2PYJA

Phi29 dna polymerase complexed with primer-template dna and incoming nucleotide substrates (ternary complex)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
567
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTA(DOC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 173
structure length 567
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pyjA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pyjA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pyjA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pyjA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pyjA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pyjA06
3ZT0A 4CF0A 3AA4A 2IS3A 3OJSA 4CF1A 1UA1A 4DSKA 1VSLA 3MEDA 4CERA 4Z4EA 3ALYA 3DRRA 1BISA 1G15A 4E7IA 1ZBUA 1D9DA 2YKMA 4ZTJA 4KREA 1A5WA 1RT5A 4ID1A 5I42A 4FCYA 2XHBA 1WSEA 3PY8A 1O1WA 1JXEA 3ZCMA 4RW4A 3ZSRA 3V1OA 1DTQA 3V81A 4M41A 3HVRA 3TAEA 3LANA 1JLCA 1S9EA 1ZBFA 3LP0A 3TR8A 2GBZA 3KIOA 1TKTA 3LAMA 3OYIA 1Y97A 4E89A 1TL1A 2FBVA 4DSIA 2B4JA 2P51A 3AVFA 4WE1A 3CFRA 2HW3A 1CZBA 5J1EA 4YFUA 1KLMA 4I9LA 4B8AB 4JS4A 4R5PA 3TABA 2XY5A 3SQ2A 2KZMA 1S9GA 1SL1A 4F2SA 3HPOA 2VWJA 5HROA 1YTUA 4KKOA 3ZT1A 3OY9A 3JSMA 2FBXA 1UOCA 4DFJA 1KLNA 3K5MA 1RT2A 2KZZA 4FLZA 1KCFA 5FRNA 4CEFA 3L2WA 2ETJA 5EU7A 3LWMA 3D0PA 4OKKA 3HYFA 3ZSYA 1RDDA 4IG3A 4O44A 4FJJA 1JLBA 4AH9A 1RBUA 2IDOA 3OYGA 1HNVA 5HRRA 3HP6A 4KI6A 2HVHA 4CJSA 3KLFA 4E7KA 3AVNA 3AVIA 4CGHA 1Z25A 1T7PA 1WSIA 3ZSXA 2QKKA 3AVJA 4O5BA 3O3FA 4JRQA 4DTPA 2YHAA 2HNDA 3AVKA 4KHQA 1EKEA 4B9MA 4HUGA 4DSFA 4NCBA 4I7FA 2HHTA 1LAVA 1NOYA 3E01A 4Y1DA 3V1RA 4DQSA 3DI6A 1JLGA 1EP4A 4ZHRA 2RKIA 5T7BA 3SV3A 2DTUA 3K59A 1QSLA 4IKFA 3C95A 4CJ4A 4B8CA 2ATQA 1A5VA 3TAMA 1RT4A 2OYQA 2P5OA 5CZ2A 4FJXA 5HLFA 3VQAA 4CJLA 3QLHA 4FLVA 5C42A 1FXXA 2B6AA 2E6LA 3P1GA 1NK9A 3DLRA 3HM9A 3LZIA 4HUEA 4DS4A 3V9SA 3RRHA 5J2NA 3QERA 1NJWA 2F8SA 2ZQBA 2IOCA 4CHPA 3SZ2A 2HNYA 4H4OA 1RT1A 4CGJA 4PQUA 4KHNA 3LWLA 4CJQA 3OYAA 3NCIA 2G8VA 3I8DA 3VA3A 4FJLA 4GW6A 3AA3A 4H8KA 1S6QA 2BGGA 3OYHA 3QO9A 4RW9A 3NGZA 2OPQA 1BGXT 1N6QA 4OKEA 2HMIA 4IG0A 3DLHA 1Q9XA 4DQIA 2X74A 1ASWA 4DF8A 1TV6A 4E19A 3OJUA 1U45A 4UQGA 4N5SA 1QSYA 4KHWA 3CG7A 3LP3A 3V9WA 2Y1JA 2WOMA 1RBRA 4KFBA 4CIGA 3L8BA 4BE1A 1KFSA 3BDPA 4M3WA 3HXMA 5KRTA 1RBSA 3MAQA 2A1SA 1UA0A 3DLBA 3TWHA 4FM1A 5CYQA 1KVCA 1LAWA 3H08A 4KTWA 4KPYA 3KK1A 4KRFA 1LW2A 3UIQA 1RTDA 1D9FA 4EZ6A 4K8ZA 3VQ7A 4FJHA 1HRHA 3PX4A 4DTUA 4CHQA 3NH2A 1XC9A 2XO7A 3OYEA 4O0JA 1NJXA 1KRPA 2D0AA 3KK3A 4NCGA 4FM0A 1RBTA 1RCHA 3AVBA 4KHSA 3DM2A 4FM2A 3O4QA 4QAGA 3AA5X 4CJKA 4PA1A 3CM5A 1J5OA 3AO1A 1NK0A 1TL3A 2ZE2A 1HYZA 3K58A 4ELUA 3TANA 4FK2A 4BDYA 1HPZA 5K14A 4IFYA 2DFFA 4I2PA 5KGWA 2YKNA 4PUOA 5JS2A 3VA0A 3M8PA 1S5JA 1RILA 2IC3A 4CEAA 5HP1A 5D3GA 2PW9A 4B08A 2OPPA 3ZSWA 4Y1CA 1WLJA 3NF6A 4MFBA 4KB1A 1C0TA 3D45A 1KVAA 1C6VA 2NUBA 4H4MA 1IKVA 1L3SA 3RR8A 4W5RA 3ZSQA 4E1NA 1LV5A 3EYZA 4CJPA 3OYDA 5DK5A 4B9UA 3NAEA 3HJFA 3ASMA 4RW8A 1U04A 3HL8A 4FJ5A 3T19A 2Z1JA 2F96A 5HRNA 2PYLA 2BE2A 4NYFA 4B9VA 4K8XA 1WSGA 4J2BA 2AJQA 2D5RA 1XHXA 2RPIA 4AHUA 4CFAA 2EHGA 3ZT4A 4DU1A 1KSPA 4Z4FA 4GVMA 3IS9A 4IFVA 3MXIA 3OYBA 4ELVA 1ASVA 1T03A 2G8KA 3EY1A 4CIFA 2YHBA 1IKXA 3OYLA 3ULDA 5HRSA 4ELTA 1SL2A 3HO1A 3QIPA 3TI0A 4CGGA 3NGIA 3OVNA 4DWIA 4FJ9A 4CJUA 2QK9A 3SPZA 2G8WA 4N47A 1W9HA 2EX3A 4CJ5A 1Z26A 2PYJA 2P5GA 3VQPA 3TAQA 2PY5A 4FJGA 4CCHA 1L3TA 5JS1A 3SCXA 4KO0A 4FZYA 3T1AA 1T8EA 1N5YA 1X9SA 1WN7A 2VG7A 3AVLA 3VQBA 3OS0A 4I2QA 4JLHA 4DMNA 3CYMA 3DYAA 3HT3A 3DOLA 3VQ9A 1TKDA 2F8TA 3OYKA 3QETA 4F4KA 3KKRA 3TAGA 5C25A 4HTUA 1JLEA 4BACA 1JLFA 4CFDA 1U49A 2Y1IA 1NKCA 1DTTA 4DTNA 3HVTA 4B9TA 2IAJA 4CECA 2W42A 1ZBLA 4E7HA 3SYZA 4CJTA 1SUQA 1HQEA 3A2FA 2VG5A 3AO2A 3L3VA 1B9FA 1JXBA 3B6PA 5KI6A 2JLEA 4FJMA 4B9SA 2YNGA 3PO4A 4FXDA 4FZXC 2HHUA 3SJJA 3LPUA 3O3HA 4DTSA 3VN5A 1R0AA 1IKYA 4LY7A 1VSIA 1JL2A 1KTQA 2QXFA 3LZJA 4CJ3A 2B5JA 2KFZA 3IRXA 1IH7A 2IGIA 1UWBA 4NYNA 3MECA 4EP5A 4CK3A 3OYJA 4DTMA 3NF8A 1YVUA 3DRSA 3L2RA 4DQRA 3PX0A 2Z1IA 4CEQA 3OYCA 5KRSA 4CK1A 4XIUA 3OS2A 4PY5A 2DFHA 3SUPA 3RWUA 4N41A 4KHYA 1BQNA 2VWKA 1WSFA 3AO3A 1VSKA 2HNZA 4CHYA 4DG1A 3QEPA 4OJRA 3PV8A 4FJ7A 3THVA 1VRTA 1BI4B 1YTAA 1U4BA 1SL0A 4KAZA 4M3XA 4CHNA 4W5TA 4IBNA 4CJVA 4JS5A 3VQDA 4HCBA 1LW0A 1VRUA 2YNIA 4DTRA 1NK5A 3V9XA 2HHVA 3M8SA 4DTOA 3WNHA 3RR7A 1MU2A 3SUQA 4AHTA 3AVAA 4OVLA 3RTVA 4DU4A 1W0HA 3I0RA 1RDBA 2BANA 2ITGA 4Q5VA 1U48A 3C6TA 4KHUA 1NKBA 2G8HA 1HJRA 1C1BA 4TSXA 4PWDA 2I5JA 1QSSA 1J54A 4FJNA 1RTIA 2OZSA 1HYVA 3K5OA 3MEEA 3CFPA 1TK8A 1GOCA 2FBTA 4RW6A 1NK4A 4DQPA 4FK4A 4FVMA 2OZMA 3ZT3A 3HK2A 4F3TA 2KFNA 1RDAA 1VSHA 4LD0A 3NF9A 4DFKA 3WNEA 2XY7A 4RG8A 3S3NA 4CEEA 3ISNC 4W5QA 4J2DA 3G10A 4Q0BA 1Q9YA 1FKPA 4AHRA 1U47A 4J2AA 1JKHA 4FJIA 1GOBA 3KK2A 4OPJA 1NK8A 2HVIA 4OPKA 3AVGA 3NF7A 1TK5A 2RN2A 2A1RA 3TARA 1WAFA 4F3OA 2G8IA 1CLQA 1HQUA 4DF4A 4J2EA 4CJFA 3OYMA 1RBVA 2E6MA 3LP1A 3HP9A 4Z0UA 2YNHA 4CF2A 3QNOA 3S9HA 1SKSA 1ZBHA 4CGDA 4CJWA 3TAPA 2DFEA 3PX6A 3L2VA 1L5UA 5FROA 4KB0A 3C6UA 3AVCA 3RMCA 1IKWA 3NBPA 2X6SA 4CJRA 1UAXA 1BHLA 3VQCA 1BIZA 4E7JA 3SUOA 5FDLA 4F8RA 3SQ1A 3HSTB 1SKRA 4CGIA 4Z4IA 1HYSA 3QEWA 1B9DA 2XY8A 3FI7A 1WAJA 2G8UA 3V6DA 4B3OA 1S1TA 1ASUA 3HPHA 1S1VA 1T05A 4CF8A 1HNIA 3L3UA 1VSJA 3U3GA 3ZT2A 4BE0A 1CXQA 2DY4A 4AILC 3QEXA 4O4GA 3MEGA 4G1QA 2GV9A 2VG6A 1QE1A 4EP4A 2FBYA 3AV9A 5DMRA 4FW1A 3M8QA 3VQ5A 1TGOA 3DLGA 3LPTA 3JYTA 1Q8IA 1I39A 3OYFA 4BE2A 2YV0X 3SPYA 4CESA 1D5AA 3K5NA 2HHQA 1BI4A 4AHVA 3L2UA 4CE9A 3RMAA 3RMBA 1FK9A 3KJVA 1S1XA 2KW4A 1TAQA 4E1MA 4E3SA 1NK6A 4CEZA 3CQ8A 4C8LA 3G0ZA 4CF9A 4FLTA 3NFAA 4FYDA 1RTJA 4OLAA 3C94A 5I3UA 5KGXA 1J9AA 1I3AA 4FK0A 1BIUA 3NE6A 4FLWA 1C0MA 3VQEA 1WNSA 4E0DA 4EZ9A 2P1JA 2X6NA 3KLIA 4DSLA 1YT3A 4CEOA 3AO5A 4M45A 3O3GA 4FW2A 3IG1A 4CIEA 1L3VA 2O4IA 4HCCA 4CFCA 4C8OA 4DSJA 1WSJA 1VSEA 4DLGA 1REVA 3QEIA 1B92A 3SQ0A 4DTJA 2HHWA 3SUNA 2BDPA 5HRPA 1L3UA 3VQ6A 4FLUA 1S1UA 5C24A 2WONA 4HHTA 3AVMA 1RT3A 3LP2A 2O4GA 4OGCA 3ZSOA 1S1WA 3M8RA 4DFPA 1LWEA 4ID5A 4LSLA 3KLGA 3KLHA 1ZBIA 3I0SA 1F21A 4KI4A 5SWMA 4W5NA 3NGYA 1TVRA 1VK0A 4FJ8A 2HB5A 4OGEA 4B9NA 1SV5A 3LAKA 4Z4CA 3EZ5A 3K5LA 3LDSA 1K6YA 2R7YA 4M42A 1RDCA 5SZTA 3P83D 1KFDA 4BDZA 3NDKA 3LALA 1WSHA 3PUFA 1IG9A 3O4NA 1QQCA 1EETA 1NKEA 3QESA 3SQ4A 1JLAA 2ZD1A 4LSNA 3VQQA 3TAFA 3KD5E 1BCOA 3RRGA 2Q3SA 4CEDA 1RT6A 1X1PA 1NJYA 3KTQA 4NCAA 1J53A 3HPGA 3ZSZA 2OA8A 4M3ZA 1C0UA 4BWMA 1RT7A 2D0BA 3VQ8A 3V9ZA 4B9LA 2HHXA 3DOKA 2RF2A 4QCLA 1NJZA 2OPSA 1FKOA 4Z4GA 1JL1A 4F2RA 1JLQA 4CJEA 1C1CA 1GOAA 3K57A 3KD1E 1EXQA 5CZ1A 5HBMA 1XWLA 4LH5A 4DTXA 3KLEA 3U6FA 1X9WA 4OKJA 4CEBA 3F73A 4KTZA 1XHZA 4CHOA 2HHSA 3DMJA 2FC0A 4BWJA 5J2PA 4I9QA 1TKXA 3MXJA 4DSEA 4DFMA 1QHTA 4KTQA 1BCMA 4AHCA 1VSMA 2Z1HA 1LWFA 3V4IA 3QINA 3VQ4A 4AHSA 1XI1A 1S6PA 2E4LA 4E7LA 5J2MA 1HMVA 2D0CA 4O55A 1TK0A 4M3YA 1QTMA 3CFOA 3DLKA 1VSDA 3S3MA 4FLYA 4CGFA 3WNFA 3NHGA 1KVBA 4DLEA 1CZ9A 4O0IA 2GUIA 2LSNA 3V1QA 2YNFA 2G8FA 3SV4A 4BDPA 4RW7A 4Z4HA 4YNQA 1RTHA 3V9UA 1DLOA 2XRIA 1TKZA 3K2PA 1D8YA 4N76A 3P5JA 4M3UA 4JRPA 1SKWA 4M3RA 4OLBA 4CK2A 3NH0A 3QEVA 5J2QA 1BL3A 4GMJB 4KV8A 2X78A 4QOZB 3B6OA 3AVHA 1EX4A 3U3YA 4FZZA 3KKSA 2R7FA 3QIOA 4IDKA 4L8RB 3ITHA 2PZSA 3NH1A 1ITGA 4N56A 3RMDA 3FFIA 2Z1GA 4C8MA 3L2QA 4DU3A 5CYMA 4DQQA 4FJKA 1QS4A 1A5XA 3WNGA 3PO5A 3T3FA 3BGRA 4HUFA 4C8NA 1NK7A 1CXUA 3F9KA 3S3OA 4ZTFA 4CFBA 3SNNA 2QKBA 1BQMA 3IAYA 2OPRA 4ICLA 4CHZA 1VSFA 5KTQA 3OYNA 5FRMA 3AA2A 3AO4A 3OS1A 3MXMA 1TAUA 3ZSVA 5CY4A 4FLXA 4MQ3A 3CM6A 4W5OA 4DS5A 3SI6A 1RNHA 1IO2A 4LH4A 1C1AA 4HVJA 2XY6A 5E41A 2KTQA 2JGUA 4M3TA 1LWCA 1NOZA 3DLEA 1X9MA 3QNNA 3DRPA 4C8KA 2KQ2A 1ZYQA
chains in the Genus database with same CATH superfamily
2UUBO 2ODMA 1WB9A 3UCSC 3J81O 4DSKA 2QM7A 5BN9A 5JLFA 5AQFA 4CERA 3CWBH 5H9CA 1BISA 1YI2N 1D9DA 4LF8B 1I5XA 4KREA 5LMUK 1A5WA 5I42A 4FCYA 1G8MA 2CDYA 2XHBA 1WSEA 2NR5A 4DR1B 3M8AA 2HMPA 1WB7A 3HOTA 3TXQA 3HVRA 5KAFZ 3TAEA 3P4IA 4DRXA 4IGGA 5LP6C 2CTPA 1SQQH 4DR2K 3EXAA 2GBZA 3KIOA 1TKTA 5CE3A 3SAFA 3AK3A 5BXZA 3CF5L 3CCQV 2QA4N 4E89A 1TL1A 1VHXA 4BR0A 2WUSA 4UVBA 3TK1A 2FBVA 5HL7L 2YIAA 1HNWK 3AVFA 4CW7B 2HW3A 3K9SA 5C3JA 1ORQC 2YC0A 1YF2A 1HW7A 4YIOA 4JYAK 4OXSA 4NXMO 3CMEN 2KZMA 1Y76A 1ZUQA 2LP7A 3OEEG 1R3LC 1YHQV 1KYOF 4FIPC 1RP3B 3ZT1A 5LHIA 1BWFO 4AM6A 3OY9A 1BE3H 2FBXA 1UOCA 2Q0UA 1U96A 2P9PB 4DFJA 3R65A 3K5MA 1KLNA 3AEFA 5JQGA 2E5LK 1K5QA 2YSUB 1RT2A 4A61A 5B3SB 2WA4A 1W59A 5KHGA 2UXCO 3D0PA 5EU7A 3LWMA 4I50A 4BRNA 4PI2A 1ATNA 3ZSYA 4O44A 3CE2A 2H94A 1X3MA 3OYGA 5HRRA 4KI6A 5IWAO 2HVHA 2H3GX 4CJSA 4JI0K 3AVNA 4CGHA 3RYCA 3D2FB 3ENHA 3T4DA 1VQ9N 3LDCA 1VQNN 4O5BA 3O3FA 1K8AO 1VRH4 1K3EA 3WEEB 3AVKA 1NZ6A 4MVUA 5GAEP 4KHQA 4P30A 2KKWA 5F0XA 3F9MA 4HUGA 4B9MA 4NCBA 2HHTA 5IT9N 3L4QA 3V1RA 3O65A 1PNKA 5BPNA 3WXLA 1BCCH 4LF9O 1JLGA 5BN8A 3H1QA 2ASMA 3BF3A 5A2QO 4DR6B 3ZRXA 3QFUA 4CJ4A 1A5VA 3C3TA 3L70H 3X2QC 4KH6A 2RCVA 1N0JA 3MK6A 2ZM6B 1WBDA 5FNVA 4CZGA 2WP9A 1GH6A 2Q2RA 3MD0A 3LDNA 2F1MA 4GV3A 4X1KA 3WB1A 2B6AA 1K73O 2RS54 2BOCC 4Z94A 5J2NA 2NZTA 3H1LH 1W0JG 3GL1A 2QKSA 4H0XB 1GLJO 4KHNA 3O5BA 3WB2A 4PA6A 2FSNA 2XASA 3I8DA 5CA1B 3VA3A 3G71N 4H8KA 1R59O 1N36O 4JTDB 1O9HA 4MVZA 3A0RA 4E2LA 1XUQA 4LF6B 4H33A 2IVNA 3NGZA 2OPQA 5AQZA 4LFCK 1BGXT 1N6QA 4OKEA 3Q4HB 2CTRA 3K06A 3DLHA 1Q9XA 1ASWA 4JAAA 1VQ4N 2BE3A 3UKUA 4BR7A 1QSYA 3MMVA 3IGAC 1OCCC 2BTFA 3V9WA 4DV6K 2WOMA 3AK1A 1RBRA 4M3WA 3L8BA 1P84F 1D4XA 4MVSA 2R9RB 2EIMC 4WCEV 3TWHA 4FM1A 4WQ5A 1KVCA 1R73A 4KTWA 4JI1B 3KK1A 2CTWA 4LF5B 4JI7B 3UIQA 1SF9A 4O4JA 3I5DA 3FZKA 1RTDA 1D9FA 4FJHA 3ZMVA 3C7NA 1WUAA 4TV8A 4FPBA 3LNMB 1MMMA 4JKEA 5KLVH 1K4DC 3RYHB 1NJXA 1NENA 3ZRWB 2VGNA 4NCGA 1RBTA 1R084 2X6AA 3DM2A 4FM2A 2WLLB 3VMFB 3CCLN 3AA5X 3AEDA 1VF6C 3SJAC 3NMUA 4Q4Y4 3IKMA 3K58A 4ELUA 1TUYA 4BDYA 5CHIA 3THWA 4EFHA 2PBDA 4I2PA 4IFYA 3B8MA 1S5JA 4B08A 3EZWA 2OPPA 3NVKA 3SYOA 1MWKA 3HSCA 4JTAB 2Q0OC 3HKEA 5FLXO 2A40A 1SZTA 2QTOA 1C0TA 3VEVA 2GWKA 1XILA 2NUBA 3D45A 3M5RA 2XAQA 5AZIA 3ZSQA 1LV5A 2P4KA 1H8HG 3H1HH 2YHWA 5DM6L 4LWSA 2WLKA 5AQXA 1GLCG 4ZI7A 4BRMA 2P9NB 1XMQK 2Z1JA 4I4TA 3E83A 2LO1A 2FYUH 2GHYA 2YEVA 4NYFA 5HRNA 1GO3F 4K8XA 1AJQA 2OCEA 4J2BA 4QPJA 4Z4FA 2AJQA 4JI2O 2O8FA 1BHAA 4GVMA 3ETQA 5AQPA 3OYBA 1PPJH 1T03A 3E22A 3EY1A 4CIFA 1L0NH 4ELTA 5BREA 4Q4X4 5C8YB 3QIPA 1M57C 3DXKB 3HM8A 4DWIA 4FJ9A 3VEZA 4CJUA 1FJGK 4B3SK 4JKDA 1JCHA 2EX3A 2H88A 1Z26A 1F4MA 1WP7A 3VQPA 1XNQK 2PY5A 2Q6AA 2YXYA 3J7AU 4CCHA 3O4WA 3U0ZA 1NGEA 3AEIA 5LGUA 4MS2A 1MG1A 1WN7A 2ZR3A 5KA6A 4IJAA 4FZ0A 3WUHA 1N32B 3AVLA 2M6YA 1S72V 2ZCEA 2W6JG 1EN6A 2OANA 1XEQA 4LF8K 5LYJB 4I2QA 3AAPA 2RJZA 3CYMA 3DYAA 3HT3A 1G1XB 3FAVA 3DOLA 1TKDA 2F8TA 1FXVA 4YOWA 4HTUA 1JLEA 4BACA 4CFDA 2UUBB 1NKCA 2Y1IA 1LOTB 3AE1A 3CC4V 2WLIA 1DTTA 2DWDC 2RN9A 1HKGA 4ABMA 3PSFA 2UXNA 1US6A 2EILB 5JJEB 3L4IA 1YITV 1S5HC 1P7GA 3GG4A 4CS2A 5CB4A 5L3CA 4JASA 3M3ZA 4FZXC 2AP1A 3O3HA 3N2GB 1RUG4 3C6AA 5EVZA 1JL2A 2QXFA 4K0KB 1SESA 3H3NO 5LMUO 4CJ3A 1HX1A 2KFZA 1QR9A 2PI5A 4NYNA 2IGIA 4CK3A 4DTMA 4MVQA 3ASOB 2W0XA 3VQYA 3CJBA 2Z1IA 1WA8B 4NYKA 4CEQA 4DR2O 3SUPA 1Q43A 1ZAUA 5A9GA 5AQWA 1R6KA 3G67A 4TQDA 4IZ9A 1NR1A 2Q5ZA 2HNZA 3RVZA 3HKCB 4OJRA 3PV8A 3THVA 3AG1C 1HNWO 4H5VA 4CHNA 2A5XA 2HWC4 3CCEV 2Q31A 4IIJB 5IYDO 4JYAO 2ADQB 4HCBA 1B3QA 2YNIA 4FOIA 1NK5A 3P4QA 4H5WA 3M8SA 3E8GA 3WNHA 1OCZB 4O2BB 1HUXA 3L74H 5KQ8A 3RTVA 5JWPA 1RDBA 4YJ2B 3C6TA 2G8HA 2IH1C 3H1IH 3SJHA 2E5LO 1O13A 2I5JA 1QSSA 5IWAB 1S77D 1J54A 1G4YB 4DR6K 3HR0A 4GUNA 2F93B 3MEEA 2WLNA 2PGGA 5KX5A 2HJDA 1AR5A 3HB3B 1GOCA 4JKGB 4RW6A 1TK8A 2PFUA 5DEDA 1QZ5A 2FXUA 3D2EB 1OH7A 4DK0A 1D2DA 3CCRV 1RDAA 3CXCU 4LD0A 4TOIA 4JI0O 5C0YA 3LNNA 4WFAL 4W5QA 3ISNC 4LF9B 3AAQA 1Q9YA 1COV4 3BHPA 3FKSG 2YIDA 4CZJA 4PDVA 4OPKA 1NU0A 4RWTA 1EZVH 3D2FA 2A0LA 2HLDG 1WAFA 4DR3O 3TARA 2G8IA 1CLQA 4J2EA 2FLOA 3FYIB 4JD2B 2E6MA 2MW2B 3HP9A 4Z0UA 3WEEA 3S9HA 2UUCK 3SDLA 3E2EA 1PNMA 5TKWA 1KP3A 5DM6V 2GX9A 3MN6A 3RMCA 5F2VO 2GEMA 2O8BA 1UAXA 2JWLA 3VQCA 3VENA 3QBXA 4PL8A 4YDUA 4IL6Z 2ZF5O 4PL7A 4FFKA 2XY8A 3K04A 3QEWA 1S1TA 1ASUA 3O9RA 2YCHA 4EEQA 3MX2A 4LFAK 2YI1A 2JGDB 1YVNA 3K0DA 5LJVA 4JI1K 3ZT2A 3DWLA 3RWRD 1CXQA 3ASNC 3ABUA 3QEXA 3B09A 3D6RA 4U3JB 1Q6IA 3BAAA 3QTCA 2UYTA 5DMRA 4LFCO 3M8QA 2B5UA 4LCUC 1TGOA 3DLGA 3LPTA 2OIGA 5CA1A 3JXUA 2R9IA 2CAZC 3K5NA 5AQYA 3ZX2A 4EIAA 4R79A 3ML0A 1NGIA 3GQHA 1KQSM 1TAQA 4E1MA 4E3SA 4CEZA 4DV6O 2GBOA 4B3RK 3AG7A 5EC2C 4CF9A 3BPZA 4FYDA 2OWOA 5BR9A 2ADPA 3FZLA 5I3UA 2ZXWC 1AJNA 1D4M4 4O2AB 4MTOA 3VESA 3NE6A 4FK5C 3SGIA 3RYFB 3N2KB 1MNGA 3CB2A 3LSUA 5AZJB 4DHYA 1L3VA 1VQLN 4IKFA 4FFBB 3U11A 4U3FH 2NN4A 2WPDG 1IXMA 4Z1MG 4DSJA 1VSEA 4DLGA 3QEIA 1KAXA 4YJ3B 2R064 2EIKC 2V4DA 3OMIB 3VQ6A 4CH4A 1OOPD 4CH5A 1EZJA 4YOTA 1DLBA 3RYHA 3JD74 3B2EE 5D5PA 5KMGA 1RT3A 1YTFB 1S1WA 2O4GA 4WQ5C 3ZSOA 2F4VK 3THYB 3ZRWA 3VRBA 2DYSC 5CN0A 1F21A 4BAYA 2IJIA 4FJ8A 3WFVA 4Z4CA 4NR1A 1RUI4 4M42A 3NDKA 5C2TA 3O4NA 3FE1A 1VBB4 4DV3B 1JMKC 1AI5A 3G71V 1AJPA 1JLAA 3GBTA 4JI2B 3QESA 3KD5E 1OHHG 4CEDA 3WG7B 1BEV4 3DXMB 1SS6A 1X1PA 3CETA 3JBG4 2MK3A 1NGJA 4NCAA 1XMQO 3QBWA 5H6QA 2RMKB 5M1KA 2NRZA 2D0BA 2OIEA 2ZGZA 4B9LA 2HHXA 1S0VA 3WT0A 1N32K 1VQ4V 1NJZA 1BG3A 3U9DA 1VQKN 2E2PA 2P9NA 4F2RA 3TETA 4CJEA 5AR0A 2E75B 4BGAA 1VQ8N 1C1CA 3K57A 4B1UB 3HZ6A 5HBMA 3U6FA 3UB5A 2DN9A 1P90A 4BRHA 2JEUA 4CHOA 2HHSA 1ROPA 5J2PA 2P9UB 4FWQA 4BWJA 1PL4A 4C23A 4DFMA 5C8YA 3M1FA 1XNQO 3ZN0A 1BCMA 2RHKA 3DLLL 3N27A 2Z1HA 1LWFA 2HBLA 4D6TH 3V4IA 3QINA 3VQ4A 1CXZB 5KHKA 1XI1A 4QS7A 4A62A 4BRFA 3GWOA 4E7LA 1AROP 1RDUA 2LJ2A 3ETGA 3RVYA 4YORA 2KSDA 1TK0A 1Q82O 1BGYH 4E1JA 1VSDA 4LF8O 4K0KK 4DLEA 4NLCA 2GUIA 3V1QA 4JAXA 4PV1B 3D8CA 4MLEA 5LA6A 2YICA 1QU7A 2FSKA 1RTHA 3CHWA 1Y76B 1DLOA 1RMU4 4DR5K 3WXMB 5LYJA 4DV5O 4X9QA 4CK2A 3NH0A 5J2QA 3B40A 1BL3A 1AILA 1QLEB 2Q0AA 5LL6Z 3DSQA 1AR74 5JQGB 2X7RB 3U9ZA 3OR7C 2EIJB 3UT5A 3ITHA 1Q5OA 2YS8A 5H2FZ 1YEWA 4Z1VA 2QJ1A 1ITGA 2IVPA 3NH1A 4RHV4 1FPOA 4C8MA 1X9JA 5CYMA 4UUJC 4XH4A 4JHDA 2ZJPL 4H0YB 4FJKA 3CQYA 1WLEA 4DR2B 3BGRA 4K3AA 3ZETA 4N21A 4WQ4A 3SMPA 3MN5A 2ITDC 4ICLA 4BRAA 3N2GA 5KPRA 5KTQA 1BA1A 3BCCH 2P90A 3OYNA 3SYAA 2QKCA 3AO4A 4YSXA 2UU9B 4FJCC 4NKGB 2FF3B 1IV0A 1EAH4 3CEIA 4JYAB 4HVJA 3CIPA 2LQTA 4GV6A 1HRI4 2Q7HA 5FL7G 1HJOA 3CRMA 1GM7A 5GONB 3QNNA 1HP8A 3P30A 4PD4F 5AQGA 3ZT0A 3AA4A 2IS3A 1NLVA 1VP7A 2QWOA 3HKCA 4CF1A 1UA1A 3K0GA 1WBBA 2ETNA 3FLCO 4PA4A 1VSLA 1G15A 4B7EA 2RNBA 2ILMA 5LHGA 4ZTJA 4ASUG 5IT9O 4YHHO 4IIJA 1YSCA 4JYCA 5B5EZ 3I55N 3OM3B 3ZCMA 4JI0B 4O2BA 3J80N 4BIZA 1DTQA 4M41A 4YJ2A 3LANA 2R9AA 1Q81W 4MDBA 1ZBFA 1V4TA 3RYIB 5KPZA 1IBLK 2EULA 3OTFA 5CMUA 1Y97A 1BOTO 4DR3B 1K9MW 3AG4B 3ABVA 2DW4A 2P51A 3CFRA 3D2EA 3AECA 3E8BA 1YJWV 5M1QA 1KLMA 4I9LA 4UCUA 2XY5A 3CJ9A 1S9GA 4IEIA 3HPOA 3H1JH 4KKOA 4I7ZB 3CD6N 3FFKB 3KWGA 2UUCO 4YOXA 5B3SC 4O4JB 5CBHA 4JKHA 3ZX6A 1KCFA 2XAGA 3C7NB 1VQMN 4TV8B 4BC3A 5FRNA 3JATA 4ZBMA 5EBMC 1JCGA 2E2QA 2WC9A 5AQOA 3MDQA 3ID6A 1MZEA 1RDDA 1JLBA 4GKJK 2IDOA 3A8YA 1DTOA 4I6MA 3W0LA 4BVPA 3EFFK 4LC1A 3I56N 1FXHA 4LFCB 1OH5A 3AVIA 4LFAO 1WSIA 4BR9A 4YXDA 3ZSXA 4CS4A 3AVJA 4XBFA 5EY4A 1AR64 3THWB 4JRQA 4DTPA 2AZ2A 2E1ZA 4X1IB 4X8AA 1M5IA 1Q86O 2A3QA 3E01A 4Y1DA 5GW7A 1NJIO 3DI6A 4I5SA 5GTHZ 1EP4A 2Q0RA 2RKIA 1KD1W 4P9PA 3A8TA 4U3JA 1R3JC 2OYQA 1KBHA 5CZ2A 5AZIB 4FJXA 5HLFA 3VF4A 1SC5B 2XOKG 4B3RO 4CJLA 4K42A 5FPOA 4L87A 1NK9A 3GE1A 3AY9A 3DLRA 4DS4A 2ZR2A 1YDXA 3JD3A 1QQOA 4IO8A 3RRHA 1SS3A 5KHJA 4CHPA 2YEVB 4I9WA 3H01A 1RT1A 1YF5L 4WYBA 2FL4A 3AG3B 1T44A 4CGJA 2O8FB 3SPHA 5LHHA 3NCIA 1BUPA 3MWPA 2G8VA 4O2AA 4YY3O 3BZCA 3AA3A 4DV3K 1BA0A 3RYFA 3QO9A 4JI2K 1QVFM 3N2KA 4P9OA 5AZJA 1K7DA 4WFBL 3F5WC 2X74A 4KL1A 1TV6A 1YJ9N 2F4VO 3FYEB 2WFBA 5IDJA 4KHWA 4IJNA 1M1KO 4ZIBA 4XDKA 4JN4A 2ZDIA 3FD9A 3W7XA 3BDPA 2EINB 4QE9A 5KRTA 3QO7A 3THYA 1TUEB 1NR7A 1THZA 2CTQA 3ETDA 1XMQB 2CGJA 4CZMA 3FAVB 2LW7A 2NNWA 3VQ7A 4O4HA 1R3KC 2QWMA 3RSEB 3NH2A 1NGAA 3W3DA 4J7KA 3IUCA 1Y67A 3WU2Z 2QEXV 4O0JA 1KRPA 2WA3A 1HXS4 5EC1C 3AVBA 2Q8VA 1RUF4 1I7FA 2AXTZ 4J80A 4CJKA 1N32O 3CM5A 3ZMSA 3ATVA 3DXMA 1GLEG 1HYZA 4W4KA 5L3FA 2R074 1PVC4 5K14A 5KGWA 4PUOA 5JS2A 4X66B 2A7WA 2GUZA 5HP1A 1FS0G 1XQ8A 1KECA 1ILYA 3GQKA 3ZSWA 2D2CB 4WFGA 1RDWX 4KB1A 4TSFG 3JD2A 2QXLA 2P9KA 3RR8A 1QLNA 3EYZA 4FPAA 3TJTA 5AQJA 4X88A 1R3IC 2Q9LA 2P9UA 1S22A 1VARA 4RW8A 3GDQA 4DKWA 4FJ5A 1AR4A 4DV5B 4DR4B 4K0KO 4B9VA 3U8XA 2EJ7A 3TSUA 1I5YA 3CCJN 3ZHQA 1NGCA 4R8CA 1XBLA 1W97L 5C10A 5IY5B 4ELVA 2G8KA 4DR5O 1IKXA 1QHAA 3ULDA 5AG2A 1HDJA 2UU9K 1MDUB 3NGIA 3ICXA 5AQVA 2XNDG 2QWLA 1ZOYA 5LGNA 3SPZA 1W9HA 1RM1B 1JPXA 3O80A 2E20A 2P5GA 2WDVA 3OEHG 5KX5B 1L3TA 1W7AA 3T1AA 2O8EA 1T8EA 1N5YA 2D4WA 4A2BA 2QDOA 2AHZA 4UCTA 2VG7A 3E1YA 3S3XA 3VQBA 4B1VA 4BRKA 4B1YB 4U7BA 4MVOA 3CSXA 1DK1A 1K8AW 3ZN1A 1EN4A 5ITZB 4QPKA 1OCOC 5BPMA 3R3LA 4PKGA 3QETA 3EKUA 5C25A 4GZRB 1SQGA 1MOFA 2ZD9A 3IDHA 1EWRA 1ZSPA 3CJHB 4UFZA 4C1NI 4CECA 4B3TB 2EILC 3ZS8C 4G28B 2W42A 1ZBLA 4CJTA 2PF4E 4YHHB 4WQ4C 1B9FA 1JXBA 1NMDA 4DR3K 1MABG 2JLEA 4BY9C 2DJVA 2NRTA 2QTDA 2YNGA 4KHPB 3CJ1A 1K73W 5J9PC 2O8BB 2A41A 4DTSA 5GONA 1R0AA 1IKYA 3SJBC 3LZJA 1I0HA 3ASOC 3OYJA 3AE3A 1UWBA 3MECA 4DUZO 4CVNE 5LMNK 2OTJN 4GKKB 4PHTX 3SBTA 1KF6A 2CGKA 5KRSA 1GAXA 2W6KA 3W7TA 4PKIA 2DFHA 3SLCA 5CA3A 4WFBV 4JK9A 3RWUA 4N41A 1BQNA 2O8CA 1NMNA 1VSKA 3E66A 2HBJA 1NH2D 2YDEA 4GVEA 4KAZA 3LM9A 3K03A 2UUCB 1SA0A 5BPLA 3RYIA 4JS5A 2EBOA 3OD4A 2F66C 4DTRA 1FXKB 1VQ5V 4DTOA 4DUYO 3RR7A 4HAMA 1RUD4 4AHTA 3A5MC 3AVAA 4OVLA 4GX0A 1U48A 2D0PA 1HJRA 4TSXA 1JJOA 2HVKC 2WQYA 4FJNA 1RTIA 5M1PA 3DTUB 4LFAB 1HYVA 1VQOV 3K9KA 4BG8A 5AQIA 1NK4A 4FK4A 4F3TA 4GKJO 3VQWA 2Z5UA 1VSHA 1T6DA 1URFA 3WNEA 1Y6XA 2XY7A 1ATRA 3K0SA 2HVJC 1VBE4 5KMGB 4CEEA 4Q0BA 4A57A 4NTYA 3CCVV 3CMAV 3D36A 4AHRA 1JKHA 4F6RA 3ZRVA 3W7UA 1BSMA 1B6QA 1GOBA 4OPJA 1NK8A 3ZIAG 4A5UB 1P4RA 4NTXA 3G80A 3JAMN 3AVGA 3NF7A 2HVIA 3VRAA 4B3RB 3AEEA 4KH5A 2HF4A 1IBKK 4CJFA 3VQXA 3LP1A 2YNHA 1B06A 4JKCA 4X1IA 2ZE6A 1K8KB 4MW8A 2DFEA 1PIV4 3JSNA 4X1YB 3L2VA 1VQPN 5FROA 1YIJN 1L5UA 1JA8A 2FTKA 3OAAG 3C6UA 4WF9L 3VTIA 4OX9K 3NBPA 2X6SA 4O8UA 1CEZA 2VQEO 1BHLA 4CJRA 1M56B 3LL3A 5FDLA 4YY3B 4V19S 1SKRA 4DB3A 4H37A 2AW9A 4FMTA 2IIRA 5J2TB 1JVMA 1IX9A 3FR0A 3TU5A 1WAJA 4H03B 3HPHA 1S1VA 2RS14 1VEWA 4TUYA 4HBNA 4MO4A 3G6EN 3U3GA 1VAZA 4RUEA 4AILC 4JI8O 1WPBA 2F4VB 4G1QA 2GV9A 2VG6A 1VQ6N 1PNLA 2Q67A 4DV3O 1NTMH 1WAZA 1YCIA 1KC8O 3AK2A 2FBYA 1KQSU 1H1VA 4FW1A 1LUVA 4FPPA 3VQ5A 1WOQA 3T1HB 2VRZA 1I39A 3OYFA 2YV0X 1W2BM 1RHI4 1BI4A 3RMAA 4CH3A 5D5QA 5FPNA 3TTFA 2KW4A 1NK6A 1RVF4 4BQZA 3G0ZA 3L73H 2ZNIA 3M6GA 5KGXA 4Q4W4 1I3AA 4FK0A 4X66K 3J7YP 1X9SA 5JH7A 2UXDB 1WNSA 4E0DA 4EZ9A 5TKYA 1POV0 3EE9A 1J5EK 1H2MA 5LA6B 2IW5A 3BY6A 4M45A 2L35A 4FW2A 4CIEA 1NQTA 4EFEA 4CD3A 2O4IA 3AE4A 4HCCA 2ZIMA 3QVNA 5EOYA 3HPLC 1WSJA 3FB6C 3UM7A 4PDRA 2HHWA 2BDPA 1RFYA 1S1UA 3RSEA 4QGPA 1JCEA 2WONA 4HHTA 3UT5B 1COWG 3DC6A 3LP2A 4DV5K 4DR4K 1X59A 3ABMB 3ULEB 2JRIA 4JYYA 1LWEA 4ID5A 3CC7V 3KLHA 4D7TA 2KQXA 3I0SA 4W5NA 2QWRB 3JD4A 3CCSV 3NGYA 3OT7A 4JHDB 1SV5A 3LAKA 3ZETB 3LDSA 1SQVH 2R7YA 4KX6A 1L0LH 4OGQB 1KKDA 2NLXA 3I8BA 1MA1A 1IJJA 2HBMA 3AE2A 3LALA 3PUFA 4FOEA 2RMU4 1MSDA 1PM9A 3AEAA 1QQCA 1EETA 3EKSA 3VEWA 3SQ4A 4DW0A 1NKEA 3WG7C 3AEGA 2ZINA 2Q36A 2Q3SA 3RRGA 1OJHA 3CXHF 5M1OA 3JD1A 4BWAA 5EK0A 1ZBSA 4DR5B 1J53A 4M3ZA 3ZSZA 2OA8A 1C0UA 1W0KG 1DF4A 3BRCA 1RT7A 2IM9A 3V9ZA 2HP8A 2H8PC 2RF2A 2A06H 2YI9A 4QCLA 2LGWA 1N4CA 1FKOA 2YIBD 1XDCA 2QWOB 4AQYB 1JL1A 5B1BC 1C0GA 4H0PA 2ZJQL 4CJ7A 3NVMA 5I9EB 1EXQA 2UU9O 5JVDB 3OR6C 4JAUA 2ASPA 4EFBA 1XHZA 3A5NC 1DEJA 1MWMA 4B3TK 2DOSA 4JK7A 3RGBA 3VETA 4AHCA 3AEBA 4CS3A 2GTAA 2XAJA 1VSMA 4Y0WA 3ZX3A 3FZHA 4YHHK 4AHSA 4FWSA 1S6PA 4CZLA 2ZT9B 1T5EA 4KHPK 3A0HZ 3AGKA 1V55B 4IXCA 3VPZA 2OTLV 1JX9A 2FB5A 4FLYA 2QWNA 5K1PA 3WNFA 3NHGA 1GN2A 3KKYA 1KVBA 2KHOA 4J9ZB 1T6CA 1JFFB 4I0XB 4O4IB 3RBZA 3SV4A 5B1AB 3CRRA 1BHBA 3LDLA 4Z4HA 3V9UA 3APQA 3J80O 4B7KA 2P9SB 3ENOA 4GKKK 3AE6A 4M3UA 2WDQA 5E26A 4Q6GA 1QLEC 4GMJB 4KV8A 2X78A 3CCMN 5ITZA 3VR8A 2EJRA 2R044 1EX4A 2EIJC 3KZBA 4FZZA 2R7FA 1OCCB 1QBZA 1YI2V 4B1WB 2RE2A 4L8RB 1EN5A 3CJHA 3JATB 4DUZB 1XC3A 3CHXA 4O5FA 3FFIA 3U4LA 3H46O 4BR6A 3VEYA 1A5XA 4M7YA 3WNGA 2DQ0A 4I6MB 5TISZ 4YTMA 2WS3A 1CXUA 3F9KA 4ZTFA 4CFBA 5LMNO 2BSKB 4CHZA 1VIBA 5IE9A 2QA4V 1GLBG 2VS0A 4CC5A 2P9LA 1N33B 5AJ3K 4TT3G 2NRWA 3OS1A 1TAUA 3ZRSA 4U7OA 3ZSVA 3J8F4 4FLXA 4MQ3A 3CM6A 4DS5A 4H0OA 2ASOA 1IO2A 3JALB 1C1AA 4FSVA 4IDHA 4DQ8A 5E41A 3QO5A 4UY8O 2ZQMA 4LR3A 3ZMZA 4DUYB 1KP2A 3CMEV 2KTQA 4GCZA 1NOZA 3ABTA 1H38A 4WFFA 3DRPA 3KHYA 2KQ2A 3Q7CA 4L8JA 3ZEUB 4CF0A 2RM24 5HOOA 1RPRA 1BU6O 2E2NA 3MEDA 5CBFA 1YUWA 3DRRA 4BR5A 5GAGP 1BQZA 4ID1A 5M1NA 1RUJ4 4GKJB 3VTHA 4LC9B 2G38A 3GB7C 1FXKA 4KUMA 4RW4A 3ZSRA 3V1OA 1VQ7N 1SAZA 3V81A 4RWUA 3G6BA 1YQ3A 3AE9A 3CRCA 1R6TA 2LGQA 1VQNV 1VQ9V 1EWQA 3TR8A 4GX2A 5EBLC 5ELZA 3AG4C 3LAMA 2HWB4 3LDDA 1ZXOA 4YY3K 1RUE4 4DSIA 3VBBA 2KG7B 2B4JA 3K9JA 1FW6A 1Q90D 1CZBA 4YFUA 2HF3A 4F9OA 1NCQD 1U2VB 4B8AB 4JS4A 4GNIA 1NBMG 4RCHA 1AP6A 1H2KA 1IDSA 1SL1A 5HROA 1YTUA 1IBKO 1N0NA 2VQEB 3JSMA 4UCRA 1GLFO 4O8KA 2O57A 3T1HK 3JAWB 4O4HB 4OPHA 4FLZA 4LF4K 2KZZA 4X65B 1K5SA 1DF5A 5B66Z 1XL4A 2ETJA 3L2WA 4OX9O 1GKFA 3D36C 4N23A 4OKKA 3CPWM 2DWEC 2O8DA 4IG3A 1E1RG 4JI8B 1K8KA 4FJJA 4AH9A 4X1YA 4CZZA 3KVGA 3HP6A 2Q7GA 4IOCL 4J10A 3KLFA 4J11A 1X4TA 3CRAA 1T7PA 3TTCA 2BTQA 5HFMA 1FAFA 2QKKA 2QWPB 1KKCA 2UXDK 2NRRA 1OVYA 3WQUA 4IOXA 2B1GA 5J2TA 2HNDA 3CCQN 4U67L 4BIOA 3VOUA 2GUZB 4BW9A 1O9GA 1LAVA 1NOYA 2DYRB 1NG9A 3U10A 4CZKA 4JYBA 3TSPA 1Y4MA 5DN6G 1BZKA 5T7BA 3K59A 3SV3A 3BFRA 5L3BA 3C95A 4ILJA 3VF6A 5GINA 1JCFA 2ATQA 2P9KB 4B8CA 4MTGA 4CZHA 1YHQN 1TYQB 3VQAA 3QLHA 5BRHA 3M7MX 1FXXA 2E6LA 1GRJA 3P1GA 4TQFA 4Z2WA 1Q82W 3ZHRA 2HHUA 4R50A 2QTSA 2F8SA 2JJ1G 1NJWA 2WDRA 4X66O 3AG3C 1K5MD 4H4OA 1LNQA 5AQNA 5BRFA 1J5EO 1SQKA 4WFAV 3BY5A 3LWLA 1AI4A 1YQ4A 1QVFU 3LSSA 2N74A 3JCZA 3Q7BA 2A42A 3QF7A 1FYJA 4FJLA 3CCLV 4GW6A 4GY2B 1XREA 2JVDA 2BGGA 2HBKA 4RW9A 1NVPD 5LP6A 1HNXK 4WFHA 1IXBA 4HNAB 3OE7G 1AR94 4IG0A 3H3OB 4PA9A 4DQIA 3CX5F 1Y64A 3OUFA 4DR4O 3O9UA 4E19A 3CC2N 1SZ2A 3OJUA 1U45A 3P31A 4UQGA 4N5SA 1Z5VA 5BZBA 2P4VA 3FFQA 2Y1JA 4KFBA 2EINC 4BE1A 2O8EB 4AQYK 1KFSA 4M63C 4NLBA 1RBSA 3DJCA 3ULEA 3DLBA 1RUH4 3G25A 3H08A 4KPYA 3O9TA 2HKOA 3P3PA 2QWRA 3JASA 3PX4A 4DTUA 2NLJC 4MSWC 2PUSA 3QO8A 3M99B 4JKBA 2L6LA 2UUAO 4MTXA 5J2UA 1R6NA 3KK3A 2JS3A 1KU9A 4FM0A 1NH2B 4KHSA 4MO5A 2GDSA 2AZ0A 2E74B 2E88A 1AVMA 4QAGA 5H1SQ 4R6ZA 4PA1A 1J5OA 1CZAN 3AO1A 4RAIA 2ZE2A 2Z3YA 5KUKA 4DV1B 4OO1J 2QM8A 4XH1A 3P3NA 4NVPA 4BIUA 3SAGA 4GT1A 1KXPA 4UVCA 1SQPH 1Z6RA 1RILA 1HWYA 2A9HA 2IC3A 4CEAA 2P6JA 3VA0A 5D3GA 3P32A 3WQTA 4Y1CA 1WLJA 3NF6A 1YXBA 1WB8A 4MTFA 4B3TO 4MFBA 3PN1A 4QS9A 2Y4TA 3A5LC 3FZMA 4BRLA 1OH8A 3STZC 4H4MA 1L3SA 4DV7B 5JVDA 1QNMA 1IKVA 2BH1A 2V52B 3VERA 2ZJRL 2HSTA 5CR4A 1UPGA 3ZJZA 5DK5A 3HBTA 4CJPA 1Z5WA 3OYDA 4DUZK 4LBEC 3NAEA 3OW2M 3P4PA 4ZOLB 4KHPO 2O8CB 2FMLA 3KG2A 2IJHA 3CJCA 3T19A 4PELA 2EZOA 2FKXA 2D5RA 3WXKA 1SA0B 2EHGA 3ZT4A 4DU1A 2V1DA 1KSPA 1P8ZA 2LFSA 5IY5C 3MXIA 4GKKO 1DKGD 4UV8A 2YHBA 3HO1A 1PP9H 3CP1A 4BR2A 5HRSA 1SL2A 1N33K 1VF5B 3UKMA 4EHUA 1JFFA 4I0XA 4O4IA 3QNEA 3KZIZ 3OVNA 1RM1C 5B1OA 1MA9B 2P9SA 3JD0A 4K41A 4N47A 5KQDA 4DUYK 4Q4V4 5AQTA 3OUSA 3AG2B 4DV2O 4ZHQB 5LMNB 4FWNA 4FJGA 1N34K 4YTPA 4DK1A 5JS1A 3SCXA 3ZBHA 4KO0A 1N8RO 4PDWD 2NRVA 1M9NA 3MHSC 5IYCO 2PAVA 5GADP 1GM9A 2OCHA 1L8DA 1FKAO 3OS0A 3O6WA 2RQ6A 4F6RB 3VQ9A 4JI4B 4J7ZA 1Q86W 3TAGA 2PLV4 1H8EG 2UXXA 4LFBB 5ADXH 2ZE7A 3TSQA 2BSKA 1NJIW 3HVTA 4MDAA 4B9TA 3T4ZA 4DV4B 3QDKA 3ENBA 3P39A 3ABKB 1ESVA 5JLHA 2F9WA 4E7HA 3ABLB 3SJCC 2WLMA 1TAEA 3SYZA 2DYSB 3BZKA 1HQEA 3AO2A 3L3VA 5KI6A 1OH6A 3JALA 1VF6A 2ACZA 3SUCA 3K3WA 3PO4A 4TV9A 2ARHA 4FXDA 5KHIA 3LPUA 4YDUC 2Q68A 3DAWA 4LY7A 3JAMO 2N04A 4YSZA 3ZEUA 2B5JA 4IEEA 2QGNA 3LSQA 1IH7A 3SAHA 3PSIA 4TUYB 2VQEK 1I94K 5GIPA 5AQHA 2YJFA 3DRSA 3L2RA 3SK3A 4DQRA 1M90O 3FB8C 4CK1A 4XIUA 3O1BA 1S72N 4X65K 1NEKA 4KHYA 5MLCQ 2VWKA 4JI6B 4NXNB 1AR1B 1M93A 4CHYA 4DG1A 1U97A 3QEPA 4JI8K 2H89A 1IBKB 3H1KH 1BI4B 1VRTA 1JJ2M 3TGUH 4M3XA 4YT0A 3ATUA 3CC4N 1QVGM 4W5TA 1M1KW 4PDMA 1FXKC 4ZKIA 3LUTB 3O1WA 3VQDA 1LW0A 1VRUA 1F7YA 3BEXA 1NTZH 1YITN 2KG7A 4GV9A 1CP9A 2YXHA 4OX9B 4LNUB 1XNRO 4DU4A 1FJGB 2UXBO 3E8FA 5JH7B 2Q7EA 1W0HA 2BANA 1DGKN 1U2VA 2ITGA 3I0RA 2H3OA 4RUFA 4Q5VA 1NKBA 4KHUA 5BMVA 3LDOA 3T1HO 2OCCB 1NT2B 1K4CC 1P7BA 1TUUA 4WFNL 4LF4O 4KBOA 3OHRA 2XAHA 2P9IB 1V9PA 3K5OA 1HR0O 3PIPL 1BDGA 2XTAA 4P2ZA 3UO3A 2YI8A 4J42A 2OZMA 5IYBO 3JAWA 2HJFC 3SYPA 3APOA 3AGRA 3C6HA 5JJNB 3NF9A 4B3MB 4DFKA 1ZP0A 4RG8A 4JF3A 1GMGA 1NGFA 3G10A 2UXDO 1U47A 4HWIA 4RO2A 1NS1A 4FJIA 4FWPA 5B1NA 1DGSA 3CYOA 2AGAA 3KK2A 3BVOA 4UB6Z 1TK5A 4G2KA 3J7AP 2A1RA 2WBNA 4F3OA 2V51B 1HQUA 5BR8O 2FSJA 4K35A 2QWPA 3H1VX 4M7XA 3CCEN 4CF2A 3QNOA 1ZBHA 1V54B 3E86A 4CGDA 3TAPA 3G4SN 4JI5B 4KB0A 1J5EB 3AVCA 4BR4A 1EO1A 3BUZB 5EX5A 1M56C 4CBWA 1IKWA 1ZL8B 5CA0A 3J7ZO 1T3VA 4BREA 3HSTB 2AA4A 4CGIA 4YOVA 1VQLV 3SQ1A 4YTNA 2QWQA 3FI7A 1TYQA 2Q1NA 4DV0O 4LF7B 1T05A 4IOAL 2E76B 4JV5K 2HEPA 4CF8A 1HNIA 2VQFO 3L3UA 4BE0A 2IU3A 4KP4A 2P7TC 4O4GA 4DW1A 3MEGA 2ZWHA 4CI6A 3SMSA 2X6CA 1GLAG 1PO24 3ZCCA 1QQNA 1QE1A 1JR9A 4C7UA 5H6RA 1HNXO 3AV9A 1YTFD 4AI8A 4BE2A 3SPYA 3BEHA 4IWVA 4K25A 2HHQA 3RMBA 2HHHB 3CQ8A 4HNAA 3N4PA 3NFAA 4AQYO 4DV1K 1RTJA 3C94A 1BS3A 1J9AA 2UUAB 3R1XA 1S3XA 1IURA 4ILHA 2QWNB 4FLWA 1SQBH 2X6NA 3HKBA 3KLIA 4DSLA 1YT3A 4CH6A 3AO5A 4CEOA 3EO3A 3O3GA 3IG1A 3L75H 1PKXA 4G27B 4H0LB 4DV7K 2YHYA 1R094 3ETEA 1VQKV 3SQ0A 2R70A 3ZMUA 4DTJA 3SUNA 1X3NA 4FLUA 1VQ8V 2Y69B 4FVUA 5EYPA 2X0LA 3ABMC 2W41A 4OGCA 4RQFA 3M8RA 4I55B 3KLGA 1ZBIA 1AI6A 4WBNA 5SWMA 4KI4A 4JEPA 1TVRA 1VK0A 3L9DA 2HB5A 4B9NA 4JGSA 4UV9A 2NRHA 2IU0A 3K5LA 3VF2A 3IC7A 4DO2A 1RDCA 4A2AA 2QE7G 4X89A 5SZTA 1FFXB 1HKBA 4PDLA 3P83D 3TPQA 1OV9A 3NR7A 1LUWA 1ENVA 3OTOB 4D7SA 1KFDA 1WSHA 3E35A 4H0VB 4BDZA 1IG9A 2Q73A 3T1YO 2P9LB 3VQQA 4LSNA 4IO9L 2ATKC 1BCOA 2BTOA 1RT6A 2WU5A 1EBOA 4YSYA 3HKDA 1NJYA 1SKVA 2V7ZA 4DR7B 3HPGA 3DC5A 3JS6A 2WSSG 4X64O 4J7JA 1SRYA 4EB6B 2F23A 3J8AA 4UCVA 3CC2V 4ZOLA 4IYHA 2W40A 4H5NA 4XH5A 1RPOA 4PJ0Z 4C1NK 2CH7B 4DV2B 4JI4K 1GOAA 1N33O 4BC2A 2QM4A 5CZ1A 1XWLA 4LH5A 5JVHL 3KLEA 4CEBA 2YX6A 4LFBK 3F73A 1NU1H 3OFNG 1OCZC 4DYLA 4F4LA 5IYZA 4DV4K 3DMJA 4JK8A 2FC0A 3UKRA 4I9QA 3SPIA 3E9OA 1TKXA 4FZ1A 3MXJA 4FWRA 1QHTA 4L3QA 4NO7A 5AFUH 4DSEA 4KTQA 2CE4A 1NBWA 1N34O 1HPMA 3AE7A 5J2MA 3QG5A 1V55C 1HMVA 4M3YA 1QTMA 3W7SA 3CFOA 1KB9F 4ZHQA 4BRPA 3S3MA 3AE8A 4CGFA 4YOYA 2ZE8A 3IC9A 1OCRB 1CZ9A 2D1KA 3VEXA 1RSOB 5B1AC 2YNFA 4BGBA 1JQ0A 2G8FA 3WXJA 4EHTA 3BA8A 4E4EA 4BDPA 1TVKB 3HI0A 2CH6A 4O4LA 2XRIA 1EFRG 3E9LA 1TKZA 1D8YA 4JRPA 1SKWA 4OLBA 3QEVA 2F7TA 1YJNN 1JOYA 3VGKA 1GM8A 5AQMA 4DCHA 4JI6K 4U7NA 4J41A 3KWIA 2E1YA 3KKSA 3U3YA 4NXNK 3VGMA 4IDKA 2PZSA 1VBA4 2VWBA 1F51A 3RMDA 3LDQA 3L6QA 3L2QA 2O8DB 1MZFA 3I55V 2DE0X 5JCOA 4DQQA 4X62O 4QJFB 1AI7A 1PO14 2E2OA 3T3FA 5EIBC 5C93A 4C8NA 4B9QA 2GUPA 4HUFA 3S3OA 1NK7A 2QKBA 2BTQB 3SJQC 1I94O 3IAYA 2OPRA 2QM1A 3MWTA 1VSFA 3KCYA 3VOVA 1IG8A 3IJ4A 3LDEA 3OBYA 4X65O 1KC8W 1XQSC 4YOUA 5CY4A 1AL24 1NA1D 1NVPB 4LH4A 4X20B 1SERA 3IMXA 4M3TA 4ICGA 1XNRB 4A5BA 2IJKA 2UXBB 3DLEA 5EXWA 4C8KA 2EWSA 2BCCH 3CPEA 1ATSA 1H8TD 4B3MK 2WAMA 1GN3A 3CD6V 1ZYQA 1ZLZA 4BRCA 3SFEA 3OJSA 4LF4B 5C12A 1HR0B 2WTUA 3H9VA 1VQMV 3ALYA 4Z4EA 1KFYA 4E7IA 2RDCA 1ZBUA 2YKMA 1RT5A 1A32A 1HNZK 1SZXA 1F4NA 4MVMA 3PY8A 1O1WA 1BT8A 1K33A 1JXEA 2DMXA 4JZGA 1Q7YW 4LH7A 5BRDA 4LNUA 3QICA 3I56V 3K79A 1JLCA 1S9EA 4RTFD 3PIOL 4JI5K 2Y4UA 3LP0A 3FB7C 1NGHA 5LP6B 3C3SA 2CGOA 3DGEA 1Q7YO 3WB0A 3OYIA 4H5TA 2P9IA 2RR14 3DXRA 5BR8B 2FF6A 4PKHA 1XMOO 1IBMB 4WE1A 3P4RA 3BP8A 5J1EA 1C0FA 3HOSA 4LF7K 1NTKH 3TABA 2ZDIC 4R5PA 3W7WA 3SQ2A 3OGCC 1VBC4 4F2SA 5M1FA 4EKWA 1V4SA 2VWJA 2WU2A 2YIBA 4CBCA 3CPWU 2ITCC 4QIWF 3F5TA 3JASB 4MVRA 5HFLA 4DV0B 3OBWA 3VEOA 4CEFA 2WLHA 1AP5A 1NNEA 2VQFB 2HHHK 5J2UB 4JI3O 3HYFA 2IH3C 5EZYB 1E4FT 4BC4A 1RBUA 2WLJA 1HNVA 3PLAA 3STLC 4DR1K 1HNXB 1OCOB 4E7KA 2UUAK 1Z25A 4JV5O 1ZL8A 3ZHVA 1S5LZ 4AM7A 3J81N 1E3MA 5IJ0A 2YHAA 1NWKA 1B04A 1I08A 3MCAB 4NB5A 3C0BA 1EKEA 1YJ9V 3O9OA 4I7FA 2DYRC 4DSFA 3JAKB 3JCUZ 1Y74B 3SPCA 1OVQA 1ASJ4 4DQSA 4UB8Z 1YJWN 4ZHRA 2CUGA 4DXWA 1QSLA 3ZHTA 2K1EA 1Y66A 3TAMA 1RT4A 5C2DA 2P5OA 3ZYYX 3X2QB 3ZX0A 5ADXA 4FLVA 4DV1O 5C42A 1HLUA 4FWLA 2F9TA 4HUEA 3HM9A 3LZIA 3V9SA 5GTIZ 1IVSA 3O9QA 3QERA 2ZQBA 3A0BZ 2IOCA 4K43A 3D7EO 2D3OW 2HNYA 3SZ2A 2IJJA 4PQUA 1BO5O 5FPMA 2OT5A 3IFRA 4CJQA 4NXMB 4KFMA 5LBQA 3OYAA 5JJJB 1J95A 3OTOK 2PI4A 2E3CA 4DV7O 2R72A 1S6QA 4IHJB 3QFPA 3OYHA 5FPEA 1H2NA 3FX7A 4A5AA 3VQVA 5JMVA 2HMIA 2UXCB 1WJZA 4DR7K 4DF8A 3G4SV 3B4SA 5GIOA 3H45C 2X5ID 2M7WA 3CG7A 3LP3A 4WF9V 4EAHD 3T1YB 1RUC4 4CIGA 3JARB 2VGMA 1GLDG 4NB4A 2F95B 3HXMA 2P22C 3MAQA 3UE5A 2A1SA 3T2MA 4I55A 4DV2K 1UA0A 5CYQA 3C65A 3HTVA 1LAWA 2EIMB 1K34A 2GTDA 1IBLO 2P9PA 5GAHP 2A79B 3VGLA 1LW2A 4KRFA 2YHXA 4X64B 3EE8A 2ZM6K 4EZ6A 4K8ZA 1TUBB 4QNHB 1HRHA 1SETA 1S3JA 1R1BA 1E79G 1QZ6A 2CGNA 4CHQA 2JK5C 2XO7A 1XC9A 2LFRA 2QR4A 3OYEA 4W4LA 1FFXA 3CCJV 3F7VC 1P49A 4NTWA 4PHZA 4F6EA 2D0AA 5A2QN 1RCHA 2B9ZA 4H13B 3O4QA 3RW0A 1S76D 4IYIA 1NK0A 4CBUA 1TL3A 5LOVB 1NI8A 2A3ZA 3JSLA 4FK2A 4TV9B 1HPZA 5E79Z 4LF6K 2DFFA 4EB6A 4JI4O 2YKNA 1GTOA 1Q6HA 1N34B 3M8PA 5JVGL 2PW9A 1L0VA 2EZPA 2VCPA 2QKAA 4LFBO 1WP8A 4WFEA 3OW2U 1NGBA 2KLAA 4DV4O 1ZWIC 2HOEA 2CH7A 4XDJA 3P38A 5F1XA 1KVAA 1C6VA 3CQXA 1N36B 4W5RA 4E1NA 3UQ8A 2PTMA 1AB3A 4B9UA 4ISFA 3HJFA 3ASMA 4QS8A 1U04A 3JYCA 3HL8A 4ISGA 4BVOA 4LF5K 4JI7K 2F96A 2PYLA 4H44B 2BE2A 1WSGA 4TWKA 1XHXA 1NGDA 2RPIA 4XEIA 4AHUA 4CFAA 1BMFG 2QEXN 3IS9A 3R6MA 4IFVA 2Y0PA 1ASVA 5AQLA 4BG9A 3OYLA 4JKAA 4BRDA 5DECA 3CS5A 1RSOA 3TI0A 1SQXH 2I7NA 4J8FA 4CGGA 3CCUN 1TVKA 1UJWB 4X62B 5BMVB 1M57B 3SPJA 5FPRA 3Q4HA 2XT9A 4JI6O 4NXNO 3MCPA 3MN7A 2G8WA 3AG2C 4CJ5A 2PYJA 1D5NA 4ISEA 1XNRK 2ITMA 2UXBK 1I94B 3GVMA 3TAQA 1VF7A 5C15A 5IJ9B 3THXB 2OTJV 1RGIA 1RFQA 1YZBA 2HR3A 4FZYA 2LW1A 4JNEA 3F2KA 1YAGA 4KH4A 1HR0K 2W6IG 1FJGO 3ID8A 3MX5A 2QK9A 4JLHA 1QCEA 4DMNA 2J4RA 1U6ZA 3K08A 1H2SB 4BQLA 3E8HA 3OYKA 4F4KA 3KKRA 2ZGYA 4BRQA 3BA9A 1G99A 1JLFA 1U49A 3EEQA 4DTNA 2Z0AA 3ABKC 3EHBB 2IAJA 3ABLC 4HYOA 5FLXN 2V7QG 5JCOC 4CD1A 4IFEA 1SUQA 2WLLA 4B3MO 3A2FA 2VG5A 3BABA 3B6PA 5BR8K 4FJMA 4X20A 3AE5A 1ZTEA 4B9SA 1XUPO 1IBMK 3QB0A 1PD3A 4JPRA 1KMIZ 2XUMA 5CA0B 5KA5A 3SJJA 3VN5A 3D3IA 1MSWD 1VSIA 1H2GA 1KTQA 3R9PA 2QWQB 2YXLA 5L3DA 4B1XB 1HNZO 3IRXA 1Z05A 4EP5A 3TANA 1NKDA 2QI2A 3NXSA 2VYPA 2ZNJA 3NF8A 1YVUA 3SYCA 3PX0A 1XMOB 3CERA 3OYCA 2W6LA 5L3EA 1JJ2U 1SQFA 5E1AC 4JI5O 5LXTB 3OS2A 4DV0K 4PY5A 1AR84 1FD9A 2JDIG 1QVGU 1YJNV 1WSFA 2VQFK 3AO3A 4GB34 3BF1A 2CK3G 4YXWG 5AQKA 4GYCB 4UCSA 1NGGA 4FJ7A 1Z7S4 1YTAA 2P06A 1U4BA 1SL0A 5B1BB 1EV14 3P4SA 1ZC6A 3AG1B 4LF7O 1OZ0A 2UUBK 4IBNA 4CJVA 1HRV4 2B76A 4B3SO 2YUAA 3T7ZA 2HHVA 3V9XA 3O08A 1YIJV 2DPNA 4FWKA 1VQPV 1MU2A 3SUQA 1Z2GA 3SBGA 4JI3B 4MT8A 4DRXB 2XAFA 4PA7A 4UXNA 2OCCC 3T1CA 3HKBB 3DXKA 4LH6A 1C1BA 3S41A 4PWDA 3TTDA 4GX1A 2CGLA 1K92A 3RT3C 2OZSA 1DT9A 2Q4PA 4JV5B 3MDSA 3O9SA 1OKJA 2HHHO 3CFPA 2FBTA 1EM1A 3CJ7A 4DQPA 3G6EV 4FVMA 5DM7L 3ZT3A 3HK2A 5CBGA 4JTCB 2KFNA 2K9PA 4DR1O 4B1ZA 5EYPB 3ZHUA 1VQ6V 3L72H 3ZLJA 3S3NA 5KUMA 5AFUA 4J2DA 1PL0A 1FKPA 4J2AA 5EZYA 4R7CA 1QR8A 3CXCM 4WBNB 3RN4A 2DTUA 4NXMK 4J9YB 2GTSA 5LMUB 2RN2A 5K1XA 4DF4A 3OYMA 1GK9A 1CPYA 1E4GT 1RBVA 1V54C 4I50B 3OA9A 2WWWA 3C90A 4QE7A 1SKSA 2KKZA 4CJWA 2D0OA 1VQ5N 3JAKA 3PX6A 1Y74A 1NM1A 5E84A 3KCXA 4OPAA 2DQ3A 4BRGA 2UXCK 5AQUA 2ZE5A 2X6BA 3SYQA 3RYCB 4UVAA 2QSAA 2IVOA 3HKDB 3SUOA 1BIZA 4GLXA 3LM2A 4F8RA 4Z4IA 3CIRA 3R8EA 3T1YK 1HYSA 1HNWB 1B9DA 4ILGB 5IWAK 2G8UA 3V6DA 4B3OA 1VQON 4FWOA 2FBWA 2I7PA 3OMAB 5B8HA 1VSJA 3MN9A 3ZMTA 3B77A 3MHHC 3OTOO 2DY4A 4X64K 1WA8A 3F7YC 3ASNB 1LR1A 3H6EA 3LDPA 3QMLA 4EP4A 1HKCA 3OGIB 3CCVN 4GX5A 4KXRA 4BW5A 2E5LB 3CMAN 5FNVB 5IYZB 3JYTA 1Q8IA 4LF9K 4X1KB 4CESA 3UKRB 4DR7O 1D5AA 4IHJA 4AHVA 3L2UA 4FO0A 4CE9A 5FPDA 1FK9A 3EVKA 1IBLB 1L1FA 1S1XA 1VMGA 2JEXA 2QW9A 3KJVA 1GN6A 1Q6UA 4C8LA 1N8RW 3THOA 4FLTA 3E89A 4OLAA 2ZKOA 1GN4A 3VR9A 4JAVA 1XL6A 4DR6O 4RQEA 1ZX3A 2ZXWB 3TCUA 1BIUA 1KUQA 4LP8A 1KAYA 1C0MA 3VQEA 5KAIZ 3UO2A 2P1JA 3ZEDA 2ZM6O 3JARA 3B8NA 4O4LB 2Q97A 4AF1A 3IFXA 3SPGA 4HTLA 2F43G 4CFCA 4C8OA 1N36K 3KK7A 4JKGA 1REVA 1B92A 1Q81O 3UKUB 3E9PA 3HRGA 1MQTD 1TUBA 1H2LA 2Y69C 2E8AA 5HRPA 1L3UA 2N05A 2EIKB 2JIZG 2BUPA 2JWKA 5C24A 1K9MO 2GELA 3AVMA 3B8AX 4DFPA 3EL2A 4PA3A 4LSLA 4FL9A 4LF6O 2Y0IA 5LL6Y 3TXSA 1QQMA 4OGEA 3EZ5A 5LOVA 2HG5C 3R66A 1K6YA 2CH5A 3CI5A 4PI0A 3SR2C 3K9AA 4Q20A 4JD2A 4XDLA 3AARA 5JICA 1WPXA 3SFDA 2B1IA 1M90W 3L71H 1J6ZA 4FWMA 4MW3A 4CZFA 4X62K 3T69A 2ZD1A 3TAFA 5AQSA 5L3GA 1FFTB 3KTQA 3EN9A 3RVCA 4JI1O 1IZ3A 2ZIOA 4LF5O 4JI7O 3CRQA 4BWMA 3VQ8A 1Q18A 3DOKA 3CCMV 4DV6B 2OPSA 3A0IX 4Z4GA 2JGDA 1JLQA 3HKEB 3KD1E 1KAZA 4HZ3A 1LCUA 4DTXA 1GLLO 4OKJA 1X9WA 4KTZA 4JKFA 1BQ0A 3CC7N 4LWSB 2A6AA 3S3WA 3CCSN 1KD1O 2Y48A 4ZI7B 1G6UA 2NRXA 4JZ2A 4H5RA 4I4TB 3GOIA 3FB5C 4A59A 2P67A 2E4LA 1UFIA 5EIBD 5AQQA 2D0CA 2C2AA 4O55A 3DLKA 3DXRB 1OCRC 3E22B 2KB1A 4E7JA 5IJ9A 2BOBC 2V7YA 5KPTA 3THXA 4BROA 4O0IA 2LSNA 3N4QA 5H5NA 3FGUA 2IBZH 2AHYA 4IT5A 3A5OC 1F23A 4RW7A 4YNQA 1YVWA 5EBWC 4FFBA 1TA8A 3K2PA 4N76A 2JJ2G 5LGTA 3P5JA 1XMOK 4M3RA 1E1QG 1XOUA 4QOZB 2W0FC 4YJ3A 3B6OA 1YXQA 3AVHA 3OMNB 2NNUA 1HNZB 1Q3EA 3QIOA 4H0TB 5LY3A 4N56A 1M4UA 4MLHA 5F2RA 1IBMO 2Z1GA 4BC5A 5C2FA 4DU3A 2RS34 1VQ7V 1QS4A 2HFEC 4CC6A 3RFRA 4BRIA 2GWJA 3PO5A 4YIPA 1VBD4 3SNNA 2WLIB 5BY1A 4UCOA 1BQMA 4JI3K 3ZHSA 1K97A 4WCEL 5IJ0B 1PV0A 2GSMB 1BL8A 5AQRA 5FRMA 3AA2A 3MXMA 2OTLN 3FZFA 2YJEA 4W5OA 3CJAA 5LJWA 3SI6A 3PJSK 4CBXA 2Q69A 5KHHA 5CB4B 4B3SB 3CCUV 2XY6A 3CCRN 2JGUA 3L0QA 3D3QA 4G9ZA 1W2BU 1LWCA 4CZIA 1X9MA 2JS5A 1XNQB 5LXTA 3O8MA 3I33A 4CZEA 1RNHA 3GWKC 1EQYA 3WXIA
chains in the Genus database with same CATH topology
4DSKA 4CERA 1BISA 1D9DA 4LF8B 4KREA 1A5WA 5I42A 4FCYA 2XHBA 1WSEA 4DR1B 3HVRA 3TAEA 4DRXA 5LP6C 2GBZA 3KIOA 1TKTA 4E89A 1TL1A 2FBVA 2YIAA 3AVFA 2HW3A 1HW7A 2KZMA 3ZT1A 3OY9A 2FBXA 1UOCA 4DFJA 1KLNA 3K5MA 5JQGA 1RT2A 5KHGA 3D0PA 5EU7A 3LWMA 4I50A 4PI2A 3ZSYA 4O44A 3OYGA 5HRRA 4KI6A 2HVHA 4CJSA 3AVNA 4CGHA 3RYCA 4O5BA 3O3FA 3AVKA 4KHQA 2KKWA 4B9MA 4NCBA 4HUGA 2HHTA 3V1RA 1JLGA 4DR6B 4CJ4A 1A5VA 2ZM6B 5FNVA 2F1MA 4X1KA 3WB1A 2B6AA 5J2NA 4KHNA 3WB2A 3I8DA 5CA1B 3VA3A 4H8KA 1O9HA 4LF6B 3NGZA 2OPQA 1BGXT 1N6QA 4OKEA 3DLHA 1Q9XA 1ASWA 1QSYA 3V9WA 2WOMA 1RBRA 4M3WA 3L8BA 3TWHA 4FM1A 1KVCA 4KTWA 4JI1B 3KK1A 4LF5B 4JI7B 3UIQA 4O4JA 1RTDA 1D9FA 4FJHA 4TV8A 3RYHB 1NJXA 4NCGA 1RBTA 3DM2A 4FM2A 3AA5X 3SJAC 3K58A 4ELUA 4BDYA 4IFYA 4I2PA 1S5JA 4B08A 2OPPA 3HKEA 1C0TA 3D45A 2NUBA 3ZSQA 1LV5A 4ZI7A 2Z1JA 4I4TA 5HRNA 4NYFA 2AJQA 4K8XA 4J2BA 4Z4FA 4GVMA 3ETQA 3OYBA 1T03A 3E22A 3EY1A 4CIFA 4ELTA 5C8YB 3QIPA 4DWIA 4FJ9A 4CJUA 2EX3A 1Z26A 3VQPA 2PY5A 4CCHA 3U0ZA 1X9SA 1WN7A 1N32B 3AVLA 2ZCEA 5LYJB 4I2QA 2RJZA 3CYMA 3DYAA 3HT3A 3DOLA 1TKDA 2F8TA 4HTUA 1JLEA 4BACA 4CFDA 2UUBB 1NKCA 2Y1IA 1DTTA 5JJEB 4CS2A 5CB4A 4FZXC 3O3HA 3N2GB 1JL2A 2QXFA 4K0KB 4CJ3A 2KFZA 4NYNA 2IGIA 4CK3A 4DTMA 3VQYA 2Z1IA 4CEQA 3SUPA 1Q43A 1ZAUA 4TQDA 2HNZA 3HKCB 4OJRA 3PV8A 3THVA 4CHNA 4IIJB 4HCBA 2YNIA 1NK5A 3M8SA 3WNHA 4O2BB 3RTVA 1RDBA 4YJ2B 3C6TA 2G8HA 2I5JA 1QSSA 5IWAB 1J54A 2F93B 3MEEA 2PGGA 5KX5A 1TK8A 1GOCA 4RW6A 4DK0A 1RDAA 4LD0A 4TOIA 3LNNA 4W5QA 3ISNC 4LF9B 1Q9YA 3BHPA 4OPKA 3TARA 1WAFA 1CLQA 2G8IA 4J2EA 2E6MA 3S9HA 3HP9A 4Z0UA 3RMCA 1UAXA 3VQCA 3QEWA 2XY8A 1S1TA 1ASUA 4EEQA 3ZT2A 3RWRD 1CXQA 3QEXA 3BAAA 4U3JB 3QTCA 5DMRA 3M8QA 1TGOA 3DLGA 3LPTA 5CA1A 2CAZC 3K5NA 1TAQA 4E1MA 4E3SA 4CEZA 4CF9A 3BPZA 4FYDA 2OWOA 5I3UA 4O2AB 3NE6A 3SGIA 3RYFB 3N2KB 3CB2A 1L3VA 4FFBB 3U11A 4DSJA 1VSEA 4DLGA 3QEIA 4YJ3B 2V4DA 3VQ6A 4CH4A 4CH5A 3RYHA 3B2EE 5D5PA 5KMGA 1RT3A 2O4GA 1S1WA 3ZSOA 1F21A 4FJ8A 4Z4CA 4M42A 3NDKA 3O4NA 4DV3B 1JMKC 3QESA 1JLAA 3KD5E 4JI2B 4CEDA 1X1PA 4NCAA 2HHXA 2D0BA 4B9LA 1NJZA 4F2RA 4CJEA 1C1CA 3K57A 5HBMA 3U6FA 4CHOA 2HHSA 5J2PA 4BWJA 4DFMA 5C8YA 1BCMA 2Z1HA 1LWFA 3V4IA 3QINA 3VQ4A 4E7LA 5KHKA 1XI1A 1TK0A 1VSDA 4DLEA 2GUIA 3V1QA 5LA6A 1RTHA 1DLOA 5LYJA 4CK2A 3NH0A 5J2QA 1BL3A 2Q0AA 3DSQA 5JQGB 3UT5A 3NH1A 3ITHA 1Q5OA 1ITGA 1YEWA 2QJ1A 4C8MA 5CYMA 4FJKA 4DR2B 3BGRA 4ICLA 3N2GA 5KTQA 3OYNA 3AO4A 2UU9B 4JYAB 4HVJA 2Q7HA 5GONB 3QNNA 3ZT0A 3AA4A 2IS3A 3HKCA 4CF1A 1UA1A 1VSLA 1G15A 4ZTJA 4IIJA 3ZCMA 4JI0B 4O2BA 1DTQA 4M41A 4YJ2A 3LANA 2R9AA 1ZBFA 3RYIB 3OTFA 1Y97A 4DR3B 2P51A 3CFRA 1KLMA 4I9LA 4UCUA 2XY5A 1S9GA 3HPOA 4KKOA 4O4JB 1KCFA 5FRNA 4TV8B 3JATA 1RDDA 1JLBA 2IDOA 4LFCB 3AVIA 1WSIA 3ZSXA 4CS4A 3AVJA 4JRQA 4DTPA 4X1IB 1M5IA 3E01A 4Y1DA 3DI6A 1EP4A 2RKIA 4U3JA 2OYQA 5CZ2A 4FJXA 5HLFA 4CJLA 5FPOA 1NK9A 3DLRA 4DS4A 3RRHA 5KHJA 4CHPA 1RT1A 4CGJA 3NCIA 2G8VA 4O2AA 3AA3A 3RYFA 3QO9A 3N2KA 2X74A 4KL1A 1TV6A 4KHWA 4ZIBA 3BDPA 5KRTA 1XMQB 3VQ7A 4O4HA 3NH2A 4O0JA 1KRPA 3AVBA 1I7FA 4CJKA 3CM5A 1HYZA 5K14A 5KGWA 4PUOA 5JS2A 4X66B 5HP1A 1XQ8A 3ZSWA 4KB1A 3RR8A 3EYZA 4RW8A 4FJ5A 4DV5B 4DR4B 4B9VA 4ELVA 2G8KA 1IKXA 3ULDA 3NGIA 3ICXA 3SPZA 1W9HA 2P5GA 5KX5B 1L3TA 3T1AA 1T8EA 1N5YA 4UCTA 2VG7A 3VQBA 3CSXA 5ITZB 3QETA 5C25A 1SQGA 4UFZA 4CECA 4B3TB 3ZS8C 2W42A 1ZBLA 4CJTA 4YHHB 1B9FA 1JXBA 2JLEA 2YNGA 4KHPB 4DTSA 5GONA 1R0AA 1IKYA 3SJBC 3LZJA 3OYJA 1UWBA 3MECA 4GKKB 5KRSA 2DFHA 3RWUA 4N41A 1BQNA 1VSKA 4KAZA 2UUCB 1SA0A 3RYIA 4JS5A 2F66C 4DTRA 4DTOA 3RR7A 4AHTA 3AVAA 4OVLA 1U48A 1HJRA 4TSXA 1JJOA 4FJNA 1RTIA 4LFAB 1HYVA 1NK4A 4FK4A 4F3TA 3VQWA 1VSHA 3WNEA 2XY7A 5KMGB 4CEEA 4Q0BA 4AHRA 1JKHA 4F6RA 1GOBA 4OPJA 1NK8A 2HVIA 3AVGA 3NF7A 4B3RB 4CJFA 3VQXA 3LP1A 2YNHA 4X1IA 2DFEA 3JSNA 4X1YB 3L2VA 1L5UA 5FROA 3C6UA 3NBPA 4CJRA 2X6SA 4E7JA 1BHLA 5FDLA 4YY3B 1SKRA 5J2TB 1WAJA 3HPHA 1S1VA 4TUYA 4HBNA 3U3GA 4AILC 2F4VB 1WPBA 4G1QA 2GV9A 2VG6A 2FBYA 4FW1A 3VQ5A 3T1HB 1I39A 3OYFA 2YV0X 1BI4A 3RMAA 4CH3A 5D5QA 2KW4A 1NK6A 3G0ZA 2ZNIA 5KGXA 1I3AA 4FK0A 5JH7A 2UXDB 1WNSA 4E0DA 4EZ9A 5LA6B 4M45A 4FW2A 4CIEA 4EFEA 2O4IA 4HCCA 2ZIMA 1WSJA 2HHWA 2BDPA 1S1UA 2WONA 4HHTA 3UT5B 3LP2A 1LWEA 4ID5A 3KLHA 4D7TA 3I0SA 4W5NA 3NGYA 1SV5A 3LAKA 3LDSA 2R7YA 3LALA 3PUFA 1QQCA 1EETA 1NKEA 3SQ4A 2ZINA 3RRGA 2Q3SA 4BWAA 4DR5B 1J53A 4M3ZA 3ZSZA 2OA8A 1C0UA 3BRCA 1RT7A 2IM9A 3V9ZA 4QCLA 2RF2A 2YI9A 1FKOA 2YIBD 1JL1A 4AQYB 1EXQA 5JVDB 4EFBA 1XHZA 3RGBA 4AHCA 4CS3A 1VSMA 4AHSA 1S6PA 1T5EA 4FLYA 5K1PA 3WNFA 3NHGA 1KVBA 1JFFB 4O4IB 3SV4A 4Z4HA 3V9UA 4M3UA 4Q6GA 4GMJB 4KV8A 2X78A 5ITZA 1EX4A 4FZZA 2R7FA 4L8RB 3JATB 4DUZB 3CHXA 3FFIA 1A5XA 3WNGA 1CXUA 3F9KA 4ZTFA 4CFBA 4CHZA 4CC5A 1N33B 3OS1A 1TAUA 3ZSVA 4FLXA 4MQ3A 3CM6A 4DS5A 1IO2A 3JALB 1C1AA 5E41A 2KTQA 4DUYB 4LR3A 1NOZA 3DRPA 2KQ2A 4L8JA 4CF0A 3MEDA 3DRRA 4ID1A 4GKJB 4RW4A 3ZSRA 3V1OA 3V81A 3TR8A 3LAMA 4DSIA 2B4JA 1CZBA 4YFUA 4B8AB 4JS4A 1SL1A 5HROA 1YTUA 2VQEB 3JSMA 4UCRA 3JAWB 4O4HB 4FLZA 2KZZA 4X65B 3L2WA 2ETJA 4OKKA 4IG3A 4FJJA 4JI8B 4AH9A 4X1YA 3HP6A 2Q7GA 3KLFA 1X4TA 1T7PA 2BTQA 2QKKA 5J2TA 2HNDA 1LAVA 4BW9A 1O9GA 1NOYA 3U10A 5T7BA 3SV3A 2DTUA 3K59A 4IKFA 3C95A 4B8CA 2ATQA 3VQAA 3QLHA 3M7MX 1FXXA 2E6LA 3P1GA 4TQFA 2HHUA 2F8SA 1NJWA 4H4OA 3LWLA 3QF7A 4FJLA 4GW6A 2JVDA 2BGGA 4RW9A 5LP6A 4HNAB 4IG0A 4DQIA 4E19A 3OJUA 1U45A 4UQGA 4N5SA 1Z5VA 3FFQA 2Y1JA 4KFBA 4BE1A 1KFSA 1RBSA 3DLBA 3H08A 4KPYA 3JASA 3PX4A 4DTUA 2PUSA 5J2UA 3KK3A 1KU9A 4FM0A 4KHSA 4QAGA 1J5OA 4PA1A 3AO1A 2ZE2A 4DV1B 4NVPA 3VA0A 1RILA 2IC3A 4CEAA 5D3GA 4Y1CA 1WLJA 3NF6A 4MFBA 3PN1A 4H4MA 1L3SA 4DV7B 5JVDA 1IKVA 4CJPA 3OYDA 5DK5A 1Z5WA 3NAEA 4ZOLB 3T19A 2D5RA 1SA0B 2EHGA 3ZT4A 4DU1A 1KSPA 3MXIA 2YHBA 3HO1A 5HRSA 1SL2A 1JFFA 4O4IA 3OVNA 4N47A 4ZHQB 5LMNB 4FJGA 4DK1A 5JS1A 3SCXA 4KO0A 1L8DA 3OS0A 2RQ6A 4F6RB 3VQ9A 4JI4B 3TAGA 4LFBB 3HVTA 4B9TA 4DV4B 4E7HA 3SJCC 1TAEA 3SYZA 1HQEA 3AO2A 3L3VA 5KI6A 3JALA 3PO4A 4FXDA 4TV9A 5KHIA 3LPUA 4LY7A 2B5JA 1IH7A 4TUYB 3DRSA 3L2RA 4DQRA 4CK1A 4XIUA 4KHYA 2VWKA 4JI6B 4NXNB 1M93A 4CHYA 4DG1A 3QEPA 1IBKB 1VRTA 1BI4B 4M3XA 4W5TA 3VQDA 1LW0A 1VRUA 4OX9B 4LNUB 4DU4A 1FJGB 1W0HA 3I0RA 5JH7B 2Q7EA 2BANA 2ITGA 4Q5VA 4KHUA 1NKBA 5BMVA 1NT2B 1V9PA 3K5OA 2YI8A 2OZMA 3JAWA 5JJNB 3NF9A 4B3MB 4DFKA 4RG8A 3G10A 1U47A 4FJIA 3KK2A 1DGSA 1TK5A 2A1RA 4F3OA 1HQUA 4CF2A 3QNOA 1ZBHA 4CGDA 3TAPA 4JI5B 4KB0A 1J5EB 3AVCA 1IKWA 5CA0A 3SQ1A 3HSTB 4CGIA 3FI7A 4LF7B 1T05A 2HEPA 4CF8A 1HNIA 3L3UA 4BE0A 4O4GA 3MEGA 1QE1A 3AV9A 4BE2A 3SPYA 2HHQA 3RMBA 2HHHB 3CQ8A 4HNAA 3NFAA 1RTJA 3C94A 1J9AA 2UUAB 4FLWA 2X6NA 3HKBA 3KLIA 4DSLA 1YT3A 4CH6A 3AO5A 4CEOA 3O3GA 3IG1A 3SQ0A 2R70A 4DTJA 3SUNA 4FLUA 5EYPA 4OGCA 3M8RA 4I55B 3KLGA 1ZBIA 4WBNA