2PW9A

Crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
251
structure length
231
Chain Sequence
PLSIMQKSVVIRPGGRQEMDEHVAIETPYAIALNDRVIGSSMVLPVDLEEFGAGFLFGQGYIKKAEEIREILVCPQGRISVYADKIPKEMLEEFAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTGRLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative formate dehydrogenase accessory protein
publication title Crystal structure of a putative formate dehydrogenase accessory protein from Desulfotalea psychrophila.
rcsb
source organism Desulfotalea psychrophila lsv54
total genus 63
structure length 231
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02634 FdhD-NarQ FdhD/NarQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pw9A02
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 2pw9A03
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pw9A01
1K52A 4WH4A 2O7PA 1AF2A 1P7EA 2PYLA 3ZPCA 1FD6A 3EX8A 4G3MA 4OCLB 1IGCA 4HJGE 4K1RA 2JZPA 2ONQA 4LCNA 4MSJA 1EM7A 2GB1A 4OZBA 2IGDA 2QMTA 1OI0A 2B3JA 1JTKA 4P9EA 2JU6X 2KDMA 1UX1A 2OG4A 4HRQA 2K0PA 2JXTA 4OZAA 2I2YA 4KGSA 5HI1A 1YSBA 1MHHE 1PGAA 1D4BA 4O8YA 2G6VA 2KN4A 4HKZE 4ZFRA 5HG2A 1JMLA 5BMGA 4OZCA 3OJ6A 4IKGA 1XCTL 4ZD5A 2P87A 1XF5L 4OWPB 5HHDG 1XI1A 2PW9A 1XHXA 3G8QA 3FILA 1FCCC 1PGBA 1WN6A 2D5NA 2G84A 1GB4A 2KCQA 1K53A 1WWRA 4F7OA 4LD2A 2PLPA 1MQ0A 4HRWA 2HVWA 1K51A 3MP9A 1WN5A 1R5XA 2QSDA 3DMOA 4ILGC 2PY5A 2KWDA 1KH0A 1QKZA 1YSDA 4LCPA 2FR5A 2QLCA 2O95A 4JXEA 4P9CA 2PYJA 1YNTE 3GB1A 3RZVA 1MHXA 2JWUA 2IGHA 1IGDA 1P6OA 2O3KA 3ZEFB 1ZABA 2LUMA 2RPZA 2NMQA 2ZW1A 3V3XA 1GB1A 4E0QA 5M59B 4D2KA 2RPVA 2PZSA 2R7FA 4OCNB 1CTTA 3FI7A 1F2RC 4O8XB 1F2RI 3B8FA 1WKQA 4KGTA 4LC5A 4OCMB 1VQ2A 4PQTA 1IBXB 4P9DA 1MVKA 1P7FA 2LHDA 4ZD4A 3MPZA 2N9LA 1UWZA 4ZFTA 1XHZA 2NX8A 2OEDA 2FR6A 2KKSA 1Q10A 2B3ZA 1OX7A 2LGIA 4GLSC 2KACA 2NYTA 2KQ4X 3IJFX 3OCQA 1ALNA 4NQLA 4D10F 2Z3HA 2OBCA 2ZW0A 4EG2A 2I38A 2P8RA 2J52A 4OCLA 4MS7A 2PTLA 5CW6A 4F3WA 1R5TA 1MPEA 2N9KA 3FILB 5JXVA 2IGGA 3E1UA 3R2NA 2N7JA 1C9FA 3RZUA 3DH1A 3UI3A 4BGDC 5GAOA 2ON8A 2Z3GA 5BMIA 1HZ6A 4KITC 4KGRA 2A8NA 1TIYA 3SBGA 2Z3IA 1K50A 4OCNA 4WIGA 1UX0A 2W4LA 2ZNVA 4O8XA 1MI0A 1HZ5A 4QFTA 4OWPA 3ZPGA 4OCMA 2Z3JA 2EELA 1FCLA 1Z3AA 1RB7A 4MSMA 4O8YB 5DCAJ 4LD4A 1ZXHA 1XCQL 2JSVX 1IBXA 5HFYA 4MACA 4LCOA 4I43B 1UAQA 2ZNRA 2HVVA 1CTUA 5BMHA 2HXVA 4WIFA 4MSQA 1UWXA 2RMMA 2GI9A 1PGXA 2EX3A 4IOIE 1YMHE 2O96A 4MSDA 1HEZE 2J53A 2D30A 5C2OA 5M52C 2LHEA
chains in the Genus database with same CATH superfamily
1E7VA 4KSKC 1D3ZA 1EU3A 4TUUA 2MW5A 3ENEA 4Q4X4 4KX6B 2KK8A 4ARCA 4DXAB 2IGDA 3N30A 1OQYA 2KX0A 3E9SA 4M0WA 2X5ID 4KSLC 3C8YA 4HRQA 3I57A 2L1AA 2G4SA 2I2YA 1ZOYB 4IM0A 3BWUD 3AEDA 1JROA 3I3TB 4GN1A 4OZCA 4IKGA 1VBE4 1KFYB 5E6PA 4YSYB 1XF5L 2J0KA 1JRUA 3AE3B 1GJZA 3HM3A 1EV14 5AZGA 3R7QA 5LNK1 3PO0A 3DVNV 2MA9B 4F7ZA 4MGKE 5KHQA 2KWDA 3PGEA 1AWDA 2IO3B 1G6JA 3QWZB 1XLOA 4KKJA 1MJDA 3ZNGC 2WXOA 1L4DB 1IGDA 2O3KA 4HCNB 3CIRB 3CSTA 4ITKA 3U7DA 1GB1A 2M1MA 2KYWA 2BB5A 1OZ0A 1OQRA 2K1FA 3X23A 3R8BA 3GE3C 4UDUC 3ZJVA 3ZRFA 3NS8A 3DWMA 4RGTA 1ZPSA 2LASA 4NQLA 3AXCA 1YQ3B 3SEBA 2OBCA 1UH6A 4MS7A 2PTLA 2WU5A 3E1UA 3M95A 3UQAA 2L8JA 3DBRB 1NEKB 3BH1A 1WF9A 4PYUA 5GAOA 3PZ8A 3D32A 1P0RA 2ON8A 1YJ1A 2NBVB 1VRH4 2D10A 2MWSB 3C0RB 1RUF4 2A8NA 4EKUA 1OEYJ 2G45B 2WDRB 1BMLC 3P4SB 4K3BA 1TIYA 3UIPB 4HPLB 3W5UB 1JQ4A 3VFKA 2J0JA 3GE8C 3V6CB 3WAOA 3A9JB 4MSMA 4O8YB 2KVRA 4L2YA 2LXAA 3Q8BA 4LCOA 2BWES 4WIFA 4YSZB 1Q1OA 4LNKA 4PS7A 1WE6A 3VTVA 1J7BA 2FBWA 2D2QA 1DOXA 1YQBA 2IPKD 5C2OA 2K22A 1VBC4 2MBOA 1I4PA 3L17A 3RD2A 4OVZA 4WH4A 3BK2A 4REZA 1JRPA 1YQ4B 4K1RA 1EM7A 4MEMA 3MHSD 3NHEB 3RNCC 3RNGC 1R094 1WMHB 3PREA 1LO5D 4XE0A 4XX5A 3SHQA 4AUQC 3AE2B 1OQQA 3TIXA 1SSNA 2JXTA 2PLV4 2LVPA 2XEWA 2KWUB 2ZNVB 1P4RA 1M9NA 4ZHPA 3G8QA 2LGDA 1J0GA 1V1OA 1YX5B 2G84A 1GB4A 1GPXA 3NRZA 2BYFA 2CS4A 4XWTA 4K81A 1JWMD 3URYA 5D2MB 4KVGB 4EE2A 4EZLA 4DHJB 2RS14 1WXAA 4ANVA 3W1YA 5L95C 5C3JB 2PYJA 2RDHA 4IDIA 2LUMA 1ZXIA 3V3XA 2NBUA 3O65B 2Z8LA 2X38A 2PZSA 2IU3A 4OCNB 3AEBB 2W54A 1WKQA 2AL6A 1NCQD 4XYCA 4LJPB 3AE8B 4GDLB 2LHDA 5J17A 1CQVA 3IAM1 1FNVA 3RN9C 2HD5B 2NX8A 4LK0M 4RFBA 1Q10A 2B3ZA 4D10F 1NYQA 4OCLA 1RHI4 2QCZA 1XD3B 4DHZB 3B1LX 2UYZB 4KITC 2BKFA 2B76A 3GQHA 1FXAA 1CMXB 3N32A 1K50A 4WIGA 1LXDA 3K9OB 2N0SB 5G2NA 4ICVA 2DYOA 3WCQA 2Z3JA 3CSFA 5DCNA 1SB3C 1XCQL 3RFZB 2RMMA 1R084 1T0YA 1V81A 2KFKA 2MJ3A 5M52C 3SFDA 3EFCA 2ACZA 4YXDB 1AF2A 5C23A 2J7QB 5FK9C 2QILA 2NBWB 4HJGE 3BY4B 1YOVB 3N9YC 4MSJA 2INCC 2RR9A 2B3JA 1JTKA 2R074 3AECA 4GSWA 1YSBA 2C7MB 3V61A 1C77A 5EE0A 2R2QA 5IP4D 2PW9A 3DHHC 3NVYA 1FXTB 2WXHA 4BBNF 3DHIC 2FCQA 2WNMA 3HRDD 4GOCA 1MG8A 4FXCA 2D3AA 1C1YB 3P4QB 1SE2A 3P1MA 4WWPA 2N1WA 3VVWB 1IPGA 3EFUA 3GB1A 1MHXA 2KWVB 3MC9A 3EUB2 4F1SA 4HLEA 1UGJA 4JE3B 1FO4A 2KJRA 3VAWA 3L08A 1V86A 4P16A 1UZXB 1VQ2A 1NENA 2LD9A 2PVGC 1NI2A 4P9DA 3Q6BA 4KDLB 2D3CA 4RGNA 1UWZA 2VH2A 2NS5A 1V97A 4WIPA 3RNEC 1OGWA 2KOXA 2V3NA 2N7DA 1SEBD 2Y5PA 1WXVA 2MP2B 4I6NB 3M62B 1GOZA 3VH3B 3DQVA 1D6EC 2V4IB 3Q3JA 5KHOA 2X8XX 4EOYA 4O8XA 1HZ5A 4OHJA 4OWPA 3BZDB 4B9KA 3V60A 1JALA 3AE1A 3QJZA 1J7AA 5DPWA 2KTRB 1LQBA 3QAQA 4WQOB 2RD0A 2KQ7A 1HEZE 5JHAA 3K9PB 3LB8C 1TZOA 1OFFA 4YTNA 3BIID 3AE7B 1TS5A 3KYCD 2RS54 2GMIC 1E6EB 1E8WA 1RUG4 1XEEA 3R3MA 1PYWD 4AOFA 3ALBA 4GB9A 1TZ1A 5D94A 3SFEB 1L6UA 2KWCA 2FCNA 4IWQA 1TS4A 4MM3A 1I4HA 1WM2A 1V1PB 1WH3A 2BWFA 2Q5WD 3Q3FA 1AYFA 2KLGA 4K7SA 4B0MA 3UGBB 1RRBA 2KN5A 5G5HA 3AE5A 3PSEB 2QSDA 4N59A 4A1OA 2BQQA 1SJED 4EZJA 3LJ3A 5IA7A 2KC2A 1WJ6A 2JRHA 3IHPC 1WGYA 3BINA 4MGYE 1CZPA 4AQ7A 4KIKB 1E8ZA 2PVOD 1IBXB 1FMAD 3AULA 3DPDA 2M19A 4M00A 5BYSA 1BUIC 2FIDA 2ZVOA 3OCQA 3TL5A 2HWC4 1R4NI 1YX6B 3HIZA 3U4EG 1VZ6A 5CW6A 3L16A 3KQ4A 2I1JA 2BKRB 4IUMB 4JL9A 3ZXVA 3RZUA 3KH0A 2BS3B 3VR9A 1WM3A 3AM9A 1AARA 1R4MB 2KDBA 1TBEA 3ZPGA 4DHZE 1MFWA 2PMVA 2JSVX 3WANA 2FE8A 3QCAA 3FKYA 2WYQA 2HVVA 2LRWA 2HXVA 5TR5A 1WJNA 3V62A 2J53A 2R61A 3DCGA 5IAAC 2UWQA 3PLUA 4NNJB 3TEYA 1N60A 2MX2A 1ZP0B 4DXFA 3DOWA 4HK2A 1HTQA 3ZPCA 2MBQA 2V9HA 1FD6A 1IGCA 4CO7A 3DBLB 4OZBA 3T8MA 4ZRPA 1WI0A 3AE9A 4J6EA 2RGFA 3ZUNA 3P4PB 2ZPYA 1SIJA 2MRPA 1I35A 3R7RA 3NG0A 2P87A 2JT4B 3JVZX 2R044 3PRMB 4OW0A 2N7EA 3KVFB 4CYEA 3MP9A 4AWJA 4LCPA 2FR5A 2O95A 3DHGC 4AJYB 4C4VB 1V5OA 2V3SA 2DZKA 4A55A 2WP9A 2NTTA 1TKEA 2RS34 2O2VA 2KX3A 4E0QA 4D2KA 4I6PA 3A1QA 3IVFA 2YVCA 3PZ7A 1F2RI 3B8FA 1TY2A 2WDQA 4M0WB 1E8YA 1L0VB 2IY0B 5HKHA 2N9LA 4MSQB 5I4DA 4FA6A 4NJCA 4NAWA 1E90A 1H8CA 3VUYA 4GGMX 2H89A 1S3SG 2XN9C 2RMU4 2KD0A 1MQTD 3ABVA 1GUAB 3W2DA 4IWPA 1P1AA 4FLHA 1UBIA 4YTMA 2RR14 3AEFB 2YEPB 1YN3A 5AUIA 1F1HA 3VR8A 3R2IA 1QOBA 1T5XD 2N9EB 3A4SC 1XO3A 4S0RA 1LFDA 2J42A 3PTFC 4P7IA 4BFRA 2GRIA 2AEHA 2A5UA 1PGXA 2QC8A 4DQOC 3W1SC 2O96A 3WIMA 1SF0A 1YN5A 1VD2A 1J7CA 3Q3NC 3B9JA 2KTFA 4NQLB 5CHVC 3AE6A 3AEGB 3AE4A 2KANA 4US9A 2N9PC 1BXTA 1UF0A 4DWFA 3NZ3A 2BTEA 4Q4W4 4KV2A 2HJ1A 2M8SA 1WY8A 2K0PA 3UIOB 1TT5B 1HQRD 1D4BA 4YTPA 2GBKA 2G6VA 1R4NB 3I63C 2ZZPB 1OEYA 1RFAA 2DYMA 2MBEA 1PIV4 5AZHA 1YJIA 2CU3A 3N1ZC 4JLCA 1K53A 4HRWA 3N1XC 1T0QC 2M17A 5J18A 2H88B 2BYVE 4W9IA 3RZVA 5FKAC 2K9XA 3SU8X 1P98A 1VBA4 3TEZA 2W9NA 2UU7A 3RCZA 4PS8A 3KUZA 2E3TA 2AYOB 1HRV4 5JZEB 4XDDA 1HTOA 4B0EA 4BAXA 1N63A 1D5XC 2KC1A 4TKNA 4YSXA 2KQ4X 3NY5A 2ZCBA 4NZLB 1QLBB 2DHZA 4AS1A 3IXSA 2MJDA 1WYWB 4YL8A 2WQYA 2B1IA 1QQRA 2KMCA 2C60A 3ZXRA 3L0WB 5BMIA 4TQ0A 2K8HA 5EE9A 1F0ZA 3IBEA 3SBGA 1KLGD 3QHTA 4LNNA 2A4ZA 1VJKA 2NPTA 4MACA 3FC4A 3GP7A 1AL24 3TEWA 1E7UA 4LJOB 2ZJDA 4M8MA 1UBQA 2WXFA 3NVVA 2LHEA 3ZIMA 1KLVA 4NJ6A 1THZA 4W9DA 2RPQA 4OCLB 2ONQA 3P63A 2LEKA 2L00B 2JXXA 4LCDE 4ZYSA 3JW0X 5IN7A 4LDTD 4RH6A 1MHHE 5HG2A 4ZOHC 4BKTA 3W9CB 1U4AA 4GXBA 2MHJA 3IAS1 1GAQB 2L52A 4A9AA 4EZKA 1V2YA 2IY1B 1TYGB 1EU4A 3HVZA 1KJTA 2PY5A 1PUTA 4WQMA 1V49A 4LNIA 3KUDB 2DENB 3SFDB 1D5MC 3KLSX 4KX6A 1IUEA 2E6XA 3LYYA 1C78A 1T6BX 1Z5SB 1ZCZA 2IO0B 1F2RC 1ZOYA 3Q3OC 4DBGA 1KRHA 1D4M4 1KFYA 4YSYA 4DDID 4C56C 1C76A 3AE3A 2JX5A 1JWUD 3IT6B 4W9CA 3PS6A 4FADA 2J52A 4HPPA 1QZEA 3UF8A 3JBG4 2LXCA 4K7WA 4AJWA 2PKOA 4HRSA 1Y8RC 3DH1A 2BYTA 1ZGUB 2PEAA 3CIRA 4I6LB 1WRDB 1TS2A 2MQJA 3PRPB 4ZHOA 4JPSA 2W4LA 1RUJ4 1VBD4 4ZDVA 3LDZE 3SUCA 1NI3A 2ZNVC 2MBBB 2L76A 3NOBA 2LUEA 3A9KA 1PKXA 1YQ3A 2LMCA 2D11A 3Q8FA 2JZZA 4HJKA 2L83A 3ZNID 1I4XA 2XBBC 3PZDA 3OJ3A 1NEKA 2Y5CA 2O7PA 3EX8A 1T0SC 3P4RB 5GXGB 1JWSD 2K5PA 4XGAB 1RM6C 3PHXB 2HTME 4WWNA 4CQNA 1FRRA 3TEXA 2WS3A 4O8YA 4KGSA 1PGAA 4Q2JA 2KN4A 1F9JA 3RI7C 1EO6A 4O1NA 4YSZA 1HRI4 3OLMD 4OWPB 3TUOA 2XK5A 1KTKA 1EF5A 2IU0A 1R5XA 1RAXA 2QLCA 2KZRA 3U30A 4P9CA 3NJTA 1E10A 4JX1C 1QOAA 2IGHA 1P6OA 3ZEFB 4CHKA 3RZWC 1WMHA 4JGHB 3L13A 3AE2A 1A70A 2IYDB 2GBMA 3APDA 3M63B 4LTUA 4OCMB 2LGSA 2WXLA 1SXTA 1IYFA 5G5GA 1A5RA 2WLBA 4ZD4A 1XXGA 3AH7A 2WXRA 3J9CA 2FR6A 2LGIA 1N6ZA 1WWTA 2WXJA 1KLUD 4MM3B 1L5PA 2MEKA 4GDKA 1MPEA 1N62A 3PHWB 1PL0A 1F52A 4LNOA 1QF6A 4GIVA 5C3JA 1OTRB 1XLPA 2CHWA 2WGSA 1FFVA 2LRUA 4OCNA 3AV8A 3ZJUA 3VRAB 3AEBA 4JWSC 2QHOA 2GBJA 3KWVA 2DAJA 2KVZA 4TQ1A 4GDLA 3VUWA 3AE8A 3M3JA 2G4DB 4J6IA 4ZRQA 4DHJD 3NZSA 2K6DB 2MCNB 1TJEA 1PO14 2JF5A 2JRIB 2VH1A 1P9DU 2O6VB 3WAMA 2K25A 3PRZA 3GOEA 3Q3MC 2Y5BB 2JU6X 5HI1A 4JIOU 4MELA 2KQSA 1WIAA 2EKEC 3P2BA 1VZ7A 1PQSA 1SGHA 1WGHA 2VZKB 3KUCB 1PGBA 1WJUA 5C2TB 3V6EB 4EUTA 2IO2B 4FHKA 1R7SA 4YXDA 2JY6A 3QA8A 1SIFA 4EFOA 1YSDA 4E71A 1VZ8A 1ZDXA 4RF1A 2PIAA 5JH5C 3GS2A 2BB6A 3U2SC 1UELA 4NAMA 3RZFA 4NPNA 1VLBA 2ZEQA 3I9V1 4KDIC 3A33B 2IO1B 4PQTA 4M8NA 1P7FA 1B9RA 4IG7B 2GOWA 2NYTA 3Q8CA 4M01A 2ZW0A 2ICIA 4EG2A 3H7PB 3NUHB 3P4QA 3Q8EA 2JUOA 3ZNZB 4ASWC 1K5MD 1YN4A 4HCPB 3H6NA 1WRIA 2Z59B 2KO3A 1KOTA 1L7YA 1X1MA 4XZ4A 3J8F4 1WFYA 5D3IB 2KMMA 1QILA 3JYUA 4B6WA 3SR6A 1ZXHA 2C7NB 5CHFA 4I43B 1V6EA 3U7ZA 1UD7A 2W55A 3ZVVA 2WDVA 4IOIE 3B2FA 3BVGA 3OG5A 2WDQB 2D30A 4Q4V4 4MDKE 3NVZA 4MGZE 2FCSA 4HKQA 2MP2A 2K39A 4BOZB 2LZ6A 1KM7A 2MSED 2BS2B 3NVWA 2JVCA 2LI5A 4HVBA 1YIWA 2WX0A 2D5GA 4YTMB 2ZCCA 4HKZE 4IC7B 3HUIA 3ZKJC 2KTRA 1XCTL 3VRBB 1VBB4 4WWMA 5H8YE 4R3DA 3FILA 3H7SA 3W5VB 1P3QU 1ZKHA 2KCQA 2OJWA 3AE7A 2C9WB 2WX1A 2HVWA 1K51A 2L7RA 2KJ6A 4ILGC 2KDIA 1F77A 3AEAB 4ZRIA 1C4AA 4KKIA 2KJHB 2AL3A 2M4NA 1RUH4 2RPZA 2C5LC 4PYZA 3BYTB 3UQBA 1T3QA 2J4XA 2RPVA 3SFEA 2R7FA 1MG4A 2KNBA 3AE4B 2NTSA 3FI7A 2CU1A 2N4FA 3T9LA 1WGKA 5T8IA 4YWGG 3RYTA 3TMPB 1MVKA 1ZW7A 3VH4B 2V1YA 4XWWA 3FAHA 2OEDA 4YTPB 1V1PA 3UINB 1J19A 3L10B 5H92C 2M0AA 3VX8A 2WU2B 1E9MA 4DXGA 4HWIB 1E0ZA 2MH7A 1GC6A 4W9LA 4WJPA 4RGOS 2K8CA 5CTRC 2WDTB 3AI5A 1I42A 4GB34 3ONSA 1MI0A 2QIEB 4QFTA 2G9HD 2EELA 1Z3AA 3Q8AA 2CJOA 1IBXA 4A90A 3AEDB 3A4RA 5AUKA 2TSSA 1RUE4 2EMTA 4MSDA 2BW2A 2BPSA 2WXIA 1COV4 2CHZA 1RUI4 3MHZA 1P7EA 2MLBA 2Z0EB 3EGRA 2GB1A 1WSPA 2JYTA 1DGJA 4RCOA 4USAA 1RWSA 3H8HA 4FULA 3OWEB 4URKA 1C4CA 2SEBD 2W3RA 1BEV4 3MFGA 4OVUA 1JMLA 1SJHD 1EF1A 2KHWB 1TTNA 3MJ5A 4P1BC 5HHDG 2WXKA 1J8CA 1FCCC 2DAFA 3EA6A 1TIFA 1JW9D 4LD2A 2PLPA 1MQ0A 1ZP0A 3DMOA 3JSVA 2WU5B 2D3GA 3QARA 2GLSA 3P4PA 2M0XA 5E6NA 2NVUI 3TJPA 2AQ1B 1AR94 4FJZA 4MSMB 3TBLD 1TKYA 1XLNA 4ANUA 2FCMA 3AEEA 4NQKE 1V8CA 1XHZA 4IW0A 1NBFC 2MJEA 3ZTCA 1WXQA 2FBWB 1IP9A 2K6QA 2G1EA 1XQQA 1C9FA 2LGYA 4C4VA 1WJ4A 4US8A 1H4RA 1CK1A 4K1RB 3BVZA 1HXYD 4E74A 3AU5A 2AX5A 1WE7A 4F8CB 3W1SA 2JPHA 2LVQA 3RNFC 1RB7A 1E5WA 1L0VA 2D3BA 4TV3A 3NS1A 1PO24 4KZ0A 4W9GA 4MSQA 2EX3A 3CWIA 2W82A 1Z2MA 4JQWC 3ZYYX 2CJNA 4OVVA 1V9JA 1XHXA 2AWTA 2KFJA 1K52A 1VK9A 5BYQA 4G0NB 3HVDA 2DYBA 1STEA 2G3QB 3QC8B 2JZPA 4ICUA 1FNWA 4LCNA 4GU2A 3AEFA 2QMTA 1OOPD 4P9EA 3VHTC 2D07B 5JHBA 2OG4A 2IZVB 1EAH4 1FEHA 3TSSA 4FBJB 3OJ6A 4FJVB 2YEPF 1PFDA 1C79A 2INPE 3TCAA 2JQRB 1KF6A 3AN1A 1RVF4 4MH0E 1Q0WB 2L3ZA 4TSSA 3A9KB 1QKZA 1PVC4 3BVMA 3AEGA 4HPMB 1WGGA 5DPTA 2OJRA 2JWUA 3MC0B 4YT0A 3ZDTA 2WHIA 2WXNA 1LGRA 2B76B 2ZW1A 4A3PA 1SE4A 2FUHB 4MJSA 1L4ZB 4QAYA 4LNFA 2B3AA 2PE9A 1NA1D 2WS3B 2KKSA 1ROEA 2YLMA 5IO9A 4PDWD 1T0RC 1WYGA 5BO4B 4A8XC 2I38A 1GG3A 2KFKB 2K8BA 1WXMA 2XK5B 1ASJ4 2IGGA 2H88A 2ACZB 3Q69A 2IBIB 4HDOA 3ML8A 1WR1A 2QJLA 5C1ZA 3BK1A 1FNUA 4G3XB 4W9EA 1QT9A 1FIQA 2DWQA 1UX0A 5BYRA 3PV1A 4XDCA 2OHFA 2RDBC 3E56A 3AECB 5DCAJ 1ZUD2 4Q4Y4 1C4PA 4H2AA 5HFYA 3PPAA 2ZNRA 4IM2A 1UWMA 4RM8A 2INNE 4HEA1 1ENFA 2KLCA 1WX7A 1I4RA 4EHIA 2N1VA 2JWZA 1BT0A 2BBCA 4A6QA 1VCBA 4BKSA 3OAWA 1WX8A 4W9JA 4GDKB 3QK0A 5AZFA 3B2GA 4ZRJA 3GQKA 3RULA 2FAZA 2EKIA 2KDEB 4OZAA 3ZZMA 1RUD4 1NENB 3ETRA 3QIJA 4ZD5A 5LXHA 1JWAD 3RUIB 4BBNC 2KKCA 3RNBC 3ZJTA 1WN6A 1NDDA 4F7OA 3VXWA 4BKSD 1L0XB 3Q2AC 1WR6E 4GMVA 3GZNI 2WDRA 3P4SA 2L32A 3A9JA 2CKHB 2M56B 4BKGA 4WAAA 1CTTA 4O8XB 2FIFA 4KGTA 1QOFA 3AE1B 1RMU4 3LXFA 2CR5A 4G50A 2ZPNA 3ZW3A 1AW7A 1DOYA 4ZYNA 3VDZA 2KT7A 1YQ4A 4YTNB 4F3WA 4HXDA 2N9KA 3N3KB 5JXVA 2N7JA 5DPSA 3T3OA 4ACFA 4BGDC 4N9F4 5CX3A 3O13A 3H1UA 1HZ6A 4GGQA 3ZLZA 4W9FA 2Z3IA 3APCA 5L83A 4RNAA 2ZNVA 5GMVA 1SBBB 4PT5A 1XLQA 2J0MA 3BYYB 4LD4A 2BT6A 2NR2A 3PLVA 3JD74 1K8RB 5BMHA 4N6EB 1UWXA 4IM3A 3CF6E 3IT4B 1R4MI 1RYJA 1TS3A 3WA0A 4II3B 3AE5B 2OOBB 4EEWA 2JYEA 4WURA 2NCNA 5EE1A 4ANXA 1NVID 5CHWA 2DLBA 1YJJA 4XC2A 4BVUC 2WXGA 5IOIA 1QOGA 4HDQA 4WWOA 2AQ2B 4MH8A 1UUPA 4BZAA 1WGRA 2Y3AA 3ZNHB 2HE7A 4FHJA 2FUG1 1RFKA 3DBLI 2WXPA 2D5NA 3N20C 2ASQA 2BYEA 2VRRB 2KMAA 2LJ5A 3WAPA 4W9KA 2WDVB 3OJ4B 3ZTDA 1E7PB 1KH0A 1EWCA 1M4VA 1EUVB 2DZMA 4RF0A 4JXEA 3P4RA 1AR64 3ZDMC 1SE3A 3VR9B 1DYQA 2JZ3B 4RMAA 3SD5A 1SE9A 1Q5WB 2WXMA 5M59B 1POV0 3RMKC 3AMZA 3ZGZA 4DK5A 3MPZA 1HA5A 2B1GA 4NY0A 4P6VF 4X57B 1C3TA 1I4GA 4GLSC 2KACA 3IJFX 2CHXA 2LJIA 2P8RA 1NYRA 4RGMA 3FILB 3R2NA 1VRAB 5MPOA 3N1YC 3IFWB 2FNJB 2LVOA 2W3SA 3UI3A 2BS4B 3WALA 3DBSA 3ECIA 1GNUA 3B0AA 3AE9B 3R2TA 1XT9B 4OCMA 4FJYA 1I4QA 4M02A 5D7GA 3DBHI 3T3NA 2QDFA 3I5JC 1HE8A 2I1KA 1JWBD 2GI9A 3EC8A 1VDVA 5E6OA 1YMHE 1N61A 2KDFB 3GZNB 2QEJC 3RNAC 1ESFA 2WWZA 4RM9A 3KW5B 1V80A 1Y56A 1G8MA 3VTUA 1TKGA 2KXJA 1EWYC 2IJ0A 3AB5A 4ANWA 2WP9B 2V3PA 2MBHA 2O2VB 3VRAA 3ZO5B 2KDMA 1UX1A 2BVCA 1DOIA 2LWPA 3QX1A 3A1QB 1ACCA 4RHV4 1RLFA 4ZFRA 4HROA 2DX5B 1AN8A 3RT3B 3PVLA 4WJOA 3IG3A 5J2RA 1RUC4 2L05A 4MT5A 4NAWB 2EMSA 2H89B 4PK1A 3U8ZA 3C19A 2DBYA 4S17A 2O6VA 3ABVB 3KWLA 1ZABA 2NMQA 4G11A 3PT2B 1FXIA 3VR8B 3DVGY 1N5XA 3L4PA 3DWGC 5AEKB 4LC5A 4J3OD 4ZRKA 1TY0A 2PJHA 3V05A 4N58A 1ET9A 1D5ZC 3KYDD 2R2OA 4ZFTA 2REXA 5C2TA 3VUXA 5LLIA 1OX7A 1CJEA 1ALNA 3L54A 1VR9A 1YD8U 2O6VD 3SDLC 1R5TA 4C80A 1WZ3A 3Q14C 3AE6B 4K7UA 1AR84 2Z3GA 1FM0D 3JSVB 3MC8A 4KZCA 4NJ7A 4C7ZA 4KGRA 3B08A 3ZRCA 1UGMA 5G55A 4L23A 2VZKD 4IWOA 1FCLA 3VTWA 2RDGA 4K3CA 2LFIA 2AQ3B 2N9XA 3QQ8B 3MTNB 4AP4C 4JWUC 3AEEB 4A20A 1N5WA 3H7PA 1L2NA 3HM6X 2RSUA 2SAKA 1B1ZA 1M94A 1FFUA 2PYLA 4A3OA 4G3MA 2INDC 3HHMA 4TMAB 2DZJA 5D3DA 3P42A 1WXSA 3CMMB 5EE3A 1WZ0A 4C7YA 4KIKA 1OI0A 3DBRI 1S1QB 2GBNA 1HXS4 4E3CA 5LXIB 2HTHA 5FR3A 2L0TA 5EDSA 4DDGD 5BMGA 1H8TD 2KAJA 2GBRA 1XI1A 3AU4A 3ML9A 3S2AA 4ARIA 2BF8B 4YSXB 1WWRA 4FN2A 2BGFA 1WN5A 1FPYA 5IKCM 2K3UA 3HK0A 1YNTE 2DNFA 2V0GA 2WQYB 5D6JB 2HDEA 3ZQ4A 3X0WA 1E8XA 4PS3A 1WGDA 1I7HA 3APFA 3DBHB 3DDCB 1LM8B 1L0YB 3R66C 4LLGM 1TGZB 2Z0DB 1V5TA 3DVNU 1WX9A 4C00A 3DVGX 4BOSC 2NPTB 2V4LA 2PE6B 3VRBA 2C7HA 2RM24 2WXQA 3U52E 1L6VA 4WAFA 4LDTB 3MJWA 3RPFC 2HWB4 1ISNA 4MGIE 2Z3HA 2HJ8A 5TSSA 4P1CC 3EECA 3AEAA 1KF6B 3NZUA 1FRDA 1ZDVA 2IDYA 3H9DA 1GC7A 3VQIA 2L0FA 1AR74 2R064 4W9HA 2PPHA 2XNAC 4YT0B 4B95A 1PDXA 5DPRA 1Z7S4 5E6JA 5FR6A 1UNSA 4MJSB 1UAQA 1CTUA 1ZE3D 4WJNA 2LGXA 2ZVNA 1ET6A 4L1BA 4WJQA 2WU2A 1JCKB 3EHVA 4II2B 2DZIA
chains in the Genus database with same CATH topology
1TJEA 2BBCA 4A6QA 4DXFA 1EU3A 3ZPCA 1FD6A 1IGCA 4GDKB 4KX6B 4OZBA 4ARCA 4ZRPA 2IGDA 3B2GA 3E9SA 4M0WA 2JU6X 3C8YA 4HRQA 3P4PB 2EKIA 3I57A 2L1AA 1SIJA 4OZAA 2I2YA 5HI1A 1ZOYB 1NENB 3BWUD 3ETRA 1JROA 1VZ7A 4OZCA 4IKGA 1KFYB 4ZD5A 2P87A 4YSYB 1JWAD 1XF5L 3AE3B 2VZKB 4OW0A 3ZJTA 1PGBA 5C2TB 1WN6A 5LNK1 4F7OA 3PO0A 1L0XB 3MP9A 1R7SA 2KWDA 1AWDA 1YSDA 4LCPA 2FR5A 2O95A 1VZ8A 1XLOA 1ZDXA 2L32A 4KKJA 2WXOA 1L4DB 1IGDA 4RF1A 4A55A 2O3KA 2NTTA 2PIAA 3CIRB 1TKEA 4ITKA 3GS2A 2BB6A 3U2SC 1GB1A 4E0QA 2M56B 4D2KA 2BB5A 4NAMA 1CTTA 1OQRA 1VLBA 3I9V1 4O8XB 3PZ7A 1F2RI 3B8FA 4KGTA 1TY2A 3R8BA 1QOFA 3ZJVA 3AE1B 4UDUC 4PQTA 1L0VB 1P7FA 2N9LA 3LXFA 5I4DA 1B9RA 3DWMA 4RGTA 1AW7A 1ZPSA 3Q8CA 2NYTA 1YQ3B 1DOYA 3SEBA 4NQLA 4NJCA 2OBCA 2ZW0A 2ICIA 4EG2A 4YTNB 4MS7A 2PTLA 4F3WA 3NUHB 2N9KA 2XN9C 3Q8EA 5JXVA 3E1UA 2N7JA 1NEKB 1YN4A 3T3OA 4BGDC 5GAOA 3PZ8A 3W2DA 2ON8A 3O13A 1HZ6A 1WRIA 3AEFB 2YEPB 1YN3A 1TIYA 2WDRB 5AUIA 1BMLC 3P4SB 2A8NA 3R2IA 1QOBA 1T5XD 2Z3IA 4RNAA 5D3IB 2KMMA 3W5UB 1JQ4A 2ZNVA 1SBBB 1QILA 1XO3A 4PT5A 4MSMA 1XLQA 4O8YB 3BYYB 2J42A 4LD4A 4L2YA 1ZXHA 3SR6A 3Q8BA 2BT6A 4LCOA 2GRIA 4I43B 3U7ZA 5BMHA 4N6EB 2W55A 4YSZB 4WIFA 1UWXA 1PGXA 4IOIE 4DQOC 3IT4B 3B2FA 3BVGA 1J7BA 2O96A 2WDQB 1SF0A 1RYJA 1YN5A 1TS3A 1DOXA 2D30A 2IPKD 5C2OA 2K22A 3NVZA 1J7CA 1I4PA 3AE5B 2JYEA 4WURA 3B9JA 4OVZA 4WH4A 4HKQA 5EE1A 3BK2A 4REZA 3AEGB 1JRPA 1NVID 1YQ4B 4K1RA 2DLBA 1EM7A 4US9A 1YJJA 1BXTA 2WXGA 1LO5D 3NZ3A 4XE0A 2BTEA 2BS2B 3AE2B 1OQQA 1QOGA 3NVWA 2K0PA 1SSNA 2JXTA 2D5GA 1HQRD 4YTMB 1D4BA 2AQ2B 2G6VA 4HKZE 4MH8A 1UUPA 3HUIA 2DYMA 2Y3AA 1XCTL 3VRBB 4ZHPA 1YJIA 2FUG1 4WWMA 4R3DA 3FILA 1RFKA 2CU3A 1V1OA 5H8YE 2WXPA 3W5VB 2D5NA 2G84A 1GB4A 1GPXA 3NRZA 2KCQA 1K53A 4XWTA 4HRWA 1JWMD 3URYA 2HVWA 1K51A 2WDVB 4ILGC 4EE2A 1E7PB 1KH0A 1F77A 3AEAB 1EWCA 2H88B 1M4VA 1C4AA 4KKIA 4JXEA 4RF0A 2PYJA 5C3JB 3RZVA 5FKAC 2K9XA 2RDHA 4IDIA 1SE3A 3VR9B 1DYQA 2LUMA 2RPZA 3BYTB 3TEZA 1ZXIA 3V3XA 2Z8LA 1T3QA 2J4XA 2WXMA 2X38A 5M59B 2RPVA 2PZSA 2R7FA 3AE4B 4OCNB 2NTSA 3FI7A 3AEBB 1WGKA 2W54A 2E3TA 4YWGG 5T8IA 3AMZA 1WKQA 3ZGZA 4XDDA 1MVKA 3AE8B 4GDLB 2LHDA 3MPZA 1CQVA 3IAM1 1HA5A 4B0EA 4XWWA 1FNVA 3FAHA 4P6VF 2OEDA 2NX8A 4LK0M 4RFBA 1V1PA 1I4GA 1N63A 1D5XC 1Q10A 4GLSC 4YTPB 2KACA 2B3ZA 2KQ4X 5H92C 3IJFX 2M0AA 4NZLB 2LJIA 4D10F 1NYQA 1QLBB 2WU2B 1E9MA 4AS1A 2P8RA 4OCLA 1NYRA 3IXSA 4RGMA 4DXGA 1E0ZA 3FILB 3R2NA 2MH7A 2MJDA 1VRAB 5MPOA 4RGOS 1QQRA 2W3SA 3UI3A 2BS4B 5BMIA 4TQ0A 5EE9A 1F0ZA 4KITC 1FXAA 3SBGA 1K50A 1KLGD 4WIGA 3AE9B 2N0SB 1MI0A 3R2TA 2QIEB 4QFTA 2DYOA 2G9HD 3WCQA 2Z3JA 1I4QA 2EELA 1Z3AA 4OCMA 1VJKA 3Q8AA 2CJOA 1SB3C 1XCQL 1IBXA 4A90A 4MACA 5D7GA 3AEDB 3FC4A 5AUKA 3T3NA 2TSSA 3GP7A 3RFZB 2RMMA 1JWBD 2GI9A 3TEWA 1VDVA 1YMHE 1N61A 4MSDA 2BW2A 2WXIA 2QEJC 2WXFA 3NVVA 2MJ3A 1ESFA 5M52C 2LHEA 4YXDB 3MHZA 1AF2A 1P7EA 1Y56A 1TKGA 5FK9C 4OCLB 2QILA 4HJGE 1EWYC 2IJ0A 2ONQA 3AB5A 3EGRA 3P63A 2LEKA 3N9YC 4MSJA 2GB1A 1WSPA 2JYTA 1DGJA 2V3PA 2WP9B 4RCOA 4USAA 1RWSA 3H8HA 2B3JA 1JTKA 3OWEB 4ZYSA 2KDMA 1C4CA 1UX1A 1DOIA 1ACCA 4RH6A 1MHHE 1YSBA 2SEBD 2W3RA 4ZFRA 3MFGA 5HG2A 1C77A 4HROA 4ZOHC 1AN8A 1JMLA 5EE0A 1SJHD 3W9CB 3MJ5A 5HHDG 2PW9A 2WXKA 3IAS1 1FCCC 2WXHA 3NVYA 1GAQB 2L52A 3EA6A 4A9AA 2WNMA 3HRDD 1JW9D 4MT5A 4FXCA 4NAWB 4LD2A 2PLPA 1TYGB 1MQ0A 2H89B 1EU4A 3HVZA 3DMOA 2PY5A 2WU5B 1PUTA 3P4QB 1SE2A 3P1MA 4WQMA 2DBYA 3GB1A 3SFDB 3ABVB 1MHXA 3KWLA 1D5MC 3KLSX 3EUB2 1IUEA 2E6XA 1ZABA 2NMQA 3LYYA 1C78A 1T6BX 1UGJA 4JE3B 1FO4A 1FXIA 3VR8B 1N5XA 3L4PA 3DWGC 4P16A 1F2RC 2AQ1B 4LC5A 4J3OD 1VQ2A 1TY0A 3V05A 1KRHA 1TKYA 1XLNA 4N58A 2PVGC 4P9DA 1V8CA 1ET9A 1D5ZC 4RGNA 4C56C 1C76A 2JX5A 1UWZA 4ZFTA 1XHZA 1JWUD 3IT6B 2MJEA 1OX7A 1V97A 1CJEA 4WIPA 1WXQA 1ALNA 2FBWB 2J52A 1VR9A 2V3NA 2G1EA 1R5TA 1SEBD 2Y5PA 4C80A 2PKOA 1C9FA 4HRSA 3DH1A 4US8A 3AE6B 2BYTA 1GOZA 1CK1A 1FM0D 2Z3GA 4C7ZA 1D6EC 2V4IB 4KGRA 1TS2A 3BVZA 1HXYD 4ZHOA 4JPSA 2AX5A 2W4LA 4O8XA 1HZ5A 4OHJA 4OWPA 3G8QA 4L23A 2VZKD 3BZDB 1FCLA 3W1SA 1RB7A 2RDGA 1JALA 3NS1A 1J7AA 2LFIA 1NI3A 2AQ3B 4MSQA 2EX3A 3CWIA 2W82A 2LMCA 3Q8FA 1HEZE 4JWUC 3AEEB 3LB8C 2L83A 1TZOA 3ZYYX 1N5WA 1OFFA 3BIID 2CJNA 1XHXA 3AE7B 1I4XA 1K52A 2SAKA 1B1ZA 1TS5A 5BYQA 1FFUA 2Y5CA 3HVDA 2O7PA 2PYLA 1STEA 4G3MA 3EX8A 3P4RB 4TMAB 5GXGB 2JZPA 1JWSD 2K5PA 5D3DA 1RM6C 1E6EB 1FNWA 3P42A 4LCNA 1XEEA 5EE3A 1PYWD 4C7YA 2QMTA 1OI0A 4P9EA 2HTME 4CQNA 2OG4A 3SFEB 1FRRA 3TEXA 4O8YA 4KGSA 1PGAA 1L6UA 4Q2JA 1FEHA 1TS4A 3TSSA 2KN4A 5FR3A 3OJ6A 5BMGA 2KAJA 4O1NA 2YEPF 1PFDA 1C79A 2INPE 2JQRB 4OWPB 3TUOA 1I4HA 1XI1A 4ARIA 3AN1A 1V1PB 1KTKA 2Q5WD 4YSXB 1AYFA 4B0MA 1WWRA 5G5HA 4TSSA 1WN5A 1R5XA 2QSDA 4N59A 1QKZA 3BVMA 2QLCA 4P9CA 2K3UA 1YNTE 1E10A 2V0GA 2WQYB 4JX1C 2HDEA 1QOAA 2JWUA 3MC0B 2IGHA 3ZQ4A 1P6OA 3ZEFB 1SJED 2WXNA 2B76B 2ZW1A 1I7HA 1SE4A 1A70A 1L0YB 1L4ZB 4LLGM 4LTUA 4OCMB 2WXLA 1CZPA 1SXTA 4AQ7A 2PVOD 1IBXB 1FMAD 5G5GA 2M19A 2WLBA 4ZD4A 1XXGA 2WXQA 5BYSA 3U52E 3AH7A 2WS3B 1L6VA 2WXRA 3J9CA 1BUIC 4WAFA 2FR6A 2KKSA 1ROEA 2LGIA 3RPFC 3OCQA 1WWTA 2WXJA 4A8XC 1KLUD 1WYGA 4MM3B 2Z3HA 1L5PA 2I38A 2MEKA 3U4EG 5TSSA 1VZ6A 5CW6A 3KQ4A 1MPEA 1N62A 1KF6B 2IGGA 1FRDA 1ZDVA 2IDYA 2ACZB 1QF6A 3Q69A 1XLPA 3RZUA 2BS3B 2QJLA 3BK1A 3VQIA 1FNUA 3AM9A 1FFVA 1QT9A 1FIQA 4OCNA 2DWQA 3AV8A 1UX0A 3ZJUA 5BYRA 3VRAB 4JWSC 2OHFA 3E56A 4XDCA 3ZPGA 3AECB 2XNAC 2PMVA 4YT0B 1PDXA 3KWVA 5DCAJ 1ZUD2 2JSVX 5E6JA 1C4PA 1UNSA 2FE8A 4H2AA 4TQ1A 5HFYA 1UAQA 2ZNRA 2HVVA 1CTUA 1ZE3D 2HXVA 1UWMA 4ZRQA 2INNE 4HEA1 1ENFA 1ET6A 4L1BA 2J53A 2R61A 1JCKB 3TEYA 1N60A 1I4RA 1ZP0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K52 A;  4WH4 A;  2O7P A;  1AF2 A;  1P7E A;  2PYL A;  3ZPC A;  1FD6 A;  3EX8 A;  4G3M A;  4OCL B;  1IGC A;  4HJG E;  4K1R A;  2JZP A;  2ONQ A;  4LCN A;  4MSJ A;  1EM7 A;  2GB1 A;  4OZB A;  2IGD A;  2QMT A;  1OI0 A;  2B3J A;  1JTK A;  4P9E A;  2JU6 X;  2KDM A;  1UX1 A;  2OG4 A;  4HRQ A;  2K0P A;  2JXT A;  4OZA A;  2I2Y A;  4KGS A;  5HI1 A;  1YSB A;  1MHH E;  1PGA A;  1D4B A;  4O8Y A;  2G6V A;  2KN4 A;  4HKZ E;  4ZFR A;  5HG2 A;  1JML A;  5BMG A;  4OZC A;  3OJ6 A;  4IKG A;  1XCT L;  4ZD5 A;  2P87 A;  1XF5 L;  4OWP B;  5HHD G;  1XI1 A;  2PW9 A;  1XHX A;  3G8Q A;  3FIL A;  1FCC C;  1PGB A;  1WN6 A;  2D5N A;  2G84 A;  1GB4 A;  2KCQ A;  1K53 A;  1WWR A;  4F7O A;  4LD2 A;  2PLP A;  1MQ0 A;  4HRW A;  2HVW A;  1K51 A;  3MP9 A;  1WN5 A;  1R5X A;  2QSD A;  3DMO A;  4ILG C;  2PY5 A;  2KWD A;  1KH0 A;  1QKZ A;  1YSD A;  4LCP A;  2FR5 A;  2QLC A;  2O95 A;  4JXE A;  4P9C A;  2PYJ A;  1YNT E;  3GB1 A;  3RZV A;  1MHX A;  2JWU A;  2IGH A;  1IGD A;  1P6O A;  2O3K A;  3ZEF B;  1ZAB A;  2LUM A;  2RPZ A;  2NMQ A;  2ZW1 A;  3V3X A;  1GB1 A;  4E0Q A;  5M59 B;  4D2K A;  2RPV A;  2PZS A;  2R7F A;  4OCN B;  1CTT A;  3FI7 A;  1F2R C;  4O8X B;  1F2R I;  3B8F A;  1WKQ A;  4KGT A;  4LC5 A;  4OCM B;  1VQ2 A;  4PQT A;  1IBX B;  4P9D A;  1MVK A;  1P7F A;  2LHD A;  4ZD4 A;  3MPZ A;  2N9L A;  1UWZ A;  4ZFT A;  1XHZ A;  2NX8 A;  2OED A;  2FR6 A;  2KKS A;  1Q10 A;  2B3Z A;  1OX7 A;  2LGI A;  4GLS C;  2KAC A;  2NYT A;  2KQ4 X;  3IJF X;  3OCQ A;  1ALN A;  4NQL A;  4D10 F;  2Z3H A;  2OBC A;  2ZW0 A;  4EG2 A;  2I38 A;  2P8R A;  2J52 A;  4OCL A;  4MS7 A;  2PTL A;  5CW6 A;  4F3W A;  1R5T A;  1MPE A;  2N9K A;  3FIL B;  5JXV A;  2IGG A;  3E1U A;  3R2N A;  2N7J A;  1C9F A;  3RZU A;  3DH1 A;  3UI3 A;  4BGD C;  5GAO A;  2ON8 A;  2Z3G A;  5BMI A;  1HZ6 A;  4KIT C;  4KGR A;  2A8N A;  1TIY A;  3SBG A;  2Z3I A;  1K50 A;  4OCN A;  4WIG A;  1UX0 A;  2W4L A;  2ZNV A;  4O8X A;  1MI0 A;  1HZ5 A;  4QFT A;  4OWP A;  3ZPG A;  4OCM A;  2Z3J A;  2EEL A;  1FCL A;  1Z3A A;  1RB7 A;  4MSM A;  4O8Y B;  5DCA J;  4LD4 A;  1ZXH A;  1XCQ L;  2JSV X;  1IBX A;  5HFY A;  4MAC A;  4LCO A;  4I43 B;  1UAQ A;  2ZNR A;  2HVV A;  1CTU A;  5BMH A;  2HXV A;  4WIF A;  4MSQ A;  1UWX A;  2RMM A;  2GI9 A;  1PGX A;  2EX3 A;  4IOI E;  1YMH E;  2O96 A;  4MSD A;  1HEZ E;  2J53 A;  2D30 A;  5C2O A;  5M52 C;  2LHE A; 
#chains in the Genus database with same CATH topology
 1E7V A;  4KSK C;  1D3Z A;  1EU3 A;  4TUU A;  2MW5 A;  3ENE A;  4Q4X 4;  4KX6 B;  2KK8 A;  4ARC A;  4DXA B;  2IGD A;  3N30 A;  1OQY A;  2KX0 A;  3E9S A;  4M0W A;  2X5I D;  4KSL C;  3C8Y A;  4HRQ A;  3I57 A;  2L1A A;  2G4S A;  2I2Y A;  1ZOY B;  4IM0 A;  3BWU D;  3AED A;  1JRO A;  3I3T B;  4GN1 A;  4OZC A;  4IKG A;  1VBE 4;  1KFY B;  5E6P A;  4YSY B;  1XF5 L;  2J0K A;  1JRU A;  3AE3 B;  1GJZ A;  3HM3 A;  1EV1 4;  5AZG A;  3R7Q A;  5LNK 1;  3PO0 A;  3DVN V;  2MA9 B;  4F7Z A;  4MGK E;  5KHQ A;  2KWD A;  3PGE A;  1AWD A;  2IO3 B;  1G6J A;  3QWZ B;  1XLO A;  4KKJ A;  1MJD A;  3ZNG C;  2WXO A;  1L4D B;  1IGD A;  2O3K A;  4HCN B;  3CIR B;  3CST A;  4ITK A;  3U7D A;  1GB1 A;  2M1M A;  2KYW A;  2BB5 A;  1OZ0 A;  1OQR A;  2K1F A;  3X23 A;  3R8B A;  3GE3 C;  4UDU C;  3ZJV A;  3ZRF A;  3NS8 A;  3DWM A;  4RGT A;  1ZPS A;  2LAS A;  4NQL A;  3AXC A;  1YQ3 B;  3SEB A;  2OBC A;  1UH6 A;  4MS7 A;  2PTL A;  2WU5 A;  3E1U A;  3M95 A;  3UQA A;  2L8J A;  3DBR B;  1NEK B;  3BH1 A;  1WF9 A;  4PYU A;  5GAO A;  3PZ8 A;  3D32 A;  1P0R A;  2ON8 A;  1YJ1 A;  2NBV B;  1VRH 4;  2D10 A;  2MWS B;  3C0R B;  1RUF 4;  2A8N A;  4EKU A;  1OEY J;  2G45 B;  2WDR B;  1BML C;  3P4S B;  4K3B A;  1TIY A;  3UIP B;  4HPL B;  3W5U B;  1JQ4 A;  3VFK A;  2J0J A;  3GE8 C;  3V6C B;  3WAO A;  3A9J B;  4MSM A;  4O8Y B;  2KVR A;  4L2Y A;  2LXA A;  3Q8B A;  4LCO A;  2BWE S;  4WIF A;  4YSZ B;  1Q1O A;  4LNK A;  4PS7 A;  1WE6 A;  3VTV A;  1J7B A;  2FBW A;  2D2Q A;  1DOX A;  1YQB A;  2IPK D;  5C2O A;  2K22 A;  1VBC 4;  2MBO A;  1I4P A;  3L17 A;  3RD2 A;  4OVZ A;  4WH4 A;  3BK2 A;  4REZ A;  1JRP A;  1YQ4 B;  4K1R A;  1EM7 A;  4MEM A;  3MHS D;  3NHE B;  3RNC C;  3RNG C;  1R09 4;  1WMH B;  3PRE A;  1LO5 D;  4XE0 A;  4XX5 A;  3SHQ A;  4AUQ C;  3AE2 B;  1OQQ A;  3TIX A;  1SSN A;  2JXT A;  2PLV 4;  2LVP A;  2XEW A;  2KWU B;  2ZNV B;  1P4R A;  1M9N A;  4ZHP A;  3G8Q A;  2LGD A;  1J0G A;  1V1O A;  1YX5 B;  2G84 A;  1GB4 A;  1GPX A;  3NRZ A;  2BYF A;  2CS4 A;  4XWT A;  4K81 A;  1JWM D;  3URY A;  5D2M B;  4KVG B;  4EE2 A;  4EZL A;  4DHJ B;  2RS1 4;  1WXA A;  4ANV A;  3W1Y A;  5L95 C;  5C3J B;  2PYJ A;  2RDH A;  4IDI A;  2LUM A;  1ZXI A;  3V3X A;  2NBU A;  3O65 B;  2Z8L A;  2X38 A;  2PZS A;  2IU3 A;  4OCN B;  3AEB B;  2W54 A;  1WKQ A;  2AL6 A;  1NCQ D;  4XYC A;  4LJP B;  3AE8 B;  4GDL B;  2LHD A;  5J17 A;  1CQV A;  3IAM 1;  1FNV A;  3RN9 C;  2HD5 B;  2NX8 A;  4LK0 M;  4RFB A;  1Q10 A;  2B3Z A;  4D10 F;  1NYQ A;  4OCL A;  1RHI 4;  2QCZ A;  1XD3 B;  4DHZ B;  3B1L X;  2UYZ B;  4KIT C;  2BKF A;  2B76 A;  3GQH A;  1FXA A;  1CMX B;  3N32 A;  1K50 A;  4WIG A;  1LXD A;  3K9O B;  2N0S B;  5G2N A;  4ICV A;  2DYO A;  3WCQ A;  2Z3J A;  3CSF A;  5DCN A;  1SB3 C;  1XCQ L;  3RFZ B;  2RMM A;  1R08 4;  1T0Y A;  1V81 A;  2KFK A;  2MJ3 A;  5M52 C;  3SFD A;  3EFC A;  2ACZ A;  4YXD B;  1AF2 A;  5C23 A;  2J7Q B;  5FK9 C;  2QIL A;  2NBW B;  4HJG E;  3BY4 B;  1YOV B;  3N9Y C;  4MSJ A;  2INC C;  2RR9 A;  2B3J A;  1JTK A;  2R07 4;  3AEC A;  4GSW A;  1YSB A;  2C7M B;  3V61 A;  1C77 A;  5EE0 A;  2R2Q A;  5IP4 D;  2PW9 A;  3DHH C;  3NVY A;  1FXT B;  2WXH A;  4BBN F;  3DHI C;  2FCQ A;  2WNM A;  3HRD D;  4GOC A;  1MG8 A;  4FXC A;  2D3A A;  1C1Y B;  3P4Q B;  1SE2 A;  3P1M A;  4WWP A;  2N1W A;  3VVW B;  1IPG A;  3EFU A;  3GB1 A;  1MHX A;  2KWV B;  3MC9 A;  3EUB 2;  4F1S A;  4HLE A;  1UGJ A;  4JE3 B;  1FO4 A;  2KJR A;  3VAW A;  3L08 A;  1V86 A;  4P16 A;  1UZX B;  1VQ2 A;  1NEN A;  2LD9 A;  2PVG C;  1NI2 A;  4P9D A;  3Q6B A;  4KDL B;  2D3C A;  4RGN A;  1UWZ A;  2VH2 A;  2NS5 A;  1V97 A;  4WIP A;  3RNE C;  1OGW A;  2KOX A;  2V3N A;  2N7D A;  1SEB D;  2Y5P A;  1WXV A;  2MP2 B;  4I6N B;  3M62 B;  1GOZ A;  3VH3 B;  3DQV A;  1D6E C;  2V4I B;  3Q3J A;  5KHO A;  2X8X X;  4EOY A;  4O8X A;  1HZ5 A;  4OHJ A;  4OWP A;  3BZD B;  4B9K A;  3V60 A;  1JAL A;  3AE1 A;  3QJZ A;  1J7A A;  5DPW A;  2KTR B;  1LQB A;  3QAQ A;  4WQO B;  2RD0 A;  2KQ7 A;  1HEZ E;  5JHA A;  3K9P B;  3LB8 C;  1TZO A;  1OFF A;  4YTN A;  3BII D;  3AE7 B;  1TS5 A;  3KYC D;  2RS5 4;  2GMI C;  1E6E B;  1E8W A;  1RUG 4;  1XEE A;  3R3M A;  1PYW D;  4AOF A;  3ALB A;  4GB9 A;  1TZ1 A;  5D94 A;  3SFE B;  1L6U A;  2KWC A;  2FCN A;  4IWQ A;  1TS4 A;  4MM3 A;  1I4H A;  1WM2 A;  1V1P B;  1WH3 A;  2BWF A;  2Q5W D;  3Q3F A;  1AYF A;  2KLG A;  4K7S A;  4B0M A;  3UGB B;  1RRB A;  2KN5 A;  5G5H A;  3AE5 A;  3PSE B;  2QSD A;  4N59 A;  4A1O A;  2BQQ A;  1SJE D;  4EZJ A;  3LJ3 A;  5IA7 A;  2KC2 A;  1WJ6 A;  2JRH A;  3IHP C;  1WGY A;  3BIN A;  4MGY E;  1CZP A;  4AQ7 A;  4KIK B;  1E8Z A;  2PVO D;  1IBX B;  1FMA D;  3AUL A;  3DPD A;  2M19 A;  4M00 A;  5BYS A;  1BUI C;  2FID A;  2ZVO A;  3OCQ A;  3TL5 A;  2HWC 4;  1R4N I;  1YX6 B;  3HIZ A;  3U4E G;  1VZ6 A;  5CW6 A;  3L16 A;  3KQ4 A;  2I1J A;  2BKR B;  4IUM B;  4JL9 A;  3ZXV A;  3RZU A;  3KH0 A;  2BS3 B;  3VR9 A;  1WM3 A;  3AM9 A;  1AAR A;  1R4M B;  2KDB A;  1TBE A;  3ZPG A;  4DHZ E;  1MFW A;  2PMV A;  2JSV X;  3WAN A;  2FE8 A;  3QCA A;  3FKY A;  2WYQ A;  2HVV A;  2LRW A;  2HXV A;  5TR5 A;  1WJN A;  3V62 A;  2J53 A;  2R61 A;  3DCG A;  5IAA C;  2UWQ A;  3PLU A;  4NNJ B;  3TEY A;  1N60 A;  2MX2 A;  1ZP0 B;  4DXF A;  3DOW A;  4HK2 A;  1HTQ A;  3ZPC A;  2MBQ A;  2V9H A;  1FD6 A;  1IGC A;  4CO7 A;  3DBL B;  4OZB A;  3T8M A;  4ZRP A;  1WI0 A;  3AE9 A;  4J6E A;  2RGF A;  3ZUN A;  3P4P B;  2ZPY A;  1SIJ A;  2MRP A;  1I35 A;  3R7R A;  3NG0 A;  2P87 A;  2JT4 B;  3JVZ X;  2R04 4;  3PRM B;  4OW0 A;  2N7E A;  3KVF B;  4CYE A;  3MP9 A;  4AWJ A;  4LCP A;  2FR5 A;  2O95 A;  3DHG C;  4AJY B;  4C4V B;  1V5O A;  2V3S A;  2DZK A;  4A55 A;  2WP9 A;  2NTT A;  1TKE A;  2RS3 4;  2O2V A;  2KX3 A;  4E0Q A;  4D2K A;  4I6P A;  3A1Q A;  3IVF A;  2YVC A;  3PZ7 A;  1F2R I;  3B8F A;  1TY2 A;  2WDQ A;  4M0W B;  1E8Y A;  1L0V B;  2IY0 B;  5HKH A;  2N9L A;  4MSQ B;  5I4D A;  4FA6 A;  4NJC A;  4NAW A;  1E90 A;  1H8C A;  3VUY A;  4GGM X;  2H89 A;  1S3S G;  2XN9 C;  2RMU 4;  2KD0 A;  1MQT D;  3ABV A;  1GUA B;  3W2D A;  4IWP A;  1P1A A;  4FLH A;  1UBI A;  4YTM A;  2RR1 4;  3AEF B;  2YEP B;  1YN3 A;  5AUI A;  1F1H A;  3VR8 A;  3R2I A;  1QOB A;  1T5X D;  2N9E B;  3A4S C;  1XO3 A;  4S0R A;  1LFD A;  2J42 A;  3PTF C;  4P7I A;  4BFR A;  2GRI A;  2AEH A;  2A5U A;  1PGX A;  2QC8 A;  4DQO C;  3W1S C;  2O96 A;  3WIM A;  1SF0 A;  1YN5 A;  1VD2 A;  1J7C A;  3Q3N C;  3B9J A;  2KTF A;  4NQL B;  5CHV C;  3AE6 A;  3AEG B;  3AE4 A;  2KAN A;  4US9 A;  2N9P C;  1BXT A;  1UF0 A;  4DWF A;  3NZ3 A;  2BTE A;  4Q4W 4;  4KV2 A;  2HJ1 A;  2M8S A;  1WY8 A;  2K0P A;  3UIO B;  1TT5 B;  1HQR D;  1D4B A;  4YTP A;  2GBK A;  2G6V A;  1R4N B;  3I63 C;  2ZZP B;  1OEY A;  1RFA A;  2DYM A;  2MBE A;  1PIV 4;  5AZH A;  1YJI A;  2CU3 A;  3N1Z C;  4JLC A;  1K53 A;  4HRW A;  3N1X C;  1T0Q C;  2M17 A;  5J18 A;  2H88 B;  2BYV E;  4W9I A;  3RZV A;  5FKA C;  2K9X A;  3SU8 X;  1P98 A;  1VBA 4;  3TEZ A;  2W9N A;  2UU7 A;  3RCZ A;  4PS8 A;  3KUZ A;  2E3T A;  2AYO B;  1HRV 4;  5JZE B;  4XDD A;  1HTO A;  4B0E A;  4BAX A;  1N63 A;  1D5X C;  2KC1 A;  4TKN A;  4YSX A;  2KQ4 X;  3NY5 A;  2ZCB A;  4NZL B;  1QLB B;  2DHZ A;  4AS1 A;  3IXS A;  2MJD A;  1WYW B;  4YL8 A;  2WQY A;  2B1I A;  1QQR A;  2KMC A;  2C60 A;  3ZXR A;  3L0W B;  5BMI A;  4TQ0 A;  2K8H A;  5EE9 A;  1F0Z A;  3IBE A;  3SBG A;  1KLG D;  3QHT A;  4LNN A;  2A4Z A;  1VJK A;  2NPT A;  4MAC A;  3FC4 A;  3GP7 A;  1AL2 4;  3TEW A;  1E7U A;  4LJO B;  2ZJD A;  4M8M A;  1UBQ A;  2WXF A;  3NVV A;  2LHE A;  3ZIM A;  1KLV A;  4NJ6 A;  1THZ A;  4W9D A;  2RPQ A;  4OCL B;  2ONQ A;  3P63 A;  2LEK A;  2L00 B;  2JXX A;  4LCD E;  4ZYS A;  3JW0 X;  5IN7 A;  4LDT D;  4RH6 A;  1MHH E;  5HG2 A;  4ZOH C;  4BKT A;  3W9C B;  1U4A A;  4GXB A;  2MHJ A;  3IAS 1;  1GAQ B;  2L52 A;  4A9A A;  4EZK A;  1V2Y A;  2IY1 B;  1TYG B;  1EU4 A;  3HVZ A;  1KJT A;  2PY5 A;  1PUT A;  4WQM A;  1V49 A;  4LNI A;  3KUD B;  2DEN B;  3SFD B;  1D5M C;  3KLS X;  4KX6 A;  1IUE A;  2E6X A;  3LYY A;  1C78 A;  1T6B X;  1Z5S B;  1ZCZ A;  2IO0 B;  1F2R C;  1ZOY A;  3Q3O C;  4DBG A;  1KRH A;  1D4M 4;  1KFY A;  4YSY A;  4DDI D;  4C56 C;  1C76 A;  3AE3 A;  2JX5 A;  1JWU D;  3IT6 B;  4W9C A;  3PS6 A;  4FAD A;  2J52 A;  4HPP A;  1QZE A;  3UF8 A;  3JBG 4;  2LXC A;  4K7W A;  4AJW A;  2PKO A;  4HRS A;  1Y8R C;  3DH1 A;  2BYT A;  1ZGU B;  2PEA A;  3CIR A;  4I6L B;  1WRD B;  1TS2 A;  2MQJ A;  3PRP B;  4ZHO A;  4JPS A;  2W4L A;  1RUJ 4;  1VBD 4;  4ZDV A;  3LDZ E;  3SUC A;  1NI3 A;  2ZNV C;  2MBB B;  2L76 A;  3NOB A;  2LUE A;  3A9K A;  1PKX A;  1YQ3 A;  2LMC A;  2D11 A;  3Q8F A;  2JZZ A;  4HJK A;  2L83 A;  3ZNI D;  1I4X A;  2XBB C;  3PZD A;  3OJ3 A;  1NEK A;  2Y5C A;  2O7P A;  3EX8 A;  1T0S C;  3P4R B;  5GXG B;  1JWS D;  2K5P A;  4XGA B;  1RM6 C;  3PHX B;  2HTM E;  4WWN A;  4CQN A;  1FRR A;  3TEX A;  2WS3 A;  4O8Y A;  4KGS A;  1PGA A;  4Q2J A;  2KN4 A;  1F9J A;  3RI7 C;  1EO6 A;  4O1N A;  4YSZ A;  1HRI 4;  3OLM D;  4OWP B;  3TUO A;  2XK5 A;  1KTK A;  1EF5 A;  2IU0 A;  1R5X A;  1RAX A;  2QLC A;  2KZR A;  3U30 A;  4P9C A;  3NJT A;  1E10 A;  4JX1 C;  1QOA A;  2IGH A;  1P6O A;  3ZEF B;  4CHK A;  3RZW C;  1WMH A;  4JGH B;  3L13 A;  3AE2 A;  1A70 A;  2IYD B;  2GBM A;  3APD A;  3M63 B;  4LTU A;  4OCM B;  2LGS A;  2WXL A;  1SXT A;  1IYF A;  5G5G A;  1A5R A;  2WLB A;  4ZD4 A;  1XXG A;  3AH7 A;  2WXR A;  3J9C A;  2FR6 A;  2LGI A;  1N6Z A;  1WWT A;  2WXJ A;  1KLU D;  4MM3 B;  1L5P A;  2MEK A;  4GDK A;  1MPE A;  1N62 A;  3PHW B;  1PL0 A;  1F52 A;  4LNO A;  1QF6 A;  4GIV A;  5C3J A;  1OTR B;  1XLP A;  2CHW A;  2WGS A;  1FFV A;  2LRU A;  4OCN A;  3AV8 A;  3ZJU A;  3VRA B;  3AEB A;  4JWS C;  2QHO A;  2GBJ A;  3KWV A;  2DAJ A;  2KVZ A;  4TQ1 A;  4GDL A;  3VUW A;  3AE8 A;  3M3J A;  2G4D B;  4J6I A;  4ZRQ A;  4DHJ D;  3NZS A;  2K6D B;  2MCN B;  1TJE A;  1PO1 4;  2JF5 A;  2JRI B;  2VH1 A;  1P9D U;  2O6V B;  3WAM A;  2K25 A;  3PRZ A;  3GOE A;  3Q3M C;  2Y5B B;  2JU6 X;  5HI1 A;  4JIO U;  4MEL A;  2KQS A;  1WIA A;  2EKE C;  3P2B A;  1VZ7 A;  1PQS A;  1SGH A;  1WGH A;  2VZK B;  3KUC B;  1PGB A;  1WJU A;  5C2T B;  3V6E B;  4EUT A;  2IO2 B;  4FHK A;  1R7S A;  4YXD A;  2JY6 A;  3QA8 A;  1SIF A;  4EFO A;  1YSD A;  4E71 A;  1VZ8 A;  1ZDX A;  4RF1 A;  2PIA A;  5JH5 C;  3GS2 A;  2BB6 A;  3U2S C;  1UEL A;  4NAM A;  3RZF A;  4NPN A;  1VLB A;  2ZEQ A;  3I9V 1;  4KDI C;  3A33 B;  2IO1 B;  4PQT A;  4M8N A;  1P7F A;  1B9R A;  4IG7 B;  2GOW A;  2NYT A;  3Q8C A;  4M01 A;  2ZW0 A;  2ICI A;  4EG2 A;  3H7P B;  3NUH B;  3P4Q A;  3Q8E A;  2JUO A;  3ZNZ B;  4ASW C;  1K5M D;  1YN4 A;  4HCP B;  3H6N A;  1WRI A;  2Z59 B;  2KO3 A;  1KOT A;  1L7Y A;  1X1M A;  4XZ4 A;  3J8F 4;  1WFY A;  5D3I B;  2KMM A;  1QIL A;  3JYU A;  4B6W A;  3SR6 A;  1ZXH A;  2C7N B;  5CHF A;  4I43 B;  1V6E A;  3U7Z A;  1UD7 A;  2W55 A;  3ZVV A;  2WDV A;  4IOI E;  3B2F A;  3BVG A;  3OG5 A;  2WDQ B;  2D30 A;  4Q4V 4;  4MDK E;  3NVZ A;  4MGZ E;  2FCS A;  4HKQ A;  2MP2 A;  2K39 A;  4BOZ B;  2LZ6 A;  1KM7 A;  2MSE D;  2BS2 B;  3NVW A;  2JVC A;  2LI5 A;  4HVB A;  1YIW A;  2WX0 A;  2D5G A;  4YTM B;  2ZCC A;  4HKZ E;  4IC7 B;  3HUI A;  3ZKJ C;  2KTR A;  1XCT L;  3VRB B;  1VBB 4;  4WWM A;  5H8Y E;  4R3D A;  3FIL A;  3H7S A;  3W5V B;  1P3Q U;  1ZKH A;  2KCQ A;  2OJW A;  3AE7 A;  2C9W B;  2WX1 A;  2HVW A;  1K51 A;  2L7R A;  2KJ6 A;  4ILG C;  2KDI A;  1F77 A;  3AEA B;  4ZRI A;  1C4A A;  4KKI A;  2KJH B;  2AL3 A;  2M4N A;  1RUH 4;  2RPZ A;  2C5L C;  4PYZ A;  3BYT B;  3UQB A;  1T3Q A;  2J4X A;  2RPV A;  3SFE A;  2R7F A;  1MG4 A;  2KNB A;  3AE4 B;  2NTS A;  3FI7 A;  2CU1 A;  2N4F A;  3T9L A;  1WGK A;  5T8I A;  4YWG G;  3RYT A;  3TMP B;  1MVK A;  1ZW7 A;  3VH4 B;  2V1Y A;  4XWW A;  3FAH A;  2OED A;  4YTP B;  1V1P A;  3UIN B;  1J19 A;  3L10 B;  5H92 C;  2M0A A;  3VX8 A;  2WU2 B;  1E9M A;  4DXG A;  4HWI B;  1E0Z A;  2MH7 A;  1GC6 A;  4W9L A;  4WJP A;  4RGO S;  2K8C A;  5CTR C;  2WDT B;  3AI5 A;  1I42 A;  4GB3 4;  3ONS A;  1MI0 A;  2QIE B;  4QFT A;  2G9H D;  2EEL A;  1Z3A A;  3Q8A A;  2CJO A;  1IBX A;  4A90 A;  3AED B;  3A4R A;  5AUK A;  2TSS A;  1RUE 4;  2EMT A;  4MSD A;  2BW2 A;  2BPS A;  2WXI A;  1COV 4;  2CHZ A;  1RUI 4;  3MHZ A;  1P7E A;  2MLB A;  2Z0E B;  3EGR A;  2GB1 A;  1WSP A;  2JYT A;  1DGJ A;  4RCO A;  4USA A;  1RWS A;  3H8H A;  4FUL A;  3OWE B;  4URK A;  1C4C A;  2SEB D;  2W3R A;  1BEV 4;  3MFG A;  4OVU A;  1JML A;  1SJH D;  1EF1 A;  2KHW B;  1TTN A;  3MJ5 A;  4P1B C;  5HHD G;  2WXK A;  1J8C A;  1FCC C;  2DAF A;  3EA6 A;  1TIF A;  1JW9 D;  4LD2 A;  2PLP A;  1MQ0 A;  1ZP0 A;  3DMO A;  3JSV A;  2WU5 B;  2D3G A;  3QAR A;  2GLS A;  3P4P A;  2M0X A;  5E6N A;  2NVU I;  3TJP A;  2AQ1 B;  1AR9 4;  4FJZ A;  4MSM B;  3TBL D;  1TKY A;  1XLN A;  4ANU A;  2FCM A;  3AEE A;  4NQK E;  1V8C A;  1XHZ A;  4IW0 A;  1NBF C;  2MJE A;  3ZTC A;  1WXQ A;  2FBW B;  1IP9 A;  2K6Q A;  2G1E A;  1XQQ A;  1C9F A;  2LGY A;  4C4V A;  1WJ4 A;  4US8 A;  1H4R A;  1CK1 A;  4K1R B;  3BVZ A;  1HXY D;  4E74 A;  3AU5 A;  2AX5 A;  1WE7 A;  4F8C B;  3W1S A;  2JPH A;  2LVQ A;  3RNF C;  1RB7 A;  1E5W A;  1L0V A;  2D3B A;  4TV3 A;  3NS1 A;  1PO2 4;  4KZ0 A;  4W9G A;  4MSQ A;  2EX3 A;  3CWI A;  2W82 A;  1Z2M A;  4JQW C;  3ZYY X;  2CJN A;  4OVV A;  1V9J A;  1XHX A;  2AWT A;  2KFJ A;  1K52 A;  1VK9 A;  5BYQ A;  4G0N B;  3HVD A;  2DYB A;  1STE A;  2G3Q B;  3QC8 B;  2JZP A;  4ICU A;  1FNW A;  4LCN A;  4GU2 A;  3AEF A;  2QMT A;  1OOP D;  4P9E A;  3VHT C;  2D07 B;  5JHB A;  2OG4 A;  2IZV B;  1EAH 4;  1FEH A;  3TSS A;  4FBJ B;  3OJ6 A;  4FJV B;  2YEP F;  1PFD A;  1C79 A;  2INP E;  3TCA A;  2JQR B;  1KF6 A;  3AN1 A;  1RVF 4;  4MH0 E;  1Q0W B;  2L3Z A;  4TSS A;  3A9K B;  1QKZ A;  1PVC 4;  3BVM A;  3AEG A;  4HPM B;  1WGG A;  5DPT A;  2OJR A;  2JWU A;  3MC0 B;  4YT0 A;  3ZDT A;  2WHI A;  2WXN A;  1LGR A;  2B76 B;  2ZW1 A;  4A3P A;  1SE4 A;  2FUH B;  4MJS A;  1L4Z B;  4QAY A;  4LNF A;  2B3A A;  2PE9 A;  1NA1 D;  2WS3 B;  2KKS A;  1ROE A;  2YLM A;  5IO9 A;  4PDW D;  1T0R C;  1WYG A;  5BO4 B;  4A8X C;  2I38 A;  1GG3 A;  2KFK B;  2K8B A;  1WXM A;  2XK5 B;  1ASJ 4;  2IGG A;  2H88 A;  2ACZ B;  3Q69 A;  2IBI B;  4HDO A;  3ML8 A;  1WR1 A;  2QJL A;  5C1Z A;  3BK1 A;  1FNU A;  4G3X B;  4W9E A;  1QT9 A;  1FIQ A;  2DWQ A;  1UX0 A;  5BYR A;  3PV1 A;  4XDC A;  2OHF A;  2RDB C;  3E56 A;  3AEC B;  5DCA J;  1ZUD 2;  4Q4Y 4;  1C4P A;  4H2A A;  5HFY A;  3PPA A;  2ZNR A;  4IM2 A;  1UWM A;  4RM8 A;  2INN E;  4HEA 1;  1ENF A;  2KLC A;  1WX7 A;  1I4R A;  4EHI A;  2N1V A;  2JWZ A;  1BT0 A;  2BBC A;  4A6Q A;  1VCB A;  4BKS A;  3OAW A;  1WX8 A;  4W9J A;  4GDK B;  3QK0 A;  5AZF A;  3B2G A;  4ZRJ A;  3GQK A;  3RUL A;  2FAZ A;  2EKI A;  2KDE B;  4OZA A;  3ZZM A;  1RUD 4;  1NEN B;  3ETR A;  3QIJ A;  4ZD5 A;  5LXH A;  1JWA D;  3RUI B;  4BBN C;  2KKC A;  3RNB C;  3ZJT A;  1WN6 A;  1NDD A;  4F7O A;  3VXW A;  4BKS D;  1L0X B;  3Q2A C;  1WR6 E;  4GMV A;  3GZN I;  2WDR A;  3P4S A;  2L32 A;  3A9J A;  2CKH B;  2M56 B;  4BKG A;  4WAA A;  1CTT A;  4O8X B;  2FIF A;  4KGT A;  1QOF A;  3AE1 B;  1RMU 4;  3LXF A;  2CR5 A;  4G50 A;  2ZPN A;  3ZW3 A;  1AW7 A;  1DOY A;  4ZYN A;  3VDZ A;  2KT7 A;  1YQ4 A;  4YTN B;  4F3W A;  4HXD A;  2N9K A;  3N3K B;  5JXV A;  2N7J A;  5DPS A;  3T3O A;  4ACF A;  4BGD C;  4N9F 4;  5CX3 A;  3O13 A;  3H1U A;  1HZ6 A;  4GGQ A;  3ZLZ A;  4W9F A;  2Z3I A;  3APC A;  5L83 A;  4RNA A;  2ZNV A;  5GMV A;  1SBB B;  4PT5 A;  1XLQ A;  2J0M A;  3BYY B;  4LD4 A;  2BT6 A;  2NR2 A;  3PLV A;  3JD7 4;  1K8R B;  5BMH A;  4N6E B;  1UWX A;  4IM3 A;  3CF6 E;  3IT4 B;  1R4M I;  1RYJ A;  1TS3 A;  3WA0 A;  4II3 B;  3AE5 B;  2OOB B;  4EEW A;  2JYE A;  4WUR A;  2NCN A;  5EE1 A;  4ANX A;  1NVI D;  5CHW A;  2DLB A;  1YJJ A;  4XC2 A;  4BVU C;  2WXG A;  5IOI A;  1QOG A;  4HDQ A;  4WWO A;  2AQ2 B;  4MH8 A;  1UUP A;  4BZA A;  1WGR A;  2Y3A A;  3ZNH B;  2HE7 A;  4FHJ A;  2FUG 1;  1RFK A;  3DBL I;  2WXP A;  2D5N A;  3N20 C;  2ASQ A;  2BYE A;  2VRR B;  2KMA A;  2LJ5 A;  3WAP A;  4W9K A;  2WDV B;  3OJ4 B;  3ZTD A;  1E7P B;  1KH0 A;  1EWC A;  1M4V A;  1EUV B;  2DZM A;  4RF0 A;  4JXE A;  3P4R A;  1AR6 4;  3ZDM C;  1SE3 A;  3VR9 B;  1DYQ A;  2JZ3 B;  4RMA A;  3SD5 A;  1SE9 A;  1Q5W B;  2WXM A;  5M59 B;  1POV 0;  3RMK C;  3AMZ A;  3ZGZ A;  4DK5 A;  3MPZ A;  1HA5 A;  2B1G A;  4NY0 A;  4P6V F;  4X57 B;  1C3T A;  1I4G A;  4GLS C;  2KAC A;  3IJF X;  2CHX A;  2LJI A;  2P8R A;  1NYR A;  4RGM A;  3FIL B;  3R2N A;  1VRA B;  5MPO A;  3N1Y C;  3IFW B;  2FNJ B;  2LVO A;  2W3S A;  3UI3 A;  2BS4 B;  3WAL A;  3DBS A;  3ECI A;  1GNU A;  3B0A A;  3AE9 B;  3R2T A;  1XT9 B;  4OCM A;  4FJY A;  1I4Q A;  4M02 A;  5D7G A;  3DBH I;  3T3N A;  2QDF A;  3I5J C;  1HE8 A;  2I1K A;  1JWB D;  2GI9 A;  3EC8 A;  1VDV A;  5E6O A;  1YMH E;  1N61 A;  2KDF B;  3GZN B;  2QEJ C;  3RNA C;  1ESF A;  2WWZ A;  4RM9 A;  3KW5 B;  1V80 A;  1Y56 A;  1G8M A;  3VTU A;  1TKG A;  2KXJ A;  1EWY C;  2IJ0 A;  3AB5 A;  4ANW A;  2WP9 B;  2V3P A;  2MBH A;  2O2V B;  3VRA A;  3ZO5 B;  2KDM A;  1UX1 A;  2BVC A;  1DOI A;  2LWP A;  3QX1 A;  3A1Q B;  1ACC A;  4RHV 4;  1RLF A;  4ZFR A;  4HRO A;  2DX5 B;  1AN8 A;  3RT3 B;  3PVL A;  4WJO A;  3IG3 A;  5J2R A;  1RUC 4;  2L05 A;  4MT5 A;  4NAW B;  2EMS A;  2H89 B;  4PK1 A;  3U8Z A;  3C19 A;  2DBY A;  4S17 A;  2O6V A;  3ABV B;  3KWL A;  1ZAB A;  2NMQ A;  4G11 A;  3PT2 B;  1FXI A;  3VR8 B;  3DVG Y;  1N5X A;  3L4P A;  3DWG C;  5AEK B;  4LC5 A;  4J3O D;  4ZRK A;  1TY0 A;  2PJH A;  3V05 A;  4N58 A;  1ET9 A;  1D5Z C;  3KYD D;  2R2O A;  4ZFT A;  2REX A;  5C2T A;  3VUX A;  5LLI A;  1OX7 A;  1CJE A;  1ALN A;  3L54 A;  1VR9 A;  1YD8 U;  2O6V D;  3SDL C;  1R5T A;  4C80 A;  1WZ3 A;  3Q14 C;  3AE6 B;  4K7U A;  1AR8 4;  2Z3G A;  1FM0 D;  3JSV B;  3MC8 A;  4KZC A;  4NJ7 A;  4C7Z A;  4KGR A;  3B08 A;  3ZRC A;  1UGM A;  5G55 A;  4L23 A;  2VZK D;  4IWO A;  1FCL A;  3VTW A;  2RDG A;  4K3C A;  2LFI A;  2AQ3 B;  2N9X A;  3QQ8 B;  3MTN B;  4AP4 C;  4JWU C;  3AEE B;  4A20 A;  1N5W A;  3H7P A;  1L2N A;  3HM6 X;  2RSU A;  2SAK A;  1B1Z A;  1M94 A;  1FFU A;  2PYL A;  4A3O A;  4G3M A;  2IND C;  3HHM A;  4TMA B;  2DZJ A;  5D3D A;  3P42 A;  1WXS A;  3CMM B;  5EE3 A;  1WZ0 A;  4C7Y A;  4KIK A;  1OI0 A;  3DBR I;  1S1Q B;  2GBN A;  1HXS 4;  4E3C A;  5LXI B;  2HTH A;  5FR3 A;  2L0T A;  5EDS A;  4DDG D;  5BMG A;  1H8T D;  2KAJ A;  2GBR A;  1XI1 A;  3AU4 A;  3ML9 A;  3S2A A;  4ARI A;  2BF8 B;  4YSX B;  1WWR A;  4FN2 A;  2BGF A;  1WN5 A;  1FPY A;  5IKC M;  2K3U A;  3HK0 A;  1YNT E;  2DNF A;  2V0G A;  2WQY B;  5D6J B;  2HDE A;  3ZQ4 A;  3X0W A;  1E8X A;  4PS3 A;  1WGD A;  1I7H A;  3APF A;  3DBH B;  3DDC B;  1LM8 B;  1L0Y B;  3R66 C;  4LLG M;  1TGZ B;  2Z0D B;  1V5T A;  3DVN U;  1WX9 A;  4C00 A;  3DVG X;  4BOS C;  2NPT B;  2V4L A;  2PE6 B;  3VRB A;  2C7H A;  2RM2 4;  2WXQ A;  3U52 E;  1L6V A;  4WAF A;  4LDT B;  3MJW A;  3RPF C;  2HWB 4;  1ISN A;  4MGI E;  2Z3H A;  2HJ8 A;  5TSS A;  4P1C C;  3EEC A;  3AEA A;  1KF6 B;  3NZU A;  1FRD A;  1ZDV A;  2IDY A;  3H9D A;  1GC7 A;  3VQI A;  2L0F A;  1AR7 4;  2R06 4;  4W9H A;  2PPH A;  2XNA C;  4YT0 B;  4B95 A;  1PDX A;  5DPR A;  1Z7S 4;  5E6J A;  5FR6 A;  1UNS A;  4MJS B;  1UAQ A;  1CTU A;  1ZE3 D;  4WJN A;  2LGX A;  2ZVN A;  1ET6 A;  4L1B A;  4WJQ A;  2WU2 A;  1JCK B;  3EHV A;  4II2 B;  2DZI A; 
#chains in the Genus database with same CATH homology
 1TJE A;  2BBC A;  4A6Q A;  4DXF A;  1EU3 A;  3ZPC A;  1FD6 A;  1IGC A;  4GDK B;  4KX6 B;  4OZB A;  4ARC A;  4ZRP A;  2IGD A;  3B2G A;  3E9S A;  4M0W A;  2JU6 X;  3C8Y A;  4HRQ A;  3P4P B;  2EKI A;  3I57 A;  2L1A A;  1SIJ A;  4OZA A;  2I2Y A;  5HI1 A;  1ZOY B;  1NEN B;  3BWU D;  3ETR A;  1JRO A;  1VZ7 A;  4OZC A;  4IKG A;  1KFY B;  4ZD5 A;  2P87 A;  4YSY B;  1JWA D;  1XF5 L;  3AE3 B;  2VZK B;  4OW0 A;  3ZJT A;  1PGB A;  5C2T B;  1WN6 A;  5LNK 1;  4F7O A;  3PO0 A;  1L0X B;  3MP9 A;  1R7S A;  2KWD A;  1AWD A;  1YSD A;  4LCP A;  2FR5 A;  2O95 A;  1VZ8 A;  1XLO A;  1ZDX A;  2L32 A;  4KKJ A;  2WXO A;  1L4D B;  1IGD A;  4RF1 A;  4A55 A;  2O3K A;  2NTT A;  2PIA A;  3CIR B;  1TKE A;  4ITK A;  3GS2 A;  2BB6 A;  3U2S C;  1GB1 A;  4E0Q A;  2M56 B;  4D2K A;  2BB5 A;  4NAM A;  1CTT A;  1OQR A;  1VLB A;  3I9V 1;  4O8X B;  3PZ7 A;  1F2R I;  3B8F A;  4KGT A;  1TY2 A;  3R8B A;  1QOF A;  3ZJV A;  3AE1 B;  4UDU C;  4PQT A;  1L0V B;  1P7F A;  2N9L A;  3LXF A;  5I4D A;  1B9R A;  3DWM A;  4RGT A;  1AW7 A;  1ZPS A;  3Q8C A;  2NYT A;  1YQ3 B;  1DOY A;  3SEB A;  4NQL A;  4NJC A;  2OBC A;  2ZW0 A;  2ICI A;  4EG2 A;  4YTN B;  4MS7 A;  2PTL A;  4F3W A;  3NUH B;  2N9K A;  2XN9 C;  3Q8E A;  5JXV A;  3E1U A;  2N7J A;  1NEK B;  1YN4 A;  3T3O A;  4BGD C;  5GAO A;  3PZ8 A;  3W2D A;  2ON8 A;  3O13 A;  1HZ6 A;  1WRI A;  3AEF B;  2YEP B;  1YN3 A;  1TIY A;  2WDR B;  5AUI A;  1BML C;  3P4S B;  2A8N A;  3R2I A;  1QOB A;  1T5X D;  2Z3I A;  4RNA A;  5D3I B;  2KMM A;  3W5U B;  1JQ4 A;  2ZNV A;  1SBB B;  1QIL A;  1XO3 A;  4PT5 A;  4MSM A;  1XLQ A;  4O8Y B;  3BYY B;  2J42 A;  4LD4 A;  4L2Y A;  1ZXH A;  3SR6 A;  3Q8B A;  2BT6 A;  4LCO A;  2GRI A;  4I43 B;  3U7Z A;  5BMH A;  4N6E B;  2W55 A;  4YSZ B;  4WIF A;  1UWX A;  1PGX A;  4IOI E;  4DQO C;  3IT4 B;  3B2F A;  3BVG A;  1J7B A;  2O96 A;  2WDQ B;  1SF0 A;  1RYJ A;  1YN5 A;  1TS3 A;  1DOX A;  2D30 A;  2IPK D;  5C2O A;  2K22 A;  3NVZ A;  1J7C A;  1I4P A;  3AE5 B;  2JYE A;  4WUR A;  3B9J A;  4OVZ A;  4WH4 A;  4HKQ A;  5EE1 A;  3BK2 A;  4REZ A;  3AEG B;  1JRP A;  1NVI D;  1YQ4 B;  4K1R A;  2DLB A;  1EM7 A;  4US9 A;  1YJJ A;  1BXT A;  2WXG A;  1LO5 D;  3NZ3 A;  4XE0 A;  2BTE A;  2BS2 B;  3AE2 B;  1OQQ A;  1QOG A;  3NVW A;  2K0P A;  1SSN A;  2JXT A;  2D5G A;  1HQR D;  4YTM B;  1D4B A;  2AQ2 B;  2G6V A;  4HKZ E;  4MH8 A;  1UUP A;  3HUI A;  2DYM A;  2Y3A A;  1XCT L;  3VRB B;  4ZHP A;  1YJI A;  2FUG 1;  4WWM A;  4R3D A;  3FIL A;  1RFK A;  2CU3 A;  1V1O A;  5H8Y E;  2WXP A;  3W5V B;  2D5N A;  2G84 A;  1GB4 A;  1GPX A;  3NRZ A;  2KCQ A;  1K53 A;  4XWT A;  4HRW A;  1JWM D;  3URY A;  2HVW A;  1K51 A;  2WDV B;  4ILG C;  4EE2 A;  1E7P B;  1KH0 A;  1F77 A;  3AEA B;  1EWC A;  2H88 B;  1M4V A;  1C4A A;  4KKI A;  4JXE A;  4RF0 A;  2PYJ A;  5C3J B;  3RZV A;  5FKA C;  2K9X A;  2RDH A;  4IDI A;  1SE3 A;  3VR9 B;  1DYQ A;  2LUM A;  2RPZ A;  3BYT B;  3TEZ A;  1ZXI A;  3V3X A;  2Z8L A;  1T3Q A;  2J4X A;  2WXM A;  2X38 A;  5M59 B;  2RPV A;  2PZS A;  2R7F A;  3AE4 B;  4OCN B;  2NTS A;  3FI7 A;  3AEB B;  1WGK A;  2W54 A;  2E3T A;  4YWG G;  5T8I A;  3AMZ A;  1WKQ A;  3ZGZ A;  4XDD A;  1MVK A;  3AE8 B;  4GDL B;  2LHD A;  3MPZ A;  1CQV A;  3IAM 1;  1HA5 A;  4B0E A;  4XWW A;  1FNV A;  3FAH A;  4P6V F;  2OED A;  2NX8 A;  4LK0 M;  4RFB A;  1V1P A;  1I4G A;  1N63 A;  1D5X C;  1Q10 A;  4GLS C;  4YTP B;  2KAC A;  2B3Z A;  2KQ4 X;  5H92 C;  3IJF X;  2M0A A;  4NZL B;  2LJI A;  4D10 F;  1NYQ A;  1QLB B;  2WU2 B;  1E9M A;  4AS1 A;  2P8R A;  4OCL A;  1NYR A;  3IXS A;  4RGM A;  4DXG A;  1E0Z A;  3FIL B;  3R2N A;  2MH7 A;  2MJD A;  1VRA B;  5MPO A;  4RGO S;  1QQR A;  2W3S A;  3UI3 A;  2BS4 B;  5BMI A;  4TQ0 A;  5EE9 A;  1F0Z A;  4KIT C;  1FXA A;  3SBG A;  1K50 A;  1KLG D;  4WIG A;  3AE9 B;  2N0S B;  1MI0 A;  3R2T A;  2QIE B;  4QFT A;  2DYO A;  2G9H D;  3WCQ A;  2Z3J A;  1I4Q A;  2EEL A;  1Z3A A;  4OCM A;  1VJK A;  3Q8A A;  2CJO A;  1SB3 C;  1XCQ L;  1IBX A;  4A90 A;  4MAC A;  5D7G A;  3AED B;  3FC4 A;  5AUK A;  3T3N A;  2TSS A;  3GP7 A;  3RFZ B;  2RMM A;  1JWB D;  2GI9 A;  3TEW A;  1VDV A;  1YMH E;  1N61 A;  4MSD A;  2BW2 A;  2WXI A;  2QEJ C;  2WXF A;  3NVV A;  2MJ3 A;  1ESF A;  5M52 C;  2LHE A;  4YXD B;  3MHZ A;  1AF2 A;  1P7E A;  1Y56 A;  1TKG A;  5FK9 C;  4OCL B;  2QIL A;  4HJG E;  1EWY C;  2IJ0 A;  2ONQ A;  3AB5 A;  3EGR A;  3P63 A;  2LEK A;  3N9Y C;  4MSJ A;  2GB1 A;  1WSP A;  2JYT A;  1DGJ A;  2V3P A;  2WP9 B;  4RCO A;  4USA A;  1RWS A;  3H8H A;  2B3J A;  1JTK A;  3OWE B;  4ZYS A;  2KDM A;  1C4C A;  1UX1 A;  1DOI A;  1ACC A;  4RH6 A;  1MHH E;  1YSB A;  2SEB D;  2W3R A;  4ZFR A;  3MFG A;  5HG2 A;  1C77 A;  4HRO A;  4ZOH C;  1AN8 A;  1JML A;  5EE0 A;  1SJH D;  3W9C B;  3MJ5 A;  5HHD G;  2PW9 A;  2WXK A;  3IAS 1;  1FCC C;  2WXH A;  3NVY A;  1GAQ B;  2L52 A;  3EA6 A;  4A9A A;  2WNM A;  3HRD D;  1JW9 D;  4MT5 A;  4FXC A;  4NAW B;  4LD2 A;  2PLP A;  1TYG B;  1MQ0 A;  2H89 B;  1EU4 A;  3HVZ A;  3DMO A;  2PY5 A;  2WU5 B;  1PUT A;  3P4Q B;  1SE2 A;  3P1M A;  4WQM A;  2DBY A;  3GB1 A;  3SFD B;  3ABV B;  1MHX A;  3KWL A;  1D5M C;  3KLS X;  3EUB 2;  1IUE A;  2E6X A;  1ZAB A;  2NMQ A;  3LYY A;  1C78 A;  1T6B X;  1UGJ A;  4JE3 B;  1FO4 A;  1FXI A;  3VR8 B;  1N5X A;  3L4P A;  3DWG C;  4P16 A;  1F2R C;  2AQ1 B;  4LC5 A;  4J3O D;  1VQ2 A;  1TY0 A;  3V05 A;  1KRH A;  1TKY A;  1XLN A;  4N58 A;  2PVG C;  4P9D A;  1V8C A;  1ET9 A;  1D5Z C;  4RGN A;  4C56 C;  1C76 A;  2JX5 A;  1UWZ A;  4ZFT A;  1XHZ A;  1JWU D;  3IT6 B;  2MJE A;  1OX7 A;  1V97 A;  1CJE A;  4WIP A;  1WXQ A;  1ALN A;  2FBW B;  2J52 A;  1VR9 A;  2V3N A;  2G1E A;  1R5T A;  1SEB D;  2Y5P A;  4C80 A;  2PKO A;  1C9F A;  4HRS A;  3DH1 A;  4US8 A;  3AE6 B;  2BYT A;  1GOZ A;  1CK1 A;  1FM0 D;  2Z3G A;  4C7Z A;  1D6E C;  2V4I B;  4KGR A;  1TS2 A;  3BVZ A;  1HXY D;  4ZHO A;  4JPS A;  2AX5 A;  2W4L A;  4O8X A;  1HZ5 A;  4OHJ A;  4OWP A;  3G8Q A;  4L23 A;  2VZK D;  3BZD B;  1FCL A;  3W1S A;  1RB7 A;  2RDG A;  1JAL A;  3NS1 A;  1J7A A;  2LFI A;  1NI3 A;  2AQ3 B;  4MSQ A;  2EX3 A;  3CWI A;  2W82 A;  2LMC A;  3Q8F A;  1HEZ E;  4JWU C;  3AEE B;  3LB8 C;  2L83 A;  1TZO A;  3ZYY X;  1N5W A;  1OFF A;  3BII D;  2CJN A;  1XHX A;  3AE7 B;  1I4X A;  1K52 A;  2SAK A;  1B1Z A;  1TS5 A;  5BYQ A;  1FFU A;  2Y5C A;  3HVD A;  2O7P A;  2PYL A;  1STE A;  4G3M A;  3EX8 A;  3P4R B;  4TMA B;  5GXG B;  2JZP A;  1JWS D;  2K5P A;  5D3D A;  1RM6 C;  1E6E B;  1FNW A;  3P42 A;  4LCN A;  1XEE A;  5EE3 A;  1PYW D;  4C7Y A;  2QMT A;  1OI0 A;  4P9E A;  2HTM E;  4CQN A;  2OG4 A;  3SFE B;  1FRR A;  3TEX A;  4O8Y A;  4KGS A;  1PGA A;  1L6U A;  4Q2J A;  1FEH A;  1TS4 A;  3TSS A;  2KN4 A;  5FR3 A;  3OJ6 A;  5BMG A;  2KAJ A;  4O1N A;  2YEP F;  1PFD A;  1C79 A;  2INP E;  2JQR B;  4OWP B;  3TUO A;  1I4H A;  1XI1 A;  4ARI A;  3AN1 A;  1V1P B;  1KTK A;  2Q5W D;  4YSX B;  1AYF A;  4B0M A;  1WWR A;  5G5H A;  4TSS A;  1WN5 A;  1R5X A;  2QSD A;  4N59 A;  1QKZ A;  3BVM A;  2QLC A;  4P9C A;  2K3U A;  1YNT E;  1E10 A;  2V0G A;  2WQY B;  4JX1 C;  2HDE A;  1QOA A;  2JWU A;  3MC0 B;  2IGH A;  3ZQ4 A;  1P6O A;  3ZEF B;  1SJE D;  2WXN A;  2B76 B;  2ZW1 A;  1I7H A;  1SE4 A;  1A70 A;  1L0Y B;  1L4Z B;  4LLG M;  4LTU A;  4OCM B;  2WXL A;  1CZP A;  1SXT A;  4AQ7 A;  2PVO D;  1IBX B;  1FMA D;  5G5G A;  2M19 A;  2WLB A;  4ZD4 A;  1XXG A;  2WXQ A;  5BYS A;  3U52 E;  3AH7 A;  2WS3 B;  1L6V A;  2WXR A;  3J9C A;  1BUI C;  4WAF A;  2FR6 A;  2KKS A;  1ROE A;  2LGI A;  3RPF C;  3OCQ A;  1WWT A;  2WXJ A;  4A8X C;  1KLU D;  1WYG A;  4MM3 B;  2Z3H A;  1L5P A;  2I38 A;  2MEK A;  3U4E G;  5TSS A;  1VZ6 A;  5CW6 A;  3KQ4 A;  1MPE A;  1N62 A;  1KF6 B;  2IGG A;  1FRD A;  1ZDV A;  2IDY A;  2ACZ B;  1QF6 A;  3Q69 A;  1XLP A;  3RZU A;  2BS3 B;  2QJL A;  3BK1 A;  3VQI A;  1FNU A;  3AM9 A;  1FFV A;  1QT9 A;  1FIQ A;  4OCN A;  2DWQ A;  3AV8 A;  1UX0 A;  3ZJU A;  5BYR A;  3VRA B;  4JWS C;  2OHF A;  3E56 A;  4XDC A;  3ZPG A;  3AEC B;  2XNA C;  2PMV A;  4YT0 B;  1PDX A;  3KWV A;  5DCA J;  1ZUD 2;  2JSV X;  5E6J A;  1C4P A;  1UNS A;  2FE8 A;  4H2A A;  4TQ1 A;  5HFY A;  1UAQ A;  2ZNR A;  2HVV A;  1CTU A;  1ZE3 D;  2HXV A;  1UWM A;  4ZRQ A;  2INN E;  4HEA 1;  1ENF A;  1ET6 A;  4L1B A;  2J53 A;  2R61 A;  1JCK B;  3TEY A;  1N60 A;  1I4R A;  1ZP0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...