2PW9A

Crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
251
structure length
231
Chain Sequence
b'PLSIMQKSVVIRPGGRQEMDEHVAIETPYAIALNDRVIGSSMVLPVDLEEFGAGFLFGQGYIKKAEEIREILVCPQGRISVYADKIPKEMLEEFAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTGRLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative formate dehydrogenase accessory protein
publication title Crystal structure of a putative formate dehydrogenase accessory protein from Desulfotalea psychrophila.
rcsb
source organism Desulfotalea psychrophila lsv54
molecule tags Structural genomics, unknown function
total genus 63
structure length 231
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02634 FdhD-NarQ FdhD/NarQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pw9A02
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 2pw9A03
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pw9A01
2PLPA 2ZW0A 2LUMA 1K53A 5M59B 4ZFRA 2HXVA 1AF2A 4MS7A 4KGSA 2N9KA 2O95A 3V3XA 4I43B 4LCNA 4NQLA 1JMLA 2Z3HA 2HVWA 5JXVA 2ONQA 4OCMA 4LC5A 2ON8A 2IGDA 2ZW1A 3DH1A 1PGAA 4WIGA 2PYJA 2GI9A 4PQTA 1OX7A 1P7EA 1IGDA 1XCQL 1FD6A 1XI1A 5GAOA 2N7JA 3B8FA 4OCNB 1UAQA 2LGIA 2LHEA 1UWZA 2KACA 3GB1A 2PW9A 1XF5L 5HHDG 3RZUA 2RPZA 3FILB 2W4LA 3R2NA 4G3MA 1IGCA 1F2RI 4D10F 1MQ0A 2KKSA 4MACA 4MSJA 1K52A 2J53A 1TIYA 4IOIE 5BMHA 1C9FA 5BMIA 4BGDC 1ZXHA 2JZPA 3UI3A 1OI0A 4ZD5A 4O8XA 4E0QA 1VQ2A 2KCQA 1R5XA 3EX8A 2PY5A 1PGXA 4KGRA 1HEZE 4OCLA 1P7FA 1MHHE 4OWPA 1WN5A 1IBXB 4KITC 3SBGA 4D2KA 2JU6X 2NMQA 1KH0A 4ZFTA 1FCLA 4QFTA 2QSDA 4F7OA 2P87A 4ZD4A 4MSMA 4P9DA 2KN4A 1WKQA 2ZNVA 1P6OA 2G6VA 1YNTE 2J52A 2OEDA 1WWRA 3G8QA 3MPZA 2KWDA 1UX0A 3ZPGA 2KDMA 1CTUA 2IGGA 2OBCA 3IJFX 4MSDA 4O8YB 4EG2A 5BMGA 5C2OA 2RMMA 1XCTL 4HRQA 2GB1A 2O3KA 4OZBA 1ALNA 2D5NA 4OCNA 5HI1A 4WH4A 1HZ6A 2N9LA 2PYLA 4MSQA 2I2YA 1YSBA 4LCPA 1R5TA 1UWXA 3FI7A 2IGHA 1FCCC 2JWUA 1K50A 4HKZE 2K0PA 3FILA 4OZAA 2R7FA 2KQ4X 2EELA 3OCQA 1YSDA 1HZ5A 2FR6A 4OCMB 1MHXA 4OCLB 3ZPCA 2PZSA 3MP9A 5HFYA 2NX8A 4LD4A 2A8NA 1UX1A 4GLSC 4WIFA 2EX3A 5M52C 3DMOA 2I38A 1F2RC 2QLCA 1EM7A 1QKZA 2OG4A 1GB1A 2P8RA 1WN6A 1MPEA 2RPVA 2O96A 4HRWA 2FR5A 1RB7A 1IBXA 4F3WA 2D30A 4P9EA 2B3JA 2JXTA 4OZCA 2JSVX 1D4BA 1MVKA 4P9CA 1K51A 1ZABA 2Z3GA 2Z3JA 5CW6A 3RZVA 1Q10A 1GB4A 2NYTA 5HG2A 4K1RA 1JTKA 4LD2A 2PTLA 4KGTA 1Z3AA 2HVVA 4ILGC 2ZNRA 2B3ZA 3E1UA 2O7PA 1YMHE 1MI0A 3OJ6A 1XHZA 2G84A 4O8YA 4O8XB 4LCOA 3ZEFB 5DCAJ 4JXEA 1XHXA 2LHDA 4OWPB 1CTTA 2QMTA 1PGBA 4IKGA 2Z3IA 4HJGE
chains in the Genus database with same CATH superfamily
3AECA 4MM3B 1D5MC 1WYWB 2JQRB 2WXQA 4HROA 3N1ZC 3TUOA 2INNE 3SFEA 3Q8AA 2J0JA 2ONQA 2WDTB 4JWUC 2IGDA 2CHZA 3DDCB 4MJSB 1UUPA 1EWCA 1VBE4 3V62A 1QZEA 2N7JA 4WJPA 3EHVA 2QILA 3UGBB 3EA6A 2FNJB 3K9PB 4YTNB 3P4SB 3RZUA 3IFWB 2R074 3M63B 3T3OA 3BY4B 3R2TA 2L0TA 1YQ4A 4KVGB 5BMHA 4JX1C 4MDKE 2AYOB 1SE9A 2KCQA 4ARCA 2O6VA 3VAWA 2R2QA 1YX6B 3D32A 3KH0A 3DVNV 4USAA 4ZDVA 3HK0A 4ZD4A 5AEKB 4P9DA 2AX5A 1Y56A 4WAAA 2WWZA 3KQ4A 5E6NA 1XCTL 4LNNA 1ISNA 4ICUA 1YQ3B 2PYLA 2IBIB 1UWMA 4IDIA 1KF6B 3VR8A 4ANWA 2R7FA 1DOXA 1RUG4 2SAKA 1HZ5A 3FC4A 4TQ0A 2MEKA 4OCLB 1R4MI 4GLSC 2RMU4 5AUIA 3VUWA 1VD2A 2WXGA 1WN6A 1PDXA 2H88B 2FUG1 3RZFA 3CIRB 4FA6A 1Q10A 5C2TA 2PMVA 2L32A 4FHJA 4KIKB 5HG2A 1BUIC 1GNUA 5AZFA 2JRIB 4A6QA 2WDRA 1P3QU 1B1ZA 2ZPYA 1C4CA 3H7PB 3VTUA 2KVZA 1F52A 1P9DU 5GXGB 1QILA 1TYGB 4DWFA 1UF0A 5IP4D 1OEYJ 3SFDB 3BYYB 4KZ0A 2MBOA 5E6OA 2HXVA 4NJCA 2BS4B 2YEPB 3KLSX 4W9FA 1WSPA 1LO5D 3H6NA 5JXVA 2AL3A 2ON8A 1PIV4 1M4VA 1WWTA 1H8TD 1T0RC 1JWMD 5GAOA 2KAJA 4NAWA 1PYWD 3L54A 2LGYA 2BKFA 2WU5A 1NI3A 2N1VA 3ZKJC 1H8CA 2WP9A 2M8SA 4D10F 3RFZB 2XK5B 3APCA 3ZNZB 4PK1A 1SBBB 3AE4B 2K3UA 1RHI4 4BGDC 2L3ZA 2LUEA 4M02A 4MELA 4O8XA 3L0WB 1VQ2A 4F8CB 1P0RA 3SBGA 2GMIC 2D07B 1VZ6A 3L16A 3TMPB 5G5HA 2KJ6A 2WDQA 3AU5A 1SXTA 2D3BA 1QOAA 3UQAA 2J4XA 1KFYB 1WWRA 3MPZA 3ZPGA 3ZUNA 3PGEA 2MSED 5BMGA 3ABVA 4ZRIA 4HRQA 2JUOA 2O3KA 1NBFC 4LJPB 2LJIA 4I6PA 1OZ0A 3MC0B 2AQ2B 1WMHB 2KFKA 2HWC4 4YSXA 2KHWB 3BYTB 4MM3A 1L5PA 2KZRA 1MQTD 4WIFA 1AR64 1UZXB 4MSMB 2J7QB 2MJEA 4JLCA 4PYZA 2O2VB 3KW5B 1XLQA 4MJSA 3KYDD 2QDFA 1L6VA 1POV0 2W55A 3NS1A 3B08A 3P4SA 3P4PA 4IM3A 1D3ZA 1VCBA 4CYEA 3ZW3A 4XWTA 2LGSA 1CTTA 1WIAA 1PGBA 1E7PB 1TS4A 1R4NI 1LM8B 3M62B 2N9KA 3WCQA 2O95A 2B3AA 4W9JA 2BQQA 5EE0A 1HTQA 4NQLA 2IO1B 3RYTA 1KRHA 5C3JA 2KKCA 5E6JA 1J7BA 3QJZA 2K9XA 2PW9A 3L17A 3P4QB 3AE2B 3N20C 5BYQA 2M56B 2WGSA 1KF6A 1WM2A 1C9FA 4DDGD 4KX6B 2MHJA 3V61A 4FXCA 1C76A 2N9PC 4OCLA 3O65B 1MHHE 1KTKA 4OVUA 3U7ZA 3AE8B 2PIAA 1E5WA 1R4MB 3NZ3A 1HTOA 2RDGA 2ZNVA 3DHIC 1UD7A 4HK2A 1CJEA 3AEFB 1I7HA 1N5XA 4AUQC 3VTVA 2E6XA 3W1YA 2VH1A 2KWDA 2MH7A 1VBD4 2LRUA 4W9HA 2KDIA 1YSBA 1GOZA 2NBWB 2AQ3B 2G1EA 3B0AA 2KQ4X 4DXFA 1CMXB 1IYFA 4YSYA 2IZVB 3SFDA 1D6EC 2LVPA 1R084 3DBHB 3AULA 3AEDA 2WDVB 1KM7A 2K8HA 4URKA 1TIFA 2P8RA 1R094 2UYZB 2MQJA 3AE6A 2RDHA 3RNCC 3PZ7A 1D4BA 3EGRA 2NVUI 4II2B 1VK9A 4HKQA 1YJ1A 4OVZA 3SEBA 4N58A 2ZVOA 5CX3A 2HVVA 4BFRA 1WI0A 4KZCA 1XHZA 4W9EA 1M9NA 1EO6A 2LHDA 3GS2A 2LXAA 2WNMA 4ZRPA 1E8XA 1V86A 3ZNID 1TTNA 1NEKA 1TT5B 2DZKA 1R7SA 2GBRA 2ZW1A 1PGAA 3P2BA 4TSSA 2FIDA 4EEWA 5JH5C 4ARIA 1Z5SB 2ACZB 3Q3JA 2ZEQA 1UWZA 3APDA 1WY8A 3CSTA 3R2NA 5AUKA 1F2RI 3V60A 4MSJA 1RAXA 1BT0A 3E9SA 1FNWA 2C60A 1HEZE 1Q1OA 2IO3B 3VRBB 2C7NB 2DZIA 3T3NA 3AE5A 4MSMA 3RMKC 1J8CA 2G6VA 3HM6X 2J52A 2KQSA 4NAMA 2NPTB 1I4GA 2KC1A 3OLMD 3UF8A 4FBJB 2FCMA 1AW7A 4HLEA 4OZBA 2K25A 4XDDA 1XD3B 4BKSD 2N9LA 3PRZA 2RS14 3TJPA 3UQBA 3HVZA 1WJ4A 2IDYA 3BVMA 1YN5A 4IWQA 1WX8A 2GLSA 1RMU4 2CHWA 3ZJVA 1C79A 2DAJA 1VJKA 4XZ4A 4OZCA 5CW6A 4HCNB 4IC7B 1JTKA 4B95A 1YQ4B 3KVFB 1E8ZA 2NTSA 4GSWA 2O6VB 3UIOB 1QT9A 4DHJD 1PUTA 4BBNC 1FFVA 2VZKD 4AOFA 3AE8A 1UGJA 4I6NB 5L95C 4YXDA 4HPLB 2WS3B 4W9IA 1JWSD 4WIGA 1RUH4 3AEAA 3K9OB 3B2FA 4H2AA 3UINB 1FD6A 1XI1A 3U2SC 3B8FA 3ZDMC 2FCNA 1UAQA 1TKYA 3L08A 1T3QA 3PZ8A 2LMCA 1C4PA 4MH0E 3VR8B 2BYEA 5TR5A 1IGCA 3DBSA 4ANUA 1TIYA 2KTRA 3J8F4 3I63C 3R66C 4LCDE 1GJZA 4E0QA 2MX2A 3IXSA 4EHIA 2V4IB 4IW0A 3ZIMA 2ASQA 2DWQA 4ZOHC 2LZ6A 2G9HD 4WQOB 2WXKA 1N62A 1T0SC 1NENA 1WKQA 3CF6E 3ZLZA 3VX8A 1XQQA 3LYYA 3ZYYX 3W9CB 3T9LA 3I3TB 2KDMA 1KLVA 3A9JA 1GC6A 2JT4B 3W1SA 4K3BA 2JY6A 4JL9A 4OCNA 1HZ6A 3R2IA 2W54A 3TSSA 4RNAA 2NCNA 2MA9B 4FLHA 1K50A 4LLGM 1AR74 3KUCB 4HRSA 2FR6A 2GOWA 4X57B 1UBIA 1WJ6A 4MT5A 2FBWA 2CU1A 4Q4X4 3DQVA 4PT5A 4CO7A 4NAWB 3NUHB 1STEA 1UH6A 4HRWA 1CZPA 1C3TA 1RB7A 1PL0A 1YN4A 1JQ4A 2DAFA 2WU5B 1V49A 4EZKA 3DWGC 2WP9B 5JHAA 2NYTA 3P4RA 2D10A 3JW0X 1MFWA 2K1FA 4B0EA 2B3ZA 4WURA 3IG3A 4WWMA 4O8XB 2KC2A 4A3PA 2Z3IA 1I4PA 2IO0B 3R8BA 2ZW0A 4A9AA 2O6VD 3AE1A 3APFA 1D5ZC 2WXPA 2I1JA 2KWCA 1Y8RC 1WE6A 1FXAA 3Q6BA 3QARA 4LTUA 5KHQA 4GN1A 1EUVB 2XNAC 2VH2A 4BVUC 4NJ7A 1ZKHA 4W9CA 3BZDB 3GZNI 3NVVA 3GB1A 3PHWB 2KFKB 2INCC 1RUE4 2ZJDA 2ICIA 4M8MA 3NRZA 5J18A 5CHWA 4AJYB 3ALBA 1RFAA 1TKGA 1ZCZA 4HDQA 3MJWA 3KWVA 5CHFA 4Q2JA 1V1OA 1AWDA 3BINA 4G11A 4DBGA 2QSDA 2PLV4 2P87A 5C23A 2BVCA 3WALA 2G4DB 5TSSA 1COV4 4LNKA 3P4PB 1L2NA 1XT9B 3VRAA 2CU3A 2HTHA 2NR2A 4K81A 3A33B 3QWZB 1ALNA 4LNOA 3X23A 2MBEA 3SU8X 1SEBD 4P1BC 1JWBD 4DHZB 3FI7A 2IO2B 1C78A 2H89B 4OZAA 2K0PA 3T8MA 1E8YA 5KHOA 3RNAC 4NQLB 3AM9A 3PS6A 2X38A 3ENEA 3DHHC 2WXLA 3TIXA 2QJLA 5C3JB 5M52C 3X0WA 1GUAB 2WXRA 2MBQA 1DGJA 2WS3A 2L05A 3AV8A 3ONSA 2L52A 3Q8BA 3JSVA 2KOXA 1KLGD 2B1GA 4A1OA 4NQKE 1IPGA 3NOBA 4K1RA 2JPHA 5L83A 1Z3AA 1SJHD 3AE3A 1XLNA 2GBMA 1J0GA 2RDBC 2REXA 3ZRCA 5BYSA 1SIJA 2KLGA 5D3DA 2JVCA 3DBLI 4W9DA 5FR6A 5DPTA 2Z59B 2BYVE 2LUMA 3BWUD 1WRIA 5E6PA 2ZNVB 1XLOA 4BAXA 4I43B 1XLPA 3OJ3A 4XGAB 3DVNU 3DH1A 2QEJC 4ICVA 1P7EA 4LDTB 1V5OA 3WA0A 3RUIB 2N9XA 1L6UA 3W5VB 4YSYB 4MACA 1NYQA 4K7SA 3AEDB 4YSZA 4DK5A 4YT0A 4RH6A 3CWIA 3AXCA 2KX0A 3Q8EA 4KV2A 2PY5A 2K8CA 3AE6B 3AEBA 2IU3A 3IAM1 3PRMB 4W9GA 4YTPB 5LXIB 3AEEB 3I5JC 3A1QA 2BB5A 1RWSA 3R7QA 3G8QA 1UX0A 1CTUA 4EG2A 4DDID 2J0KA 3HUIA 4TKNA 4BKGA 1J7CA 5HI1A 4WWOA 1E10A 3GQKA 3ZZMA 4NJ6A 4WWNA 2D3GA 4EZLA 3FILA 3MHZA 1C1YB 2EELA 4RMAA 2DYBA 1NEKB 4C00A 1MHXA 2MW5A 5DPWA 2KJRA 2RPQA 1BEV4 4P1CC 2G45B 4LK0M 1N60A 2BW2A 2L8JA 2QC8A 1I4XA 4II3B 1MVKA 1FPYA 2PKOA 3TL5A 3GZNB 3VH4B 1YJJA 3EUB2 2PEAA 3RNBC 1VBC4 3ZVVA 2MRPA 3QK0A 3JYUA 5EE9A 3ZNGC 1VR9A 2AWTA 2A5UA 2ZPNA 4ZFRA 4L23A 3AE5B 1ESFA 1YN3A 2C7HA 4FULA 2LI5A 4JQWC 3V3XA 2BB6A 3QX1A 1NCQD 4A55A 3A4RA 1FMAD 5JZEB 2HDEA 3MC9A 1FM0D 3R7RA 4B6WA 1I35A 3PTFC 5C1ZA 1YJIA 1P1AA 1TY0A 2KVRA 2MBBB 1EU3A 1FNUA 3PV1A 2WLBA 1QLBB 3MFGA 2IPKD 4G3MA 5FR3A 3SD5A 3J9CA 1SSNA 2H89A 4R3DA 5BMIA 3QIJA 3ZJTA 3IVFA 2KYWA 1S3SG 2AL6A 1UELA 1K8RB 2M19A 1N61A 2J42A 2LASA 1FXIA 2M1MA 1QF6A 1JW9D 2BT6A 4ZRJA 3HIZA 5BYRA 5D94A 2DENB 2HWB4 4XWWA 4MSDA 5FKAC 2M17A 4P7IA 1I4HA 1D4M4 2WHIA 3AEGB 1AYFA 4YXDB 3Q3NC 4ZYSA 3ECIA 2NX8A 2A8NA 3AEAB 3JVZX 4BKTA 3SR6A 2LGXA 1OTRB 4XC2A 3TEYA 3LDZE 1ROEA 3AH7A 1ZP0A 4WAFA 1IUEA 5D6JB 2EKIA 3DBRI 1AR84 2IJ0A 1I4QA 1Q5WB 5DCNA 2KTRB 4ACFA 4RCOA 1C4AA 4TQ1A 4ILGC 3E1UA 4N9F4 3A4SC 2YVCA 2KXJA 5CTRC 2KMMA 5IO9A 4ZRKA 4EOYA 4WIPA 5H8YE 2XBBC 4IM2A 1HRV4 2PPHA 1NENB 2JF5A 4YTPA 3AEEA 4US8A 2CJNA 4L2YA 3A9JB 1Z7S4 2KN5A 2L0FA 3NHEB 4OCNB 1OQYA 2M0AA 2GBKA 2LHEA 1XF5L 3IAS1 5HHDG 1GG3A 1FXTB 3LXFA 2L1AA 1K5MD 2KKSA 4RGOS 4LNIA 1UGMA 2FBWB 1VZ8A 2PVGC 4IG7B 2WXNA 4B9KA 1PGXA 3WIMA 3R3MA 3O13A 1WGKA 3OWEB 3PVLA 3Q3MC 5LLIA 1ENFA 4C80A 1OQQA 4RF1A 2X5ID 3P4RB 1WGGA 2YLMA 4XE0A 4RM8A 4FHKA 3DWMA 2HE7A 4TMAB 2DLBA 4E74A 1XEEA 4HPPA 4BZAA 4DHZE 1DYQA 5DPSA 4MSQA 3PRPB 3AE1B 2FUHB 3EC8A 2IY0B 3QA8A 3VR9A 1SB3C 4L1BA 2MLBA 3DMOA 4Q4V4 2QLCA 3Q3OC 3Q3FA 4JWSC 2E3TA 2RPVA 1OGWA 3MC8A 2JXTA 4P9CA 2Z3GA 2K8BA 2EMSA 2SEBD 2LRWA 5AZHA 3S2AA 2I1KA 3PREA 3ZJUA 1RUJ4 3N1YC 1AR94 1WJNA 4EUTA 1R4NB 2D3AA 2D3CA 2KT7A 4GGQA 2W4LA 2B76A 4LJOB 3ZTCA 1E90A 3GE3C 1WR1A 1T0YA 1SE3A 5G5GA 3VRAB 4OCMA 2GBJA 1ZPSA 3PSEB 2R064 1TKEA 5IAAC 1JRUA 1VZ7A 2FIFA 1ZE3D 2RPZA 4ZHPA 3P63A 4KKJA 3QHTA 3QAQA 3U4EG 1RLFA 4GDLA 3SDLC 3AEGA 1TGZB 4ZD5A 3EX8A 3PPAA 2V4LA 4KGRA 1AN8A 3ZRFA 4XDCA 2MWSB 2NMQA 3C8YA 1CQVA 3JSVB 3B2GA 4F7OA 4K1RB 1L7YA 1HA5A 1FNVA 4ANVA 3AE3B 4YWGG 5JHBA 2LXCA 2IGGA 1GAQB 1SIFA 2W82A 3U52E 2RMMA 1FEHA 3RNGC 3KWLA 4F1SA 3PLVA 1TBEA 4PS3A 1WZ0A 1G8MA 3AE9A 2LD9A 4EFOA 2JWUA 3OJ4B 2DBYA 5IA7A 3EFUA 4E71A 3W2DA 4LD4A 1EF1A 1WX9A 2D11A 3NY5A 2I38A 1WR6E 1WX7A 1L4ZB 1WXMA 1FFUA 4GU2A 1IBXA 3JBG4 2BYTA 1BMLC 4WQMA 2JSVX 2RS54 3Q8FA 2HJ8A 4M8NA 3H8HA 4PDWD 4KDIC 3C0RB 3WANA 4YSZB 3L4PA 3ZQ4A 1ET9A 4YT0B 5LXHA 4A8XC 3ZEFB 1NI2A 4PS8A 1XHXA 3ZDTA 3AEBB 4WJQA 1RYJA 1ASJ4 1EU4A 2LFIA 4GDKA 5M59B 1V9JA 2WXFA 1AF2A 3A1QB 1F9JA 4GB9A 1RRBA 2HVWA 1RUC4 4LC5A 2DHZA 4W9KA 2PYJA 3I9V1 1OX7A 2WU2A 3SUCA 1SE4A 1HQRD 2RR9A 4GB34 1EV14 2KACA 3ZGZA 1WGDA 1VBB4 3FILB 3PLUA 5LNK1 2WXIA 1MQ0A 4M00A 5J17A 2BS2B 4IOIE 3Q8CA 2N4FA 4RM9A 3URYA 1ZOYA 4WWPA 2KQ7A 2ZCBA 4HPMB 1M94A 4B0MA 1SE2A 2WXMA 4ZHOA 2KDFB 4J6IA 1ZDXA 1RM6C 2KWVB 3ML8A 2KN4A 4RGMA 1ET6A 2KJHB 2MCNB 4PS7A 3HHMA 4TV3A 4MGZE 4J6EA 1ZW7A 2CHXA 2WYQA 1UWXA 3SHQA 3RN9C 1L0YB 3VTWA 1RUF4 3AI5A 1WXVA 2QIEB 3W1SC 4EKUA 3OAWA 4C4VA 2IYDB 3MP9A 4HCPB 4HXDA 3M3JA 2HJ1A 1F77A 3CSFA 2FAZA 1QKZA 1VLBA 1V8CA 3UIPB 3PT2B 2FR5A 4F3WA 5H92C 2KDEB 2MP2B 4DXGA 4MEMA 5EE3A 2JYEA 2CR5A 1JCKB 1YOVB 3VFKA 4FJZA 2ZNRA 1WYGA 3DVGY 1V81A 1J7AA 1TY2A 3OJ6A 4O8YA 3HVDA 1E7UA 2QMTA 4CHKA 1SGHA 3TBLD 1L0XB 3V6CB 1YIWA 1U4AA 1LFDA 2L00B 4M01A 4A20A 2PE6B 3H7SA 1Q0WB 5MPOA 2K5PA 3TEWA 3IBEA 4P6VF 4FN2A 4QAYA 1N6ZA 4S0RA 4PQTA 1AL24 1A5RA 1LGRA 1XCQL 1ZUD2 5D7GA 3WAMA 1VRAB 1SF0A 4F7ZA 2FCQA 1S1QB 1WH3A 3NS8A 1P98A 1V5TA 2BPSA 1TJEA 2D2QA 5AZGA 1PVC4 4HWIB 4FJYA 1X1MA 2GBNA 1HE8A 2VRRB 3KUDB 2RSUA 3VQIA 1V1PA 1R5XA 4BOSC 1QOBA 4G50A 4JIOU 1OEYA 2PVOD 3ML9A 2V1YA 1ZP0B 2RM24 2JU6X 4J3OD 1G6JA 2WQYA 4YL8A 1TZOA 4K7UA 1T0QC 1N5WA 3ZNHB 5GMVA 3ZXRA 1ZXIA 4HEA1 3ZO5B 2V0GA 1C77A 3HM3A 2GB1A 2JZ3B 5HKHA 3NG0A 4Q4W4 2D5NA 3JD74 3ETRA 4OW0A 4AJWA 4C7YA 3KUZA 4HKZE 3NJTA 2Z8LA 3BVGA 4FJVB 1F1HA 2ZVNA 1OQRA 3L10B 2Y5PA 2WXHA 3DBHI 1HXS4 3RNEC 2LWPA 3GOEA 2OG4A 5G2NA 4TUUA 4JPSA 2JX5A 2N1WA 4C7ZA 1WXAA 2C5LC 2C7MB 4MGYE 4P9EA 3TEXA 2UWQA 3RZVA 1GB4A 4XX5A 2JXXA 5G55A 1PO14 5CHVC 2KX3A 2ZCCA 1OFFA 1TZ1A 1NDDA 3VHTC 4JXEA 2JZZA 3N1XC 2KMCA 2KANA 4A90A 2PLPA 3QCAA 4HVBA 1K53A 1WGRA 5DPRA 2ZZPB 3QQ8B 1E6EB 4LNFA 4YTMB 4REZA 1DOYA 1TS3A 2AEHA 5FK9C 3V6EB 2RGFA 3A9KA 2EKEC 4MSQB 2MBHA 3OG5A 1E9MA 2N7DA 4ZRQA 1WXQA 3VUXA 1A70A 2L76A 1L4DB 2BTEA 3PHXB 2BS3B 1OOPD 3VR9B 3RT3B 1ZXHA 3C19A 3RD2A 1OI0A 1JWAD 2G3QB 2DYOA 1P7FA 5EDSA 1YQBA 4OWPA 1WN5A 1L0VA 2INDC 3VDZA 4DXAB 4FADA 1KOTA 4ZFTA 1FCLA 4QFTA 1RUI4 1E7VA 1PQSA 3NVWA 1FRRA 4LDTD 2MP2A 3DOWA 4NNJB 1YNTE 2NTTA 4I6LB 3U7DA 5IOIA 1WRDB 3B9JA 4RGNA 3NVZA 2B76B 5EE1A 2I2YA 3EECA 1EF5A 4LCPA 4YTNA 1Z2MA 1NYRA 1FCCC 2NBVB 2Y3AA 2QCZA 3DPDA 2KLCA 4KDLB 3PZDA 2JRHA 3RPFC 4HDOA 4OCMB 1F2RC 1FRDA 2KTFA 4NZLB 1CK1A 4RGTA 1MG8A 2AQ1B 3BIID 3N30A 1SJED 1JRPA 4NPNA 1EAH4 2QHOA 2V3SA 3DCGA 3M95A 4W9LA 2V3PA 2PTLA 3VUYA 2MJ3A 2R61A 3FKYA 3MTNB 3TEZA 1VBA4 4GDLB 1THZA 2Z0DB 1WM3A 3Q69A 1GC7A 3DBLB 5DCAJ 1E0ZA 1HXYD 1QQRA 2OHFA 3U8ZA 3V05A 3B1LX 1QOFA 1YQ3A 3RZWC 1WGYA 4MGKE 2Y5CA 2KMAA 2XEWA 3W5UB 3BK1A 1WFYA 3AN1A 1YD8U 2HTME 2OJWA 1PKXA 2V9HA 2LGIA 2H88A 2FCSA 3AE9B 3NZSA 5I4DA 3CIRA 2BWFA 1I4RA 4KIKA 4GGMX 1K52A 2J53A 1IP9A 2XN9C 1DOIA 4P16A 5D3IB 2K39A 4BOZB 3UI3A 4HJKA 1V97A 3H7PA 4AQ7A 2OJRA 1IBXB 4KITC 1VRH4 1BXTA 4MGIE 2C9WB 4KSKC 5C2OA 1UBQA 2RR14 1KJTA 4K3CA 2CS4A 5IN7A 4GDKB 2EMTA 3EFCA 1ACCA 3MJ5A 2K6QA 4DHJB 2CJOA 1YSDA 1WF9A 2XK5A 3AE4A 1MJDA 2M0XA 5D2MB 2VZKB 1RFKA 3N9YC 4NY0A 2WU2B 4YTMA 1MPEA 3ZTDA 3BVZA 2IY1B 2D30A 3Q2AC 2LJ5A 2ZNVC 2YEPF 1K51A 1TS2A 1ZABA 2Z3JA 4MH8A 5BO4B 2DZMA 1PO24 2G4SA 1WGHA 1QOGA 3Q14C 1KFYA 1ZOYB 2O7PA 1YMHE 1MI0A 2GRIA 2L7RA 5J2RA 1LQBA 4GMVA 3HRDD 4IKGA 2DNFA 4M0WB 3CMMB 1J19A 3AE7B 1WMHA 2K6DB 4UDUC 4MS7A 1H4RA 4KGSA 2KO3A 1JMLA 3AU4A 1JALA 3MHSD 1IGDA 1FIQA 4WJNA 2W3SA 4KSLC 1B9RA 2N7EA 2NS5A 1XXGA 2KFJA 2WXJA 3GQHA 2LVQA 2W3RA 3BH1A 1V6EA 2O2VA 2K22A 2DZJA 4ASWC 4OVVA 4S17A 4C4VB 4BBNF 2IU0A 2BBCA 3H9DA 2BKRB 3AECB 3WAOA 2DX5B 2LVOA 3WAPA 2Y5BB 2FE8A 2N9EB 4D2KA 4PYUA 5IKCM 1KH0A 3NVYA 3SFEB 1RUD4 2CKHB 2MJDA 2V3NA 3LJ3A 2W9NA 2PE9A 4GXBA 2LEKA 1UNSA 2Q5WD 2OEDA 2R2OA 3BK2A 2R044 4O8YB 1MG4A 3RULA 1TS5A 1EWYC 3P4QA 2IGHA 3AE2A 3GP7A 1T5XD 1LXDA 1JROA 4GOCA 1WZ3A 3ZPCA 4GIVA 5HFYA 2DYMA 2KNBA 2EX3A 3H1UA 4KX6A 4EZJA 4A3OA 3AMZA 4DQOC 3KYCD 1N63A 3ZXVA 3DBRB 4N6EB 4O1NA 4C56C 4OHJA 2B3JA 2OOBB 3L13A 2B1IA 1WXSA 2RD0A 3NZUA 3I57A 3AEFA 4RFBA 4KKIA 4RF0A 4JGHB 2BWES 4BKSA 3PO0A 4LCOA 1V1PB 2WX1A 1ZGUB 3U30A 1NVID 3E56A 1ZDVA 4CQNA 4HJGE 3RNFC 3N3KB 2WQYB 4G3XB 2JWZA 2L83A 3N32A 2J0MA 4JE3B 2BGFA 3IT4B 4LCNA 2A4ZA 4AP4C 2KDBA 4AS1A 2Z3HA 4RHV4 1XO3A 2KK8A 4G0NB 2GI9A 2WDVA 2JYTA 1WE7A 5C2TB 1YX5B 2WX0A 1NA1D 1GPXA 2WDRB 3QC8B 2BYFA 1VDVA 4Q4Y4 4IM0A 2RS34 3TCAA 5T8IA 4K7WA 2JZPA 1T6BX 1PFDA 2INPE 4EE2A 4AWJA 4IWPA 2Z0EB 1D5XC 1E8WA 1V80A 3AB5A 2TSSA 2PJHA 4WJOA 3RCZA 4US9A 3DVGX 1P6OA 3VVWB 4ZYNA 3P42A 3IHPC 3IT6B 4N59A 3RI7C 2OBCA 1JWUD 1FO4A 3IJFX 4E3CA 4WH4A 2ACZA 1R5TA 4ANXA 3LB8C 3OCQA 4M0WA 3AE7A 2PZSA 1KLUD 1UX1A 2BF8B 2LGDA 3VXWA 1V2YA 1EM7A 3A9KB 3DHGC 1GB1A 3P1MA 2WDQB 2X8XX 4IWOA 2O96A 2NBUA 1I42A 2M4NA 1HRI4 3VRBA 1AARA 3GE8C 2UU7A 3FAHA 3ABVB 4LD2A 4KGTA 4IUMB 2WXOA 1RVF4 1P4RA 2NPTA 2HD5B 2KD0A 1F0ZA 2G84A 4XYCA 1WJUA 3VH3B 4OWPB 2KWUB 1L0VB 4YSXB 2N0SB 2D5GA 4ITKA
chains in the Genus database with same CATH topology
2PLPA 5H8YE 1K53A 4MM3B 1D5MC 1FFVA 1NENB 2JQRB 2VZKD 2WXQA 4HROA 3TUOA 1UGJA 1E6EB 2INNE 4YTMB 3Q8AA 4REZA 2ONQA 4JWUC 1DOYA 2IGDA 2WS3B 1JWSD 2CJNA 4US8A 4WIGA 1TS3A 4L2YA 5FK9C 3B2FA 4H2AA 1FD6A 1UUPA 1EWCA 1XI1A 3U2SC 2N7JA 3B8FA 4OCNB 2QILA 1TKYA 1UAQA 2M0AA 3EA6A 2LHEA 1T3QA 3PZ8A 2LMCA 1C4PA 1E9MA 1XF5L 3P4SB 3IAS1 4YTNB 5HHDG 3RZUA 3VR8B 3LXFA 4ZRQA 1WXQA 2L1AA 1IGCA 1A70A 1L4DB 3T3OA 2BTEA 2KKSA 2BS3B 3R2TA 3VR9B 4RGOS 1TIYA 5BMHA 2FBWB 1VZ8A 1ZXHA 4JX1C 1OI0A 1JWAD 2PVGC 2WXNA 4E0QA 2DYOA 3IXSA 2KCQA 1PGXA 2V4IB 4ARCA 1P7FA 3O13A 4OWPA 1WGKA 1WN5A 3OWEB 1ENFA 4C80A 2DWQA 4ZFTA 4ZOHC 1FCLA 4QFTA 4USAA 1OQQA 2G9HD 4RF1A 2WXKA 4ZD4A 1N62A 3P4RB 4P9DA 2AX5A 1WKQA 1Y56A 3NVWA 1FRRA 4XE0A 3LYYA 1YNTE 2NTTA 3B9JA 3DWMA 4RGNA 4TMAB 3W9CB 3KQ4A 3ZYYX 2KDMA 2DLBA 1XEEA 1XCTL 3W1SA 1DYQA 4OCNA 3NVZA 1YQ3B 1HZ6A 2B76B 3R2IA 5EE1A 2PYLA 4MSQA 1UWMA 2W54A 4IDIA 3TSSA 2I2YA 4LCPA 4RNAA 3AE1B 1KF6B 1NYRA 1FCCC 1K50A 4LLGM 2R7FA 2Y3AA 1DOXA 2SAKA 3RPFC 1HZ5A 3FC4A 4HRSA 4TQ0A 2FR6A 4OCMB 2MEKA 4OCLB 1SB3C 4MT5A 4GLSC 4L1BA 3DMOA 1F2RC 1FRDA 5AUIA 2QLCA 4PT5A 4JWSC 2E3TA 1CK1A 3NUHB 4NAWB 4NZLB 2WXGA 4RGTA 1WN6A 1PDXA 1STEA 2AQ1B 2RPVA 3BIID 1CZPA 2H88B 2FUG1 1RB7A 4HRWA 1SJED 1YN4A 3CIRB 1JQ4A 2WU5B 1JRPA 2JXTA 4P9CA 2Z3GA 3DWGC 1Q10A 2WP9B 2NYTA 2PMVA 2L32A 5HG2A 2V3PA 1BUIC 2PTLA 4A6QA 4B0EA 2MJ3A 2R61A 2SEBD 1B1ZA 3TEZA 2B3ZA 4GDLB 4WURA 1C4CA 3Q69A 3ZJUA 4WWMA 4O8XB 5DCAJ 1E0ZA 1HXYD 1QQRA 2OHFA 3V05A 5GXGB 1QILA 1QOFA 1TYGB 2Z3IA 2W4LA 1I4PA 3R8BA 3SFDB 2ZW0A 4A9AA 3BYYB 2HXVA 4NJCA 1D5ZC 2WXPA 2BS4B 2YEPB 2Y5CA 3KLSX 3W5UB 1WSPA 3BK1A 1LO5D 1SE3A 1FXAA 4LTUA 5G5GA 3VRAB 5JXVA 4OCMA 2ON8A 1ZPSA 3AN1A 1M4VA 1WWTA 2XNAC 2HTME 1TKEA 1JWMD 5GAOA 2KAJA 3BZDB 1VZ7A 2LGIA 1PYWD 3NVVA 3GB1A 3AE9B 5I4DA 1ZE3D 2RPZA 1NI3A 4ZHPA 3P63A 4KKJA 1I4RA 2ICIA 4D10F 3RFZB 1K52A 2J53A 3NRZA 1SBBB 2XN9C 1DOIA 3AE4B 3U4EG 2K3UA 4P16A 5D3IB 4BGDC 3UI3A 4ZD5A 1V97A 4O8XA 1VQ2A 3EX8A 1TKGA 4KGRA 4AQ7A 3KWVA 3SBGA 1IBXB 1AN8A 4KITC 4XDCA 2NMQA 4Q2JA 3C8YA 1AWDA 1CQVA 1V1OA 1VZ6A 5G5HA 1BXTA 3B2GA 2QSDA 4F7OA 2P87A 1SXTA 5TSSA 1HA5A 1QOAA 3P4PB 1FNVA 2J4XA 1KFYB 3AE3B 1WWRA 3MPZA 4YWGG 2CU3A 3ZPGA 2IGGA 5C2OA 1GAQB 5BMGA 2W82A 3U52E 2RMMA 4HRQA 1FEHA 2O3KA 1ALNA 3KWLA 1SEBD 2LJIA 1JWBD 4GDKB 3MC0B 2AQ2B 3FI7A 1C78A 1ACCA 2H89B 2JWUA 4OZAA 2DBYA 2K0PA 3MJ5A 3AM9A 2CJOA 2X38A 1YSDA 3BYTB 2WXLA 1L5PA 2QJLA 3W2DA 4LD4A 5C3JB 4WIFA 2VZKB 5M52C 1RFKA 2I38A 3N9YC 2WU2B 2WXRA 1MPEA 1L4ZB 1DGJA 1FFUA 2MJEA 3BVZA 1IBXA 2D30A 2BYTA 1BMLC 1XLQA 3AV8A 4WQMA 2JSVX 2L52A 3Q8BA 1L6VA 2YEPF 1K51A 1KLGD 1TS2A 3Q8FA 1ZABA 2W55A 3NS1A 4MH8A 2Z3JA 3H8HA 4K1RA 1Z3AA 1QOGA 1SJHD 1XLNA 1ZOYB 4YSZB 3L4PA 3ZQ4A 1ET9A 4YT0B 2O7PA 1YMHE 4A8XC 1MI0A 5BYSA 1SIJA 5D3DA 3ZEFB 2GRIA 1XHXA 3AEBB 4XWTA 1CTTA 1RYJA 1PGBA 3HRDD 1E7PB 1TS4A 4IKGA 1EU4A 2LFIA 2LUMA 3BWUD 5M59B 1WRIA 3AE7B 2WXFA 4UDUC 1AF2A 4MS7A 4KGSA 2N9KA 1XLOA 3WCQA 2O95A 4I43B 4NQLA 5EE0A 1XLPA 1JMLA 2HVWA 4LC5A 1JALA 1KRHA 2QEJC 3DH1A 2PYJA 3I9V1 1OX7A 1P7EA 1IGDA 1FIQA 2W3SA 5E6JA 1B9RA 1J7BA 1SE4A 1HQRD 1XXGA 2WXJA 2K9XA 2KACA 2PW9A 2W3RA 3ZGZA 3P4QB 1L6UA 3AE2B 3FILB 2K22A 3W5VB 5LNK1 2WXIA 5BYQA 2M56B 4YSYB 1MQ0A 4MACA 1NYQA 2BS2B 4IOIE 3Q8CA 3URYA 1C9FA 3AEDB 2BBCA 4RH6A 4KX6B 3AECB 3CWIA 4FXCA 3Q8EA 2PY5A 1C76A 4B0MA 3AE6B 4OCLA 2FE8A 1SE2A 1MHHE 2WXMA 1KTKA 4ZHOA 3U7ZA 3IAM1 4D2KA 3AE8B 2PIAA 1ZDXA 1KH0A 3NVYA 4YTPB 3SFEB 1RM6C 3AEEB 3NZ3A 2MJDA 2V3NA 2RDGA 2KN4A 2ZNVA 4RGMA 1ET6A 1CJEA 2LEKA 3AEFB 1I7HA 1RWSA 1N5XA 1UNSA 2BB5A 2OEDA 2Q5WD 2E6XA 3G8QA 2KWDA 2MH7A 1UX0A 2B3JA 3BK2A 1CTUA 4O8YB 4EG2A 3HUIA 1PUTA 1J7CA 5HI1A 1E10A 1TS5A 1YSBA 1EWYC 1UWXA 1GOZA 2IGHA 2AQ3B 1L0YB 2G1EA 3FILA 3GP7A 1T5XD 2KQ4X 3MHZA 2EELA 4DXFA 2QIEB 1NEKB 1JROA 1D6EC 1MHXA 3ZPCA 3MP9A 5HFYA 2DYMA 2WDVB 2EX3A 1F77A 1QKZA 1VLBA 1V8CA 2P8RA 3AMZA 4DQOC 4LK0M 2FR5A 1N60A 2BW2A 4F3WA 2RDHA 5H92C 1N63A 4C56C 1I4XA 3PZ7A 4N6EB 4O1NA 4OHJA 3EGRA 1MVKA 4DXGA 5EE3A 1D4BA 2JYEA 4HKQA 2PKOA 4OVZA 3SEBA 4N58A 1JCKB 3I57A 2HVVA 4RFBA 2ZNRA 4KKIA 4RF0A 1WYGA 1J7AA 1YJJA 3EUB2 1TY2A 3OJ6A 1XHZA 3PO0A 4O8YA 3HVDA 4LCOA 1V1PB 5EE9A 2LHDA 3GS2A 1NVID 2QMTA 1VR9A 3E56A 2WNMA 1ZDVA 1L0XB 4HJGE 4CQNA 4ZRPA 2WQYB 2L83A 4ZFRA 4L23A 4JE3B 3AE5B 1ESFA 1YN3A 3IT4B 3V3XA 4LCNA 2BB6A 4AS1A 5MPOA 2K5PA 2Z3HA 3TEWA 1XO3A 4A55A 1R7SA 4P6VF 2ZW1A 1PGAA 4TSSA 2GI9A 1FMAD 4PQTA 2HDEA 1FM0D 1XCQL 1ZUD2 2JYTA 5D7GA 1YJIA 1VRAB 1TY0A 4ARIA 1SF0A 2ACZB 5C2TB 1EU3A 1FNUA 1UWZA 1GPXA 2WLBA 2WDRB 1QLBB 3MFGA 2IPKD 3R2NA 1VDVA 5FR3A 4G3MA 5AUKA 1TJEA 1F2RI 4MSJA 3J9CA 5T8IA 1SSNA 4R3DA 5BMIA 4A90A 3ZJTA 2JZPA 1T6BX 3E9SA 3VQIA 1FNWA 1PFDA 2INPE 1V1PA 1R5XA 4EE2A 1QOBA 1HEZE 2PVOD 1ZP0B 2JU6X 2M19A 4J3OD 1N61A 2J42A 1D5XC 3VRBB 1FXIA 3AB5A 1TZOA 2TSSA 3T3NA 1QF6A 4US9A 4MSMA 1N5WA 1JW9D 2BT6A 1P6OA 2G6VA 5BYRA 1ZXIA 4HEA1 2J52A 4NAMA 2V0GA 1C77A 3P42A 3IT6B 1I4GA 4N59A 4XWWA 2OBCA 1JWUD 1FO4A 3IJFX 4MSDA 5FKAC 1AW7A 2GB1A 4OZBA 2D5NA 4XDDA 4WH4A 2N9LA 1I4HA 3ETRA 1R5TA 4OW0A 4C7YA 4HKZE 2Z8LA 3BVGA 3LB8C 3HVZA 3AEGB 3OCQA 1AYFA 4YXDB 2IDYA 1OQRA 3BVMA 4M0WA 1YN5A 2Y5PA 4ZYSA 2WXHA 2PZSA 2NX8A 1KLUD 2A8NA 1UX1A 3AEAB 1EM7A 3ZJVA 2OG4A 1GB1A 1C79A 2WDQB 3P1MA 4JPSA 2JX5A 3SR6A 2O96A 4C7ZA 3TEYA 1ROEA 3AH7A 1VJKA 4P9EA 4OZCA 4WAFA 1IUEA 3TEXA 5CW6A 3RZVA 2EKIA 1GB4A 3FAHA 2IJ0A 1I4QA 3ABVB 4LD2A 1JTKA 4KGTA 4RCOA 1C4AA 1YQ4B 4TQ1A 4ILGC 2WXOA 3E1UA 1OFFA 2NTSA 1F0ZA 2G84A 4JXEA 4OWPB 1QT9A 2KMMA 1L0VB 4YSXB 2N0SB 2D5GA 4WIPA 4ITKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLP A;  2ZW0 A;  2LUM A;  1K53 A;  5M59 B;  4ZFR A;  2HXV A;  1AF2 A;  4MS7 A;  4KGS A;  2N9K A;  2O95 A;  3V3X A;  4I43 B;  4LCN A;  4NQL A;  1JML A;  2Z3H A;  2HVW A;  5JXV A;  2ONQ A;  4OCM A;  4LC5 A;  2ON8 A;  2IGD A;  2ZW1 A;  3DH1 A;  1PGA A;  4WIG A;  2PYJ A;  2GI9 A;  4PQT A;  1OX7 A;  1P7E A;  1IGD A;  1XCQ L;  1FD6 A;  1XI1 A;  5GAO A;  2N7J A;  3B8F A;  4OCN B;  1UAQ A;  2LGI A;  2LHE A;  1UWZ A;  2KAC A;  3GB1 A;  2PW9 A;  1XF5 L;  5HHD G;  3RZU A;  2RPZ A;  3FIL B;  2W4L A;  3R2N A;  4G3M A;  1IGC A;  1F2R I;  4D10 F;  1MQ0 A;  2KKS A;  4MAC A;  4MSJ A;  1K52 A;  2J53 A;  1TIY A;  4IOI E;  5BMH A;  1C9F A;  5BMI A;  4BGD C;  1ZXH A;  2JZP A;  3UI3 A;  1OI0 A;  4ZD5 A;  4O8X A;  4E0Q A;  1VQ2 A;  2KCQ A;  1R5X A;  3EX8 A;  2PY5 A;  1PGX A;  4KGR A;  1HEZ E;  4OCL A;  1P7F A;  1MHH E;  4OWP A;  1WN5 A;  1IBX B;  4KIT C;  3SBG A;  4D2K A;  2JU6 X;  2NMQ A;  1KH0 A;  4ZFT A;  1FCL A;  4QFT A;  2QSD A;  4F7O A;  2P87 A;  4ZD4 A;  4MSM A;  4P9D A;  2KN4 A;  1WKQ A;  2ZNV A;  1P6O A;  2G6V A;  1YNT E;  2J52 A;  2OED A;  1WWR A;  3G8Q A;  3MPZ A;  2KWD A;  1UX0 A;  3ZPG A;  2KDM A;  1CTU A;  2IGG A;  2OBC A;  3IJF X;  4MSD A;  4O8Y B;  4EG2 A;  5BMG A;  5C2O A;  2RMM A;  1XCT L;  4HRQ A;  2GB1 A;  2O3K A;  4OZB A;  1ALN A;  2D5N A;  4OCN A;  5HI1 A;  4WH4 A;  1HZ6 A;  2N9L A;  2PYL A;  4MSQ A;  2I2Y A;  1YSB A;  4LCP A;  1R5T A;  1UWX A;  3FI7 A;  2IGH A;  1FCC C;  2JWU A;  1K50 A;  4HKZ E;  2K0P A;  3FIL A;  4OZA A;  2R7F A;  2KQ4 X;  2EEL A;  3OCQ A;  1YSD A;  1HZ5 A;  2FR6 A;  4OCM B;  1MHX A;  4OCL B;  3ZPC A;  2PZS A;  3MP9 A;  5HFY A;  2NX8 A;  4LD4 A;  2A8N A;  1UX1 A;  4GLS C;  4WIF A;  2EX3 A;  5M52 C;  3DMO A;  2I38 A;  1F2R C;  2QLC A;  1EM7 A;  1QKZ A;  2OG4 A;  1GB1 A;  2P8R A;  1WN6 A;  1MPE A;  2RPV A;  2O96 A;  4HRW A;  2FR5 A;  1RB7 A;  1IBX A;  4F3W A;  2D30 A;  4P9E A;  2B3J A;  2JXT A;  4OZC A;  2JSV X;  1D4B A;  1MVK A;  4P9C A;  1K51 A;  1ZAB A;  2Z3G A;  2Z3J A;  5CW6 A;  3RZV A;  1Q10 A;  1GB4 A;  2NYT A;  5HG2 A;  4K1R A;  1JTK A;  4LD2 A;  2PTL A;  4KGT A;  1Z3A A;  2HVV A;  4ILG C;  2ZNR A;  2B3Z A;  3E1U A;  2O7P A;  1YMH E;  1MI0 A;  3OJ6 A;  1XHZ A;  2G84 A;  4O8Y A;  4O8X B;  4LCO A;  3ZEF B;  5DCA J;  4JXE A;  1XHX A;  2LHD A;  4OWP B;  1CTT A;  2QMT A;  1PGB A;  4IKG A;  2Z3I A;  4HJG E; 
#chains in the Genus database with same CATH topology
 3AEC A;  4MM3 B;  1D5M C;  1WYW B;  2JQR B;  2WXQ A;  4HRO A;  3N1Z C;  3TUO A;  2INN E;  3SFE A;  3Q8A A;  2J0J A;  2ONQ A;  2WDT B;  4JWU C;  2IGD A;  2CHZ A;  3DDC B;  4MJS B;  1UUP A;  1EWC A;  1VBE 4;  3V62 A;  1QZE A;  2N7J A;  4WJP A;  3EHV A;  2QIL A;  3UGB B;  3EA6 A;  2FNJ B;  3K9P B;  4YTN B;  3P4S B;  3RZU A;  3IFW B;  2R07 4;  3M63 B;  3T3O A;  3BY4 B;  3R2T A;  2L0T A;  1YQ4 A;  4KVG B;  5BMH A;  4JX1 C;  4MDK E;  2AYO B;  1SE9 A;  2KCQ A;  4ARC A;  2O6V A;  3VAW A;  2R2Q A;  1YX6 B;  3D32 A;  3KH0 A;  3DVN V;  4USA A;  4ZDV A;  3HK0 A;  4ZD4 A;  5AEK B;  4P9D A;  2AX5 A;  1Y56 A;  4WAA A;  2WWZ A;  3KQ4 A;  5E6N A;  1XCT L;  4LNN A;  1ISN A;  4ICU A;  1YQ3 B;  2PYL A;  2IBI B;  1UWM A;  4IDI A;  1KF6 B;  3VR8 A;  4ANW A;  2R7F A;  1DOX A;  1RUG 4;  2SAK A;  1HZ5 A;  3FC4 A;  4TQ0 A;  2MEK A;  4OCL B;  1R4M I;  4GLS C;  2RMU 4;  5AUI A;  3VUW A;  1VD2 A;  2WXG A;  1WN6 A;  1PDX A;  2H88 B;  2FUG 1;  3RZF A;  3CIR B;  4FA6 A;  1Q10 A;  5C2T A;  2PMV A;  2L32 A;  4FHJ A;  4KIK B;  5HG2 A;  1BUI C;  1GNU A;  5AZF A;  2JRI B;  4A6Q A;  2WDR A;  1P3Q U;  1B1Z A;  2ZPY A;  1C4C A;  3H7P B;  3VTU A;  2KVZ A;  1F52 A;  1P9D U;  5GXG B;  1QIL A;  1TYG B;  4DWF A;  1UF0 A;  5IP4 D;  1OEY J;  3SFD B;  3BYY B;  4KZ0 A;  2MBO A;  5E6O A;  2HXV A;  4NJC A;  2BS4 B;  2YEP B;  3KLS X;  4W9F A;  1WSP A;  1LO5 D;  3H6N A;  5JXV A;  2AL3 A;  2ON8 A;  1PIV 4;  1M4V A;  1WWT A;  1H8T D;  1T0R C;  1JWM D;  5GAO A;  2KAJ A;  4NAW A;  1PYW D;  3L54 A;  2LGY A;  2BKF A;  2WU5 A;  1NI3 A;  2N1V A;  3ZKJ C;  1H8C A;  2WP9 A;  2M8S A;  4D10 F;  3RFZ B;  2XK5 B;  3APC A;  3ZNZ B;  4PK1 A;  1SBB B;  3AE4 B;  2K3U A;  1RHI 4;  4BGD C;  2L3Z A;  2LUE A;  4M02 A;  4MEL A;  4O8X A;  3L0W B;  1VQ2 A;  4F8C B;  1P0R A;  3SBG A;  2GMI C;  2D07 B;  1VZ6 A;  3L16 A;  3TMP B;  5G5H A;  2KJ6 A;  2WDQ A;  3AU5 A;  1SXT A;  2D3B A;  1QOA A;  3UQA A;  2J4X A;  1KFY B;  1WWR A;  3MPZ A;  3ZPG A;  3ZUN A;  3PGE A;  2MSE D;  5BMG A;  3ABV A;  4ZRI A;  4HRQ A;  2JUO A;  2O3K A;  1NBF C;  4LJP B;  2LJI A;  4I6P A;  1OZ0 A;  3MC0 B;  2AQ2 B;  1WMH B;  2KFK A;  2HWC 4;  4YSX A;  2KHW B;  3BYT B;  4MM3 A;  1L5P A;  2KZR A;  1MQT D;  4WIF A;  1AR6 4;  1UZX B;  4MSM B;  2J7Q B;  2MJE A;  4JLC A;  4PYZ A;  2O2V B;  3KW5 B;  1XLQ A;  4MJS A;  3KYD D;  2QDF A;  1L6V A;  1POV 0;  2W55 A;  3NS1 A;  3B08 A;  3P4S A;  3P4P A;  4IM3 A;  1D3Z A;  1VCB A;  4CYE A;  3ZW3 A;  4XWT A;  2LGS A;  1CTT A;  1WIA A;  1PGB A;  1E7P B;  1TS4 A;  1R4N I;  1LM8 B;  3M62 B;  2N9K A;  3WCQ A;  2O95 A;  2B3A A;  4W9J A;  2BQQ A;  5EE0 A;  1HTQ A;  4NQL A;  2IO1 B;  3RYT A;  1KRH A;  5C3J A;  2KKC A;  5E6J A;  1J7B A;  3QJZ A;  2K9X A;  2PW9 A;  3L17 A;  3P4Q B;  3AE2 B;  3N20 C;  5BYQ A;  2M56 B;  2WGS A;  1KF6 A;  1WM2 A;  1C9F A;  4DDG D;  4KX6 B;  2MHJ A;  3V61 A;  4FXC A;  1C76 A;  2N9P C;  4OCL A;  3O65 B;  1MHH E;  1KTK A;  4OVU A;  3U7Z A;  3AE8 B;  2PIA A;  1E5W A;  1R4M B;  3NZ3 A;  1HTO A;  2RDG A;  2ZNV A;  3DHI C;  1UD7 A;  4HK2 A;  1CJE A;  3AEF B;  1I7H A;  1N5X A;  4AUQ C;  3VTV A;  2E6X A;  3W1Y A;  2VH1 A;  2KWD A;  2MH7 A;  1VBD 4;  2LRU A;  4W9H A;  2KDI A;  1YSB A;  1GOZ A;  2NBW B;  2AQ3 B;  2G1E A;  3B0A A;  2KQ4 X;  4DXF A;  1CMX B;  1IYF A;  4YSY A;  2IZV B;  3SFD A;  1D6E C;  2LVP A;  1R08 4;  3DBH B;  3AUL A;  3AED A;  2WDV B;  1KM7 A;  2K8H A;  4URK A;  1TIF A;  2P8R A;  1R09 4;  2UYZ B;  2MQJ A;  3AE6 A;  2RDH A;  3RNC C;  3PZ7 A;  1D4B A;  3EGR A;  2NVU I;  4II2 B;  1VK9 A;  4HKQ A;  1YJ1 A;  4OVZ A;  3SEB A;  4N58 A;  2ZVO A;  5CX3 A;  2HVV A;  4BFR A;  1WI0 A;  4KZC A;  1XHZ A;  4W9E A;  1M9N A;  1EO6 A;  2LHD A;  3GS2 A;  2LXA A;  2WNM A;  4ZRP A;  1E8X A;  1V86 A;  3ZNI D;  1TTN A;  1NEK A;  1TT5 B;  2DZK A;  1R7S A;  2GBR A;  2ZW1 A;  1PGA A;  3P2B A;  4TSS A;  2FID A;  4EEW A;  5JH5 C;  4ARI A;  1Z5S B;  2ACZ B;  3Q3J A;  2ZEQ A;  1UWZ A;  3APD A;  1WY8 A;  3CST A;  3R2N A;  5AUK A;  1F2R I;  3V60 A;  4MSJ A;  1RAX A;  1BT0 A;  3E9S A;  1FNW A;  2C60 A;  1HEZ E;  1Q1O A;  2IO3 B;  3VRB B;  2C7N B;  2DZI A;  3T3N A;  3AE5 A;  4MSM A;  3RMK C;  1J8C A;  2G6V A;  3HM6 X;  2J52 A;  2KQS A;  4NAM A;  2NPT B;  1I4G A;  2KC1 A;  3OLM D;  3UF8 A;  4FBJ B;  2FCM A;  1AW7 A;  4HLE A;  4OZB A;  2K25 A;  4XDD A;  1XD3 B;  4BKS D;  2N9L A;  3PRZ A;  2RS1 4;  3TJP A;  3UQB A;  3HVZ A;  1WJ4 A;  2IDY A;  3BVM A;  1YN5 A;  4IWQ A;  1WX8 A;  2GLS A;  1RMU 4;  2CHW A;  3ZJV A;  1C79 A;  2DAJ A;  1VJK A;  4XZ4 A;  4OZC A;  5CW6 A;  4HCN B;  4IC7 B;  1JTK A;  4B95 A;  1YQ4 B;  3KVF B;  1E8Z A;  2NTS A;  4GSW A;  2O6V B;  3UIO B;  1QT9 A;  4DHJ D;  1PUT A;  4BBN C;  1FFV A;  2VZK D;  4AOF A;  3AE8 A;  1UGJ A;  4I6N B;  5L95 C;  4YXD A;  4HPL B;  2WS3 B;  4W9I A;  1JWS D;  4WIG A;  1RUH 4;  3AEA A;  3K9O B;  3B2F A;  4H2A A;  3UIN B;  1FD6 A;  1XI1 A;  3U2S C;  3B8F A;  3ZDM C;  2FCN A;  1UAQ A;  1TKY A;  3L08 A;  1T3Q A;  3PZ8 A;  2LMC A;  1C4P A;  4MH0 E;  3VR8 B;  2BYE A;  5TR5 A;  1IGC A;  3DBS A;  4ANU A;  1TIY A;  2KTR A;  3J8F 4;  3I63 C;  3R66 C;  4LCD E;  1GJZ A;  4E0Q A;  2MX2 A;  3IXS A;  4EHI A;  2V4I B;  4IW0 A;  3ZIM A;  2ASQ A;  2DWQ A;  4ZOH C;  2LZ6 A;  2G9H D;  4WQO B;  2WXK A;  1N62 A;  1T0S C;  1NEN A;  1WKQ A;  3CF6 E;  3ZLZ A;  3VX8 A;  1XQQ A;  3LYY A;  3ZYY X;  3W9C B;  3T9L A;  3I3T B;  2KDM A;  1KLV A;  3A9J A;  1GC6 A;  2JT4 B;  3W1S A;  4K3B A;  2JY6 A;  4JL9 A;  4OCN A;  1HZ6 A;  3R2I A;  2W54 A;  3TSS A;  4RNA A;  2NCN A;  2MA9 B;  4FLH A;  1K50 A;  4LLG M;  1AR7 4;  3KUC B;  4HRS A;  2FR6 A;  2GOW A;  4X57 B;  1UBI A;  1WJ6 A;  4MT5 A;  2FBW A;  2CU1 A;  4Q4X 4;  3DQV A;  4PT5 A;  4CO7 A;  4NAW B;  3NUH B;  1STE A;  1UH6 A;  4HRW A;  1CZP A;  1C3T A;  1RB7 A;  1PL0 A;  1YN4 A;  1JQ4 A;  2DAF A;  2WU5 B;  1V49 A;  4EZK A;  3DWG C;  2WP9 B;  5JHA A;  2NYT A;  3P4R A;  2D10 A;  3JW0 X;  1MFW A;  2K1F A;  4B0E A;  2B3Z A;  4WUR A;  3IG3 A;  4WWM A;  4O8X B;  2KC2 A;  4A3P A;  2Z3I A;  1I4P A;  2IO0 B;  3R8B A;  2ZW0 A;  4A9A A;  2O6V D;  3AE1 A;  3APF A;  1D5Z C;  2WXP A;  2I1J A;  2KWC A;  1Y8R C;  1WE6 A;  1FXA A;  3Q6B A;  3QAR A;  4LTU A;  5KHQ A;  4GN1 A;  1EUV B;  2XNA C;  2VH2 A;  4BVU C;  4NJ7 A;  1ZKH A;  4W9C A;  3BZD B;  3GZN I;  3NVV A;  3GB1 A;  3PHW B;  2KFK B;  2INC C;  1RUE 4;  2ZJD A;  2ICI A;  4M8M A;  3NRZ A;  5J18 A;  5CHW A;  4AJY B;  3ALB A;  1RFA A;  1TKG A;  1ZCZ A;  4HDQ A;  3MJW A;  3KWV A;  5CHF A;  4Q2J A;  1V1O A;  1AWD A;  3BIN A;  4G11 A;  4DBG A;  2QSD A;  2PLV 4;  2P87 A;  5C23 A;  2BVC A;  3WAL A;  2G4D B;  5TSS A;  1COV 4;  4LNK A;  3P4P B;  1L2N A;  1XT9 B;  3VRA A;  2CU3 A;  2HTH A;  2NR2 A;  4K81 A;  3A33 B;  3QWZ B;  1ALN A;  4LNO A;  3X23 A;  2MBE A;  3SU8 X;  1SEB D;  4P1B C;  1JWB D;  4DHZ B;  3FI7 A;  2IO2 B;  1C78 A;  2H89 B;  4OZA A;  2K0P A;  3T8M A;  1E8Y A;  5KHO A;  3RNA C;  4NQL B;  3AM9 A;  3PS6 A;  2X38 A;  3ENE A;  3DHH C;  2WXL A;  3TIX A;  2QJL A;  5C3J B;  5M52 C;  3X0W A;  1GUA B;  2WXR A;  2MBQ A;  1DGJ A;  2WS3 A;  2L05 A;  3AV8 A;  3ONS A;  2L52 A;  3Q8B A;  3JSV A;  2KOX A;  1KLG D;  2B1G A;  4A1O A;  4NQK E;  1IPG A;  3NOB A;  4K1R A;  2JPH A;  5L83 A;  1Z3A A;  1SJH D;  3AE3 A;  1XLN A;  2GBM A;  1J0G A;  2RDB C;  2REX A;  3ZRC A;  5BYS A;  1SIJ A;  2KLG A;  5D3D A;  2JVC A;  3DBL I;  4W9D A;  5FR6 A;  5DPT A;  2Z59 B;  2BYV E;  2LUM A;  3BWU D;  1WRI A;  5E6P A;  2ZNV B;  1XLO A;  4BAX A;  4I43 B;  1XLP A;  3OJ3 A;  4XGA B;  3DVN U;  3DH1 A;  2QEJ C;  4ICV A;  1P7E A;  4LDT B;  1V5O A;  3WA0 A;  3RUI B;  2N9X A;  1L6U A;  3W5V B;  4YSY B;  4MAC A;  1NYQ A;  4K7S A;  3AED B;  4YSZ A;  4DK5 A;  4YT0 A;  4RH6 A;  3CWI A;  3AXC A;  2KX0 A;  3Q8E A;  4KV2 A;  2PY5 A;  2K8C A;  3AE6 B;  3AEB A;  2IU3 A;  3IAM 1;  3PRM B;  4W9G A;  4YTP B;  5LXI B;  3AEE B;  3I5J C;  3A1Q A;  2BB5 A;  1RWS A;  3R7Q A;  3G8Q A;  1UX0 A;  1CTU A;  4EG2 A;  4DDI D;  2J0K A;  3HUI A;  4TKN A;  4BKG A;  1J7C A;  5HI1 A;  4WWO A;  1E10 A;  3GQK A;  3ZZM A;  4NJ6 A;  4WWN A;  2D3G A;  4EZL A;  3FIL A;  3MHZ A;  1C1Y B;  2EEL A;  4RMA A;  2DYB A;  1NEK B;  4C00 A;  1MHX A;  2MW5 A;  5DPW A;  2KJR A;  2RPQ A;  1BEV 4;  4P1C C;  2G45 B;  4LK0 M;  1N60 A;  2BW2 A;  2L8J A;  2QC8 A;  1I4X A;  4II3 B;  1MVK A;  1FPY A;  2PKO A;  3TL5 A;  3GZN B;  3VH4 B;  1YJJ A;  3EUB 2;  2PEA A;  3RNB C;  1VBC 4;  3ZVV A;  2MRP A;  3QK0 A;  3JYU A;  5EE9 A;  3ZNG C;  1VR9 A;  2AWT A;  2A5U A;  2ZPN A;  4ZFR A;  4L23 A;  3AE5 B;  1ESF A;  1YN3 A;  2C7H A;  4FUL A;  2LI5 A;  4JQW C;  3V3X A;  2BB6 A;  3QX1 A;  1NCQ D;  4A55 A;  3A4R A;  1FMA D;  5JZE B;  2HDE A;  3MC9 A;  1FM0 D;  3R7R A;  4B6W A;  1I35 A;  3PTF C;  5C1Z A;  1YJI A;  1P1A A;  1TY0 A;  2KVR A;  2MBB B;  1EU3 A;  1FNU A;  3PV1 A;  2WLB A;  1QLB B;  3MFG A;  2IPK D;  4G3M A;  5FR3 A;  3SD5 A;  3J9C A;  1SSN A;  2H89 A;  4R3D A;  5BMI A;  3QIJ A;  3ZJT A;  3IVF A;  2KYW A;  1S3S G;  2AL6 A;  1UEL A;  1K8R B;  2M19 A;  1N61 A;  2J42 A;  2LAS A;  1FXI A;  2M1M A;  1QF6 A;  1JW9 D;  2BT6 A;  4ZRJ A;  3HIZ A;  5BYR A;  5D94 A;  2DEN B;  2HWB 4;  4XWW A;  4MSD A;  5FKA C;  2M17 A;  4P7I A;  1I4H A;  1D4M 4;  2WHI A;  3AEG B;  1AYF A;  4YXD B;  3Q3N C;  4ZYS A;  3ECI A;  2NX8 A;  2A8N A;  3AEA B;  3JVZ X;  4BKT A;  3SR6 A;  2LGX A;  1OTR B;  4XC2 A;  3TEY A;  3LDZ E;  1ROE A;  3AH7 A;  1ZP0 A;  4WAF A;  1IUE A;  5D6J B;  2EKI A;  3DBR I;  1AR8 4;  2IJ0 A;  1I4Q A;  1Q5W B;  5DCN A;  2KTR B;  4ACF A;  4RCO A;  1C4A A;  4TQ1 A;  4ILG C;  3E1U A;  4N9F 4;  3A4S C;  2YVC A;  2KXJ A;  5CTR C;  2KMM A;  5IO9 A;  4ZRK A;  4EOY A;  4WIP A;  5H8Y E;  2XBB C;  4IM2 A;  1HRV 4;  2PPH A;  1NEN B;  2JF5 A;  4YTP A;  3AEE A;  4US8 A;  2CJN A;  4L2Y A;  3A9J B;  1Z7S 4;  2KN5 A;  2L0F A;  3NHE B;  4OCN B;  1OQY A;  2M0A A;  2GBK A;  2LHE A;  1XF5 L;  3IAS 1;  5HHD G;  1GG3 A;  1FXT B;  3LXF A;  2L1A A;  1K5M D;  2KKS A;  4RGO S;  4LNI A;  1UGM A;  2FBW B;  1VZ8 A;  2PVG C;  4IG7 B;  2WXN A;  4B9K A;  1PGX A;  3WIM A;  3R3M A;  3O13 A;  1WGK A;  3OWE B;  3PVL A;  3Q3M C;  5LLI A;  1ENF A;  4C80 A;  1OQQ A;  4RF1 A;  2X5I D;  3P4R B;  1WGG A;  2YLM A;  4XE0 A;  4RM8 A;  4FHK A;  3DWM A;  2HE7 A;  4TMA B;  2DLB A;  4E74 A;  1XEE A;  4HPP A;  4BZA A;  4DHZ E;  1DYQ A;  5DPS A;  4MSQ A;  3PRP B;  3AE1 B;  2FUH B;  3EC8 A;  2IY0 B;  3QA8 A;  3VR9 A;  1SB3 C;  4L1B A;  2MLB A;  3DMO A;  4Q4V 4;  2QLC A;  3Q3O C;  3Q3F A;  4JWS C;  2E3T A;  2RPV A;  1OGW A;  3MC8 A;  2JXT A;  4P9C A;  2Z3G A;  2K8B A;  2EMS A;  2SEB D;  2LRW A;  5AZH A;  3S2A A;  2I1K A;  3PRE A;  3ZJU A;  1RUJ 4;  3N1Y C;  1AR9 4;  1WJN A;  4EUT A;  1R4N B;  2D3A A;  2D3C A;  2KT7 A;  4GGQ A;  2W4L A;  2B76 A;  4LJO B;  3ZTC A;  1E90 A;  3GE3 C;  1WR1 A;  1T0Y A;  1SE3 A;  5G5G A;  3VRA B;  4OCM A;  2GBJ A;  1ZPS A;  3PSE B;  2R06 4;  1TKE A;  5IAA C;  1JRU A;  1VZ7 A;  2FIF A;  1ZE3 D;  2RPZ A;  4ZHP A;  3P63 A;  4KKJ A;  3QHT A;  3QAQ A;  3U4E G;  1RLF A;  4GDL A;  3SDL C;  3AEG A;  1TGZ B;  4ZD5 A;  3EX8 A;  3PPA A;  2V4L A;  4KGR A;  1AN8 A;  3ZRF A;  4XDC A;  2MWS B;  2NMQ A;  3C8Y A;  1CQV A;  3JSV B;  3B2G A;  4F7O A;  4K1R B;  1L7Y A;  1HA5 A;  1FNV A;  4ANV A;  3AE3 B;  4YWG G;  5JHB A;  2LXC A;  2IGG A;  1GAQ B;  1SIF A;  2W82 A;  3U52 E;  2RMM A;  1FEH A;  3RNG C;  3KWL A;  4F1S A;  3PLV A;  1TBE A;  4PS3 A;  1WZ0 A;  1G8M A;  3AE9 A;  2LD9 A;  4EFO A;  2JWU A;  3OJ4 B;  2DBY A;  5IA7 A;  3EFU A;  4E71 A;  3W2D A;  4LD4 A;  1EF1 A;  1WX9 A;  2D11 A;  3NY5 A;  2I38 A;  1WR6 E;  1WX7 A;  1L4Z B;  1WXM A;  1FFU A;  4GU2 A;  1IBX A;  3JBG 4;  2BYT A;  1BML C;  4WQM A;  2JSV X;  2RS5 4;  3Q8F A;  2HJ8 A;  4M8N A;  3H8H A;  4PDW D;  4KDI C;  3C0R B;  3WAN A;  4YSZ B;  3L4P A;  3ZQ4 A;  1ET9 A;  4YT0 B;  5LXH A;  4A8X C;  3ZEF B;  1NI2 A;  4PS8 A;  1XHX A;  3ZDT A;  3AEB B;  4WJQ A;  1RYJ A;  1ASJ 4;  1EU4 A;  2LFI A;  4GDK A;  5M59 B;  1V9J A;  2WXF A;  1AF2 A;  3A1Q B;  1F9J A;  4GB9 A;  1RRB A;  2HVW A;  1RUC 4;  4LC5 A;  2DHZ A;  4W9K A;  2PYJ A;  3I9V 1;  1OX7 A;  2WU2 A;  3SUC A;  1SE4 A;  1HQR D;  2RR9 A;  4GB3 4;  1EV1 4;  2KAC A;  3ZGZ A;  1WGD A;  1VBB 4;  3FIL B;  3PLU A;  5LNK 1;  2WXI A;  1MQ0 A;  4M00 A;  5J17 A;  2BS2 B;  4IOI E;  3Q8C A;  2N4F A;  4RM9 A;  3URY A;  1ZOY A;  4WWP A;  2KQ7 A;  2ZCB A;  4HPM B;  1M94 A;  4B0M A;  1SE2 A;  2WXM A;  4ZHO A;  2KDF B;  4J6I A;  1ZDX A;  1RM6 C;  2KWV B;  3ML8 A;  2KN4 A;  4RGM A;  1ET6 A;  2KJH B;  2MCN B;  4PS7 A;  3HHM A;  4TV3 A;  4MGZ E;  4J6E A;  1ZW7 A;  2CHX A;  2WYQ A;  1UWX A;  3SHQ A;  3RN9 C;  1L0Y B;  3VTW A;  1RUF 4;  3AI5 A;  1WXV A;  2QIE B;  3W1S C;  4EKU A;  3OAW A;  4C4V A;  2IYD B;  3MP9 A;  4HCP B;  4HXD A;  3M3J A;  2HJ1 A;  1F77 A;  3CSF A;  2FAZ A;  1QKZ A;  1VLB A;  1V8C A;  3UIP B;  3PT2 B;  2FR5 A;  4F3W A;  5H92 C;  2KDE B;  2MP2 B;  4DXG A;  4MEM A;  5EE3 A;  2JYE A;  2CR5 A;  1JCK B;  1YOV B;  3VFK A;  4FJZ A;  2ZNR A;  1WYG A;  3DVG Y;  1V81 A;  1J7A A;  1TY2 A;  3OJ6 A;  4O8Y A;  3HVD A;  1E7U A;  2QMT A;  4CHK A;  1SGH A;  3TBL D;  1L0X B;  3V6C B;  1YIW A;  1U4A A;  1LFD A;  2L00 B;  4M01 A;  4A20 A;  2PE6 B;  3H7S A;  1Q0W B;  5MPO A;  2K5P A;  3TEW A;  3IBE A;  4P6V F;  4FN2 A;  4QAY A;  1N6Z A;  4S0R A;  4PQT A;  1AL2 4;  1A5R A;  1LGR A;  1XCQ L;  1ZUD 2;  5D7G A;  3WAM A;  1VRA B;  1SF0 A;  4F7Z A;  2FCQ A;  1S1Q B;  1WH3 A;  3NS8 A;  1P98 A;  1V5T A;  2BPS A;  1TJE A;  2D2Q A;  5AZG A;  1PVC 4;  4HWI B;  4FJY A;  1X1M A;  2GBN A;  1HE8 A;  2VRR B;  3KUD B;  2RSU A;  3VQI A;  1V1P A;  1R5X A;  4BOS C;  1QOB A;  4G50 A;  4JIO U;  1OEY A;  2PVO D;  3ML9 A;  2V1Y A;  1ZP0 B;  2RM2 4;  2JU6 X;  4J3O D;  1G6J A;  2WQY A;  4YL8 A;  1TZO A;  4K7U A;  1T0Q C;  1N5W A;  3ZNH B;  5GMV A;  3ZXR A;  1ZXI A;  4HEA 1;  3ZO5 B;  2V0G A;  1C77 A;  3HM3 A;  2GB1 A;  2JZ3 B;  5HKH A;  3NG0 A;  4Q4W 4;  2D5N A;  3JD7 4;  3ETR A;  4OW0 A;  4AJW A;  4C7Y A;  3KUZ A;  4HKZ E;  3NJT A;  2Z8L A;  3BVG A;  4FJV B;  1F1H A;  2ZVN A;  1OQR A;  3L10 B;  2Y5P A;  2WXH A;  3DBH I;  1HXS 4;  3RNE C;  2LWP A;  3GOE A;  2OG4 A;  5G2N A;  4TUU A;  4JPS A;  2JX5 A;  2N1W A;  4C7Z A;  1WXA A;  2C5L C;  2C7M B;  4MGY E;  4P9E A;  3TEX A;  2UWQ A;  3RZV A;  1GB4 A;  4XX5 A;  2JXX A;  5G55 A;  1PO1 4;  5CHV C;  2KX3 A;  2ZCC A;  1OFF A;  1TZ1 A;  1NDD A;  3VHT C;  4JXE A;  2JZZ A;  3N1X C;  2KMC A;  2KAN A;  4A90 A;  2PLP A;  3QCA A;  4HVB A;  1K53 A;  1WGR A;  5DPR A;  2ZZP B;  3QQ8 B;  1E6E B;  4LNF A;  4YTM B;  4REZ A;  1DOY A;  1TS3 A;  2AEH A;  5FK9 C;  3V6E B;  2RGF A;  3A9K A;  2EKE C;  4MSQ B;  2MBH A;  3OG5 A;  1E9M A;  2N7D A;  4ZRQ A;  1WXQ A;  3VUX A;  1A70 A;  2L76 A;  1L4D B;  2BTE A;  3PHX B;  2BS3 B;  1OOP D;  3VR9 B;  3RT3 B;  1ZXH A;  3C19 A;  3RD2 A;  1OI0 A;  1JWA D;  2G3Q B;  2DYO A;  1P7F A;  5EDS A;  1YQB A;  4OWP A;  1WN5 A;  1L0V A;  2IND C;  3VDZ A;  4DXA B;  4FAD A;  1KOT A;  4ZFT A;  1FCL A;  4QFT A;  1RUI 4;  1E7V A;  1PQS A;  3NVW A;  1FRR A;  4LDT D;  2MP2 A;  3DOW A;  4NNJ B;  1YNT E;  2NTT A;  4I6L B;  3U7D A;  5IOI A;  1WRD B;  3B9J A;  4RGN A;  3NVZ A;  2B76 B;  5EE1 A;  2I2Y A;  3EEC A;  1EF5 A;  4LCP A;  4YTN A;  1Z2M A;  1NYR A;  1FCC C;  2NBV B;  2Y3A A;  2QCZ A;  3DPD A;  2KLC A;  4KDL B;  3PZD A;  2JRH A;  3RPF C;  4HDO A;  4OCM B;  1F2R C;  1FRD A;  2KTF A;  4NZL B;  1CK1 A;  4RGT A;  1MG8 A;  2AQ1 B;  3BII D;  3N30 A;  1SJE D;  1JRP A;  4NPN A;  1EAH 4;  2QHO A;  2V3S A;  3DCG A;  3M95 A;  4W9L A;  2V3P A;  2PTL A;  3VUY A;  2MJ3 A;  2R61 A;  3FKY A;  3MTN B;  3TEZ A;  1VBA 4;  4GDL B;  1THZ A;  2Z0D B;  1WM3 A;  3Q69 A;  1GC7 A;  3DBL B;  5DCA J;  1E0Z A;  1HXY D;  1QQR A;  2OHF A;  3U8Z A;  3V05 A;  3B1L X;  1QOF A;  1YQ3 A;  3RZW C;  1WGY A;  4MGK E;  2Y5C A;  2KMA A;  2XEW A;  3W5U B;  3BK1 A;  1WFY A;  3AN1 A;  1YD8 U;  2HTM E;  2OJW A;  1PKX A;  2V9H A;  2LGI A;  2H88 A;  2FCS A;  3AE9 B;  3NZS A;  5I4D A;  3CIR A;  2BWF A;  1I4R A;  4KIK A;  4GGM X;  1K52 A;  2J53 A;  1IP9 A;  2XN9 C;  1DOI A;  4P16 A;  5D3I B;  2K39 A;  4BOZ B;  3UI3 A;  4HJK A;  1V97 A;  3H7P A;  4AQ7 A;  2OJR A;  1IBX B;  4KIT C;  1VRH 4;  1BXT A;  4MGI E;  2C9W B;  4KSK C;  5C2O A;  1UBQ A;  2RR1 4;  1KJT A;  4K3C A;  2CS4 A;  5IN7 A;  4GDK B;  2EMT A;  3EFC A;  1ACC A;  3MJ5 A;  2K6Q A;  4DHJ B;  2CJO A;  1YSD A;  1WF9 A;  2XK5 A;  3AE4 A;  1MJD A;  2M0X A;  5D2M B;  2VZK B;  1RFK A;  3N9Y C;  4NY0 A;  2WU2 B;  4YTM A;  1MPE A;  3ZTD A;  3BVZ A;  2IY1 B;  2D30 A;  3Q2A C;  2LJ5 A;  2ZNV C;  2YEP F;  1K51 A;  1TS2 A;  1ZAB A;  2Z3J A;  4MH8 A;  5BO4 B;  2DZM A;  1PO2 4;  2G4S A;  1WGH A;  1QOG A;  3Q14 C;  1KFY A;  1ZOY B;  2O7P A;  1YMH E;  1MI0 A;  2GRI A;  2L7R A;  5J2R A;  1LQB A;  4GMV A;  3HRD D;  4IKG A;  2DNF A;  4M0W B;  3CMM B;  1J19 A;  3AE7 B;  1WMH A;  2K6D B;  4UDU C;  4MS7 A;  1H4R A;  4KGS A;  2KO3 A;  1JML A;  3AU4 A;  1JAL A;  3MHS D;  1IGD A;  1FIQ A;  4WJN A;  2W3S A;  4KSL C;  1B9R A;  2N7E A;  2NS5 A;  1XXG A;  2KFJ A;  2WXJ A;  3GQH A;  2LVQ A;  2W3R A;  3BH1 A;  1V6E A;  2O2V A;  2K22 A;  2DZJ A;  4ASW C;  4OVV A;  4S17 A;  4C4V B;  4BBN F;  2IU0 A;  2BBC A;  3H9D A;  2BKR B;  3AEC B;  3WAO A;  2DX5 B;  2LVO A;  3WAP A;  2Y5B B;  2FE8 A;  2N9E B;  4D2K A;  4PYU A;  5IKC M;  1KH0 A;  3NVY A;  3SFE B;  1RUD 4;  2CKH B;  2MJD A;  2V3N A;  3LJ3 A;  2W9N A;  2PE9 A;  4GXB A;  2LEK A;  1UNS A;  2Q5W D;  2OED A;  2R2O A;  3BK2 A;  2R04 4;  4O8Y B;  1MG4 A;  3RUL A;  1TS5 A;  1EWY C;  3P4Q A;  2IGH A;  3AE2 A;  3GP7 A;  1T5X D;  1LXD A;  1JRO A;  4GOC A;  1WZ3 A;  3ZPC A;  4GIV A;  5HFY A;  2DYM A;  2KNB A;  2EX3 A;  3H1U A;  4KX6 A;  4EZJ A;  4A3O A;  3AMZ A;  4DQO C;  3KYC D;  1N63 A;  3ZXV A;  3DBR B;  4N6E B;  4O1N A;  4C56 C;  4OHJ A;  2B3J A;  2OOB B;  3L13 A;  2B1I A;  1WXS A;  2RD0 A;  3NZU A;  3I57 A;  3AEF A;  4RFB A;  4KKI A;  4RF0 A;  4JGH B;  2BWE S;  4BKS A;  3PO0 A;  4LCO A;  1V1P B;  2WX1 A;  1ZGU B;  3U30 A;  1NVI D;  3E56 A;  1ZDV A;  4CQN A;  4HJG E;  3RNF C;  3N3K B;  2WQY B;  4G3X B;  2JWZ A;  2L83 A;  3N32 A;  2J0M A;  4JE3 B;  2BGF A;  3IT4 B;  4LCN A;  2A4Z A;  4AP4 C;  2KDB A;  4AS1 A;  2Z3H A;  4RHV 4;  1XO3 A;  2KK8 A;  4G0N B;  2GI9 A;  2WDV A;  2JYT A;  1WE7 A;  5C2T B;  1YX5 B;  2WX0 A;  1NA1 D;  1GPX A;  2WDR B;  3QC8 B;  2BYF A;  1VDV A;  4Q4Y 4;  4IM0 A;  2RS3 4;  3TCA A;  5T8I A;  4K7W A;  2JZP A;  1T6B X;  1PFD A;  2INP E;  4EE2 A;  4AWJ A;  4IWP A;  2Z0E B;  1D5X C;  1E8W A;  1V80 A;  3AB5 A;  2TSS A;  2PJH A;  4WJO A;  3RCZ A;  4US9 A;  3DVG X;  1P6O A;  3VVW B;  4ZYN A;  3P42 A;  3IHP C;  3IT6 B;  4N59 A;  3RI7 C;  2OBC A;  1JWU D;  1FO4 A;  3IJF X;  4E3C A;  4WH4 A;  2ACZ A;  1R5T A;  4ANX A;  3LB8 C;  3OCQ A;  4M0W A;  3AE7 A;  2PZS A;  1KLU D;  1UX1 A;  2BF8 B;  2LGD A;  3VXW A;  1V2Y A;  1EM7 A;  3A9K B;  3DHG C;  1GB1 A;  3P1M A;  2WDQ B;  2X8X X;  4IWO A;  2O96 A;  2NBU A;  1I42 A;  2M4N A;  1HRI 4;  3VRB A;  1AAR A;  3GE8 C;  2UU7 A;  3FAH A;  3ABV B;  4LD2 A;  4KGT A;  4IUM B;  2WXO A;  1RVF 4;  1P4R A;  2NPT A;  2HD5 B;  2KD0 A;  1F0Z A;  2G84 A;  4XYC A;  1WJU A;  3VH3 B;  4OWP B;  2KWU B;  1L0V B;  4YSX B;  2N0S B;  2D5G A;  4ITK A; 
#chains in the Genus database with same CATH homology
 2PLP A;  5H8Y E;  1K53 A;  4MM3 B;  1D5M C;  1FFV A;  1NEN B;  2JQR B;  2VZK D;  2WXQ A;  4HRO A;  3TUO A;  1UGJ A;  1E6E B;  2INN E;  4YTM B;  3Q8A A;  4REZ A;  2ONQ A;  4JWU C;  1DOY A;  2IGD A;  2WS3 B;  1JWS D;  2CJN A;  4US8 A;  4WIG A;  1TS3 A;  4L2Y A;  5FK9 C;  3B2F A;  4H2A A;  1FD6 A;  1UUP A;  1EWC A;  1XI1 A;  3U2S C;  2N7J A;  3B8F A;  4OCN B;  2QIL A;  1TKY A;  1UAQ A;  2M0A A;  3EA6 A;  2LHE A;  1T3Q A;  3PZ8 A;  2LMC A;  1C4P A;  1E9M A;  1XF5 L;  3P4S B;  3IAS 1;  4YTN B;  5HHD G;  3RZU A;  3VR8 B;  3LXF A;  4ZRQ A;  1WXQ A;  2L1A A;  1IGC A;  1A70 A;  1L4D B;  3T3O A;  2BTE A;  2KKS A;  2BS3 B;  3R2T A;  3VR9 B;  4RGO S;  1TIY A;  5BMH A;  2FBW B;  1VZ8 A;  1ZXH A;  4JX1 C;  1OI0 A;  1JWA D;  2PVG C;  2WXN A;  4E0Q A;  2DYO A;  3IXS A;  2KCQ A;  1PGX A;  2V4I B;  4ARC A;  1P7F A;  3O13 A;  4OWP A;  1WGK A;  1WN5 A;  3OWE B;  1ENF A;  4C80 A;  2DWQ A;  4ZFT A;  4ZOH C;  1FCL A;  4QFT A;  4USA A;  1OQQ A;  2G9H D;  4RF1 A;  2WXK A;  4ZD4 A;  1N62 A;  3P4R B;  4P9D A;  2AX5 A;  1WKQ A;  1Y56 A;  3NVW A;  1FRR A;  4XE0 A;  3LYY A;  1YNT E;  2NTT A;  3B9J A;  3DWM A;  4RGN A;  4TMA B;  3W9C B;  3KQ4 A;  3ZYY X;  2KDM A;  2DLB A;  1XEE A;  1XCT L;  3W1S A;  1DYQ A;  4OCN A;  3NVZ A;  1YQ3 B;  1HZ6 A;  2B76 B;  3R2I A;  5EE1 A;  2PYL A;  4MSQ A;  1UWM A;  2W54 A;  4IDI A;  3TSS A;  2I2Y A;  4LCP A;  4RNA A;  3AE1 B;  1KF6 B;  1NYR A;  1FCC C;  1K50 A;  4LLG M;  2R7F A;  2Y3A A;  1DOX A;  2SAK A;  3RPF C;  1HZ5 A;  3FC4 A;  4HRS A;  4TQ0 A;  2FR6 A;  4OCM B;  2MEK A;  4OCL B;  1SB3 C;  4MT5 A;  4GLS C;  4L1B A;  3DMO A;  1F2R C;  1FRD A;  5AUI A;  2QLC A;  4PT5 A;  4JWS C;  2E3T A;  1CK1 A;  3NUH B;  4NAW B;  4NZL B;  2WXG A;  4RGT A;  1WN6 A;  1PDX A;  1STE A;  2AQ1 B;  2RPV A;  3BII D;  1CZP A;  2H88 B;  2FUG 1;  1RB7 A;  4HRW A;  1SJE D;  1YN4 A;  3CIR B;  1JQ4 A;  2WU5 B;  1JRP A;  2JXT A;  4P9C A;  2Z3G A;  3DWG C;  1Q10 A;  2WP9 B;  2NYT A;  2PMV A;  2L32 A;  5HG2 A;  2V3P A;  1BUI C;  2PTL A;  4A6Q A;  4B0E A;  2MJ3 A;  2R61 A;  2SEB D;  1B1Z A;  3TEZ A;  2B3Z A;  4GDL B;  4WUR A;  1C4C A;  3Q69 A;  3ZJU A;  4WWM A;  4O8X B;  5DCA J;  1E0Z A;  1HXY D;  1QQR A;  2OHF A;  3V05 A;  5GXG B;  1QIL A;  1QOF A;  1TYG B;  2Z3I A;  2W4L A;  1I4P A;  3R8B A;  3SFD B;  2ZW0 A;  4A9A A;  3BYY B;  2HXV A;  4NJC A;  1D5Z C;  2WXP A;  2BS4 B;  2YEP B;  2Y5C A;  3KLS X;  3W5U B;  1WSP A;  3BK1 A;  1LO5 D;  1SE3 A;  1FXA A;  4LTU A;  5G5G A;  3VRA B;  5JXV A;  4OCM A;  2ON8 A;  1ZPS A;  3AN1 A;  1M4V A;  1WWT A;  2XNA C;  2HTM E;  1TKE A;  1JWM D;  5GAO A;  2KAJ A;  3BZD B;  1VZ7 A;  2LGI A;  1PYW D;  3NVV A;  3GB1 A;  3AE9 B;  5I4D A;  1ZE3 D;  2RPZ A;  1NI3 A;  4ZHP A;  3P63 A;  4KKJ A;  1I4R A;  2ICI A;  4D10 F;  3RFZ B;  1K52 A;  2J53 A;  3NRZ A;  1SBB B;  2XN9 C;  1DOI A;  3AE4 B;  3U4E G;  2K3U A;  4P16 A;  5D3I B;  4BGD C;  3UI3 A;  4ZD5 A;  1V97 A;  4O8X A;  1VQ2 A;  3EX8 A;  1TKG A;  4KGR A;  4AQ7 A;  3KWV A;  3SBG A;  1IBX B;  1AN8 A;  4KIT C;  4XDC A;  2NMQ A;  4Q2J A;  3C8Y A;  1AWD A;  1CQV A;  1V1O A;  1VZ6 A;  5G5H A;  1BXT A;  3B2G A;  2QSD A;  4F7O A;  2P87 A;  1SXT A;  5TSS A;  1HA5 A;  1QOA A;  3P4P B;  1FNV A;  2J4X A;  1KFY B;  3AE3 B;  1WWR A;  3MPZ A;  4YWG G;  2CU3 A;  3ZPG A;  2IGG A;  5C2O A;  1GAQ B;  5BMG A;  2W82 A;  3U52 E;  2RMM A;  4HRQ A;  1FEH A;  2O3K A;  1ALN A;  3KWL A;  1SEB D;  2LJI A;  1JWB D;  4GDK B;  3MC0 B;  2AQ2 B;  3FI7 A;  1C78 A;  1ACC A;  2H89 B;  2JWU A;  4OZA A;  2DBY A;  2K0P A;  3MJ5 A;  3AM9 A;  2CJO A;  2X38 A;  1YSD A;  3BYT B;  2WXL A;  1L5P A;  2QJL A;  3W2D A;  4LD4 A;  5C3J B;  4WIF A;  2VZK B;  5M52 C;  1RFK A;  2I38 A;  3N9Y C;  2WU2 B;  2WXR A;  1MPE A;  1L4Z B;  1DGJ A;  1FFU A;  2MJE A;  3BVZ A;  1IBX A;  2D30 A;  2BYT A;  1BML C;  1XLQ A;  3AV8 A;  4WQM A;  2JSV X;  2L52 A;  3Q8B A;  1L6V A;  2YEP F;  1K51 A;  1KLG D;  1TS2 A;  3Q8F A;  1ZAB A;  2W55 A;  3NS1 A;  4MH8 A;  2Z3J A;  3H8H A;  4K1R A;  1Z3A A;  1QOG A;  1SJH D;  1XLN A;  1ZOY B;  4YSZ B;  3L4P A;  3ZQ4 A;  1ET9 A;  4YT0 B;  2O7P A;  1YMH E;  4A8X C;  1MI0 A;  5BYS A;  1SIJ A;  5D3D A;  3ZEF B;  2GRI A;  1XHX A;  3AEB B;  4XWT A;  1CTT A;  1RYJ A;  1PGB A;  3HRD D;  1E7P B;  1TS4 A;  4IKG A;  1EU4 A;  2LFI A;  2LUM A;  3BWU D;  5M59 B;  1WRI A;  3AE7 B;  2WXF A;  4UDU C;  1AF2 A;  4MS7 A;  4KGS A;  2N9K A;  1XLO A;  3WCQ A;  2O95 A;  4I43 B;  4NQL A;  5EE0 A;  1XLP A;  1JML A;  2HVW A;  4LC5 A;  1JAL A;  1KRH A;  2QEJ C;  3DH1 A;  2PYJ A;  3I9V 1;  1OX7 A;  1P7E A;  1IGD A;  1FIQ A;  2W3S A;  5E6J A;  1B9R A;  1J7B A;  1SE4 A;  1HQR D;  1XXG A;  2WXJ A;  2K9X A;  2KAC A;  2PW9 A;  2W3R A;  3ZGZ A;  3P4Q B;  1L6U A;  3AE2 B;  3FIL B;  2K22 A;  3W5V B;  5LNK 1;  2WXI A;  5BYQ A;  2M56 B;  4YSY B;  1MQ0 A;  4MAC A;  1NYQ A;  2BS2 B;  4IOI E;  3Q8C A;  3URY A;  1C9F A;  3AED B;  2BBC A;  4RH6 A;  4KX6 B;  3AEC B;  3CWI A;  4FXC A;  3Q8E A;  2PY5 A;  1C76 A;  4B0M A;  3AE6 B;  4OCL A;  2FE8 A;  1SE2 A;  1MHH E;  2WXM A;  1KTK A;  4ZHO A;  3U7Z A;  3IAM 1;  4D2K A;  3AE8 B;  2PIA A;  1ZDX A;  1KH0 A;  3NVY A;  4YTP B;  3SFE B;  1RM6 C;  3AEE B;  3NZ3 A;  2MJD A;  2V3N A;  2RDG A;  2KN4 A;  2ZNV A;  4RGM A;  1ET6 A;  1CJE A;  2LEK A;  3AEF B;  1I7H A;  1RWS A;  1N5X A;  1UNS A;  2BB5 A;  2OED A;  2Q5W D;  2E6X A;  3G8Q A;  2KWD A;  2MH7 A;  1UX0 A;  2B3J A;  3BK2 A;  1CTU A;  4O8Y B;  4EG2 A;  3HUI A;  1PUT A;  1J7C A;  5HI1 A;  1E10 A;  1TS5 A;  1YSB A;  1EWY C;  1UWX A;  1GOZ A;  2IGH A;  2AQ3 B;  1L0Y B;  2G1E A;  3FIL A;  3GP7 A;  1T5X D;  2KQ4 X;  3MHZ A;  2EEL A;  4DXF A;  2QIE B;  1NEK B;  1JRO A;  1D6E C;  1MHX A;  3ZPC A;  3MP9 A;  5HFY A;  2DYM A;  2WDV B;  2EX3 A;  1F77 A;  1QKZ A;  1VLB A;  1V8C A;  2P8R A;  3AMZ A;  4DQO C;  4LK0 M;  2FR5 A;  1N60 A;  2BW2 A;  4F3W A;  2RDH A;  5H92 C;  1N63 A;  4C56 C;  1I4X A;  3PZ7 A;  4N6E B;  4O1N A;  4OHJ A;  3EGR A;  1MVK A;  4DXG A;  5EE3 A;  1D4B A;  2JYE A;  4HKQ A;  2PKO A;  4OVZ A;  3SEB A;  4N58 A;  1JCK B;  3I57 A;  2HVV A;  4RFB A;  2ZNR A;  4KKI A;  4RF0 A;  1WYG A;  1J7A A;  1YJJ A;  3EUB 2;  1TY2 A;  3OJ6 A;  1XHZ A;  3PO0 A;  4O8Y A;  3HVD A;  4LCO A;  1V1P B;  5EE9 A;  2LHD A;  3GS2 A;  1NVI D;  2QMT A;  1VR9 A;  3E56 A;  2WNM A;  1ZDV A;  1L0X B;  4HJG E;  4CQN A;  4ZRP A;  2WQY B;  2L83 A;  4ZFR A;  4L23 A;  4JE3 B;  3AE5 B;  1ESF A;  1YN3 A;  3IT4 B;  3V3X A;  4LCN A;  2BB6 A;  4AS1 A;  5MPO A;  2K5P A;  2Z3H A;  3TEW A;  1XO3 A;  4A55 A;  1R7S A;  4P6V F;  2ZW1 A;  1PGA A;  4TSS A;  2GI9 A;  1FMA D;  4PQT A;  2HDE A;  1FM0 D;  1XCQ L;  1ZUD 2;  2JYT A;  5D7G A;  1YJI A;  1VRA B;  1TY0 A;  4ARI A;  1SF0 A;  2ACZ B;  5C2T B;  1EU3 A;  1FNU A;  1UWZ A;  1GPX A;  2WLB A;  2WDR B;  1QLB B;  3MFG A;  2IPK D;  3R2N A;  1VDV A;  5FR3 A;  4G3M A;  5AUK A;  1TJE A;  1F2R I;  4MSJ A;  3J9C A;  5T8I A;  1SSN A;  4R3D A;  5BMI A;  4A90 A;  3ZJT A;  2JZP A;  1T6B X;  3E9S A;  3VQI A;  1FNW A;  1PFD A;  2INP E;  1V1P A;  1R5X A;  4EE2 A;  1QOB A;  1HEZ E;  2PVO D;  1ZP0 B;  2JU6 X;  2M19 A;  4J3O D;  1N61 A;  2J42 A;  1D5X C;  3VRB B;  1FXI A;  3AB5 A;  1TZO A;  2TSS A;  3T3N A;  1QF6 A;  4US9 A;  4MSM A;  1N5W A;  1JW9 D;  2BT6 A;  1P6O A;  2G6V A;  5BYR A;  1ZXI A;  4HEA 1;  2J52 A;  4NAM A;  2V0G A;  1C77 A;  3P42 A;  3IT6 B;  1I4G A;  4N59 A;  4XWW A;  2OBC A;  1JWU D;  1FO4 A;  3IJF X;  4MSD A;  5FKA C;  1AW7 A;  2GB1 A;  4OZB A;  2D5N A;  4XDD A;  4WH4 A;  2N9L A;  1I4H A;  3ETR A;  1R5T A;  4OW0 A;  4C7Y A;  4HKZ E;  2Z8L A;  3BVG A;  3LB8 C;  3HVZ A;  3AEG B;  3OCQ A;  1AYF A;  4YXD B;  2IDY A;  1OQR A;  3BVM A;  4M0W A;  1YN5 A;  2Y5P A;  4ZYS A;  2WXH A;  2PZS A;  2NX8 A;  1KLU D;  2A8N A;  1UX1 A;  3AEA B;  1EM7 A;  3ZJV A;  2OG4 A;  1GB1 A;  1C79 A;  2WDQ B;  3P1M A;  4JPS A;  2JX5 A;  3SR6 A;  2O96 A;  4C7Z A;  3TEY A;  1ROE A;  3AH7 A;  1VJK A;  4P9E A;  4OZC A;  4WAF A;  1IUE A;  3TEX A;  5CW6 A;  3RZV A;  2EKI A;  1GB4 A;  3FAH A;  2IJ0 A;  1I4Q A;  3ABV B;  4LD2 A;  1JTK A;  4KGT A;  4RCO A;  1C4A A;  1YQ4 B;  4TQ1 A;  4ILG C;  2WXO A;  3E1U A;  1OFF A;  2NTS A;  1F0Z A;  2G84 A;  4JXE A;  4OWP B;  1QT9 A;  2KMM A;  1L0V B;  4YSX B;  2N0S B;  2D5G A;  4WIP A;  4ITK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...