2R044

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2r04400
1PIV4 1ASJ4 1EAH4 1HXS4 1MQTD 4Q4V4 1AL24 4GB34 1RUJ4 1VBA4 1HRV4 1H8TD 4Q4W4 1BEV4 1RUF4 1HRI4 1RHI4 2R074 2HWC4 2RS54 3JBG4 4RHV4 4Q4X4 1OOPD 1RMU4 1AR64 1POV0 1RUG4 1NA1D 1Z7S4 3J8F4 1RUI4 1EV14 1AR74 1RVF4 1VBD4 1VRH4 1VBE4 2RM24 1PO14 1R094 2RR14 1PO24 2PLV4 1NCQD 3JD74 2HWB4 1RUH4 2X5ID 2RMU4 1VBB4 1VBC4 4PDWD 2R064 1RUD4 1RUE4 1K5MD 1AR94 1AR84 2RS34 1COV4 1PVC4 2RS14 4Q4Y4 1D4M4 1RUC4 1R084 2R044
chains in the Genus database with same CATH superfamily
1PIV4 1HXS4 2WU2A 2B76A 1HRV4 1H8TD 1YQ3A 1RUF4 2HWC4 4Q4X4 1OOPD 1RUI4 1EV14 1RVF4 3AE8A 2RR14 3GQHA 1NCQD 3P4PA 3SFDA 3VRAA 2HWB4 2X5ID 3AEGA 1VBB4 4KX6A 3AE6A 1RUE4 3VRBA 4YSYA 3AE9A 2PZSA 1COV4 1NEKA 2RS14 4YT0A 1NENA 1D4M4 5C3JA 2RM24 1R084 1ASJ4 1EAH4 4GB34 1RUJ4 2WDVA 1BEV4 3AEDA 1HRI4 3CIRA 3AECA 3JBG4 1NA1D 3AE3A 4YSZA 1ZOYA 3AEAA 1VRH4 2FBWA 3AEBA 1VBE4 5C2TA 2PLV4 3SFEA 3JD74 3VR8A 1RUH4 2RMU4 2R064 2WU5A 1XHZA 4YTNA 3P4RA 2R044 1RUC4 3AE1A 2EX3A 2WP9A 1MQTD 2R7FA 4Q4W4 1XI1A 2PW9A 2R074 3SUCA 3AE2A 1POV0 1RUG4 2ACZA 2WDRA 3J8F4 3P4SA 4YTMA 1L0VA 3AE4A 1AR74 3AE7A 2H89A 1R094 4YXDA 1VBC4 4PDWD 1RUD4 1AR84 2RS34 2WS3A 2WDQA 1PVC4 1YQ4A 4Q4Y4 3FI7A 3AE5A 1AL24 1VBA4 1KFYA 4YSXA 1RHI4 4YTPA 2RS54 4RHV4 3VR9A 1RMU4 1AR64 3GQKA 1KF6A 1Z7S4 2H88A 1VBD4 2WQYA 3P4QA 2PYLA 1PO14 3ABVA 1PO24 2PY5A 3AEEA 2PYJA 1ZP0A 1K5MD 1AR94 1XHXA 3AEFA 4Q4V4
chains in the Genus database with same CATH topology
1PIV4 1ASJ4 1EAH4 1HXS4 1MQTD 4Q4V4 1AL24 4GB34 1RUJ4 1VBA4 1HRV4 1H8TD 4Q4W4 1BEV4 1RUF4 1HRI4 1RHI4 2R074 2HWC4 2RS54 3JBG4 4RHV4 4Q4X4 1OOPD 1RMU4 1AR64 1POV0 1RUG4 1NA1D 1Z7S4 3J8F4 1RUI4 1EV14 1AR74 1RVF4 1VBD4 1VRH4 1VBE4 2RM24 1PO14 1R094 2RR14 1PO24 2PLV4 1NCQD 3JD74 2HWB4 1RUH4 2X5ID 2RMU4 1VBB4 1VBC4 4PDWD 2R064 1RUD4 1RUE4 1K5MD 1AR94 1AR84 2RS34 1COV4 1PVC4 2RS14 4Q4Y4 1D4M4 1RUC4 1R084 2R044
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIV 4;  1ASJ 4;  1EAH 4;  1HXS 4;  1MQT D;  4Q4V 4;  1AL2 4;  4GB3 4;  1RUJ 4;  1VBA 4;  1HRV 4;  1H8T D;  4Q4W 4;  1BEV 4;  1RUF 4;  1HRI 4;  1RHI 4;  2R07 4;  2HWC 4;  2RS5 4;  3JBG 4;  4RHV 4;  4Q4X 4;  1OOP D;  1RMU 4;  1AR6 4;  1POV 0;  1RUG 4;  1NA1 D;  1Z7S 4;  3J8F 4;  1RUI 4;  1EV1 4;  1AR7 4;  1RVF 4;  1VBD 4;  1VRH 4;  1VBE 4;  2RM2 4;  1PO1 4;  1R09 4;  2RR1 4;  1PO2 4;  2PLV 4;  1NCQ D;  3JD7 4;  2HWB 4;  1RUH 4;  2X5I D;  2RMU 4;  1VBB 4;  1VBC 4;  4PDW D;  2R06 4;  1RUD 4;  1RUE 4;  1K5M D;  1AR9 4;  1AR8 4;  2RS3 4;  1COV 4;  1PVC 4;  2RS1 4;  4Q4Y 4;  1D4M 4;  1RUC 4;  1R08 4;  2R04 4; 
#chains in the Genus database with same CATH topology
 1PIV 4;  1HXS 4;  2WU2 A;  2B76 A;  1HRV 4;  1H8T D;  1YQ3 A;  1RUF 4;  2HWC 4;  4Q4X 4;  1OOP D;  1RUI 4;  1EV1 4;  1RVF 4;  3AE8 A;  2RR1 4;  3GQH A;  1NCQ D;  3P4P A;  3SFD A;  3VRA A;  2HWB 4;  2X5I D;  3AEG A;  1VBB 4;  4KX6 A;  3AE6 A;  1RUE 4;  3VRB A;  4YSY A;  3AE9 A;  2PZS A;  1COV 4;  1NEK A;  2RS1 4;  4YT0 A;  1NEN A;  1D4M 4;  5C3J A;  2RM2 4;  1R08 4;  1ASJ 4;  1EAH 4;  4GB3 4;  1RUJ 4;  2WDV A;  1BEV 4;  3AED A;  1HRI 4;  3CIR A;  3AEC A;  3JBG 4;  1NA1 D;  3AE3 A;  4YSZ A;  1ZOY A;  3AEA A;  1VRH 4;  2FBW A;  3AEB A;  1VBE 4;  5C2T A;  2PLV 4;  3SFE A;  3JD7 4;  3VR8 A;  1RUH 4;  2RMU 4;  2R06 4;  2WU5 A;  1XHZ A;  4YTN A;  3P4R A;  2R04 4;  1RUC 4;  3AE1 A;  2EX3 A;  2WP9 A;  1MQT D;  2R7F A;  4Q4W 4;  1XI1 A;  2PW9 A;  2R07 4;  3SUC A;  3AE2 A;  1POV 0;  1RUG 4;  2ACZ A;  2WDR A;  3J8F 4;  3P4S A;  4YTM A;  1L0V A;  3AE4 A;  1AR7 4;  3AE7 A;  2H89 A;  1R09 4;  4YXD A;  1VBC 4;  4PDW D;  1RUD 4;  1AR8 4;  2RS3 4;  2WS3 A;  2WDQ A;  1PVC 4;  1YQ4 A;  4Q4Y 4;  3FI7 A;  3AE5 A;  1AL2 4;  1VBA 4;  1KFY A;  4YSX A;  1RHI 4;  4YTP A;  2RS5 4;  4RHV 4;  3VR9 A;  1RMU 4;  1AR6 4;  3GQK A;  1KF6 A;  1Z7S 4;  2H88 A;  1VBD 4;  2WQY A;  3P4Q A;  2PYL A;  1PO1 4;  3ABV A;  1PO2 4;  2PY5 A;  3AEE A;  2PYJ A;  1ZP0 A;  1K5M D;  1AR9 4;  1XHX A;  3AEF A;  4Q4V 4; 
#chains in the Genus database with same CATH homology
 1PIV 4;  1ASJ 4;  1EAH 4;  1HXS 4;  1MQT D;  4Q4V 4;  1AL2 4;  4GB3 4;  1RUJ 4;  1VBA 4;  1HRV 4;  1H8T D;  4Q4W 4;  1BEV 4;  1RUF 4;  1HRI 4;  1RHI 4;  2R07 4;  2HWC 4;  2RS5 4;  3JBG 4;  4RHV 4;  4Q4X 4;  1OOP D;  1RMU 4;  1AR6 4;  1POV 0;  1RUG 4;  1NA1 D;  1Z7S 4;  3J8F 4;  1RUI 4;  1EV1 4;  1AR7 4;  1RVF 4;  1VBD 4;  1VRH 4;  1VBE 4;  2RM2 4;  1PO1 4;  1R09 4;  2RR1 4;  1PO2 4;  2PLV 4;  1NCQ D;  3JD7 4;  2HWB 4;  1RUH 4;  2X5I D;  2RMU 4;  1VBB 4;  1VBC 4;  4PDW D;  2R06 4;  1RUD 4;  1RUE 4;  1K5M D;  1AR9 4;  1AR8 4;  2RS3 4;  1COV 4;  1PVC 4;  2RS1 4;  4Q4Y 4;  1D4M 4;  1RUC 4;  1R08 4;  2R04 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...