2PW9A

Crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
251
structure length
231
Chain Sequence
PLSIMQKSVVIRPGGRQEMDEHVAIETPYAIALNDRVIGSSMVLPVDLEEFGAGFLFGQGYIKKAEEIREILVCPQGRISVYADKIPKEMLEEFAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTGRLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative formate dehydrogenase accessory protein
publication title Crystal structure of a putative formate dehydrogenase accessory protein from Desulfotalea psychrophila.
rcsb
source organism Desulfotalea psychrophila lsv54
molecule tags Structural genomics, unknown function
total genus 63
structure length 231
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02634 FdhD-NarQ FdhD/NarQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pw9A02
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 2pw9A03
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pw9A01
1RB7A 1OX7A 2O7PA 1K51A 1TIYA 3MPZA 3MP9A 2LUMA 2O96A 2KKSA 5BMIA 2NMQA 4HRQA 2KACA 1XHZA 4D2KA 2FR6A 1MI0A 1YSDA 2ZW1A 2RPZA 4LD4A 3ZEFB 3R2NA 5HI1A 1JMLA 4LCOA 2NX8A 4OCMA 4EG2A 3UI3A 2PY5A 1F2RI 1ZXHA 3IJFX 2N9LA 1UAQA 1K52A 5C2OA 5GAOA 2NYTA 2D5NA 2ON8A 2I2YA 4HRWA 1MHHE 4WIGA 2OG4A 4O8YA 4LC5A 2N9KA 4NQLA 2JXTA 1CTTA 1XF5L 4OCNA 3ZPCA 4P9DA 2QLCA 2IGDA 2PZSA 3OJ6A 1YMHE 1K53A 4OCNB 1Z3AA 2JSVX 3ZPGA 2G84A 4K1RA 4HJGE 5HFYA 4LD2A 2KN4A 1P7FA 4I43B 2LHDA 2G6VA 1PGBA 2B3ZA 1PGAA 2IGGA 1UX1A 1Q10A 1QKZA 5CW6A 3B8FA 1MQ0A 4OWPA 1XI1A 2GI9A 2J52A 2RMMA 1AF2A 4ZD4A 1FCCC 4LCPA 1HEZE 2LHEA 1F2RC 4JXEA 4ZFRA 2JU6X 2N7JA 2P87A 4D10F 4WH4A 4OCMB 5HG2A 1CTUA 4MS7A 1XCTL 4QFTA 1YNTE 1JTKA 4F7OA 5M52C 2B3JA 3GB1A 5BMGA 2ZNVA 3G8QA 1R5XA 4P9EA 2QMTA 2GB1A 2KDMA 4O8YB 2OEDA 1R5TA 2HVWA 5DCAJ 3E1UA 2I38A 1MVKA 2PLPA 2KCQA 1EM7A 4F3WA 1IGDA 2Z3HA 3FI7A 3DH1A 1PGXA 1UX0A 4OCLA 3OCQA 5JXVA 3DMOA 2EX3A 2ZNRA 1OI0A 1ZABA 4OZAA 2JZPA 3RZVA 2R7FA 4MSMA 1FCLA 1MHXA 3EX8A 4E0QA 2PYJA 2P8RA 4WIFA 1HZ5A 4OWPB 2HXVA 1GB1A 2K0PA 1P6OA 2OBCA 1IBXA 3SBGA 2FR5A 4MSDA 4IOIE 4KGSA 1C9FA 1XCQL 2D30A 4ZFTA 4P9CA 1WN5A 1KH0A 2PW9A 4O8XA 4GLSC 2HVVA 2W4LA 4O8XB 1WWRA 1UWZA 2QSDA 3RZUA 4KGTA 1IGCA 2EELA 1D4BA 2Z3IA 2ONQA 2PYLA 4MACA 4PQTA 1VQ2A 3V3XA 4BGDC 4ILGC 4OCLB 2IGHA 4OZCA 2PTLA 5M59B 2LGIA 5BMHA 1HZ6A 2KWDA 2RPVA 4OZBA 2J53A 2KQ4X 1YSBA 4MSQA 4MSJA 1WN6A 1FD6A 1K50A 1MPEA 1UWXA 2JWUA 1ALNA 1GB4A 4ZD5A 2O3KA 2Z3JA 1WKQA 1XHXA 4HKZE 1IBXB 3FILA 1P7EA 2O95A 2Z3GA 2A8NA 3FILB 2ZW0A 4IKGA 4G3MA 4KGRA 5HHDG 4KITC 4LCNA
chains in the Genus database with same CATH superfamily
2RD0A 2N0SB 3QHTA 2LUMA 4YSZB 3ENEA 2FR6A 1C4AA 2REXA 3EFUA 1I42A 1FNUA 1LXDA 3P1MA 3AE2A 1R4MB 3RZFA 1F77A 2DYMA 2DNFA 2PPHA 2L0FA 3BZDB 2JSVX 1KFYA 4AUQC 1F1HA 2J0KA 4RMAA 1TJEA 4ZHPA 3H8HA 3WA0A 3SR6A 2NR2A 3TBLD 1JQ4A 1KRHA 2V3SA 1SF0A 2H88B 2B3JA 1T0YA 3I3TB 3U2SC 2BYEA 4MGZE 2HVWA 4PYUA 4IC7B 2I38A 2XK5B 3AN1A 2WXGA 4OCLA 1JWSD 4N6EB 1AL24 4K1RB 3ZUNA 1UBIA 3PSEB 1A5RA 2KWVB 3EX8A 4IM2A 4WIFA 1E7UA 1GOZA 2G45B 1BMLC 1PL0A 3DBSA 4LNKA 4PYZA 4WWPA 1WSPA 1C9FA 1OQQA 3CIRA 4LK0M 4N59A 4O8XA 3JYUA 3QC8B 1Z2MA 2G9HD 2QSDA 4KGTA 1ZCZA 3AE6A 1NVID 2JXXA 2IY1B 1VCBA 1FXIA 1CQVA 1WF9A 1NA1D 3QQ8B 1V6EA 3DHIC 2J53A 2JT4B 4W9JA 4RGNA 2O6VB 2ASQA 4FHKA 4A90A 1FXTB 1YN3A 3KYDD 1HE8A 1K51A 4YTMB 1FRDA 3HHMA 3BYYB 2W55A 4LCOA 4YTPB 2HWB4 4EG2A 2X5ID 3VVWB 1F2RI 1RWSA 3NVVA 3UQAA 2WQYA 1WR6E 1HXS4 2G4DB 2MP2A 2ZPYA 4CO7A 4LCDE 1EF5A 4OCNB 4P1BC 3JSVB 5HFYA 1EV14 2GBKA 1KF6A 1UX1A 1SJHD 2CR5A 1N62A 2H89A 1THZA 2LWPA 1WRIA 2H88A 3TCAA 1PO14 1FMAD 1V81A 3M3JA 2LRWA 2SAKA 2XK5A 2X38A 4HCNB 3IT4B 3ZKJC 4O8YB 2IU0A 3ZYYX 4LDTB 2RS34 4EOYA 2W82A 1VZ6A 4HK2A 1K5MD 3APFA 4PT5A 3AEDA 2G1EA 3KUZA 2WDVB 3Q8FA 1IYFA 3R2TA 1RM6C 1VBA4 3NZUA 3AE8A 4KGSA 4FLHA 4W9IA 4C4VA 4A1OA 4HWIB 1ISNA 1D5ZC 2PKOA 1N60A 4GLSC 2KFKB 2N7DA 2LGDA 2HVVA 2KLGA 3PREA 2WDQB 3SFDB 4KKJA 2PYLA 4MACA 1XD3B 2DYBA 3S2AA 3AE4B 1YX5B 2B76A 2XNAC 2D3AA 3QARA 1F52A 3AE1A 4HDOA 2VH1A 5IO9A 3QWZB 1IBXB 2KDIA 2JVCA 2Z3GA 4HRSA 1AR74 1MG4A 3E9SA 4YTMA 2CKHB 2EKIA 1AR64 3HUIA 4HCPB 4AOFA 4E74A 4YTPA 1YSDA 3T9LA 3N32A 3UINB 2NTTA 3N20C 1J7BA 4HRWA 3T3NA 2JXTA 3U7DA 3I57A 4AJYB 4OCNA 1D5XC 4WURA 3JSVA 5AZHA 2KT7A 1IPGA 3NRZA 4YXDA 2DZMA 4MEMA 5DPWA 3IAM1 2Z0EB 2VH2A 4NAWB 1ET9A 5KHQA 2IBIB 2WP9B 1TS4A 4WWOA 2M56B 4D10F 4OCMB 2WU5A 3GB1A 2BB6A 2GOWA 4EHIA 2KK8A 3DVGY 4B0MA 3DBRI 3U8ZA 3WALA 3AI5A 4NPNA 1TS5A 3RNBC 1C4PA 4WWMA 1PYWD 1L5PA 2FAZA 3UGBB 5IP4D 2KC1A 3QK0A 2IZVB 3OJ3A 2WDVA 4KDIC 2WXIA 4W9EA 1EWYC 5G55A 2LXCA 4WJPA 3H6NA 4WQMA 1H4RA 1WX8A 3C19A 4YL8A 2KFKA 1QT9A 1TY2A 4PK1A 4XC2A 1CZPA 3W2DA 2LASA 4A3OA 3R66C 3BK2A 2ZNVC 3AE4A 4ZRQA 4PQTA 3V3XA 4LNFA 3AECB 2DZIA 4DHZB 2L52A 3LYYA 2LEKA 1RUG4 4TKNA 2GBRA 4ZRJA 1MPEA 1I4QA 1VZ7A 3AMZA 1V1PA 2A8NA 3EECA 3ZVVA 1WMHB 3MTNB 2K3UA 3MPZA 4XE0A 1V86A 1P9DU 4F8CB 1NYQA 2NMQA 4ITKA 4AWJA 3BVZA 4D2KA 4DDID 3ZNHB 1GAQB 4RGMA 2G3QB 1TY0A 2L00B 4K3CA 5IKCM 5C2OA 1V9JA 5AUKA 1H8TD 3LB8C 1RUC4 2JRIB 4I6NB 3L4PA 4EZKA 4EEWA 2KWCA 3QIJA 2K6DB 1FM0D 4M8MA 1TS2A 2PLV4 4MGIE 1B1ZA 2KD0A 2G6VA 1PUTA 5JHBA 2N1WA 2GBJA 4HROA 4LTUA 4IUMB 4LCPA 2LJIA 1N6ZA 4ARCA 1HEZE 2G4SA 3N1XC 2AWTA 2IO3B 4WH4A 3P4QB 4EE2A 4AS1A 3ZNID 4P7IA 3ZQ4A 1SSNA 1TKEA 1EM7A 1IGDA 2CU1A 2KZRA 1OEYA 4E3CA 4FADA 3PZ7A 4R3DA 5FR3A 3P42A 4A9AA 2ZPNA 1OI0A 4RGTA 3RNCC 3L16A 1P6OA 4W9KA 1RYJA 4J3OD 3QCAA 3RN9C 1WN5A 2KNBA 2YEPB 1WI0A 3AE9B 3TEWA 2W4LA 1R7SA 1WWRA 3RZUA 1ACCA 2FE8A 3KLSX 3BYTB 1GJZA 3HVDA 1YJ1A 2KTFA 5LXHA 1JALA 1PFDA 1NENB 3RYTA 4EZLA 2YVCA 1PDXA 4ARIA 3GOEA 3A9JA 5BYQA 3HVZA 1WY8A 2KX3A 3TEYA 1E8WA 2BKFA 2K22A 1WX7A 1ZDVA 3R3MA 3VUYA 1PKXA 1TIYA 1GC7A 3T3OA 3IVFA 2INCC 1QOGA 4G50A 2QEJC 3SHQA 3Q8BA 3QA8A 1FNVA 3L54A 1Q1OA 1KJTA 4TMAB 2FCMA 2KDEB 4MT5A 3KYCD 1R4NI 3LXFA 2IY0B 3TEZA 4YSXA 1PO24 1QOAA 3K9OB 1P3QU 3PV1A 3NOBA 1L0VB 2WXKA 2I1JA 5AZFA 2IO0B 3AH7A 3V05A 3ZJVA 1L0XB 5EE0A 5T8IA 3HK0A 1E5WA 1KLUD 3AE2B 1MQTD 3MHZA 3GZNB 4ZYNA 4JWSC 3VTUA 3BK1A 3X0WA 3V6EB 1AWDA 1KFYB 2INDC 2IU3A 2DX5B 2CS4A 3Q3MC 1RFKA 1YQ3B 1EAH4 3W1SC 3L17A 2OBCA 5G5HA 3DHHC 3VH3B 2WXFA 2KJRA 4ZFTA 1COV4 4YSYB 2MLBA 4HPPA 4J6EA 1RUI4 3AB5A 5C2TB 3CSTA 1Y56A 1X1MA 3UIOB 1ZP0B 4W9GA 4N9F4 4OCLB 1LM8B 3ECIA 2KVZA 1WYWB 1NENA 2RS54 2MCNB 4IG7B 2IYDB 3N1YC 4A55A 2M19A 2WS3B 3NHEB 2QILA 3OJ4B 3ML9A 4E71A 1ET6A 1PQSA 2EKEC 3FILB 2NPTA 1FFVA 2MHJA 1M94A 1OX7A 3ZNZB 3ZXVA 1RUH4 2Y5CA 1FEHA 1N5WA 2IDYA 5BMIA 2C5LC 1ZDXA 2ZEQA 4RH6A 2WLBA 3AE6B 2D07B 4LD4A 2D5GA 4YT0A 3RD2A 3ZTCA 2XN9C 5FK9C 4LC5A 1SBBB 3BIID 4MGYE 4US9A 5CHFA 5DCNA 2BT6A 1J8CA 3OJ6A 1DOYA 2FUG1 4LD2A 3W5VB 1U4AA 1PGBA 5D94A 1BEV4 1SE9A 2JWZA 3JD74 4OWPA 2Z0DB 2GRIA 1P98A 2WYQA 2KLCA 5IN7A 4DBGA 2KQ7A 1L6VA 1WWTA 2WQYB 1YD8U 1J7CA 1SXTA 3A9KB 1LGRA 1WXSA 2V3PA 3IT6B 2KCQA 2MP2B 1T6BX 2DYOA 3IG3A 4NY0A 4XYCA 4CYEA 1KF6B 4JGHB 3AEGB 2JZPA 2A4ZA 1YQ3A 3BWUD 3RFZB 2KC2A 3TJPA 2PYJA 5D3IB 5LNK1 3HM6X 4HJKA 1P4RA 4MJSA 2H89B 2KTRB 4KKIA 1RUF4 4YSYA 3Q3JA 2N9EB 2M8SA 5C2TA 4AQ7A 2RR14 3RI7C 1LO5D 1UWZA 3ZXRA 1ZP0A 1ZKHA 4WAAA 2C9WB 2IGHA 4US8A 4L23A 4Q4W4 3M95A 2LD9A 3AEDB 4MSJA 1D4M4 1WN6A 2WS3A 5EDSA 1KTKA 1SE4A 1E7PB 1RRBA 3FILA 3QX1A 1R4MI 1OGWA 1N61A 3AE8B 1WE6A 4C4VB 4IKGA 2D10A 4KGRA 3RT3B 1SIJA 2EMSA 4K7WA 2BBCA 3MP9A 4KV2A 2K39A 4HRQA 1CK1A 2KACA 2RPQA 4WIPA 3PT2B 3ZEFB 2B76B 4KSKC 2N9LA 3EUB2 1E10A 3I63C 2WU2A 2DAJA 4GB9A 3AE1B 4K81A 3P4RB 2PZSA 2WGSA 3ZPGA 2DZJA 4JWUC 4FHJA 5G2NA 3VHTC 3KH0A 2G84A 3PGEA 3VH4B 4RHV4 2BKRB 2LI5A 4M0WA 4GDLA 1TZ1A 3PHXB 1AF2A 5JH5C 4A3PA 1TGZB 5EE3A 4JQWC 5TR5A 1CTUA 1WYGA 1TBEA 5M52C 2JRHA 3A9KA 2BQQA 2QMTA 1UD7A 3AEFB 5L95C 1JRUA 3MC8A 3E56A 3AEGA 3ZDMC 4EUTA 2K25A 1VRAB 4YXDB 5EE1A 2LGSA 1EWCA 2K8CA 4M02A 2BPSA 1AR84 2KTRA 4IM3A 4FULA 1C1YB 3DPDA 4J6IA 4HPMB 5C1ZA 1PVC4 3GQHA 4P9CA 2QDFA 2WU5B 2KDBA 2WXRA 2V9HA 3AM9A 1LQBA 2ONQA 3JBG4 4IWPA 4BGDC 1I4PA 2D3BA 3BY4B 4FXCA 1RAXA 2MJ3A 2RMU4 3MC0B 1WRDB 2KO3A 2K9XA 1S3SG 4MSQA 3FC4A 4JPSA 2V3NA 3VDZA 1QQRA 5DPSA 1YJJA 4HKZE 3P2BA 2N7EA 2FUHB 3NY5A 4JE3B 4OVZA 2ZW0A 4G3MA 5HHDG 4HEA1 4P6VF 4KITC 3Q6BA 4UDUC 3Q3NC 3PRMB 2WNMA 2FCSA 2MBHA 3IHPC 3W1YA 1XLNA 2L05A 2KDFB 2PY5A 3NVYA 2D2QA 1I7HA 1RLFA 1EF1A 4TV3A 1KLVA 3P4RA 4BOSC 2FNJB 2QLCA 3SUCA 1YMHE 1VBB4 4DXFA 1WXMA 3PTFC 1V1PB 4HJGE 3ZGZA 1QILA 4NJ6A 3B1LX 2RDHA 2BW2A 2J42A 2JZ3B 5D7GA 1FO4A 1XI1A 3MC9A 2PE6B 2K1FA 2IO1B 1T0QC 3ZLZA 4F7OA 2V4IB 1CJEA 1UUPA 4PS8A 4FN2A 3AEFA 2GB1A 1V97A 5D3DA 3ZTDA 2E6XA 3DH1A 2OJRA 1V80A 1UX0A 1OOPD 2WXNA 4C7YA 3MHSD 1XXGA 2AL3A 4XWWA 3RNEC 4ACFA 2V4LA 3SBGA 1DGJA 3VQIA 1A70A 3OLMD 2D30A 3AEBB 4BKGA 2BS3B 4RF0A 1NDDA 4TQ0A 2BF8B 3NJTA 5EE9A 1FRRA 1IGCA 2ZZPB 4TUUA 2LUEA 2GBMA 3Q3FA 4ASWC 3B2FA 1BXTA 2CU3A 3RUIB 2MA9B 1NYRA 2CJOA 3ZRCA 1HZ6A 1SE2A 2JQRB 4DHJB 3M62B 4TSSA 1CMXB 2WDRA 2W9NA 2K5PA 2KVRA 4LNIA 2O2VB 1T5XD 2MSED 1HRI4 3ONSA 5LXIB 2PIAA 2E3TA 3Q8CA 1HQRD 4HVBA 3WAPA 3U30A 4NNJB 4C80A 1KOTA 4ZRKA 3A4SC 2NCNA 2R2OA 3UI3A 2KYWA 3U52E 1WX9A 3TSSA 2D5NA 2QHOA 2RM24 1IUEA 4NQLA 3DWGC 3ZPCA 2BYTA 1T0SC 3A9JB 1S1QB 1FPYA 1I4XA 3PRPB 2Z8LA 3N1ZC 4C7ZA 4XGAB 1VD2A 2PVOD 2M17A 3RNFC 1R084 3VR9B 5HG2A 5J2RA 2GMIC 1I4RA 3VUWA 2AEHA 5BMGA 1WXVA 2Y5BB 4EFOA 3E1UA 4YSXB 4BOZB 1VJKA 2X8XX 3H7PA 2EX3A 3PPAA 1HTQA 4MSMA 4RFBA 1FCLA 1YN5A 1HZ5A 3DHGC 2MJEA 4M00A 2KHWB 3AEBA 1WGRA 2R064 2CHZA 2OOBB 4LJPB 3AE5B 3AEEB 4IM0A 4BBNC 1VBC4 1SGHA 4OHJA 2VRRB 5GXGB 2JPHA 5FKAC 1JCKB 1WGHA 3RNAC 3HM3A 2SEBD 2KJ6A 1RUD4 4L2YA 1YJIA 4Q4Y4 1K50A 4YWGG 2WXPA 2N4FA 1ALNA 2O2VA 1NI3A 3A1QB 1JROA 1L0VA 1N5XA 2B1GA 1F0ZA 2AL6A 1WJ6A 2NBVB 3NVZA 1SEBD 3RMKC 3NZSA 5E6JA 3SFEB 4LCNA 3AV8A 1KLGD 2IPKD 2KJHB 3V62A 1QF6A 4XDDA 2NBWB 2V0GA 3R2NA 2UWQA 1ENFA 1JMLA 3GQKA 1J0GA 4BKSA 1UH6A 4PDWD 5C23A 4ANWA 2N9PC 3ZJUA 2UU7A 3ALBA 4P9DA 2WXQA 2KKCA 3QJZA 2ACZA 2ZVNA 2J0MA 4XDCA 2C60A 2KN4A 2KMCA 4BAXA 2NPTB 1SB3C 2XEWA 3R8BA 4EKUA 2QIEB 3VR8A 1WFYA 3VRBA 2WDTB 4A20A 4ANVA 3Q8EA 3V6CB 3O65B 4AP4C 3DVNU 3VR9A 1MJDA 4WJNA 1YNTE 2Y5PA 3DBLB 4YT0B 5H92C 5JHAA 2FBWB 4TQ1A 2R074 3AE3A 2WXHA 2PJHA 1DYQA 1WM3A 3VFKA 3FI7A 4S0RA 1DOIA 2J7QB 1L2NA 2L76A 2RGFA 1QLBB 2QJLA 3KW5B 2YLMA 4B9KA 3A4RA 3KUDB 4OWPB 1GB1A 2D11A 1ZW7A 1JWBD 4MM3B 4Q4X4 1H8CA 3AE5A 3AEEA 1SIFA 2A5UA 3CMMB 4HKQA 2KMAA 1F9JA 3D32A 4IDIA 3X23A 1T3QA 4LJOB 3W5UB 5BMHA 1EUVB 3A1QA 2JWUA 3JW0X 4GU2A 1WE7A 1XHXA 1HXYD 1OQYA 4MJSB 3MJ5A 2C7MB 4HDQA 3SFEA 2BTEA 1TYGB 3ZNGC 2BWFA 3J9CA 4BVUC 3DBHB 3ZJTA 2B1IA 1C76A 1GC6A 4LNOA 3I5JC 1XHZA 1C4CA 2L3ZA 3NVWA 1YQ4A 2L83A 2HDEA 4PS7A 2NS5A 3PZ8A 2LVPA 1AR94 2MW5A 1NEKB 1UNSA 3JVZX 3HIZA 2VZKB 1UGMA 3C8YA 4K3BA 4A8XC 4JX1C 1TZOA 3AU4A 2IGDA 2WXOA 4K7SA 3Q14C 3GZNI 4XWTA 1P7FA 5IA7A 2QC8A 1WZ3A 4I6PA 1PGAA 2IO2B 3APDA 2L8JA 1E7VA 2FIDA 3J8F4 3VXWA 4FJZA 4N58A 1ZXIA 2L7RA 2NBUA 2LHEA 4JXEA 4MH0E 2FBWA 4IWQA 2ZNVA 4KZ0A 2WU2B 2Y3AA 3BINA 2YEPF 3AE7B 1KM7A 2DENB 3CSFA 5CHWA 4F3WA 1AW7A 4GGMX 1E90A 3DMOA 2WXJA 1G8MA 3P4SB 1YN4A 3FAHA 2R7FA 3TMPB 2BS4B 2AYOB 4M0WB 1ESFA 4GDLB 4LNNA 3VRAA 4MSDA 3K9PB 4MM3A 1D5MC 4IOIE 2BWES 3DVNV 2R61A 3P4PA 3L0WB 3PLUA 1QZEA 4W9CA 1ZPSA 5CX3A 5IAAC 4CQNA 1C77A 5I4DA 2RS14 3LJ3A 3B2GA 4B6WA 4OZCA 4IW0A 2PTLA 4DHJD 2DBYA 3EC8A 1WKQA 1P0RA 5AEKB 3TL5A 1YQBA 5AZGA 2NVUI 1TS3A 1G6JA 2I1KA 1V5OA 3B9JA 3TEXA 5IOIA 2O7PA 2R044 1L0YB 2QCZA 1C79A 2CHWA 5HKHA 1MI0A 2RSUA 2RPZA 3B0AA 4W9LA 4WJOA 2NX8A 1D3ZA 1NEKA 1L4DB 3RNGC 4BKSD 4RCOA 5GAOA 2MBBB 1J19A 4MSQB 1M4VA 4IWOA 1CTTA 4S17A 1K53A 3WCQA 4O1NA 2L0TA 4RM9A 4ZRPA 3W9CB 2LHDA 3TUOA 1TTNA 2HTHA 2IJ0A 1WGYA 1WGDA 4FJVB 4GDKA 2LXAA 2MBEA 2MEKA 2DZKA 3RPFC 1MQ0A 2GI9A 4ZD4A 3IAS1 1FCCC 3PHWB 2N7JA 2KX0A 1WGKA 2ZCBA 4KX6B 1WJ4A 1Z7S4 4BBNF 3L13A 1UELA 1R5XA 3AE7A 2KDMA 1R5TA 2KN5A 1AYFA 2FIFA 5G5GA 1MVKA 2PLPA 3UF8A 4B95A 1YX6B 2OJWA 2W3SA 3P4SA 1XQQA 5JXVA 1I35A 4NJCA 2LGXA 1ZABA 4OZAA 3ZZMA 5E6PA 1MHXA 3MJWA 2HXVA 1E8XA 3PVLA 3PRZA 2WHIA 4DDGD 4RF1A 3N3KB 1KH0A 2PW9A 4BFRA 1WZ0A 4GB34 4P16A 4YSZA 4JL9A 3O13A 4NJ7A 2JF5A 1L7YA 4MGKE 4GGQA 1ZGUB 3WAMA 1L6UA 4ZYSA 3GS2A 2HWC4 2JUOA 3ML8A 2J0JA 1FD6A 1WJUA 2LMCA 4YTNB 1STEA 1P7EA 1WIAA 3V61A 4ZHOA 2MRPA 4BZAA 3ZW3A 3AU5A 4II2B 2OHFA 1XLPA 4KZCA 1NBFC 2AQ1B 3A33B 2L32A 3PS6A 4ZRIA 3L08A 1QOFA 4DXGA 1C3TA 1RUJ4 1E8ZA 2NYTA 2I2YA 1VR9A 2WDRB 1XF5L 2HD5B 2PVGC 5E6OA 2KXJA 3T8MA 4K1RA 4I43B 4F7ZA 3UIPB 3W1SA 2B3ZA 2R2QA 5TSSA 3ZO5B 4KX6A 2KQSA 4QFTA 3AULA 1JTKA 1AN8A 1WXAA 3NG0A 2OEDA 2J4XA 4NQLB 4B0EA 1JW9D 4ANXA 1K8RB 2B3AA 1D6EC 5D6JB 1E0ZA 1OQRA 2KANA 4JIOU 3U7ZA 2O6VA 2GBNA 2FR5A 4OW0A 4REZA 1JWAD 1L4ZB 2PMVA 2MH7A 3CF6E 3DBRB 2INPE 3NUHB 3VX8A 1T0RC 2KOXA 1QOBA 5DPRA 2K8HA 2Q5WD 1YOVB 2ZJDA 1VBE4 4H2AA 4ILGC 2LGYA 3I9V1 1RFAA 3H7PB 1Q5WB 1ZOYB 4OZBA 2JY6A 2KQ4X 1XT9B 4YTNA 4MSMB 1TKYA 1TKGA 1SJED 3OAWA 2LZ6A 3KWVA 1WXQA 4KDLB 1MFWA 1V8CA 3KWLA 3VUXA 1GNUA 3V60A 2N1VA 4A6QA 4GN1A 5BYRA 4ZDVA 2JZZA 5L83A 1NCQD 1J7AA 4GXBA 2M1MA 5FR6A 1C78A 2FCQA 4PS3A 3IJFX 4GMVA 3ZIMA 1ROEA 4KVGB 5E6NA 4WIGA 1E9MA 2VZKD 4O8YA 1ZE3D 4QAYA 3ETRA 5J18A 1FNWA 1WH3A 4FA6A 3WIMA 2IGGA 1Q10A 4M8NA 5MPOA 1I4GA 3SU8X 2WWZA 4MDKE 2RDGA 1Z5SB 2J52A 2BS2B 3AEAB 2N9XA 3M63B 3URYA 1UWMA 2JU6X 2P87A 4LLGM 5CHVC 3U4EG 1JRPA 3SEBA 4F1SA 2W3RA 3AXCA 1UBQA 5CTRC 2KAJA 5DCAJ 2WDQA 3SFDA 2JX5A 1RUE4 3DOWA 2Z3HA 3GE3C 3RULA 2ACZB 2DHZA 3ZRFA 3OCQA 2ZVOA 2PE9A 2WX1A 1GUAB 1GG3A 2ZNRA 3GP7A 3EGRA 3RZVA 3DVGX 1OFFA 1P1AA 1JWMD 4E0QA 3VR8B 2KWUB 1LFDA 1V5TA 4KIKB 3VRBB 1POV0 2K0PA 3DQVA 1XLQA 1IBXA 1VDVA 1RHI4 2CJNA 1UZXB 1YIWA 4ICUA 2BB5A 3WAOA 3Q2AC 2INNE 1RVF4 3PZDA 1DOXA 4NQKE 3N30A 3AE3B 1D4BA 5C3JB 2V1YA 3LDZE 1ZOYA 1SE3A 5M59B 4FJYA 5LLIA 2PEAA 2ZCCA 3FKYA 3EA6A 1UWXA 2WXMA 4ZD5A 4JLCA 1XEEA 4RM8A 2LJ5A 4WJQA 3NZ3A 4BKTA 3BH1A 5KHOA 2M4NA 4HLEA 3R7RA 2UYZB 5DPTA 4Q2JA 4NAWA 5J17A 3N9YC 2WP9A 1VZ8A 4USAA 1VRH4 4OCMA 4KSLC 4AJWA 1UAQA 2ON8A 1MHHE 3R7QA 1BUIC 1WM2A 2BVCA 2WXLA 4NZLB 2CHXA 4DQOC 1Z3AA 3H9DA 4FBJB 4C00A 4DWFA 3OWEB 3AEAA 3B8FA 2MJDA 2M0AA 2RMMA 4G11A 1YQ4B 3SDLC 4ZFRA 1R4NB 4MH8A 1E6EB 1XCTL 4W9HA 4C56C 3CWIA 2LRUA 3HRDD 2JYEA 1B9RA 1XO3A 2HJ8A 1HA5A 1R094 1EU4A 4WQOB 4URKA 3KUCB 3AECA 4OVVA 4OVUA 2D3GA 4WAFA 4KIKA 2TSSA 2MQJA 4RGOS 1Q0WB 2HE7A 3ABVB 4II3B 2P8RA 3SD5A 2O6VD 2D3CA 4XX5A 3UQBA 1WR1A 2LFIA 1WGGA 3KQ4A 1WMHA 1XCQL 4W9FA 3H7SA 1VK9A 3BVMA 3IXSA 2AX5A 1EU3A 2ZNVB 5C3JA 1ZUD2 2EMTA 2Z3IA 1M9NA 2JYTA 1RMU4 4ZOHC 1HRV4 1Y8RC 2LGIA 2KWDA 2RPVA 3QAQA 1FXAA 4DK5A 4GIVA 1VLBA 4ANUA 4HPLB 3KVFB 3DCGA 3VRAB 1XLOA 3H1UA 2C7HA 3RZWC 1V2YA 1UF0A 2DAFA 3P4PB 4MELA 1I4HA 4RNAA 1RB7A 2C7NB 1JWUD 2O96A 4P1CC 2M0XA 2KKSA 2Z59B 2ZW1A 3EFCA 5HI1A 5JZEB 5D2MB 1ZXHA 3P4QA 3PO0A 1K52A 1PIV4 3DDCB 4HXDA 2OG4A 1UGJA 2N9KA 4LDTD 2MBOA 3DBLI 3Q8AA 3VTVA 1IP9A 1ASJ4 1FFUA 4GSWA 2KFJA 3NS1A 5AUIA 2BYVE 5GMVA 3B08A 3VAWA 2W54A 1N63A 1QKZA 3NS8A 5CW6A 2HTME 2RR9A 3APCA 1F2RC 2GLSA 1HTOA 4NAMA 3P63A 4ICVA 2ICIA 3C0RB 4MS7A 2KMMA 1NI2A 2K8BA 3G8QA 1BT0A 1AARA 4EZJA 5H8YE 4P9EA 1WJNA 4DHZE 2MBQA 3AE9A 3VTWA 3ZDTA 2AQ3B 2FCNA 2BGFA 1PGXA 1TT5B 4X57B 2LVQA 1TIFA 4K7UA 4G0NB 3DWMA 1FIQA 4GDKB 3ABVA 3Q3OC 3Q69A 5BYSA 4M01A 3EHVA 2L1AA 2BYFA 2MWSB 3IFWB 4GOCA 3MFGA 3BVGA 1V49A 4DXAB 5BO4B 4I6LB 2DLBA 3OG5A 4W9DA 4Q4V4 4L1BA 4WWNA 3R2IA 3L10B 3CIRB 3PLVA 1MG8A 3GE8C 4O8XB 1OZ0A 1VBD4 2EELA 3DBHI 1V1OA 1E8YA 1VQ2A 2HJ1A 2XBBC 4G3XB 3IBEA 1EO6A 2LVOA 1YSBA 2K6QA 1GB4A 2O3KA 2Z3JA 2WX0A 1OEYJ 2RDBC 2O95A 1OTRB 2DWQA 4CHKA 3WANA 1GPXA 3RCZA 4XZ4A 2AQ2B 2MX2A 2NTSA 3TIXA
chains in the Genus database with same CATH topology
1XLPA 1TIYA 2N0SB 1HQRD 2LUMA 3T3OA 2AQ1B 4YSZB 1QOGA 2FR6A 2L32A 1C4AA 4C80A 1FNUA 2QEJC 3Q8BA 1FNVA 1QOFA 3UI3A 4DXGA 4TMAB 3P1MA 3U52E 3TSSA 2D5NA 2NYTA 2I2YA 1VR9A 2WDRB 4MT5A 1IUEA 1F77A 3LXFA 3DWGC 4NQLA 1XF5L 2DYMA 3TEZA 2PVGC 3ZPCA 2BYTA 1QOAA 3BZDB 2JSVX 4K1RA 1I4XA 4I43B 2Z8LA 4C7ZA 1L0VB 3W1SA 2B3ZA 1TJEA 2WXKA 2PVOD 5TSSA 4ZHPA 3AH7A 3H8HA 3V05A 3ZJVA 1L0XB 3SR6A 5EE0A 1JQ4A 1KRHA 1SF0A 5T8IA 3VR9B 5HG2A 1I4RA 4QFTA 1JTKA 2H88B 1AN8A 1KLUD 3AE2B 2B3JA 5BMGA 3U2SC 3MHZA 2NTSA 2OEDA 2HVWA 2J4XA 4B0EA 3E1UA 2I38A 1JW9D 4JWSC 4YSXB 1D6EC 3BK1A 3AN1A 1E0ZA 2WXGA 1OQRA 4OCLA 1JWSD 1VJKA 4N6EB 2EX3A 1AWDA 1KFYB 4MSMA 4RFBA 1FCLA 3EX8A 4WIFA 3U7ZA 1YN5A 1HZ5A 1RFKA 1YQ3B 2MJEA 1GOZA 2OBCA 1BMLC 5G5HA 2WXFA 2FR5A 4OW0A 4REZA 1JWAD 1L4ZB 1WSPA 2PMVA 2MH7A 1C9FA 4ZFTA 2INPE 1OQQA 4YSYB 4LK0M 3NUHB 4N59A 4O8XA 3AB5A 3AE5B 3AEEB 5C2TB 1QOBA 2Q5WD 4OHJA 2G9HD 2QSDA 4KGTA 1Y56A 5GXGB 1NVID 4H2AA 1ZP0B 5FKAC 1FXIA 4ILGC 4OCLB 3I9V1 1CQVA 1JCKB 2SEBD 1ZOYB 4OZBA 2J53A 1YJIA 2KQ4X 4L2YA 4A55A 1K50A 4YWGG 1TKYA 2M19A 1TKGA 2WXPA 2WS3B 1ALNA 4RGNA 1SJED 1NI3A 2QILA 1JROA 1N5XA 3KWVA 1WXQA 1F0ZA 3NVZA 4A90A 1ET6A 1SEBD 3FILB 1V8CA 3KWLA 1YN3A 5E6JA 4A6QA 1FFVA 3SFEB 4LCNA 3AV8A 5BYRA 1OX7A 1K51A 1KLGD 2IPKD 4YTMB 1QF6A 1FRDA 4XDDA 2Y5CA 1FEHA 1N5WA 2IDYA 5BMIA 1ZDXA 4RH6A 2WLBA 3AE6B 3BYYB 4LD4A 2D5GA 2W55A 1J7AA 2V0GA 3R2NA 4LCOA 1ENFA 1JMLA 4YTPB 4EG2A 1C78A 1F2RI 3IJFX 1RWSA 3NVVA 2XN9C 1ROEA 4WIGA 1E9MA 2VZKD 5FK9C 4O8YA 4LC5A 1SBBB 3BIID 3ZJUA 4US9A 1ZE3D 2BT6A 4P9DA 3OJ6A 2WXQA 1DOYA 4OCNB 3ETRA 2FUG1 5HFYA 4XDCA 4LD2A 2KN4A 3W5VB 3R8BA 1SB3C 2QIEB 1FNWA 1PGBA 2IGGA 1UX1A 1Q10A 5MPOA 1SJHD 1I4GA 4OWPA 2RDGA 2GRIA 2J52A 1N62A 2BS2B 3AEAB 3Q8EA 3URYA 1UWMA 1WRIA 2JU6X 2P87A 1L6VA 4LLGM 3U4EG 1JRPA 1WWTA 1YNTE 2Y5PA 2WQYB 4YT0B 1FMAD 5H92C 1J7CA 3SEBA 2FBWB 1SXTA 2W3RA 4TQ1A 2SAKA 2X38A 4O8YB 2KAJA 3IT4B 5DCAJ 2V3PA 3IT6B 3ZYYX 2JX5A 2WXHA 2KCQA 2Z3HA 1DYQA 3FI7A 2ACZB 1T6BX 2DYOA 3OCQA 2W82A 1DOIA 1VZ6A 2ZNRA 1KF6B 1QLBB 3GP7A 3AEGB 2JZPA 2QJLA 3EGRA 4PT5A 3RZVA 1OFFA 2G1EA 2WDVB 1JWMD 3BWUD 3VR8B 3RFZB 4E0QA 2PYJA 3VRBB 5D3IB 4OWPB 3Q8FA 1GB1A 2K0PA 3R2TA 1XLQA 1IBXA 1RM6C 1VDVA 5LNK1 2CJNA 2H89B 1JWBD 4KKIA 4KGSA 4MM3B 2BB5A 4AQ7A 1D5ZC 2INNE 2PKOA 1N60A 4GLSC 1LO5D 1DOXA 2HVVA 4HKQA 1UWZA 3AE3B 2WDQB 3SFDB 4KKJA 1D4BA 5C3JB 2PYLA 4MACA 4IDIA 1T3QA 3AE4B 2IGHA 1SE3A 2XNAC 4US8A 5M59B 3W5UB 5BMHA 4L23A 3AEDB 4MSJA 1WN6A 3EA6A 1UWXA 2JWUA 2WXMA 1KTKA 4ZD5A 1SE4A 1XEEA 3NZ3A 1XHXA 1E7PB 1IBXB 3FILA 1HXYD 2Z3GA 1N61A 4HRSA 3AE8B 3MJ5A 2BTEA 1TYGB 4IKGA 3J9CA 4KGRA 3E9SA 3ZJTA 4Q2JA 1SIJA 1C76A 2BBCA 3MP9A 2EKIA 3N9YC 3HUIA 4HRQA 1CK1A 2KACA 1XHZA 1VZ8A 1C4CA 4USAA 1YSDA 3NVWA 4WIPA 3ZEFB 2L83A 2HDEA 2B76B 4OCMA 3PZ8A 2N9LA 3EUB2 1UAQA 2NTTA 1J7BA 1NEKB 1UNSA 4HRWA 2ON8A 3T3NA 1E10A 1MHHE 1BUIC 2JXTA 2VZKB 2WXLA 3AE1B 3I57A 4OCNA 3C8YA 1D5XC 4A8XC 3P4RB 1TZOA 4JX1C 4NZLB 2IGDA 4WURA 2PZSA 4DQOC 1Z3AA 2WXOA 3ZPGA 4JWUC 4XWTA 2G84A 3NRZA 1P7FA 1PGAA 4M0WA 3IAM1 3OWEB 4NAWB 3B8FA 2MJDA 2M0AA 1ET9A 4N58A 2RMMA 1AF2A 1ZXIA 2WP9B 1TS4A 2M56B 5EE3A 1YQ4B 2LHEA 4JXEA 4ZFRA 4D10F 4MH8A 4OCMB 1CTUA 1E6EB 1WYGA 1XCTL 4C56C 3CWIA 5M52C 3GB1A 2ZNVA 2BB6A 3HRDD 2JYEA 1B9RA 2QMTA 2WU2B 1XO3A 2Y3AA 4B0MA 2YEPF 3AEFB 1HA5A 3AE7B 4F3WA 1AW7A 1TS5A 1C4PA 4WWMA 1PYWD 1EU4A 1L5PA 3E56A 3DMOA 2WXJA 3P4SB 1YN4A 1VRAB 4YXDB 5EE1A 4WAFA 3FAHA 2R7FA 2BS4B 1EWCA 2TSSA 4RGOS 3ABVB 1ESFA 4GDLB 2WXIA 2P8RA 1EWYC 4MSDA 2LFIA 3KQ4A 1D5MC 4IOIE 1XCQL 4WQMA 3BVMA 3IXSA 2AX5A 4P9CA 2WU5B 1QT9A 1EU3A 1TY2A 2PIAA 2R61A 1CZPA 3W2DA 2WXRA 3AM9A 3BK2A 1ZUD2 1ZPSA 2Z3IA 2ONQA 4ZRQA 4CQNA 4PQTA 1C77A 2JYTA 3V3XA 4BGDC 1I4PA 5I4DA 4ZOHC 3B2GA 4OZCA 3AECB 2L52A 2PTLA 2LGIA 2MJ3A 3LYYA 2KWDA 2RPVA 3MC0B 4FXCA 2LEKA 2K9XA 4MSQA 2DBYA 1FXAA 3FC4A 4JPSA 1MPEA 2V3NA 1VLBA 1QQRA 1WKQA 1I4QA 1VZ7A 3AMZA 1YJJA 4HKZE 3VRAB 1XLOA 1V1PA 2A8NA 1TS3A 4JE3B 4OVZA 2ZW0A 4G3MA 5HHDG 4HEA1 4P6VF 4KITC 3TEXA 2K3UA 3B9JA 3P4PB 1I4HA 4RNAA 4UDUC 1RB7A 2O7PA 3MPZA 1L0YB 4XE0A 1JWUD 2O96A 2WNMA 1C79A 1NYQA 2NMQA 2KKSA 4ITKA 3BVZA 4D2KA 1MI0A 2ZW1A 1XLNA 2RPZA 5HI1A 2NX8A 1GAQB 2PY5A 4RGMA 1L4DB 1ZXHA 3NVYA 1TY0A 3PO0A 1K52A 5C2OA 4RCOA 5GAOA 5AUKA 1I7HA 3LB8C 2OG4A 1M4VA 1UGJA 2N9KA 1CTTA 3L4PA 3Q8AA 2QLCA 1FFUA 1YMHE 1K53A 3WCQA 4O1NA 4DXFA 3NS1A 5AUIA 1V1PB 4ZRPA 4HJGE 3ZGZA 3W9CB 1FM0D 1QILA 1TS2A 2LHDA 3TUOA 1B1ZA 2IJ0A 2G6VA 2W54A 1PUTA 2RDHA 1N63A 1QKZA 5CW6A 2BW2A 2MEKA 2J42A 5D7GA 2HTME 3RPFC 1FO4A 4HROA 1MQ0A 1XI1A 2GI9A 4ZD4A 4LTUA 3IAS1 1FCCC 4LCPA 2LJIA 4ARCA 1HEZE 1F2RC 4NAMA 2N7JA 3P63A 4WH4A 1WGKA 2ICIA 4KX6B 4MS7A 2KMMA 3P4QB 4EE2A 4AS1A 4F7OA 2V4IB 1CJEA 1UUPA 1R5XA 3G8QA 4P9EA 5H8YE 2GB1A 2KDMA 3ZQ4A 1SSNA 1R5TA 1V97A 1AYFA 5D3DA 2AQ3B 1MVKA 2PLPA 1TKEA 1EM7A 5G5GA 1IGDA 2W3SA 2E6XA 3DH1A 1PGXA 1UX0A 3PZ7A 2WXNA 5JXVA 4R3DA 5FR3A 3P42A 4C7YA 4NJCA 4A9AA 1OI0A 1ZABA 4RGTA 1XXGA 4OZAA 3DWMA 1FIQA 4GDKB 3Q69A 5BYSA 4XWWA 1MHXA 2L1AA 2HXVA 3MFGA 3BVGA 1P6OA 3SBGA 1DGJA 1RYJA 3VQIA 4J3OD 2DLBA 1A70A 4L1BA 2D30A 4RF1A 3AEBB 3R2IA 1WN5A 1KH0A 2PW9A 2BS3B 2YEPB 3CIRB 4RF0A 3AE9B 4TQ0A 3TEWA 2W4LA 1R7SA 1WWRA 4O8XB 4P16A 3RZUA 1ACCA 2FE8A 1FRRA 3KLSX 1IGCA 5EE9A 3BYTB 2EELA 3O13A 1V1OA 3HVDA 1VQ2A 3B2FA 1BXTA 2CU3A 1JALA 1L6UA 1NYRA 2CJOA 3GS2A 1HZ6A 4ZYSA 1SE2A 2JQRB 4TSSA 1PFDA 1NENB 1YSBA 1FD6A 1GB4A 2LMCA 4YTNB 2O3KA 2Z3JA 2K5PA 1PDXA 4ARIA 1STEA 2O95A 5BYQA 1P7EA 3HVZA 1T5XD 3TEYA 4ZHOA 2DWQA 1GPXA 2K22A 2AQ2B 2E3TA 3Q8CA 1ZDVA 2OHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RB7 A;  1OX7 A;  2O7P A;  1K51 A;  1TIY A;  3MPZ A;  3MP9 A;  2LUM A;  2O96 A;  2KKS A;  5BMI A;  2NMQ A;  4HRQ A;  2KAC A;  1XHZ A;  4D2K A;  2FR6 A;  1MI0 A;  1YSD A;  2ZW1 A;  2RPZ A;  4LD4 A;  3ZEF B;  3R2N A;  5HI1 A;  1JML A;  4LCO A;  2NX8 A;  4OCM A;  4EG2 A;  3UI3 A;  2PY5 A;  1F2R I;  1ZXH A;  3IJF X;  2N9L A;  1UAQ A;  1K52 A;  5C2O A;  5GAO A;  2NYT A;  2D5N A;  2ON8 A;  2I2Y A;  4HRW A;  1MHH E;  4WIG A;  2OG4 A;  4O8Y A;  4LC5 A;  2N9K A;  4NQL A;  2JXT A;  1CTT A;  1XF5 L;  4OCN A;  3ZPC A;  4P9D A;  2QLC A;  2IGD A;  2PZS A;  3OJ6 A;  1YMH E;  1K53 A;  4OCN B;  1Z3A A;  2JSV X;  3ZPG A;  2G84 A;  4K1R A;  4HJG E;  5HFY A;  4LD2 A;  2KN4 A;  1P7F A;  4I43 B;  2LHD A;  2G6V A;  1PGB A;  2B3Z A;  1PGA A;  2IGG A;  1UX1 A;  1Q10 A;  1QKZ A;  5CW6 A;  3B8F A;  1MQ0 A;  4OWP A;  1XI1 A;  2GI9 A;  2J52 A;  2RMM A;  1AF2 A;  4ZD4 A;  1FCC C;  4LCP A;  1HEZ E;  2LHE A;  1F2R C;  4JXE A;  4ZFR A;  2JU6 X;  2N7J A;  2P87 A;  4D10 F;  4WH4 A;  4OCM B;  5HG2 A;  1CTU A;  4MS7 A;  1XCT L;  4QFT A;  1YNT E;  1JTK A;  4F7O A;  5M52 C;  2B3J A;  3GB1 A;  5BMG A;  2ZNV A;  3G8Q A;  1R5X A;  4P9E A;  2QMT A;  2GB1 A;  2KDM A;  4O8Y B;  2OED A;  1R5T A;  2HVW A;  5DCA J;  3E1U A;  2I38 A;  1MVK A;  2PLP A;  2KCQ A;  1EM7 A;  4F3W A;  1IGD A;  2Z3H A;  3FI7 A;  3DH1 A;  1PGX A;  1UX0 A;  4OCL A;  3OCQ A;  5JXV A;  3DMO A;  2EX3 A;  2ZNR A;  1OI0 A;  1ZAB A;  4OZA A;  2JZP A;  3RZV A;  2R7F A;  4MSM A;  1FCL A;  1MHX A;  3EX8 A;  4E0Q A;  2PYJ A;  2P8R A;  4WIF A;  1HZ5 A;  4OWP B;  2HXV A;  1GB1 A;  2K0P A;  1P6O A;  2OBC A;  1IBX A;  3SBG A;  2FR5 A;  4MSD A;  4IOI E;  4KGS A;  1C9F A;  1XCQ L;  2D30 A;  4ZFT A;  4P9C A;  1WN5 A;  1KH0 A;  2PW9 A;  4O8X A;  4GLS C;  2HVV A;  2W4L A;  4O8X B;  1WWR A;  1UWZ A;  2QSD A;  3RZU A;  4KGT A;  1IGC A;  2EEL A;  1D4B A;  2Z3I A;  2ONQ A;  2PYL A;  4MAC A;  4PQT A;  1VQ2 A;  3V3X A;  4BGD C;  4ILG C;  4OCL B;  2IGH A;  4OZC A;  2PTL A;  5M59 B;  2LGI A;  5BMH A;  1HZ6 A;  2KWD A;  2RPV A;  4OZB A;  2J53 A;  2KQ4 X;  1YSB A;  4MSQ A;  4MSJ A;  1WN6 A;  1FD6 A;  1K50 A;  1MPE A;  1UWX A;  2JWU A;  1ALN A;  1GB4 A;  4ZD5 A;  2O3K A;  2Z3J A;  1WKQ A;  1XHX A;  4HKZ E;  1IBX B;  3FIL A;  1P7E A;  2O95 A;  2Z3G A;  2A8N A;  3FIL B;  2ZW0 A;  4IKG A;  4G3M A;  4KGR A;  5HHD G;  4KIT C;  4LCN A; 
#chains in the Genus database with same CATH topology
 2RD0 A;  2N0S B;  3QHT A;  2LUM A;  4YSZ B;  3ENE A;  2FR6 A;  1C4A A;  2REX A;  3EFU A;  1I42 A;  1FNU A;  1LXD A;  3P1M A;  3AE2 A;  1R4M B;  3RZF A;  1F77 A;  2DYM A;  2DNF A;  2PPH A;  2L0F A;  3BZD B;  2JSV X;  1KFY A;  4AUQ C;  1F1H A;  2J0K A;  4RMA A;  1TJE A;  4ZHP A;  3H8H A;  3WA0 A;  3SR6 A;  2NR2 A;  3TBL D;  1JQ4 A;  1KRH A;  2V3S A;  1SF0 A;  2H88 B;  2B3J A;  1T0Y A;  3I3T B;  3U2S C;  2BYE A;  4MGZ E;  2HVW A;  4PYU A;  4IC7 B;  2I38 A;  2XK5 B;  3AN1 A;  2WXG A;  4OCL A;  1JWS D;  4N6E B;  1AL2 4;  4K1R B;  3ZUN A;  1UBI A;  3PSE B;  1A5R A;  2KWV B;  3EX8 A;  4IM2 A;  4WIF A;  1E7U A;  1GOZ A;  2G45 B;  1BML C;  1PL0 A;  3DBS A;  4LNK A;  4PYZ A;  4WWP A;  1WSP A;  1C9F A;  1OQQ A;  3CIR A;  4LK0 M;  4N59 A;  4O8X A;  3JYU A;  3QC8 B;  1Z2M A;  2G9H D;  2QSD A;  4KGT A;  1ZCZ A;  3AE6 A;  1NVI D;  2JXX A;  2IY1 B;  1VCB A;  1FXI A;  1CQV A;  1WF9 A;  1NA1 D;  3QQ8 B;  1V6E A;  3DHI C;  2J53 A;  2JT4 B;  4W9J A;  4RGN A;  2O6V B;  2ASQ A;  4FHK A;  4A90 A;  1FXT B;  1YN3 A;  3KYD D;  1HE8 A;  1K51 A;  4YTM B;  1FRD A;  3HHM A;  3BYY B;  2W55 A;  4LCO A;  4YTP B;  2HWB 4;  4EG2 A;  2X5I D;  3VVW B;  1F2R I;  1RWS A;  3NVV A;  3UQA A;  2WQY A;  1WR6 E;  1HXS 4;  2G4D B;  2MP2 A;  2ZPY A;  4CO7 A;  4LCD E;  1EF5 A;  4OCN B;  4P1B C;  3JSV B;  5HFY A;  1EV1 4;  2GBK A;  1KF6 A;  1UX1 A;  1SJH D;  2CR5 A;  1N62 A;  2H89 A;  1THZ A;  2LWP A;  1WRI A;  2H88 A;  3TCA A;  1PO1 4;  1FMA D;  1V81 A;  3M3J A;  2LRW A;  2SAK A;  2XK5 A;  2X38 A;  4HCN B;  3IT4 B;  3ZKJ C;  4O8Y B;  2IU0 A;  3ZYY X;  4LDT B;  2RS3 4;  4EOY A;  2W82 A;  1VZ6 A;  4HK2 A;  1K5M D;  3APF A;  4PT5 A;  3AED A;  2G1E A;  3KUZ A;  2WDV B;  3Q8F A;  1IYF A;  3R2T A;  1RM6 C;  1VBA 4;  3NZU A;  3AE8 A;  4KGS A;  4FLH A;  4W9I A;  4C4V A;  4A1O A;  4HWI B;  1ISN A;  1D5Z C;  2PKO A;  1N60 A;  4GLS C;  2KFK B;  2N7D A;  2LGD A;  2HVV A;  2KLG A;  3PRE A;  2WDQ B;  3SFD B;  4KKJ A;  2PYL A;  4MAC A;  1XD3 B;  2DYB A;  3S2A A;  3AE4 B;  1YX5 B;  2B76 A;  2XNA C;  2D3A A;  3QAR A;  1F52 A;  3AE1 A;  4HDO A;  2VH1 A;  5IO9 A;  3QWZ B;  1IBX B;  2KDI A;  2JVC A;  2Z3G A;  4HRS A;  1AR7 4;  1MG4 A;  3E9S A;  4YTM A;  2CKH B;  2EKI A;  1AR6 4;  3HUI A;  4HCP B;  4AOF A;  4E74 A;  4YTP A;  1YSD A;  3T9L A;  3N32 A;  3UIN B;  2NTT A;  3N20 C;  1J7B A;  4HRW A;  3T3N A;  2JXT A;  3U7D A;  3I57 A;  4AJY B;  4OCN A;  1D5X C;  4WUR A;  3JSV A;  5AZH A;  2KT7 A;  1IPG A;  3NRZ A;  4YXD A;  2DZM A;  4MEM A;  5DPW A;  3IAM 1;  2Z0E B;  2VH2 A;  4NAW B;  1ET9 A;  5KHQ A;  2IBI B;  2WP9 B;  1TS4 A;  4WWO A;  2M56 B;  4D10 F;  4OCM B;  2WU5 A;  3GB1 A;  2BB6 A;  2GOW A;  4EHI A;  2KK8 A;  3DVG Y;  4B0M A;  3DBR I;  3U8Z A;  3WAL A;  3AI5 A;  4NPN A;  1TS5 A;  3RNB C;  1C4P A;  4WWM A;  1PYW D;  1L5P A;  2FAZ A;  3UGB B;  5IP4 D;  2KC1 A;  3QK0 A;  2IZV B;  3OJ3 A;  2WDV A;  4KDI C;  2WXI A;  4W9E A;  1EWY C;  5G55 A;  2LXC A;  4WJP A;  3H6N A;  4WQM A;  1H4R A;  1WX8 A;  3C19 A;  4YL8 A;  2KFK A;  1QT9 A;  1TY2 A;  4PK1 A;  4XC2 A;  1CZP A;  3W2D A;  2LAS A;  4A3O A;  3R66 C;  3BK2 A;  2ZNV C;  3AE4 A;  4ZRQ A;  4PQT A;  3V3X A;  4LNF A;  3AEC B;  2DZI A;  4DHZ B;  2L52 A;  3LYY A;  2LEK A;  1RUG 4;  4TKN A;  2GBR A;  4ZRJ A;  1MPE A;  1I4Q A;  1VZ7 A;  3AMZ A;  1V1P A;  2A8N A;  3EEC A;  3ZVV A;  1WMH B;  3MTN B;  2K3U A;  3MPZ A;  4XE0 A;  1V86 A;  1P9D U;  4F8C B;  1NYQ A;  2NMQ A;  4ITK A;  4AWJ A;  3BVZ A;  4D2K A;  4DDI D;  3ZNH B;  1GAQ B;  4RGM A;  2G3Q B;  1TY0 A;  2L00 B;  4K3C A;  5IKC M;  5C2O A;  1V9J A;  5AUK A;  1H8T D;  3LB8 C;  1RUC 4;  2JRI B;  4I6N B;  3L4P A;  4EZK A;  4EEW A;  2KWC A;  3QIJ A;  2K6D B;  1FM0 D;  4M8M A;  1TS2 A;  2PLV 4;  4MGI E;  1B1Z A;  2KD0 A;  2G6V A;  1PUT A;  5JHB A;  2N1W A;  2GBJ A;  4HRO A;  4LTU A;  4IUM B;  4LCP A;  2LJI A;  1N6Z A;  4ARC A;  1HEZ E;  2G4S A;  3N1X C;  2AWT A;  2IO3 B;  4WH4 A;  3P4Q B;  4EE2 A;  4AS1 A;  3ZNI D;  4P7I A;  3ZQ4 A;  1SSN A;  1TKE A;  1EM7 A;  1IGD A;  2CU1 A;  2KZR A;  1OEY A;  4E3C A;  4FAD A;  3PZ7 A;  4R3D A;  5FR3 A;  3P42 A;  4A9A A;  2ZPN A;  1OI0 A;  4RGT A;  3RNC C;  3L16 A;  1P6O A;  4W9K A;  1RYJ A;  4J3O D;  3QCA A;  3RN9 C;  1WN5 A;  2KNB A;  2YEP B;  1WI0 A;  3AE9 B;  3TEW A;  2W4L A;  1R7S A;  1WWR A;  3RZU A;  1ACC A;  2FE8 A;  3KLS X;  3BYT B;  1GJZ A;  3HVD A;  1YJ1 A;  2KTF A;  5LXH A;  1JAL A;  1PFD A;  1NEN B;  3RYT A;  4EZL A;  2YVC A;  1PDX A;  4ARI A;  3GOE A;  3A9J A;  5BYQ A;  3HVZ A;  1WY8 A;  2KX3 A;  3TEY A;  1E8W A;  2BKF A;  2K22 A;  1WX7 A;  1ZDV A;  3R3M A;  3VUY A;  1PKX A;  1TIY A;  1GC7 A;  3T3O A;  3IVF A;  2INC C;  1QOG A;  4G50 A;  2QEJ C;  3SHQ A;  3Q8B A;  3QA8 A;  1FNV A;  3L54 A;  1Q1O A;  1KJT A;  4TMA B;  2FCM A;  2KDE B;  4MT5 A;  3KYC D;  1R4N I;  3LXF A;  2IY0 B;  3TEZ A;  4YSX A;  1PO2 4;  1QOA A;  3K9O B;  1P3Q U;  3PV1 A;  3NOB A;  1L0V B;  2WXK A;  2I1J A;  5AZF A;  2IO0 B;  3AH7 A;  3V05 A;  3ZJV A;  1L0X B;  5EE0 A;  5T8I A;  3HK0 A;  1E5W A;  1KLU D;  3AE2 B;  1MQT D;  3MHZ A;  3GZN B;  4ZYN A;  4JWS C;  3VTU A;  3BK1 A;  3X0W A;  3V6E B;  1AWD A;  1KFY B;  2IND C;  2IU3 A;  2DX5 B;  2CS4 A;  3Q3M C;  1RFK A;  1YQ3 B;  1EAH 4;  3W1S C;  3L17 A;  2OBC A;  5G5H A;  3DHH C;  3VH3 B;  2WXF A;  2KJR A;  4ZFT A;  1COV 4;  4YSY B;  2MLB A;  4HPP A;  4J6E A;  1RUI 4;  3AB5 A;  5C2T B;  3CST A;  1Y56 A;  1X1M A;  3UIO B;  1ZP0 B;  4W9G A;  4N9F 4;  4OCL B;  1LM8 B;  3ECI A;  2KVZ A;  1WYW B;  1NEN A;  2RS5 4;  2MCN B;  4IG7 B;  2IYD B;  3N1Y C;  4A55 A;  2M19 A;  2WS3 B;  3NHE B;  2QIL A;  3OJ4 B;  3ML9 A;  4E71 A;  1ET6 A;  1PQS A;  2EKE C;  3FIL B;  2NPT A;  1FFV A;  2MHJ A;  1M94 A;  1OX7 A;  3ZNZ B;  3ZXV A;  1RUH 4;  2Y5C A;  1FEH A;  1N5W A;  2IDY A;  5BMI A;  2C5L C;  1ZDX A;  2ZEQ A;  4RH6 A;  2WLB A;  3AE6 B;  2D07 B;  4LD4 A;  2D5G A;  4YT0 A;  3RD2 A;  3ZTC A;  2XN9 C;  5FK9 C;  4LC5 A;  1SBB B;  3BII D;  4MGY E;  4US9 A;  5CHF A;  5DCN A;  2BT6 A;  1J8C A;  3OJ6 A;  1DOY A;  2FUG 1;  4LD2 A;  3W5V B;  1U4A A;  1PGB A;  5D94 A;  1BEV 4;  1SE9 A;  2JWZ A;  3JD7 4;  4OWP A;  2Z0D B;  2GRI A;  1P98 A;  2WYQ A;  2KLC A;  5IN7 A;  4DBG A;  2KQ7 A;  1L6V A;  1WWT A;  2WQY B;  1YD8 U;  1J7C A;  1SXT A;  3A9K B;  1LGR A;  1WXS A;  2V3P A;  3IT6 B;  2KCQ A;  2MP2 B;  1T6B X;  2DYO A;  3IG3 A;  4NY0 A;  4XYC A;  4CYE A;  1KF6 B;  4JGH B;  3AEG B;  2JZP A;  2A4Z A;  1YQ3 A;  3BWU D;  3RFZ B;  2KC2 A;  3TJP A;  2PYJ A;  5D3I B;  5LNK 1;  3HM6 X;  4HJK A;  1P4R A;  4MJS A;  2H89 B;  2KTR B;  4KKI A;  1RUF 4;  4YSY A;  3Q3J A;  2N9E B;  2M8S A;  5C2T A;  4AQ7 A;  2RR1 4;  3RI7 C;  1LO5 D;  1UWZ A;  3ZXR A;  1ZP0 A;  1ZKH A;  4WAA A;  2C9W B;  2IGH A;  4US8 A;  4L23 A;  4Q4W 4;  3M95 A;  2LD9 A;  3AED B;  4MSJ A;  1D4M 4;  1WN6 A;  2WS3 A;  5EDS A;  1KTK A;  1SE4 A;  1E7P B;  1RRB A;  3FIL A;  3QX1 A;  1R4M I;  1OGW A;  1N61 A;  3AE8 B;  1WE6 A;  4C4V B;  4IKG A;  2D10 A;  4KGR A;  3RT3 B;  1SIJ A;  2EMS A;  4K7W A;  2BBC A;  3MP9 A;  4KV2 A;  2K39 A;  4HRQ A;  1CK1 A;  2KAC A;  2RPQ A;  4WIP A;  3PT2 B;  3ZEF B;  2B76 B;  4KSK C;  2N9L A;  3EUB 2;  1E10 A;  3I63 C;  2WU2 A;  2DAJ A;  4GB9 A;  3AE1 B;  4K81 A;  3P4R B;  2PZS A;  2WGS A;  3ZPG A;  2DZJ A;  4JWU C;  4FHJ A;  5G2N A;  3VHT C;  3KH0 A;  2G84 A;  3PGE A;  3VH4 B;  4RHV 4;  2BKR B;  2LI5 A;  4M0W A;  4GDL A;  1TZ1 A;  3PHX B;  1AF2 A;  5JH5 C;  4A3P A;  1TGZ B;  5EE3 A;  4JQW C;  5TR5 A;  1CTU A;  1WYG A;  1TBE A;  5M52 C;  2JRH A;  3A9K A;  2BQQ A;  2QMT A;  1UD7 A;  3AEF B;  5L95 C;  1JRU A;  3MC8 A;  3E56 A;  3AEG A;  3ZDM C;  4EUT A;  2K25 A;  1VRA B;  4YXD B;  5EE1 A;  2LGS A;  1EWC A;  2K8C A;  4M02 A;  2BPS A;  1AR8 4;  2KTR A;  4IM3 A;  4FUL A;  1C1Y B;  3DPD A;  4J6I A;  4HPM B;  5C1Z A;  1PVC 4;  3GQH A;  4P9C A;  2QDF A;  2WU5 B;  2KDB A;  2WXR A;  2V9H A;  3AM9 A;  1LQB A;  2ONQ A;  3JBG 4;  4IWP A;  4BGD C;  1I4P A;  2D3B A;  3BY4 B;  4FXC A;  1RAX A;  2MJ3 A;  2RMU 4;  3MC0 B;  1WRD B;  2KO3 A;  2K9X A;  1S3S G;  4MSQ A;  3FC4 A;  4JPS A;  2V3N A;  3VDZ A;  1QQR A;  5DPS A;  1YJJ A;  4HKZ E;  3P2B A;  2N7E A;  2FUH B;  3NY5 A;  4JE3 B;  4OVZ A;  2ZW0 A;  4G3M A;  5HHD G;  4HEA 1;  4P6V F;  4KIT C;  3Q6B A;  4UDU C;  3Q3N C;  3PRM B;  2WNM A;  2FCS A;  2MBH A;  3IHP C;  3W1Y A;  1XLN A;  2L05 A;  2KDF B;  2PY5 A;  3NVY A;  2D2Q A;  1I7H A;  1RLF A;  1EF1 A;  4TV3 A;  1KLV A;  3P4R A;  4BOS C;  2FNJ B;  2QLC A;  3SUC A;  1YMH E;  1VBB 4;  4DXF A;  1WXM A;  3PTF C;  1V1P B;  4HJG E;  3ZGZ A;  1QIL A;  4NJ6 A;  3B1L X;  2RDH A;  2BW2 A;  2J42 A;  2JZ3 B;  5D7G A;  1FO4 A;  1XI1 A;  3MC9 A;  2PE6 B;  2K1F A;  2IO1 B;  1T0Q C;  3ZLZ A;  4F7O A;  2V4I B;  1CJE A;  1UUP A;  4PS8 A;  4FN2 A;  3AEF A;  2GB1 A;  1V97 A;  5D3D A;  3ZTD A;  2E6X A;  3DH1 A;  2OJR A;  1V80 A;  1UX0 A;  1OOP D;  2WXN A;  4C7Y A;  3MHS D;  1XXG A;  2AL3 A;  4XWW A;  3RNE C;  4ACF A;  2V4L A;  3SBG A;  1DGJ A;  3VQI A;  1A70 A;  3OLM D;  2D30 A;  3AEB B;  4BKG A;  2BS3 B;  4RF0 A;  1NDD A;  4TQ0 A;  2BF8 B;  3NJT A;  5EE9 A;  1FRR A;  1IGC A;  2ZZP B;  4TUU A;  2LUE A;  2GBM A;  3Q3F A;  4ASW C;  3B2F A;  1BXT A;  2CU3 A;  3RUI B;  2MA9 B;  1NYR A;  2CJO A;  3ZRC A;  1HZ6 A;  1SE2 A;  2JQR B;  4DHJ B;  3M62 B;  4TSS A;  1CMX B;  2WDR A;  2W9N A;  2K5P A;  2KVR A;  4LNI A;  2O2V B;  1T5X D;  2MSE D;  1HRI 4;  3ONS A;  5LXI B;  2PIA A;  2E3T A;  3Q8C A;  1HQR D;  4HVB A;  3WAP A;  3U30 A;  4NNJ B;  4C80 A;  1KOT A;  4ZRK A;  3A4S C;  2NCN A;  2R2O A;  3UI3 A;  2KYW A;  3U52 E;  1WX9 A;  3TSS A;  2D5N A;  2QHO A;  2RM2 4;  1IUE A;  4NQL A;  3DWG C;  3ZPC A;  2BYT A;  1T0S C;  3A9J B;  1S1Q B;  1FPY A;  1I4X A;  3PRP B;  2Z8L A;  3N1Z C;  4C7Z A;  4XGA B;  1VD2 A;  2PVO D;  2M17 A;  3RNF C;  1R08 4;  3VR9 B;  5HG2 A;  5J2R A;  2GMI C;  1I4R A;  3VUW A;  2AEH A;  5BMG A;  1WXV A;  2Y5B B;  4EFO A;  3E1U A;  4YSX B;  4BOZ B;  1VJK A;  2X8X X;  3H7P A;  2EX3 A;  3PPA A;  1HTQ A;  4MSM A;  4RFB A;  1FCL A;  1YN5 A;  1HZ5 A;  3DHG C;  2MJE A;  4M00 A;  2KHW B;  3AEB A;  1WGR A;  2R06 4;  2CHZ A;  2OOB B;  4LJP B;  3AE5 B;  3AEE B;  4IM0 A;  4BBN C;  1VBC 4;  1SGH A;  4OHJ A;  2VRR B;  5GXG B;  2JPH A;  5FKA C;  1JCK B;  1WGH A;  3RNA C;  3HM3 A;  2SEB D;  2KJ6 A;  1RUD 4;  4L2Y A;  1YJI A;  4Q4Y 4;  1K50 A;  4YWG G;  2WXP A;  2N4F A;  1ALN A;  2O2V A;  1NI3 A;  3A1Q B;  1JRO A;  1L0V A;  1N5X A;  2B1G A;  1F0Z A;  2AL6 A;  1WJ6 A;  2NBV B;  3NVZ A;  1SEB D;  3RMK C;  3NZS A;  5E6J A;  3SFE B;  4LCN A;  3AV8 A;  1KLG D;  2IPK D;  2KJH B;  3V62 A;  1QF6 A;  4XDD A;  2NBW B;  2V0G A;  3R2N A;  2UWQ A;  1ENF A;  1JML A;  3GQK A;  1J0G A;  4BKS A;  1UH6 A;  4PDW D;  5C23 A;  4ANW A;  2N9P C;  3ZJU A;  2UU7 A;  3ALB A;  4P9D A;  2WXQ A;  2KKC A;  3QJZ A;  2ACZ A;  2ZVN A;  2J0M A;  4XDC A;  2C60 A;  2KN4 A;  2KMC A;  4BAX A;  2NPT B;  1SB3 C;  2XEW A;  3R8B A;  4EKU A;  2QIE B;  3VR8 A;  1WFY A;  3VRB A;  2WDT B;  4A20 A;  4ANV A;  3Q8E A;  3V6C B;  3O65 B;  4AP4 C;  3DVN U;  3VR9 A;  1MJD A;  4WJN A;  1YNT E;  2Y5P A;  3DBL B;  4YT0 B;  5H92 C;  5JHA A;  2FBW B;  4TQ1 A;  2R07 4;  3AE3 A;  2WXH A;  2PJH A;  1DYQ A;  1WM3 A;  3VFK A;  3FI7 A;  4S0R A;  1DOI A;  2J7Q B;  1L2N A;  2L76 A;  2RGF A;  1QLB B;  2QJL A;  3KW5 B;  2YLM A;  4B9K A;  3A4R A;  3KUD B;  4OWP B;  1GB1 A;  2D11 A;  1ZW7 A;  1JWB D;  4MM3 B;  4Q4X 4;  1H8C A;  3AE5 A;  3AEE A;  1SIF A;  2A5U A;  3CMM B;  4HKQ A;  2KMA A;  1F9J A;  3D32 A;  4IDI A;  3X23 A;  1T3Q A;  4LJO B;  3W5U B;  5BMH A;  1EUV B;  3A1Q A;  2JWU A;  3JW0 X;  4GU2 A;  1WE7 A;  1XHX A;  1HXY D;  1OQY A;  4MJS B;  3MJ5 A;  2C7M B;  4HDQ A;  3SFE A;  2BTE A;  1TYG B;  3ZNG C;  2BWF A;  3J9C A;  4BVU C;  3DBH B;  3ZJT A;  2B1I A;  1C76 A;  1GC6 A;  4LNO A;  3I5J C;  1XHZ A;  1C4C A;  2L3Z A;  3NVW A;  1YQ4 A;  2L83 A;  2HDE A;  4PS7 A;  2NS5 A;  3PZ8 A;  2LVP A;  1AR9 4;  2MW5 A;  1NEK B;  1UNS A;  3JVZ X;  3HIZ A;  2VZK B;  1UGM A;  3C8Y A;  4K3B A;  4A8X C;  4JX1 C;  1TZO A;  3AU4 A;  2IGD A;  2WXO A;  4K7S A;  3Q14 C;  3GZN I;  4XWT A;  1P7F A;  5IA7 A;  2QC8 A;  1WZ3 A;  4I6P A;  1PGA A;  2IO2 B;  3APD A;  2L8J A;  1E7V A;  2FID A;  3J8F 4;  3VXW A;  4FJZ A;  4N58 A;  1ZXI A;  2L7R A;  2NBU A;  2LHE A;  4JXE A;  4MH0 E;  2FBW A;  4IWQ A;  2ZNV A;  4KZ0 A;  2WU2 B;  2Y3A A;  3BIN A;  2YEP F;  3AE7 B;  1KM7 A;  2DEN B;  3CSF A;  5CHW A;  4F3W A;  1AW7 A;  4GGM X;  1E90 A;  3DMO A;  2WXJ A;  1G8M A;  3P4S B;  1YN4 A;  3FAH A;  2R7F A;  3TMP B;  2BS4 B;  2AYO B;  4M0W B;  1ESF A;  4GDL B;  4LNN A;  3VRA A;  4MSD A;  3K9P B;  4MM3 A;  1D5M C;  4IOI E;  2BWE S;  3DVN V;  2R61 A;  3P4P A;  3L0W B;  3PLU A;  1QZE A;  4W9C A;  1ZPS A;  5CX3 A;  5IAA C;  4CQN A;  1C77 A;  5I4D A;  2RS1 4;  3LJ3 A;  3B2G A;  4B6W A;  4OZC A;  4IW0 A;  2PTL A;  4DHJ D;  2DBY A;  3EC8 A;  1WKQ A;  1P0R A;  5AEK B;  3TL5 A;  1YQB A;  5AZG A;  2NVU I;  1TS3 A;  1G6J A;  2I1K A;  1V5O A;  3B9J A;  3TEX A;  5IOI A;  2O7P A;  2R04 4;  1L0Y B;  2QCZ A;  1C79 A;  2CHW A;  5HKH A;  1MI0 A;  2RSU A;  2RPZ A;  3B0A A;  4W9L A;  4WJO A;  2NX8 A;  1D3Z A;  1NEK A;  1L4D B;  3RNG C;  4BKS D;  4RCO A;  5GAO A;  2MBB B;  1J19 A;  4MSQ B;  1M4V A;  4IWO A;  1CTT A;  4S17 A;  1K53 A;  3WCQ A;  4O1N A;  2L0T A;  4RM9 A;  4ZRP A;  3W9C B;  2LHD A;  3TUO A;  1TTN A;  2HTH A;  2IJ0 A;  1WGY A;  1WGD A;  4FJV B;  4GDK A;  2LXA A;  2MBE A;  2MEK A;  2DZK A;  3RPF C;  1MQ0 A;  2GI9 A;  4ZD4 A;  3IAS 1;  1FCC C;  3PHW B;  2N7J A;  2KX0 A;  1WGK A;  2ZCB A;  4KX6 B;  1WJ4 A;  1Z7S 4;  4BBN F;  3L13 A;  1UEL A;  1R5X A;  3AE7 A;  2KDM A;  1R5T A;  2KN5 A;  1AYF A;  2FIF A;  5G5G A;  1MVK A;  2PLP A;  3UF8 A;  4B95 A;  1YX6 B;  2OJW A;  2W3S A;  3P4S A;  1XQQ A;  5JXV A;  1I35 A;  4NJC A;  2LGX A;  1ZAB A;  4OZA A;  3ZZM A;  5E6P A;  1MHX A;  3MJW A;  2HXV A;  1E8X A;  3PVL A;  3PRZ A;  2WHI A;  4DDG D;  4RF1 A;  3N3K B;  1KH0 A;  2PW9 A;  4BFR A;  1WZ0 A;  4GB3 4;  4P16 A;  4YSZ A;  4JL9 A;  3O13 A;  4NJ7 A;  2JF5 A;  1L7Y A;  4MGK E;  4GGQ A;  1ZGU B;  3WAM A;  1L6U A;  4ZYS A;  3GS2 A;  2HWC 4;  2JUO A;  3ML8 A;  2J0J A;  1FD6 A;  1WJU A;  2LMC A;  4YTN B;  1STE A;  1P7E A;  1WIA A;  3V61 A;  4ZHO A;  2MRP A;  4BZA A;  3ZW3 A;  3AU5 A;  4II2 B;  2OHF A;  1XLP A;  4KZC A;  1NBF C;  2AQ1 B;  3A33 B;  2L32 A;  3PS6 A;  4ZRI A;  3L08 A;  1QOF A;  4DXG A;  1C3T A;  1RUJ 4;  1E8Z A;  2NYT A;  2I2Y A;  1VR9 A;  2WDR B;  1XF5 L;  2HD5 B;  2PVG C;  5E6O A;  2KXJ A;  3T8M A;  4K1R A;  4I43 B;  4F7Z A;  3UIP B;  3W1S A;  2B3Z A;  2R2Q A;  5TSS A;  3ZO5 B;  4KX6 A;  2KQS A;  4QFT A;  3AUL A;  1JTK A;  1AN8 A;  1WXA A;  3NG0 A;  2OED A;  2J4X A;  4NQL B;  4B0E A;  1JW9 D;  4ANX A;  1K8R B;  2B3A A;  1D6E C;  5D6J B;  1E0Z A;  1OQR A;  2KAN A;  4JIO U;  3U7Z A;  2O6V A;  2GBN A;  2FR5 A;  4OW0 A;  4REZ A;  1JWA D;  1L4Z B;  2PMV A;  2MH7 A;  3CF6 E;  3DBR B;  2INP E;  3NUH B;  3VX8 A;  1T0R C;  2KOX A;  1QOB A;  5DPR A;  2K8H A;  2Q5W D;  1YOV B;  2ZJD A;  1VBE 4;  4H2A A;  4ILG C;  2LGY A;  3I9V 1;  1RFA A;  3H7P B;  1Q5W B;  1ZOY B;  4OZB A;  2JY6 A;  2KQ4 X;  1XT9 B;  4YTN A;  4MSM B;  1TKY A;  1TKG A;  1SJE D;  3OAW A;  2LZ6 A;  3KWV A;  1WXQ A;  4KDL B;  1MFW A;  1V8C A;  3KWL A;  3VUX A;  1GNU A;  3V60 A;  2N1V A;  4A6Q A;  4GN1 A;  5BYR A;  4ZDV A;  2JZZ A;  5L83 A;  1NCQ D;  1J7A A;  4GXB A;  2M1M A;  5FR6 A;  1C78 A;  2FCQ A;  4PS3 A;  3IJF X;  4GMV A;  3ZIM A;  1ROE A;  4KVG B;  5E6N A;  4WIG A;  1E9M A;  2VZK D;  4O8Y A;  1ZE3 D;  4QAY A;  3ETR A;  5J18 A;  1FNW A;  1WH3 A;  4FA6 A;  3WIM A;  2IGG A;  1Q10 A;  4M8N A;  5MPO A;  1I4G A;  3SU8 X;  2WWZ A;  4MDK E;  2RDG A;  1Z5S B;  2J52 A;  2BS2 B;  3AEA B;  2N9X A;  3M63 B;  3URY A;  1UWM A;  2JU6 X;  2P87 A;  4LLG M;  5CHV C;  3U4E G;  1JRP A;  3SEB A;  4F1S A;  2W3R A;  3AXC A;  1UBQ A;  5CTR C;  2KAJ A;  5DCA J;  2WDQ A;  3SFD A;  2JX5 A;  1RUE 4;  3DOW A;  2Z3H A;  3GE3 C;  3RUL A;  2ACZ B;  2DHZ A;  3ZRF A;  3OCQ A;  2ZVO A;  2PE9 A;  2WX1 A;  1GUA B;  1GG3 A;  2ZNR A;  3GP7 A;  3EGR A;  3RZV A;  3DVG X;  1OFF A;  1P1A A;  1JWM D;  4E0Q A;  3VR8 B;  2KWU B;  1LFD A;  1V5T A;  4KIK B;  3VRB B;  1POV 0;  2K0P A;  3DQV A;  1XLQ A;  1IBX A;  1VDV A;  1RHI 4;  2CJN A;  1UZX B;  1YIW A;  4ICU A;  2BB5 A;  3WAO A;  3Q2A C;  2INN E;  1RVF 4;  3PZD A;  1DOX A;  4NQK E;  3N30 A;  3AE3 B;  1D4B A;  5C3J B;  2V1Y A;  3LDZ E;  1ZOY A;  1SE3 A;  5M59 B;  4FJY A;  5LLI A;  2PEA A;  2ZCC A;  3FKY A;  3EA6 A;  1UWX A;  2WXM A;  4ZD5 A;  4JLC A;  1XEE A;  4RM8 A;  2LJ5 A;  4WJQ A;  3NZ3 A;  4BKT A;  3BH1 A;  5KHO A;  2M4N A;  4HLE A;  3R7R A;  2UYZ B;  5DPT A;  4Q2J A;  4NAW A;  5J17 A;  3N9Y C;  2WP9 A;  1VZ8 A;  4USA A;  1VRH 4;  4OCM A;  4KSL C;  4AJW A;  1UAQ A;  2ON8 A;  1MHH E;  3R7Q A;  1BUI C;  1WM2 A;  2BVC A;  2WXL A;  4NZL B;  2CHX A;  4DQO C;  1Z3A A;  3H9D A;  4FBJ B;  4C00 A;  4DWF A;  3OWE B;  3AEA A;  3B8F A;  2MJD A;  2M0A A;  2RMM A;  4G11 A;  1YQ4 B;  3SDL C;  4ZFR A;  1R4N B;  4MH8 A;  1E6E B;  1XCT L;  4W9H A;  4C56 C;  3CWI A;  2LRU A;  3HRD D;  2JYE A;  1B9R A;  1XO3 A;  2HJ8 A;  1HA5 A;  1R09 4;  1EU4 A;  4WQO B;  4URK A;  3KUC B;  3AEC A;  4OVV A;  4OVU A;  2D3G A;  4WAF A;  4KIK A;  2TSS A;  2MQJ A;  4RGO S;  1Q0W B;  2HE7 A;  3ABV B;  4II3 B;  2P8R A;  3SD5 A;  2O6V D;  2D3C A;  4XX5 A;  3UQB A;  1WR1 A;  2LFI A;  1WGG A;  3KQ4 A;  1WMH A;  1XCQ L;  4W9F A;  3H7S A;  1VK9 A;  3BVM A;  3IXS A;  2AX5 A;  1EU3 A;  2ZNV B;  5C3J A;  1ZUD 2;  2EMT A;  2Z3I A;  1M9N A;  2JYT A;  1RMU 4;  4ZOH C;  1HRV 4;  1Y8R C;  2LGI A;  2KWD A;  2RPV A;  3QAQ A;  1FXA A;  4DK5 A;  4GIV A;  1VLB A;  4ANU A;  4HPL B;  3KVF B;  3DCG A;  3VRA B;  1XLO A;  3H1U A;  2C7H A;  3RZW C;  1V2Y A;  1UF0 A;  2DAF A;  3P4P B;  4MEL A;  1I4H A;  4RNA A;  1RB7 A;  2C7N B;  1JWU D;  2O96 A;  4P1C C;  2M0X A;  2KKS A;  2Z59 B;  2ZW1 A;  3EFC A;  5HI1 A;  5JZE B;  5D2M B;  1ZXH A;  3P4Q A;  3PO0 A;  1K52 A;  1PIV 4;  3DDC B;  4HXD A;  2OG4 A;  1UGJ A;  2N9K A;  4LDT D;  2MBO A;  3DBL I;  3Q8A A;  3VTV A;  1IP9 A;  1ASJ 4;  1FFU A;  4GSW A;  2KFJ A;  3NS1 A;  5AUI A;  2BYV E;  5GMV A;  3B08 A;  3VAW A;  2W54 A;  1N63 A;  1QKZ A;  3NS8 A;  5CW6 A;  2HTM E;  2RR9 A;  3APC A;  1F2R C;  2GLS A;  1HTO A;  4NAM A;  3P63 A;  4ICV A;  2ICI A;  3C0R B;  4MS7 A;  2KMM A;  1NI2 A;  2K8B A;  3G8Q A;  1BT0 A;  1AAR A;  4EZJ A;  5H8Y E;  4P9E A;  1WJN A;  4DHZ E;  2MBQ A;  3AE9 A;  3VTW A;  3ZDT A;  2AQ3 B;  2FCN A;  2BGF A;  1PGX A;  1TT5 B;  4X57 B;  2LVQ A;  1TIF A;  4K7U A;  4G0N B;  3DWM A;  1FIQ A;  4GDK B;  3ABV A;  3Q3O C;  3Q69 A;  5BYS A;  4M01 A;  3EHV A;  2L1A A;  2BYF A;  2MWS B;  3IFW B;  4GOC A;  3MFG A;  3BVG A;  1V49 A;  4DXA B;  5BO4 B;  4I6L B;  2DLB A;  3OG5 A;  4W9D A;  4Q4V 4;  4L1B A;  4WWN A;  3R2I A;  3L10 B;  3CIR B;  3PLV A;  1MG8 A;  3GE8 C;  4O8X B;  1OZ0 A;  1VBD 4;  2EEL A;  3DBH I;  1V1O A;  1E8Y A;  1VQ2 A;  2HJ1 A;  2XBB C;  4G3X B;  3IBE A;  1EO6 A;  2LVO A;  1YSB A;  2K6Q A;  1GB4 A;  2O3K A;  2Z3J A;  2WX0 A;  1OEY J;  2RDB C;  2O95 A;  1OTR B;  2DWQ A;  4CHK A;  3WAN A;  1GPX A;  3RCZ A;  4XZ4 A;  2AQ2 B;  2MX2 A;  2NTS A;  3TIX A; 
#chains in the Genus database with same CATH homology
 1XLP A;  1TIY A;  2N0S B;  1HQR D;  2LUM A;  3T3O A;  2AQ1 B;  4YSZ B;  1QOG A;  2FR6 A;  2L32 A;  1C4A A;  4C80 A;  1FNU A;  2QEJ C;  3Q8B A;  1FNV A;  1QOF A;  3UI3 A;  4DXG A;  4TMA B;  3P1M A;  3U52 E;  3TSS A;  2D5N A;  2NYT A;  2I2Y A;  1VR9 A;  2WDR B;  4MT5 A;  1IUE A;  1F77 A;  3LXF A;  3DWG C;  4NQL A;  1XF5 L;  2DYM A;  3TEZ A;  2PVG C;  3ZPC A;  2BYT A;  1QOA A;  3BZD B;  2JSV X;  4K1R A;  1I4X A;  4I43 B;  2Z8L A;  4C7Z A;  1L0V B;  3W1S A;  2B3Z A;  1TJE A;  2WXK A;  2PVO D;  5TSS A;  4ZHP A;  3AH7 A;  3H8H A;  3V05 A;  3ZJV A;  1L0X B;  3SR6 A;  5EE0 A;  1JQ4 A;  1KRH A;  1SF0 A;  5T8I A;  3VR9 B;  5HG2 A;  1I4R A;  4QFT A;  1JTK A;  2H88 B;  1AN8 A;  1KLU D;  3AE2 B;  2B3J A;  5BMG A;  3U2S C;  3MHZ A;  2NTS A;  2OED A;  2HVW A;  2J4X A;  4B0E A;  3E1U A;  2I38 A;  1JW9 D;  4JWS C;  4YSX B;  1D6E C;  3BK1 A;  3AN1 A;  1E0Z A;  2WXG A;  1OQR A;  4OCL A;  1JWS D;  1VJK A;  4N6E B;  2EX3 A;  1AWD A;  1KFY B;  4MSM A;  4RFB A;  1FCL A;  3EX8 A;  4WIF A;  3U7Z A;  1YN5 A;  1HZ5 A;  1RFK A;  1YQ3 B;  2MJE A;  1GOZ A;  2OBC A;  1BML C;  5G5H A;  2WXF A;  2FR5 A;  4OW0 A;  4REZ A;  1JWA D;  1L4Z B;  1WSP A;  2PMV A;  2MH7 A;  1C9F A;  4ZFT A;  2INP E;  1OQQ A;  4YSY B;  4LK0 M;  3NUH B;  4N59 A;  4O8X A;  3AB5 A;  3AE5 B;  3AEE B;  5C2T B;  1QOB A;  2Q5W D;  4OHJ A;  2G9H D;  2QSD A;  4KGT A;  1Y56 A;  5GXG B;  1NVI D;  4H2A A;  1ZP0 B;  5FKA C;  1FXI A;  4ILG C;  4OCL B;  3I9V 1;  1CQV A;  1JCK B;  2SEB D;  1ZOY B;  4OZB A;  2J53 A;  1YJI A;  2KQ4 X;  4L2Y A;  4A55 A;  1K50 A;  4YWG G;  1TKY A;  2M19 A;  1TKG A;  2WXP A;  2WS3 B;  1ALN A;  4RGN A;  1SJE D;  1NI3 A;  2QIL A;  1JRO A;  1N5X A;  3KWV A;  1WXQ A;  1F0Z A;  3NVZ A;  4A90 A;  1ET6 A;  1SEB D;  3FIL B;  1V8C A;  3KWL A;  1YN3 A;  5E6J A;  4A6Q A;  1FFV A;  3SFE B;  4LCN A;  3AV8 A;  5BYR A;  1OX7 A;  1K51 A;  1KLG D;  2IPK D;  4YTM B;  1QF6 A;  1FRD A;  4XDD A;  2Y5C A;  1FEH A;  1N5W A;  2IDY A;  5BMI A;  1ZDX A;  4RH6 A;  2WLB A;  3AE6 B;  3BYY B;  4LD4 A;  2D5G A;  2W55 A;  1J7A A;  2V0G A;  3R2N A;  4LCO A;  1ENF A;  1JML A;  4YTP B;  4EG2 A;  1C78 A;  1F2R I;  3IJF X;  1RWS A;  3NVV A;  2XN9 C;  1ROE A;  4WIG A;  1E9M A;  2VZK D;  5FK9 C;  4O8Y A;  4LC5 A;  1SBB B;  3BII D;  3ZJU A;  4US9 A;  1ZE3 D;  2BT6 A;  4P9D A;  3OJ6 A;  2WXQ A;  1DOY A;  4OCN B;  3ETR A;  2FUG 1;  5HFY A;  4XDC A;  4LD2 A;  2KN4 A;  3W5V B;  3R8B A;  1SB3 C;  2QIE B;  1FNW A;  1PGB A;  2IGG A;  1UX1 A;  1Q10 A;  5MPO A;  1SJH D;  1I4G A;  4OWP A;  2RDG A;  2GRI A;  2J52 A;  1N62 A;  2BS2 B;  3AEA B;  3Q8E A;  3URY A;  1UWM A;  1WRI A;  2JU6 X;  2P87 A;  1L6V A;  4LLG M;  3U4E G;  1JRP A;  1WWT A;  1YNT E;  2Y5P A;  2WQY B;  4YT0 B;  1FMA D;  5H92 C;  1J7C A;  3SEB A;  2FBW B;  1SXT A;  2W3R A;  4TQ1 A;  2SAK A;  2X38 A;  4O8Y B;  2KAJ A;  3IT4 B;  5DCA J;  2V3P A;  3IT6 B;  3ZYY X;  2JX5 A;  2WXH A;  2KCQ A;  2Z3H A;  1DYQ A;  3FI7 A;  2ACZ B;  1T6B X;  2DYO A;  3OCQ A;  2W82 A;  1DOI A;  1VZ6 A;  2ZNR A;  1KF6 B;  1QLB B;  3GP7 A;  3AEG B;  2JZP A;  2QJL A;  3EGR A;  4PT5 A;  3RZV A;  1OFF A;  2G1E A;  2WDV B;  1JWM D;  3BWU D;  3VR8 B;  3RFZ B;  4E0Q A;  2PYJ A;  3VRB B;  5D3I B;  4OWP B;  3Q8F A;  1GB1 A;  2K0P A;  3R2T A;  1XLQ A;  1IBX A;  1RM6 C;  1VDV A;  5LNK 1;  2CJN A;  2H89 B;  1JWB D;  4KKI A;  4KGS A;  4MM3 B;  2BB5 A;  4AQ7 A;  1D5Z C;  2INN E;  2PKO A;  1N60 A;  4GLS C;  1LO5 D;  1DOX A;  2HVV A;  4HKQ A;  1UWZ A;  3AE3 B;  2WDQ B;  3SFD B;  4KKJ A;  1D4B A;  5C3J B;  2PYL A;  4MAC A;  4IDI A;  1T3Q A;  3AE4 B;  2IGH A;  1SE3 A;  2XNA C;  4US8 A;  5M59 B;  3W5U B;  5BMH A;  4L23 A;  3AED B;  4MSJ A;  1WN6 A;  3EA6 A;  1UWX A;  2JWU A;  2WXM A;  1KTK A;  4ZD5 A;  1SE4 A;  1XEE A;  3NZ3 A;  1XHX A;  1E7P B;  1IBX B;  3FIL A;  1HXY D;  2Z3G A;  1N61 A;  4HRS A;  3AE8 B;  3MJ5 A;  2BTE A;  1TYG B;  4IKG A;  3J9C A;  4KGR A;  3E9S A;  3ZJT A;  4Q2J A;  1SIJ A;  1C76 A;  2BBC A;  3MP9 A;  2EKI A;  3N9Y C;  3HUI A;  4HRQ A;  1CK1 A;  2KAC A;  1XHZ A;  1VZ8 A;  1C4C A;  4USA A;  1YSD A;  3NVW A;  4WIP A;  3ZEF B;  2L83 A;  2HDE A;  2B76 B;  4OCM A;  3PZ8 A;  2N9L A;  3EUB 2;  1UAQ A;  2NTT A;  1J7B A;  1NEK B;  1UNS A;  4HRW A;  2ON8 A;  3T3N A;  1E10 A;  1MHH E;  1BUI C;  2JXT A;  2VZK B;  2WXL A;  3AE1 B;  3I57 A;  4OCN A;  3C8Y A;  1D5X C;  4A8X C;  3P4R B;  1TZO A;  4JX1 C;  4NZL B;  2IGD A;  4WUR A;  2PZS A;  4DQO C;  1Z3A A;  2WXO A;  3ZPG A;  4JWU C;  4XWT A;  2G84 A;  3NRZ A;  1P7F A;  1PGA A;  4M0W A;  3IAM 1;  3OWE B;  4NAW B;  3B8F A;  2MJD A;  2M0A A;  1ET9 A;  4N58 A;  2RMM A;  1AF2 A;  1ZXI A;  2WP9 B;  1TS4 A;  2M56 B;  5EE3 A;  1YQ4 B;  2LHE A;  4JXE A;  4ZFR A;  4D10 F;  4MH8 A;  4OCM B;  1CTU A;  1E6E B;  1WYG A;  1XCT L;  4C56 C;  3CWI A;  5M52 C;  3GB1 A;  2ZNV A;  2BB6 A;  3HRD D;  2JYE A;  1B9R A;  2QMT A;  2WU2 B;  1XO3 A;  2Y3A A;  4B0M A;  2YEP F;  3AEF B;  1HA5 A;  3AE7 B;  4F3W A;  1AW7 A;  1TS5 A;  1C4P A;  4WWM A;  1PYW D;  1EU4 A;  1L5P A;  3E56 A;  3DMO A;  2WXJ A;  3P4S B;  1YN4 A;  1VRA B;  4YXD B;  5EE1 A;  4WAF A;  3FAH A;  2R7F A;  2BS4 B;  1EWC A;  2TSS A;  4RGO S;  3ABV B;  1ESF A;  4GDL B;  2WXI A;  2P8R A;  1EWY C;  4MSD A;  2LFI A;  3KQ4 A;  1D5M C;  4IOI E;  1XCQ L;  4WQM A;  3BVM A;  3IXS A;  2AX5 A;  4P9C A;  2WU5 B;  1QT9 A;  1EU3 A;  1TY2 A;  2PIA A;  2R61 A;  1CZP A;  3W2D A;  2WXR A;  3AM9 A;  3BK2 A;  1ZUD 2;  1ZPS A;  2Z3I A;  2ONQ A;  4ZRQ A;  4CQN A;  4PQT A;  1C77 A;  2JYT A;  3V3X A;  4BGD C;  1I4P A;  5I4D A;  4ZOH C;  3B2G A;  4OZC A;  3AEC B;  2L52 A;  2PTL A;  2LGI A;  2MJ3 A;  3LYY A;  2KWD A;  2RPV A;  3MC0 B;  4FXC A;  2LEK A;  2K9X A;  4MSQ A;  2DBY A;  1FXA A;  3FC4 A;  4JPS A;  1MPE A;  2V3N A;  1VLB A;  1QQR A;  1WKQ A;  1I4Q A;  1VZ7 A;  3AMZ A;  1YJJ A;  4HKZ E;  3VRA B;  1XLO A;  1V1P A;  2A8N A;  1TS3 A;  4JE3 B;  4OVZ A;  2ZW0 A;  4G3M A;  5HHD G;  4HEA 1;  4P6V F;  4KIT C;  3TEX A;  2K3U A;  3B9J A;  3P4P B;  1I4H A;  4RNA A;  4UDU C;  1RB7 A;  2O7P A;  3MPZ A;  1L0Y B;  4XE0 A;  1JWU D;  2O96 A;  2WNM A;  1C79 A;  1NYQ A;  2NMQ A;  2KKS A;  4ITK A;  3BVZ A;  4D2K A;  1MI0 A;  2ZW1 A;  1XLN A;  2RPZ A;  5HI1 A;  2NX8 A;  1GAQ B;  2PY5 A;  4RGM A;  1L4D B;  1ZXH A;  3NVY A;  1TY0 A;  3PO0 A;  1K52 A;  5C2O A;  4RCO A;  5GAO A;  5AUK A;  1I7H A;  3LB8 C;  2OG4 A;  1M4V A;  1UGJ A;  2N9K A;  1CTT A;  3L4P A;  3Q8A A;  2QLC A;  1FFU A;  1YMH E;  1K53 A;  3WCQ A;  4O1N A;  4DXF A;  3NS1 A;  5AUI A;  1V1P B;  4ZRP A;  4HJG E;  3ZGZ A;  3W9C B;  1FM0 D;  1QIL A;  1TS2 A;  2LHD A;  3TUO A;  1B1Z A;  2IJ0 A;  2G6V A;  2W54 A;  1PUT A;  2RDH A;  1N63 A;  1QKZ A;  5CW6 A;  2BW2 A;  2MEK A;  2J42 A;  5D7G A;  2HTM E;  3RPF C;  1FO4 A;  4HRO A;  1MQ0 A;  1XI1 A;  2GI9 A;  4ZD4 A;  4LTU A;  3IAS 1;  1FCC C;  4LCP A;  2LJI A;  4ARC A;  1HEZ E;  1F2R C;  4NAM A;  2N7J A;  3P63 A;  4WH4 A;  1WGK A;  2ICI A;  4KX6 B;  4MS7 A;  2KMM A;  3P4Q B;  4EE2 A;  4AS1 A;  4F7O A;  2V4I B;  1CJE A;  1UUP A;  1R5X A;  3G8Q A;  4P9E A;  5H8Y E;  2GB1 A;  2KDM A;  3ZQ4 A;  1SSN A;  1R5T A;  1V97 A;  1AYF A;  5D3D A;  2AQ3 B;  1MVK A;  2PLP A;  1TKE A;  1EM7 A;  5G5G A;  1IGD A;  2W3S A;  2E6X A;  3DH1 A;  1PGX A;  1UX0 A;  3PZ7 A;  2WXN A;  5JXV A;  4R3D A;  5FR3 A;  3P42 A;  4C7Y A;  4NJC A;  4A9A A;  1OI0 A;  1ZAB A;  4RGT A;  1XXG A;  4OZA A;  3DWM A;  1FIQ A;  4GDK B;  3Q69 A;  5BYS A;  4XWW A;  1MHX A;  2L1A A;  2HXV A;  3MFG A;  3BVG A;  1P6O A;  3SBG A;  1DGJ A;  1RYJ A;  3VQI A;  4J3O D;  2DLB A;  1A70 A;  4L1B A;  2D30 A;  4RF1 A;  3AEB B;  3R2I A;  1WN5 A;  1KH0 A;  2PW9 A;  2BS3 B;  2YEP B;  3CIR B;  4RF0 A;  3AE9 B;  4TQ0 A;  3TEW A;  2W4L A;  1R7S A;  1WWR A;  4O8X B;  4P16 A;  3RZU A;  1ACC A;  2FE8 A;  1FRR A;  3KLS X;  1IGC A;  5EE9 A;  3BYT B;  2EEL A;  3O13 A;  1V1O A;  3HVD A;  1VQ2 A;  3B2F A;  1BXT A;  2CU3 A;  1JAL A;  1L6U A;  1NYR A;  2CJO A;  3GS2 A;  1HZ6 A;  4ZYS A;  1SE2 A;  2JQR B;  4TSS A;  1PFD A;  1NEN B;  1YSB A;  1FD6 A;  1GB4 A;  2LMC A;  4YTN B;  2O3K A;  2Z3J A;  2K5P A;  1PDX A;  4ARI A;  1STE A;  2O95 A;  5BYQ A;  1P7E A;  3HVZ A;  1T5X D;  3TEY A;  4ZHO A;  2DWQ A;  1GPX A;  2K22 A;  2AQ2 B;  2E3T A;  3Q8C A;  1ZDV A;  2OHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...