2R044

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r04400
1EAH4 2R064 1VBA4 1AR84 1RUG4 4RHV4 1VBE4 1RHI4 1PO14 2HWB4 1AL24 1NCQD 1VRH4 2RS34 2X5ID 3J8F4 1RMU4 2PLV4 1D4M4 1COV4 1AR94 1POV0 1RUC4 1RUH4 4PDWD 2R074 3JD74 1VBC4 1AR74 2RMU4 2RS14 2RR14 1RUI4 4Q4W4 1EV14 1RUF4 1VBB4 1MQTD 1PO24 1NA1D 1RUD4 1Z7S4 4GB34 1RUE4 1VBD4 2RM24 1PVC4 3JBG4 4Q4X4 1HXS4 1HRV4 1RUJ4 1R094 1RVF4 2RS54 4Q4V4 4Q4Y4 2R044 1AR64 1R084 2HWC4 1BEV4 1ASJ4 1H8TD 1PIV4 1K5MD 1HRI4 1OOPD
chains in the Genus database with same CATH superfamily
2R064 1VBA4 2PY5A 1XHXA 1PO14 1KF6A 1AL24 1VRH4 2X5ID 1NEKA 2EX3A 1ZP0A 2PLV4 3AEBA 1L0VA 1POV0 1RUC4 3AE4A 2RR14 1XHZA 3AEAA 1YQ3A 1RUI4 4Q4W4 1ZOYA 4YTPA 5C2TA 1NENA 2R7FA 3AEEA 3VR9A 4GB34 1VBD4 4Q4X4 3GQHA 2PYJA 3SUCA 1R094 4Q4Y4 2R044 1BEV4 1ASJ4 1H8TD 2WS3A 3VRBA 4RHV4 2H89A 1VBE4 2WU5A 3FI7A 2RMU4 1AR74 4YTMA 2B76A 2ACZA 2H88A 1VBB4 1PO24 4YSZA 1Z7S4 1PVC4 4YXDA 1HXS4 2FBWA 3AEDA 1AR64 1R084 3AE7A 2PYLA 2WDQA 3AE1A 1PIV4 3JBG4 1HRI4 3AE8A 5C3JA 1EAH4 1AR84 3ABVA 4YSXA 1RHI4 2RS34 2HWB4 1D4M4 1COV4 1AR94 4PDWD 3GQKA 3JD74 3AE9A 3AE2A 1EV14 1RUF4 1MQTD 1NA1D 2PW9A 1RUE4 2WDVA 3AECA 3AE5A 3SFDA 3AEGA 3CIRA 3P4SA 1YQ4A 1HRV4 3P4PA 1RVF4 4Q4V4 2HWC4 1XI1A 3VRAA 3VR8A 1K5MD 3SFEA 1RUG4 1NCQD 3J8F4 2PZSA 2WQYA 4YTNA 1RUH4 2R074 1VBC4 2RS14 4YSYA 1KFYA 1RUD4 2RM24 3AE6A 3P4QA 2WP9A 1RUJ4 2WDRA 3P4RA 4YT0A 4KX6A 2RS54 3AE3A 3AEFA 2WU2A 1RMU4 1OOPD
chains in the Genus database with same CATH topology
1EAH4 2R064 1VBA4 1AR84 1RUG4 4RHV4 1VBE4 1RHI4 1PO14 2HWB4 1AL24 1NCQD 1VRH4 2RS34 2X5ID 3J8F4 1RMU4 2PLV4 1D4M4 1COV4 1AR94 1POV0 1RUC4 1RUH4 4PDWD 2R074 3JD74 1VBC4 1AR74 2RMU4 2RS14 2RR14 1RUI4 4Q4W4 1EV14 1RUF4 1VBB4 1MQTD 1PO24 1NA1D 1RUD4 1Z7S4 4GB34 1RUE4 1VBD4 2RM24 1PVC4 3JBG4 4Q4X4 1HXS4 1HRV4 1RUJ4 1R094 1RVF4 2RS54 4Q4V4 4Q4Y4 2R044 1AR64 1R084 2HWC4 1BEV4 1ASJ4 1H8TD 1PIV4 1K5MD 1HRI4 1OOPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAH 4;  2R06 4;  1VBA 4;  1AR8 4;  1RUG 4;  4RHV 4;  1VBE 4;  1RHI 4;  1PO1 4;  2HWB 4;  1AL2 4;  1NCQ D;  1VRH 4;  2RS3 4;  2X5I D;  3J8F 4;  1RMU 4;  2PLV 4;  1D4M 4;  1COV 4;  1AR9 4;  1POV 0;  1RUC 4;  1RUH 4;  4PDW D;  2R07 4;  3JD7 4;  1VBC 4;  1AR7 4;  2RMU 4;  2RS1 4;  2RR1 4;  1RUI 4;  4Q4W 4;  1EV1 4;  1RUF 4;  1VBB 4;  1MQT D;  1PO2 4;  1NA1 D;  1RUD 4;  1Z7S 4;  4GB3 4;  1RUE 4;  1VBD 4;  2RM2 4;  1PVC 4;  3JBG 4;  4Q4X 4;  1HXS 4;  1HRV 4;  1RUJ 4;  1R09 4;  1RVF 4;  2RS5 4;  4Q4V 4;  4Q4Y 4;  2R04 4;  1AR6 4;  1R08 4;  2HWC 4;  1BEV 4;  1ASJ 4;  1H8T D;  1PIV 4;  1K5M D;  1HRI 4;  1OOP D; 
#chains in the Genus database with same CATH topology
 2R06 4;  1VBA 4;  2PY5 A;  1XHX A;  1PO1 4;  1KF6 A;  1AL2 4;  1VRH 4;  2X5I D;  1NEK A;  2EX3 A;  1ZP0 A;  2PLV 4;  3AEB A;  1L0V A;  1POV 0;  1RUC 4;  3AE4 A;  2RR1 4;  1XHZ A;  3AEA A;  1YQ3 A;  1RUI 4;  4Q4W 4;  1ZOY A;  4YTP A;  5C2T A;  1NEN A;  2R7F A;  3AEE A;  3VR9 A;  4GB3 4;  1VBD 4;  4Q4X 4;  3GQH A;  2PYJ A;  3SUC A;  1R09 4;  4Q4Y 4;  2R04 4;  1BEV 4;  1ASJ 4;  1H8T D;  2WS3 A;  3VRB A;  4RHV 4;  2H89 A;  1VBE 4;  2WU5 A;  3FI7 A;  2RMU 4;  1AR7 4;  4YTM A;  2B76 A;  2ACZ A;  2H88 A;  1VBB 4;  1PO2 4;  4YSZ A;  1Z7S 4;  1PVC 4;  4YXD A;  1HXS 4;  2FBW A;  3AED A;  1AR6 4;  1R08 4;  3AE7 A;  2PYL A;  2WDQ A;  3AE1 A;  1PIV 4;  3JBG 4;  1HRI 4;  3AE8 A;  5C3J A;  1EAH 4;  1AR8 4;  3ABV A;  4YSX A;  1RHI 4;  2RS3 4;  2HWB 4;  1D4M 4;  1COV 4;  1AR9 4;  4PDW D;  3GQK A;  3JD7 4;  3AE9 A;  3AE2 A;  1EV1 4;  1RUF 4;  1MQT D;  1NA1 D;  2PW9 A;  1RUE 4;  2WDV A;  3AEC A;  3AE5 A;  3SFD A;  3AEG A;  3CIR A;  3P4S A;  1YQ4 A;  1HRV 4;  3P4P A;  1RVF 4;  4Q4V 4;  2HWC 4;  1XI1 A;  3VRA A;  3VR8 A;  1K5M D;  3SFE A;  1RUG 4;  1NCQ D;  3J8F 4;  2PZS A;  2WQY A;  4YTN A;  1RUH 4;  2R07 4;  1VBC 4;  2RS1 4;  4YSY A;  1KFY A;  1RUD 4;  2RM2 4;  3AE6 A;  3P4Q A;  2WP9 A;  1RUJ 4;  2WDR A;  3P4R A;  4YT0 A;  4KX6 A;  2RS5 4;  3AE3 A;  3AEF A;  2WU2 A;  1RMU 4;  1OOP D; 
#chains in the Genus database with same CATH homology
 1EAH 4;  2R06 4;  1VBA 4;  1AR8 4;  1RUG 4;  4RHV 4;  1VBE 4;  1RHI 4;  1PO1 4;  2HWB 4;  1AL2 4;  1NCQ D;  1VRH 4;  2RS3 4;  2X5I D;  3J8F 4;  1RMU 4;  2PLV 4;  1D4M 4;  1COV 4;  1AR9 4;  1POV 0;  1RUC 4;  1RUH 4;  4PDW D;  2R07 4;  3JD7 4;  1VBC 4;  1AR7 4;  2RMU 4;  2RS1 4;  2RR1 4;  1RUI 4;  4Q4W 4;  1EV1 4;  1RUF 4;  1VBB 4;  1MQT D;  1PO2 4;  1NA1 D;  1RUD 4;  1Z7S 4;  4GB3 4;  1RUE 4;  1VBD 4;  2RM2 4;  1PVC 4;  3JBG 4;  4Q4X 4;  1HXS 4;  1HRV 4;  1RUJ 4;  1R09 4;  1RVF 4;  2RS5 4;  4Q4V 4;  4Q4Y 4;  2R04 4;  1AR6 4;  1R08 4;  2HWC 4;  1BEV 4;  1ASJ 4;  1H8T D;  1PIV 4;  1K5M D;  1HRI 4;  1OOP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...