1VBD4

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vbd400
1VBD4 1AR74 2RS34 1NA1D 1OOPD 1EV14 1RUD4 1R084 1VBC4 1PO14 1HRV4 2RS54 1H8TD 2R064 2RMU4 1MQTD 1COV4 1BEV4 1AR64 1AL24 1HXS4 2R044 3JD74 1ASJ4 4Q4X4 3J8F4 1AR84 1PO24 4Q4W4 2R074 1PIV4 4Q4V4 1VBE4 2RM24 1HRI4 1RUH4 3JBG4 1Z7S4 1RUI4 2RR14 2X5ID 1EAH4 1NCQD 1POV0 1RUE4 4PDWD 2HWB4 2PLV4 1RMU4 1D4M4 4GB34 1VRH4 1R094 1RHI4 1AR94 1VBB4 1RVF4 4RHV4 1K5MD 1RUJ4 2RS14 1RUG4 1VBA4 1PVC4 4Q4Y4 1RUC4 1RUF4 2HWC4
chains in the Genus database with same CATH superfamily
3AE9A 3AEDA 1H8TD 2R064 1COV4 3GQHA 3AEEA 2PZSA 1AR84 4YSXA 5C2TA 2R074 4KX6A 1HRI4 2ACZA 1RUI4 4YTPA 1EAH4 1NCQD 1XI1A 1RUE4 3AE6A 2PLV4 1RMU4 1D4M4 1KFYA 1YQ3A 1RUJ4 1RUG4 1NEKA 1VBA4 2H88A 4YTNA 2PY5A 1RUF4 2HWC4 1XHZA 3P4RA 1AR74 1NA1D 1VBC4 1RUC4 2FBWA 1YQ4A 4YSYA 2RMU4 1MQTD 1BEV4 2R044 1HXS4 3JD74 4YSZA 1ASJ4 2WP9A 1PIV4 3JBG4 1Z7S4 2WS3A 2X5ID 2H89A 2RR14 1POV0 4PDWD 1NENA 3AE4A 2WQYA 3VRAA 1RHI4 4RHV4 1RVF4 3AE7A 3AEAA 2WU2A 2WDQA 2RS34 3AEBA 1KF6A 1OOPD 1R084 3FI7A 1AR64 3SFEA 3VR8A 1ZP0A 3J8F4 4Q4W4 4Q4V4 1VBE4 2RM24 3P4QA 4Q4Y4 3AECA 2R7FA 3GQKA 2HWB4 3AEGA 1VRH4 1ZOYA 1R094 1AR94 2B76A 1VBB4 3AEFA 3AE8A 3SUCA 3ABVA 1K5MD 2EX3A 1PVC4 3P4SA 1VBD4 3AE2A 2WDVA 1EV14 1RUD4 3AE5A 3SFDA 1PO14 1HRV4 2RS54 2PYLA 3VR9A 1L0VA 1AL24 3P4PA 4Q4X4 1PO24 2PYJA 4YXDA 1RUH4 1XHXA 2WDRA 2WU5A 4GB34 3VRBA 5C3JA 4YTMA 3AE3A 3AE1A 3CIRA 2RS14 2PW9A 4YT0A
chains in the Genus database with same CATH topology
1VBD4 1AR74 2RS34 1NA1D 1OOPD 1EV14 1RUD4 1R084 1VBC4 1PO14 1HRV4 2RS54 1H8TD 2R064 2RMU4 1MQTD 1COV4 1BEV4 1AR64 1AL24 1HXS4 2R044 3JD74 1ASJ4 4Q4X4 3J8F4 1AR84 1PO24 4Q4W4 2R074 1PIV4 4Q4V4 1VBE4 2RM24 1HRI4 1RUH4 3JBG4 1Z7S4 1RUI4 2RR14 2X5ID 1EAH4 1NCQD 1POV0 1RUE4 4PDWD 2HWB4 2PLV4 1RMU4 1D4M4 4GB34 1VRH4 1R094 1RHI4 1AR94 1VBB4 1RVF4 4RHV4 1K5MD 1RUJ4 2RS14 1RUG4 1VBA4 1PVC4 4Q4Y4 1RUC4 1RUF4 2HWC4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBD 4;  1AR7 4;  2RS3 4;  1NA1 D;  1OOP D;  1EV1 4;  1RUD 4;  1R08 4;  1VBC 4;  1PO1 4;  1HRV 4;  2RS5 4;  1H8T D;  2R06 4;  2RMU 4;  1MQT D;  1COV 4;  1BEV 4;  1AR6 4;  1AL2 4;  1HXS 4;  2R04 4;  3JD7 4;  1ASJ 4;  4Q4X 4;  3J8F 4;  1AR8 4;  1PO2 4;  4Q4W 4;  2R07 4;  1PIV 4;  4Q4V 4;  1VBE 4;  2RM2 4;  1HRI 4;  1RUH 4;  3JBG 4;  1Z7S 4;  1RUI 4;  2RR1 4;  2X5I D;  1EAH 4;  1NCQ D;  1POV 0;  1RUE 4;  4PDW D;  2HWB 4;  2PLV 4;  1RMU 4;  1D4M 4;  4GB3 4;  1VRH 4;  1R09 4;  1RHI 4;  1AR9 4;  1VBB 4;  1RVF 4;  4RHV 4;  1K5M D;  1RUJ 4;  2RS1 4;  1RUG 4;  1VBA 4;  1PVC 4;  4Q4Y 4;  1RUC 4;  1RUF 4;  2HWC 4; 
#chains in the Genus database with same CATH topology
 3AE9 A;  3AED A;  1H8T D;  2R06 4;  1COV 4;  3GQH A;  3AEE A;  2PZS A;  1AR8 4;  4YSX A;  5C2T A;  2R07 4;  4KX6 A;  1HRI 4;  2ACZ A;  1RUI 4;  4YTP A;  1EAH 4;  1NCQ D;  1XI1 A;  1RUE 4;  3AE6 A;  2PLV 4;  1RMU 4;  1D4M 4;  1KFY A;  1YQ3 A;  1RUJ 4;  1RUG 4;  1NEK A;  1VBA 4;  2H88 A;  4YTN A;  2PY5 A;  1RUF 4;  2HWC 4;  1XHZ A;  3P4R A;  1AR7 4;  1NA1 D;  1VBC 4;  1RUC 4;  2FBW A;  1YQ4 A;  4YSY A;  2RMU 4;  1MQT D;  1BEV 4;  2R04 4;  1HXS 4;  3JD7 4;  4YSZ A;  1ASJ 4;  2WP9 A;  1PIV 4;  3JBG 4;  1Z7S 4;  2WS3 A;  2X5I D;  2H89 A;  2RR1 4;  1POV 0;  4PDW D;  1NEN A;  3AE4 A;  2WQY A;  3VRA A;  1RHI 4;  4RHV 4;  1RVF 4;  3AE7 A;  3AEA A;  2WU2 A;  2WDQ A;  2RS3 4;  3AEB A;  1KF6 A;  1OOP D;  1R08 4;  3FI7 A;  1AR6 4;  3SFE A;  3VR8 A;  1ZP0 A;  3J8F 4;  4Q4W 4;  4Q4V 4;  1VBE 4;  2RM2 4;  3P4Q A;  4Q4Y 4;  3AEC A;  2R7F A;  3GQK A;  2HWB 4;  3AEG A;  1VRH 4;  1ZOY A;  1R09 4;  1AR9 4;  2B76 A;  1VBB 4;  3AEF A;  3AE8 A;  3SUC A;  3ABV A;  1K5M D;  2EX3 A;  1PVC 4;  3P4S A;  1VBD 4;  3AE2 A;  2WDV A;  1EV1 4;  1RUD 4;  3AE5 A;  3SFD A;  1PO1 4;  1HRV 4;  2RS5 4;  2PYL A;  3VR9 A;  1L0V A;  1AL2 4;  3P4P A;  4Q4X 4;  1PO2 4;  2PYJ A;  4YXD A;  1RUH 4;  1XHX A;  2WDR A;  2WU5 A;  4GB3 4;  3VRB A;  5C3J A;  4YTM A;  3AE3 A;  3AE1 A;  3CIR A;  2RS1 4;  2PW9 A;  4YT0 A; 
#chains in the Genus database with same CATH homology
 1VBD 4;  1AR7 4;  2RS3 4;  1NA1 D;  1OOP D;  1EV1 4;  1RUD 4;  1R08 4;  1VBC 4;  1PO1 4;  1HRV 4;  2RS5 4;  1H8T D;  2R06 4;  2RMU 4;  1MQT D;  1COV 4;  1BEV 4;  1AR6 4;  1AL2 4;  1HXS 4;  2R04 4;  3JD7 4;  1ASJ 4;  4Q4X 4;  3J8F 4;  1AR8 4;  1PO2 4;  4Q4W 4;  2R07 4;  1PIV 4;  4Q4V 4;  1VBE 4;  2RM2 4;  1HRI 4;  1RUH 4;  3JBG 4;  1Z7S 4;  1RUI 4;  2RR1 4;  2X5I D;  1EAH 4;  1NCQ D;  1POV 0;  1RUE 4;  4PDW D;  2HWB 4;  2PLV 4;  1RMU 4;  1D4M 4;  4GB3 4;  1VRH 4;  1R09 4;  1RHI 4;  1AR9 4;  1VBB 4;  1RVF 4;  4RHV 4;  1K5M D;  1RUJ 4;  2RS1 4;  1RUG 4;  1VBA 4;  1PVC 4;  4Q4Y 4;  1RUC 4;  1RUF 4;  2HWC 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...