IH3C 2CTWA 2OTLV 2IJKA 2YIBA 4DV7O 1C6VA 2PBDA 5T7BA 2B5UA 4FFBB 4QIWF 1PP9H 1EWRA 1LWEA 1I7FA 3ZHQA 3CXCM 4FK4A 4N5SA 1TK5A 1NT2B 1N33B 2D4WA 3CFPA 4J9ZB 1J5EO 3IG1A 4JYAK 5C2TA 5BRHA 2KKWA 2CGJA 3FB8C 2UUCB 1A32A 1K92A 4DHYA 3F7VC 3NH0A 4RG8A 4JRQA 2K9PA 4GW6A 4PA4A 3ZJZA 1Y76A 3BRCA 1NJXA 3P31A 3OGIB 3CRCA 1QS4A 1FK9A 4B7KA 1YTAA 3QO7A 2GV9A 1XREA 5I3UA 1VBE4 3HKBB 4IGGA 3AG2B 4H0XB 3JYTA 4ISFA 1RUI4 4NXMB 1IBLB 3JATA 4DR2K 1UJWB 4GUNA 3A0IX 1XBLA 1IKXA 2VGMA 3OYGA 3OYKA 4DQIA 3L73H 2PTMA 4XH5A 3TCUA 3AG3C 1RDDA 3MN6A 3ZX0A 5EU7A 3HZ6A 1NGFA 3LP1A 1V54C 3ZSQA 5C93A 2YNHA 1TVKB 3T1HK 1IX9A 4MSWC 3ZSZA 1XMQO 4LWSA 3C94A 5IYZB 1WPBA 3HKDA 3QO8A 4QAGA 1G1XB 3ITHA 2JGDA 4NCGA 4PA7A 4JI2K 3CJHA 3W7TA 4FJKA 4GB34 3MHSC 3T2MA 2HHHO 3ASNB 4YFUA 3WXJA 4DR3K 4XIUA 3AARA 1OVYA 4GKKK 3JAWA 3L8BA 2O4GA 1NI8A 3EHBB 1N34B 3SPIA 4JI0O 4NXNB 1E4GT 4H13B 4IFYA 3WXMB 4DR1O 4CZLA 2HW3A 2AHYA 4FWSA 2F4VB 2FBXA 1YI2V 1N32K 4HCCA 4AQYO 4CEDA 3WNEA 1YTFB 4DR4K 3QF7A 4ISEA 3U11A 2V7QG 1WSFA 5AQGA 4BRMA 4B3TB 2QWLA 4C1NK 1AP6A 2WDQA 1N6QA 3T4DA 1Q9YA 4WE1A 4QE7A 1ATSA 3QERA 1WSJA 3BZCA 2OCHA 3AEGA 4FWQA 4NR1A 1C0TA 5AQTA 4C7UA 3GWOA 1M5IA 4I0XA 4BW5A 3L2WA 4B9MA 5H2FZ 4JI5O 1HYVA 3F2KA 4Z4CA 2ZE8A 5CMUA 1M90O 3OD4A 1HNZK 2BDPA 1CZ9A 4OKKA 3TU5A 3LDSA 4TQDA 1KFDA 4BRKA 4DV3O 4CEZA 3ZSOA 5EXWA 4H0PA 5GIPA 4UV8A 4DV2B 4FWLA 2YNFA 1GOCA 4KKOA 1Q6UA 1Q82O 1TKXA 1YJNN 2HHXA 4UCUA 2IVOA 1KB9F 5LHIA 3MAQA 3A5OC 3W7UA 3CD6N 4N41A 3K2PA 1QVGU 4DSLA 4KHQA 5B1BC 3O08A 2VQFK 1VQ7N 1NKEA 3KLGA 1JLQA 4EFEA 3VQ7A 3ABLB 1YHQN 1HP8A 3I5DA 1WSGA 2PI4A 3V1QA 1HW7A 3GVMA 2DJVA 1RUJ4 2P06A 4PA3A 3QO5A 4K41A 3C7NB 1YF2A 4WFFA 2HP8A 4LF5B 1ASJ4 4DUYB 4CFBA 5CE3A 1JR9A 1HDJA 3OYHA 4H33A 4JI7O 2EILB 4W5TA 3C90A 1O13A 4QS7A 1EFRG 1NLVA 1NU0A 4CCHA 1M57B 3TAGA 2CH7A 3EVKA 4OGEA 1VQ4N 2LFSA 1M90W 1XQ8A 2HKOA 1MSWD 3K9JA 5ELZA 3VEXA 1RT1A 1ZXOA 4FZZA 3HVRA 3AA4A 4O4IA 1D9DA 3OFNG 5BMVA 1HKBA 3HPLC 1NR1A 2Q7EA 2HVKC 2Z1HA 2AZ2A 1Q82W 5M1OA 4N47A 2QWMA 5AQKA 1NG9A 4OO1J 3AEFA 1VQNV 3K3WA 1I3AA 2E1ZA 1ZWIC 1VSJA 4GZRB 5CA1B 1RHI4 3ZRXA 4GKJB 3AAPA 3J81O 1QQOA 4LF4B 4CF8A 2O8CA 4CH5A 4PA1A 3W0LA 4BR6A 2HHUA 2EIKC 3CJAA 1RFYA 4YOWA 1ORQC 3ETEA 3VQ5A 3DMJA 4DR6B 4JI4K 1C0GA 4X65B 2QM1A 3E9LA 1MSDA 4LFCK 3MDQA 1ZBIA 3ETDA 1VQ6V 5JJEB 3DLRA 3JAKA 2HJFC 2GELA 1Y6XA 3H1QA 3O5BA 2VWJA 3D2EB 2KW4A 3DRRA 1KFYA 2Q6AA 2WLLB 3HSCA 2OA8A 1SERA 3QEWA 4GT1A 2D2CB 2F96A 2F43G 2UXBB 4FJCC 4DUZO 3V6DA 3NGYA 1JFFA 1SA0A 2UUCO 1XILA 3T3FA 2Y4UA 1EN5A 4HNAA 4CESA 2P9PA 2DE0X 3SPCA 4DTRA 5C8YA 5LYJA 3NMUA 3ZEUB 3AO4A 2YKMA 2C2AA 3E8GA 1JLCA 3M7MX 4MVUA 4WFAV 3AEEA 1T6CA 4YIPA 1HKGA 4O8UA 1Q6HA 2ZIMA 2F93B 3VESA 4A2BA 2F1MA 2OWOA 3DLLL 5LGUA 2HVIA 4NXMO 4UV9A 4IG0A 4I9WA 3J81N 3G25A 3KZIZ 4ID1A 5J2UA 4DV1O 3R66A 1FKOA 3SYZA 1I94B 1Q86O 3JXUA 1FFTB 1B9FA 4FLTA 3QEVA 3B6OA 5AQIA 4E19A 4QJFB 2E76B 3MN9A 4AHRA 4UFZA 5EBWC 3IFRA 3M1FA 3S3NA 4JAAA 4AHSA 4H4MA 1AILA 4NVPA 1KVBA 4Y1CA 3AG3B 2ATQA 4CEQA 4BRFA 4QCLA 3K57A 3GG4A 2MK3A 3CC2N 1V54B 3MCPA 4E1MA 1Y76B 5IYDO 1BL8A 3U3GA 2Y4TA 4X66B 3DOKA 2FTKA 2UUBB 4FIPC 3MEEA 3U9DA 3T7ZA 3QEIA 4H37A 3EKUA 4A5BA 1G6UA 1VQLN 3MWPA 3VTHA 4DLGA 3P39A 4LC1A 2P9UB 2DN9A 1DF5A 3BZKA 4BR5A 2F4VO 5FDLA 3NGIA 4AHTA 1H8EG 3JATB 2XAFA 1Z2GA 2G38A 1Q8IA 5JWPA 5LP6A 1IURA 1YCIA 4KUMA 4PJ0Z 3K9AA 3MMVA 3CJ9A 2AZ0A 5LMNB 3BFRA 4JI3B 3AVBA 3U10A 1LWFA 2VS0A 1Q86W 3CCEV 4JK7A 3OYAA 3L2RA 2X6SA 2Q97A 4LWSB 3E66A 1TKDA 1VQMN 4BR2A 4OKJA 3PLAA 3HKDB 1MZFA 1VSHA 2JGDB 3CJHB 1C0MA 4H4OA 3CQYA 3OS0A 2RCVA 4OVLA 1ZYQA 5AQVA 4B3MO 1QR9A 3G6BA 3CXHF 4O2BA 1XMOO 4J7ZA 2UXDB 3H46O 1JL1A 1BS3A 1L8DA 4ILJA 2A9HA 3EYZA 5LP6C 3QBXA 3BUZB 5FROA 2R7FA 2CTQA 1W0KG 1Q6IA 4LF8K 5KLVH 1FYJA 3KK2A 3CMEV 4DU3A 1L3TA 4CHNA 4HBNA 3T69A 4A61A 3CCMV 3ZSYA 3JD3A 5EOYA 4I2QA 2QEXV 5IYBO 1CPYA 4OPHA 3ZHVA 3CETA 4XH4A 5IYCO 1Q3EA 2V51B 4CEFA 3DLHA 5E1AC 4N76A 3N4QA 1HXS4 1AI4A 5B1BB 5DEDA 3D36A 3V4IA 4X64B 3SAHA 3NF7A 3JALA 4BC4A 3OUSA 4I0XB 5JVGL 2R70A 3EFFK 3MHHC 2ASPA 3SYAA 4Z0UA 1DGKN 2P9NB 3CRQA 1BHLA 1LOTB 2NLXA 4AF1A 4DB3A 3CPWM 2DTUA 3AE6A 2ZM6B 4F2SA 3RRHA 3AK1A 1IBKK 2E88A 5AQRA 1X9MA 4CFCA 5AQLA 1YSCA 4DTXA 4KFMA 3K04A 2IU0A 2UXCO 3ENBA 3ZX3A 2N04A 5LJVA 1REVA 4WFNL 2WA3A 5M1KA 3GDQA 1AR94 2Q8VA 4KXRA 4TWKA 3N2GA 3OYFA 4Y1DA 3BP8A 4MO5A 3TWHA 5D5QA 4JF3A 3OHRA 3RMCA 2JJ2G 1M9NA 3D36C 3CD6V 3EE8A 4CHPA 5LGTA 4MTOA 2HOEA 3H45C 3D7EO 4OXSA 1RSOB 1J6ZA 1V4SA 2D0OA 2IIRA 2R72A 1YHQV 1VRTA 1MDUB 4DR7K 1BMFG 3ZX6A 1YQ3A 4J10A 2ZE7A 3RW0A 3OYDA 4DR5B 5KRSA 4QPJA 4E2LA 4DXWA 2B5JA 3CHWA 3SK3A 2P9LB 2RR14 4W5OA 1TKZA 2EIKB 5IWAK 4X1KA 1ZLZA 1POV0 2YIAA 2YIDA 4YOTA 1K5SA 1C0UA 3ZHTA 1IH7A 3RN4A 5AQZA 4CEBA 3SAFA 2ITGA 1VQ4V 1FXKA 4M45A 1JJOA 5JCOA 3OJSA 4NYNA 2NN4A 3E83A 3VBBA 1J53A 3CJCA 4MTFA 4O4IB 2GTSA 2D0CA 4Q4X4 5BMVB 2WONA 1SQVH 2RNBA 3F7YC 3VR9A 5J1EA 3PX0A 3OMIB 2UXBO 1KXPA 4JTDB 5F2VO 1DEJA 3KJVA 3TABA 3JD74 3NGZA 3L72H 2XRIA 5JS2A 2KZMA 4BR7A 2O8FB 2M6YA 2O8CB 4CJFA 3T1AA 4DV4K 3SCXA 1VQPN 2O4IA 2X0LA 4M3UA 4YHHO 2DY4A 3MD0A 1ASWA 3APOA 3OR7C 2ZNIA 5HRSA 3SAGA 2WSSG 1XNRB 2Y1JA 3OYEA 3MX2A 4CJ5A 3EEQA 4YJ2B 2YI9A 3UIQA 3J7AU 2HNYA 3VGKA 4DV6O 5C15A 3JAKB 3K9SA 2V52B 3SLCA 4NB4A 2B4JA 3O9TA 4RTFD 4HUGA 1GLAG 2JDIG 3OTOB 5EY4A 4Z4EA 1NH2D 3EO3A 2P4KA 3L6QA 1SKVA 1L0VA 3VRBA 1IDSA 1OH8A 2NRRA 1VAZA 3G0ZA 1NK8A 3RR7A 3F73A 3KCXA 2R9AA 1CZBA 2WWWA 1VF7A 5F2RA 3HXMA 3AA2A 4HNAB 1QSLA 2OTLN 4OLBA 2HB5A 4B9TA 1KFSA 2P9PB 3FX7A 3MXMA 5C8YB 5LYJB 2BUPA 4JKGA 3P3PA 4FFBA 2I5JA 3AVNA 5CBFA 1RPRA 4JS5A 1LW2A 1JLAA 1DTQA 2ZGYA 5K1PA 1SQKA 1TUUA 4Z4HA 3A0RA 3A5MC 3TTDA 5AJ3K 5BN9A 2V4DA 2F9TA 3A5LC 3ALYA 4FWKA 2GSMB 1A5VA 1WB8A 3CE2A 4IDHA 5J2UB 1HNWO 4CJLA 4DSEA 2E6MA 3SYQA 2IU3A 2XAGA 3D2FA 4JI3O 4JYAB 1NK7A 4CS3A 4PQUA 3I55V 4F6EA 4FJNA 2P9KA 2YEVA 3SUPA 2N05A 3BF3A 2VQEK 2ZDIC 3S3MA 3RYFA 4JI6K 4YY3K 4RHV4 1FS0G 3QICA 1S1UA 3ZMSA 2D3OW 4MVMA 1KAYA 2J4RA 2WA4A 5B1AC 3CC2V 1MA9B 1UWBA 1YVNA 3ZSVA 4K0KK 4LR3A 3LDNA 3TTFA 2Q36A 4BRPA 4X88A 3GWKC 1BIZA 3PSFA 4BRDA 2GUZA 5KGWA 3DJCA 3NF8A 4P30A 3STLC 4DR2B 1VQLV 3IKMA 4DFJA 3QO9A 3MDSA 1KYOF 3WFVA 5KHHA 1H8TD 1JJ2U 2KTQA 3DAWA 5LP6B 1T05A 1ESVA 1TUEB 4E4EA 1ZBHA 1S1WA 4LY7A 4OLAA 3T1HB 2HVHA 1VSIA 1NEKA 4B3SK 1NJIO 4J2EA 4CK1A 3CYOA 4NLBA 2Q68A 2YXHA 1IBMB 1NVPB 5AQUA 4EFHA 3SQ2A 4X64O 3FB5C 4LF6O 1NGGA 3AGKA 3PIOL 1SKRA 1FXXA 4PL7A 1KD1O 4UVAA 2Z0AA 1G4YB 3M8AA 4DR3B 1VQMV 1HJRA 3F9MA 4MO4A 3DRSA 2A3ZA 3ENHA 4BQLA 2DYSC 4CC6A 4PL8A 2XY5A 2F23A 2IJIA 3WNHA 1O9GA 5HFLA 2XUMA 1O1WA 1RT2A 1SZXA 1BHAA 2F9WA 4YOVA 2PGGA 1RFQA 1AI7A 3D3IA 4IYHA 3V9SA 3LSUA 4R50A 4DTJA 2IVNA 5BR8O 2P5OA 1N32B 4DQRA 1S5LZ 1W0HA 3HSTB 3C0BA 3VA3A 2LW7A 5KA5A 3QINA 4DR4B 4BRHA 4Q20A 1NGAA 4FPPA 2FMLA 4JAUA 1P7GA 3E1YA 4ISGA 4IYIA 3CMAN 5HRRA 1L5UA 1BCMA 1OCRC 4K35A 3RYHB 1NJZA 2HFEC 3EXAA 1KC8O 3CC7V 1XNQK 4KHPK 5AQNA 4AHUA 3KWIA 1HRHA 1JMKC 4GX1A 5C42A 1TAEA 3F9KA 3VQYA 1ATNA 1W2BU 3HVTA 1T03A 1AJNA 1NJIW 1RDCA 1KSPA 3FB7C 4Z4IA 3VTIA 3JALB 3LP3A 1OZ0A 3SNNA 4NKGB 1HR0K 1B6QA 4DR5O 1FAFA 2NUBA 5DN6G 4BWAA 4PD4F 3I56V 3DXMA 4ZTFA 4R6ZA 1KD1W 3CXCU 1VF6C 3N27A 3IC9A 1NR7A 3FE1A 3JAMO 4Z4GA 3O4QA 4ID5A 1Z7S4 2KLAA 2X5ID 2HG5C 3RR8A 1DLBA 1SQGA 4IIJA 4B8AB 5HL7L 2BCCH 1VRUA 1Y67A 3DLGA 4CJWA 2VQFB 2PZSA 4FJMA 1Y97A 5AQSA 1K3EA 2ITDC 4LF9K 4JKBA 1S6QA 1N4CA 3IJ4A 4Q5VA 2RPIA 3TAPA 4CHYA 1V55C 1TUBB 4JI1K 1HNXK 3MX5A 2ITCC 1SL1A 1GO3F 5BXZA 1SRYA 2XAJA 1AJPA 2IVPA 1KC8W 4LFBK 5KQ8A 4RUEA 3O9QA 4CBXA 3D6RA 4JKFA 1B04A 3VOUA 5CYQA 3SV3A 4PUOA 4JV5K 3ABVA 2Z1GA 1UA0A 1YDXA 1JVMA 2AP1A 1VQNN 3IFXA 1UAXA 4O0IA 4FYDA 5J9PC 2Q0OC 1AI5A 4X1KB 1I39A 1Y64A 2HBMA 5LMUK 3RRGA 1BU6O 1FD9A 3L3VA 3L71H 3PY8A 4CZZA 4LF7K 1JXBA 2L6LA 2QR4A 4O4LA 1VBA4 3UKMA 1NMDA 1FXKB 1HNIA 4PELA 1X1PA 3NVMA 3WQUA 4NCAA 1AR74 2Q73A 2G8UA 1F51A 4B1UB 4ZI7A 1S1XA 2ZT9B 4LNUA 2BE3A 4M3TA 4YOUA 2FF6A 2X74A 3D3QA 5EYPA 2HNZA 1NK6A 1KQSM 1AR4A 4F4LA 2R9RB 4IHJA 3EKSA 3JAMN 1QZ5A 3CFRA 1VQ6N 2JJ1G 3KHYA 5GONB 3T4ZA 1XOUA 1TK8A 2UU9O 4FK0A 2QM7A 3QEXA 4FLYA 2Y1IA 1YF5L 3DYAA 4JI4B 3BEXA 2KB1A 2Q0RA 1RUD4 1WLJA 2B1GA 1RMU4 3ETQA 2QW9A 2QM4A 1VQPV 1G15A 4GX5A 4LFCB 4I50B 3L0QA 4E1JA 1ZAUA 2GDSA 1K4CC 2XY8A 4FLVA 4J8FA 1XUQA 1I0HA 3S3XA 3AK3A 3T1YK 1RUC4 1C0FA 4MDBA 1H2KA 1NS1A 3OAAG 1BDGA 2VG7A 3QIOA 3TPQA 3ZEUA 4HUFA 4J2DA 4KHYA 4MLEA 3SJQC 3HPGA 1L0LH 1FKPA 3G4SV 4EZ6A 2ZR3A 4J9YB 5EK0A 2HMIA 2JIZG 4LBEC 1EXQA 3OVNA 3O65A 2FBYA 2VWBA 5AQYA 1WN7A 4YIOA 2QDOA 2D1KA 3LL3A 3SDLA 3D8CA 1L0NH 2LFRA 2ODMA 3OBWA 2A7WA 4JKGB 3AE3A 3AVAA 1FJGO 3H6EA 3VQ9A 3KG2A 3LANA 3C6TA 3V81A 3G6EN 1E1RG 3OYBA 1QSYA 2YDEA 3B77A 3L2QA 1R59O 2RN2A 4GV6A 1KECA 1DF4A 3FB6C 3KD5E 4ELVA 5B1AB 1NNEA 5JJNB 3BVOA 4DR2O 2WDVA 1NGJA 3CCSN 1BQZA 3AVMA 3OTFA 3OT7A 3KKYA 2UUAO 1NGCA 1D4XA 4IG3A 3AK2A 4PI2A 2W6JG 4HTLA 4R79A 3D2FB 4F8RA 2ZR2A 1T44A 3WT0A 2Q4PA 4BVPA 2W40A 3VGMA 5HLFA 1NTKH 1IBMO 1N36K 2P9KB 2YEVB 3PUFA 2XTAA 2P9UA 4CZEA 3RYFB 4B3RK 4YTMA 4OPKA 3AVFA 1RTJA 5JLHA 4MLHA
chains in the Genus database with same CATH topology
1LAVA 3QEPA 3QETA 4C8NA 4D7SA 4CHOA 4FLUA 3HPOA 3PN1A 1U45A 2ZINA 1CXQA 1L3UA 4GLXA 4PY5A 1BI4B 2DFFA 3HKEA 5D5PA 2XY7A 4QOZB 4LD0A 2HHWA 3UQ8A 5I42A 3NH2A 3ZCMA 1TV6A 1WSEA 4FJ9A 4ZTJA 1EX4A 4CJVA 3V9WA 1VSKA 4LF8B 5CY4A 3HPHA 2YXLA 4RW7A 4BWJA 3DOLA 4G1QA 1DGSA 2F66C 4O4GA 4FVMA 4O5BA 3CQ8A 3BGRA 4BE2A 4DF4A 1B9DA 3RYCA 2RKIA 4DSJA 2D5RA 4CH3A 3K58A 4ICLA 1IBKB 2E4LA 1QHTA 4OPJA 1IKVA 3V1RA 3O3GA 1RSOA 3VQ8A 4ZOLA 1S5JA 4IIJB 3OYLA 4L8RB 3L2VA 1V9PA 3OJUA 4IFVA 4HUEA 3JASA 4CFDA 2PYJA 4DR7B 5EIBC 5FNVB 5ITZA 3VQAA 5IWAB 5KHKA 4KHUA 2JVDA 1U04A 1Z5VA 4DMNA 4O4LB 2RJZA 1KVAA 4BW9A 3P83D 1C1CA 4ZI7B 1C1BA 4LNUB 1BQNA 1X4TA 5EYPB 5CA0A 3M8SA 4IHJB 4DK1A 2Q7GA 4DV4B 4YJ2A 1TA8A 2YV0X 3NF6A 4BDZA 1X9SA 5KMGA 3SR2C 1YVUA 3AA5X 4CECA 1S6PA 4RW6A 2HHVA 3VQXA 3NBPA 3H08A 3ZSXA 3DLBA 4B9UA 4E0DA 3KIOA 4R5PA 4LH6A 2YHAA 1T5EA 1Z5WA 1U47A 4OJRA 3RMDA 3ZEDA 4HHTA 3OYIA 3LALA 4FM1A 1GOBA 1JLBA 3RWRD 4RW4A 3WNFA 3LWLA 2Z1IA 1BISA 4FM0A 1T8EA 4KTZA 2OYQA 4KTWA 1D5AA 5CZ2A 2PYLA 1NJYA 2VQEB 4DSIA 4JI6B 4YY3B 1S9EA 4KI6A 4M42A 3OY9A 4K0KB 3LNNA 1KVCA 4FJGA 1XHZA 4H8KA 3AA3A 4I2PA 5LOVA 3SUNA 3KKSA 2ETJA 3ZT3A 4B3SB 3HKEB 3RGBA 3NFAA 3ZT1A 3TI0A 3AO3A 4BWMA 3OYJA 3U0ZA 4FXDA 3VQCA 4RW8A 1FFXA 1QTMA 1H2SB 5EZYA 3K5OA 4CJQA 4FJJA 4F6RA 1KLMA 3RYHA 1D9FA 2G8FA 4W5NA 4AHCA 1M93A 1ZBFA 4I4TA 4M3RA 4BDYA 5HROA 3L2UA 1SL2A 4ZHQA 1XNQB 5HBMA 4KAZA 4KHPB 2EX3A 3TAMA 1KMIZ 3AVIA 3A2FA 5JVDA 3RYCB 3PV8A 4UCVA 1D8YA 4CS4A 1HR0B 2OPQA 3NCIA 3AO1A 4DQSA 3HL8A 4O55A 1RILA 1TUBA 4DS5A 4BDPA 1LAWA 2HNDA 2G8VA 4ZOLB 1GOAA 4LF9B 3MEDA 2VWKA 4JI1B 1HNXB 3JSNA 4YJ3A 1JKHA 4UQGA 4LFBB 3KD1E 3JASB 4LH4A 4JV5B 5ITZB 4IBNA 3E22A 3WB1A 3NE6A 5LMUB 1WSIA 4J2BA 4LF7B 1RT5A 3RMAA 3HO1A 4FJHA 5K14A 4E7JA 4FW1A 5GONA 3TAFA 2Q0AA 1TKTA 1DTTA 4GMJB 4E1NA 3AVJA 2YNIA 4I50A 3SJCC 5CA0B 4CHZA 1SV5A 4JRPA 4CJSA 1NK0A 5KMGB 4RW9A 3RFRA 4CF0A 3ZT4A 4AHVA 4X1YA 4FZXC 3T1YB 2IC3A 5CB4B 4DF8A 1R0AA 3AVKA 4ELTA 3I8DA 1NOYA 3P1GA 3SI6A 1NKCA 1RT7A 3LZIA 3O4NA 1U48A 2EHGA 4LSNA 3FI7A 4TQFA 4DTUA 2YNGA 4EFBA 3P5JA 4CJPA 4FJ5A 5J2QA 1VSLA 2P22C 1SQFA 3ZSRA 3CSXA 3VQ4A 4DLEA 4DS4A 4EP5A 1P49A 3WB2A 2FBVA 1ZBUA 2F8TA 4CGGA 3MXIA 4B3RB 2OZMA 2D0AA 5JJJB 1BIUA 1WSHA 3PO5A 1Z26A 3O3FA 3C95A 3DRPA 3CYMA 1BI4A 3DI6A 4DV7B 1XWLA 5LOVB 4FLXA 2X78A 4JI2B 3VQPA 1S1TA 4GKKB 3RWUA 3SPYA 1A5WA 4I55A 5SZTA 2KFZA 3HM9A 4DV5B 4DTOA 3RYIB 1FFXB 5EZYB 4F6RB 5FRMA 3QTCA 4E7HA 2G8HA 1TL1A 4I4TB 4MFBA 1DLOA 4KI4A 2X6NA 3LAKA 5IJ0A 5FPOA 1HNZB 4ZHQB 3G10A 1XMQB 3V1OA 4MQ3A 5JVDB 3B2EE 1QSSA 3LAMA 2E6LA 1KRPA 4KPYA 3OYCA 3DLEA 3PX6A 4CGJA 1IKYA 1LW0A 4B9VA 2KZZA 4JI0B 4DR1B 4CC5A 2OPPA 3M8RA 4AQYB 3AV9A 4WBNA 1TAUA 5FNVA 3SQ1A 3OS2A 3TAQA 4GYCB 4FJ8A 3U3YA 4YJ3B 1J54A 2YKNA 1Q9XA 4JI5B 1NK9A 3AVCA 3K5LA 4DV3B 3PX4A 3E22B 3KKRA 4CIGA 4C8MA 4LSLA 4B9LA 2WOMA 1B92A 5JS1A 4K8ZA 2DFEA 1Q5OA 4X20A 3HYFA 2PUSA 5J2TA 4BE1A 4BE0A 5J2NA 3UT5A 3KK3A 2KQ2A 4FJ7A 4JI7B 4FW2A 4F4KA 1W9HA 3VA0A 3TAEA 1RTDA 4X1YB 4O44A 1O9HA 3DLKA 1HQEA 2YIBD 3V9ZA 2P51A 1NK5A 1XI1A 1TGOA 3CG7A 3VQQA 4EB6A 3TANA 2IS3A 5CYMA 3U6FA 4DFPA 1JXEA 3EY1A 3K5NA 5JH7A 5D3GA 1Q43A 2VG5A 4TV8A 1RDBA 5FPRA 1HNVA 3KLEA 3K5MA 3DM2A 3S3OA 1WAJA 4DUZB 5FRNA 1RBTA 4PHZA 1NJWA 3THOA 5KI6A 4CGHA 2ZCEA 4CGIA 1TVRA 4CK2A 4NCBA 4DTMA 3AO5A 1RTIA 1RBUA 3AO2A 4DV1B 3QNNA 4Q0BA 4EEQA 2ZQBA 1JL2A 4M3ZA 2AJQA 2JS5A 2RQ6A 2DFHA 4I55B 3HT3A 3AVLA 2R7YA 1XC9A 4KB1A 5KHJA 4KRFA 1BQMA 2Q3SA 3CM5A 4O4JA 3QLHA 4B9SA 1U49A 3SJAC 4TV9A 4CF1A 2ZIOA 4DFMA 2BTQA 4KHNA 4C8LA 3IS9A 2QK9A 2P5GA 4DTPA 5IJ0B 4U3JA 5EIBD 3LWMA 1UOCA 1BGXT 1TL3A 2Q7HA 4IKFA 3OYMA 4E7LA 4DSKA 2ZE2A 1VSEA 1RT3A 4B3MB 2W42A 3SZ2A 1XMOB 3CB2A 4CGDA 2BANA 3LP0A 1ZBLA 3KLHA 3T19A 1T7PA 4WBNB 3BA8A 2JLEA 4IDKA 4C8OA 3QNOA 3HJFA 4JS4A 4AH9A 4YNQA 2F95B 3BAAA 4KV8A 3SV4A 4FCYA 4FJLA 4CH6A 2UXCB 4EZ9A 4FLZA 3AVGA 1VSFA 3ICXA 4E3SA 3SJJA 2PY5A 4DQPA 1RT4A 1HYSA 3HP9A 3SGIA 5KHIA 2YHBA 4X20B 1X9WA 1ITGA 3MEGA 5J2TB 5CB4A 3SJBC 3UT5B 1RDAA 4CEAA 3QESA 3CM6A 4OKEA 2FBTA 3M8PA 2GBZA 3ZSWA 5KHGA 3E01A 1RBVA 4CEEA 1MU2A 4HVJA 5KX5A 5HP1A 4CJKA 4CFAA 4CIFA 3BPZA 4X1IB 1C1AA 1HMVA 4FJXA 4KO0A 4EB6B 3I0RA 5J2MA 4YHHB 3TARA 1HPZA 4OX9B 1XHXA 3CFOA 5IJ9A 4PI0A 3JSLA 3TR8A 5JH7B 1Z25A 2XHBA 3ZT2A 5SWMA 4DV6B 4TV8B 1LWCA 5DMRA 4HCBA 3NF9A 4O4HA 3KLFA 4O2AA 4TUYA 2IOCA 1IKWA 4LH5A 3LP2A 2QKBA 1RCHA 4N56A 1U4BA 5DK5A 1TK0A 2G8IA 4BACA 3ZS8C 2KFNA 2P1JA 4UCTA 3HK2A 2G8KA 2JGUA 3FFIA 1HNWB 2A1RA 4E7KA 4X62B 1S1VA 3RYIA 2HEPA 2F8SA 4CGFA 2QJ1A 5LXTA 3MXJA 3D0PA 5LA6A 1YTUA 3RMBA 2ZD1A 2A1SA 2OPRA 4O4JB 4CEOA 3JAWB 3EZ5A 4OGCA 4TOIA 4TV9B 4AILC 4DSFA 2BTQB 3NHGA 4KHWA 4DU4A 4CHQA 4FM2A 3SUOA 4U3JB 1NOZA 4K8XA 2IM9A 5C25A 4LF6B 4W5QA 3THVA 4B3OA 3VN5A 2OZSA 3BABA 5KRTA 4JLHA 2HHQA 3M8QA 3KK1A 1LV5A 2B6AA 3IAYA 1IO2A 5BR8B 2D0BA 4DTSA 1N5YA 4KREA 3ULDA 1UA1A 4FK2A 4E7IA 2ZNJA 4CJ4A 2IAJA 4KTQA 4DRXA 1F21A 1EKEA 1JLEA 2IGIA 3VQ6A 3KTQA 3ISNC 3NAEA 4DK0A 4M3YA 4B8CA 3MECA 1QQCA 3QG5A 3CHXA 2G8WA 4ZHRA 5KTQA 3V9XA 4PWDA 1JLFA 3BA9A 3LPUA 1A5XA 4DWIA 4F3OA 3OS1A 1WNSA 3JARA 5JCOC 3D45A 2BTOA 1BCOA 4CERA 4CF9A 3HKCA 1SL0A 1TAQA 3N2KA 4NYFA 5KX5B 3VQEA 5JQGA 1JFFB 1SA0B 2UU9B 2YI8A 2HHTA 1L3VA 1KTQA 2CAZC 4UCRA 5IJ9B 4CE9A 4EP4A 3SQ0A 4CF2A 1N36B 4FLWA 3NH1A 2QXFA 4O4HB 4O2AB 2XY6A 1VK0A 4TUYB 1ASUA 2XO7A 1RTHA 3HKBA 1KCFA 4B9NA 4KL1A 2PW9A 3VQBA 1EETA 2IDOA 4GVMA 5K1XA 1RBSA 3I0SA 1FJGB 1L3SA 1CLQA 2BGGA 1JLGA 4CK3A 4Z4FA 4DTNA 1SKWA 1NK4A 1RBRA 2VG6A 1TVKA 1J5OA 1J5EB 4CJ3A 3B6PA 5IYZA 2UUAB 1KLNA 4DU1A 4C8KA 2E3CA 3O3HA 4B08A 4O0JA 3HP6A 1YEWA 1SUQA 4UCSA 5LXTB 2LSNA 3LZJA 4D7TA 5C24A 4UCOA 5LA6B 3AVHA 2OPSA 3BDPA 1SKSA 1NKBA 1M4UA 4O2BB 4FZYA 4CJEA 3BHPA 4CJUA 3KLIA 1KU9A 2RF2A 1RT6A 3JSMA 3IRXA 1QE1A 4E89A 4TSXA 2HHHB 1EP4A 4ZIBA 1WAFA 3LPTA 2FC0A 4I7FA 3L3UA 3V9UA 4CS2A 4M3XA 3RTVA 4LFAB 4JI8B 4CJRA 3VQWA 3VQVA 4I9LA 4KHSA 3FFQA 4CH4A 3K59A 3N2GB 5E41A 1S9GA 4I9QA 5HRNA 4W5RA 3SPZA 4DQQA 4DV0B 4DFKA 2HHSA 1ASVA 4LH7A 4DRXB 2GUIA 3S9HA 3ZT0A 5J2PA 4CJTA 3DSQA 4HTUA 3SUQA 5KGXA 1VSMA 5CA1A 3C6UA 3WNGA 3QIPA 5HRPA 1VSDA 3ASMA 4Q6GA 3NDKA 4KB0A 4FJIA 4DG1A 1HYZA 1YT3A 4KFBA 2Z1JA 4L8JA 3JARB 1BL3A 2QKKA 1K6YA 4M41A 5CZ1A 4ELUA 3PO4A 4J2AA 1IG9A 3HKCB 4X1IA 3WB0A 4F3TA 1J9AA 2E5LB 4M3WA 4CIEA 2BE2A 3N2KB 3SQ4A 5JQGB 3VQDA 1HQUA 4F2RA 1RNHA 1CXUA 2YIBA 1C6VA 5T7BA 4FFBB 1LWEA 1I7FA 4FK4A 4N5SA 1TK5A 1NT2B 1N33B 3CFPA 3IG1A 2KKWA 2UUCB 3NH0A 4RG8A 4JRQA 4GW6A 3BRCA 1NJXA 1QS4A 1FK9A 1YTAA 2GV9A 5I3UA 3HKBB 3JYTA 4NXMB 1IBLB 3JATA 1IKXA 3OYGA 3OYKA 4DQIA 2PTMA 1RDDA 5EU7A 3LP1A 3ZSQA 2YNHA 1TVKB 3ZSZA 3C94A 5IYZB 1WPBA 3HKDA 4QAGA 4NCGA 3ITHA 4FJKA 4YFUA 4XIUA 3L8BA 3JAWA 2O4GA