2PYJA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
567
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTA(DOC)-3'
total genus 173
structure length 567
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pyjA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pyjA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pyjA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pyjA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pyjA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pyjA06
4CK2A 4Z4HA 4DTPA 2BGGA 3KD1E 1CLQA 3B6OA 2LSNA 4M45A 2KQ2A 4E3SA 4B8AB 2X78A 4E7HA 2NUBA 1JXEA 4CIEA 3KJVA 1RTHA 3F73A 2Y1IA 1HYVA 1IKXA 2PZSA 4FW1A 4DU3A 4B3OA 3K2PA 3RMCA 3AVNA 4CF9A 1LAVA 2OYQA 2IOCA 4AHUA 4W5OA 3QETA 1HQEA 1S5JA 3K57A 1TKDA 3KLIA 1NKCA 1RBTA 4Q0BA 4I2QA 4KPYA 3D0PA 3HO1A 4KKOA 3OJSA 1BQMA 5HBMA 1Q8IA 3U6FA 3KTQA 3V81A 1ASVA 3OYLA 1RT2A 3DOLA 4IKFA 2F8SA 4CK1A 3V9UA 1JLBA 4UQGA 2R7FA 3ZT0A 4DFKA 1L3SA 3D45A 3CFOA 1EKEA 3H08A 3ITHA 4RW8A 4DF4A 4DF8A 1BL3A 4AHTA 2HHWA 4B9LA 4ELUA 5SWMA 3L8BA 1XI1A 3AV9A 3DYAA 1XC9A 5E41A 4CHYA 1QSLA 3SPYA 1LW0A 2EHGA 3VQ9A 1YVUA 5D3GA 3AO2A 3ZSVA 3IG1A 4Z0UA 4FJXA 2DFHA 3I0RA 3C94A 5CZ2A 4M3RA 4B9NA 1BCMA 4FW2A 4IFVA 3KIOA 1EP4A 1JLAA 1BI4B 4ELVA 4CHQA 4O55A 3OY9A 4K8XA 4BDYA 1U47A 2OPQA 4CEEA 4EP4A 3HP9A 3KK3A 4KB1A 2OPRA 4DTOA 1JL1A 1R0AA 4M3WA 1RT7A 1RDCA 4BE2A 4KTQA 2KFNA 4ID5A 4KHQA 2Q3SA 3K5MA 3QNNA 2PY5A 1DTQA 1HQUA 3NE6A 3K5LA 4KHYA 1RBUA 5FRNA 4KO0A 3TAFA 1HYZA 1RNHA 4N47A 4EP5A 3LPUA 2RN2A 3AVGA 4OKJA 2YHAA 4RW6A 3VQ8A 3ULDA 3TABA 3RRGA 1IKWA 4OLBA 2D5RA 4LY7A 2QK9A 4DQQA 1U49A 1VK0A 2EX3A 2B4JA 3WNHA 3V9XA 2DFFA 4Z4CA 1BGXT 3CG7A 4IBNA 1RT3A 4O0IA 4J2EA 1RDDA 3OVNA 4HUGA 4KHSA 1UA0A 1A5WA 4DTSA 1SKRA 3P83D 4I9QA 3VQBA 4ELTA 3NCIA 4I2PA 3I0SA 1C0UA 4NCBA 1NJWA 1S1VA 3JYTA 5DMRA 4B9TA 3RR8A 3TAMA 1VSDA 1U4BA 4IDKA 1IG9A 1NK5A 4TSXA 4C8MA 3LPTA 4FM0A 2KFZA 4CJLA 1GOBA 2ETJA 4G1QA 1TAQA 2P51A 1TK5A 3SI6A 3TAEA 1NK6A 3HJFA 1VSHA 2X6SA 4BWJA 4N56A 4Z4EA 4OGCA 4J2DA 1NJZA 4FJ9A 4H4MA 4NYFA 4CGDA 3V9SA 2HHQA 1Q9YA 5EU7A 2HHXA 4JS4A 5HP1A 1C1AA 4CFAA 3NGZA 1VSKA 3VA0A 1L3TA 4KHWA 2YKMA 3ALYA 1B9DA 3NFAA 1RBSA 5K14A 1VRTA 3U3GA 4FZXC 4FZZA 3ZSRA 4OGEA 3EZ5A 4RW4A 1JXBA 4KREA 4ZTJA 5DK5A 3MAQA 4M41A 4Q5VA 2RKIA 3PX6A 3V1OA 3OYCA 2Y1JA 2BE2A 1J9AA 4J2AA 3HP6A 3RTVA 1QSYA 3OYIA 1KFDA 2E6MA 5JS2A 1YT3A 4Y1DA 3OJUA 4HUEA 4FVMA 3SJJA 3OYJA 5I42A 4HTUA 4DQPA 2E6LA 4F8RA 1BHLA 4DTRA 1QS4A 4K8ZA 4B9VA 4DS5A 3AVBA 3VQCA 4Z4FA 3HT3A 1T7PA 1S1WA 3QESA 5J1EA 1VSJA 2YNHA 3C95A 3FFIA 2Z1JA 2HMIA 3AO5A 4E7IA 3MECA 1KLNA 2G8VA 4FJ5A 4FLZA 1S9EA 4NYNA 4AHRA 2GV9A 3CM5A 3NF6A 3VQPA 4CCHA 4F2RA 4CHPA 3L2QA 5HLFA 1NKEA 4CGGA 3OYMA 3ZT4A 1HNIA 3PX0A 1NKBA 3QEVA 1QSSA 3O4QA 4PWDA 4CFDA 2P1JA 1RDAA 1REVA 1JLEA 5KGWA 3DMJA 2FBTA 4FLVA 4CGJA 1ASUA 3L2WA 5HROA 2AJQA 3AVLA 1QE1A 3VQEA 4LH4A 3NAEA 3NF8A 3LWLA 3RR7A 3DLEA 4EZ6A 4NCGA 4E7KA 4AHVA 2YNGA 4DU4A 4PY5A 4E19A 4DQIA 1KTQA 2IC3A 1U04A 3CQ8A 1Y97A 1A5VA 4F4KA 3LAKA 4CJPA 1TKTA 3V9ZA 2P5GA 1KVAA 4YFUA 4EZ9A 3EYZA 1S1XA 1HRHA 4AHCA 2BANA 3SV4A 1GOAA 1DLOA 1RT6A 3F9KA 3AVJA 3HSTB 3O4NA 4CF2A 4CHNA 3KLGA 3LDSA 3LALA 3NGYA 3AA4A 4IG3A 1KCFA 1X9SA 4M3ZA 3HM9A 4N41A 3M8PA 4HUFA 1TV6A 4DTUA 4FJGA 4FJ7A 3OYBA 3HPGA 1JLFA 4FLTA 3ASMA 3OYHA 4CEOA 1GOCA 3HK2A 3V4IA 4CFCA 4LSNA 1SL2A 4DTNA 3LWMA 3VA3A 4CJWA 4CEAA 5HRSA 4CJUA 3DRRA 4FLYA 3NHGA 4E7JA 2IDOA 4CFBA 2YNFA 3O3GA 3TAGA 1X9MA 4OPKA 1X1PA 2HB5A 1QQCA 1YTAA 2YNIA 2IS3A 3L3VA 3S3NA 1S6QA 4DTJA 2ATQA 4OKKA 3OS2A 3RMDA 1NK8A 1LV5A 1LWFA 3I8DA 4QCLA 1HYSA 3OYNA 2KZZA 2F96A 3QERA 1WSFA 4MQ3A 2GUIA 2DY4A 4CF1A 5C25A 2R7YA 4GVMA 3K58A 4PQUA 4PUOA 3QEIA 1X9WA 4FJMA 3A2FA 4KI6A 1F21A 2OPPA 2YV0X 4DSLA 1RCHA 4BDPA 5KGXA 4DG1A 1BQNA 4HHTA 1FXXA 1SUQA 2JLEA 3NH2A 4E0DA 3VQ5A 3PY8A 3PO4A 3AO1A 3ZT3A 2ZD1A 3SQ2A 1YTUA 3DLGA 3KLFA 1UOCA 3RWUA 3MEDA 3ZSZA 4DLEA 3QNOA 4KAZA 4PA1A 3VN5A 4DSKA 2HHVA 1T03A 1XHZA 2JGUA 3VQQA 3NDKA 1NJXA 4CGHA 1C1CA 3AA2A 1WSHA 1D9FA 4AILC 1A5XA 2F8TA 1UAXA 2OPSA 1TKXA 4ICLA 1NJYA 4FJHA 3TAQA 5HRNA 4XIUA 3V1RA 1C0MA 3AVKA 3OS1A 1JLQA 2HHTA 1BISA 4C8NA 3S3OA 1TKZA 3PX4A 2O4GA 5KRSA 2FBXA 3LZIA 4CJEA 3O3FA 1W0HA 4M42A 3WNGA 3UIQA 3DI6A 3CFPA 1VSIA 4I9LA 4OKEA 4YNQA 4CEDA 1C6VA 2XY6A 1WAFA 4W5TA 3L2UA 1D9DA 3BDPA 4H4OA 3S9HA 4M3TA 3HPOA 1ZBFA 3QIOA 4LH5A 3OYEA 1HMVA 1L3VA 4HCBA 1RT1A 3QEWA 3NH0A 4W5RA 2D0AA 2PW9A 1ZBUA 4FLXA 3AVCA 3OYAA 1Z25A 2RPIA 4KTWA 3V6DA 3K5OA 5SZTA 4IFYA 3SV3A 3K59A 2D0CA 1WSEA 3P1GA 3G0ZA 5CZ1A 3VQ4A 3OYDA 2FC0A 2BDPA 1U48A 1QHTA 3KK1A 1IKYA 3L3UA 4CIGA 1IO2A 1S1UA 4DLGA 4OPJA 3HPHA 1K6YA 2W42A 4CJVA 1LAWA 3AO3A 3KKSA 3LAMA 1ZBLA 3IAYA 3QO9A 3QEPA 3P5JA 3HXMA 4KTZA 2KW4A 2OZMA 3ZT2A 4CERA 4BACA 2ITGA 3M8QA 3TWHA 4ID1A 1D5AA 2XY5A 3L2VA 3TARA 1ZYQA 2VG7A 4KI4A 1ITGA 5FDLA 3SYZA 4RW7A 1CXUA 4O5BA 4Y1CA 3BGRA 1UA1A 4OVLA 1ASWA 4DQSA 1NK4A 3SQ1A 1RT4A 5HRRA 5JS1A 4KRFA 1XWLA 4KHUA 2PYJA 3VQAA 2VWJA 1HJRA 5KRTA 5KTQA 4KFBA 3RMBA 3SUPA 3T19A 1KSPA 4DFPA 3NF9A 3AVFA 4B08A 4RG8A 3ZSYA 3ZSQA 3KLHA 1T05A 2VWKA 3FI7A 2Z1HA 4E1NA 4O44A 3OS0A 3T1AA 4KB0A 1EXQA 5FROA 3ZCMA 1FK9A 3IRXA 1L3UA 3AO4A 3DRSA 5CYMA 4DQRA 5HRPA 5CYQA 1VSFA 4AH9A 4DMNA 3CFRA 1TL3A 2XO7A 2XRIA 2A1RA 2ZQBA 5J2NA 1NOYA 1JKHA 4H8KA 4CE9A 1LW2A 1UWBA 3C6UA 4FLUA 4CJFA 3QINA 1U45A 1BIUA 1C0TA 3AA3A 1N5YA 4DSIA 4DSJA 4CJKA 1EX4A 5C42A 3T3FA 1S9GA 3LANA 4CEFA 1KVCA 1WSIA 1KRPA 2O4IA 4DTXA 2OA8A 3LP2A 1S1TA 4CK3A 2G8WA 2G8HA 4MFBA 1JLGA 1VRUA 4M3YA 3WNEA 2RF2A 2X6NA 4BWMA 1BI4A 2G8KA 2QKKA 2YHBA 1WAJA 4F2SA 1KLMA 3SUOA 1RDBA 3C6TA 3MXIA 3AVAA 1NK9A 4M3XA 1Q9XA 4BDZA 1NOZA 4OLAA 4FM2A 3E01A 1TVRA 4FZYA 3DLHA 2X74A 3NBPA 1J54A 4NCAA 1IH7A 3NH1A 2OZSA 3M8RA 2G8UA 3CYMA 2HNDA 1QTMA 2DFEA 3ZSWA 4CHZA 3VQ6A 2YKNA 1NK7A 4B9UA 2QXFA 4KV8A 1C1BA 1SKWA 4C8KA 3THVA 3DM2A 4HVJA 1B92A 2G8IA 1JLCA 4DSEA 2IAJA 3MEGA 4CGFA 4CF8A 1N6QA 4FK2A 1B9FA 1FKPA 3ISNC 4N5SA 4LD0A 3SUQA 4O0JA 1CZBA 1WSGA 5CY4A 4CEBA 1J5OA 1HNVA 4FXDA 4Z4IA 3LP1A 3CM6A 3VQ7A 2P5OA 1D8YA 3SZ2A 3DOKA 4R5PA 2DTUA 1VSEA 1RT5A 1ZBHA 3U3YA 4CJ4A 3NGIA 4CJTA 4FM1A 3TAPA 2G8FA 4JRPA 4E1MA 3ZT1A 4DU1A 1L5UA 1J53A 4J2BA 3S3MA 1TL1A 4QAGA 4CIFA 4L8RB 4FYDA 4CJSA 1Z26A 4E89A 4C8OA 4ZTFA 1SV5A 4CJRA 4DTMA 2XY8A 3DLBA 1IKVA 2HHSA 4FJNA 1FKOA 3RMAA 2HVHA 1JL2A 4ZHRA 4DS4A 2KZMA 4CJQA 3RRHA 4B9MA 4WE1A 2PYLA 1VSLA 3HVRA 3SCXA 1KVBA 1T8EA 2I5JA 1S6PA 3G10A 3ZSOA 4GW6A 3HYFA 3OYGA 4JS5A 2QKBA 3ZSXA 3OYFA 1LWEA 3MXJA 3SNNA 4RW9A 3KK2A 3KKRA 4AHSA 2HNYA 1WNSA 4M3UA 4CJ5A 1TK8A 1XHXA 4FJJA 4KHNA 3O3HA 1BCOA 3L2RA 1G15A 4BE0A 3KD5E 3TI0A 4OJRA 4CGIA 1WLJA 3DLRA 4DSFA 1SL0A 3PO5A 4C8LA 4FJIA 1DTTA 2VG6A 3QEXA 4DFMA 4N76A 4I7FA 3VQDA 5T7BA 4O4GA 4CEQA 3SUNA 1TAUA 3NF7A 4CEZA 4IG0A 4FK4A 1SKSA 2WONA 3JSMA 4CESA 4FJ8A 1KFSA 1I39A 2WOMA 3EY1A 4CJ3A 4W5QA 1RBRA 2XY7A 2A1SA 1RTDA 4B9SA 1RBVA 4FJLA 5J2PA 1W9HA 3DRPA 2HHUA 4FLWA 3LP0A 4JLHA 1SL1A 2IGIA 1VSMA 3AVMA 1RTJA 1WSJA 3IS9A 3MEEA 1CZ9A 1RILA 3QIPA 2XHBA 4FCYA 2Z1IA 1MU2A 3HVTA 5C24A 4FJKA 5J2QA 4GMJB 3WNFA 2HNZA 2ZE2A 3TR8A 2B6AA 4DWIA 2GBZA 2VG5A 4B8CA 3K5NA 3QLHA 4JRQA 3V1QA 3V9WA 4F3OA 4W5NA 4FK0A 3AA5X 4HCCA 4BE1A 4F3TA 1HPZA 2HVIA 5KI6A 3KLEA 3LP3A 5I3UA 3HL8A 1CXQA 3M8SA 4E7LA 4CF0A 1WN7A 4QOZB 3TANA 3OYKA 3SQ4A 1I3AA 3MXMA 1TK0A 1ZBIA 5FRMA 1O1WA 3PV8A 1NK0A 2KTQA 5J2MA 2B5JA 2HW3A 1EETA 1TGOA 3AVHA 4LSLA 2D0BA 3LZJA 4CHOA 3SQ0A 4CECA 2FBYA 4Z4GA 4DFJA 2FBVA 3SPZA 3AVIA 3DLKA 1BIZA 3PUFA 2E4LA 2Z1GA 1LWCA 3B6PA 1RTIA
chains in the Genus database with same CATH superfamily
1EN6A 4DTPA 2VS0A 5KX5A 1VQON 1CLQA 4M45A 3BHPA 1WLEA 1E1RG 3PN1A 4LF4O 1XNQO 3HR0A 2KQ2A 2LSNA 3L0QA 2CK3G 2X78A 2WLLB 5EC2C 1JXEA 1RTHA 5CA0B 1KUQA 3JYCA 1HYVA 1IKXA 2Y1IA 2PZSA 1XOUA 1HW7A 3RSEA 3C6AA 4AQYB 1OVYA 4BVPA 1PNMA 3AVNA 4CF9A 3VRAA 4YOWA 1YDXA 2ZINA 3W7SA 2NLJC 2VQEO 5LMNB 1S5JA 3KKYA 3KLIA 1N32K 5DEDA 3MN6A 4I2QA 4G9ZA 5AQHA 5H1SQ 2WUSA 2P4KA 3CCEV 4E1JA 3U6FA 1SQBH 2ITCC 3OYLA 5D5QA 2ZNIA 1RT2A 3DOLA 5F1XA 3T1HB 4CK1A 1MQTD 3M6GA 1JLBA 4I50A 2P4VA 2GEMA 3LDDA 5E1AC 1SERA 2NR5A 2UUCK 2RS54 2B76A 3ZT0A 1IXMA 1L3SA 1R3JC 4PV1B 4TUYB 1EKEA 2ZGYA 5BZBA 3D45A 4RW8A 4DV3K 4DF4A 2V1DA 4CS2A 3OD4A 5CBFA 3SFDA 3APQA 4LF9O 1WPBA 3B8MA 5AQKA 4ELUA 3UT5B 3L8BA 4ZOLB 3DYAA 2EZPA 4NVPA 3I33A 3AE9A 4UV9A 3E35A 4CHYA 1O9GA 4A61A 5JMVA 3SPYA 1QSLA 1LW0A 4JZGA 2CGOA 1YVUA 3VQ9A 3THOA 1NU1H 3J7AP 1EBOA 1ZL8B 1VIBA 3AGRA 3C94A 5CZ2A 4B9NA 3OMNB 1JFFA 4FW2A 3QFPA 3G4SV 1EP4A 2OANA 4IFVA 3RVCA 4O55A 1V4TA 1FFXB 2OPQA 4EP4A 2QM1A 2OPRA 3W0LA 1JL1A 3MHHC 3P4IA 4DTOA 3JAWB 1JJ2M 3CCRN 3QO7A 4EHUA 3VEZA 1DKGD 1RT7A 1TUBA 4BE2A 4KTQA 2KFNA 3L4QA 4X1YB 3AE8A 3QNNA 1DTQA 4G2KA 1OH7A 5FRNA 5AZIB 2QI2A 3TAFA 1HYZA 4N47A 3CCLN 5JCOC 1B3QA 2UUBB 4RW6A 5AQFA 1YJWN 3KWIA 3ZMUA 3ULDA 3D2FA 3RRGA 2QK9A 4X88A 4LY7A 4HAMA 2EX3A 3ATVA 1AR94 4LF7B 4LFCK 3CG7A 1NH2B 3BRCA 5KAFZ 4B3MO 4UCRA 4P30A 2ARHA 3AG7A 4L87A 4WCEV 3EZWA 1SKRA 3P83D 4I9QA 1SS6A 5BR8K 2F23A 4DR5K 5JLFA 1SC5B 1C0UA 1XMQO 4TQFA 4NO7A 1YIJN 2H89A 4B9TA 3RR8A 1VSDA 3F5TA 3FZLA 2DQ0A 2EIJB 1IG9A 5AJ3K 2KQXA 2Q9LA 3AG2C 5KHGA 3EKUA 4H37A 4GKKO 4LFAO 3J7YP 3QBWA 4H5RA 2X6SA 4BR4A 4N56A 2WP9A 3LSQA 3DLLL 1NJZA 4H4MA 2CE4A 5JVDB 1Q81O 3V9SA 2HHQA 4J7JA 2HHXA 4JS4A 4DR2K 5HP1A 2DYRC 3JD1A 1YJNN 3A5MC 3MN9A 1RUG4 1JMKC 1D4M4 1RBSA 2CTPA 1VRTA 5MLCQ 3JD0A 4DUZO 2W0XA 4ZI7B 1D5NA 2E88A 4JKFA 4OGEA 3EZ5A 4RW4A 4GKJK 3FD9A 2NNWA 4KREA 4M41A 2R70A 1J9AA 1HJOA 4CI6A 3JASA 2E6MA 5JS2A 5BR9A 4JYAB 2F93B 1IDSA 5E84A 1Q3EA 1FJGO 3OYJA 4HTUA 2Q5ZA 5FNVB 1DLBA 1G8MA 2QKCA 3VQYA 3M3ZA 4JI1K 4Q20A 2UXBB 3VQCA 4KH4A 4WFNL 1T7PA 1S1WA 2WBNA 2JK5C 2PUSA 4U3JA 3QESA 3JARB 4MW8A 4JYAO 3LDNA 1VHXA 3C95A 4BG9A 1EZVH 2A7WA 3MECA 4FJ5A 3J80N 4NTYA 5EOYA 4KP4A 3CCVV 3BF3A 1JR9A 3IMXA 4CHPA 2YSUB 5EBMC 3ZT4A 3S41A 4NXNK 1KKCA 1NGCA 2R72A 1T5EA 3SJQC 1SZTA 1VQ4V 3UM7A 2A9HA 2B1IA 1REVA 4DRXA 5KGWA 3L2WA 2CGKA 2YIBA 3ABMC 1QE1A 3VQEA 3THXA 1TVKA 3NF8A 1N34K 1TUUA 3E8GA 4NCGA 1KKDA 1NR1A 4E7KA 1VQPV 4XH1A 5EY4A 4DU4A 4PY5A 3P3PA 3LM2A 3DXRA 1VF5B 1IBKB 5E79Z 1US6A 1U04A 2BCCH 1JCFA 4MSWC 4CJPA 2XAHA 1TKTA 4YFUA 2D2CB 3JD3A 1XUQA 3JD74 1WP8A 3W7UA 4AHCA 3ENOA 1DLOA 3F9KA 3AVJA 3KLGA 2A0LA 1KYOF 3LALA 4LF5K 1X4TA 1X9SA 4M3ZA 5CE3A 1HXS4 1NVPB 5IWAK 4N41A 3C90A 4DV6O 2PI5A 3OYBA 4FLTA 3OYHA 4ABMA 1GOCA 2I7NA 2ILMA 4RWUA 1P7BA 3T4DA 5L3BA 4JI0B 3W7TA 1GLEG 4IDHA 4DTNA 4LF9K 4CEAA 4UCOA 3G80A 5HRSA 4CBWA 4JPRA 4E7JA 5KUMA 4OPKA 1X1PA 2HB5A 1QQCA 1YTAA 3TSUA 1S6QA 3FB6C 4OKKA 2EBOA 2IU0A 1K8KA 2V51B 4GX2A 2ZIMA 1OCOC 3CRQA 4TV8A 3D2EB 2K9PA 2F96A 3RW0A 4RHV4 1HKGA 5C15A 2ASMA 5IJ9A 1VQ9V 4MQ3A 4GVEA 4X1KA 4CF1A 2R7YA 3JASB 3WG7B 2O8CB 3QEIA 3K03A 1WA8A 2Q1NA 1X9WA 3A2FA 3HTVA 5K1XA 2P9UB 5KGXA 3LDLA 1FXXA 4JI8O 2JLEA 4E0DA 2EIKB 1IBLO 1KQSM 3PY8A 5KPTA 4FZ1A 4YXDA 3VQXA 2ZD1A 2BOCC 2ZDIC 4UB6Z 3CXHF 3CCQV 1XMOO 1XILA 2E5LO 1NJXA 3IGAC 1MDUB 3CJ1A 4EFEA 4RO2A 4PDRA 5FNVA 5DM6V 1UAXA 2OPSA 1TKXA 4ICLA 1NJYA 3U0ZA 2J4RA 4FMTA 4ZKIA 5IDJA 2JJ2G 2EIMC 2YXYA 4X20A 1L0LH 4J11A 1HNWO 1PPJH 2P9SA 5GADP 1BISA 4KH5A 2HHTA 1SRYA 2QEXN 4B3TK 2DOSA 2R9RB 2FBXA 4BC2A 1HNZK 3WQUA 3O3FA 5J2TB 4TWKA 5AQUA 3VMFB 1W0HA 1YQ3A 2JRIA 2V52B 4OKEA 1C6VA 4JKAA 3O1BA 1VBE4 1WAZA 5TISZ 5LJVA 3BEXA 3BDPA 3S9HA 3OTFA 2V4DA 5J2TA 2WAMA 4IXCA 1Y67A 4W4KA 5LXTB 3O80A 5EVZA 3OYEA 4FWSA 5JVGL 2UU9K 3AARA 4HCBA 4DRXB 1EWQA 3QEWA 1FAFA 4O4JA 2PW9A 4GKJO 1Z25A 3CC7N 5SZTA 3K59A 4IO8A 1WSEA 1V4SA 3G0ZA 3VQ4A 3OYDA 2CGLA 4YSZA 3OHRA 1GMGA 3HRGA 1IKYA 2YS8A 4CIGA 4UVBA 1BT8A 2CTWA 1BOTO 4DLGA 3A8TA 1KD1W 5B1BC 2P9LB 4CJVA 5CBHA 2F7TA 4IYHA 1ATSA 4BR2A 1ZP0A 4QGPA 2AZ2A 3P5JA 1RMU4 2UYTA 2KTQA 5FLXN 3M8QA 3ENBA 3L2VA 3SYZA 4Y1CA 3BGRA 1UA1A 4DQSA 3J81O 3EFFK 1M90W 3I8BA 5JS1A 4KRFA 1VF6A 1KMIZ 2IBZH 3T2MA 1HJRA 4KFBA 1XNQB 2X7RB 3HKBB 1H1VA 1NBWA 4BR9A 2Y0PA 4DV2K 3SUPA 4MVOA 3O9QA 3AG3C 2VGMA 4RG8A 4MT8A 3ZSQA 1ATRA 2KSDA 2VWKA 3FI7A 2Z1HA 2ZKOA 4O44A 3M99B 1YJ9N 3QB0A 5B1AB 4PHZA 5ADXH 4JD2B 5FROA 3ZCMA 1V54C 4O5FA 1L3UA 4MO5A 3DRSA 4GKKK 2Q7HA 5CYQA 1VSFA 4JHDB 5HRPA 4LF8K 1BGYH 2ZR2A 2XO7A 1NENA 2ZQBA 3C7NA 1O13A 1NOYA 1JKHA 5AZJA 3M7MX 4H8KA 4CE9A 2ZE6A 4BAYA 4CJFA 3GBTA 2GBOA 3QINA 1C0TA 3AA3A 4YXWG 3AEGA 4DSIA 1KF6A 3LANA 4CEFA 4DCHA 2YXHA 1RP3B 2O4IA 3JAMN 2OA8A 4JI3B 1IV0A 4X62O 2P9NA 3CJBA 4TV9B 1JLGA 2H3GX 2WLKA 4H5TA 1VRUA 4M3YA 2RF2A 4NTXA 3CRCA 4DV3O 4JKBA 4U7NA 1VBB4 1QVFM 5BREA 1WAJA 4F2SA 5LP6C 3R66A 3DXKB 1NLVA 1RDBA 3MXIA 1NK9A 1FD9A 3TTCA 1Q9XA 1VBC4 1NOZA 1ZAUA 2XTAA 2KKZA 4OLAA 3OR6C 3X2QC 5HFLA 1TVRA 2HWC4 4NCAA 5CA3A 1J54A 5FLXO 3L70H 2OZSA 2G8UA 4BG8A 2DFEA 4U7BA 3VQ6A 4O4HB 4MDBA 2QXFA 3H1IH 1C1BA 5EBWC 4WBNA 1COV4 3H6EA 2P9KA 3G6BA 1JVMA 5LMUB 2G8IA 2IJIA 2IAJA 1N6QA 4CF8A 1Y74A 3SDLA 1B9FA 4I5SA 1U6ZA 4N5SA 4UY8O 1PP9H 4P9OA 5KA6A 2Q0OC 4O0JA 1WSGA 1D2DA 3J8AA 4Z4IA 1NGFA 1AL24 1D8YA 5FL7G 4E4EA 4OO1J 4R5PA 2WLIB 5FPNA 2R064 1SQFA 1RSOB 3AG3B 3LDCA 4FM1A 1YEWA 2R044 3J8F4 2CUGA 2E1ZA 1B06A 3K79A 5KPRA 3BABA 4L8RB 3UKUA 1YTFD 1Z6RA 1MOFA 1X9JA 4E89A 4C8OA 4PL7A 4X66B 3KG2A 1SA0A 2P06A 4FIPC 1RDWX 5L3FA 2JEXA 4NB4A 5HOOA 2HVHA 3HB3B 3SAGA 2PLV4 3RRHA 5IT9O 1P7GA 4YTNA 1JX9A 4B3TO 3ZX6A 1BL8A 2I5JA 4O4LA 1M57C 3G10A 3TTFA 3UKRB 3ZSOA 4BRDA 3MXJA 1Z5WA 2HLDG 2HVKC 2WLHA 5BPMA 3KK2A 3KKRA 3VEOA 1WNSA 4X65B 1XHXA 2PGGA 3DSQA 1R094 3OA9A 1BCOA 3QDKA 2HF3A 3KZIZ 3CB2A 1H2SB 3H1VX 4FJIA 3VERA 1DTTA 1IJJA 3NF7A 4FK4A 1SKSA 5CMUA 4JAAA 3CCSN 4FJLA 3SUCA 4LH6A 5KPZA 4WQ4C 4JHDA 1W9HA 4DV2B 4FOEA 1FFTB 1MZFA 3LP0A 4YOUA 1SL1A 1WSJA 1ZSPA 2FBWA 1DGSA 2HBMA 1RILA 3QIPA 2XHBA 3HKEB 4JV5O 4GMJB 4Z1MG 4DWIA 3I55V 4I7ZB 2VG5A 3OT7A 1BA1A 1BO5O 4X65O 4CZKA 5TKYA 3B2EE 2QWQB 3AY9A 4LFBK 4BIOA 1OCCB 4QJFB 1YF5L 1IBLK 2WSSG 4LFAB 2Q0RA 3HL8A 2N74A 4ZOLA 3WG7C 4QOZB 3BY6A 4JNEA 2W6IG 3SQ4A 1KP3A 3PV8A 5J2MA 1OCZB 1Y74B 3RYCB 3OUFA 2IJKA 3H1JH 3RVYA 4XEIA 3LZJA 3KHYA 4BRIA 3FLCO 2WWWA 3JAMO 4NXMK 3SYPA 3CHXA 2M7WA 4DFJA 3SPZA 1N0JA 1WJZA 3DLKA 4GY2B 1BIZA 2IJJA 3LDOA 3RYFA 2JEUA 1ZBSA 5JJEB 4FPAA 1GAXA 1XREA 3B6PA 1RTIA 4Z4HA 1XMOK 2GWKA 3KD1E 2E20A 3ID8A 4X1YA 5KUKA 3F73A 5GAEP 1B04A 2DYSC 4YHHB 3B40A 4DU3A 1FXKC 1J5EK 2Q73A 3RYIB 1IBMB 3O1WA 1X3MA 4MVUA 1K4DC 2QSAA 1GN6A 2OYQA 2IOCA 4W5OA 3QETA 2O8DA 3VQVA 4Q0BA 2FF6A 2NRHA 1NNEA 3AAPA 5BPNA 5EK0A 4KPYA 4XDLA 3SYAA 2FL4A 1EFRG 2Q68A 2PAVA 1OH8A 3KTQA 5C2TA 4KHPK 1ASVA 4QPKA 4PA7A 2JVDA 4EHTA 4IKFA 2F8SA 3V9UA 4UQGA 4X65K 1FXVA 5C8YA 1FS0G 1XNRB 2R7FA 4DFKA 4RAIA 3CJHA 3CS5A 2BOBC 3H08A 1F4NA 3CFOA 3GOIA 3OMIB 2GTAA 1K73W 1BL3A 2RN9A 4AQYK 3ASOB 4UFZA 4L8JA 5LMUK 1XI1A 3AV9A 3AG4C 4J9YB 3Q7CA 1AI4A 4TOIA 2AGAA 1NTMH 2BUPA 4W4LA 1NA1D 3AO2A 3JSNA 3AK1A 2BTQA 5FPDA 1YJ9V 2UXCO 1AJNA 4PI2A 3NR7A 4X8AA 3CIPA 2WLMA 5KHKA 1PD3A 3I0RA 1RUH4 1BCMA 4GX1A 4PA9A 4ELVA 2O8BA 3JAKB 2RM24 3APOA 4FFBB 4CEEA 5DM7L 3HP9A 5LOVA 2RS14 3G67A 5C2DA 3D6RA 1R0AA 4YOTA 2RHKA 4CZLA 2CAZC 4NLBA 2NRRA 1RDCA 3BUZB 3UB5A 2WTUA 2RJZA 1NJIO 4IHJA 1N36K 1XNRO 2XASA 3H1QA 1PKXA 5HL7L 2RR14 1BU6O 3K5MA 2YIDA 1XMQB 4DV7O 3GE1A 4GKJB 4EP5A 4J42A 4RWTA 1JJ2U 4PI0A 3O8MA 2HBKA 4PA3A 5LP6A 2FB5A 2HKOA 4D7SA 2CTQA 4LF4B 1IKWA 2E3CA 3BVOA 2ZXWC 4LF5B 2ZJQL 4DQQA 4GLXA 3ASNB 3WNHA 2YI8A 2DFFA 4Z4CA 1ENVA 1NGAA 4ILJA 2B5UA 2ZM6O 2JWLA 4O0IA 4J2EA 2RS34 1RDDA 1M9NA 1UA0A 4JYCA 1A5WA 2R9IA 4KHPB 4MTGA 4GKKB 1S1VA 1T6CA 3JYTA 5JLHA 1HR0O 3GQHA 1HNWB 2W40A 3TAMA 1EV14 4IDKA 2YUAA 5CA1B 4HNAA 1AROP 5AQTA 5GAHP 2JDIG 2PBDA 2G38A 2KFZA 1GOBA 2YIBD 3RYIA 3TAEA 3HJFA 1VQKN 4Z4EA 3QICA 2M6YA 4YORA 1YCIA 4FWQA 4J2DA 5JVDA 1JCHA 4O4HA 3MCPA 4NYFA 4CGDA 2QEXV 2DYRB 4KH6A 4JKHA 1SF9A 5EU7A 1Q9YA 1POV0 3C0BA 2OTLV 1MA9B 1H2GA 1Y64A 5FPRA 5KMGB 2VCPA 4CFAA 5GINA 1NKDA 2DWDC 2CGNA 3OGCC 4IO9L 1S22A 3CQYA 3NFAA 4YJ2B 2ITDC 5K14A 1H8TD 3MDQA 1HP8A 2QWRB 3ZSRA 5GIOA 4NXMB 5ITZB 1HNZO 3K9KA 3ZX2A 2E76B 3CPWM 1Y76A 4MTOA 4BRLA 3AEEA 5C0YA 4H44B 4J41A 4OX9B 2QM4A 2O8DB 3CQXA 4MVQA 3V1OA 3ZETB 1URFA 3UE5A 4J2AA 3HP6A 4JI5B 3RTVA 4HUEA 3HKEA 3MDSA 1YT3A 4Y1DA 2ZGZA 1XL6A 4FVMA 4JI3O 3ULEB 4C1NI 3SJJA 4JN4A 1Q82O 4K43A 4DQPA 2E6LA 4F8RA 2JGDA 5C10A 4DR1K 4H0XB 4K8ZA 2UUAB 3BFRA 4B9VA 2JS3A 3MWTA 3HT3A 3THXB 3H1KH 4EB6B 1RFQA 2VQEB 3RVZA 2UU9B 1VSJA 4WFAL 5IY5C 5IYZB 4GV6A 3ZN1A 2QDOA 1VQ9N 2HMIA 2H88A 5GAGP 2HR3A 5HFMA 4LFCB 1VQLV 4YOYA 4LF7K 5CBGA 1VQ8V 1S9EA 4AHRA 2GV9A 3CM5A 3NF6A 5HLFA 1NKEA 3E89A 1R59O 1RUD4 3QF7A 1Z5VA 4CGGA 3U8XA 1CEZA 1NKBA 4H03B 4JEPA 3K0GA 5CA0A 2CH7A 3B8AX 3E9OA 4PWDA 4J9ZB 2P1JA 1KFYA 3SMPA 3DMJA 5K1PA 3HKDB 4FLVA 2AJQA 5HROA 1RUC4 3AVLA 5LP6B 3NMUA 4XH5A 1AR1B 1TA8A 3RR7A 1KXPA 3LWLA 1R1BA 2ZXWB 3DXMB 4IJNA 2KG7B 3ZMZA 2OT5A 4MLHA 4AHVA 1F51A 2QKAA 1AILA 4E19A 3QFUA 2EILC 1KTQA 2IC3A 3AGKA 5LOVB 5A2QN 3CQ8A 2BSKA 4LF8O 1N32B 3IC9A 1A5VA 1QLNA 3TSPA 5ADXA 3UQ8A 4EZ9A 5EBLC 3EXAA 1PM9A 4LNUB 1NGGA 3SV4A 5AQNA 3LDSA 4OPHA 3CX5F 4HZ3A 5M1PA 3CE2A 3NGYA 2JJ1G 4KFMA 1KCFA 1YXBA 4O4IA 2P9SB 5DM6L 3J7AU 3SBTA 1TV6A 1VQPN 2HHHB 3HPGA 4B7KA 3ASMA 1OCRC 1N32O 1Q90D 2WU2A 2P9UA 3B8NA 4RUFA 2UXDB 2ZCEA 2Z5UA 4X1IA 4KBOA 3LWMA 3I5DA 3OUSA 2EJRA 2YI9A 4CJUA 3LNMB 4FLYA 3KK7A 3O3GA 1SQXH 2YNIA 3AE1A 4I9WA 1NM1A 2IS3A 1MNGA 1BWFO 3L3VA 3O9TA 3U9DA 1U2VA 3R9PA 3L73H 1N34O 1OH5A 1NGEA 5BMVB 3CCVN 1OHHG 4L3QA 4OXSA 2LP7A 1OKJA 3SLCA 4KL1A 1WSFA 4JI7K 1NR7A 2CDYA 3STLC 2GUIA 1RUI4 4R8CA 2CH7B 3O9OA 4FJMA 3W3DA 4DSLA 1RCHA 2GUZA 4X64O 3JD2A 1ESVA 3VEXA 3CCMN 1Z7S4 3VEYA 1HX1A 2O57A 1QLEC 3VQ5A 1ZWIC 3LDEA 3AO1A 3SQ2A 1VP7A 3T1CA 3DLGA 3KLFA 4YSXA 2GWJA 3ZSZA 3QNOA 2QWLA 1Q6IA 4JI1B 3LM9A 4PA1A 1CPYA 5AZIA 1T03A 4MVSA 3VQQA 1BG3A 4BRKA 2OTJV 1WSHA 4AILC 2YCHA 3OAAG 4JI5O 1V54B 4RQFA 4DQ8A 1A5XA 3C7NB 4Z94A 1H38A 3I56V 1N33O 2P9IA 3GL1A 1RM1C 3HM8A 2QWPB 1GLCG 5HRNA 4YOXA 1N8RO 4C8NA 1VMGA 2O4GA 5BN8A 1R3LC 2V7QG 4CJEA 4TV9A 4M42A 4DV0O 3A0BZ 3O65A 5AQIA 1W0KG 1VSIA 3WT0A 2WFBA 1KB9F 2XY6A 1PNKA 2Y48A 4H4OA 1LUWA 3QIOA 4CZGA 2QWQA 2B1GA 3O5BA 3H3OB 1HMVA 1E4GT 1YUWA 2EWSA 4W5RA 2D0AA 1JA8A 3L72H 1YIJV 1FFXA 2YJFA 3P31A 2RPIA 4KTWA 3BF1A 4F4LA 5CZ1A 3P32A 3CXCM 2BDPA 3G71N 4LF6O 1OV9A 1G99A 3IJ4A 1WUAA 2W42A 1YZBA 3MHSC 5BR8B 3AO3A 2ZD9A 2XAFA 2YHWA 1YJWV 5BRDA 3QEPA 1B6QA 1HKBA 3HZ6A 1RUE4 4TQDA 5LGTA 4MVMA 4CERA 3TWHA 1SAZA 4ID1A 1D5AA 3TARA 1ZYQA 4KI4A 2V7ZA 1G4YB 5GTIZ 1ITGA 5FDLA 3X2QB 2BTFA 4RW7A 1OOPD 3TETA 3VGLA 5LL6Z 4U3FH 5B5EZ 3ULEA 1NK4A 2WU5A 4PD4F 3CCRV 1XWLA 5BMVA 3ZN0A 4KHUA 2PYJA 3VQAA 3THYB 5GONB 2VWJA 4O4IB 1N4CA 4DV2O 3VTIA 1Y76B 2E2NA 5CN0A 4DV4K 3ZSYA 1RPRA 3KLHA 1SZ2A 4E1NA 3ML0A 4EIAA 3H1LH 4KB0A 2WS3A 4KX6A 2A6AA 3TXQA 3JXUA 3AO4A 5CYMA 1L0NH 4ISFA 5IY5B 3DC6A 4IT5A 5J2NA 3U10A 3BP8A 4DV5K 2A3QA 1LW2A 1UWBA 3C6UA 1I0HA 2LGWA 2XAJA 4CD3A 1BIUA 5JVHL 1N5YA 2HHHK 2YHYA 4V19S 3F9MA 4CJKA 1EX4A 3H46O 4DSJA 1OZ0A 3UCSC 3K06A 5C93A 3LL3A 4DTXA 3RYHB 5M1QA 2P9KB 4YY3B 2X6NA 4DUYO 1XQ8A 1GM9A 4PELA 4GB34 3JALB 2YHBA 3AE3A 5H6RA 4CC6A 4B3RB 1KLMA 2GTDA 3C6TA 4NLCA 3CF5L 4M3XA 4BDZA 4CD1A 4B3MB 2F9TA 3ENHA 4LC1A 3DAWA 2RE2A 5LMNK 2X74A 1QVFU 3NBPA 2H94A 1Q82W 4B3SO 3W7XA 1GLJO 4Y0WA 2HNDA 3VR9A 4K35A 5KHIA 3KWGA 1NU0A 4B9UA 4KV8A 3THVA 2HWB4 5B1OA 2E1YA 4HVJA 4C1NK 2GTSA 1B92A 3SK3A 4B3SB 4DSEA 5LL6Y 4LR3A 2Z3YA 3B4SA 4DR6B 2ZIOA 1FKPA 2ZF5O 2XAGA 2VYPA 3SUQA 2O8EB 1CZBA 3WB2A 1MA1A 3NVMA 3P39A 1HNVA 1J5OA 3ZLJA 3FAVA 2D0OA 3LP1A 1GLFO 2P5OA 3SZ2A 2DTUA 1JPXA 1ZBHA 1RT5A 2HG5C 3E86A 3NGIA 2G8FA 1PL0A 4O2BA 4BW9A 1GM7A 3T1YB 3EE8A 2FMLA 3ASNC 1L5UA 2OIEA 4ZIBA 1VBA4 1TL1A 4QAGA 4CIFA 2OIGA 5EIBC 4CJSA 4DV4B 4B3RK 4JI5K 1Q5OA 1IURA 1SV5A 4BC4A 4DTMA 4BIZA 1XDCA 1X3NA 1HNXO 3OBYA 5AQOA 4IWVA 3O9RA 4DS4A 2UU9O 1HRI4 3SPIA 1VSLA 5CB4B 3VF6A 4B9QA 2O8FA 1OCZC 3A0HZ 3D36C 1NJIW 1W7AA 2W0FC 3OYFA 1LWEA 3UKMA 3SNNA 1FYJA 5EXWA 4AHSA 3AG2B 2HNYA 4M3UA 3CMEN 3CXCU 1AB3A 4KHNA 4I0XB 2EZOA 3L2RA 3LDQA 3KD5E 1AR84 4OJRA 1WLJA 1XC3A 3SYQA 4C8LA 1HDJA 1J6ZA 3CCUN 3MMVA 1YHQV 5JJJB 4DFMA 4I7FA 3VQDA 3WXIA 4N76A 4CEQA 1I08A 3VGKA 2Y4TA 4IG0A 3LNNA 4AM6A 3AG4B 4QE9A 2UXCK 2WONA 4WFFA 4FPPA 3WEEA 1HWYA 2EILB 2W6KA 4CESA 4CZJA 4CJ3A 5BRFA 3EY1A 2XY7A 3AEFA 1RTDA 3DJCA 1HNWK 2HHUA 5H6QA 1M4UA 1ZLZA 3MEEA 1RTJA 3AVMA 3IS9A 5M1FA 3JALA 1R3KC 3SAHA 2X6BA 2XOKG 3R65A 3TGUH 3FB7C 1K8AW 1LCUA 3KVGA 3T69A 4YOVA 4DHYA 3WNFA 3JCUZ 5BY1A 3ZBHA 4O4JB 4UUJC 2GBZA 4FWKA 2QTDA 2A40A 1NTZH 2UUCO 1GN2A 1GH6A 3AA5X 3JBG4 5LYJA 1AJPA 2Q36A 4ZHQB 4UVCA 1HPZA 3R6MA 4X64B 5KI6A 3KLEA 3P4SA 3VOVA 1BS3A 3HPLC 3VQWA 4E7LA 3TANA 3OYKA 1BCCH 1I3AA 2B9ZA 3ZEUA 1TK0A 4BGBA 5FRMA 1ZBIA 1M90O 1NK0A 2ZDIA 4JI0O 2Q7EA 1SETA 3ZHTA 2YEVB 2Q4PA 2Q7GA 2D0BA 1QR8A 2GHYA 2KG7A 1WB8A 1NG9A 1OJHA 3SQ0A 2FBYA 3G71V 3JAKA 2FBVA 4BRNA 2JIZG 2MK3A 3PJSK 2EIMB 4F6EA 3PUFA 4I6MA 5LY3A 3IC7A 2E4LA 3IFRA 3QO5A 3ZHSA 4IEEA 2OCCB 4I55B 5FPEA 2BGGA 2Q2RA 4DR1O 2HOEA 4JV5K 2H3OA 4E7HA 2NUBA 2ZE7A 3KJVA 1GLDG 2HMPA 4PA4A 3E66A 2RCVA 4LF6B 1K97A 5LHGA 2EINC 4X1KB 4LF7O 1LAVA 2PTMA 1TKDA 1NKCA 3K57A 2UXCB 4TSFG 1RBTA 4FFKA 3HSCA 2AHYA 3RN4A 3EO3A 3HO1A 3ABUA 4J7ZA 1VQ5N 1K33A 1BQMA 1Q8IA 3T1YK 4RTFD 3V81A 1S0VA 1JJOA 1YQ4A 3AEAA 3I56N 4QE7A 3ZMSA 2QW9A 3FKSG 3F2KA 3PLAA 2DMXA 1OCOB 4YY3K 2GDSA 2OTJN 3AE5A 4BW5A 4DF8A 3ASOC 3EL2A 2HHWA 1SA0B 3M8AA 4NXNO 1NH2D 1W2BM 4B9LA 4YT0A 5SWMA 5LBQA 2RQ6A 1XC9A 3SPCA 3CYOA 5LMNO 2QWMA 2QWNB 3RT3C 2JS5A 4B7EA 5AQJA 2EHGA 1HR0K 3D2FB 2CH6A 5JQGB 3CCMV 4JI6K 5AQVA 3ZSVA 4Z0UA 4FJXA 1F23A 2N04A 2DFHA 5IE9A 2R9AA 3MWPA 3VEWA 2QA4N 2CGJA 2EJ7A 4FOIA 1VF7A 1BI4B 4H0YB 3OEHG 4CHQA 3OY9A 4K8XA 4BDYA 1U47A 4JTCB 2UXXA 5BXZA 2A41A 1Y4MA 2KLAA 1AP6A 3KK3A 4YIPA 3AE6A 4JD2A 1DK1A 4M3WA 3JAWA 3JARA 1Q86W 4PDVA 2WA4A 3H01A 5B3SB 2IIRA 2Q3SA 4ID5A 4MS2A 1COWG 1HQUA 1HUXA 1YTFB 3ZETA 1K7DA 3NXSA 3K5LA 3NE6A 5BN9A 1EM1A 3QO8A 1DEJA 4HNAB 3K9SA 3ABLB 3FAVB 4LC9B 2RN2A 1QQNA 4DB3A 2YHAA 3OW2M 1FJGK 1OVQA 4CH6A 2D0PA 2NRVA 1U49A 4JZ2A 2B4JA 4B1WB 1SZXA 1H8EG 2HP8A 3N2KB 1RT3A 4UB8Z 2ZM6K 3OVNA 1LNQA 4KHSA 4WFBV 2FSJA 4DR2O 4DV5B 2E74B 1VQ7V 4DV1B 3ATUA 3MX5A 1S72V 5AQSA 1WB7A 4JI2B 4I2PA 1Q43A 2Q8VA 4DV4O 2OWOA 2UUAK 3AE7A 1IBMO 5DMRA 1ILYA 3FB8C 4WFBL 3P30A 5ITZA 3ABTA 1U4BA 1AR5A 2Q69A 3E8FA 3CC4V 4BIUA 3CERA 4TSXA 4C8MA 5LGUA 1NK5A 4FWMA 4CJLA 2ETJA 4G1QA 2P51A 2ETNA 3HOSA 3SI6A 3CJ7A 1VSHA 2NRZA 4FJ9A 3FX7A 5J2UA 1RDUA 3BZKA 5IT9N 1V55B 2FTKA 1BSMA 4I55A 1VSKA 3L4IA 1PNLA 4K42A 3VA0A 4KHPO 4MO4A 1NT2B 3AEIA 3ZMTA 2YKMA 1L3TA 1VQMV 4KHWA 3CEIA 2A5XA 3U3GA 4GV3A 1FPOA 1EAH4 3A0IX 1P49A 5E26A 3JCZA 5AQRA 1S3JA 4LNUA 4U67L 2YIAA 4JGSA 1GLLO 2VQEK 3EE9A 4CS3A 1HLUA 3M1FA 1VQ8N 4ZTJA 4Q5VA 1K5MD 1VQLN 1DTOA 3OYCA 2Y1JA 2BE2A 4CZHA 3WXJA 1QSYA 2QKSA 4JKCA 3OYIA 3OJUA 4YJ3B 4J80A 2ITMA 2P90A 4DV7B 3H9VA 2BTOA 3D2EA 1BHLA 4DTRA 2HF4A 3F7VC 1QS4A 3WXLA 3AVBA 4Z4FA 5LA6B 1K34A 5LYJB 5AR0A 3WXMB 4B1XB 4JAXA 1BMFG 4ILHA 2HBLA 3FFIA 2Z1JA 3BZCA 1VBD4 2DJVA 4A2BA 1QQOA 2G8VA 1AI5A 1KLNA 1PIV4 1W0JG 4HWIA 4FLZA 3DXKA 4NYNA 1M5IA 4CCHA 1ZX3A 1JCGA 3L2QA 1YI2N 2PF4E 3AK2A 3SPJA 4BC5A 4I0XA 3KCYA 3PX0A 1RUJ4 3CRAA 4O8KA 1SESA 3O4QA 1TYQB 1MZEA 4CFDA 2QWNA 1RDAA 2OTLN 3U4LA 5LHHA 1N36B 1H8HG 3GDQA 3CP1A 3RFRA 1RFYA 3DLEA 3G6EN 2IU3A 4Q6GA 4X9QA 2DE0X 1SQKA 3TTDA 1VQKV 1AR74 1TUEB 3ETGA 4CZZA 3CIRA 4I4TB 1AI6A 4DQIA 1HPMA 2VRZA 1DT9A 1Y97A 1S5HC 4F4KA 3O08A 1Q7YW 4RCHA 3V9ZA 4WQ4A 3EYZA 1S1XA 5AQMA 3R3LA 5KHHA 1HRHA 4X66O 4YY3O 2BANA 5GIPA 3O4NA 1J5EB 4CF2A 3HSTB 3JATB 4CHNA 3AA4A 4D7TA 3IFXA 4QS7A 3HM9A 1I7FA 4HUFA 4DTUA 3ETEA 1JLFA 3WUHA 1NQTA 1NWKA 4CEOA 1XNRK 1N36O 3V4IA 1I94B 4CFCA 4LSNA 5M1KA 4PDMA 4JI8K 4CJWA 1QBZA 3CSXA 3DRRA 3NHGA 3TAGA 3FYIB 3B77A 3OW2U 1X9MA 3HKBA 1MSWD 3QMLA 3RMDA 1NK8A 4QCLA 1K5SA 4JTAB 4JI6O 1LWFA 3I8DA 1HYSA 4CH3A 4FWRA 4CBUA 4DR6K 3BA9A 1GM8A 2GUZB 2IW5A 3AG1C 4DUYB 3CPEA 3ZHVA 1IBLB 1TYQA 5C25A 4GVMA 3K58A 3ZMVA 3CRMA 4EFBA 1DF4A 5JJNB 4PUOA 4CZIA 1VQNV 3F7YC 3L74H 4DV6B 1F21A 3BCCH 2OPPA 2YV0X 3K9JA 5GTHZ 5B66Z 3ZX3A 4BDPA 1VEWA 4WFGA 1NGHA 4J8FA 3OR7C 4DG1A 4HHTA 4YSYA 3AECA 1SUQA 3AK3A 3T7ZA 1Q7YO 3RBZA 3PO4A 4IL6Z 1NVPD 1JFFB 2D1KA 1YTUA 2Q67A 4YDUC 1R084 3RWUA 1UOCA 4CZEA 4DLEA 2E75B 4DSKA 3QBXA 2JGUA 3NDKA 1AP5A 1C1CA 2N05A 4ISEA 5L3CA 3O9SA 5AQGA 1D9FA 5H5NA 4CS4A 1KQSU 4NYKA 4H0TB 2HJFC 2QWOB 4FJHA 2ZNJA 3JATA 4G27B 4PJ0Z 4X20B 5C8YB 3H3NO 2QTSA 3TAQA 1KU9A 3V1RA 1C0MA 3OS1A 1JLQA 2C2AA 3PSIA 4A5AA 1TKZA 5KLVH 1RHI4 4BRCA 3LZIA 4UCTA 3L71H 5AQLA 3SPGA 4DR7O 3WNGA 3HKDA 3DI6A 3CFPA 3UIQA 4YNQA 1BEV4 4A59A 3QVNA 3R1XA 4WQ5C 4CEDA 1WAFA 4W5TA 1TVKB 3HPOA 1RUF4 5C3JA 3P4QA 5GW7A 4YDUA 1VF6C 4FWNA 1L3VA 3OTOB 3JS6A 1N8RW 4PKHA 3NH0A 1ZBUA 4FFBA 4FLXA 3AVCA 2RDCA 4LP8A 3K04A 4JAVA 3S3WA 1YITV 2HJDA 3H45C 3P1GA 4IFYA 2DPNA 4JKDA 5LGNA 4LWSB 2VQFO 3K0DA 1U48A 4O2AB 3E22B 3KK1A 4QPJA 1O9HA 2MW2B 1MWKA 2FSKA 4B1UB 4BRGA 5KQDA 3OE7G 3KKSA 4KXRA 4OPAA 3LAMA 1H2NA 1NZ6A 3QO9A 3HXMA 4I6MB 4KTZA 5JH7B 4LFBB 1E4FT 1GLAG 5JWPA 3ZT2A 2ITGA 5L3EA 1EQYA 4BACA 2FKXA 4DK1A 4DUZB 4Q4X4 1P84F 1S5LZ 2RMKB 3NVKA 1CXUA 4O5BA 1P4RA 3D36A 2XT9A 1R6KA 2AHZA 4MW3A 3T4ZA 3FFKB 2WDRA 5HRRA 3EVKA 1XQSC 3CRRA 3FE1A 3UO3A 1QR9A 1RSOA 4X62B 3B09A 2RMU4 5KTQA 4DR1B 3RMBA 5IWAO 3I55N 2EINB 3STZC 1KSPA 3ZRWA 2UUAO 2DQ3A 4B08A 1T05A 1N33B 3K9AA 4HYOA 1DGKN 2RNBA 2YC0A 5H9CA 1EXQA 3IRXA 5ELZA 4MTXA 4DQRA 1NMNA 1NTKH 3WB1A 3CCSV 5KHJA 5M1OA 4DMNA 5JICA 2A1RA 3MX2A 1L1FA 2W6LA 3SJAC 1I94K 1HRV4 4PDLA 3CJHB 1R3IC 1P90A 4R7CA 1ZUQA 5C42A 3H1HH 1WSIA 1MSDA 4YTPA 3ICXA 4J7KA 1JQ0A 3ETQA 1WOQA 2QWPA 3WNEA 1XMQK 3VENA 1BI4A 3N27A 2HBJA 2UUBO 5CR4A 3E8BA 3OM3B 4LF8B 3CD6N 3AVAA 2LJ2A 2VQFB 2ODMA 1VARA 4FM2A 3E01A 1I94O 4FZYA 4PL8A 5LA6A 3DLHA 1QHAA 3QNEA 3ZS8C 3NH1A 4XH4A 3GQKA 3M8RA 3J80O 4AQYO 3ZSWA 4IIJA 4YHHK 3GWKC 3E9PA 1SKWA 4M63C 3BEHA 1IVSA 3CC2V 1CZAN 4G28B 2I7PA 3BPZA 1JLCA 4FK2A 4DR7B 2NRWA 2V7YA 5CA1A 2BTQB 4F6RB 2P67A 4LD0A 5C2FA 4DUZK 1I5YA 5CY4A 3MCAB 2ZR3A 3AE4A 1U2VB 3CM6A 1WPXA 3VQ7A 4O8UA 4LH7A 1YVNA 2DW4A 1VSEA 4UV8A 2P9LA 3U3YA 2X6CA 3ABMB 1THZA 4PA6A 4CJTA 4YIOA 4IHJB 3WXKA 2VQFK 3MN5A 3ZJZA 1J53A 4LWSA 3UKUB 2WLLA 4FYDA 3TCUA 1OCCC 1IZ3A 1Z26A 3CJ9A 2BSKB 4ZTFA 3HBTA 2FLOA 4CJRA 2XY8A 4LFAK 4Z2WA 1IKVA 4X62K 4FJNA 3T1YO 2ASOA 3WEEB 3SYCA 2KZMA 1KC8W 4WE1A 4UXNA 2PYLA 3HVRA 3SCXA 3SMSA 1KVBA 4AM7A 3SJHA 1T8EA 1S6PA 3AAQA 3FFQA 4GW6A 2F95B 3HYFA 3OYGA 2QKBA 3K08A 3GVMA 4RW9A 4ASUG 3U9ZA 4QS9A 3CCJN 3MK6A 4H5NA 4CJ5A 4DXWA 2F43G 3TSQA 2QWOA 1YAGA 3VGMA 4BR5A 4BE0A 5B8HA 2E2QA 1SL0A 3PO5A 1JCEA 3VBBA 2H8PC 2VG6A 4TV8B 3QEXA 2O8CA 4RUEA 4O4GA 4ZHQA 4FL9A 4GZRB 4CEZA 5IJ9B 1NBMG 3JSMA 3CCJV 2GSMB 1G1XB 2FYUH 1I39A 2Q97A 1IG8A 2WOMA 5D5PA 4HTLA 4W5QA 3ZRXA 2WA3A 4NB5A 5J2PA 5AQXA 1CP9A 4IOXA 3S3XA 4FLWA 4JLHA 2IVNA 1BQZA 1VSMA 2IGIA 3ID6A 3RYCA 1CZ9A 4BRPA 1AVMA 4DYLA 2FF3B 2Z1IA 3TJTA 4NXMO 3HVTA 4FCYA 4BY9C 4FJKA 1Q18A 3HI0A 2ZE2A 1XMOB 3TR8A 3DC5A 3N2GB 1U96A 1XBLA 1YF2A 2ZM6B 3IKMA 2ACZA 3ABVA 3M5RA 5AQZA 2QTOA 3V1QA 2ZE5A 3VF2A 4DV6K 4F3OA 3LDPA 4W5NA 4Q4Y4 1NGJA 3ETDA 3OFNG 4DW1A 2X6AA 2XUMA 3LP3A 4JK9A 1CXQA 3M8SA 4WYBA 4CF0A 1ZTEA 3BY5A 2QE7G 4BRAA 3BAAA 5F2VO 1TGOA 3AVHA 3L9DA 2Y4UA 1NMDA 4HBNA 1EN5A 2QJ1A 4Z4GA 2R074 3OTOK 3CC2N 1TUYA 2ZJPL 4IIJB 4MVRA 4IFEA 4UVAA 1L0VA 4CH5A 3RYFB 3CC7V 4JI7O 1XL4A 5AFUH 2NRXA 4CK2A 1C0FA 3B6OA 4E3SA 3FR0A 4B8AB 3CJCA 3P3NA 4CIEA 4JKGB 2P9PB 4ICGA 4K41A 3JD4A 2WLJA 1KAXA 2NZTA 4FW1A 5EZYB 4B3OA 3K2PA 3RYHA 5DECA 3WU2Z 3RMCA 3CD6V 1BDGA 1PL4A 4AHUA 3ZYYX 3U11A 1HQEA 3LSSA 1GTOA 3D8CA 2WPDG 5JQGA 3D0PA 3ABKB 3T1HK 4FWPA 3DXRB 4QIWF 4KKOA 5HBMA 4BROA 5AFUA 1QU7A 4A5BA 3OJSA 5C12A 4YTMA 3N2GA 3KCXA 3SJCC 1YXQA 4A62A 4XDJA 4PKGA 1K8AO 1EO1A 1RPOA 3ITHA 1ZXOA 1ASJ4 4B1YB 4IGGA 4TUYA 2WC9A 4AHTA 5IWAB 4PKIA 1NGIA 3CCQN 3RSEB 3EN9A 2OCHA 4JV5B 5AQPA 5E41A 2ADPA 4B1ZA 2A3ZA 1F4MA 3THYA 5D3GA 1BUPA 1ORQC 4BVOA 5B1AC 1WB9A 1WP7A 1OH6A 4KUMA 3IG1A 1OCRB 3ZRWB 5M1NA 4M3RA 3TK1A 5IJ0B 1W2BU 1HKCA 3KIOA 1WA8B 3FYEB 3AG1B 4JASA 1JLAA 2FXUA 4C7UA 2YJEA 2AZ0A 1NCQD 2UXBK 4BWAA 4KB1A 3SFEA 1EZJA 2P7TC 4IOCL 5IJ0A 4H33A 3EKSA 2QGNA 4R79A 4JI8B 4KHQA 4LF9B 3J7ZO 1NS1A 3E9LA 5AQWA 2PY5A 1Z05A 1R73A 4KHYA 1RBUA 1UPGA 4KO0A 2L6LA 5EC1C 4MLEA 5BPLA 2IVPA 1RNHA 4C23A 3LPUA 2ZT9B 4DV1O 4OKJA 4P9PA 5DN6G 3AVGA 3VQ8A 2Y69C 3TABA 3SJBC 5BR8O 4GX0A 2D5RA 4OLBA 3ZEDA 2HSTA 1VK0A 3V9XA 5J2UB 4UCSA 2YEVA 2CH5A 5B1BB 3VR8A 1BGXT 1MG1A 5FPOA 2YXLA 1SQVH 4IBNA 4HUGA 1H2LA 1Q86O 4DW0A 4DTSA 4ELTA 3P4RA 3VQBA 1YITN 2Q0AA 3NCIA 4M7XA 3I0SA 4EAHD 2WLIA 4NCBA 3E8HA 4GT1A 1NJWA 4H0LB 1IBKK 4ILGB 1G6UA 4H0OA 1QNMA 3FZKA 4IYIA 3LPTA 1KAYA 4UCVA 3VETA 1H2KA 4FM0A 3PIPL 5GONA 2AW9A 4JF3A 2LQTA 1TAQA 3J81N 1TK5A 2Q6AA 4DV0B 1LR1A 1NK6A 1IX9A 1LOTB 1IBMK 4BWJA 1SS3A 2Q0UA 4OGCA 1FW6A 4JI3K 4WF9L 1FXHA 2ADQB 1BA0A 3W7WA 1C1AA 2VWBA 1JOYA 3TXSA 4K25A 3HOTA 1WBDA 1VQ4N 4GV9A 3VOUA 5IYZA 2P22C 1UJWB 3FZFA 1DF5A 1B9DA 4F9OA 3ZRSA 4QNHB 5KQ8A 4FZXC 4WCEL 4FZZA 2BH1A 1P8ZA 2L35A 3UT5A 2YHXA 1FJGB 4AF1A 3O6WA 2GUPA 1TUBB 4IJAA 4BQZA 3C3SA 4JI1O 5F0XA 1JXBA 1VRH4 5DK5A 3MAQA 5AZJB 2RKIA 2PI4A 2IM9A 2UXDO 3PX6A 4O2BB 5AQYA 4R6ZA 2W6JG 3ABLC 5LHIA 3VESA 1N33K 5AG2A 1KFDA 1GN3A 2X5ID 5I42A 2FSNA 4TT3G 3IUCA 1XNQK 5H2FZ 4NTWA 4CBCA 1VAZA 4DS5A 5KA5A 3K3WA 1NEKA 4MVZA 2P9NB 1VQNN 2Q31A 4DKWA 3T1HO 1ATNA 2WDVA 5J1EA 2E2PA 1N0NA 3A5NC 1RM1B 4H0PA 2ZQMA 2YNHA 4MDAA 1M93A 3FB5C 4WF9V 2F9WA 3DGEA 2Z0AA 2PFUA 1GLBG 3AO5A 4FWLA 4P2ZA 4E7IA 4H13B 3CJAA 4GYCB 3EEQA 2YICA 1AR64 3VQPA 4F2RA 1NI8A 4J10A 3ABKC 1HNZB 2IVOA 1M56C 4B3TB 3OYMA 2UUBK 1HNIA 2IH1C 1QLEB 4WQ5A 3TPQA 3QEVA 1QSSA 1YJNV 3KZBA 4CGJA 1JLEA 2FBTA 1ASUA 1FXKA 4JYBA 4A2AA 4LH4A 3NAEA 4EZ6A 3E83A 3VF4A 5EX5A 1J95A 1V9PA 2YNGA 2ASPA 3VPZA 5AQQA 4XDKA 2NRTA 3LAKA 5FPMA 2P5GA 4LFCO 1KVAA 2NLXA 1V55C 5CHIA 4E2LA 4ZI7A 1GOAA 4CC5A 1RT6A 1NGDA 5BRHA 4JI4O 4IG3A 2A42A 4CW7B 1MABG 4DR4K 2QXLA 3M8PA 4FJGA 4FJ7A 3MD0A 4JYYA 3C65A 4X66K 4F6RA 3G6EV 2F4VO 1BE3H 5EYPA 2P9PA 1PVC4 2BE3A 3HK2A 4X1IB 3ZCCA 2EIKC 4K3AA 3RWRD 4LBEC 5KAIZ 3ZHQA 3OTOO 3VA3A 1SL2A 4N21A 3ZEUB 1M1KO 3CCLV 3IDHA 4GCZA 2IDOA 4CFBA 1Q81W 2YNFA 1UFIA 5A2QO 1ROPA 3S3NA 4K0KO 4DTJA 2ATQA 3OS2A 1YI2V 1LV5A 2HEPA 2HVJC 1K8KB 5LJWA 3OYNA 2LO1A 4FZ0A 2JGDB 4GUNA 2KZZA 2HFEC 4DR7K 1QCEA 3QERA 1HR0B 1SQGA 2K1EA 2DY4A 3G4SN 3WQTA 4PQUA 2F4VB 1CXZB 3PSFA 4CZFA 4KI6A 1BZKA 3SYOA 4JKGA 1EWRA 5B3SC 4FVUA 1LWCA 2VGNA 5EZYA 3ZHUA 1BQNA 4BR0A 3NH2A 3FGUA 2LFSA 4D6TH 4LF5O 3ZT3A 2QR4A 3FZHA 4OGQB 3LSUA 3MEDA 4KAZA 2HHVA 2NN4A 4OX9O 3OBWA 3VN5A 3ZX0A 4EB6A 5I9EB 1XHZA 4CGHA 1TAEA 3AA2A 4K0KB 1W97L 2ATKC 1AI7A 2GX9A 2F8TA 3TU5A 1VQMN 1QVGU 2P9IB 4XIUA 1J5EO 1R6NA 3AVKA 3Q4HA 1K9MO 3CCEN 3CHWA 3P4PA 2YDEA 1GN4A 4ISGA 3S3OA 4X89A 3EHBB 3PX4A 4R50A 1ZL8A 5KRSA 1BQ0A 2D4WA 2DN9A 1KAZA 1K4CC 2JWKA 3GG4A 4JI4K 3AE2A 4WFEA 4DR6O 2GELA 3VRBA 4DK0A 4H5WA 4I9LA 4WFHA 4BRMA 1IXBA 3L2UA 1D9DA 4DR3O 3PIOL 4M3TA 4JI4B 4BREA 1ZBFA 3CC4N 4LH5A 1M1KW 2Y0IA 4DO2A 4I4TA 2OCCC 2E2OA 1VQOV 3DTUB 4GX5A 1RT1A 3N4PA 3VTHA 4GNIA 3OYAA 3V6DA 3K5OA 2ZWHA 4CJ7A 2NNUA 3SV3A 2D0CA 1KD1O 4JYAK 1S72N 3QTCA 5B1NA 3N2KA 4CZMA 2FC0A 1VQ7N 1E79G 2ZE8A 3L75H 4B1VA 1QHTA 3L3UA 1HNXK 1IO2A 1S1UA 4ZBMA 4H5VA 4M7YA 3CMAV 3HPHA 4OPJA 1K6YA 4DR5B 4Z1VA 1LAWA 4JI2K 1ZBLA 3IAYA 3THWB 4EKWA 2KW4A 5KMGA 2AXTZ 3TAPA 2OZMA 3VEVA 2UXNA 2XY5A 3CETA 1A32A 4PDWD 3GB7C 2VG7A 1X59A 5JCOA 4BQLA 4DR2B 4OVLA 1ASWA 4N23A 4BGAA 1W59A 3SQ1A 3RGBA 1RT4A 2F4VK 4JAUA 4FPBA 1KC8O 4U7OA 5KRTA 2WDQA 2YI1A 3C3TA 4DR4O 3T19A 4DV7K 4DFPA 3NF9A 4BRFA 3AVFA 2XAQA 2QA4V 3A5LC 3A0RA 1K5QA 3JSLA 3OS0A 3WB0A 4YJ2A 3T1AA 3UO2A 4B3MK 2WQYA 4YHHO 3A8YA 1FK9A 1KECA 4B3RO 3ZIAG 4AH9A 3CFRA 1TL3A 4UCUA 5TKWA 2XRIA 4QS8A 4JI6B 2UXDK 4RQEA 1BHBA 3C6HA 4FLUA 1U45A 4B3SK 2QM7A 4AI8A 3T3FA 1QZ6A 2CTRA 1S9GA 1KVCA 4DR4B 3N4QA 1QQMA 1KRPA 3LP2A 1S1TA 4BRQA 4CK3A 2G8WA 2G8HA 4MFBA 1GRJA 1PO24 1S3XA 1AJQA 2IH3C 1VQ5V 2ZJRL 4BWMA 4FWOA 2G8KA 2QKKA 1Q6HA 3WFVA 5EIBD 1VQ6N 4MTFA 3SUOA 5LXTA 3K0SA 1Q6UA 1C0GA 2KHOA 2D3OW 2AP1A 3D7EO 3E1YA 3SR2C 4BR7A 4XBFA 3CWBH 4DR5O 3P38A 1IH7A 2F1MA 4DV1K 2KKWA 2HHHO 3CYMA 1QTMA 1S77D 4FJCC 4FSVA 1K92A 4CHZA 1LUVA 1XUPO 2YKNA 1NK7A 4C8KA 2O8BB 1SQPH 3FZMA 3O9UA 5IYCO 3OMAB 4WBNB 4BC3A 3DM2A 1I5XA 4A5UB 3MEGA 4CGFA 4PHTX 4DUYK 3ISNC 1K3EA 1PO14 5IYBO 3DXMA 3A5OC 4CEBA 2O8FB 4CH4A 4FXDA 3OEEG 2DYSB 4DR3B 2O8EA 1H2MA 4IZ9A 4JKEA 3CI5A 1E1QG 1FXKB 2LW7A 4JK8A 5LMUO 1QVGM 3SAFA 4BR6A 5J9PC 3DOKA 1IBKO 4CJ4A 4DV5O 2UXBO 2X0LA 1NGBA 4E1MA 2Y69B 3SGIA 3ZT1A 4JRPA 4DU1A 1FKAO 4J2BA 4WFAV 4JI0K 1M57B 3S3MA 1XEQA 1RVF4 1ZOYA 3NGZA 4I50B 1M56B 2QWRA 3DLBA 3QG5A 2HHSA 1FKOA 3RMAA 1GO3F 1BHAA 1JL2A 1AR4A 3F5WC 3E2EA 4ZHRA 1KBHA 3MN7A 4CJQA 3THWA 4OX9K 4B9MA 2A79B 1L8DA 1VQ6V 1RGIA 4LFBO 1Y66A 4JS5A 4DV3B 3ZSXA 3GWOA 2EIJC 2P6JA 1D4XA 1GK9A 2E5LB 2YX6A 1TK8A 2UUCB 3HKCA 3Q7BA 4FJJA 3O3HA 1WBBA 2AA4A 1YSCA 1G15A 2LFRA 3TI0A 1E3MA 4CGIA 1YHQN 3O4WA 3DLRA 4LCUC 2E8AA 3CCUV 4DSFA 4FO0A 1HNXB 5F2RA 3OGIB 1SKVA 3ZHRA 1N34B 1YVWA 3HKCB 3L6QA 3G25A 5T7BA 4DV0K 3SUNA 4IOAL 1TAUA 4H0VB 3AEDA 2KB1A 1GKFA 2XNDG 4JTDB 3CMEV 4FJ8A 1KFSA 4K0KK 2IJHA 1RBRA 3D3QA 2A1SA 4B9SA 1RBVA 1QZ5A 1T44A 4LF6K 5CB4A 5L3GA 3DRPA 4NXNB 4O2AA 5L3DA 4X64K 4BRHA 3LUTB 4IEIA 4FK5C 3ZRVA 1T3VA 1MU2A 3Q4HB 5C24A 2QM8A 5J2QA 2HNZA 4EFHA 2B6AA 5JH7A 5IYDO 2WLNA 3BA8A 4B8CA 3K5NA 3QLHA 1KP2A 4CVNE 4JRQA 3V9WA 4A57A 3SBGA 3SPHA 2DWEC 4HCCA 1ZC6A 4U3JB 4FK0A 4BE1A 4Q4W4 4F3TA 4JI2O 1T6DA 4Q4V4 4LF4K 1EN4A 3E22A 2HVIA 5I3UA 4JI7B 2EULA 3AEBA 1PV0A 1F7YA 2F66C 3D3IA 1K9MW 4YJ3A 1WN7A 2OCEA 1MWMA 4CBXA 3R8EA 3MXMA 4EEQA 4NKGB 1O1WA 2LGQA 4NR1A 1MMMA 2B5JA 2HW3A 1EETA 1R6TA 5A9GA 4LSLA 1Y6XA 5EYPB 3CPWU 4CHOA 3CMAN 1U97A 4O4LB 3UKRA 4CECA 1K73O 1Z2GA 5KX5B 4JK7A 1SQQH 2LW1A 3AVIA 1S76D 2W41A 4DR3K 3DWLA 2Z1GA 2A06H 2E5LK 3ALYA
chains in the Genus database with same CATH topology
4DTPA 5KX5A 1CLQA 4M45A 3BHPA 3PN1A 2LSNA 2KQ2A 2X78A 1JXEA 1RTHA 5CA0B 2Y1IA 1HYVA 1IKXA 2PZSA 1HW7A 4AQYB 3AVNA 4CF9A 2ZINA 5LMNB 1S5JA 3KLIA 4I2QA 3U6FA 3OYLA 5D5QA 2ZNIA 1RT2A 3DOLA 3T1HB 4CK1A 1JLBA 4I50A 3ZT0A 1L3SA 3D45A 4TUYB 1EKEA 4DF4A 4RW8A 4CS2A 1WPBA 4ELUA 3UT5B 3L8BA 4ZOLB 3DYAA 4NVPA 4CHYA 1QSLA 3SPYA 1O9GA 1LW0A 3VQ9A 1YVUA 3THOA 5CZ2A 3C94A 4B9NA 1JFFA 4FW2A 4IFVA 1EP4A 4O55A 1FFXB 2OPQA 4EP4A 2OPRA 4DTOA 1JL1A 3JAWB 1RT7A 4BE2A 1TUBA 4KTQA 2KFNA 4X1YB 3QNNA 1DTQA 5FRNA 3TAFA 1HYZA 4N47A 5JCOC 2UUBB 4RW6A 2QK9A 3ULDA 3RRGA 4LY7A 2EX3A 4LF7B 3CG7A 3BRCA 4UCRA 1SKRA 3P83D 4I9QA 1C0UA 4TQFA 4B9TA 3RR8A 1VSDA 1IG9A 5KHGA 2X6SA 4N56A 1NJZA 4H4MA 5JVDB 3V9SA 2HHQA 2HHXA 4JS4A 5HP1A 1JMKC 1RBSA 1VRTA 4ZI7B 4OGEA 3EZ5A 4RW4A 4KREA 4M41A 2R70A 1J9AA 3JASA 2E6MA 5JS2A 4JYAB 2F93B 1Q3EA 3OYJA 4HTUA 5FNVB 3VQYA 2UXBB 3VQCA 1T7PA 1S1WA 2PUSA 4U3JA 3QESA 3JARB 3C95A 3MECA 4FJ5A 4CHPA 3ZT4A 2R72A 1T5EA 5KGWA 1REVA 4DRXA 3L2WA 2YIBA 1QE1A 3VQEA 1TVKA 3NF8A 4NCGA 4E7KA 4DU4A 4PY5A 1IBKB 1U04A 4CJPA 1TKTA 4YFUA 4AHCA 1DLOA 3F9KA 3AVJA 3KLGA 3LALA 1X4TA 1X9SA 4M3ZA 4N41A 3OYBA 4FLTA 3OYHA 1GOCA 4JI0B 4DTNA 4CEAA 4UCOA 5HRSA 4E7JA 4OPKA 1X1PA 2HB5A 1QQCA 1YTAA 1S6QA 4OKKA 2ZIMA 4TV8A 2F96A 5IJ9A 4MQ3A 4X1KA 4CF1A 2R7YA 3JASB 3QEIA 1X9WA 3A2FA 5K1XA 5KGXA 1FXXA 2JLEA 4E0DA 3PY8A 3VQXA 2ZD1A 1NJXA 4EFEA 5FNVA 1UAXA 2OPSA 1TKXA 4ICLA 1NJYA 3U0ZA 4X20A 2HHTA 1BISA 2FBXA 3O3FA 5J2TB 1W0HA 4OKEA 1C6VA 3BDPA 3S9HA 3OTFA 2V4DA 5J2TA 5LXTB 3OYEA 4HCBA 4DRXB 3QEWA 4O4JA 2PW9A 1Z25A 5SZTA 3K59A 1WSEA 3VQ4A 3G0ZA 3OYDA 1IKYA 4DLGA 4CIGA 4CJVA 3P5JA 2KTQA 3M8QA 3L2VA 3SYZA 4Y1CA 3BGRA 1UA1A 4DQSA 5JS1A 4KRFA 1KMIZ 1HJRA 4KFBA 1XNQB 3HKBB 3SUPA 4RG8A 3ZSQA 3FI7A 2VWKA 2Z1HA 4O44A 4PHZA 5FROA 3ZCMA 1L3UA 3DRSA 5HRPA 2Q7HA 1VSFA 5CYQA 2XO7A 2ZQBA 1NOYA 1JKHA 3M7MX 4H8KA 4CE9A 4CJFA 3QINA 1C0TA 3AA3A 4DSIA 3LANA 4CEFA 2O4IA 2OA8A 4JI3B 4TV9B 1JLGA 1VRUA 4M3YA 2RF2A 1WAJA 4F2SA 5LP6C 1RDBA 3MXIA 1NK9A 1Q9XA 1NOZA 1ZAUA 4OLAA 1TVRA 4NCAA 1J54A 2OZSA 2G8UA 2DFEA 3VQ6A 4O4HB 2QXFA 1C1BA 4WBNA 5LMUB 2G8IA 1N6QA 2IAJA 4CF8A 1B9FA 4N5SA 4O0JA 1WSGA 4Z4IA 1D8YA 4R5PA 1SQFA 4FM1A 1YEWA 3BABA 4L8RB 4E89A 4C8OA 4X66B 1SA0A 2HVHA 3RRHA 2I5JA 4O4LA 3G10A 3ZSOA 3MXJA 1Z5WA 3KK2A 3KKRA 1WNSA 4X65B 2PGGA 1XHXA 3DSQA 1BCOA 3CB2A 1H2SB 4FJIA 1DTTA 3NF7A 4FK4A 1SKSA 4FJLA 4LH6A 1W9HA 4DV2B 3LP0A 1SL1A 1WSJA 1DGSA 1RILA 3QIPA 2XHBA 3HKEB 4GMJB 4DWIA 2VG5A 3B2EE 4LFAB 3HL8A 4ZOLA 4QOZB 3SQ4A 3PV8A 5J2MA 3RYCB 3LZJA 3CHXA 4DFJA 3SPZA 3DLKA 1BIZA 3RYFA 5JJEB 3B6PA 1RTIA 4Z4HA 3KD1E 4X1YA 3F73A 1B04A 4YHHB 4DU3A 3RYIB 1IBMB 2OYQA 2IOCA 4W5OA 3QETA 3VQVA 4Q0BA 4KPYA 3KTQA 1ASVA 4IKFA 2JVDA 2F8SA 3V9UA 4UQGA 5C8YA 2R7FA 1XNRB 4DFKA 3H08A 3CFOA 1BL3A 4UFZA 4L8JA 1XI1A 3AV9A 4TOIA 3AO2A 3JSNA 2BTQA 4PI2A 3I0RA 5KHKA 1BCMA 4ELVA 3JAKB 4FFBB 4CEEA 3HP9A 5LOVA 1R0AA 2CAZC 1RDCA 2RJZA 4IHJA 3K5MA 1XMQB 4GKJB 4EP5A 4PI0A 5LP6A 4LF4B 4D7SA 1IKWA 2E3CA 4LF5B 4DQQA 4GLXA 3WNHA 2YI8A 2DFFA 4Z4CA 4O0IA 4J2EA 1RDDA 1UA0A 1A5WA 4KHPB 4GKKB 1S1VA 3JYTA 1HNWB 3TAMA 4IDKA 5CA1B 4HNAA 2KFZA 1GOBA 2YIBD 3RYIA 3TAEA 3HJFA 4Z4EA 4J2DA 5JVDA 4O4HA 4NYFA 4CGDA 1Q9YA 5EU7A 3NGZA 4CFAA 5FPRA 5KMGB 3NFAA 4YJ2B 5K14A 3ZSRA 4NXMB 5ITZB 4OX9B 2QM4A 3V1OA 4J2AA 3HP6A 4JI5B 3RTVA 4HUEA 3HKEA 1YT3A 4Y1DA 4FVMA 3SJJA 4DQPA 2E6LA 4F8RA 4K8ZA 2UUAB 4B9VA 3HT3A 4EB6B 2VQEB 2UU9B 1VSJA 5IYZB 2HMIA 4LFCB 1S9EA 4AHRA 2GV9A 3CM5A 3NF6A 5HLFA 1NKEA 3QF7A 1Z5VA 4CGGA 1NKBA 5CA0A 4PWDA 2P1JA 3DMJA 5K1PA 3HKDB 4FLVA 2AJQA 5HROA 3AVLA 5LP6B 1TA8A 3RR7A 3LWLA 4AHVA 4E19A 1KTQA 2IC3A 5LOVB 3CQ8A 1N32B 1A5VA 3UQ8A 4EZ9A 4LNUB 3SV4A 3LDSA 3NGYA 1KCFA 4O4IA 1TV6A 2HHHB 3HPGA 3ASMA 2UXDB 2ZCEA 4X1IA 3LWMA 2YI9A 4CJUA 4FLYA 3O3GA 2YNIA 2IS3A 3L3VA 5BMVB 4KL1A 1WSFA 2GUIA 4FJMA 4DSLA 1RCHA 3VQ5A 3AO1A 3SQ2A 3DLGA 3KLFA 3ZSZA 3QNOA 4JI1B 4PA1A 1T03A 3VQQA 1WSHA 4AILC 1A5XA 5HRNA 4C8NA 2O4GA 4CJEA 4TV9A 4M42A 1VSIA 2XY6A 4H4OA 3QIOA 1HMVA 4W5RA 2D0AA 1FFXA 2RPIA 4KTWA 5CZ1A 2BDPA 2W42A 5BR8B 3AO3A 3QEPA 4TQDA 4CERA 3TWHA 4ID1A 1D5AA 3TARA 1ZYQA 4KI4A 1ITGA 5FDLA 4RW7A 1NK4A 1XWLA 5BMVA 4KHUA 2PYJA 3VQAA 5GONB 2VWJA 4O4IB 3ZSYA 3KLHA 4E1NA 4KB0A 3AO4A 5CYMA 5J2NA 3U10A 1LW2A 1UWBA 3C6UA 1N5YA 1BIUA 4DSJA 4CJKA 1EX4A 4DTXA 3RYHB 4YY3B 2X6NA 1XQ8A 3JALB 2YHBA 4CC6A 4B3RB 1KLMA 3C6TA 4M3XA 4BDZA 4B3MB 2X74A 3NBPA 2HNDA 5KHIA 4B9UA 4KV8A 3THVA 4HVJA 1B92A 4B3SB 4DSEA 4LR3A 4DR6B 1FKPA 2ZIOA 3SUQA 1CZBA 3WB2A 1J5OA 1HNVA 3LP1A 2P5OA 3SZ2A 2DTUA 1ZBHA 1RT5A 3NGIA 2G8FA 4O2BA 4BW9A 3T1YB 1L5UA 4ZIBA 1TL1A 4QAGA 4CIFA 5EIBC 4CJSA 4DV4B 1Q5OA 1SV5A 4DTMA 4DS4A 1VSLA 5CB4B 3OYFA 1LWEA 3SNNA 4AHSA 2HNYA 4M3UA 4KHNA 3L2RA 3KD5E 4OJRA 1WLJA 4C8LA 4DFMA 5JJJB 4N76A 4I7FA 3VQDA 4CEQA 4IG0A 3LNNA 2WONA 4CESA 3EY1A 4CJ3A 2XY7A 1RTDA 2HHUA 1M4UA 3MEEA 1RTJA 3AVMA 3IS9A 3JALA 3WNFA 4O4JB 2GBZA 3AA5X 5LYJA 4ZHQB 1HPZA 4X64B 5KI6A 3KLEA 3VQWA 4E7LA 3TANA 3OYKA 1I3AA 1TK0A 1ZBIA 5FRMA 1NK0A 2Q7EA 2Q7GA 2D0BA 3SQ0A 2FBYA 3JAKA 2FBVA 3PUFA 2E4LA 4I55B 2BGGA 4E7HA 2NUBA 3KJVA 4LF6B 4X1KB 1LAVA 2PTMA 1TKDA 1NKCA 3K57A 2UXCB 1RBTA 3HO1A 1BQMA 1Q8IA 3V81A 1JJOA 4DF8A 2HHWA 1SA0B 4B9LA 5SWMA 2RQ6A 1XC9A 2JS5A 2EHGA 5JQGB 3ZSVA 4Z0UA 4FJXA 2DFHA 2R9AA 1VF7A 1BI4B 4CHQA 3OY9A 1U47A 4K8XA 3KK3A 4M3WA 3JAWA 3JARA 4ID5A 2Q3SA 1HQUA 3NE6A 3K5LA 4HNAB 2RN2A 2YHAA 4CH6A 1U49A 2B4JA 3N2KB 1RT3A 3OVNA 4KHSA 4DV5B 4DV1B 4JI2B 4I2PA 1Q43A 2OWOA 5DMRA 5ITZA 1U4BA 1NK5A 4TSXA 4C8MA 4CJLA 2ETJA 4G1QA 2P51A 3SI6A 1VSHA 4FJ9A 5J2UA 4I55A 1VSKA 3VA0A 1L3TA 1NT2B 2YKMA 4KHWA 3U3GA 1P49A 4LNUA 2YIAA 4CS3A 4ZTJA 4Q5VA 3OYCA 2Y1JA 2BE2A 1QSYA 3OYIA 3OJUA 4YJ3B 4DV7B 2BTOA 1BHLA 4DTRA 1QS4A 3AVBA 4Z4FA 5LA6B 5LYJB 3FFIA 2Z1JA 2G8VA 1KLNA 4FLZA 4NYNA 1M5IA 4CCHA 3L2QA 3PX0A 3O4QA 4CFDA 1RDAA 1N36B 3RFRA 3DLEA 4Q6GA 4I4TB 4DQIA 1Y97A 4F4KA 3V9ZA 3EYZA 1S1XA 5KHHA 1HRHA 2BANA 3O4NA 1J5EB 4CF2A 3HSTB 3JATB 4CHNA 3AA4A 4D7TA 3HM9A 1I7FA 4HUFA 4DTUA 1JLFA 4CEOA 3V4IA 1I94B 4CFCA 4LSNA 4CJWA 3CSXA 3DRRA 3NHGA 3TAGA 1X9MA 3HKBA 1NK8A 3RMDA 4QCLA 1LWFA 3I8DA 1HYSA 4CH3A 3BA9A 4DUYB 1IBLB 5C25A 4GVMA 3K58A 4EFBA 5JJNB 4PUOA 4DV6B 1F21A 2OPPA 2YV0X 4BDPA 4DG1A 4HHTA 1SUQA 3PO4A 1JFFB 1YTUA 3RWUA 1UOCA 4DLEA 4DSKA 2JGUA 3NDKA 1C1CA 1D9FA 4CS4A 4FJHA 2ZNJA 3JATA 4X20B 5C8YB 3TAQA 1KU9A 3V1RA 1C0MA 3OS1A 1JLQA 1TKZA 3LZIA 4UCTA 3WNGA 3HKDA 3DI6A 3CFPA 3UIQA 4YNQA 4CEDA 1WAFA 4W5TA 1TVKB 3HPOA 1L3VA 3OTOB 3NH0A 1ZBUA 4FFBA 4FLXA 3AVCA 4IFYA 3P1GA 1U48A 4O2AB 3E22B 3KK1A 1O9HA 3KKSA 3LAMA 3QO9A 3HXMA 4KTZA 5JH7B 4LFBB 4BACA 3ZT2A 2ITGA 4DK1A 4DUZB 1CXUA 4O5BA 5HRRA 1RSOA 4X62B 5KTQA 4DR1B 3RMBA 1KSPA 4B08A 1T05A 1N33B 1EXQA