1VBD4

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
62
Chain Sequence
b'GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vbd400
1D4M4 1AR84 1EAH4 1RUE4 2RM24 3JBG4 4Q4V4 1Z7S4 1RUF4 1RHI4 1COV4 1RUJ4 1PO24 1H8TD 1RVF4 1RMU4 1VBD4 1VRH4 1PVC4 2R044 2RS34 1OOPD 2HWB4 1K5MD 1POV0 1RUC4 1VBA4 2HWC4 1AR64 1EV14 2PLV4 1AL24 1R084 2RR14 4RHV4 4Q4W4 1VBC4 1PIV4 1RUG4 4Q4Y4 2R064 1VBE4 1NCQD 1PO14 2X5ID 1RUH4 3JD74 2RS14 1BEV4 1RUI4 2RMU4 1ASJ4 4Q4X4 1MQTD 1HRV4 1HRI4 1VBB4 1AR94 1NA1D 3J8F4 1R094 4PDWD 2R074 2RS54 1AR74 1HXS4 4GB34 1RUD4
chains in the Genus database with same CATH superfamily
2EX3A 3AEFA 1KF6A 3AE8A 4Q4V4 2WS3A 3AE3A 4YSXA 3P4SA 1COV4 3P4PA 1VRH4 3AEGA 1K5MD 1POV0 4YTMA 3SFDA 4Q4W4 1VBC4 3AEDA 2H88A 3AE6A 3SUCA 1BEV4 2RMU4 1ZP0A 4YTNA 3VR9A 1NEKA 1XHZA 4YTPA 3VRBA 3P4RA 2R074 1AR74 1HXS4 1AR84 3AECA 3JBG4 1RUE4 1RHI4 1RUJ4 2RS34 3CIRA 2PYJA 1PVC4 3FI7A 1OOPD 1RUC4 2PLV4 1R084 3AE9A 3ABVA 1PIV4 4Q4Y4 2ACZA 1RUH4 4YXDA 5C3JA 2WP9A 3AE2A 1NENA 4YT0A 2RS54 4YSYA 3VRAA 1Z7S4 1RUF4 1RVF4 1ZOYA 2WU2A 1XI1A 2HWB4 1VBA4 1AL24 4RHV4 2WDVA 1YQ3A 3SFEA 3P4QA 1NCQD 2WQYA 1PO14 2X5ID 1XHXA 3JD74 2RS14 1RUI4 4KX6A 1ASJ4 1HRV4 1HRI4 1VBB4 1AR94 1NA1D 2WU5A 3J8F4 2PY5A 4PDWD 3AE5A 2PYLA 3GQKA 2WDQA 2R7FA 5C2TA 3AEAA 1KFYA 1L0VA 2H89A 1D4M4 1EAH4 2RM24 3AE7A 2B76A 1PO24 1H8TD 1VBD4 1RMU4 2R044 3GQHA 2WDRA 4GB34 2HWC4 1AR64 1EV14 2PW9A 2RR14 2FBWA 1RUG4 2R064 1VBE4 4Q4X4 1MQTD 1YQ4A 3VR8A 3AEEA 2PZSA 1R094 3AE1A 4YSZA 3AE4A 3AEBA 1RUD4
chains in the Genus database with same CATH topology
1D4M4 1AR84 1EAH4 1RUE4 2RM24 3JBG4 4Q4V4 1Z7S4 1RUF4 1RHI4 1COV4 1RUJ4 1PO24 1H8TD 1RVF4 1RMU4 1VBD4 1VRH4 1PVC4 2R044 2RS34 1OOPD 2HWB4 1K5MD 1POV0 1RUC4 1VBA4 2HWC4 1AR64 1EV14 2PLV4 1AL24 1R084 2RR14 4RHV4 4Q4W4 1VBC4 1PIV4 1RUG4 4Q4Y4 2R064 1VBE4 1NCQD 1PO14 2X5ID 1RUH4 3JD74 2RS14 1BEV4 1RUI4 2RMU4 1ASJ4 4Q4X4 1MQTD 1HRV4 1HRI4 1VBB4 1AR94 1NA1D 3J8F4 1R094 4PDWD 2R074 2RS54 1AR74 1HXS4 4GB34 1RUD4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4M 4;  1AR8 4;  1EAH 4;  1RUE 4;  2RM2 4;  3JBG 4;  4Q4V 4;  1Z7S 4;  1RUF 4;  1RHI 4;  1COV 4;  1RUJ 4;  1PO2 4;  1H8T D;  1RVF 4;  1RMU 4;  1VBD 4;  1VRH 4;  1PVC 4;  2R04 4;  2RS3 4;  1OOP D;  2HWB 4;  1K5M D;  1POV 0;  1RUC 4;  1VBA 4;  2HWC 4;  1AR6 4;  1EV1 4;  2PLV 4;  1AL2 4;  1R08 4;  2RR1 4;  4RHV 4;  4Q4W 4;  1VBC 4;  1PIV 4;  1RUG 4;  4Q4Y 4;  2R06 4;  1VBE 4;  1NCQ D;  1PO1 4;  2X5I D;  1RUH 4;  3JD7 4;  2RS1 4;  1BEV 4;  1RUI 4;  2RMU 4;  1ASJ 4;  4Q4X 4;  1MQT D;  1HRV 4;  1HRI 4;  1VBB 4;  1AR9 4;  1NA1 D;  3J8F 4;  1R09 4;  4PDW D;  2R07 4;  2RS5 4;  1AR7 4;  1HXS 4;  4GB3 4;  1RUD 4; 
#chains in the Genus database with same CATH topology
 2EX3 A;  3AEF A;  1KF6 A;  3AE8 A;  4Q4V 4;  2WS3 A;  3AE3 A;  4YSX A;  3P4S A;  1COV 4;  3P4P A;  1VRH 4;  3AEG A;  1K5M D;  1POV 0;  4YTM A;  3SFD A;  4Q4W 4;  1VBC 4;  3AED A;  2H88 A;  3AE6 A;  3SUC A;  1BEV 4;  2RMU 4;  1ZP0 A;  4YTN A;  3VR9 A;  1NEK A;  1XHZ A;  4YTP A;  3VRB A;  3P4R A;  2R07 4;  1AR7 4;  1HXS 4;  1AR8 4;  3AEC A;  3JBG 4;  1RUE 4;  1RHI 4;  1RUJ 4;  2RS3 4;  3CIR A;  2PYJ A;  1PVC 4;  3FI7 A;  1OOP D;  1RUC 4;  2PLV 4;  1R08 4;  3AE9 A;  3ABV A;  1PIV 4;  4Q4Y 4;  2ACZ A;  1RUH 4;  4YXD A;  5C3J A;  2WP9 A;  3AE2 A;  1NEN A;  4YT0 A;  2RS5 4;  4YSY A;  3VRA A;  1Z7S 4;  1RUF 4;  1RVF 4;  1ZOY A;  2WU2 A;  1XI1 A;  2HWB 4;  1VBA 4;  1AL2 4;  4RHV 4;  2WDV A;  1YQ3 A;  3SFE A;  3P4Q A;  1NCQ D;  2WQY A;  1PO1 4;  2X5I D;  1XHX A;  3JD7 4;  2RS1 4;  1RUI 4;  4KX6 A;  1ASJ 4;  1HRV 4;  1HRI 4;  1VBB 4;  1AR9 4;  1NA1 D;  2WU5 A;  3J8F 4;  2PY5 A;  4PDW D;  3AE5 A;  2PYL A;  3GQK A;  2WDQ A;  2R7F A;  5C2T A;  3AEA A;  1KFY A;  1L0V A;  2H89 A;  1D4M 4;  1EAH 4;  2RM2 4;  3AE7 A;  2B76 A;  1PO2 4;  1H8T D;  1VBD 4;  1RMU 4;  2R04 4;  3GQH A;  2WDR A;  4GB3 4;  2HWC 4;  1AR6 4;  1EV1 4;  2PW9 A;  2RR1 4;  2FBW A;  1RUG 4;  2R06 4;  1VBE 4;  4Q4X 4;  1MQT D;  1YQ4 A;  3VR8 A;  3AEE A;  2PZS A;  1R09 4;  3AE1 A;  4YSZ A;  3AE4 A;  3AEB A;  1RUD 4; 
#chains in the Genus database with same CATH homology
 1D4M 4;  1AR8 4;  1EAH 4;  1RUE 4;  2RM2 4;  3JBG 4;  4Q4V 4;  1Z7S 4;  1RUF 4;  1RHI 4;  1COV 4;  1RUJ 4;  1PO2 4;  1H8T D;  1RVF 4;  1RMU 4;  1VBD 4;  1VRH 4;  1PVC 4;  2R04 4;  2RS3 4;  1OOP D;  2HWB 4;  1K5M D;  1POV 0;  1RUC 4;  1VBA 4;  2HWC 4;  1AR6 4;  1EV1 4;  2PLV 4;  1AL2 4;  1R08 4;  2RR1 4;  4RHV 4;  4Q4W 4;  1VBC 4;  1PIV 4;  1RUG 4;  4Q4Y 4;  2R06 4;  1VBE 4;  1NCQ D;  1PO1 4;  2X5I D;  1RUH 4;  3JD7 4;  2RS1 4;  1BEV 4;  1RUI 4;  2RMU 4;  1ASJ 4;  4Q4X 4;  1MQT D;  1HRV 4;  1HRI 4;  1VBB 4;  1AR9 4;  1NA1 D;  3J8F 4;  1R09 4;  4PDW D;  2R07 4;  2RS5 4;  1AR7 4;  1HXS 4;  4GB3 4;  1RUD 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...