2PYJA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
567
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTA(DOC)-3'
total genus 173
structure length 567
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pyjA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pyjA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pyjA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pyjA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pyjA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pyjA06
1HYSA 1VRTA 3L2QA 2DFEA 4CGGA 4B9SA 1RTJA 1RDDA 1QE1A 3NCIA 1RILA 1ZBIA 3VQ4A 2VG5A 2YKMA 3V81A 1IKWA 4DFMA 3C6TA 1SKSA 3TAQA 3RMBA 4K8XA 3K5OA 1FKPA 1VSHA 4EP5A 2QXFA 3ZT2A 4M3RA 3LWMA 1HQEA 2ZQBA 4EZ9A 1JLBA 2PYLA 4KV8A 1CXQA 4CEBA 1KFSA 4TSXA 4FLZA 3V6DA 2OZMA 2D0AA 1LV5A 4FJ9A 1X9WA 3FI7A 3NF8A 1JXEA 4Z4HA 5C42A 1C0MA 2PY5A 3KD1E 3KKRA 4B8AB 4CEZA 1JLGA 3V9UA 2OPSA 2Y1JA 2X78A 1XI1A 1J54A 4C8NA 4IKFA 4NYFA 1KLMA 1RT4A 3ZCMA 1J9AA 5JS1A 2EX3A 4NCBA 3T3FA 4CHYA 4FLUA 1A5VA 4CJWA 4ZTJA 4DU4A 4M3XA 4BE2A 3M8RA 3RMCA 1T05A 3AV9A 1JLAA 4Z4IA 4LY7A 4FJ7A 4LH4A 3HP9A 4LH5A 2KTQA 1HRHA 1C0UA 1KRPA 5FRMA 3ZSWA 1WLJA 2E6MA 1KVBA 3KLGA 1IKXA 2IC3A 3K57A 4KHQA 2KZMA 3T19A 1TGOA 1WSIA 4E7JA 3QEWA 4I9QA 4B9TA 1FXXA 3BDPA 1EETA 1HQUA 3K2PA 4IFVA 5DK5A 1NKBA 4FJGA 4J2DA 2OYQA 4NCAA 3CM5A 3DMJA 4MQ3A 3NGZA 4DTOA 4GVMA 4E19A 3ZSOA 3FFIA 4EP4A 4KTZA 4C8LA 1S1WA 4CJFA 2Q3SA 2P5GA 1S1TA 5T7BA 2IOCA 3HVTA 1C1AA 3CFOA 5J2MA 1C0TA 4ZTFA 1RT6A 4DSKA 4CHZA 4AHCA 4FJNA 4AHTA 3OYHA 3AVLA 3AVJA 3OYGA 3EYZA 1YTUA 2IDOA 3AVNA 3HPOA 1NJZA 2KW4A 1TV6A 3HO1A 3PUFA 4HCBA 4DF8A 1HYVA 4CIGA 3DRPA 3VQPA 3SQ1A 5HLFA 2HHUA 1W9HA 3OY9A 2FBXA 1JLCA 5HBMA 3DLBA 3ZSVA 1JLQA 1SUQA 4FXDA 1UWBA 4CHOA 1RTHA 4O0IA 3NHGA 4DQQA 4F2SA 1JLFA 3OS0A 4OPKA 3MECA 2F96A 2KZZA 1VSEA 2BANA 4KI4A 1A5WA 1Z25A 3HT3A 1Q9XA 4IFYA 3HXMA 3VQDA 1JXBA 1S6QA 2E4LA 5HRSA 3NGIA 4M3ZA 1U49A 1WN7A 1BISA 3NF6A 1WAJA 4H8KA 4CK3A 1X9SA 3KD5E 4PA1A 1ZBUA 2YHAA 3DOKA 4KAZA 4DU3A 1BIZA 1SL1A 2XY6A 2X6SA 1ZBFA 4MFBA 1HMVA 4OKJA 4ID5A 3V1OA 3OYIA 4DTSA 1EXQA 2VG7A 4CJTA 4E3SA 3QEXA 3PO5A 3AVCA 4DFKA 3PX6A 1ASUA 3AO4A 2YNIA 1BHLA 3QNOA 4KHNA 4DSIA 1IO2A 4DS4A 1RCHA 2DTUA 4DWIA 4CECA 4FM1A 2A1RA 4FJJA 1VK0A 1TK0A 3RR8A 4I7FA 4CF2A 4FZYA 4FJ5A 3WNEA 3A2FA 4CIEA 4E7LA 1YTAA 3THVA 4M41A 3V1QA 2DFFA 4E89A 3LP3A 3VQCA 3MAQA 3VA0A 1HNVA 3KLHA 3NDKA 3IG1A 4L8RB 1O1WA 1TVRA 4FK2A 1TAUA 3VQAA 3TARA 3OYEA 3S3MA 4KTQA 3ZSZA 2G8IA 4DTPA 4OGEA 3QEPA 3MXMA 2HVHA 3SYZA 1J5OA 3NFAA 4FW2A 1EKEA 3LP2A 3VQ9A 1WNSA 1JLEA 4KB0A 4F4KA 2YHBA 3AA2A 5HRPA 1S5JA 1BGXT 1LAVA 3HPHA 3ZSRA 2BE2A 3MXJA 4FLVA 1BCMA 4GW6A 4CERA 4CJ4A 4IG0A 1CXUA 4YFUA 4ID1A 3TAMA 3OYMA 3SZ2A 1RT2A 3ZSXA 3TABA 2VWJA 1UA1A 2HNDA 5HRRA 4RW9A 1L3SA 4CJQA 3QEIA 4F8RA 4FJLA 2YNHA 3H08A 2AJQA 3MEGA 3ASMA 3SNNA 3AVMA 3TAGA 5J1EA 4FJIA 1XWLA 2GBZA 1Q9YA 3LP1A 3OYJA 1IH7A 4FVMA 1KFDA 3ZSQA 3V1RA 4W5OA 3L2UA 1L3TA 4Z4GA 2JLEA 2Y1IA 4RG8A 5J2PA 3RMDA 2Z1JA 3CYMA 3RMAA 4KPYA 5CZ2A 3DI6A 2ZE2A 3F73A 2OPPA 1NK0A 2ATQA 4Z0UA 3TI0A 1U48A 2XO7A 4DF4A 1S6PA 4M3YA 3OYLA 3OYBA 2O4GA 4FJXA 5E41A 1ASWA 3RRHA 4HHTA 3DLKA 3IS9A 4HUFA 1NK4A 2OZSA 1I3AA 2YV0X 3TWHA 3L2VA 5J2NA 3SI6A 2E6LA 5DMRA 2D5RA 3K5LA 4W5NA 3HVRA 1SL2A 2HB5A 2IS3A 4BWJA 4G1QA 1QHTA 3QLHA 4OLBA 1QSSA 2PW9A 4CGJA 4PQUA 1NK5A 1LAWA 3NBPA 3PX0A 3SPZA 4F2RA 4LSNA 4CHPA 4RW6A 4B08A 4FM0A 3TR8A 3VQ8A 3JSMA 4QCLA 2JGUA 4DLGA 4FYDA 3V9SA 1CZ9A 3OYKA 4CEQA 2WOMA 1S1VA 3KLIA 1RT7A 4CGFA 4UQGA 1NJXA 3K59A 4CEDA 2G8KA 3VA3A 2Z1IA 3SPYA 5CY4A 1LW0A 4KFBA 1WSHA 2R7FA 2VWKA 1SL0A 5I3UA 3PX4A 3S3NA 1LWCA 1XC9A 3VQQA 4B9NA 1LWFA 2B5JA 3LALA 4Q5VA 3NH0A 3LZJA 4BACA 1N6QA 2WONA 2QK9A 4H4OA 2G8FA 1T7PA 3LAMA 3QIPA 1BCOA 1QQCA 4ICLA 4RW4A 4CESA 4W5RA 1TL3A 3RR7A 3WNFA 2EHGA 4Y1CA 4OLAA 2RKIA 3OYNA 3TANA 2HHTA 3C94A 3ISNC 3O4NA 4NYNA 3DRSA 4N41A 4M3TA 4CJUA 1F21A 1B9FA 1W0HA 2B4JA 1JL1A 3E01A 3AA4A 3C6UA 3F9KA 5EU7A 2GV9A 3AVAA 4GMJB 4CJRA 1G15A 3HJFA 1HJRA 4E1MA 1JKHA 4J2EA 4CEFA 2NUBA 2ETJA 2RN2A 3U6FA 1DTTA 1B92A 4AILC 3HK2A 3IAYA 3SJJA 1S1UA 4CF8A 1RT3A 4YNQA 1BQMA 1I39A 2GUIA 3VQ6A 1X9MA 4K8ZA 3HSTB 2ZD1A 1TKXA 3NE6A 2Z1GA 1CLQA 4M3UA 1BIUA 3NH2A 1D5AA 3NH1A 1VSDA 5CYQA 5KRTA 4DQRA 4DSLA 4PWDA 2HW3A 4Y1DA 1VSJA 2XY5A 3TAPA 4N5SA 2HVIA 4CGHA 4DSJA 1U4BA 3SQ2A 3O3HA 1WSJA 1DLOA 2DY4A 4LD0A 3ULDA 4OPJA 4F3TA 4CEOA 3M8QA 3QERA 3LZIA 3EY1A 3LDSA 4OJRA 5HRNA 4W5TA 3I0SA 1L3VA 4KREA 4FW1A 4CHNA 1ZYQA 4JS4A 4Z4EA 5FDLA 4M45A 3OS1A 1SKRA 4CF9A 3AA3A 3AO3A 1N5YA 5KRSA 3CM6A 4ELUA 1HNIA 2OPRA 3OS2A 2XRIA 3EZ5A 1GOBA 1SKWA 1XHZA 1VSMA 3O3FA 1Q8IA 3HPGA 3SUQA 4J2BA 2RPIA 3SV3A 3KJVA 1RNHA 1BI4B 4FK0A 1NK7A 1U47A 2X74A 1NOZA 2D0CA 3TAFA 1D8YA 2HHSA 4LSLA 4IDKA 3U3YA 1U45A 3AVIA 3L8BA 2R7YA 4DS5A 4CFDA 4OKKA 1QTMA 5JS2A 5HROA 4CK1A 1ITGA 4CHQA 4R5PA 1A5XA 1TKZA 4B9UA 1EX4A 1WSEA 1VSLA 1C1BA 3V9XA 4FM2A 2KFNA 1GOAA 2KFZA 4BE0A 3OYAA 1HYZA 5KI6A 3HL8A 3OYFA 4Z4FA 1UOCA 1VSKA 5D3GA 3NGYA 2Z1HA 1EP4A 1MU2A 4CCHA 3SV4A 4FLTA 5C25A 3LPTA 3HP6A 1TK8A 4FZXC 3KK1A 4CJEA 4C8OA 2QKBA 4WE1A 4FLYA 2D0BA 4AH9A 1Z26A 4O44A 4FCYA 3L2RA 3DLRA 3V9WA 3S9HA 1KLNA 1VSFA 3SUPA 4ELVA 1SV5A 2IAJA 4DSEA 4DG1A 1NJYA 3HYFA 1NKCA 4FJ8A 4CF1A 4KB1A 2P5OA 3NF7A 4KTWA 3AVFA 3LANA 3K5MA 1QSYA 3LP0A 3I8DA 1NK9A 1NOYA 3P83D 2XY8A 3CG7A 1TKTA 4DQSA 4KKOA 4PY5A 5J2QA 4KHUA 2QKKA 1D9DA 4O55A 4DU1A 4BE1A 3K58A 4DLEA 3ALYA 4CJ5A 2DFHA 4HCCA 1S9EA 3L3VA 3T1AA 4DQPA 2KQ2A 1WAFA 1K6YA 2HNZA 1TAQA 4B8CA 2G8VA 3SQ4A 1RDAA 3CFPA 4E7IA 1S1XA 3ZT4A 4CFBA 3JYTA 4C8KA 5SWMA 1ASVA 4DFJA 3ZT3A 3CFRA 1U04A 4CF0A 1YVUA 3BGRA 3M8PA 2OA8A 1UA0A 4FLXA 4B3OA 1X1PA 5CYMA 3OYDA 3DOLA 2G8UA 5C24A 1QSLA 2HMIA 5CZ1A 1J53A 1KSPA 3KKSA 4FJMA 3QO9A 4O0JA 1IG9A 1CZBA 3B6PA 4DTRA 4I2QA 3ZT1A 2HHWA 1JL2A 3DLGA 3ZSYA 2G8HA 2P1JA 3AA5X 3QETA 4FLWA 2HHQA 3VQ7A 2I5JA 4OVLA 1RBUA 1BQNA 4AHSA 3MXIA 2OPQA 4BWMA 4CEEA 3I0RA 4KHSA 3SUNA 4RW8A 3DLHA 2G8WA 3NF9A 4XIUA 1Y97A 3WNGA 3AVBA 3OJUA 4JRQA 3VQBA 3PY8A 1WSFA 4CGIA 4E1NA 4DQIA 4O5BA 4DSFA 2YKNA 4CJVA 3WNHA 3S3OA 1RDCA 1IKYA 4DTXA 3ITHA 2PZSA 3DM2A 3OVNA 5KTQA 4O4GA 4DFPA 1C1CA 2LSNA 4C8MA 4KRFA 1L5UA 1NKEA 1REVA 3QEVA 4DMNA 4HTUA 4KHWA 4DTUA 1RDBA 3KK3A 3RRGA 1TL1A 1ZBLA 1FK9A 3KIOA 3HM9A 4CJLA 4OKEA 4CJPA 4CJKA 4B9VA 4B9LA 3CQ8A 3DLEA 1KCFA 3QESA 1C6VA 3G10A 3QINA 1XHXA 1RT5A 1S9GA 4Z4CA 4JRPA 4E7KA 1ZBHA 4JS5A 4CK2A 1IKVA 3MEEA 3G0ZA 1NK6A 3LPUA 2F8TA 1KVAA 4E7HA 3UIQA 2BGGA 4W5QA 1BL3A 4IBNA 1NK8A 4QOZB 4CFAA 1T8EA 4FZZA 4I2PA 4B9MA 2XHBA 2HNYA 1GOCA 3KLEA 1RBSA 2RF2A 2X6NA 3O4QA 3C95A 2F8SA 4DTJA 2P51A 3AO1A 4N56A 4ELTA 1KTQA 2XY7A 3DYAA 4IG3A 3ZT0A 3P5JA 4ZHRA 5HP1A 4PUOA 2IGIA 1D9FA 4BDZA 3RWUA 1YT3A 4KO0A 4CEAA 1T03A 4BDPA 3AVGA 1HPZA 3IRXA 5I42A 3B6OA 3L2WA 4BDYA 1L3UA 3PO4A 3SUOA 1TKDA 2FBYA 4N76A 4AHRA 4CJSA 4Q0BA 1TK5A 1QS4A 3DRRA 1RBVA 1WSGA 4RW7A 3KK2A 3P1GA 1RBRA 5K14A 1LW2A 4CE9A 3VQEA 1R0AA 3OYCA 1NJWA 2BDPA 4CIFA 4F3OA 3AVKA 3AVHA 3VQ5A 4H4MA 2HHVA 2ITGA 4FK4A 1LWEA 3QIOA 3MEDA 2PYJA 3V9ZA 2YNGA 5FRNA 4N47A 3OJSA 1RTDA 4EZ6A 4HUGA 2A1SA 2W42A 4DTMA 4HUEA 1RTIA 3SCXA 2VG6A 5KGWA 4KI6A 3QNNA 3K5NA 3L3UA 3V4IA 3NAEA 3SQ0A 2FBTA 3KLFA 1KVCA 1RT1A 2FBVA 2YNFA 4J2AA 4CGDA 3U3GA 3D0PA 4AHVA 4I9LA 4CJ3A 3KTQA 1VRUA 4NCGA 3VN5A 3AO5A 3LWLA 2HHXA 4JLHA 3LAKA 3RTVA 4DTNA 4M3WA 4FJHA 4OGCA 2FC0A 1RBTA 1FKOA 4CFCA 5KGXA 4QAGA 1UAXA 3TAEA 5FROA 3D45A 4KHYA 5SZTA 2O4IA 3O3GA 3M8SA 3PV8A 4FJKA 2B6AA 4HVJA 1BI4A 4AHUA 4E0DA 1VSIA 4M42A 1DTQA 3AO2A 1B9DA
chains in the Genus database with same CATH superfamily
2HVKC 2F95B 1IXMA 4I50B 3OW2M 1RTJA 3T1CA 1AI7A 3J7AU 1FXHA 1RILA 1AI6A 4I9WA 4PI2A 4DFMA 2RMU4 2QM7A 3QNEA 4WF9V 5F1XA 1WOQA 4RQEA 3C7NA 4EZ9A 3EFFK 2PYLA 4LNUB 4TSXA 1AR5A 2OZMA 1LV5A 4J8FA 4D6TH 3KD1E 3THWB 1Q18A 1QR9A 4B8AB 3K3WA 3V9UA 2OPSA 1PP9H 4F6RA 2FB5A 2Q97A 1J54A 4C8NA 1J9AA 3WEEB 2EX3A 4MVMA 4G2KA 4DU4A 4F9OA 5JCOC 4M3XA 4GV6A 3AV9A 4Z4IA 5KA5A 3SBGA 4CS4A 1V55C 1C0UA 3WG7B 1QQMA 5FRMA 5GONA 2E6MA 1KVBA 3KLGA 2IC3A 2B1IA 3K57A 4QNHB 1TGOA 5M1QA 1SA0A 4MVUA 1FXXA 1LNQA 2UU9O 3AE1A 4OX9B 3K2PA 1SZ2A 4IFVA 5LMNB 2QM8A 2OYQA 4BRMA 3ZHQA 3CM5A 4X1IA 4DR7O 1EWQA 3FFIA 1HKBA 4AM7A 3AG1C 4C8LA 4E4EA 4IZ9A 1XMQB 3C3TA 2ZE8A 5LYJA 1BGYH 1IZ3A 4ZTFA 1FJGO 4FJNA 2W41A 2NN4A 1T6CA 4O5FA 3GOIA 4AQYK 3AVJA 4Q20A 2WU5A 1ZLZA 1B6QA 5FPEA 3CCQN 2VQFB 3CF5L 4BRDA 3VQPA 1VQON 2UU9B 2HHUA 1R3JC 1N8RO 2FBXA 1XQSC 3CD6V 4H5RA 3WFVA 4JEPA 5HBMA 1K9MW 3SMSA 1VQKN 4JI2B 5EC2C 1UWBA 4DUZO 3O80A 3CC2V 3NHGA 4DQQA 4B1YB 5BMVA 1JLFA 2F96A 1NU1H 1QU7A 3CIPA 4IFYA 3CXCM 5KX5A 4X64O 3VQDA 3THXA 5E1AC 3C90A 5KPTA 4JAXA 4CK3A 3NF6A 3ATVA 4XH5A 4R7CA 3ZIAG 5A9GA 4PA1A 2O8CA 4KAZA 2PFUA 3B09A 2KHOA 1SERA 1RPOA 4IFEA 1AILA 4JAVA 4ZI7B 2FLOA 2X6SA 4MW8A 1Y67A 5AQKA 4E3SA 4KRFA 4CJTA 2R72A 1GTOA 2EIKB 1SS6A 4DFKA 4YIOA 2O8FB 4H5WA 4KHPO 5L3EA 1KFYA 2RS54 1Y6XA 4DWIA 4FM1A 2Q31A 4FJJA 3L74H 3RR8A 4CF2A 2OANA 2WA3A 3X2QC 4E7LA 4FZYA 2WDQA 5KPRA 4H5NA 3V1QA 4TV8B 2WA4A 4DK0A 2ZGZA 4X65B 2YSUB 3LP3A 2OCEA 3TSQA 1FFXB 4JI0K 3CPEA 4U67L 5LL6Y 2W6LA 3IC7A 2WTUA 1RMU4 2G8IA 3IFRA 3SBTA 3B8MA 4OGEA 1Z6RA 4JYAK 3MXMA 1FW6A 5CHIA 4NXMK 3JXUA 3VRAA 2BOBC 4QJFB 1P8ZA 1QQOA 1XNRK 4O4IA 4UCOA 3NXSA 3LP2A 4BR9A 1WNSA 4DR4O 3I8BA 1JJOA 5IWAK 3OTOK 3MN9A 5LMNO 3E8FA 3CMAN 1S5JA 1LAVA 1HNZK 4PA3A 1AL24 1Y76B 2BE2A 3MHHC 3RWRD 4FLVA 2Z3YA 3ABLB 4WBNB 1IBKB 4BRIA 3TABA 1VQKV 4DUYB 2D0PA 4RW9A 1UJWB 1QVFM 2A6AA 2GUZA 2M7WA 3GG4A 3R9PA 2AJQA 1BE3H 2EZOA 3CCMV 5GIOA 5A2QN 4DSKA 4BIZA 3ZSQA 1L3TA 1YIJN 3Q4HA 3M5RA 3TU5A 4A57A 3ETDA 4YOUA 5LXTA 3RMAA 4KPYA 4YTMA 5B66Z 4U3JB 4IO8A 1AI5A 1DF4A 1R6KA 3SYCA 2HFEC 2XO7A 1YHQV 3TI0A 4DF4A 1WJZA 3OYLA 3DSQA 4IT5A 3Q7CA 4FSVA 4LFCB 4FFBA 4IL6Z 3JARA 3ZMVA 1D4XA 3OGCC 3RRHA 4FVUA 2WSSG 4HHTA 4K25A 4ABMA 3DLKA 1GLDG 3IS9A 1NK4A 2QA4N 4DB3A 1QLNA 1NH2D 1YTFB 4KFMA 3CCRN 3T1HO 2OTLN 5EIBD 2BH1A 3E66A 4LBEC 1SQQH 3H1KH 5BR8B 5E26A 2F9TA 2HB5A 5L3CA 5EZYB 2BOCC 1PNKA 2WDRA 3CCSN 2IJIA 3DAWA 2PF4E 1NGHA 4PQUA 1YJWV 3NBPA 1XQ8A 3UO3A 4WFAV 2QM4A 3EHBB 3SPZA 3SYAA 3RSEB 3DXKB 1KUQA 4HNAB 5KAFZ 3OYKA 4JI3O 2X7RB 3JARB 5LHIA 2ASMA 1RT7A 2E88A 4CEQA 3KWGA 4CEDA 3CCVV 5CY4A 1SQGA 3HOSA 1XC3A 1W2BU 4KFBA 3AG3B 1SL0A 4B3RK 1YXBA 2HVJC 2OCHA 4K0KK 2N74A 1LWCA 3VQQA 4JV5O 5LA6B 4B3SB 2B5JA 3NH0A 4JYCA 3E9LA 2ZKOA 2WFBA 1HLUA 1SS3A 2V1DA 2Y4UA 3ABTA 1NEKA 2P4VA 1S72V 1ZTEA 2Q7HA 2F7TA 2EHGA 3ID8A 2RKIA 3OYNA 3CMEV 3FGUA 2BTFA 2VQEB 2HHTA 3C94A 1NA1D 2R044 1TUBA 4I4TA 4B3TK 4WCEL 4M3TA 4JI5K 1H2LA 4FXDA 1B9FA 1W0HA 1K5SA 5IE9A 3CCJV 3GE1A 4CJRA 1HNWK 3HJFA 4NTXA 2P9PA 4E1MA 5H9CA 3KVGA 1JKHA 5JWPA 4UY8O 1POV0 2NUBA 2RN2A 4Z94A 5EBLC 3IAYA 2E2NA 3HK2A 5EYPA 4DYLA 4YHHK 3LSSA 2O8EA 5IDJA 4YOVA 3VQ6A 4DR2B 4K8ZA 4JV5B 5CMUA 2NRWA 1TKXA 1US6A 2ZD1A 4BR6A 4M3UA 3C65A 4MO5A 3NH2A 1VSDA 4DSLA 5KRTA 2B9ZA 3AEGA 2HW3A 1VSJA 4N5SA 2EJRA 3WXJA 3SR2C 3H46O 3SAGA 4CJ7A 2DY4A 4F3TA 1M90O 3FKSG 3LZIA 1I08A 2AW9A 4ZKIA 2Q1NA 4HNAA 4OJRA 3HR0A 4JZ2A 5HRNA 1VQ4N 1YIJV 1L3VA 5BPNA 3BY5A 3SJCC 3FLCO 4JS4A 1NT2B 4Z4EA 3OS1A 2A9HA 4YTNA 4CF9A 4TQDA 3AA3A 3AO3A 4CVNE 3K9AA 4J7JA 4Z1VA 4YHHO 4LF7O 3AE6A 1G4YB 2ADQB 1SKWA 1VSMA 3SUQA 3L71H 1PNLA 2JRIA 3T7ZA 2X6CA 3SV3A 3ZMTA 4BG9A 3K03A 5LP6A 1XNRO 1BS3A 1BI4B 4ISGA 4IOCL 4FK0A 3TAFA 1NOZA 4GLXA 2D0CA 2YS8A 1KB9F 4DR2O 3ZYYX 4YXDA 4M63C 1U45A 4O2BB 3AVIA 3T1YB 1B04A 3L8BA 2ADPA 3C3SA 1Q86O 3EXAA 3ENHA 4GX0A 1VARA 3QMLA 4CFDA 1NG9A 2FMLA 4JGSA 3EE8A 5AFUH 1EX4A 1EO1A 1VSLA 1C1BA 3V9XA 4CW7B 2KFZA 4BE0A 3OYAA 3HL8A 3OYFA 4FIPC 4R8CA 3AE2A 4JI0O 4K0KB 2IVNA 1GN4A 1EP4A 3SV4A 3IKMA 2RNBA 2Y69B 2IW5A 2ZDIA 2DW4A 3CCVN 1XREA 2FSJA 4CJEA 4C8OA 4BR7A 4WE1A 5CB4A 4FCYA 4GT1A 4DV4K 4GX2A 1ZAUA 2LFSA 3CERA 1F4NA 3U4LA 2QWNA 1U96A 2P22C 1N36K 3CMAV 4CF1A 2OIEA 2WLIB 4DR3K 2XOKG 5FNVA 2CH7A 4KTWA 3AVFA 4Z2WA 3LP0A 3ATUA 4U7NA 5GW7A 1U97A 5KQDA 2IU3A 3OBYA 3DTUB 3LUTB 1GLLO 1ZC6A 3P83D 1Y74B 4TOIA 2YXYA 2FL4A 1YZBA 3WB2A 3RT3C 1KP2A 5IYDO 4KHUA 3JAWB 2QKKA 2H88A 3ULEA 3SFEA 1OZ0A 4K3AA 5HFLA 2B76A 1OOPD 3ALYA 1N32O 3T1AA 4YTPA 1R73A 1Z5WA 3VOVA 3CYOA 1TAQA 1RDAA 3VEWA 5HOOA 3UE5A 3LL3A 4C8KA 4MTXA 1R6TA 2UXBK 3CFRA 4FFKA 3ABMB 2F23A 5M1NA 2OA8A 1TUUA 4NB5A 3OM3B 1NGAA 2HMIA 2E8AA 3K08A 4JI1O 3L4IA 1IG9A 4I2QA 4DV1O 3CCMN 1GRJA 2G8HA 3QETA 5JICA 4FLWA 4AHSA 3CB2A 2E20A 2D3OW 4JI8O 3SUNA 1LCUA 1D5NA 3KZBA 3CP1A 2HF4A 1Y97A 5AQIA 3AVBA 2CGLA 1FAFA 4J80A 1N36B 1OCRB 1WSFA 3MDSA 4PA4A 4O5BA 4DSFA 1ATNA 2YKNA 3U9ZA 1U6ZA 1RDCA 4M7YA 1IKYA 4DTXA 5FLXO 4A62A 2VS0A 3AG4B 5IT9O 2IJKA 1P90A 4QS9A 4C8MA 3QO5A 1FS0G 2ZF5O 2Y0PA 4BC3A 3AG2B 2E3CA 4BC2A 1REVA 3SYPA 2NZTA 3ZRWB 4JKEA 4O4JA 2E5LB 2ZWHA 2AA4A 3QBXA 1KQSU 4HTUA 4KHWA 3P4RA 4DR6K 1X9JA 1ZBLA 3RSEA 2YIBD 3MN7A 1K5QA 1JJ2U 5JMVA 2UUCB 3E22A 4YY3K 4CJLA 4CJKA 1ATSA 4CJPA 3CQ8A 1OH7A 3DLEA 5L3DA 2ARHA 1K7DA 4PDLA 4UCUA 4FJCC 5JQGA 1KCFA 1TYQA 3G10A 3HRGA 4DUYO 4JD2A 5EX5A 1M93A 4JKFA 4E7KA 1ZBHA 3A5LC 1IV0A 1NK6A 3LPUA 1WB8A 3CJBA 2FSKA 4DQ8A 4IHJB 4EKWA 1JR9A 1AJQA 2VCPA 3EE9A 4IBNA 2XAHA 4W5QA 1NK8A 3TSPA 4QOZB 1DLBA 2UUAB 2XAQA 4IIJB 3HKEB 1H2GA 3ZRVA 2F8SA 1E1QG 3K0SA 2P51A 1K8KB 2HG5C 4H44B 2F43G 4WFBL 2FF6A 3Q7BA 2QDOA 3P4SA 4EB6B 1XBLA 3EZWA 4ZHRA 3VEYA 2A7WA 4N21A 4DXWA 4KO0A 4MVQA 1T03A 2IU0A 1HPZA 1WP8A 3TXQA 4BDPA 3B6OA 5EBMC 3CJCA 5AQMA 3PO4A 1RUF4 1TKDA 4N76A 3W7XA 4CJSA 2HWB4 1GAXA 1HR0B 3DRRA 5LJVA 2BUPA 5K14A 5D5PA 3F5WC 1R0AA 4L8JA 2P9UA 5H1SQ 3FX7A 4AI8A 3P31A 1GLJO 4H4MA 2HHVA 4FMTA 1LWEA 2QWPB 3ZN0A 3WU2Z 4LFBB 2HSTA 2UU9K 1VQ6N 2YNGA 2NRZA 5JVHL 3GWKC 3APQA 4DV7K 4CH6A 2HBMA 4HUGA 2Y69C 3L72H 4GX5A 3T4ZA 2VG6A 5KGWA 3THOA 5LJWA 4GKKK 2QWLA 1XNQO 3N4QA 4BRGA 1RT1A 2WLNA 4FWPA 3U3GA 4I9LA 1HDJA 3KTQA 3AO5A 4JLHA 3LAKA 3WQUA 3BEHA 4CS3A 2FC0A 4EAHD 1KQSM 1FKOA 4CFCA 3S3XA 3TAEA 4H37A 2UXCB 4HWIA 5FROA 2ITDC 5ADXH 4ZIBA 4JI8K 2MW2B 2O4IA 3PV8A 2V7ZA 1BI4A 4F6RB 1BEV4 4LP8A 2K9PA 1IBLB 2YJFA 3AO2A 1L3SA 3JBG4 1HYSA 1JA8A 1VRTA 3QFUA 3L2QA 1YUWA 2ZR3A 3H1HH 3J7AP 2DFEA 1S76D 4B9SA 4MTFA 1XMOK 1RDDA 4EFEA 3OE7G 3O65A 3OMNB 1QE1A 4A2AA 2VG5A 2A06H 3U9DA 3N2KA 2H3OA 2ZE6A 4K43A 3ZN1A 1VQ4V 3K5OA 1XOUA 4M3RA 3VGMA 1HQEA 2CTQA 1HNXK 1T44A 3AAQA 4A61A 4FLZA 4DV5O 1YITN 2D0AA 3E2EA 2P9KB 3FI7A 4E2LA 3NF8A 4UB8Z 3KKRA 1JQ0A 1EFRG 5BREA 1VQ9N 4X65O 4CEZA 1JLGA 1XL6A 1IBLO 4LWSB 1IX9A 1CPYA 1GN6A 4QPJA 2FYUH 4NYFA 3VEOA 3LDNA 3R66A 1FXKB 4FLUA 4CJWA 1BDGA 5F2RA 4BE2A 2EINC 2QWNB 2NR5A 1JLAA 4JAAA 4O4HA 3HP9A 4LH5A 4C7UA 2KTQA 5C8YB 3LDPA 1WLJA 1K8KA 3O5BA 3T19A 1WSIA 4UB6Z 3QEWA 3A0HZ 4BROA 4B9TA 3AE5A 4ISEA 2YXHA 4BW5A 2LGQA 5DK5A 4JTAB 5FPMA 4NCAA 1UPGA 3CWBH 3ZSOA 5C93A 5GINA 1CEZA 2YHWA 1S1WA 1I94B 2ZCEA 4QGPA 1S1TA 1TYQB 4BVPA 5J2MA 1RT6A 2ZDIC 3CJHA 3THYA 4PDMA 1L0LH 1SQXH 4YJ3A 2IDOA 2V7YA 3SK3A 1YJNN 4B3MK 3FZLA 3MN6A 3HPOA 5C8YA 4CIGA 3OA9A 4IIJA 5JLFA 5HLFA 4K35A 3DXMB 4LFBK 1W9HA 3LNMB 4X20B 3JALA 3DLBA 3CE2A 3G4SV 3ZSVA 4N23A 5AQRA 4CHOA 4BAYA 2PAVA 4F2SA 4LF5K 1VQMN 3OS0A 2QTSA 2X6AA 4WBNA 2HBJA 1VSEA 2BANA 3MCPA 1QZ6A 1VBA4 3M3ZA 1K5MD 4BWAA 4XDJA 4DR5B 2ZXWB 4M3ZA 5IJ0A 3VENA 4JYAB 4H0YB 3GVMA 1VBC4 4YT0A 2LGWA 1VQ5V 3SAFA 1NCQD 4UCVA 5EXWA 3ZBHA 4B3RO 1G6UA 3HKCA 1GLEG 2JK5C 1E1RG 2XY6A 1FXKC 1HMVA 4OKJA 4DTSA 1WBBA 4DV6B 3OYIA 5KAIZ 1V54B 2LJ2A 3E8BA 5FPRA 4CS2A 4LH7A 4RUEA 3AO4A 4PDRA 1YEWA 1VQ7V 3D3IA 1IO2A 4DS4A 4GY2B 4KX6A 4GCZA 1SETA 1Z5VA 1ORQC 3UQ8A 2AZ0A 1BQ0A 1VF6C 1DT9A 5AQSA 2HF3A 1YTAA 3LM2A 1NGGA 4M41A 4BRPA 4YIPA 2E5LO 2DFFA 3OEHG 4DHYA 3VQCA 1NLVA 2HP8A 4LNUA 1HNVA 3KLHA 1PL4A 4ZBMA 3R3LA 1O1WA 4FK2A 3BA8A 3G6EN 3S3MA 4KTQA 5BN8A 2CDYA 3ZSZA 4J9ZB 5JH7B 4A5BA 1DK1A 1OCCB 1HNXO 3QEPA 3SYZA 4WQ5C 5B1AC 3AE9A 4P2ZA 1EKEA 3VQ9A 3RYFA 1V4SA 1Y66A 4FPAA 1WBDA 3EEQA 1BGXT 3HTVA 3BF3A 4DV6O 1JPXA 5DM7L 3ZSRA 2DN9A 5FL7G 1BCMA 1PKXA 2QJ1A 4GW6A 4CERA 2ZIMA 1OV9A 4BRNA 3OR7C 3N2KB 4JZGA 1S72N 1QQNA 2UXNA 2A5XA 3SPHA 4CJQA 3AEIA 2YNHA 2X5ID 1RVF4 1TVKB 5EK0A 4B3MB 4FK5C 2GBZA 2P9SB 1ZL8A 2V52B 3L2UA 5JH7A 4FVMA 2E75B 1IH7A 3H1QA 4W5OA 4KB0A 4Z4GA 2Y1IA 1N34O 3R6MA 1GLBG 3W0LA 4IYHA 5BPLA 3LSUA 4CBWA 4J41A 3RMDA 1M1KO 1ZOYA 4NXMO 5AQVA 2OPPA 1NK0A 1YITV 3ABMC 1Q81O 5HL7L 4PA9A 1NKDA 3CCUV 3BRCA 1PIV4 1AR4A 4OX9K 4BRCA 4FJXA 4YORA 4NTWA 4JHDA 3F7VC 5BXZA 4CZGA 4Q4Y4 4JTDB 1GM7A 4C23A 4B3MO 2GEMA 4BREA 4IXCA 3NGZA 1BO5O 3TWHA 3W7WA 1PNMA 3SI6A 1NWKA 1N33B 1EQYA 2OTLV 3K5LA 5EBWC 4W5NA 4GUNA 3HVRA 1SL2A 2A41A 2QA4V 4XH1A 4BWJA 4X66K 4V19S 4BVOA 3CX5F 1N0JA 4X1YB 4IJAA 1SQPH 2Q0RA 1QLEB 1IURA 1LAWA 5DM6L 4F2RA 1MDUB 5AQFA 4RW6A 3B8NA 1VF5B 4G9ZA 4FYDA 2ZQMA 5CE3A 2KSDA 4RAIA 2WLJA 4U7OA 4ZOLB 2WOMA 1NJXA 2KB1A 1RUI4 2Z1IA 5LXTB 3SPYA 1P84F 1Q81W 1WSHA 1KP3A 2VWKA 2EINB 4XDLA 4CZEA 3S3NA 4LFAO 3M8AA 4DV2O 3O9SA 1L8DA 1W7AA 4JI1B 1LWFA 3L6QA 3LALA 3LZJA 1N6QA 3LDDA 2WONA 3THWA 3BF1A 2P9SA 3ABLC 4ASUG 4CC6A 1QQCA 4DK1A 1BCOA 3QIPA 4RWUA 1KMIZ 4PHTX 4DV5B 4JI8B 2VGMA 1VRH4 5B3SB 1NGIA 3ISNC 5BPMA 3J81N 4PL8A 3IMXA 2Q4PA 5FPNA 3HOTA 3ZX6A 3T1YK 3C6UA 3FFKB 5AQWA 2GV9A 3AVAA 2WS3A 1HJRA 4GKJK 3RVCA 4O4IB 3OUSA 3OAAG 3BUZB 4CEFA 4RWTA 4X66B 2ETJA 5F0XA 3U6FA 1DTTA 5LL6Z 1FXVA 3KZIZ 3DXRB 2Q7EA 1GO3F 1BU6O 1RT3A 4YNQA 5LOVB 1BQMA 1N33K 4JYAO 4H0OA 2WLMA 1X9MA 1W2BM 1S5HC 4DV2K 3LDEA 3QG5A 2JEXA 2WDVA 4XBFA 1CLQA 2BTQB 1BIUA 3ZETB 2UUBB 3NH1A 1D5AA 3SGIA 4DQRA 3STZC 4PWDA 3TAPA 1IG8A 4JYYA 4X1YA 2B1GA 3OW2U 4MS2A 2YI8A 4JI6K 3O3HA 3SQ2A 5KHHA 4CBXA 4MDAA 4DV1K 4CEOA 1RFQA 1HR0K 1O13A 4LF8B 2Q0AA 2JS5A 3I0SA 4FW1A 2E76B 3WG7C 4CHNA 1NM1A 5FDLA 4M45A 2P4KA 5L3GA 2NRVA 3TTFA 1AP6A 1LOTB 2OPRA 4A5UB 1GOBA 3P3NA 2WPDG 3O3FA 1Q8IA 4EFHA 2RPIA 2VYPA 4F6EA 2VWBA 3E89A 3CRMA 4UVBA 3ZMSA 3QFPA 5KX5B 1ZXOA 1D8YA 5KUMA 2ZJRL 1DTOA 1NI8A 2I7PA 1HJOA 4X8AA 4LSLA 2AP1A 3JATA 5CBFA 2E74B 1YF5L 4DS5A 4UV9A 2P9NB 3HKBB 3SJAC 1QTMA 1F23A 5HROA 1ZL8B 1BOTO 4CK1A 1ITGA 4R5PA 5CBHA 1JCGA 4YDUC 3ABUA 1A32A 3VEVA 2CH7B 3M6GA 4MVOA 1NTKH 3O08A 2O8FA 1I7FA 2XNDG 5TISZ 3STLC 1HYZA 5KI6A 1QR8A 4MVSA 2GTDA 5FPDA 1UOCA 2QKSA 2RMKB 2V4DA 5D3GA 4DR6B 2ZE7A 4LF4K 4B3RB 1MU2A 3RFRA 3T1YO 1R084 1RUG4 4FFBB 4DV0K 4HTLA 4GYCB 4OPAA 2AZ2A 3HP6A 1TK8A 1VMGA 4I6MA 4FZXC 4BRAA 3J8F4 2D0BA 3PSIA 4AH9A 3V9WA 3S9HA 1K3EA 5AG2A 2NRRA 3FYEB 3C7NB 3JD3A 1KLNA 4BC4A 2WLHA 4ELVA 4DG1A 1NKCA 4X89A 2NRHA 2D2CB 3ZRWA 4RO2A 4DV6K 4O2AA 5AZJB 3K5MA 4CZKA 2ZT9B 1WPBA 5C12A 1EV14 2IH1C 5BR8K 4ILHA 1NK9A 1NOYA 3UKRA 1TKTA 1V55B 4KKOA 4XEIA 3SMPA 4PY5A 4W4LA 3SPJA 4O55A 1GH6A 4BE1A 4W4KA 2WC9A 2H3GX 4DLEA 2DFHA 1M4UA 5J2TB 4DQPA 2HHHO 1VQNV 5GONB 1K6YA 4IHJA 5GAHP 4GV3A 4B8CA 3NR7A 4J11A 5L3BA 1GLAG 3SQ4A 2P90A 1TVKA 1YHQN 2BE3A 2CH6A 1Q5OA 1BMFG 1ASVA 1K97A 4DFJA 4NLBA 2GWKA 3ZJZA 1Y76A 3E86A 1U04A 1K4DC 3ZT3A 4CF0A 4DCHA 2CUGA 4RTFD 3TSUA 1OJHA 2UUBK 3OYDA 1EN5A 2P9IB 3BVOA 2N05A 1IBKO 3VR9A 1K4CC 4O0JA 1CZBA 3B6PA 4WQ4C 3ZT1A 1JL2A 4YOWA 3DLGA 3ZSYA 3K06A 3CCLN 4LFBO 3VQ7A 2NRTA 2I5JA 4PKGA 1RBUA 3VTIA 3MXIA 2OPQA 5ITZB 1I94K 4KHSA 1N34B 4RW8A 2QKAA 3DLHA 4JKGB 2G8WA 3NF9A 3L9DA 3WNGA 4TT3G 4JRQA 3CJAA 1COV4 4TUYA 2NNUA 3S3OA 1IXBA 4YSYA 4DKWA 2O8EB 2PZSA 3DM2A 5KTQA 2PI5A 4DFPA 3ABVA 1QBZA 2LSNA 4LC9B 4DV5K 1W0KG 1Q86W 1OCCC 2XTAA 4DV0O 3D36A 2E2OA 1NKEA 1O9GA 2B5UA 4DR1B 1PO14 4DMNA 1FFXA 3FB6C 5JVGL 2F4VK 3RRGA 3VOUA 3KWIA 4EB6A 5CA3A 1FK9A 2GELA 3KIOA 4JYBA 3HM9A 5MLCQ 1MABG 3AK2A 3D7EO 3JS6A 3QESA 3QINA 2AHYA 1NMNA 2ATKC 1S9GA 1SQKA 1H2KA 3CRAA 3F7YC 3G0ZA 2Q7GA 1MWKA 2WWWA 5BRHA 3U8XA 4E7HA 2R074 2QWMA 3R8EA 2HHHK 4B9MA 2A42A 2Y0IA 3H1JH 4PA7A 3WB1A 1RBSA 1H8EG 2X6NA 3KLEA 4DTJA 5EY4A 3AO1A 3KK7A 3TPQA 3CPWM 4UCRA 4H0VB 2QWRB 5GADP 3LSQA 2W0XA 1N8RW 5HP1A 4Q4W4 3CCRV 1OCZB 2WLIA 4BDZA 3RWUA 3ZRSA 2HEPA 4CEAA 3HKBA 1CXZB 4BW9A 1JMKC 3K0GA 4CD1A 1SZXA 1E4GT 2HKOA 3F2KA 5JJNB 4Q0BA 2F9WA 1TK5A 1QS4A 1RBVA 1MNGA 1Q6UA 1SQFA 3HSCA 1RBRA 1IBMO 4CE9A 3VQEA 1BT8A 3G71V 3H3NO 4QIWF 1NR1A 4CIFA 4F3OA 3T69A 4PV1B 3D2FA 3AVHA 4A5AA 4FK4A 3QIOA 3V9ZA 1RSOA 5TKYA 4N47A 4EZ6A 4GZRB 5AZIA 2NNWA 1Q43A 2W42A 4WFGA 4O4HB 1RTIA 1I0HA 3ETGA 5KQ8A 4LC1A 3MN5A 4LF4O 3RYCA 3K5NA 3L3UA 3SQ0A 2WP9A 1KVCA 4KL1A 4B3TO 2OT5A 4JI7O 2OWOA 4GNIA 4BRLA 1YVNA 5AQZA 1Z2GA 1VRUA 5KHGA 4NCGA 5DN6G 4DTNA 2D0OA 4FJHA 4JI5B 3O6WA 2P6JA 5IJ9B 1BHAA 2P9KA 1NGEA 2VQEK 4YSZA 3VEZA 2GBOA 1K73W 5SZTA 4HZ3A 3O1WA 4FJKA 4HVJA 4E0DA 2O8DB 5D5QA 5M1PA 1PO24 3AARA 3CHWA 3RYCB 3SFDA 1QVFU 2DYRB 2EULA 4CGGA 5M1OA 3VESA 4NR1A 1VHXA 3VQ4A 1ZBIA 4KH4A 3V81A 1YI2N 1I5YA 1IKWA 1RUH4 3RMBA 1RFYA 4K8XA 5IT9N 4EP5A 1FKPA 1OKJA 1VSHA 2QXFA 3ZT2A 2ZQBA 1BUPA 2HHHB 4KV8A 3IUCA 4B1ZA 2UUAK 3E22B 2LP7A 3V6DA 2FSNA 3JASA 4FJ9A 1KYOF 1X9WA 2P9LB 5C42A 1C0MA 2PY5A 5B1BC 2WAMA 2Z5UA 3PN1A 2X78A 1XI1A 2EIKC 5E79Z 1V4TA 1KU9A 1Y74A 1KLMA 5LBQA 4IKFA 2O8DA 3B4SA 4CHYA 1A5VA 3ENBA 1NBMG 1S77D 2QKCA 3RMCA 1T05A 1ROPA 1VQPN 3OTOO 4LY7A 1AB3A 4U3FH 1KBHA 4FJ7A 4KHPK 2YI9A 5BZBA 1HNZO 1HRHA 1BG3A 2ZGYA 2R9AA 3O1BA 1KRPA 1IKXA 2KZMA 2V51B 4BIOA 2K1EA 4O2AB 5AZJA 4DR5K 5LHGA 5JCOA 4NKGB 1HQUA 4XH4A 1XEQA 5CB4B 3L0QA 1NKBA 4FJGA 3JASB 3E8HA 2LQTA 4HYOA 4UCSA 4J2DA 3DMJA 3VBBA 3G25A 1QVGU 3KHYA 3MK6A 3VEXA 1H8HG 4EP4A 2YCHA 4JK8A 2GX9A 4CJFA 3OBWA 1N34K 2Q3SA 3ZEUA 3HVTA 5AQLA 3CCLV 1C1AA 1Y4MA 3QF7A 4FZ1A 3G6EV 4LF7B 4CHZA 3OYHA 3SJBC 2RN9A 5KPZA 3AVLA 1PVC4 3OYGA 2YXLA 2HLDG 3AVNA 2KW4A 3SPCA 1TV6A 1NJZA 3PUFA 1H8TD 4HCBA 3BFRA 5C2TA 4H0XB 3SQ1A 4DUYK 1H2NA 3OY9A 4GB34 1V9PA 3WEEA 5IY5B 2N04A 2UXBB 1R1BA 1SUQA 5KMGB 1HNZB 3CRCA 2JEUA 5B3SC 1RTHA 3CJ9A 1P7GA 3AG4C 4TSFG 4OPKA 4R6ZA 2KZZA 2I7NA 4CZZA 5JLHA 1A5WA 1Z25A 2P06A 2ILMA 4J7ZA 2E4LA 1S6QA 5HRSA 3NGIA 4AM6A 4H8KA 3C6AA 1WAJA 3KD5E 3IC9A 3JAMO 1RP3B 5J9PC 2MK3A 4G27B 1BIZA 1SL1A 1VIBA 2ZR2A 4JI0B 4K0KO 4MFBA 3V1OA 4X65K 5LGUA 4B3OA 4J42A 1EXQA 3ETEA 3HBTA 1X3NA 4D7SA 3QNOA 1BHLA 1PV0A 3UKMA 3OUFA 1RCHA 4JF3A 1JFFA 1HW7A 2YHYA 1QHAA 3GDQA 4DR5O 1HWYA 3D36C 3WNEA 3WQTA 1NZ6A 4CIEA 3THVA 1ZP0A 4LR3A 3TJTA 1K33A 3DXMA 1VQ7N 4E89A 2O8BB 3BY6A 5KUKA 3PSFA 3MAQA 4DV0B 2GUPA 1S0VA 3VA0A 2DMXA 3NDKA 4LF4B 2ODMA 1SRYA 3IG1A 4L8RB 1YQ3A 3GB7C 2FXUA 2P9LA 1TAUA 3VQAA 4CZIA 4EFBA 2ZE5A 3TARA 4BR5A 5H6RA 5F2VO 3K79A 2EILC 1WA8A 1EZVH 2HJDA 2Y48A 3VQWA 2D4WA 3NFAA 4DR7B 4FW2A 1FXKA 1K92A 5CA1A 4JI7B 2UUCO 1Z05A 3SLCA 1H2MA 2P9UB 3BZCA 5AQUA 2O8CB 3T4DA 3G6BA 4YJ2B 2GWJA 5HRPA 1Q3EA 3CPWU 2W40A 1M57B 3MXJA 3GBTA 3ZLJA 1Y64A 1GM9A 3EKUA 3ZX0A 4IG0A 3SUCA 1SZTA 4X88A 4YFUA 4ID1A 1VF6A 3ZSXA 3OT7A 2EWSA 2HNDA 1YSCA 5BR9A 1WPXA 1K9MO 1URFA 3H08A 2JGDB 3ASMA 4G28B 4QPKA 5CBGA 1OCOB 4FJIA 3CQYA 3LDLA 1AP5A 3OFNG 3BP8A 1GMGA 1Q9YA 3VQXA 3KCXA 2D1KA 4PDWD 4UVCA 4BQLA 4YOTA 5C0YA 2QEXV 1T3VA 3CYMA 5IYCO 4C1NI 1PD3A 3CJHB 3DI6A 3F73A 3THYB 1NQTA 2A40A 4Z0UA 1U48A 1KKCA 4DV1B 1KD1O 4YJ2A 1KC8O 2YICA 1S6PA 3C6HA 4M3YA 2ASOA 5LMNK 5B1AB 4DRXB 3OD4A 2JWLA 5E41A 4JAUA 4EEQA 3OHRA 3L70H 2EJ7A 3CCSV 4DR3O 1V54C 4JI4B 3I56V 4HUFA 4UCTA 1SAZA 5BRDA 2YX6A 4DR2K 1ENVA 1TUBB 2XAFA 3BABA 1DGKN 2E6LA 2D5RA 4YHHB 4B1XB 3ID6A 3ZHVA 3VTHA 3FZKA 4G1QA 4JD2B 1QHTA 3QLHA 4OLBA 2PW9A 1WA8B 4BR0A 2YDEA 2DWEC 1I5XA 3O9UA 4LSNA 3CC2N 3VQ8A 3HKDA 3JSMA 3CCUN 4H03B 2JGUA 4DLGA 4QCLA 2R064 1CZ9A 5LMUO 3OR6C 1S1VA 2XAJA 3HKEA 3Q4HB 1HKCA 3J8AA 4UQGA 2G8KA 4BY9C 5K1PA 1R094 5H2FZ 1VQOV 2LW7A 4NO7A 1J95A 2DYSB 4U3JA 1LW0A 4X62K 3SJHA 3FYIB 2UUCK 2EIMB 3G80A 4CC5A 2W6JG 3ZHRA 2XT9A 4NTYA 1KXPA 3BEXA 3AG3C 2ITMA 4B9NA 3H01A 5BR8O 4WFBV 4BACA 4WFFA 1W0JG 2HMPA 4E1JA 3U10A 2QK9A 4H4OA 2G8FA 2E2PA 4RW4A 4CESA 4W5RA 4J10A 2RS34 3VRBA 1H2SB 3FFQA 2QGNA 5IYBO 3JATB 1TL3A 3WNFA 3RR7A 4Y1CA 4OLAA 4Q6GA 1AI4A 1XDCA 2QE7G 2IBZH 3F5TA 1K34A 4NYNA 1VAZA 3DRSA 3ZMUA 1ATRA 3BAAA 2Q8VA 3SPIA 1F21A 3N27A 4JTCB 3E01A 2YIAA 3F9KA 3HKCB 1NVPD 3TTDA 3CRRA 3NVKA 4J2EA 4LWSA 3U11A 1OCZC 1AROP 4AILC 1B92A 3SJJA 4CF8A 3GQHA 1M56C 5ADXA 2GUIA 2A3ZA 1Q82W 5AQXA 3HSTB 4X64B 3NE6A 2ZD9A 3GQKA 2DJVA 3U0ZA 3SAHA 5J2UA 1L0NH 1PM9A 4DW1A 5CYQA 3T1HK 4Y1DA 2XY5A 1EN6A 1XMQO 1VQLN 2ZM6B 4DSJA 4BR4A 3ULDA 4OPJA 1COWG 2W6IG 2QEXN 5GAEP 3EY1A 3HB3B 1RDUA 1X3MA 1MZEA 2DQ3A 1MA9B 4P9PA 5LP6C 2JJ1G 5DEDA 3C0BA 2LW1A 4JI3K 1N5YA 1XL4A 1ZX3A 2HBLA 3CM6A 3W7UA 3MWTA 3ZHUA 1FJGB 5KRSA 3CSXA 4HAMA 2PBDA 3OS2A 4AF1A 3A5NC 2YIDA 4FZ0A 1XHZA 5H5NA 1BHBA 2QTDA 3HPGA 5E84A 1DKGD 4J2BA 3AEBA 1B3QA 1MSDA 1EN4A 3MX5A 2Q36A 4DR3B 2X74A 3ASOC 1U2VB 3K04A 1FD9A 3HI0A 5EYPB 2HBKA 4IDKA 4XDKA 2F93B 3U3YA 4MTGA 2R7YA 5IYZA 3CC7V 3H45C 4CI6A 2UXDO 4OKKA 2GSMB 4YXWG 2Q9LA 3N2GB 3WXKA 3E83A 4CHQA 2IJJA 1TKZA 2O57A 5CN0A 1WSEA 2X0LA 5AQPA 1GK9A 3LNNA 3UT5B 4IYIA 3J81O 5B8HA 1HUXA 1RM1C 4Z4FA 1KKDA 3LM9A 1J5EB 1NJIW 3AEAA 1YJNV 3NGYA 2NLXA 3LDCA 3A0IX 2DQ0A 3F9MA 4MLHA 3FB7C 5C25A 3LPTA 3VF6A 3IGAC 3KK1A 4L87A 4OPHA 1Z26A 1VP7A 1P49A 2WLLB 1BA0A 1VSFA 1F7YA 2IAJA 3OMAB 1NJYA 3HYFA 2F4VO 3D6RA 4FJ8A 5IWAO 4KB1A 3VF4A 3ZX3A 2P5OA 1Q90D 5KHKA 3LANA 1QSYA 3ZMZA 4C1NK 4YDUA 5CA1B 2UXDB 1HRI4 4LH6A 3CG7A 1JCEA 1E4FT 2IIRA 4DQSA 1VQ5N 4CD3A 2P9NA 4H33A 5J2QA 1IJJA 3JCZA 4PELA 4CZMA 3JD74 2CGKA 5AQGA 3K58A 4CJ5A 4HCCA 5ITZA 3P32A 1S9EA 1XNQK 2Q68A 2HNZA 3DXRA 3G67A 1ESVA 5FLXN 4WFNL 2M6YA 3RYFB 3FD9A 3CFPA 3AECA 4FPPA 4LF5B 1S1XA 1YQ4A 4JI6B 3EO3A 5SWMA 2NRXA 2Q5ZA 5FPOA 3BGRA 1Q7YW 2BSKB 4FLXA 2RS14 5GTIZ 1MMMA 5C24A 4IJNA 1T6DA 1QSLA 1J53A 1KSPA 4PDVA 4FJMA 1MA1A 3QO9A 4DV2B 3VGLA 3JD1A 2ZM6O 3L4QA 5AJ3K 1PL0A 3RYHA 3B40A 2P1JA 2HHQA 1M90W 5KHIA 1BQNA 3DWLA 4FPBA 3ZCCA 3J80O 2Q69A 1H1VA 3UKUB 4JN4A 4OO1J 2H94A 4GKJB 4DW0A 3OJUA 3KKYA 3VQBA 2YJEA 3PY8A 4DQIA 4E1NA 1PPJH 4B9QA 3CCJN 4CJVA 4FWOA 2OTJN 2RQ6A 3EKSA 2CH5A 1S22A 3OVNA 4IOXA 3M1FA 1N4CA 1VEWA 4DR7K 2IM9A 1KAZA 1L5UA 2EILB 4BRFA 2JWKA 3ASOB 3TGUH 3QEVA 3JSLA 3W7TA 3CD6N 1N33O 5IJ0B 4JI1K 2Q73A 2R9RB 2HR3A 2VQFO 2W6KA 4OKEA 4B9VA 4B9LA 4LFAK 4D7TA 5AQYA 1C6VA 3UM7A 1XHXA 4JRPA 5I9EB 4A2BA 3K9SA 4H5TA 4CK2A 1IKVA 2GHYA 3MEEA 4B1VA 1MSWD 3ZEDA 1P4RA 1KVAA 1BL3A 3P3PA 1NGFA 2Q2RA 4FZZA 3HZ6A 2XHBA 2H8PC 1YI2V 4DR4B 3JD0A 1GOCA 2RF2A 2RHKA 2WUSA 5CA0B 3O4QA 4JKGA 1BCCH 2QWOA 4N56A 1RUE4 2RJZA 1L1FA 1OH8A 1KTQA 2QSAA 3W7SA 1D4M4 1U2VA 1XMOB 4IG3A 4FL9A 1OHHG 2P67A 3SYOA 3CCEN 5GIPA 2BTQA 3ZETA 1DGSA 1N32B 1XUPO 3FE1A 4H5VA 3QVNA 3A8TA 1OVQA 2CTPA 3AVGA 3IRXA 3L2WA 4L3QA 3I56N 1L3UA 2DYSC 3SUOA 3ZHTA 5JVDA 5DECA 4AHRA 3AE8A 5EVZA 3H3OB 1RUC4 4LFCK 1NGBA 2UXCK 1WSGA 4MO4A 4JKBA 1M57C 3P1GA 1LW2A 1ZBSA 4B7EA 4I4TB 5HFMA 4LF6B 3OYCA 1NJWA 2BDPA 4ZI7A 5GAGP 1CZAN 1BQZA 4GV9A 5CA0A 1TUEB 4MVRA 2PYJA 2CTRA 4IDHA 5AQHA 1X59A 5B5EZ 3OJSA 1TUYA 2A1SA 3DC5A 4FWSA 4X64K 1LR1A 4O8UA 3LDOA 5AQOA 4GKKB 4DV3K 3SCXA 4KI6A 3QNNA 3VGKA 3V4IA 5C15A 2FBTA 1SKVA 1NBWA 4DV7B 1YJ9V 2ZJPL 4LF7K 4BIUA 2FBVA 4J2AA 3AG1B 4O8KA 3D0PA 1WLEA 3PJSK 1KD1W 3FZFA 3E1YA 4FWLA 1BL8A 4CJ3A 2W0FC 3R65A 3EL2A 4GKJO 3RTVA 1JJ2M 1KAXA 4OGCA 1RBTA 1TA8A 1BZKA 1UAXA 2KG7B 2AGAA 5EIBC 2UUBO 4KBOA 4DUZB 3MX2A 4KHYA 4Q4X4 1SC5B 3M8SA 2YUAA 1D2DA 3IFXA 3CHXA 3P39A 5CR4A 1NTMH 1VSIA 3B2EE 1DTQA 3CCEV 4RHV4 3CXHF 1MZFA 4H13B 1B9DA 3H1VX 2QWOB 4TWKA 5AQJA 2Q0OC 3VERA 4B1WB 4EHTA 3DXKA 1AR64 4DV3O 1W59A 4Z1MG 2DOSA 3NCIA 2XUMA 4X1IB 3D2FB 2ZXWC 2YKMA 4I6MB 1FKAO 4LF5O 3C6TA 3TK1A 3CJ1A 3TAQA 4JKDA 2QWPA 1SKSA 1NGDA 5LP6B 4NXNO 3DLLL 2BSKA 1VQ9V 3LWMA 3ZRXA 4LF9K 2QI2A 1JLBA 4K41A 4CEBA 1CXQA 1KFSA 4CZFA 4FOIA 4KP4A 4ZHQB 1HX1A 1JXEA 2A79B 4Z4HA 4DV4O 2RM24 1GKFA 4ISFA 2Y1JA 4OX9O 4RCHA 2DWDC 3O9OA 3WB0A 3VMFB 4DR6O 1VQNN 4IO9L 3JAKB 3FZHA 2RR14 3UKRB 1RT4A 3ZCMA 2GTSA 5JS1A 1AR74 4NCBA 3T3FA 3I5DA 2KLAA 4ZTJA 3ULEB 3CJ7A 3H9VA 2QTOA 3JSNA 1M1KW 4WFAL 4KH5A 3M8RA 1N0NA 3QB0A 3PLAA 4LH4A 2E5LK 2X6BA 3ZSWA 1LUVA 5C2FA 4JI4K 4KHQA 2PGGA 4E7JA 4I9QA 2ETNA 2WU2A 3BDPA 2AHZA 4MTOA 1EETA 2OTJV 3ZX2A 4DUZK 1S3XA 1AR94 3DGEA 2V7QG 5L3FA 2UYTA 2LFRA 1HNWO 2ZINA 3DC6A 2E1ZA 3LDQA 2CGNA 3QICA 2FBWA 1LUWA 2L35A 3ENOA 3UCSC 4FWKA 4GVMA 4MQ3A 4JI2K 4E19A 4PL7A 4DTOA 2IJHA 2RCVA 4KTZA 2A0LA 3OTFA 4UV8A 3DJCA 2P5GA 5T7BA 3VETA 2IOCA 3CFOA 3FZMA 1C0TA 4AHCA 3MD0A 1EWRA 4AHTA 2VQFK 3D3QA 3EYZA 1YTUA 4FO0A 1RUJ4 4BGAA 3HO1A 3CRQA 5LOVA 3J80N 4DF8A 5AQNA 1HYVA 4LF8O 4UVAA 3DRPA 2CGJA 1BSMA 4TV8A 3ZS8C 3OGIB 1XMQK 5J2TA 4BR2A 1JLCA 4TUYB 1RDWX 5C3JA 1EBOA 2PTMA 3G71N 1JLQA 1DF5A 5LA6A 1G99A 4O0IA 2QM1A 3RYHB 3QDKA 1JFFB 3HM8A 3M7MX 3MECA 5LY3A 3O9QA 3T2MA 2VRZA 5LGTA 1XMOO 3WXLA 4KI4A 4GVEA 3HT3A 5C10A 4YOYA 1Q9XA 1NH2B 1YTFD 3JD2A 2QXLA 3HXMA 3UKUA 1JXBA 3W3DA 1U49A 4PA6A 1WN7A 1BISA 4QE9A 4I7ZB 1X9SA 3JAKA 1ZBUA 2KKZA 1T5EA 2YHAA 3DOKA 3AEEA 4DU3A 3UB5A 4ILJA 4X62O 3AAPA 1WP7A 5JQGB 4A59A 3FR0A 3SDLA 1ZBFA 4CZHA 1K8AO 3ML0A 4MT8A 4ID5A 2NLJC 4B1UB 4X1KB 3QEXA 2VG7A 4JKCA 3AVCA 3PO5A 3PX6A 1ASUA 5EC1C 2YNIA 1TAEA 1SA0B 4DSIA 2G38A 2CE4A 4UFZA 4KHNA 4BC5A 5BMVB 4CECA 3ABKC 3HPLC 4O4LB 2A1RA 1JX9A 4BRHA 1VK0A 1TK0A 4I7FA 4FJ5A 4EIAA 3A2FA 5B1OA 1HNXB 1GLFO 5IY5C 5AQTA 3THXB 4IEIA 2FTKA 5BRFA 4DV7O 4LFAB 3A5MC 1OCOC 4JI2O 1TVRA 4GKKO 3O9RA 4ZHQA 3ZHSA 2JGDA 3TXSA 5BY1A 3H6EA 5AR0A 4ICGA 5C2DA 3OYEA 3UO2A 2F4VB 4FWRA 1MQTD 4DTPA 1IBLK 1M56B 2KG7A 4LF9O 1S5LZ 4DO2A 2HVHA 5FNVB 1NMDA 1J5OA 1VBD4 2P9PB 1Q82O 4CBCA 1ZUQA 2KKWA 2LO1A 2P7TC 1JLEA 3CC7N 4I55B 1M9NA 4F4KA 2YHBA 3AA2A 3RN4A 3D2EB 3CI5A 3HPHA 1GM8A 4B7KA 4WQ5A 4DRXA 3BHPA 1J5EO 1NVPB 4FOEA 4CJ4A 1CXUA 3OYMA 3SZ2A 3TAMA 1UA1A 3NMUA 1RT2A 2L6LA 1QVGM 2VWJA 1F4MA 4HBNA 5K1XA 4NB4A 5HRRA 1JOYA 5EOYA 3QEIA 4F8RA 3MDQA 1YJ9N 4FJLA 3MEGA 1HPMA 4JI5O 3SNNA 2WBNA 3AVMA 3TAGA 5J1EA 1SQBH 4JI6O 1XWLA 3LP1A 5LMUB 3CCQV 3OYJA 1KFDA 3AE3A 3V1RA 3AG2C 1UFIA 2JLEA 1THZA 3JAWA 4RG8A 2Y4TA 5J2PA 4CZLA 4DR1O 2Z1JA 1VQ6V 5CZ2A 4PI0A 2ZE2A 2ATQA 5AZIB 1VQLV 5B1BB 1E79G 4Q4V4 3D2EA 3ETQA 4OXSA 2PUSA 1R3KC 1O9HA 4BG8A 2A3QA 3TTCA 3OYBA 3L75H 1AJNA 2R9IA 2O4GA 3FAVA 4KUMA 1ASWA 1RHI4 2CTWA 4IEEA 2OZSA 1OH5A 1RSOB 2HJFC 1I3AA 2YV0X 4KHPB 3VPZA 2P9IA 3L2VA 1HXS4 5J2NA 5DMRA 1GLCG 1EAH4 2UXXA 4LFCO 2YC0A 4PHZA 2Q6AA 3QTCA 2ASPA 4CBUA 2IS3A 2R70A 4WF9L 3X2QB 1NJIO 1QSSA 4CGJA 1HNWB 1NK5A 1HRV4 1P7BA 3PX0A 1ASJ4 4NXNK 4CHPA 4B08A 3BCCH 4FM0A 2BTOA 5B1NA 1OCRC 3TR8A 3V9SA 5IJ9A 2DE0X 3A0BZ 4I55A 4IGGA 3KLIA 4CGFA 2YI1A 3FB5C 3K59A 4LF9B 2ACZA 3VA3A 1NTZH 2JDIG 3MWPA 5KLVH 1CP9A 3AK1A 2F66C 3BZKA 1KC8W 2R7FA 4I0XA 2E1YA 5I3UA 3PX4A 4YY3B 4O4LA 1XC9A 3BA9A 4LCUC 3D8CA 4Q5VA 2GUZB 3R1XA 4KXRA 2EIMC 2QWQB 1J6ZA 3IDHA 1T7PA 3LAMA 4ICLA 4MVZA 3CEIA 4WFEA 3P4IA 4X66O 3AEDA 2PLV4 2OIGA 2Q67A 2GTAA 3I55N 2CGOA 4P9OA 2VGNA 1C0FA 3TANA 3O8MA 3O4NA 5ELZA 3SYQA 1AR84 4N41A 1HR0O 1VF7A 4CJUA 3QBWA 4NXNB 2B4JA 1JL1A 5EU7A 3AA4A 2XASA 4MSWC 4GMJB 1G15A 3JCUZ 4M7XA 3ZEUB 1FYJA 3IJ4A 1OH6A 1S3JA 1NENA 1NR7A 2FKXA 1IBMB 4I0XB 5A2QO 4CH3A 1S1UA 1VQPV 3SPGA 3AY9A 1I39A 2QWRA 1VBB4 2EIJB 3ASNC 4ZOLA 4JI3B 1BWFO 4CH5A 2Z1GA 3E9OA 3P38A 4KH6A 3JALB 3AG7A 3OEEG 3L73H 1R3IC 2UXCO 2DTUA 4H0PA 4JNEA 2O8BA 2WLLA 5EZYA 4PKHA 4J9YB 3VR8A 2YEVB 4IWVA 2HVIA 4CGHA 1U4BA 1YVWA 1WSJA 5IYZB 3KCYA 1DLOA 1KF6A 2ZM6K 3A8YA 4LD0A 3TCUA 3EN9A 2YIBA 3M8QA 5M1KA 3QERA 3LDSA 4PKIA 4W5TA 4PJ0Z 4TV9A 2JJ2G 4R50A 3T1HB 3GL1A 4KREA 1ZYQA 4H0LB 1SKRA 4JI4O 4QE7A 3O4WA 3O9TA 1N32K 3UT5A 3CIRA 1RM1B 4ELUA 1HNIA 4GX1A 2XRIA 3EZ5A 3QO7A 4BQZA 3FAVB 4I5SA 3TETA 4MLEA 1VQ8N 1ZWIC 3KJVA 1RNHA 3AEFA 1NK7A 2UXBO 4JKHA 1U47A 1IBKK 4DR4K 2HHSA 1GN2A 4FWNA 1FPOA 4O4JB 1Q6HA 2IVOA 1N36O 4DV4B 3CMEN 3WUHA 2E2QA 5JS2A 3CS5A 3PIPL 3E9PA 1JCFA 1XNRB 1A5XA 3JYCA 1ZSPA 4X1KA 4B9UA 4NXMB 2KFNA 4FM2A 2ZNJA 2FF3B 1AVMA 1GOAA 2DYRC 4P30A 1NU0A 4JK7A 2C2AA 1VSKA 3K9JA 1EM1A 3B77A 2Z1HA 1SF9A 4RQFA 4X62B 4YSXA 4CCHA 3FB8C 4FLTA 4CZJA 1DEJA 3VF2A 4DR1K 3BPZA 2UUAO 5KA6A 2QKBA 1SESA 3RBZA 4FLYA 4O44A 4CH4A 3L2RA 3DLRA 3AGKA 3SUPA 4MW3A 1SV5A 4DSEA 2IH3C 1VBE4 1YJWN 1W97L 4BGBA 1YXQA 1K8AW 4FWMA 3CC4N 1HP8A 1RPRA 1M5IA 4EHUA 5H6QA 2YHXA 3NF7A 3VQYA 5M1FA 1MG1A 3VQVA 1NGCA 4BRKA 3I8DA 1R6NA 2XY8A 2KQXA 4JKAA 3HKDB 4X9QA 2QR4A 3RVZA 1D9DA 4DU1A 1K73O 2F1MA 1AR1B 3CXCU 1YAGA 1AJPA 1WUAA 3L3VA 1R59O 2KQ2A 4ILGB 5KHJA 1WAFA 1KECA 1VQMV 2ZJQL 1B06A 2G8VA 4WFHA 3M99B 1NNEA 4E7IA 3G4SN 4YJ3B 3ZT4A 4CFBA 4O2BA 3PIOL 4WQ4A 4JHDB 3JYTA 4LF6O 5AFUA 2GDSA 1YVUA 3M8PA 4PD4F 1UA0A 5GTHZ 2EZPA 3K9KA 3JAMN 1XNQB 1X1PA 5CYMA 3DOLA 5AQQA 3S41A 2G8UA 1QNMA 4NVPA 1E3MA 1OVYA 4B3SO 3KKSA 4WCEV 3A5OC 4DTRA 4JV5K 2EBOA 2ZNIA 2HHWA 3NVMA 3AA5X 3RYIA 5JJEB 2ITCC 2JVDA 2BCCH 3RGBA 4AQYB 4TV9B 4OVLA 4R79A 2H89A 1HKGA 2UXDK 1MWMA 1IBMK 1MOFA 5JVDB 3N4PA 4BWMA 3I0RA 4CEEA 3H1IH 3CQXA 4XIUA 4Y0WA 3OMIB 5JJJB 4CGIA 4YOXA 4X20A 3E35A 3CC4V 4B3TB 3WNHA 1RUD4 3ITHA 5KMGA 3AE4A 4O4GA 1C1CA 4JI7K 1Z7S4 3ICXA 4IOAL 1VQ8V 2JS3A 1ILYA 3EVKA 3RW0A 3P4QA 4J7KA 4DTUA 1RDBA 4UXNA 3KK3A 4UUJC 4RUFA 1TL1A 4B3SK 3RYIB 1J5EK 3SJQC 1Q7YO 3AK3A 5TKWA 1IDSA 5LYJB 1FFTB 1NGJA 1RT5A 3APOA 4Z4CA 1I94O 4JS5A 2JIZG 3ABKB 2F8TA 2IVPA 4BRQA 3AE7A 3UIQA 2ZIOA 3JD4A 2BGGA 4WYBA 2AXTZ 2DPNA 3WXMB 4CFAA 1T8EA 1RGIA 3QO8A 4I2PA 4NLCA 4OGQB 2QWQA 3S3WA 2HNYA 1WAZA 3C95A 2Z0AA 3GWOA 3B8AX 5BN9A 4ELTA 2XAGA 3A0RA 2RE2A 1R3LC 2OCCB 1H38A 2XY7A 4U7BA 3DYAA 3ZT0A 3P5JA 2EIJC 3ASNB 4JPRA 1G8MA 1FJGK 2CK3G 4PUOA 2IGIA 1D9FA 5LGNA 1IVSA 3MCAB 1KAYA 3H1LH 1YT3A 3J7ZO 4JASA 3MHSC 5I42A 4QS8A 1QCEA 4BDYA 1L0VA 3N2GA 2FBYA 4LF8K 1G1XB 4H0TB 1YCIA 3WXIA 3KK2A 4RW7A 3E8GA 3CETA 4NYKA 3K0DA 2VQEO 5DM6V 2RDCA 1XUQA 2PI4A 2QW9A 3AVKA 3VQ5A 2ITGA 2CAZC 1QLEC 1YF2A 3MEDA 1F51A 3J7YP 2HOEA 5FRNA 4F4LA 3P4PA 1RTDA 2YEVA 1YDXA 2HWC4 5LMUK 4DTMA 4HUEA 1SQVH 4MDBA 4I50A 2OCCC 5LHHA 1JVMA 4DV3B 4JK9A 3NAEA 1BA1A 4TQFA 3RVYA 3KLFA 4K42A 1NS1A 2YNFA 3WT0A 4CGDA 4AHVA 5J2UB 1Q6IA 1QZ5A 1JCHA 3VN5A 3LWLA 2HHXA 4YY3O 4M3WA 4LF6K 1X4TA 1WB9A 1XILA 3KG2A 5KGXA 2J4RA 3OTOB 4QAGA 5IWAB 3I33A 4AQYO 1GN3A 3D45A 2WQYA 3O3GA 2B6AA 1EZJA 4FWQA 3I55V 1C0GA 1WB7A 3AGRA 3MMVA 4QS7A 2Q0UA 4AHUA 4M42A 3P30A 2WLKA 5CZ1A
chains in the Genus database with same CATH topology
2F95B 4I50B 1RTJA 1RILA 4PI2A 4DFMA 4EZ9A 2PYLA 4LNUB 4TSXA 2OZMA 1LV5A 3KD1E 4B8AB 3V9UA 2OPSA 4F6RA 1J54A 4C8NA 1J9AA 2EX3A 4DU4A 5JCOC 4M3XA 3AV9A 4Z4IA 4CS4A 1C0UA 5FRMA 5GONA 2E6MA 1KVBA 3KLGA 2IC3A 3K57A 1TGOA 1SA0A 1FXXA 4OX9B 3K2PA 4IFVA 5LMNB 2OYQA 3CM5A 4X1IA 3FFIA 4C8LA 1XMQB 5LYJA 4ZTFA 4FJNA 3AVJA 2VQFB 3VQPA 2UU9B 2HHUA 2FBXA 5HBMA 4JI2B 1UWBA 3NHGA 4DQQA 5BMVA 1JLFA 2F96A 4IFYA 5KX5A 3VQDA 4CK3A 3NF6A 4PA1A 4KAZA 4ZI7B 2X6SA 4E3SA 4KRFA 4CJTA 2R72A 4DFKA 4DWIA 4FM1A 4FJJA 3RR8A 4CF2A 4FZYA 4E7LA 3V1QA 4TV8B 4DK0A 4X65B 3LP3A 1FFXB 2G8IA 4OGEA 3MXMA 4O4IA 4UCOA 3LP2A 1WNSA 1JJOA 1S5JA 1LAVA 2BE2A 3RWRD 4FLVA 4WBNB 1IBKB 3TABA 4DUYB 4RW9A 2AJQA 4DSKA 3ZSQA 1L3TA 5LXTA 3RMAA 4KPYA 4U3JB 3TI0A 2XO7A 4DF4A 3OYLA 3DSQA 4LFCB 4FFBA 3JARA 3RRHA 4HHTA 3IS9A 1NK4A 5EIBD 5BR8B 2HB5A 5EZYB 4PQUA 3NBPA 1XQ8A 3SPZA 2QM4A 4HNAB 3OYKA 3JARB 4CEQA 1RT7A 4CEDA 5CY4A 1SQGA 4KFBA 1SL0A 1LWCA 3VQQA 5LA6B 4B3SB 2B5JA 3NH0A 2Q7HA 2EHGA 2RKIA 3OYNA 2VQEB 2HHTA 3C94A 1TUBA 4I4TA 4M3TA 4FXDA 1B9FA 1W0HA 4CJRA 3HJFA 4E1MA 1JKHA 2NUBA 2RN2A 3HK2A 3IAYA 5EYPA 3VQ6A 4DR2B 4K8ZA 4JV5B 2ZD1A 1TKXA 4M3UA 3NH2A 1VSDA 4DSLA 5KRTA 2HW3A 1VSJA 4N5SA 3SR2C 2DY4A 4F3TA 3LZIA 4OJRA 5HRNA 4HNAA 1L3VA 3SJCC 4JS4A 1NT2B 4Z4EA 3OS1A 4CF9A 4TQDA 3AA3A 3AO3A 1SKWA 1VSMA 3SUQA 3SV3A 5LP6A 1BI4B 4FK0A 3TAFA 1NOZA 4GLXA 2D0CA 1U45A 4O2BB 3AVIA 3T1YB 1B04A 3L8BA 4CFDA 1EX4A 1VSLA 1C1BA 3V9XA 2KFZA 4BE0A 3OYAA 3HL8A 3OYFA 4K0KB 1EP4A 3SV4A 4CJEA 4C8OA 4WE1A 5CB4A 4FCYA 1ZAUA 2P22C 4CF1A 5FNVA 4KTWA 3AVFA 3LP0A 3P83D 4TOIA 3WB2A 4KHUA 3JAWB 2QKKA 3ALYA 3T1AA 1Z5WA 1TAQA 1RDAA 4C8KA 3CFRA 2OA8A 2HMIA 1IG9A 4I2QA 2G8HA 3QETA 4FLWA 4AHSA 3CB2A 3SUNA 1Y97A 3AVBA 1N36B 1WSFA 4O5BA 4DSFA 2YKNA 1RDCA 1IKYA 4DTXA 4C8MA 2E3CA 1REVA 4HTUA 4O4JA 2E5LB 4KHWA 1ZBLA 2YIBD 2UUCB 3E22A 4CJLA 4CJKA 4CJPA 3CQ8A 3DLEA 4UCUA 5JQGA 1KCFA 3G10A 1ZBHA 4E7KA 1M93A 1NK6A 3LPUA 4IHJB 4W5QA 4IBNA 1NK8A 4QOZB 2UUAB 4IIJB 3HKEB 2F8SA 2P51A 4EB6B 4ZHRA 4KO0A 1T03A 4BDPA 1HPZA 3B6OA 3PO4A 1TKDA 4N76A 4CJSA 1HR0B 3DRRA 5K14A 5D5PA 1R0AA 4L8JA 4H4MA 2HHVA 1LWEA 4LFBB 2YNGA 4CH6A 4HUGA 2VG6A 5KGWA 3THOA 1RT1A 3U3GA 4I9LA 3KTQA 3AO5A 4JLHA 3LAKA 4CS3A 2FC0A 1FKOA 4CFCA 3TAEA 2UXCB 5FROA 4ZIBA 2O4IA 3PV8A 1BI4A 4F6RB 1IBLB 1L3SA 3AO2A 1HYSA 1VRTA 3L2QA 2DFEA 4B9SA 1RDDA 4EFEA 1QE1A 2VG5A 3N2KA 3K5OA 4M3RA 1HQEA 4FLZA 3FI7A 2D0AA 3NF8A 3KKRA 4CEZA 1JLGA 4NYFA 4FLUA 4CJWA 4BE2A 1JLAA 4O4HA 3HP9A 4LH5A 2KTQA 5C8YB 1WLJA 3T19A 1WSIA 3QEWA 4B9TA 5DK5A 4NCAA 3ZSOA 1S1WA 1I94B 2ZCEA 1S1TA 5J2MA 1RT6A 4YJ3A 2IDOA 3HPOA 5C8YA 4CIGA 4IIJA 5HLFA 1W9HA 4X20B 3JALA 3DLBA 3ZSVA 4CHOA 4F2SA 3OS0A 4WBNA 1VSEA 2BANA 4BWAA 4DR5B 4M3ZA 5IJ0A 4JYAB 4UCVA 1G6UA 3HKCA 2XY6A 1HMVA 4OKJA 4DTSA 4DV6B 3OYIA 4CS2A 5FPRA 4LH7A 3AO4A 1YEWA 1IO2A 4DS4A 1Z5VA 3UQ8A 1YTAA 4M41A 2DFFA 3VQCA 4LNUA 1HNVA 3KLHA 1O1WA 4FK2A 3BA8A 3S3MA 4KTQA 3ZSZA 5JH7B 3QEPA 3SYZA 1EKEA 3VQ9A 3RYFA 1BGXT 3ZSRA 1BCMA 2QJ1A 4GW6A 4CERA 2ZIMA 3N2KB 4CJQA 2YNHA 1TVKB 4B3MB 2GBZA 3L2UA 4KB0A 5JH7A 4FVMA 1IH7A 4W5OA 2Y1IA 3RMDA 2OPPA 1NK0A 3BRCA 4FJXA 3TWHA 3SI6A 1N33B 3K5LA 4W5NA 3HVRA 1SL2A 4BWJA 4X1YB 1LAWA 4F2RA 4RW6A 4FYDA 2WOMA 4ZOLB 1NJXA 2Z1IA 5LXTB 3SPYA 1WSHA 2VWKA 3S3NA 1L8DA 4JI1B 1LWFA 3LALA 3LZJA 1N6QA 2WONA 4CC6A 3QIPA 1BCOA 1QQCA 4DK1A 1KMIZ 4DV5B 4JI8B 3ISNC 3C6UA 2GV9A 3AVAA 1HJRA 4O4IB 4CEFA 4X66B 2ETJA 3U6FA 1DTTA 2Q7EA 1RT3A 4YNQA 5LOVB 1BQMA 1X9MA 3QG5A 1CLQA 2BTQB 1BIUA 2UUBB 3NH1A 1D5AA 3SGIA 4DQRA 4PWDA 3TAPA 4X1YA 2YI8A 3O3HA 3SQ2A 5KHHA 4CEOA 4LF8B 2Q0AA 2JS5A 3I0SA 4FW1A 4CHNA 5FDLA 4M45A 2OPRA 1GOBA 3O3FA 1Q8IA 2RPIA 5KX5B 1D8YA 4LSLA 3JATA 4DS5A 3HKBB 3SJAC 1QTMA 5HROA 4CK1A 1ITGA 4R5PA 1I7FA 1HYZA 5KI6A 1UOCA 2V4DA 5D3GA 4DR6B 4B3RB 1MU2A 3RFRA 4FFBB 4GYCB 3HP6A 1TK8A 4FZXC 2D0BA 4AH9A 3S9HA 3V9WA 4Z4GA 1KLNA 4ELVA 4DG1A 1NKCA 4O2AA 3K5MA 1WPBA 1NK9A 1NOYA 1TKTA 4KKOA 4PY5A 4O55A 4BE1A 4DLEA 2DFHA 1M4UA 5J2TB 4DQPA 5GONB 1K6YA 4IHJA 4B8CA 3SQ4A 1TVKA 1Q5OA 1ASVA 4DFJA 3ZT3A 1U04A 4CF0A 3OYDA 4O0JA 1CZBA 3B6PA 3ZT1A 1JL2A 3DLGA 3ZSYA 3VQ7A 2I5JA 1RBUA 3MXIA 2OPQA 5ITZB 4KHSA 1N34B 4RW8A 3DLHA 2G8WA 3NF9A 3WNGA 4JRQA 4TUYA 3S3OA 2PZSA 3DM2A 5KTQA 4DFPA 2LSNA 1NKEA 1O9GA 4DR1B 4DMNA 1FFXA 3RRGA 4EB6A 1FK9A 3KIOA 3HM9A 3QESA 3QINA 1S9GA 3G0ZA 2Q7GA 4E7HA 4B9MA 3KLEA 3WB1A 1RBSA 2X6NA 4DTJA 3AO1A 4UCRA 5HP1A 4BDZA 3RWUA 2HEPA 4CEAA 3HKBA 4BW9A 1JMKC 5JJNB 4Q0BA 1TK5A 1QS4A 1RBVA 1SQFA 1RBRA 4CE9A 3VQEA 4CIFA 4F3OA 3AVHA 4FK4A 3QIOA 3V9ZA 1RSOA 4N47A 4EZ6A 1Q43A 2W42A 4O4HB 1RTIA 3RYCA 3K5NA 3L3UA 3SQ0A 1KVCA 4KL1A 2OWOA 1VRUA 5KHGA 4NCGA 4DTNA 4FJHA 4JI5B 5IJ9B 5SZTA 4FJKA 4HVJA 4E0DA 5D5QA 3RYCB 4CGGA 1ZBIA 3VQ4A 3V81A 1IKWA 3RMBA 4K8XA 4EP5A 1FKPA 1VSHA 2QXFA 3ZT2A 2ZQBA 2HHHB 4KV8A 3E22B 3V6DA 3JASA 4FJ9A 1X9WA 5C42A 1C0MA 2PY5A 3PN1A 2X78A 1XI1A 4IKFA 1KU9A 1KLMA 4CHYA 1A5VA 3RMCA 1T05A 4LY7A 4FJ7A 2YI9A 1HRHA 1KRPA 2R9AA 1IKXA 2KZMA 4O2AB 5JCOA 1HQUA 5CB4B 1NKBA 4FJGA 3JASB 4UCSA 4J2DA 3DMJA 4EP4A 4CJFA 2Q3SA 3HVTA 1C1AA 3QF7A 4LF7B 4CHZA 3OYHA 3SJBC 3AVLA 3OYGA 2YXLA 3AVNA 1NJZA 2KW4A 1TV6A 3PUFA 4HCBA 3SQ1A 3OY9A 1V9PA 2UXBB 1SUQA 5KMGB 1HNZB 1RTHA 4OPKA 2KZZA 1A5WA 1Z25A 2E4LA 1S6QA 5HRSA 3NGIA 4H8KA 1WAJA 3KD5E 1BIZA 1SL1A 4JI0B 4MFBA 3V1OA 4B3OA 1EXQA 4D7SA 3QNOA 1BHLA 1RCHA 1JFFA 1HW7A 3WNEA 4CIEA 3THVA 4LR3A 4E89A 3MAQA 4DV0B 3VA0A 3NDKA 4LF4B 3IG1A 4L8RB 1TAUA 3VQAA 3TARA 4EFBA 3VQWA 3NFAA 4DR7B 4FW2A 5CA1A 4JI7B 5HRPA 4YJ2B 1Q3EA 3MXJA 4IG0A 4YFUA 4ID1A 3ZSXA 2HNDA 3H08A 3ASMA 4FJIA 1Q9YA 3VQXA 3CYMA 3DI6A 3F73A 4Z0UA 1U48A 4DV1B 4YJ2A 1S6PA 4M3YA 4DRXB 5E41A 4EEQA 4JI4B 4HUFA 4UCTA 1TUBB 2E6LA 3BABA 2D5RA 4YHHB 4G1QA 1QHTA 3QLHA 4OLBA 2PW9A 4LSNA 3VQ8A 3HKDA 3JSMA 4QCLA 2JGUA 4DLGA 1CZ9A 1S1VA 4UQGA 3HKEA 2G8KA 5K1PA 1LW0A 4U3JA 4CC5A 4B9NA 4BACA 3U10A 2QK9A 4H4OA 2G8FA 4CESA 4RW4A 4W5RA 1H2SB 3FFQA 1TL3A 3JATB 3RR7A 3WNFA 4Y1CA 4OLAA 4Q6GA 4NYNA 3DRSA 3BAAA 1F21A 3F9KA 3E01A 2YIAA 3HKCB 4J2EA 3U11A 1B92A 4AILC 3SJJA 4CF8A 2GUIA 3HSTB 4X64B 3NE6A 3U0ZA 5J2UA 5CYQA 4Y1DA 2XY5A 4DSJA 2ZM6B 3ULDA 4OPJA 3EY1A 5LP6C 1N5YA 5KRSA 3CM6A 1FJGB 3CSXA 3OS2A 1XHZA 3HPGA 4J2BA 4DR3B 2X74A 5EYPB 4IDKA 3U3YA 2F93B 2R7YA 5IYZA 4OKKA 3N2GB 4CHQA 1TKZA 1WSEA 3LNNA 3UT5B 4Z4FA 1J5EB 3NGYA 5C25A 3LPTA 3KK1A 1Z26A 1P49A 1VSFA 2IAJA 1NJYA 3HYFA 4FJ8A 4KB1A 2P5OA 5KHKA 3LANA 1QSYA 5CA1B 2UXDB 4LH6A 3CG7A 4DQSA 5J2QA 3K58A 4CJ5A 4HCCA 5ITZA 1S9EA 2HNZA 3RYFB 3CFPA 1S1XA 4LF5B 4JI6B 5SWMA 5FPOA 3BGRA 4FLXA 5C24A 1QSLA 1J53A 1KSPA 4FJMA 3QO9A 4DV2B 3RYHA 2P1JA 2HHQA 5KHIA 1BQNA 4GKJB 3OJUA 3VQBA 3PY8A 4DQIA 4E1NA 4CJVA 2RQ6A 3OVNA 2IM9A 1L5UA 3QEVA 3JSLA 5IJ0B 4OKEA 4B9VA