2PYJA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
567
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTA(DOC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 173
structure length 567
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pyjA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pyjA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pyjA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pyjA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pyjA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pyjA06
1BQNA 1IKWA 3AV9A 3LALA 3LDSA 2GV9A 4HVJA 1NKEA 4CFCA 3NE6A 2RKIA 2YNHA 3OS1A 3SZ2A 1N5YA 2RF2A 5FROA 3NH0A 2O4GA 5C42A 3HP6A 4CJWA 4W5TA 1ZBLA 3BDPA 1ITGA 1KFDA 3ZSQA 5FRNA 1KVAA 3HP9A 2DFFA 5HRSA 1TGOA 1MU2A 4CJPA 1LWFA 4M3YA 1QS4A 1WAFA 1WNSA 4CFAA 4CK1A 1BL3A 3C6TA 4AH9A 4HTUA 2X6NA 3OJSA 3SNNA 5CZ1A 3OS0A 1JLAA 4HHTA 1X9SA 4AHTA 1REVA 3NH1A 4O44A 4FLXA 1RTIA 2OPQA 3DM2A 2HHSA 4DWIA 4ELVA 1TKZA 2DFHA 3M8PA 4N5SA 3ULDA 3AVFA 4DQRA 3O3HA 3NFAA 1L5UA 3ALYA 2YNGA 3NBPA 1A5XA 4FJXA 1CXUA 3LWMA 4DTRA 4ZTFA 1QTMA 4F3OA 5CY4A 4FJ9A 4CGDA 2W42A 4E0DA 4M3XA 1C6VA 4FW2A 2B5JA 1UOCA 2FBTA 2OYQA 1TVRA 1RT5A 4LD0A 3U6FA 3TAFA 3TANA 1EETA 2X6SA 1RBVA 3ZSZA 4DSEA 1JLGA 1XWLA 3MEEA 3SCXA 1IG9A 1HMVA 1JXBA 4AHSA 4JS5A 4DTXA 4FJ8A 3VQBA 4FJMA 4TSXA 3ZT3A 3HPOA 1Z25A 3ZT1A 4K8XA 4NYNA 4FJGA 1NOZA 3DLGA 2YV0X 4EZ6A 2DY4A 4RW9A 2P5OA 1B92A 5HRRA 4C8MA 1LAVA 3CFPA 4BDZA 3UIQA 3OYBA 4Z4FA 3ZT0A 1DTTA 4B08A 1HNIA 1BCOA 1U4BA 4N56A 3MXIA 4F2RA 1SL0A 1C1CA 4L8RB 3I8DA 4O55A 3AVLA 1RTDA 4JS4A 3FI7A 1HRHA 4KHSA 3AVBA 1JLQA 5J1EA 4YNQA 2D5RA 4DTUA 3HJFA 3HL8A 1RILA 4IBNA 5DK5A 4B3OA 4KHWA 4AHCA 3EYZA 1NK7A 4CHNA 4Q0BA 3HYFA 2ETJA 2PYLA 4CF2A 4H4MA 5CYMA 4AHVA 2Q3SA 3RTVA 3PY8A 4CEDA 4C8KA 3RWUA 4OGCA 3LPTA 4F3TA 4KRFA 1VSIA 1BCMA 2VG7A 4B9LA 4DSKA 4FLWA 3WNEA 3LP3A 3T3FA 5HROA 2G8WA 3TAPA 3LPUA 4CJ3A 4DS4A 3MECA 1S6PA 3TAQA 3C94A 4W5RA 3TWHA 1RT3A 2HVHA 1QSLA 4FLZA 2FBXA 4E7KA 5D3GA 4PWDA 1EP4A 3OYMA 2PZSA 1IKVA 1VSJA 3QO9A 3SPZA 4EP5A 1F21A 1JLCA 4DFKA 3SI6A 1Q8IA 3VA3A 3HK2A 3D0PA 1CZBA 2FC0A 3VQ6A 4DFPA 3ISNC 1LW0A 4ELTA 4FZZA 1IKYA 3JYTA 2OPPA 4RW6A 4K8ZA 1T05A 1BIUA 2XRIA 1ZBFA 4CIGA 5C25A 3LAMA 5HP1A 2P5GA 1XHXA 3BGRA 3L2RA 1L3SA 1RTHA 1NJWA 3K2PA 3AA3A 3VQ4A 4DF4A 2Y1IA 3SQ1A 1EKEA 3K5MA 4DU4A 1L3VA 1DTQA 4KO0A 3QEIA 5K14A 1SKRA 2E6MA 4DMNA 4I9LA 3V1QA 4CGGA 4M3UA 2QXFA 3V1RA 4BACA 2YKMA 4DLGA 4KHUA 2HVIA 3SV3A 3I0SA 4FM0A 4CJFA 1ASUA 3KLGA 3PX4A 1KSPA 4B9UA 2R7YA 4M42A 4FLVA 3SUNA 5KRTA 1XC9A 3VA0A 1TK5A 4IG0A 4FXDA 5HBMA 3NDKA 3QINA 3MEDA 1X9WA 2KZMA 4CHZA 3DRRA 2IC3A 4FM1A 2QKKA 3RR8A 2KFNA 2D0CA 4PY5A 3AVAA 4PUOA 3VN5A 5T7BA 1J9AA 1U47A 2YHAA 1S9GA 1QSSA 4ZTJA 3K58A 4J2DA 1CZ9A 4LH4A 1FKPA 4W5OA 3MXJA 4CJKA 2XY6A 1HYVA 2PYJA 1VSEA 1Y97A 2YHBA 3NF8A 1YTUA 2HHUA 3L3VA 3K5NA 1LAWA 1C0MA 3CFOA 3HSTB 3V1OA 2HHWA 3SYZA 2VG5A 3AA5X 4G1QA 1O1WA 4CF1A 1FXXA 3NAEA 1NK9A 2QKBA 4B9MA 5HRPA 4FJIA 4BWMA 3ZSXA 4AILC 2QK9A 3TAMA 3K5OA 2WOMA 3P5JA 3WNHA 4DG1A 2F8TA 1RDCA 1TL1A 4BE1A 1J5OA 1ZBHA 5SZTA 3TARA 3KJVA 3FFIA 4J2EA 1HYZA 2DTUA 4GW6A 3DLKA 3MEGA 1RBTA 2ZE2A 4CFBA 4N76A 1C1AA 4UQGA 4CJSA 4XIUA 1HYSA 4KPYA 1JLBA 4Q5VA 3AO3A 3AVKA 3QERA 1LV5A 5JS1A 4B8CA 2IS3A 4M45A 1BGXT 2AJQA 4Z4GA 1S9EA 1WSFA 3QNOA 1RNHA 4DQPA 1WSJA 4FK4A 3QETA 3RMDA 2ZD1A 4OGEA 3ZSYA 4NCBA 3AO2A 1BQMA 1TKTA 2BANA 1WN7A 4GMJB 3LAKA 3VQ8A 1KCFA 2RPIA 3OYHA 2BGGA 1QHTA 2KTQA 3VQ9A 1WSIA 4GVMA 1NKBA 4CE9A 3OS2A 3HT3A 4HUEA 1JL2A 4PQUA 3LP1A 1GOAA 3LP0A 3IAYA 5HRNA 4LSNA 2GBZA 3VQQA 4J2AA 4CF8A 4OPJA 1VK0A 3AO1A 2DFEA 1TAUA 3C6UA 1TL3A 3L8BA 1RDAA 3QEWA 3L2UA 4FCYA 1VSLA 4CF0A 3CQ8A 1Z26A 3CM6A 1U48A 4IDKA 3NF9A 2HNYA 3QIOA 4KI6A 4HUFA 3P1GA 3TAGA 1ZBUA 4RW7A 1JLEA 3OYNA 2HHXA 1JXEA 2D0AA 4JRQA 3L2VA 1R0AA 4N47A 4CEBA 3K5LA 1RBSA 1RT4A 1WLJA 1C1BA 3ITHA 3IS9A 3KK2A 1D8YA 4W5QA 1ZYQA 4FYDA 4E3SA 5I3UA 2HMIA 4I7FA 3QLHA 4E1MA 1RT6A 4F4KA 4F2SA 4RW8A 4DLEA 4CEAA 3IRXA 4EZ9A 1C0UA 4CEZA 4E19A 4BWJA 4IG3A 1BIZA 1DLOA 1RT1A 3ZT4A 2E4LA 2OPSA 3B6PA 2XO7A 2E6LA 4B8AB 4YFUA 2HNZA 1S5JA 1B9DA 3O4NA 3OYGA 2VWKA 4CERA 4OKEA 4CJUA 2A1SA 2GUIA 4BDYA 2A1RA 2WONA 4DQSA 3QEVA 3DI6A 2Z1JA 2G8VA 2FBYA 4KB1A 3EY1A 1LWEA 4N41A 2NUBA 3OYEA 1TAQA 3G10A 4DFMA 4HCCA 5FRMA 2F8SA 3ZT2A 1A5VA 3JSMA 4RG8A 4FJ7A 4OLBA 1S1UA 3SJJA 3NF7A 1T8EA 1S1VA 4I2QA 1RT7A 1UWBA 3NCIA 1BI4B 3AVMA 3F73A 2YKNA 4CJEA 1U04A 2ATQA 1IH7A 3VQPA 4KTWA 3MXMA 3S3NA 2G8KA 3KLFA 3KK3A 1QE1A 1LWCA 3O4QA 3M8SA 3S3OA 4J2BA 1TV6A 3HM9A 1BISA 3DOKA 4DTOA 3M8RA 4DSLA 2VWJA 2KQ2A 4KV8A 1TK8A 3KD1E 3DRPA 1S1XA 3HVRA 4PA1A 4FM2A 4E7IA 4E7LA 4CHPA 4NYFA 3AVNA 4JLHA 4HCBA 1QQCA 3AO4A 4CEQA 3U3GA 3OYFA 3G0ZA 3ZSVA 1IKXA 1GOBA 1J53A 2B4JA 2OZSA 2YNFA 3PX0A 4CHOA 3DRSA 4CESA 5JS2A 2KZZA 3E01A 3PUFA 4B9NA 5KTQA 3ASMA 5C24A 1HQUA 3V4IA 4O5BA 3HPHA 4CEFA 4DQQA 4B9VA 3VQEA 1C0TA 4DQIA 2OPRA 1XHZA 5KI6A 1WSEA 2HHTA 4CJVA 2HHVA 1D5AA 4CJLA 3RMAA 4DU1A 3PO4A 1SKSA 4CEEA 4OJRA 1GOCA 4FLUA 2X78A 4OKKA 4C8NA 3DLRA 4WE1A 4HUGA 4E7HA 2IOCA 3KK1A 1HNVA 3L2QA 4CF9A 3LANA 3OYJA 3PX6A 3KKRA 4DSFA 1TKDA 4O4GA 3WNGA 3NH2A 3SQ4A 1EXQA 4FJLA 3HO1A 2FBVA 3QEXA 3WNFA 4FJHA 4NCAA 1K6YA 4KB0A 3C95A 3ZSRA 4MFBA 3RMCA 5HLFA 3VQCA 3KD5E 4FJNA 2ZQBA 2EX3A 4ICLA 1J54A 3S9HA 5KRSA 4KAZA 4FJKA 4CK3A 4M3ZA 4O0IA 1JKHA 1YTAA 4DU3A 4CGHA 4ZHRA 2BE2A 3OYDA 3V9ZA 1NOYA 1D9FA 4Z4IA 1KLMA 1W0HA 4LH5A 1JL1A 1KFSA 3AVHA 4FZXC 4KREA 3LWLA 3OYKA 4KHNA 2XY7A 2G8UA 3SUQA 4OPKA 2JLEA 3V9XA 1KTQA 4CGIA 1NK4A 1I3AA 2JGUA 3KLEA 4FLTA 1VSKA 3CG7A 4EP4A 4E89A 4DS5A 4CJTA 3OY9A 1BI4A 2B6AA 3AVGA 4IFVA 1ZBIA 4BDPA 3SUOA 4CJQA 1VSHA 3F9KA 4F8RA 1QSYA 2Z1HA 3DLEA 3KLIA 4CGFA 3PV8A 1Q9YA 4FW1A 3AO5A 3TABA 1JLFA 4FK0A 3LP2A 2OA8A 3H08A 4CIFA 2HHQA 3P83D 3SQ2A 1NK5A 1B9FA 4DTSA 1RBRA 3AA4A 4KI4A 4CECA 1U45A 2P51A 4CK2A 1WSHA 1ASVA 1L3UA 1LW2A 1W9HA 2IGIA 2X74A 4CGJA 1EX4A 3VQAA 4CFDA 4E7JA 4B9TA 2KW4A 1X9MA 3IG1A 4C8LA 4LSLA 3LZJA 2XY8A 3KKSA 1KVBA 3AVIA 3ZSOA 2Z1IA 4DTJA 3K59A 4IFYA 4CJ5A 3RMBA 2XY5A 5EU7A 2HW3A 4B9SA 1S6QA 2RN2A 5FDLA 1YT3A 2G8IA 4CHYA 3CM5A 3V81A 4IKFA 3RRGA 4Z4EA 4H8KA 5CYQA 1NK0A 5J2PA 1KLNA 4ELUA 3KTQA 1I39A 4M3WA 1VRTA 3HPGA 3NGIA 1SV5A 2IDOA 3A2FA 1D9DA 2PW9A 3NF6A 4QCLA 4BE0A 4FJ5A 1HQEA 2Z1GA 4CJRA 1T7PA 2ITGA 1NJXA 1N6QA 2KFZA 1IO2A 3VQ7A 4AHUA 4CJ4A 4NCGA 4CIEA 4DFJA 3LZIA 1YVUA 3RR7A 1WSGA 4I9QA 1UA1A 4Z4HA 4DTMA 4DTNA 1XI1A 1RTJA 2VG6A 2BDPA 3KLHA 2EHGA 2PY5A 2YNIA 3V9WA 5KGWA 1UA0A 3RRHA 4DTPA 3AVJA 2HB5A 3PO5A 3VQDA 3CFRA 1NKCA 1UAXA 1KRPA 4QOZB 1G15A 1TK0A 1RT2A 3TR8A 4DSJA 1RBUA 1VSFA 3T1AA 3QEPA 4MQ3A 1VSDA 5E41A 3THVA 1FK9A 2O4IA 1A5WA 1ASWA 1WAJA 3SUPA 4C8OA 3KIOA 4H4OA 1HPZA 2OZMA 3NGYA 1U49A 5J2NA 3SQ0A 1X1PA 4Y1CA 3DLHA 4R5PA 1HJRA 2R7FA 1BHLA 3OYIA 3I0RA 4ID1A 4OVLA 3D45A 3OYLA 3HXMA 3DYAA 1NJZA 3AA2A 4Z4CA 3TAEA 3SV4A 4QAGA 3L2WA 4CEOA 3OVNA 2F96A 4Z0UA 2I5JA 4M3RA 3DMJA 3MAQA 1TKXA 4I2PA 1Q9XA 4Y1DA 3T19A 4FLYA 4LY7A 4BE2A 4M3TA 4E1NA 4FZYA 1CLQA 3TI0A 3NHGA 1SUQA 2LSNA 2IAJA 5J2MA 2G8HA 2D0BA 3EZ5A 1RDDA 3B6OA 3QIPA 4OLAA 3K57A 3S3MA 4FK2A 3NGZA 3O3FA 4O0JA 5KGXA 4JRPA 3OJUA 4CCHA 3ZSWA 4RW4A 1FKOA 4KKOA 5J2QA 3V6DA 2XHBA 3DLBA 3SPYA 3QNNA 5SWMA 4DSIA 1S1TA 1T03A 2Y1JA 3M8QA 4KFBA 3ZCMA 1NJYA 1S1WA 1NK8A 4FVMA 3OYAA 1SL2A 3V9UA 3QESA 3U3YA 1KVCA 4KTZA 1CXQA 3HVTA 1L3TA 4DF8A 3OYCA 2HNDA 4OKJA 1RCHA 3V9SA 1VRUA 1NK6A 4M41A 4KTQA 4AHRA 4FJJA 1RDBA 3L3UA 2G8FA 4KHQA 5I42A 5DMRA 3O3GA 3AVCA 2P1JA 4ID5A 3VQ5A 5CZ2A 1SL1A 1SKWA 4KHYA 4W5NA 3CYMA 3DOLA 1VSMA 4CHQA
chains in the Genus database with same CATH superfamily
3PIOL 3MMVA 3CCEN 2JDIG 1GTOA 2Q68A 1IKWA 3LALA 4M7XA 1M90W 4H0YB 2ETNA 5C42A 4Q20A 2Z5UA 1ITGA 1GLAG 3ZSQA 2IJKA 3JD4A 1KVAA 1YF5L 4UCUA 3FZFA 3LDNA 4RUFA 1TGOA 3ID6A 4UY8O 4CZJA 4CJPA 3HKDA 4B3SB 4M3YA 1QS4A 4X88A 3C6TA 1N0NA 2YJEA 3OJSA 2UUAB 3SNNA 1EZJA 2OTLN 4IGGA 1PO24 4JI5K 1X9SA 1R3KC 5EYPB 2HWC4 2CAZC 3ZHTA 3NH1A 3CC7N 4FLXA 4BC3A 1RTIA 2HHSA 2JS3A 2Y0PA 5C0YA 5H6RA 3RVCA 3ZEUB 3HKCB 1TKZA 4X1KA 3M8PA 3ULDA 1K8AW 3WB0A 3HBTA 3NFAA 4DQRA 3RBZA 4FJXA 1QTMA 4F3OA 4FJ9A 4NTXA 3MK6A 5CR4A 4JHDB 4CGDA 2W42A 1VQ8N 4E0DA 4Z2WA 1C6VA 4YY3B 4FW2A 3OR7C 4GZRB 2FBTA 3THWA 2QR4A 3U6FA 2UUBK 4PL8A 3D2FB 2PLV4 4LF4K 2X6SA 4DSEA 2CK3G 4W4KA 5HL7L 1JLGA 2UU9O 2RN9A 1ZSPA 3MEEA 4FJ8A 4AHSA 4JS5A 1MSDA 3C7NB 3VQBA 4FJMA 4TV9B 2LW1A 5BY1A 1Z25A 3ZT1A 4NYNA 3RN4A 4EZ6A 3O9TA 2DY4A 1B92A 1JQ0A 3G6EV 1LAVA 1EWQA 1RUE4 4O4LB 3TXSA 1Q81O 1BO5O 4E4EA 1DTTA 4FWOA 4DR3B 3SR2C 4QS7A 2LO1A 5GIPA 2ZM6K 3CCJN 3FI7A 4O55A 3AVLA 2ACZA 1SF9A 2Q7GA 1XREA 3UQ8A 2QWPB 1JLQA 1HKGA 5L3BA 2A40A 2D5RA 3E8HA 3MHHC 3HL8A 3OW2M 3L0QA 4IBNA 1AP6A 3EYZA 1EO1A 2EBOA 3QB0A 4CHNA 3SPGA 2Q97A 2ETJA 3HYFA 2AHZA 2KQXA 2Q0RA 1GLEG 4P2ZA 2Q3SA 3CCUV 4CEDA 3E89A 3RWUA 4KRFA 4LF5B 1SQVH 4CBCA 4OX9B 1COV4 3CRRA 5A2QO 2N74A 4MS2A 5DECA 1S6PA 3MECA 1IXBA 3QBWA 4W5RA 3TWHA 1WBBA 1GN2A 1QSLA 4FLZA 4LFBK 1ZLZA 1LNQA 2UUCO 4W4LA 3AE9A 1VSJA 2HVKC 1RM1C 4B3MO 4DFKA 3BZCA 1ZP0A 1EZVH 2X7RB 1P84F 4TOIA 3VQ6A 4FIPC 3DGEA 1SERA 2BTQB 3JYTA 1L1FA 2FMLA 2GTSA 3MCAB 3FGUA 2FYUH 1NVPD 3ZEUA 2QSAA 5HP1A 2P5GA 2X5ID 3L2RA 4BWAA 2FSKA 3ULEB 3B8MA 2Y1IA 1GLJO 3KKYA 2KB1A 3JARB 3VQWA 4K3AA 1GKFA 3OHRA 2Q0OC 2E20A 2RR14 1YVWA 4H5TA 4CGGA 4M3UA 3JAKB 4X20B 2HVIA 4R50A 1K8KA 1KSPA 5LP6C 4C23A 3FB7C 4I0XA 4KBOA 1NTMH 1RVF4 1X4TA 2WLJA 4PHZA 4CS4A 1XC9A 3VA0A 4JKAA 1KUQA 3NDKA 3JATB 2LP7A 4B1ZA 1X9WA 4J7JA 3THOA 2VGNA 2IC3A 4JAXA 4NTYA 3C6AA 4U7OA 4DK1A 4BR4A 5B1AC 2D0CA 3MHSC 2ZXWB 2QWPA 1J9AA 1H2MA 1S9GA 1KECA 5C93A 3K58A 3L6QA 4CI6A 2PYJA 4DV5B 3VQXA 1FFXA 4DV7B 1VSEA 3SPJA 2YHBA 3P32A 4G9ZA 2HHUA 1DEJA 2WDRA 1LAWA 1C0MA 3HSTB 1OVYA 3E1YA 1S72V 4H0XB 3SYZA 1NGGA 3TCUA 1X9JA 3HM8A 4G1QA 3SYPA 3RYCB 2QKBA 5CBFA 4DR4B 1COWG 3QO7A 1MA1A 2GX9A 1SESA 1E1QG 3TAMA 3K5OA 1SQFA 2QWOB 4UV9A 1S0VA 2WOMA 5AQNA 2F8TA 2GWKA 1RDUA 2ZT9B 5SZTA 1RUF4 4FWNA 2MK3A 4GW6A 4F9OA 4BR9A 3JXUA 4K0KB 3ZHVA 4CFBA 5IT9O 4CJSA 3AECA 3AEFA 4CZIA 1JLBA 3VEVA 5JS1A 4GT1A 5GW7A 2XASA 2P9UB 2HVHA 5ADXH 2IS3A 4M45A 1BGXT 2P9LB 1TAEA 4BQZA 4DRXB 3MWTA 1WSFA 2B76A 3JARA 3JASA 3JD0A 1AR84 2UXCB 2Q4PA 3HKEA 3ZEDA 1AR4A 1BQMA 3E9OA 4ILHA 1WN7A 1NLVA 2NRRA 3LAKA 4ZOLB 2KTQA 4OPAA 4LFAO 1NKBA 4CE9A 2JRIA 1KB9F 3T2MA 3JAMO 1JL2A 1GOAA 2YHXA 4DUZO 5IYBO 3IAYA 2ZGZA 3UB5A 3VF2A 3UKMA 3AO1A 2CTPA 4XBFA 4JI4B 1XEQA 1HNWK 5GTIZ 4DV2K 1FXKC 3UO3A 1U48A 4CF0A 1Z26A 1IG8A 3J80O 3DJCA 1MSWD 5KMGA 3VERA 4HUFA 4XH5A 3P1GA 2RM24 4RW7A 2D2CB 3B09A 1SQGA 2XAJA 2JGDB 2W41A 3CETA 1PM9A 1BU6O 2ZE7A 4N47A 2PUSA 3TU5A 4YJ2B 3O1BA 4JV5K 5BPNA 4FYDA 2WU5A 5EXWA 1VQOV 4JI6O 4LF6B 4FWPA 4B1YB 3VEWA 2NRWA 1RT6A 4E1MA 4EB6A 4RW8A 5KPTA 4BRLA 4DLEA 4F2SA 3VR9A 3VBBA 3LDQA 2CTWA 4EZ9A 1WPXA 3RYCA 1C0UA 4E19A 1WP7A 4UV8A 1Q18A 4X1IA 3C6HA 2ZCEA 1DLOA 4BWJA 4BIOA 2OPSA 4YTPA 2XO7A 1EM1A 3J7AU 2E6LA 2P4VA 3CYOA 2HBKA 2E5LO 3OYGA 3U11A 4BDYA 4L8JA 4X62B 2QEXV 4YOYA 4DQSA 2A1RA 3RYIB 2VQEO 5EC1C 2FBYA 2NNWA 4JI2K 1AJPA 2G8VA 4IL6Z 5LXTA 1NEKA 4RQFA 1OH5A 4DV3B 3G10A 1V55B 3LDLA 4DFMA 2F8SA 1Z6RA 1Y76B 3E8GA 4FSVA 3ZT2A 5M1QA 2VWBA 3JSMA 1U2VA 1M5IA 4RG8A 3CCLN 2A3ZA 1OCOB 1S1UA 4OLBA 3NF7A 5C15A 1S1VA 5EOYA 4BC4A 3U0ZA 3CMAV 1W0KG 1BI4B 3AVMA 4M7YA 3NCIA 1U04A 4J42A 1IH7A 3VOVA 1NI8A 1VQPN 1QE1A 1LWCA 3M8SA 3SFEA 1XMOO 2EINC 1R6TA 2D3OW 1TV6A 3LL3A 1URFA 2UXBB 3IUCA 4DTOA 1M93A 3D6RA 4DSLA 4IOAL 1VBB4 5M1FA 1XNRB 4FM2A 3M7MX 4E7LA 1JCFA 4WBNA 1HNXK 2BOCC 1D2DA 4JI4K 3AGKA 1LUWA 4J9YB 2Q1NA 4G2KA 4ZHQA 2P22C 4EEQA 3HZ6A 5AQQA 3DRSA 4MVOA 2YXLA 2P06A 2D0OA 1XOUA 5A9GA 4DW1A 4PDMA 1R6NA 3ATVA 3I55V 1GLBG 3HPHA 4B3TB 1VF5B 4DV4B 1VF7A 4H03B 1AR5A 4B9VA 1QLNA 2OPRA 5KI6A 1WSEA 2HHVA 2JGDA 5JVDB 1D5AA 1Q7YW 4IIJB 5LGUA 1FYJA 1MQTD 3B77A 4FLUA 2Q7HA 1HX1A 4QS9A 3KK1A 3MDSA 1NA1D 2OTJN 1YEWA 3PX6A 1A32A 4BVOA 2YS8A 3JAWB 4DR1K 3STZC 1EXQA 3AEBA 2Q6AA 3QEXA 3HKBB 3ML0A 1K6YA 4H44B 3C95A 3HSCA 3VQCA 1VF6A 2H8PC 2WWWA 3S9HA 5KRSA 4FJKA 4DV3K 4CK3A 2V1DA 4O0IA 2ZM6O 1JKHA 2L35A 4TQDA 1YTAA 5AZIA 4DU3A 1Q82O 1NENA 4YHHO 5ELZA 4EFBA 4JI7O 2DYRB 2YIBA 4BRFA 5CA0B 3A8TA 3FD9A 4FPBA 4FZXC 1Y76A 4YIOA 3D3QA 2VQFB 1YVNA 5LMNK 3WQUA 1SZ2A 1NK4A 2JGUA 1V4SA 3FFKB 1HNZK 2O8EB 4X66B 1VSKA 3CG7A 1VQNN 1YJWV 2XOKG 5JMVA 2GHYA 1BI4A 4AQYB 2RMKB 2B6AA 4Z94A 4A2BA 3SUOA 4O2AA 4CJQA 2BSKA 1V4TA 1QSYA 1RUI4 4Q4W4 3IFXA 3CQYA 3AE1A 1KAZA 3AO5A 4LFBO 4JKFA 3GQHA 3H1LH 3ZS8C 2QW9A 1E1RG 2UU9B 1N36K 1QZ5A 3A5NC 2GDSA 2QM4A 3P83D 3SQ2A 4DTSA 4JYAB 3CCQV 4JTCB 3LDPA 4Q4X4 1QVGU 1WSHA 1FJGO 2WLHA 5K1PA 1LW2A 1W9HA 1K9MO 1EX4A 4CFDA 2KW4A 2F4VB 5C10A 4GKKK 4FK5C 4LSLA 1HW7A 5B8HA 4IJAA 2DQ3A 4WFAL 4DTJA 3CE2A 3K59A 4DR7B 4AF1A 4CJ5A 2XY5A 5EU7A 3CCRN 2HW3A 5JVDA 3EN9A 4B9SA 3CXHF 1KD1O 4J7KA 2G8IA 3G6BA 4CHYA 4IKFA 3RVYA 2CGNA 3RRGA 1THZA 1YSCA 5J2PA 2F9TA 4CVNE 5EBLC 2CGKA 4JI1O 1Q81W 4PI2A 3MN9A 3AG2C 3A2FA 2E1ZA 4MVMA 1DF4A 4J80A 4F6RA 1NJXA 3K03A 4HZ3A 4R7CA 1GH6A 4BG9A 4PJ0Z 2KFZA 3CC7V 1IO2A 1SA0B 2JJ2G 5KA5A 4BGBA 1YVUA 3RR7A 1PVC4 2NRTA 2IU3A 4B3MB 3LDEA 4FFBB 3L4IA 1RTJA 2IVPA 2BDPA 1ZOYA 3V9WA 1BQ0A 5KGWA 3RRHA 4DTPA 3AVJA 1VQ8V 3JYCA 5CA0A 4O8KA 3VQDA 4C1NK 5H5NA 5EBWC 1NGDA 1NBWA 1UAXA 1KRPA 3C3TA 3N2GA 3F2KA 1G15A 2O8EA 1TK0A 1FW6A 2DN9A 4PA3A 1H38A 3T1YK 3CCMN 4WFNL 4FWSA 3ABKC 1VSDA 2O4IA 3CJHA 1A5WA 1ASWA 4UXNA 1RM1B 1WAJA 1HPZA 4LNUB 1LOTB 4WFFA 2WAMA 1MA9B 3OFNG 4BQLA 3SYAA 4AI8A 4Y1CA 1WA8A 1RGIA 4ZBMA 3APOA 2HHHB 1S5LZ 1BHLA 3CCJV 1RPRA 3ZYYX 5LGTA 3CJ1A 3OYIA 1QQMA 5CMUA 3ATUA 4OVLA 3HXMA 1KP3A 3CQXA 5M1PA 2RS14 3Q4HA 3RFRA 3QG5A 3SV4A 4QAGA 1AVMA 2X6AA 3LDCA 1NH2B 2HBLA 4XDKA 1TKXA 4Y1DA 3BZKA 4M3TA 2P9PB 1Y6XA 4BC2A 4LF8B 3TI0A 1SUQA 3O65A 1NGHA 2LSNA 4JI8B 3H1IH 4ILGB 3EZ5A 3FKSG 1HLUA 5L3FA 3KHYA 1JVMA 5LP6B 1NMNA 5AQMA 5JLHA 2ZGYA 2HFEC 4FK2A 3NGZA 3WU2Z 4O0JA 5BRFA 4JRPA 4D7TA 3P4RA 4ILJA 4BY9C 3W7XA 4RW4A 1FKOA 4KKOA 4RCHA 4B3RK 5H2FZ 4Z1VA 3QNNA 1H2SB 1WUAA 4KH6A 4KFBA 3ZCMA 3TTDA 1YIJN 2UUCK 5B1AB 3CHWA 3QESA 1CXZB 5JJNB 4B3MK 4DR6B 3HVTA 1TUUA 1NR7A 2ZWHA 3PIPL 4OKJA 1VRUA 1TVKA 4KTQA 1I94K 3FE1A 3O9SA 1ENVA 4FFBA 3DXKB 2G8FA 1P7GA 2PI4A 2GELA 3O3GA 2YXHA 2P1JA 1JCGA 4ID5A 1HRI4 3SJQC 1J95A 3N2KB 1VSMA 4U67L 4FWRA 4MVRA 4LH7A 3AV9A 5EY4A 4HVJA 2DW4A 1VBE4 3CS5A 3DAWA 3SMSA 1N5YA 5FROA 4JZ2A 3D3IA 4O8UA 1NU0A 5DM7L 5FRNA 3BY6A 4LNUA 2DFFA 5B66Z 4HNAB 3L75H 5LL6Y 4CK1A 1BL3A 4AH9A 4MTGA 3OTOK 1NMDA 4HTUA 1WPBA 2P9KB 3OS0A 1JLAA 2P7TC 1YJNN 1IJJA 3RVZA 1REVA 5KQDA 3KVGA 4KHPO 3C90A 4DUZB 3J8AA 2HJFC 4ELVA 1SZTA 2DFHA 3HK2A 3E66A 3O3HA 3DXRB 1YI2N 2OIGA 3SYQA 1QVGM 2KG7A 5JH7A 3MDQA 4DTRA 4KHPK 1OCZC 4DUYK 3ID8A 1Y64A 4BW5A 1EN4A 2NRZA 5GADP 4XEIA 3ZETA 2XAFA 4H0VB 1TVRA 1RT5A 1OJHA 3TANA 2JIZG 1E4GT 2QM7A 3WFVA 2QM8A 5EK0A 1RBVA 2WLIA 3J81N 1XWLA 3EKSA 3SCXA 1IG9A 1HMVA 1JXBA 3SJAC 4DTXA 1PKXA 4GV9A 4CZMA 2FL4A 4P9PA 3HPOA 1P8ZA 2ITCC 1JJ2U 4JI6B 4K8XA 4HTLA 1FXKB 3DLGA 1BQZA 3RSEB 1HNXO 2DYRC 4RW9A 3JD74 4BDZA 3OYBA 3M8AA 2M6YA 1S77D 4JI0O 1BCOA 1U4BA 3MXIA 3I8DA 3VR8A 1N33O 4KHSA 1BA0A 4B7EA 1G1XB 2Y4TA 3AVBA 4A2AA 1R094 1I0HA 1VF6C 3U9DA 4KUMA 4B3OA 4IT5A 4AHCA 3AEAA 1S3JA 2AP1A 1HPMA 1HWYA 5CYMA 3PY8A 2A7WA 1YJ9V 1VSIA 4B9LA 3OTFA 4DSKA 3BVOA 4FLWA 4GX0A 3L9DA 4QE7A 2YIAA 4HAMA 4DS4A 1BGYH 3TAQA 3RYHA 5AQLA 3EVKA 2Y4UA 1ZL8A 2FBXA 4PWDA 1EP4A 4CZLA 4LFAK 3QO9A 1IKVA 4HNAA 3ZRVA 3HKDB 2QTSA 2MW2B 4LR3A 1VQLV 4IEIA 4EP5A 3VEYA 1H2GA 3SI6A 2ZNIA 3D0PA 4IFEA 2FC0A 1PNMA 4CC5A 1H8TD 2P9KA 3QF7A 4FZZA 1IKYA 1NKDA 5B1OA 3AEEA 4RW6A 4K8ZA 3W3DA 4JI3O 4CIGA 3FYEB 4HWIA 3O08A 2O8DB 1Q6HA 4JI5B 4NB4A 1L3SA 4E2LA 2E88A 1R3IC 2YI1A 3AA3A 4DF4A 2EINB 1EKEA 2VRZA 3K5MA 4EHUA 5AQXA 3UM7A 3S3XA 4KO0A 3SK3A 4UVBA 2IJHA 2KKZA 4IXCA 3THWB 1KQSU 4FJCC 2AHYA 1SQBH 4BRHA 4DMNA 3E8FA 3K0SA 1FFTB 3KCXA 4Q4V4 4I9LA 4DXWA 1AROP 2AZ2A 4BACA 4DLGA 2YKMA 3UCSC 1ZC6A 3P39A 3I0SA 1G4YB 3THXA 2UUBB 4QJFB 4CJFA 4LF4B 1QZ6A 2R7YA 3S41A 1WB7A 2JVDA 5IYDO 3LSQA 4IG0A 2IVOA 5HBMA 2W0FC 2E5LK 4U7BA 1JCHA 2A3QA 2R70A 3RR8A 5I9EB 2VQEK 3G4SN 1N34O 4PY5A 3VN5A 4GKKO 4FZ0A 2ZM6B 5B3SC 2PI5A 4J2DA 1QSSA 4ZTJA 1NGIA 2YXYA 1CZ9A 4LH4A 3H1HH 4W5OA 1VQPV 1QLEC 2HEPA 4AM7A 1AJQA 4BVPA 3L3VA 4B7KA 4X64K 3CFOA 5CHIA 3KWGA 1S76D 1FXVA 1YQ3A 5E1AC 2UXDO 5KPRA 1U96A 4CF1A 3GBTA 2XAHA 1XMOK 2NLXA 3VRBA 4YOXA 5HRPA 1Q82W 4BWMA 3H1VX 4AILC 4X65O 3WNHA 4JK9A 2QDOA 4DG1A 2YC0A 3W7UA 4N23A 3WB1A 4K42A 4BGAA 4BE1A 3F7VC 4U7NA 1J5OA 4UUJC 2DTUA 3O1WA 1KP2A 1HYZA 4LFBB 1LR1A 1RBTA 4MVQA 4I9WA 2ZE2A 1KF6A 2R044 3PJSK 3SDLA 3CMEV 3CC4N 3AO3A 3R65A 3I8BA 3OMIB 2FSJA 3EE9A 4B8CA 2E2OA 4CZFA 2O8DA 4JTAB 1IV0A 1IBLO 1FJGB 4YTMA 1VQ4N 3E9LA 1RNHA 4JK7A 4FK4A 1W97L 3RMDA 3MN7A 3T4DA 2LGWA 3UKUA 3T1YO 2Y48A 5MLCQ 2CTRA 2BANA 1VP7A 3ZHRA 3ZMVA 3VQ9A 4DQ8A 1WSIA 4GVMA 3SJCC 3H3OB 3ENBA 1K8KB 2V7YA 2O8FA 3CCVN 1IURA 1K9MW 3LP0A 4I0XB 5CBHA 1JJ2M 4LSNA 2GBZA 5L3GA 1ZX3A 3EFFK 3BUZB 1MZEA 1VK0A 4OPJA 2I7PA 2DFEA 3L8BA 4PHTX 1VSLA 3CM6A 1L8DA 1NU1H 1ROPA 5KUKA 4NXNO 2HNYA 3VGMA 4YHHK 4JI7K 4KI6A 3TJTA 1KD1W 1IBMO 2NZTA 3F5TA 2HHXA 2GEMA 4KH5A 3ZCCA 3AE3A 2QWLA 1R0AA 5AQPA 4GKJO 2E75B 3R8EA 1RBSA 3AG2B 1C1BA 1YITV 3EZWA 3KK2A 1FFXB 1D8YA 4YXWG 2QKCA 4W5QA 3MN5A 2HMIA 4QE9A 3QLHA 3QFUA 3T69A 1S5HC 4CEAA 3BPZA 5EC2C 3GL1A 4CEZA 4B3RO 4YXDA 2E4LA 3DXMA 2ZKOA 1VRH4 4B8AB 3CD6N 4OGQB 1S5JA 4KFMA 2M7WA 5IDJA 3OMNB 4QNHB 5AQRA 1UJWB 4CERA 4CJUA 3OUFA 2GUIA 3JBG4 3UKRB 3QEVA 3JD2A 2ZE8A 5IYZB 1OKJA 3CJCA 3P4IA 3EY1A 3J7AP 5KLVH 3OYEA 4N41A 4A57A 1RFYA 1FJGK 1I94O 4UVCA 2F95B 3OE7G 4CD1A 2WTUA 4HYOA 2E3CA 3CCRV 3ABKB 4FJ7A 3OGCC 1TUYA 3SJJA 1T8EA 3VESA 4I2QA 1XNQK 1JMKC 2IH3C 3CJ9A 3U4LA 4GX2A 1GN3A 4GVEA 3FB5C 3JASB 5LBQA 4ZKIA 3HKEB 4J2BA 1K7DA 1KQSM 3DOKA 1GM8A 3A0HZ 1TK8A 2Q0AA 4JI1K 3HVRA 1KFYA 3JCZA 5J2TB 2V7QG 4JLHA 2LFSA 3QO8A 4HCBA 3WQTA 3H3NO 4CEQA 1K33A 5B1BC 3OTOO 3ZSVA 1AI4A 4IO8A 5AFUH 3BHPA 3K9AA 4CHOA 3ASOC 1T6CA 2KZZA 3TK1A 3FX7A 1B04A 3E01A 5KTQA 1US6A 5C24A 1HQUA 5IJ9A 2E76B 5KMGB 4QPKA 4CEFA 3CCSN 3AE7A 3VQEA 1HNWB 4YORA 1C0TA 2HHTA 4DV2B 1XHZA 2ZJQL 4DUYO 2OT5A 4B1WB 1VQ7N 3CCMV 1CP9A 4CJLA 2R72A 1N0JA 2L6LA 5EX5A 5L3EA 3PO4A 4OJRA 4LC9B 1GOCA 4C8NA 4OKKA 4YSYA 4E7HA 2IOCA 1HNVA 4JNEA 1AI5A 3CRMA 3LANA 3JALB 4EB6B 1K4CC 4JKBA 3SQ4A 4JV5B 1FAFA 2CH5A 2DWDC 3HI0A 4KB0A 3IDHA 2R074 4X1IB 5HLFA 1MG1A 2YHYA 4FJNA 4RO2A 2UYTA 3H01A 2PFUA 4ICLA 2P90A 1G99A 2H3OA 4ZHRA 4NXMO 3UKRA 5DM6L 5IYZA 1IXMA 2EILB 2OIEA 5LXTB 1JL1A 1QCEA 1KFSA 1K4DC 1GLCG 4KREA 3TSUA 1XQSC 4LF9O 4DO2A 1YZBA 4KHPB 2E2QA 2JLEA 4JI2B 1U2VB 4CGIA 1HKCA 1BOTO 4FLTA 2CGJA 4E89A 4DS5A 3WXJA 3GWKC 1R6KA 1AP5A 2A0LA 3M3ZA 3CX5F 2E2NA 2IH1C 2IIRA 4BRIA 4IFVA 4BDPA 2LFRA 4TQFA 1VSHA 4F8RA 1U97A 5LJVA 1YHQN 2HF3A 4X1YB 3KLIA 4FPPA 3PV8A 2ZR3A 2W6JG 3D8CA 4MVZA 5J2TA 4WBNB 2BTOA 3AG1C 3RW0A 3LP2A 1YXQA 4KI4A 2QWNA 4GNIA 1OCZB 5KUMA 1N32O 4ZHQB 1DK1A 1ASVA 5KAFZ 1HNXB 1L3UA 2CGOA 2QTOA 4C7UA 4DR5O 3DLLL 4JI0B 2RHKA 3IG1A 4BG8A 1NG9A 4C8LA 4ZI7A 2XY8A 3KKSA 4MW3A 4CC6A 1SKVA 1EN6A 4F6EA 1KVBA 2Z1IA 3AVIA 4UB8Z 2WDQA 4K41A 1PL4A 4MTFA 4DW0A 1HJOA 1EFRG 2RN2A 5FDLA 1YT3A 3GG4A 3ZHSA 3CM5A 2P67A 4CJ7A 3KTQA 1B6QA 3QVNA 1I39A 4CBUA 1NWKA 1AI7A 2QI2A 2F23A 2BOBC 3UT5A 1SV5A 3JALA 4LP8A 2IDOA 5AQSA 4BE0A 4FJ5A 1E79G 3KZBA 1T7PA 1AR74 2V51B 2JK5C 5BMVB 1YJNV 2A41A 5IE9A 3AGRA 4DR1B 2KLAA 1IBKK 3LZIA 1TA8A 1UA1A 4MDBA 4Z4HA 4DTNA 5AZIB 4EKWA 1XI1A 2VG6A 3CPEA 1BHAA 3KLHA 3OMAB 2ZF5O 5F2VO 2HB5A 3PO5A 3ZMZA 4TV8B 1EAH4 4RHV4 1CEZA 3E83A 3CFRA 4WFBL 1RUC4 4FZ1A 1L0LH 4XDJA 1J6ZA 1OVQA 5F0XA 4QOZB 1ORQC 1JPXA 4YSZA 5KAIZ 3ZMUA 4DSJA 1VSFA 3QEPA 4X64O 5LMNB 3TGUH 1VQ9V 3K06A 4O2AB 1HNZB 2BSKB 1RFQA 2OZMA 3D36A 3P3NA 4X1YA 2XAQA 2EIMB 3DLHA 2P9NA 3AY9A 1R3LC 1HJRA 2QXLA 1S3XA 5M1OA 3JS6A 4O4HB 3CXCU 1KBHA 3OYLA 4IO9L 1NJZA 4DV0O 3AA2A 4JI0K 2JJ1G 4Z4CA 3TXQA 1N36B 3OVNA 1N33K 3LNNA 1TYQA 2I5JA 2WUSA 4Z0UA 4M3RA 1Q9XA 3PN1A 3N4PA 4LY7A 1S22A 1HXS4 1Z5VA 2IAJA 2QKSA 3J7YP 2LJ2A 4GKKB 2D0BA 3NVMA 3B6OA 3P4QA 3QIPA 4OLAA 3K57A 1VQ6N 1MOFA 5KGXA 4DR2O 3L70H 4GYCB 4CCHA 3CJAA 4PKHA 3ZSWA 5ADXA 5J2QA 3V6DA 2PF4E 3DLBA 3PLAA 1POV0 4O4JA 5SWMA 4WFAV 1T03A 1N8RO 5FLXO 3M1FA 4H37A 5AQZA 4PA6A 5FPOA 1NJIW 4F6RB 3ZLJA 2ASOA 1RMU4 5BMVA 3OYAA 3E22B 3CRQA 4PKIA 1KVCA 5B3SB 1Q90D 2DJVA 4I55B 3SPHA 3B40A 3RYFA 3OYCA 4L3QA 2HNDA 1RCHA 2EIJC 4M41A 4GV6A 3AE8A 2HF4A 1QLEB 3K04A 4WF9L 2BCCH 1RDBA 5B1NA 4I5SA 2LW7A 4JI3K 4YT0A 1VARA 1QR8A 1SS3A 3CPWU 5LHHA 1SKWA 1SL1A 5JVGL 4TV8A 3W7SA 3SFDA 2WBNA 2BTFA 1PPJH 3WT0A 1IDSA 3N2GB 1BQNA 5AQGA 3M6GA 2W6KA 3A0IX 4FMTA 2GV9A 4JAUA 4BRQA 4ABMA 3LDSA 4CFCA 1D4XA 3OS1A 2YNHA 3SZ2A 3NH0A 3CJHB 2O4GA 3HP6A 2FB5A 4CJWA 4W5TA 1D5NA 5LHGA 1R1BA 1KFDA 3G71V 3BDPA 3HP9A 1IX9A 3T1YB 2RDCA 1YQ4A 4CZGA 1MU2A 1LWFA 1WNSA 1H2NA 1FD9A 1Y74A 1WA8B 4YJ3B 4CFAA 1JFFA 2X6NA 3AE5A 1H2LA 5CZ1A 5KQ8A 4O4HA 1XMQO 1JX9A 4DV1O 2NNUA 1Z7S4 1AJNA 1OV9A 5F2RA 3DM2A 3SAFA 1AL24 3Q4HB 1QQNA 3VMFB 2C2AA 4BR5A 4N5SA 4H0OA 5TKWA 3ALYA 1CZAN 2YNGA 3NBPA 2QA4N 4GV3A 1GLDG 1N34K 3T1CA 5E26A 1WJZA 2HP8A 3G80A 2AA4A 5GAHP 1K34A 1RSOB 1XNQO 4M3XA 4CH4A 2B5JA 4LD0A 2OYQA 3CCEV 1XC3A 1JA8A 3CCUN 4CS2A 4FWLA 3OT7A 5HFMA 2QWMA 4TWKA 4GKJB 3L71H 3HOTA 2UXDK 3AE2A 4TSXA 3SBTA 3ZT3A 1F4NA 4K43A 3AG4C 2E74B 4FL9A 4RQEA 4FJGA 1P4RA 1NOZA 2YV0X 1J5EK 4LWSA 5LL6Z 3H1KH 5HRRA 4X65K 3TETA 4BRCA 3FYIB 4CZHA 3CFPA 2OTLV 2BE3A 5FPMA 3I5DA 4B08A 3IC7A 2ZDIA 3E22A 5ITZB 1HNIA 4B3RB 4F2RA 2Q69A 2JEXA 1SL0A 5LA6A 4FWMA 3NMUA 3CC4V 4V19S 4I55A 4YY3O 3LM2A 4JS4A 3IGAC 2UUCB 2GBOA 1TVKB 4YNQA 5GAGP 3K9KA 1RILA 5DK5A 4H5VA 3D2EA 4KHWA 3A0BZ 4OXSA 3QMLA 4Q0BA 1IBLK 1I94B 2PYLA 4JGSA 2DYSC 3ASNC 3CB2A 3K79A 1NVPB 3HTVA 4H4MA 3RTVA 4C8KA 1P90A 4OGCA 3LPTA 1BCMA 2IBZH 4UB6Z 3ETEA 1SS6A 3WNEA 2B9ZA 1O13A 3T3FA 5HROA 2ATKC 3TAPA 4DR3O 1RUG4 3LPUA 4J8FA 4CBXA 5LY3A 3C94A 3CCVV 1RT3A 3A5MC 5EZYB 5CA3A 4P9OA 5D3GA 3OYMA 2OCHA 2ZINA 1F21A 5FL7G 2VS0A 3VA3A 4YJ3A 2EULA 3H6EA 4MW8A 3C0BA 2PTMA 1LW0A 4WQ4A 5A2QN 1KC8O 1NTKH 2AW9A 1BT8A 3DTUB 3O9UA 4I4TB 3OTOB 1I7FA 3F5WC 3L73H 1ZBFA 1KAYA 5C25A 4LF5O 4PELA 1XHXA 4NXNK 3BGRA 4CZEA 2VCPA 1BCCH 4OX9O 3K2PA 1GN4A 2KG7B 5JH7B 2RNBA 1NJWA 1IBMK 1BHBA 4IOCL 4DU4A 1L3VA 1KYOF 3WG7C 1DTQA 3ZETB 5DEDA 1RSOA 4BREA 3T4ZA 4DV6K 4GKJK 1B3QA 5K14A 1WLEA 1SKRA 4DUYB 2E6MA 1PNLA 3ENHA 5B1BB 5AQTA 3ETQA 5BXZA 2WLIB 3GQKA 2QXFA 3V1RA 4O4IA 3SV3A 3CD6V 4FM0A 3U10A 4R8CA 4ISGA 5DN6G 4NO7A 2GWJA 4M42A 5C8YA 3ASOB 4PA9A 4FLVA 4BRDA 5KRTA 3SUNA 1GRJA 3MX2A 1GM7A 1U6ZA 1RUD4 3VQYA 4PV1B 4EIAA 5C2TA 2KZMA 5ITZA 4CHZA 1T3VA 3MX5A 2QWRB 3DRRA 4FM1A 3O9QA 2F9WA 1SC5B 4XH1A 4PUOA 4WQ5C 1U47A 2RQ6A 1M56C 1FKPA 2ZQMA 3MXJA 2WC9A 3CPWM 4XH4A 4WCEL 1HYVA 4NVPA 3B8NA 3NF8A 1Q3EA 3K5NA 5AR0A 2EILC 2HHWA 3V1OA 2VG5A 5LHIA 1X3NA 2JS5A 1NK9A 3NAEA 3ZRWB 1HR0O 3UO2A 3R66A 4LF7K 2X6CA 3RYHB 4FJIA 2QK9A 1ZL8B 1NCQD 3P5JA 5EZYA 3HRGA 1VQ5N 4PA7A 4WFGA 4CH5A 1VHXA 4YOTA 3T1HO 1ZBHA 3TARA 3KJVA 4J9ZB 5J9PC 1IBKO 2W0XA 4J2EA 3D36C 3DLKA 3MEGA 4I50A 2DMXA 5TISZ 4LFAB 1HYSA 3CCSV 4DV7O 4UQGA 1TUBA 4K35A 4XIUA 4N76A 4I4TA 4Q5VA 2GUPA 1W0JG 3L4QA 3I33A 1YCIA 1ZUQA 1VQ7V 1H8HG 3KZIZ 2ZIOA 1P49A 3TSPA 3TPQA 2AJQA 3IJ4A 4DR4O 1OZ0A 1WSJA 5IT9N 3R6MA 1DGSA 4OGEA 4NCBA 4LFCK 2EIKC 2BUPA 2H89A 3F9MA 1VQON 3AG1B 4JKEA 3OYHA 3PSFA 3VQ8A 1QHTA 2ADPA 4K0KO 3LNMB 3OS2A 4HUEA 1WOQA 3ABMC 2XT9A 3THXB 4PQUA 1KAXA 5GONB 1R59O 3VQQA 4J2AA 2ILMA 5C3JA 2P6JA 3FZLA 2QTDA 1TAUA 3BA8A 5AQIA 1TL3A 1RDAA 2QEXN 4MTXA 4FFKA 4FWQA 3CQ8A 1FPOA 3QO5A 4IDKA 2QWRA 3JAMN 5F1XA 4Y0WA 4NXMK 2UXCO 4X89A 4JASA 4JF3A 2VYPA 2WLLA 3GVMA 2E5LB 2QM1A 1JXEA 3SPCA 3OA9A 2OCCC 4LF9K 3L2VA 3BAAA 4CEBA 2VQEB 5K1XA 3CMAN 1D4M4 2F1MA 4P30A 1WLJA 2ZE6A 2NRVA 3J80N 3IS9A 1V54C 5HFLA 1ZYQA 4E3SA 5I3UA 3OR6C 4B1XB 1PL0A 4CH3A 3R9PA 1KXPA 4F4KA 5JQGA 5H9CA 3IRXA 2GUZA 2WP9A 3ZRWA 4UCTA 4X64B 4JAVA 5AQFA 4IG3A 1BIZA 1RT1A 2V7ZA 3B6PA 1DLBA 3P38A 1UFIA 4YFUA 4BR7A 5EIBC 4ZIBA 1XMOB 1B9DA 2HNZA 3O4NA 2VWKA 1YUWA 2ZJPL 2ADQB 3AEDA 3DI6A 4KB1A 1NS1A 1N32K 2NUBA 5JJJB 1TAQA 2P9SA 3OBYA 2EIMC 5FRMA 4DR5K 2QGNA 4GUNA 3BABA 4LF6O 1EBOA 1A5VA 4EAHD 3I55N 1MNGA 1LUVA 3G25A 2RCVA 2N05A 3TSQA 1UWBA 1P7BA 4CJEA 5JICA 1AR64 3VQPA 3AE4A 4KTWA 3MXMA 2G8KA 2Z0AA 3KK3A 4DB3A 3O4QA 3UKUB 3ZRXA 1BISA 4RTFD 3M8RA 4MVUA 4X62O 2VWJA 4UVAA 3KD1E 3DRPA 1S1XA 5B5EZ 4CHPA 1VQMN 3AVNA 2YIBD 1QQCA 3AO4A 2O8FB 1MDUB 2O57A 3E35A 5GONA 1GOBA 4IEEA 1BG3A 2WLNA 1J53A 2B4JA 1PD3A 1BWFO 2PAVA 2YNFA 3PX0A 2YI8A 5D5PA 1X3MA 3AARA 4DKWA 2EZOA 3A5OC 1AI6A 4DHYA 1BDGA 1F7YA 3VGKA 2B5UA 3U8XA 3SAHA 4NYKA 3GWOA 2QWQB 2CDYA 3V4IA 4O5BA 1NJIO 1SAZA 2ASPA 2IJJA 3CCLV 2ZDIC 4DQIA 2CH6A 2UXBO 4CBWA 5HRSA 1Y4MA 2X0LA 3FFQA 1Q5OA 4IZ9A 1SQQH 3OAAG 1XNRO 4YHHB 4JI7B 1YJWN 3BY5A 4E1JA 3DLRA 4WE1A 1PV0A 1N8RW 4KX6A 4CF9A 4DYLA 4JPRA 4DSFA 1DTOA 4O4GA 3WNGA 3NH2A 4FJLA 4K25A 5EBMC 2FTKA 4FJHA 4NCAA 3EEQA 2EIJB 3ZSRA 3SGIA 4MFBA 1J5EO 5FPDA 3MWPA 3RMCA 3DXMB 3KCYA 5CB4B 4DV4O 4B3TO 2ARHA 2EX3A 2HVJC 3WXKA 3ETDA 3CERA 2O8CA 4KAZA 2KKWA 3KG2A 4BIZA 1LCUA 3CCQN 2ODMA 1NOYA 2LGQA 4CGHA 5GIOA 2CE4A 1RUJ4 2HR3A 1D9FA 5LMUK 1KLMA 4DV0K 4Z4IA 1W0HA 3AVHA 4WYBA 3CIPA 3LWLA 2R9AA 1XMQB 2WFBA 4A5BA 4BR2A 3OGIB 5IYCO 2G8UA 4KHNA 3SUQA 4OPKA 4PA4A 1KKDA 2AGAA 4WQ4C 3V9XA 1I3AA 2A42A 3AG7A 4EP4A 1VQ6V 4CJTA 2V4DA 3X2QB 4BW9A 3OY9A 4TUYA 3AVGA 2OTJV 1ZBIA 2CUGA 2HMPA 1XNQB 5JCOA 2YIDA 2OWOA 4DR2K 1GMGA 1UPGA 2P9IA 1Q9YA 3TABA 4L87A 1JLFA 4DCHA 3AEGA 3O5BA 2WA3A 2ZR2A 2CH7A 1I5YA 2OA8A 3H08A 4CIFA 2HHQA 3E2EA 2A9HA 2VQFO 5AQVA 1RBRA 4JI1B 4AM6A 1EWRA 2P51A 1WAZA 4X66O 2PBDA 2Q2RA 3B8AX 4AQYO 1GM9A 3VQAA 4R79A 4E7JA 4B9TA 2YICA 2DE0X 1MMMA 3LZJA 1W7AA 3CEIA 1T44A 5IJ9B 2QWQA 3ZSOA 1RHI4 3ZMSA 1R084 2Q31A 3RMBA 3CC2N 5BR8K 1VQNV 3IKMA 2QJ1A 1S6QA 3AG4B 4JKHA 1E3MA 4DV6O 3FR0A 4BR0A 3VQVA 4PL7A 5IWAK 4Z4EA 1C0FA 1MWMA 4H8KA 1KLNA 1O9GA 4JYAO 3AG3C 3U9ZA 2R9IA 5JJEB 2PW9A 5KX5A 4WFHA 1GAXA 3NF6A 4JD2B 1BMFG 1HQEA 2AXTZ 3HOSA 3DSQA 3WXIA 1VEWA 3QTCA 2F4VO 1N6QA 3VQ7A 1WB9A 4AHUA 3W7TA 3ABTA 4NCGA 4NLCA 4G28B 2RE2A 1XL6A 5CB4A 4DR7O 3THYB 3SYCA 4I9QA 2EZPA 4DTMA 2QA4V 4B1UB 1XMQK 4DV1K 2DYSB 3ASNB 4F4LA 2PY5A 2YNIA 1UA0A 2WLKA 3PSIA 1M4UA 5L3CA 3ETGA 1BSMA 3JCUZ 4O2BA 1ATNA 3VTHA 4A61A 5BRDA 1NKCA 4BRKA 1RT2A 3TR8A 3QNEA 4IDHA 5FPEA 3SUCA 1K3EA 5E41A 4B3SK 3TTCA 1Z5WA 5DM6V 4A5AA 5AJ3K 4H4OA 1KMIZ 2UUAK 3CSXA 1VBA4 1SQXH 3DWLA 4LF7O 1G8MA 2IM9A 3W0LA 1KC8W 1OCRB 2RMU4 4JKCA 3K08A 1IVSA 3WB2A 1HUXA 5EYPA 3I0RA 1QR9A 3AK1A 4ID1A 3SLCA 3D45A 4OO1J 2QWNB 1RPOA 5BRHA 2H3GX 3J8F4 3HKCA 1B06A 5FNVB 3AK2A 3L2WA 3WG7B 4CEOA 4YY3K 2F96A 4O5FA 5L3DA 4FVUA 1AB3A 3DMJA 4PKGA 3T19A 1Y67A 5BN8A 4ZI7B 3M5RA 4JHDA 4BE2A 1F4MA 4FZYA 1CLQA 2G8HA 3G67A 1RDDA 3D2FA 2O8BB 4LFCO 1YAGA 1Q6IA 2HHHO 2W6IG 3S3MA 1Q6UA 4GX1A 1T5EA 3EL2A 3C7NA 1NGAA 4TV9A 3EE8A 1M1KO 2XHBA 2HSTA 4DR3K 3UT5B 3SPYA 3ZHQA 4J7ZA 3P3PA 4DSIA 4JD2A 2Y1JA 3QBXA 5AQHA 3M8QA 2XNDG 4O4LA 2H94A 3BF1A 1NK8A 3K0GA 3M99B 4FVMA 1HR0B 1NH2D 3VF4A 3V9UA 3MN6A 1SL2A 4YOUA 3U3YA 2Q8VA 1MZFA 4KTZA 1CXQA 1SQKA 4LF8O 1H1VA 4KL1A 3I56N 1M56B 3THYA 4JI8O 1Q86O 3T1HB 1PO14 3CIRA 3TTFA 5KHGA 4J11A 3L3UA 4A62A 1IBKB 1GLFO 5I42A 1YF2A 5KHIA 3AVCA 4LF5K 4KHYA 3VQ5A 3ABLC 4D7SA 4W5NA 4OX9K 2H88A 3DOLA 3CJBA 4CHQA 4YOVA 3L74H 3OEEG 1GLLO 3AAPA 5IY5C 2GTDA 1NKEA 1W59A 1VIBA 4MO4A 4BROA 2RKIA 3NE6A 1HP8A 4GY2B 2RF2A 5AQUA 1ZBLA 4DR6O 4MLEA 4GCZA 3IMXA 1RUH4 4FPAA 1H8EG 5JLFA 3H9VA 2WLMA 2VGMA 2A06H 4BRNA 2CTQA 3AK3A 1YIJV 4WFBV 1WAFA 3O6WA 1MABG 1E4FT 2P9NB 4ISEA 4CZKA 3LUTB 4HHTA 4JYCA 3SPIA 2BTQA 3VTIA 4AHTA 4O44A 3VGLA 2NLJC 3S3WA 2OPQA 3BEXA 4H0PA 4DWIA 2Q7EA 3K3WA 5FNVA 1L5UA 3AVFA 2XUMA 1K5MD 1Z2GA 3ULEA 1A5XA 2EIKB 1TYQB 1CXUA 3J81O 3LWMA 4ZTFA 2RS34 5CY4A 1K97A 5CE3A 4LC1A 3R1XA 3CRAA 1N33B 1UOCA 1Q43A 4BAYA 3TAFA 1VBD4 1BA1A 4B1VA 4H5WA 2IJIA 4QPJA 3ZMTA 3ABMB 1YJ9N 1EETA 2O8BA 4UCRA 3ZSZA 3NVKA 2ZJRL 3E86A 1ASJ4 2KSDA 2WSSG 3JAKA 3BRCA 4X20A 3A8YA 1VQ5V 3OD4A 1ZTEA 1ATRA 2AZ0A 1HR0K 1KKCA 5AG2A 4O4JB 3JD3A 2P5OA 1VQLN 2R9RB 4C8MA 3UIQA 4Z4FA 4BRGA 1PIV4 3JATA 4JN4A 3ZT0A 4N56A 3HB3B 3T1HK 4WQ5A 1C1CA 2OCEA 4L8RB 2JWLA 2OCCB 3DC5A 3ZX0A 1RTDA 3RYFB 1HRHA 1OCCC 4J41A 5LGNA 2F7TA 4GLXA 5J1EA 4DV5K 4DV7K 4DTUA 3BFRA 1YI2V 1ZWIC 2ZE5A 3Q7CA 3QFPA 3HJFA 1V54B 4BRMA 1NK7A 3CRCA 1BZKA 3E8BA 1YTFB 4G27B 4Z1MG 2X6BA 3CHXA 3K9JA 4CF2A 4DR4K 2K9PA 4AHVA 3K0DA 4JI3B 1JOYA 5AFUA 4F3TA 4PDRA 2VG7A 3LP3A 3SYOA 5KHJA 1NGFA 2G8WA 2UXNA 4CJ3A 4WF9V 4MVSA 1X59A 4E7KA 2QWOA 2PZSA 4K0KK 3SPZA 3ZX2A 3J7ZO 4X8AA 4ICGA 1JLCA 1Q8IA 1Y74B 5IJ0B 1JFFB 1CZBA 5JCOC 4DFPA 3ISNC 2WQYA 4MT8A 1HRV4 5C2DA 3RT3C 4ELTA 3WUHA 2OPPA 3ZX3A 1L0VA 2YCHA 1T05A 5LMUO 1BIUA 2XRIA 2P9UA 3LAMA 1NT2B 4IWVA 2UXCK 1RTHA 2P9LA 3VQ4A 4DRXA 3SQ1A 1VQKN 3VEOA 4RWTA 3HPLC 3ZHUA 3BA9A 2YEVB 5LJWA 1M57C 3QEIA 4CD3A 3O9OA 1N34B 2Y69C 5CA1B 2A5XA 3FLCO 1AR1B 2YHWA 4IOXA 4J10A 4ZOLA 3ZN0A 3V1QA 5E79Z 1WBDA 3CF5L 1TUEB 5E84A 4KHUA 3BEHA 1DT9A 3P31A 2Q67A 1ASUA 3KLGA 3PX4A 4B9UA 3HR0A 2HKOA 1OH8A 4LWSB 1KU9A 4JI5O 4FXDA 1TK5A 2NR5A 1K73O 2UXDB 3QINA 2OANA 3MEDA 1NNEA 3O4WA 1VBC4 5LA6B 1J5EB 2QKKA 4X65B 2KFNA 4YOWA 3CMEN 1H2KA 3AVAA 3AE6A 3APQA 5T7BA 2EJ7A 3ZJZA 3NXSA 2YHAA 4A5UB 5AQKA 4LF6K 3D2EB 3E9PA 3KWIA 5BR8O 4YJ2A 4CJKA 2XY6A 2Q36A 1Y97A 1YTUA 4LH6A 2UUBO 4LF4O 2R064 3FB8C 5IWAO 5BREA 3BCCH 5AQJA 2DQ0A 1IBLB 3AA5X 4FO0A 3FAVB 1O1WA 1FXXA 2HWB4 1VQMV 4H5RA 4IYIA 3ABVA 2XTAA 4B9MA 1XILA 1R73A 2Q73A 4X62K 3ZSXA 3IC9A 1M90O 3O80A 3H46O 2Q9LA 3X2QC 5C12A 4Q4Y4 1PP9H 1RDCA 1TL1A 4PD4F 3FZHA 3H1QA 5BPMA 5IJ0A 3FFIA 3RYIA 5KPZA 3G6EN 3P4SA 2D0PA 1C1AA 1JCEA 5CBGA 4KPYA 3G4SV 1QNMA 1FS0G 3AVKA 3QERA 1LV5A 4R6ZA 1NZ6A 4QIWF 4H33A 5GTHZ 4DK0A 4YDUA 4LCUC 2A6AA 4Z4GA 1S9EA 4FWKA 3QNOA 4DQPA 2UXBK 1W2BU 4BC5A 3QETA 1OOPD 2ZD1A 3ZSYA 1K8AO 2YEVA 4NXNB 1QBZA 1EQYA 3AO2A 1YITN 1XNRK 1EV14 2F93B 1TKTA 5HOOA 1IBMB 1VMGA 3JSLA 5CA1A 4B3SO 3STLC 2NRHA 2ZNJA 4GMJB 1KCFA 2UUAO 2RPIA 2BGGA 3EXAA 1XBLA 4H5NA 4DV6B 4O4IB 3ZN1A 4FOIA 3HT3A 1SQPH 1QHAA 1L0NH 3GDQA 3LP1A 2V52B 5C8YB 5HRNA 5J2UB 4CF8A 1XQ8A 4B3TK 4DV4K 1BEV4 3C6UA 3QEWA 1NGCA 3L2UA 5FPRA 4FCYA 5BZBA 1ZAUA 3L72H 3B2EE 1WP8A 3NF9A 1JR9A 2Z3YA 3QIOA 1IZ3A 3EO3A 3TAGA 1ZBUA 1JLEA 3OYNA 2D0AA 4A59A 3GB7C 4JRQA 1VQ4V 4IIJA 5BN9A 5M1KA 4RUEA 3K5LA 3AG3B 5EVZA 3P4PA 4H0TB 1RT4A 4RAIA 3ITHA 4ISFA 1XL4A 3EHBB 1OH7A 3O9RA 4UCSA 4I7FA 5H1SQ 1BE3H 1NM1A 3JAWA 3GE1A 2FF6A 2K1EA 2WPDG 2XAGA 3FAVA 4JEPA 3HKBA 2YSUB 1YXBA 1BL8A 3ZT4A 4TT3G 1GK9A 4TSFG 2DOSA 1N4CA 4WCEV 3ABUA 1G6UA 3OEHG 4NB5A 4LF7B 4JKGB 4OKEA 2A1SA 2WONA 3VF6A 2A79B 3LSUA 4CS3A 2Z1JA 2VQFK 2WS3A 2BH1A 1LWEA 4I50B 3RWRD 4Q6GA 1PNKA 5TKYA 3SAGA 1OCRC 1TUBB 4X66K 3CXCM 4HCCA 3CC2V 4JTDB 1ZXOA 2IVNA 4AQYK 2GSMB 2W40A 1BS3A 2ITMA 4BRAA 2D4WA 2P4KA 1QVFU 1RT7A 2FLOA 4MSWC 3N27A 3F73A 4PDVA 2YKNA 2HLDG 2ATQA 3S3NA 3KLFA 3F7YC 3K9SA 3MCPA 3S3OA 3WEEB 2UU9K 4CW7B 3HM9A 2PGGA 2KQ2A 4KV8A 2F43G 1S72N 4JYAK 2FXUA 4LFCB 4PA1A 2JWKA 4JK8A 4E7IA 4NYFA 3SJBC 4GB34 5AQOA 1NGBA 1ESVA 3U3GA 3OYFA 3G0ZA 3VEXA 2RJZA 4GX5A 3ENOA 5J2UA 2GTAA 1IKXA 4NLBA 2F4VK 5GAEP 2EJRA 2OZSA 2E2PA 4DR7K 3FZMA 4CESA 4RWUA 5JS2A 1ATSA 4NKGB 3PUFA 4B9NA 3ASMA 4DQQA 1OH6A 3LDOA 2WLLB 3H45C 3JSNA 4CJVA 1NR1A 2LQTA 4I7ZB 5LYJB 2HBJA 4NXMB 2EWSA 2W6LA 1M1KW 5FPNA 4CEEA 2ZXWC 4DU1A 2X78A 4HUGA 1SKSA 5KHHA 4BIUA 3KK7A 2IU0A 4H0LB 2Q0UA 4LF9B 3L2QA 1AR94 2DWEC 2F66C 5AQYA 1VAZA 3OYJA 4NTWA 3KKRA 3N4QA 5JQGB 1TKDA 5H6QA 3HO1A 3R3LA 2FBVA 3SMPA 1K5SA 2GUZB 3WNFA 3NR7A 3ZIAG 2Y0IA 1Z05A 3KD5E 1Q86W 1SA0A 4KH4A 2UXXA 4BR6A 2ZQBA 4EFHA 1HNWO 1J54A 1F51A 4YTNA 2YDEA 4DV2O 4WFEA 4JKGA 4M3ZA 3ABLB 3OYDA 2BE2A 4LBEC 3V9ZA 4I6MB 4UFZA 4LH5A 1SRYA 5AZJB 2B1IA 4DV5O 2P9SB 4JKDA 4EHTA 4N21A 4U3FH 5IY5B 3OYKA 1YDXA 3UE5A 1T6DA 3OBWA 2XY7A 3WXMB 1JJOA 1N32B 1KTQA 3KLEA 3RMAA 4JV5O 1MWKA 1RDWX 3H1JH 3GOIA 1DF5A 3AAQA 2I7NA 4DR5B 5C2FA 2FSNA 1K92A 1QQOA 1W2BM 2QE7G 3RGBA 3C3SA 2RS54 4KP4A 3F9KA 2HHHK 3WEEA 1NGJA 1DKGD 2Z1HA 1GN6A 3DLEA 3FB6C 4CGFA 3BF3A 1EN5A 3C65A 1F23A 4FW1A 4FK0A 2ITDC 3Q7BA 3VPZA 3CP1A 1HKBA 2QKAA 3I56V 3SBGA 1NK5A 1B9FA 3O8MA 3AA4A 2YUAA 1QU7A 4CECA 4JI2O 1U45A 4B9QA 1HDJA 4CK2A 3QDKA 4LF8K 4YIPA 2IGIA 2X74A 4CGJA 2ASMA 2J4RA 3EKUA 4JI8K 1X9MA 1NQTA 4NR1A 2P9PA 3DC6A 4IFYA 5JWPA 4FOEA 5GINA 2D1KA 1Y66A 5LYJA 3OUSA 4PI0A 2FF3B 5LP6A 1SETA 3V81A 1FXHA 5CYQA 1NK0A 4ELUA 2WA4A 1YHQV 5BPLA 4M3WA 3AEIA 1VQ9N 1VRTA 5LOVB 3B4SA 3VENA 3HPGA 3NGIA 1D9DA 4DR6K 4QCLA 2Z1GA 4JI4O 3FZKA 4CJRA 4JAAA 3VOUA 5KA6A 2ITGA 3CJ7A 1OCCB 4U3JB 4CJ4A 3VRAA 1SZXA 4CIEA 4DFJA 3ZBHA 5JVHL 2O8CB 1C0GA 3CWBH 1WSGA 1NBMG 1RP3B 3OW2U 1WB8A 2IW5A 4IHJB 2FKXA 1ILYA 3DXKA 4OPHA 1I08A 3LDDA 4ASUG 2EHGA 4I6MA 3ZRSA 2WU2A 5AZJA 5M1NA 1AILA 2DPNA 1XDCA 3SJHA 3N2KA 2HG5C 5LMUB 4DV0B 2FBWA 1V55C 2YJFA 2HBMA 1FKAO 1V9PA 1RBUA 3T1AA 3W7WA 4PDWD 3JD1A 1QVFM 4MQ3A 3THVA 4TUYB 1FK9A 4C8OA 1OCOC 3SUPA 4DR1O 3KIOA 2ZD9A 4YDUC 4UCOA 3NGYA 3VEZA 1U49A 5J2NA 1R3JC 5KHKA 1NTZH 4IJNA 3SQ0A 2E8AA 1X1PA 2P9IB 1I5XA 4MLHA 4R5PA 4CZZA 4DUZK 1NGEA 4XDLA 2R7FA 2CH7B 3MD0A 4DV3O 4DR2B 4MO5A 3VETA 1XUQA 1YTFD 3DYAA 4YSXA 4H13B 3TAEA 4X1KB 4MTOA 3DXRA 1M57B 4EFEA 2E1YA 3MAQA 4JYYA 3OM3B 5LMNO 2Y69B 4I2PA 4BRPA 5EIBD 4FLYA 2NRXA 1HNZO 4E1NA 1CPYA 5BR9A 4QGPA 3LSSA 2YX6A 2G38A 2HOEA 3NHGA 5J2MA 4HBNA 1K5QA 3A0RA 4KXRA 2JEUA 4JI6K 5D5QA 2Q5ZA 3O3FA 2ZIMA 5BR8B 3OJUA 3D7EO 2HJDA 1Q7YO 1K73W 1GO3F 3G71N 1O9HA 5LOVA 1FXKA 5KX5B 1N36O 5IWAB 1DGKN 1S1TA 2B1GA 4M63C 4CH6A 3RSEA 2KHOA 1NJYA 1M9NA 1S1WA 3IFRA 3ICXA 4U3JA 4QS8A 3T7ZA 4MDAA 3A5LC 1OHHG 1L3TA 4IYHA 1ZBSA 4DF8A 4UCVA 3V9SA 1NK6A 2CGLA 3QICA 4AHRA 5FLXN 3LM9A 4IHJA 1VQKV 5CN0A 1BUPA 4D6TH 4FJJA 4X9QA 4PDLA 2YI9A 3ZX6A 4KHQA 2N04A 5DMRA 4JYBA 2WDVA 5CZ2A 4JZGA 3WXLA 3CYMA 1XUPO 4O2BB 3BP8A 4DV1B 2NN4A 3P30A 4C1NI 5AQWA 3CI5A
chains in the Genus database with same CATH topology
1IKWA 3LALA 5C42A 1ITGA 3ZSQA 1KVAA 5HRSA 4UCUA 1TGOA 4CJPA 3HKDA 4B3SB 4M3YA 1QS4A 3C6TA 3OJSA 2UUAB 3SNNA 1X9SA 5EYPB 2CAZC 3NH1A 4FLXA 1RTIA 2HHSA 3HKCB 1TKZA 4X1KA 3M8PA 3ULDA 4DQRA 3WB0A 3NFAA 4FJXA 1QTMA 4F3OA 4FJ9A 4CGDA 2W42A 4E0DA 1C6VA 4YY3B 4FW2A 2FBTA 3U6FA 2X6SA 4DSEA 1JLGA 3MEEA 4FJ8A 4AHSA 4JS5A 3VQBA 4FJMA 4TV9B 1Z25A 3ZT1A 4NYNA 4EZ6A 2DY4A 1B92A 1LAVA 4O4LB 1DTTA 4DR3B 3SR2C 3FI7A 4O55A 3AVLA 2Q7GA 3UQ8A 1JLQA 2D5RA 3HL8A 4IBNA 3EYZA 4CHNA 3HYFA 2ETJA 2Q3SA 4CEDA 3RWUA 4KRFA 4LF5B 4OX9B 2HVHA 3MECA 1S6PA 3TWHA 4W5RA 1QSLA 4FLZA 1VSJA 4DFKA 4TOIA 3VQ6A 2BTQB 3JYTA 5HP1A 2P5GA 3L2RA 4BWAA 2Y1IA 3VQWA 3JARB 4CGGA 4M3UA 3JAKB 4X20B 2HVIA 1KSPA 5LP6C 1X4TA 4PHZA 4CS4A 1XC9A 3VA0A 3NDKA 3JATB 1X9WA 3THOA 2IC3A 4DK1A 2D0CA 1J9AA 1S9GA 3K58A 2PYJA 4DV5B 3VQXA 1FFXA 4DV7B 1VSEA 2YHBA 2HHUA 1LAWA 1C0MA 3HSTB 3SYZA 4G1QA 3RYCB 2QKBA 4DR4B 3TAMA 3K5OA 1SQFA 2WOMA 2F8TA 5SZTA 4GW6A 4K0KB 4CFBA 4CJSA 1JLBA 5JS1A 2IS3A 4M45A 1BGXT 1TAEA 4DRXB 1WSFA 3JARA 3JASA 2UXCB 3HKEA 3ZEDA 1BQMA 1WN7A 3LAKA 4ZOLB 2KTQA 1NKBA 4CE9A 1JL2A 1GOAA 3IAYA 3AO1A 4JI4B 1U48A 4CF0A 1Z26A 5KMGA 4HUFA 3P1GA 4RW7A 1SQGA 4N47A 2PUSA 4YJ2B 4FYDA 4LF6B 4E1MA 1RT6A 4EB6A 4RW8A 4DLEA 4F2SA 4EZ9A 3RYCA 1C0UA 4E19A 4BWJA 4X1IA 2ZCEA 1DLOA 2OPSA 2XO7A 2E6LA 3OYGA 3U11A 4BDYA 4L8JA 4X62B 2A1RA 4DQSA 3RYIB 2G8VA 2FBYA 5LXTA 4DV3B 3G10A 4DFMA 2F8SA 3ZT2A 3JSMA 4RG8A 1M5IA 4OLBA 1S1UA 3NF7A 1S1VA 3U0ZA 3NCIA 1BI4B 3AVMA 1U04A 1IH7A 1QE1A 1LWCA 3M8SA 1TV6A 4DTOA 2UXBB 1M93A 4DSLA 1XNRB 4FM2A 3M7MX 4E7LA 4WBNA 4ZHQA 2P22C 4EEQA 3DRSA 2YXLA 3HPHA 4B3TB 4B9VA 4DV4B 1VF7A 2OPRA 5KI6A 1WSEA 2HHVA 5JVDB 1D5AA 4IIJB 4FLUA 2Q7HA 3KK1A 1YEWA 3PX6A 3JAWB 1EXQA 3QEXA 3HKBB 1K6YA 3C95A 3VQCA 3S9HA 5KRSA 4FJKA 4CK3A 4O0IA 1JKHA 1YTAA 4TQDA 4DU3A 4EFBA 2YIBA 5CA0B 4FZXC 2VQFB 1NK4A 2JGUA 4X66B 1VSKA 3CG7A 1BI4A 4AQYB 2B6AA 3SUOA 4O2AA 4CJQA 1QSYA 3AO5A 3ZS8C 2UU9B 2QM4A 3P83D 3SQ2A 4DTSA 4JYAB 1WSHA 5K1PA 1LW2A 1W9HA 1EX4A 4CFDA 2KW4A 2F4VB 4LSLA 1HW7A 4DTJA 4DR7B 3K59A 4CJ5A 2XY5A 5EU7A 2HW3A 5JVDA 4B9SA 2G8IA 4CHYA 4IKFA 3RRGA 5J2PA 4PI2A 3A2FA 4F6RA 1NJXA 2KFZA 1IO2A 1SA0B 1YVUA 3RR7A 4B3MB 4FFBB 1RTJA 2BDPA 3V9WA 5KGWA 3RRHA 4DTPA 3AVJA 5CA0A 3VQDA 1UAXA 1KRPA 3N2GA 1G15A 1TK0A 1VSDA 2O4IA 1A5WA 1ASWA 1WAJA 1HPZA 4LNUB 4Y1CA 2HHHB 1BHLA 3OYIA 4OVLA 3HXMA 3RFRA 3QG5A 3SV4A 4QAGA 1TKXA 4Y1DA 4M3TA 4LF8B 3TI0A 1SUQA 2LSNA 4JI8B 3EZ5A 5LP6B 4FK2A 3NGZA 4O0JA 4JRPA 4D7TA 4RW4A 1FKOA 4KKOA 3QNNA 1H2SB 4KFBA 3ZCMA 3QESA 5JJNB 4DR6B 3HVTA 4OKJA 1VRUA 1TVKA 4KTQA 4FFBA 2G8FA 3O3GA 2P1JA 4ID5A 1VSMA 3N2KB 4LH7A 3AV9A 4HVJA 1N5YA 5FROA 5FRNA 4LNUA 2DFFA 4HNAB 4CK1A 1BL3A 4AH9A 4HTUA 1WPBA 3OS0A 1JLAA 1REVA 4DUZB 4ELVA 2DFHA 3HK2A 3O3HA 5JH7A 4DTRA 1TVRA 1RT5A 3TANA 1RBVA 1XWLA 3SCXA 1IG9A 1HMVA 1JXBA 3SJAC 4DTXA 3HPOA 4JI6B 4K8XA 3DLGA 4RW9A 4BDZA 3OYBA 1BCOA 1U4BA 3MXIA 3I8DA 4KHSA 3AVBA 4B3OA 4AHCA 5CYMA 3PY8A 1VSIA 4B9LA 3OTFA 4DSKA 4FLWA 2YIAA 4DS4A 3TAQA 3RYHA 2FBXA 4PWDA 1EP4A 3QO9A 1IKVA 4HNAA 3HKDB 4EP5A 4LR3A 3SI6A 2ZNIA 3D0PA 2FC0A 4CC5A 3QF7A 4FZZA 1IKYA 4RW6A 4K8ZA 4CIGA 4JI5B 1L3SA 3AA3A 4DF4A 1EKEA 3K5MA 4KO0A 4DMNA 4I9LA 4BACA 4DLGA 2YKMA 3I0SA 2UUBB 4CJFA 4LF4B 2R7YA 2JVDA 4IG0A 5HBMA 2R70A 3RR8A 4PY5A 3VN5A 2ZM6B 4J2DA 1QSSA 4ZTJA 1CZ9A 4LH4A 4W5OA 2HEPA 3L3VA 3CFOA 4CF1A 5HRPA 4BWMA 4AILC 3WNHA 4DG1A 3WB1A 4BE1A 1J5OA 2DTUA 1HYZA 4LFBB 1RBTA 2ZE2A 3AO3A 4B8CA 1FJGB 1RNHA 4FK4A 3RMDA 2BANA 3VQ9A 1WSIA 4GVMA 3SJCC 3LP0A 4LSNA 2GBZA 4OPJA 1VK0A 2DFEA 3L8BA 1VSLA 3CM6A 1L8DA 2HNYA 4KI6A 2HHXA 1R0AA 1RBSA 1C1BA 3KK2A 1D8YA 1FFXB 4W5QA 2HMIA 3QLHA 4CEAA 3BPZA 4CEZA 2E4LA 4B8AB 1S5JA 4CERA 4CJUA 2GUIA 3QEVA 5IYZB 3EY1A 4N41A 3OYEA 2F95B 2E3CA 4FJ7A 3SJJA 1T8EA 4I2QA 1JMKC 3JASB 3HKEB 4J2BA 3DOKA 1TK8A 2Q0AA 3HVRA 5J2TB 4JLHA 4HCBA 4CEQA 3ZSVA 3BHPA 4CHOA 2KZZA 3E01A 1B04A 5KTQA 5C24A 1HQUA 5IJ9A 5KMGB 4CEFA 3VQEA 1HNWB 1C0TA 2HHTA 4DV2B 1XHZA 4CJLA 2R72A 3PO4A 4OJRA 1GOCA 4C8NA 4OKKA 4E7HA 2IOCA 1HNVA 3LANA 3JALB 4EB6B 3SQ4A 4JV5B 4KB0A 4X1IB 5HLFA 4FJNA 4ICLA 4ZHRA 5IYZA 5LXTB 1JL1A 1KFSA 4KREA 4KHPB 2JLEA 4JI2B 4CGIA 4FLTA 4E89A 4DS5A 4IFVA 4BDPA 4TQFA 1VSHA 4F8RA 4X1YB 3KLIA 3PV8A 5J2TA 4WBNB 2BTOA 3LP2A 4KI4A 4ZHQB 1ASVA 1HNXB 1L3UA 4C8LA 4JI0B 3IG1A 4ZI7A 2XY8A 3KKSA 1KVBA 4CC6A 1SKVA 2Z1IA 3AVIA 2RN2A 5FDLA 1YT3A 3CM5A 3KTQA 1I39A 3UT5A 1SV5A 3JALA 2IDOA 4BE0A 4FJ5A 1T7PA 5BMVB 4DR1B 3LZIA 1TA8A 1UA1A 4Z4HA 4DTNA 1XI1A 2VG6A 3KLHA 2HB5A 3PO5A 4TV8B 3CFRA 4QOZB 4DSJA 1VSFA 3QEPA 5LMNB 2OZMA 4O2AB 1HNZB 4X1YA 3DLHA 1HJRA 4O4HB 3OYLA 1NJZA 3AA2A 4Z4CA 1N36B 3OVNA 3LNNA 4Z0UA 2I5JA 4M3RA 1Q9XA 3PN1A 4LY7A 1Z5VA 2IAJA 4GKKB 2D0BA 3B6OA 3QIPA 4OLAA 3K57A 5KGXA 4GYCB 4CCHA 3ZSWA 5J2QA 3V6DA 3DLBA 4O4JA 5SWMA 1T03A 5FPOA 4F6RB 5BMVA 3OYAA 3E22B 1KVCA 4I55B 3RYFA 3OYCA 2HNDA 1RCHA 4M41A 1RDBA 1SKWA 1SL1A 4TV8A 1BQNA 3N2GB 3LDSA 2GV9A 4CFCA 3OS1A 2YNHA 3SZ2A 3NH0A 2O4GA 3HP6A 4CJWA 4W5TA 3BDPA 1KFDA 3HP9A 3T1YB 1MU2A 1LWFA 1WNSA 4CFAA 4YJ3B 1JFFA 2X6NA 5CZ1A 4O4HA 3DM2A 4N5SA 3ALYA 2YNGA 3NBPA 4M3XA 4CH4A 2B5JA 4LD0A 2OYQA 4CS2A 4GKJB 4TSXA 3ZT3A 4FJGA 1NOZA 2YV0X 5HRRA 3CFPA 1HNIA 4B08A 3E22A 5ITZB 4B3RB 4F2RA 1SL0A 5LA6A 4I55A 4JS4A 2UUCB 4YNQA 1TVKB 1RILA 5DK5A 4KHWA 4Q0BA 1I94B 2PYLA 4H4MA 3CB2A 3RTVA 4C8KA 4OGCA 3LPTA 1BCMA 3WNEA 5HROA 3T3FA 3TAPA 3LPUA 3C94A 1RT3A 5EZYB 5D3GA 3OYMA 2ZINA 1F21A 3VA3A 4YJ3A 2PTMA 1LW0A 4I4TB 3OTOB 1I7FA 1ZBFA 5C25A 1XHXA 3BGRA 1NJWA 3K2PA 5JH7B 4DU4A 1L3VA 1DTQA 1RSOA 5K14A 1SKRA 4DUYB 2E6MA 3ETQA 2QXFA 3V1RA 4O4IA 3SV3A 4FM0A 3U10A 4M42A 5C8YA 4FLVA 3SUNA 5KRTA 3VQYA 2KZMA 5ITZA 4CHZA 3DRRA 4FM1A 4PUOA 1U47A 2RQ6A 1FKPA 3MXJA 3NF8A 1HYVA 4NVPA 1Q3EA 3K5NA 2HHWA 3V1OA 2VG5A 2JS5A 1NK9A 3NAEA 3RYHB 4FJIA 2QK9A 3P5JA 5EZYA 4CH5A 1ZBHA 3TARA 3KJVA 4J2EA 3DLKA 3MEGA 4I50A 4LFAB 1HYSA 4N76A 4UQGA 1TUBA 4XIUA 4I4TA 4Q5VA 2ZIOA 1P49A 2AJQA 1WSJA 4OGEA 1DGSA 4NCBA 3OYHA 3VQ8A 1QHTA 3OS2A 4HUEA 4PQUA 5GONB 3VQQA 4J2AA 1TAUA 3BA8A 1TL3A 1RDAA 3CQ8A 4IDKA 2E5LB 1JXEA 3L2VA 3BAAA 4CEBA 2VQEB 5K1XA 2F1MA 1WLJA 3IS9A 1ZYQA 4E3SA 5I3UA 4CH3A 4F4KA 5JQGA 3IRXA 4UCTA 4X64B 4IG3A 1BIZA 1RT1A 3B6PA 4YFUA 5EIBC 4ZIBA 1XMOB 1B9DA 2HNZA 3O4NA 2VWKA 3DI6A 4KB1A 2NUBA 5JJJB 1TAQA 5FRMA 3BABA 1A5VA 1UWBA 4CJEA 3VQPA 4KTWA 3MXMA 2G8KA 3KK3A 3O4QA 1BISA 3M8RA 2VWJA 3KD1E 3DRPA 1S1XA 4CHPA 3AVNA 2YIBD 1QQCA 3AO4A 5GONA 1GOBA 1J53A 2B4JA 2YNFA 3PX0A 2YI8A 5D5PA 3V4IA 4O5BA 4DQIA 3FFQA 1Q5OA 4YHHB 4JI7B 3DLRA 4WE1A 4CF9A 4DSFA 4O4GA 3WNGA 3NH2A 4FJLA 4FJHA 4NCAA 3ZSRA 3SGIA 4MFBA 3RMCA 5CB4B 2EX3A 4KAZA 2KKWA 1NOYA 4CGHA 1D9FA 4Z4IA 1KLMA 1W0HA 3AVHA 3LWLA 2R9AA 1XMQB 4KHNA 2G8UA 3SUQA 4OPKA 3V9XA </