1VRH4

Hrv14/sdz 880-061 complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Synthesis and activity of piperazine-containing antirhinoviral agents and crystal structure of SDZ 880-061 bound to human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vrh400
1AR84 1HXS4 1VBE4 1MQTD 2RR14 4RHV4 1NCQD 1ASJ4 1COV4 2HWB4 1EV14 1RVF4 1VBA4 1AR64 2HWC4 1PO24 1RHI4 1RUD4 2RMU4 1RUE4 1EAH4 1D4M4 3JD74 1VBD4 4GB34 4Q4Y4 1PVC4 1HRV4 4Q4X4 1AR74 1OOPD 1VRH4 4Q4V4 1PIV4 1BEV4 1K5MD 1Z7S4 1NA1D 1POV0 1RUC4 2R074 2R064 1VBB4 2RM24 3JBG4 4PDWD 1HRI4 1AL24 1RUG4 1H8TD 2R044 2RS34 2RS14 2X5ID 4Q4W4 1RUF4 2PLV4 1RUH4 1AR94 1RUJ4 1VBC4 3J8F4 1R094 1PO14 1RUI4 2RS54 1R084 1RMU4
chains in the Genus database with same CATH superfamily
1ZP0A 1HXS4 4RHV4 4YT0A 1ASJ4 3ABVA 4YSXA 3AE7A 2B76A 3AEDA 1RHI4 3VRBA 4YSYA 1D4M4 1VBD4 1L0VA 4YSZA 1BEV4 3AEEA 1POV0 3VR8A 3CIRA 3JBG4 2WU2A 1YQ4A 2ACZA 1RUG4 1NEKA 1RUH4 3SFDA 3AE9A 2RS54 1VBE4 2RR14 3AE4A 1RVF4 1KFYA 2WU5A 3P4SA 2PY5A 1RUD4 4Q4Y4 4GB34 4YTPA 4Q4X4 1AR74 2WDRA 2PYJA 1NA1D 3GQHA 2R074 4PDWD 3P4PA 4Q4W4 2RS34 5C3JA 2PLV4 3AEGA 3GQKA 1R094 1RUI4 1AR84 2PYLA 2WP9A 1XI1A 1NCQD 2HWB4 1EV14 2WDQA 4KX6A 1VBA4 1AR64 2WDVA 2FBWA 2PZSA 3JD74 1XHZA 1OOPD 2WQYA 4Q4V4 1PIV4 2WS3A 1KF6A 2RM24 1VBB4 1HRI4 1NENA 1H8TD 3AE5A 1YQ3A 2EX3A 3AE2A 1PO14 1ZOYA 3SUCA 3J8F4 1RMU4 5C2TA 1MQTD 2H88A 1COV4 3AE3A 3FI7A 4YTMA 3SFEA 2HWC4 3AEFA 1PO24 4YXDA 3VR9A 2RMU4 1RUE4 1EAH4 3AEAA 1XHXA 1HRV4 2H89A 1PVC4 3AEBA 2PW9A 3AE6A 3P4RA 1VRH4 1K5MD 1Z7S4 1RUC4 2R064 3AE8A 1AL24 3AECA 2R044 2RS14 3VRAA 2X5ID 3AE1A 4YTNA 1RUF4 1AR94 1RUJ4 1VBC4 3P4QA 2R7FA 1R084
chains in the Genus database with same CATH topology
1AR84 1HXS4 1VBE4 1MQTD 2RR14 4RHV4 1NCQD 1ASJ4 1COV4 2HWB4 1EV14 1RVF4 1VBA4 1AR64 2HWC4 1PO24 1RHI4 1RUD4 2RMU4 1RUE4 1EAH4 1D4M4 3JD74 1VBD4 4GB34 4Q4Y4 1PVC4 1HRV4 4Q4X4 1AR74 1OOPD 1VRH4 4Q4V4 1PIV4 1BEV4 1K5MD 1Z7S4 1NA1D 1POV0 1RUC4 2R074 2R064 1VBB4 2RM24 3JBG4 4PDWD 1HRI4 1AL24 1RUG4 1H8TD 2R044 2RS34 2RS14 2X5ID 4Q4W4 1RUF4 2PLV4 1RUH4 1AR94 1RUJ4 1VBC4 3J8F4 1R094 1PO14 1RUI4 2RS54 1R084 1RMU4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR8 4;  1HXS 4;  1VBE 4;  1MQT D;  2RR1 4;  4RHV 4;  1NCQ D;  1ASJ 4;  1COV 4;  2HWB 4;  1EV1 4;  1RVF 4;  1VBA 4;  1AR6 4;  2HWC 4;  1PO2 4;  1RHI 4;  1RUD 4;  2RMU 4;  1RUE 4;  1EAH 4;  1D4M 4;  3JD7 4;  1VBD 4;  4GB3 4;  4Q4Y 4;  1PVC 4;  1HRV 4;  4Q4X 4;  1AR7 4;  1OOP D;  1VRH 4;  4Q4V 4;  1PIV 4;  1BEV 4;  1K5M D;  1Z7S 4;  1NA1 D;  1POV 0;  1RUC 4;  2R07 4;  2R06 4;  1VBB 4;  2RM2 4;  3JBG 4;  4PDW D;  1HRI 4;  1AL2 4;  1RUG 4;  1H8T D;  2R04 4;  2RS3 4;  2RS1 4;  2X5I D;  4Q4W 4;  1RUF 4;  2PLV 4;  1RUH 4;  1AR9 4;  1RUJ 4;  1VBC 4;  3J8F 4;  1R09 4;  1PO1 4;  1RUI 4;  2RS5 4;  1R08 4;  1RMU 4; 
#chains in the Genus database with same CATH topology
 1ZP0 A;  1HXS 4;  4RHV 4;  4YT0 A;  1ASJ 4;  3ABV A;  4YSX A;  3AE7 A;  2B76 A;  3AED A;  1RHI 4;  3VRB A;  4YSY A;  1D4M 4;  1VBD 4;  1L0V A;  4YSZ A;  1BEV 4;  3AEE A;  1POV 0;  3VR8 A;  3CIR A;  3JBG 4;  2WU2 A;  1YQ4 A;  2ACZ A;  1RUG 4;  1NEK A;  1RUH 4;  3SFD A;  3AE9 A;  2RS5 4;  1VBE 4;  2RR1 4;  3AE4 A;  1RVF 4;  1KFY A;  2WU5 A;  3P4S A;  2PY5 A;  1RUD 4;  4Q4Y 4;  4GB3 4;  4YTP A;  4Q4X 4;  1AR7 4;  2WDR A;  2PYJ A;  1NA1 D;  3GQH A;  2R07 4;  4PDW D;  3P4P A;  4Q4W 4;  2RS3 4;  5C3J A;  2PLV 4;  3AEG A;  3GQK A;  1R09 4;  1RUI 4;  1AR8 4;  2PYL A;  2WP9 A;  1XI1 A;  1NCQ D;  2HWB 4;  1EV1 4;  2WDQ A;  4KX6 A;  1VBA 4;  1AR6 4;  2WDV A;  2FBW A;  2PZS A;  3JD7 4;  1XHZ A;  1OOP D;  2WQY A;  4Q4V 4;  1PIV 4;  2WS3 A;  1KF6 A;  2RM2 4;  1VBB 4;  1HRI 4;  1NEN A;  1H8T D;  3AE5 A;  1YQ3 A;  2EX3 A;  3AE2 A;  1PO1 4;  1ZOY A;  3SUC A;  3J8F 4;  1RMU 4;  5C2T A;  1MQT D;  2H88 A;  1COV 4;  3AE3 A;  3FI7 A;  4YTM A;  3SFE A;  2HWC 4;  3AEF A;  1PO2 4;  4YXD A;  3VR9 A;  2RMU 4;  1RUE 4;  1EAH 4;  3AEA A;  1XHX A;  1HRV 4;  2H89 A;  1PVC 4;  3AEB A;  2PW9 A;  3AE6 A;  3P4R A;  1VRH 4;  1K5M D;  1Z7S 4;  1RUC 4;  2R06 4;  3AE8 A;  1AL2 4;  3AEC A;  2R04 4;  2RS1 4;  3VRA A;  2X5I D;  3AE1 A;  4YTN A;  1RUF 4;  1AR9 4;  1RUJ 4;  1VBC 4;  3P4Q A;  2R7F A;  1R08 4; 
#chains in the Genus database with same CATH homology
 1AR8 4;  1HXS 4;  1VBE 4;  1MQT D;  2RR1 4;  4RHV 4;  1NCQ D;  1ASJ 4;  1COV 4;  2HWB 4;  1EV1 4;  1RVF 4;  1VBA 4;  1AR6 4;  2HWC 4;  1PO2 4;  1RHI 4;  1RUD 4;  2RMU 4;  1RUE 4;  1EAH 4;  1D4M 4;  3JD7 4;  1VBD 4;  4GB3 4;  4Q4Y 4;  1PVC 4;  1HRV 4;  4Q4X 4;  1AR7 4;  1OOP D;  1VRH 4;  4Q4V 4;  1PIV 4;  1BEV 4;  1K5M D;  1Z7S 4;  1NA1 D;  1POV 0;  1RUC 4;  2R07 4;  2R06 4;  1VBB 4;  2RM2 4;  3JBG 4;  4PDW D;  1HRI 4;  1AL2 4;  1RUG 4;  1H8T D;  2R04 4;  2RS3 4;  2RS1 4;  2X5I D;  4Q4W 4;  1RUF 4;  2PLV 4;  1RUH 4;  1AR9 4;  1RUJ 4;  1VBC 4;  3J8F 4;  1R09 4;  1PO1 4;  1RUI 4;  2RS5 4;  1R08 4;  1RMU 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...