1VBD4

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
total genus 3
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vbd400
3JD74 1AL24 1RMU4 1VBC4 1PO24 1PO14 2RMU4 1AR84 1VBA4 1RUF4 1EV14 1RUJ4 1PVC4 2RM24 2RR14 1VBB4 4Q4X4 1VRH4 1RUI4 1H8TD 1K5MD 1RUC4 1AR94 1ASJ4 2HWB4 1EAH4 1VBE4 1HRV4 3J8F4 1RHI4 4RHV4 2RS54 4Q4Y4 2X5ID 4PDWD 1D4M4 4GB34 4Q4W4 1HRI4 2RS14 1MQTD 1PIV4 3JBG4 1RUE4 4Q4V4 1HXS4 1NCQD 1NA1D 1POV0 1AR64 1RUH4 1Z7S4 2HWC4 1R094 1OOPD 2PLV4 1AR74 1RVF4 2R064 2R074 1VBD4 2RS34 1BEV4 1RUG4 1COV4 2R044 1RUD4 1R084
chains in the Genus database with same CATH superfamily
1RMU4 3AEEA 4YTMA 1RUJ4 2RR14 3AE1A 1AR94 3AE5A 2PW9A 3AEBA 3GQHA 3J8F4 4YSYA 4PDWD 3P4RA 2WQYA 4Q4W4 1HRI4 1MQTD 3AE4A 4YT0A 4KX6A 3AE3A 1NA1D 2R7FA 2PLV4 2R074 1BEV4 1RUG4 3P4SA 2R044 2WU2A 2H88A 1AL24 2WDQA 3AECA 2PY5A 1VBA4 4YSZA 1EV14 3AEDA 5C3JA 1EAH4 3VR8A 1ZP0A 1VBE4 1HRV4 2PZSA 4Q4Y4 2X5ID 1YQ3A 3VR9A 4YXDA 3AEGA 2RS14 3CIRA 1RUE4 1AR64 3JD74 3VRBA 2HWC4 1AR74 1VBD4 1COV4 1R084 1XHZA 3SUCA 1VBC4 1PO24 2RMU4 4YSXA 1RUF4 3FI7A 1PVC4 2RM24 1VBB4 1KF6A 2WS3A 4Q4X4 1H8TD 1K5MD 3SFEA 2B76A 1ASJ4 2EX3A 2HWB4 2ACZA 3AE2A 3P4PA 1RHI4 2PYLA 2WP9A 1PIV4 4Q4V4 3GQKA 1HXS4 1NCQD 1Z7S4 1RUH4 4RHV4 3SFDA 2WU5A 3AE9A 1VRH4 2WDVA 1PO14 1AR84 4YTNA 2H89A 3AEFA 1RUI4 1RUC4 4YTPA 3P4QA 1NENA 3ABVA 1KFYA 2RS54 1D4M4 4GB34 3AEAA 2FBWA 1L0VA 3AE7A 3VRAA 1XHXA 3JBG4 3AE8A 1NEKA 1POV0 3AE6A 1XI1A 2R064 1R094 1OOPD 1YQ4A 1RVF4 5C2TA 2RS34 2WDRA 2PYJA 1RUD4 1ZOYA
chains in the Genus database with same CATH topology
3JD74 1AL24 1RMU4 1VBC4 1PO24 1PO14 2RMU4 1AR84 1VBA4 1RUF4 1EV14 1RUJ4 1PVC4 2RM24 2RR14 1VBB4 4Q4X4 1VRH4 1RUI4 1H8TD 1K5MD 1RUC4 1AR94 1ASJ4 2HWB4 1EAH4 1VBE4 1HRV4 3J8F4 1RHI4 4RHV4 2RS54 4Q4Y4 2X5ID 4PDWD 1D4M4 4GB34 4Q4W4 1HRI4 2RS14 1MQTD 1PIV4 3JBG4 1RUE4 4Q4V4 1HXS4 1NCQD 1NA1D 1POV0 1AR64 1RUH4 1Z7S4 2HWC4 1R094 1OOPD 2PLV4 1AR74 1RVF4 2R064 2R074 1VBD4 2RS34 1BEV4 1RUG4 1COV4 2R044 1RUD4 1R084
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JD7 4;  1AL2 4;  1RMU 4;  1VBC 4;  1PO2 4;  1PO1 4;  2RMU 4;  1AR8 4;  1VBA 4;  1RUF 4;  1EV1 4;  1RUJ 4;  1PVC 4;  2RM2 4;  2RR1 4;  1VBB 4;  4Q4X 4;  1VRH 4;  1RUI 4;  1H8T D;  1K5M D;  1RUC 4;  1AR9 4;  1ASJ 4;  2HWB 4;  1EAH 4;  1VBE 4;  1HRV 4;  3J8F 4;  1RHI 4;  4RHV 4;  2RS5 4;  4Q4Y 4;  2X5I D;  4PDW D;  1D4M 4;  4GB3 4;  4Q4W 4;  1HRI 4;  2RS1 4;  1MQT D;  1PIV 4;  3JBG 4;  1RUE 4;  4Q4V 4;  1HXS 4;  1NCQ D;  1NA1 D;  1POV 0;  1AR6 4;  1RUH 4;  1Z7S 4;  2HWC 4;  1R09 4;  1OOP D;  2PLV 4;  1AR7 4;  1RVF 4;  2R06 4;  2R07 4;  1VBD 4;  2RS3 4;  1BEV 4;  1RUG 4;  1COV 4;  2R04 4;  1RUD 4;  1R08 4; 
#chains in the Genus database with same CATH topology
 1RMU 4;  3AEE A;  4YTM A;  1RUJ 4;  2RR1 4;  3AE1 A;  1AR9 4;  3AE5 A;  2PW9 A;  3AEB A;  3GQH A;  3J8F 4;  4YSY A;  4PDW D;  3P4R A;  2WQY A;  4Q4W 4;  1HRI 4;  1MQT D;  3AE4 A;  4YT0 A;  4KX6 A;  3AE3 A;  1NA1 D;  2R7F A;  2PLV 4;  2R07 4;  1BEV 4;  1RUG 4;  3P4S A;  2R04 4;  2WU2 A;  2H88 A;  1AL2 4;  2WDQ A;  3AEC A;  2PY5 A;  1VBA 4;  4YSZ A;  1EV1 4;  3AED A;  5C3J A;  1EAH 4;  3VR8 A;  1ZP0 A;  1VBE 4;  1HRV 4;  2PZS A;  4Q4Y 4;  2X5I D;  1YQ3 A;  3VR9 A;  4YXD A;  3AEG A;  2RS1 4;  3CIR A;  1RUE 4;  1AR6 4;  3JD7 4;  3VRB A;  2HWC 4;  1AR7 4;  1VBD 4;  1COV 4;  1R08 4;  1XHZ A;  3SUC A;  1VBC 4;  1PO2 4;  2RMU 4;  4YSX A;  1RUF 4;  3FI7 A;  1PVC 4;  2RM2 4;  1VBB 4;  1KF6 A;  2WS3 A;  4Q4X 4;  1H8T D;  1K5M D;  3SFE A;  2B76 A;  1ASJ 4;  2EX3 A;  2HWB 4;  2ACZ A;  3AE2 A;  3P4P A;  1RHI 4;  2PYL A;  2WP9 A;  1PIV 4;  4Q4V 4;  3GQK A;  1HXS 4;  1NCQ D;  1Z7S 4;  1RUH 4;  4RHV 4;  3SFD A;  2WU5 A;  3AE9 A;  1VRH 4;  2WDV A;  1PO1 4;  1AR8 4;  4YTN A;  2H89 A;  3AEF A;  1RUI 4;  1RUC 4;  4YTP A;  3P4Q A;  1NEN A;  3ABV A;  1KFY A;  2RS5 4;  1D4M 4;  4GB3 4;  3AEA A;  2FBW A;  1L0V A;  3AE7 A;  3VRA A;  1XHX A;  3JBG 4;  3AE8 A;  1NEK A;  1POV 0;  3AE6 A;  1XI1 A;  2R06 4;  1R09 4;  1OOP D;  1YQ4 A;  1RVF 4;  5C2T A;  2RS3 4;  2WDR A;  2PYJ A;  1RUD 4;  1ZOY A; 
#chains in the Genus database with same CATH homology
 3JD7 4;  1AL2 4;  1RMU 4;  1VBC 4;  1PO2 4;  1PO1 4;  2RMU 4;  1AR8 4;  1VBA 4;  1RUF 4;  1EV1 4;  1RUJ 4;  1PVC 4;  2RM2 4;  2RR1 4;  1VBB 4;  4Q4X 4;  1VRH 4;  1RUI 4;  1H8T D;  1K5M D;  1RUC 4;  1AR9 4;  1ASJ 4;  2HWB 4;  1EAH 4;  1VBE 4;  1HRV 4;  3J8F 4;  1RHI 4;  4RHV 4;  2RS5 4;  4Q4Y 4;  2X5I D;  4PDW D;  1D4M 4;  4GB3 4;  4Q4W 4;  1HRI 4;  2RS1 4;  1MQT D;  1PIV 4;  3JBG 4;  1RUE 4;  4Q4V 4;  1HXS 4;  1NCQ D;  1NA1 D;  1POV 0;  1AR6 4;  1RUH 4;  1Z7S 4;  2HWC 4;  1R09 4;  1OOP D;  2PLV 4;  1AR7 4;  1RVF 4;  2R06 4;  2R07 4;  1VBD 4;  2RS3 4;  1BEV 4;  1RUG 4;  1COV 4;  2R04 4;  1RUD 4;  1R08 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...