2PW9A

Crystal structure of a putative formate dehydrogenase accessory protein from desulfotalea psychrophila
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
251
structure length
231
Chain Sequence
PLSIMQKSVVIRPGGRQEMDEHVAIETPYAIALNDRVIGSSMVLPVDLEEFGAGFLFGQGYIKKAEEIREILVCPQGRISVYADKIPKEMLEEFAPLADYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGRASNNSAVYTTGRLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYSRPERINVFNAPERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative formate dehydrogenase accessory protein from Desulfotalea psychrophila.
rcsb
source organism Desulfotalea psychrophila lsv54
molecule tags Structural genomics, unknown function
molecule keywords Putative formate dehydrogenase accessory protein
total genus 63
structure length 231
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02634 FdhD-NarQ FdhD/NarQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pw9A02
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 2pw9A03
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pw9A01
1R5XA 2KDMA 4LD2A 2B3ZA 2HXVA 2FR5A 1D4BA 1WKQA 2LHDA 4KGSA 4MSMA 1HZ6A 1JTKA 2GB1A 4IKGA 2W4LA 1ALNA 5HG2A 1OX7A 1UX1A 4EG2A 2KACA 1K51A 1ZXHA 2O3KA 4ZFRA 2KWDA 2ON8A 2PLPA 1K52A 4D10F 2LHEA 4LCOA 5BMHA 2OG4A 5M59B 1P7FA 4KITC 1GB4A 1F2RI 2I2YA 4MSDA 2G6VA 3EX8A 4MACA 5BMIA 1WN6A 4ZFTA 1IGDA 2HVVA 2Z3HA 4P9EA 2J53A 4OCLB 2O96A 2PYJA 4KGTA 3ZPCA 4PQTA 2JXTA 4E0QA 3IJFX 1PGAA 1RB7A 1Z3AA 4ZD4A 4OCLA 2P87A 1P7EA 4I43B 1UX0A 4OWPB 2PTLA 2KCQA 2QMTA 4WIGA 4LCPA 1XHXA 1UWXA 1XI1A 1XHZA 4OZAA 2NYTA 4OWPA 3V3XA 2GI9A 3OJ6A 2D30A 1JMLA 4OZBA 3GB1A 2KKSA 4LC5A 3ZEFB 1XF5L 1C9FA 2ONQA 2IGDA 2KQ4X 3FI7A 1FCCC 1XCTL 3SBGA 2B3JA 2RMMA 1MHXA 1IGCA 1UWZA 2D5NA 2QSDA 1Q10A 2J52A 3MPZA 4G3MA 2N7JA 4P9DA 2I38A 1FCLA 4LD4A 3DMOA 1FD6A 4O8XB 5C2OA 5GAOA 1XCQL 1F2RC 2G84A 1GB1A 1KH0A 4NQLA 5CW6A 2PYLA 4O8XA 2PY5A 1HEZE 5BMGA 1YNTE 2P8RA 4HRWA 5M52C 2JSVX 1MHHE 2Z3IA 2Z3JA 1AF2A 2O7PA 2PW9A 1CTTA 2RPVA 1P6OA 1VQ2A 2O95A 3G8QA 4F3WA 3FILA 2R7FA 2PZSA 1QKZA 4D2KA 1K53A 4WH4A 4P9CA 4O8YA 5DCAJ 1EM7A 4QFTA 3FILB 1K50A 2LGIA 2ZNVA 1IBXB 4HKZE 1CTUA 2HVWA 4BGDC 1YSBA 5HFYA 3RZUA 2LUMA 2KN4A 5HHDG 1IBXA 4IOIE 3MP9A 3R2NA 1YMHE 1HZ5A 1TIYA 1PGBA 4OCNB 4HRQA 3B8FA 1PGXA 2N9LA 1MQ0A 1MI0A 2NMQA 3DH1A 4MS7A 4OCMA 2N9KA 4OCNA 4ZD5A 4JXEA 1UAQA 3E1UA 2ZW1A 5HI1A 3OCQA 4OZCA 2IGGA 1MVKA 3UI3A 1WWRA 1ZABA 2FR6A 2JZPA 1R5TA 2OBCA 4K1RA 2K0PA 4OCMB 4HJGE 2ZNRA 4O8YB 4KGRA 4MSQA 2ZW0A 2OEDA 2Z3GA 1OI0A 1YSDA 2A8NA 2JWUA 5JXVA 4WIFA 4GLSC 2EX3A 4ILGC 2EELA 2RPZA 3ZPGA 3RZVA 1MPEA 2NX8A 1WN5A 4LCNA 2JU6X 2QLCA 4F7OA 2IGHA 4MSJA
chains in the Genus database with same CATH superfamily
1D4BA 4BOSC 1ALNA 1B1ZA 1ZXHA 1P7FA 3CF6E 1SB3C 3AECB 4MSDA 5BMIA 4HPLB 2EKIA 3WAPA 4KIKA 1I4GA 3WIMA 4WIGA 1XI1A 3WCQA 1FMAD 1JMLA 3ZNHB 1D4M4 4YXDB 2DYMA 1MHXA 3AV8A 3ZO5B 1WGKA 4LK0M 1FFVA 2WXPA 3EA6A 2B1GA 1KLUD 2CKHB 4LDTD 3SD5A 3BVMA 4EHIA 3JW0X 3AE4B 2PPHA 3NVVA 5C2TB 4O8XA 3A4SC 2CU3A 2WDRB 3W1SC 3KUZA 5M52C 2WWZA 2Z3IA 1PO24 1RUD4 3B1LX 3LXFA 2UWQA 4CYEA 1AF2A 2FCQA 1VR9A 2D11A 2PEAA 4IG7B 1EM7A 3A9JB 3DCGA 5CTRC 4HKZE 5D7GA 2M4NA 2KD0A 1EF1A 1K8RB 1TKGA 3IFWB 2RS54 3GQKA 1FRRA 2DYOA 2KWVB 3ZNZB 1PGXA 3U7ZA 2KJHB 4EEWA 1MI0A 4M0WB 4DBGA 1ROEA 2FR6A 3VRAA 3R7RA 4KGRA 4L1BA 2HWC4 1SE9A 4JIOU 3TSSA 4G50A 2DX5B 4GB34 4MSJA 2NBUA 2L52A 1WKQA 1UGMA 3EGRA 4E74A 2J7QB 3SR6A 2KWDA 2KTRB 2OG4A 3AEFA 1XLPA 1GB4A 1EWYC 3RYTA 2D10A 1FXAA 2I1KA 4P6VF 4C7YA 2WYQA 3DWMA 2PYJA 3BYYB 2EMTA 1HXYD 2J0JA 2CHXA 1R084 1V6EA 1KLGD 4PS8A 2DZIA 4FJVB 2L1AA 2LGSA 4MGYE 2RM24 4OZAA 3K9OB 3MJ5A 1L5PA 2D3AA 5E6PA 5IN7A 4FJYA 3ZEFB 1XF5L 1V81A 2V9HA 3DOWA 1IGCA 4NJ6A 1UWZA 2DNFA 5L83A 1TS5A 2JXXA 3RUIB 2MWSB 3QHTA 1N6ZA 1C76A 1FPYA 1XLQA 3KYCD 2MRPA 2D3BA 3BK2A 3AE8B 2VRRB 2PMVA 3WA0A 4K7WA 1MG4A 4FXCA 1VCBA 3RNGC 4W9EA 4YTPB 4WAFA 1E0ZA 1WM2A 2L00B 1IYFA 3EFCA 3HVZA 2C9WB 2KN4A 5TR5A 3WANA 2WP9A 1TIYA 1L6UA 5FR6A 2Z59B 2R074 3DVGY 1RMU4 4JXEA 1PO14 2KMMA 4GGQA 1A70A 1R5TA 3ZXVA 2JYEA 4HJGE 2Y5CA 1OEYJ 2ZNRA 4G3XB 2A8NA 2NBVB 4JGHB 3VR9B 1GC6A 2IU0A 5L95C 3AXCA 4S17A 1ZGUB 2LZ6A 2JU6X 1PL0A 2B3ZA 3N1YC 3B2GA 2WX1A 3I3TB 3LB8C 4B6WA 4UDUC 4GN1A 3Q8EA 2RD0A 2K39A 5DPWA 1B9RA 1JRPA 2H89B 1HTQA 2G4DB 2BYTA 3AE7A 1F0ZA 4OCLA 3Q8AA 2WU5B 1G6JA 1JWAD 1S1QB 3PHXB 1OQYA 2GI9A 3M95A 2MHJA 3AE9B 4AS1A 2ONQA 2YVCA 3V6CB 1TKYA 5G2NA 1LM8B 4XDDA 2BKFA 1PYWD 3AE9A 4LD4A 3N32A 1NI2A 4RHV4 5IO9A 2PY5A 2P8RA 4TQ1A 3NUHB 4KZ0A 3PREA 1ZOYB 4HROA 3KUCB 4M00A 1IBXB 4DDID 2CJNA 3RZUA 1R094 4JWSC 3VTWA 3PZ8A 2IU3A 1UWMA 3MP9A 1A5RA 1VZ6A 4YSYB 3T3OA 2GBRA 3B8FA 1TGZB 3LDZE 2QC8A 3SUCA 3AU4A 3N1ZC 3CSFA 3VTVA 2WDVA 4HDQA 3DBRI 5EE3A 1NYQA 3L16A 4MDKE 1OI0A 4HRSA 3VHTC 2IY1B 3AE5A 2L0TA 1HTOA 1ZDXA 2IYDB 3HK0A 3VQIA 1NA1D 1YD8U 1BEV4 2BWFA 2BYFA 2LHDA 3CSTA 4Q4X4 2FBWA 2CS4A 4B9KA 2PJHA 1C79A 2K9XA 2WHIA 5BMHA 3QIJA 3E9SA 1HQRD 1YX6B 3ZJUA 1T0YA 3R2TA 5BYRA 3U7DA 1EO6A 2OOBB 3P4QA 3RI7C 3IAM1 1V8CA 2P87A 2MBEA 2O6VB 3JSVA 1AWDA 1C4CA 4MGZE 3X23A 2IGDA 2RMMA 4JE3B 4USAA 2IY0B 1N61A 4P9DA 3KH0A 1YQ3A 5C2OA 3TEZA 2WGSA 1OFFA 1XQQA 3DBSA 1AN8A 2XK5A 4C4VA 3AE3A 2LASA 2WXFA 1YNTE 3AE3B 2K8HA 4NQLB 3AU5A 3HRDD 2BTEA 4C7ZA 4WJPA 1VBC4 2DAJA 2RGFA 3A9JA 1SXTA 2PZSA 3PVLA 1V2YA 1T0SC 3DWGC 1OEYA 2Q5WD 1Y56A 2Y5BB 3JYUA 1I35A 1RUI4 3RT3B 1T5XD 4IUMB 3PRZA 5IA7A 3B9JA 2A4ZA 4FJZA 3AEAB 4OCNB 3P4PA 2WXGA 4II3B 1LQBA 5AUKA 2HD5B 3EC8A 5D6JB 2G3QB 3QQ8B 1EV14 2UYZB 5LXHA 2OBCA 3ML9A 5DCNA 3U8ZA 4XDCA 2JRIB 3ZYYX 2VH2A 3ZDMC 4DXAB 4MSQB 1ZP0B 4PS3A 3DHHC 3KW5B 4RGOS 2NX8A 2WQYA 1C3TA 4Q4V4 1CQVA 1DYQA 2WX0A 1RUF4 1N5WA 4ARIA 4IKGA 3ZXRA 4RGMA 5AZFA 2GLSA 2C7NB 4IWOA 4EG2A 2KTRA 4MH0E 3IG3A 1J0GA 3P4SB 4M01A 4DQOC 1F2RI 2MW5A 5AZGA 2BB5A 2HVVA 4P9EA 3QCAA 3J8F4 4KGTA 2WU5A 1L6VA 1RB7A 3Q3OC 3RNAC 3NZSA 3PZDA 2LEKA 4LCPA 1UWXA 4HWIB 1L0XB 2LUEA 3V62A 5CHVC 1YQ4B 1E10A 2HE7A 2KDFB 2QILA 2NPTA 4EZJA 4JX1C 1H8TD 1Z7S4 3PRPB 4WURA 2FCMA 2NVUI 2XNAC 4TSSA 4IWQA 5JHBA 3Q69A 2R044 5J2RA 3AE8A 2G84A 1I4RA 5IP4D 1I42A 2JYTA 2M17A 1UZXB 1JWSD 2AQ2B 2K8BA 3ZDTA 2BWES 2LRUA 1EWCA 4WH4A 3KYDD 3VUYA 2MBBB 3Q3JA 1ZUD2 1TS4A 1EAH4 2KK8A 3BWUD 2NTTA 1NEKB 3P1MA 1WX9A 2MLBA 4HRQA 3P2BA 2JPHA 4LTUA 4N58A 2WDVB 1V80A 4OCNA 3AEAA 2KYWA 4RH6A 5HI1A 4JL9A 3OCQA 2DLBA 2B1IA 1ESFA 4TV3A 3LYYA 1YSDA 4GDLA 1PDXA 4G11A 2N0SB 1E7VA 5EDSA 4K7SA 2AX5A 2NBWB 4F7OA 2IGHA 3O65B 1V97A 5EE1A 1OQRA 2Y5PA 1R4MI 1T0QC 2V3NA 5DPTA 1K51A 2N1WA 2ZJDA 3AEDB 3AB5A 4AP4C 2MJEA 3T8MA 2ZVNA 4PYUA 4GDKA 3P4SA 3A33B 2ICIA 2D07B 2MP2B 1E7PB 2KWCA 1RUC4 4MM3B 1MQTD 2R064 2N7DA 1QOFA 3SFDA 1YJ1A 2D30A 3SFDB 4YT0B 3AI5A 1WR1A 4W9IA 4LNFA 4A1OA 2QSDA 2J52A 1YJJA 4RM9A 2W9NA 3TUOA 3MPZA 5FKAC 3AE2B 1AR84 2XK5B 2ZNVC 2I38A 4PDWD 3KWLA 4W9DA 3H6NA 1VBA4 1Z5SB 1L4ZB 1V1OA 2J4XA 3R8BA 2AL3A 1C1YB 4WWOA 1YOVB 1P6OA 1FFUA 4M02A 4D2KA 2KKCA 1PIV4 3DVNV 1TZ1A 1ZDVA 4K3BA 4S0RA 1IP9A 4IM2A 2I1JA 1Q0WB 4FADA 1NI3A 4MS7A 4A90A 3GQHA 4TUUA 3SU8X 4OCMB 2V4IB 3ZJVA 1UUPA 2CJOA 4ICVA 4GLSC 5D94A 2Z0DB 3PRMB 2K8CA 4WWMA 1V1PB 2ACZA 2O2VB 2YEPF 1DOYA 3M63B 4F7ZA 2KDMA 1AR64 2KACA 3BIID 1I4HA 3N1XC 3PTFC 4E3CA 5M59B 1FM0D 3IBEA 4KITC 4A20A 4KIKB 2D5GA 4ZDVA 4NAWB 5DPSA 2Z3HA 4K81A 2WDTB 4HCNB 3RMKC 1C4PA 2JZ3B 2ZEQA 1ZE3D 2BW2A 4WAAA 1OZ0A 4ZD4A 2G45B 3AE7B 4H2AA 3APCA 3IVFA 2E3TA 2QMTA 3I63C 4J6IA 4ZYSA 5C1ZA 1GUAB 1V49A 4ANVA 2M8SA 5GXGB 1TS3A 1N63A 1KLVA 2W55A 2WDQB 1YQ3B 3PZ7A 2RDBC 1F1HA 2MCNB 5C2TA 3NS1A 3NVZA 2LI5A 3AE2A 2PVGC 5FK9C 4LNIA 3P4RA 1CJEA 2K22A 3U30A 5HKHA 4N6EB 1YQBA 3EECA 5AUIA 2PYLA 1PFDA 2WXOA 1Q5WB 5H92C 1T0RC 3KWVA 3ZUNA 2O7PA 1VQ2A 5I4DA 2LJIA 2WU2A 3A9KB 3IAS1 3RNFC 3E56A 4HK2A 4LNKA 3VR8A 2QDFA 2WP9B 4P7IA 4WJOA 1JALA 4YTNB 3ZGZA 2KXJA 3KUDB 3O13A 3ML8A 4ZRKA 2CU1A 5G5GA 1CZPA 1RUJ4 4MELA 3VUWA 1VBD4 3HUIA 2WXJA 4ZHOA 1UAQA 3UI3A 1WWRA 2BYVE 2KNBA 5CHFA 3J9CA 4XX5A 4ZRQA 2OEDA 1U4AA 2XEWA 1WE6A 2C7HA 3PO0A 2QHOA 4ILGC 1JRUA 3TEYA 4MSMB 1TYGB 4CHKA 2C5LC 2MBOA 3RZWC 4E71A 4MSMA 1WGDA 1J8CA 1M4VA 2LVPA 1JTKA 3BVZA 3PSEB 3ZTCA 3L13A 3MFGA 1FXIA 4NPNA 2PLPA 1KTKA 2LHEA 1FNUA 2PLV4 1WJUA 2W54A 3NRZA 4WQOB 2L8JA 2QIEB 1F52A 1QQRA 1N60A 4MGKE 3ZPCA 2HJ1A 2KJ6A 1VLBA 1R4NB 4GB9A 3UGBB 2L3ZA 2KJRA 4EFOA 3RFZB 3P4QB 1XO3A 4B0MA 3Q14C 2NPTB 1MG8A 4YWGG 2NCNA 1RVF4 4MT5A 1QOAA 4DXGA 2RSUA 3ZLZA 3SBGA 3MC0B 2LD9A 3RNBC 1E7UA 1Z2MA 1GC7A 2DBYA 5BO4B 4QAYA 2WXHA 2FIDA 4HCPB 4BBNF 4L2YA 3PGEA 4M8MA 3B08A 1WFYA 1C4AA 1FEHA 3KQ4A 2PW9A 1CTTA 4ANWA 1P0RA 4JLCA 1HRI4 1NEKA 2ZZPB 1BXTA 4PYZA 3NS8A 3NY5A 1YSBA 3Q8CA 3JVZX 4FN2A 3RZFA 4WWPA 3OWEB 1SE2A 4EZLA 4C00A 4YTNA 4EUTA 2NS5A 2IJ0A 2RS34 4YSXA 1RRBA 4ZD5A 3UIPB 4BKSD 2WXLA 2QCZA 3PLUA 1JWUD 1QOBA 1MFWA 3ETRA 4KKIA 3VRAB 1KJTA 3UQAA 2PKOA 4RF0A 4ARCA 4RCOA 2LGYA 3RULA 1E90A 5AZHA 1E8WA 3GP7A 5E6OA 2H88B 3CIRA 3P42A 4HJKA 1X1MA 1J7BA 4KGSA 3GZNB 4KV2A 2DENB 1JCKB 1NENA 3V6EB 2HTHA 3Q3FA 4LDTB 3TMPB 4NAWA 2MP2A 4FHJA 2I2YA 3AEFB 1WN6A 4MM3A 1AW7A 4OCLB 1VD2A 2C60A 2FIFA 1XD3B 2KC2A 4JQWC 2JXTA 4I43B 3DPDA 2WNMA 1FNWA 4J6EA 3V3XA 4LJPB 1JWBD 3V05A 2KQ4X 3C0RB 3P63A 2WS3B 3OJ4B 2X5ID 2KFKB 4BFRA 1CK1A 1N62A 4JPSA 4EKUA 2OJRA 3MHZA 1FD6A 4TQ0A 2LXCA 3ZVVA 3EHVA 3D32A 5CW6A 1AR74 1ZCZA 1FIQA 1MHHE 1OOPD 1SJHD 4DHJD 3A9KA 3ZQ4A 2BF8B 3G8QA 1N5XA 2R7FA 4HLEA 1BUIC 3H7SA 4XE0A 3OLMD 2WXKA 3FILB 2FAZA 3CWIA 2KLCA 4HXDA 5H8YE 2KZRA 1HXS4 5HHDG 5CX3A 4IOIE 4XWTA 2L83A 2GBNA 4FA6A 1HZ5A 2KANA 4RMAA 1AR94 4K1RB 2BBCA 4OCMA 4TKNA 1S3SG 3BINA 3TCAA 3E1UA 1TY0A 2K0PA 5IKCM 2INNE 1EUVB 1ZP0A 4WJNA 3DVNU 2RR14 2BQQA 1J7AA 4LJOB 1CMXB 1R7SA 1NYRA 1ZW7A 2WXIA 1SSNA 2ZCCA 2HXVA 1I4XA 2R2QA 1RUE4 3CIRB 3Q8BA 5HG2A 2YEPB 4GMVA 3ZIMA 2O3KA 1Q1OA 2K5PA 2FUG1 2HDEA 3SHQA 2GBKA 3Q3NC 4NY0A 2AEHA 2N9XA 4ZRJA 3MC9A 3AEDA 2IZVB 3NVWA 3NVYA 2JWZA 4PQTA 3LJ3A 3IJFX 1Z3AA 1XLNA 2LMCA 3ABVB 4R3DA 4W9FA 1ET6A 2O6VA 1VDVA 3H8HA 1SIJA 2KAJA 4GOCA 4OZBA 2V4LA 1SF0A 1C9FA 3DHGC 1VK9A 2GOWA 4FBJB 1E5WA 1WXMA 2JUOA 1JWMD 3DBHI 4W9KA 3AEEB 1C78A 3IHPC 1PUTA 4I6LB 2N7JA 4XC2A 1QLBB 2RPQA 3Q8FA 4O8XB 1XLOA 5D2MB 5C3JB 1XCQL 1ET9A 1GB1A 4NQLA 2V1YA 2O6VD 1HEZE 5C3JA 1HE8A 2WU2B 2RDGA 4RM8A 2AWTA 3GOEA 2IO2B 4GIVA 3N30A 2X38A 2KQSA 2X8XX 1D5MC 2PIAA 2ZVOA 2UU7A 3K9PB 1SE4A 1G8MA 4YSXB 1EU3A 1TKEA 2SEBD 2FCNA 4BAXA 1L7YA 2B76B 2NMQA 1RUH4 2ZW1A 3UQBA 1SBBB 3EFUA 2VZKB 2CHZA 2MBHA 4IW0A 3U52E 1POV0 3VH3B 1WXAA 1LXDA 2KMAA 3UINB 1WZ0A 2BPSA 1P98A 1JW9D 3AM9A 5KHOA 4DK5A 4W9HA 3VX8A 2W4LA 2WLBA 1OX7A 1OGWA 4PT5A 2IPKD 4PK1A 4RGNA 1D5XC 4LCOA 4HVBA 3GE3C 1WWTA 2G6VA 4MACA 2VH1A 4MEMA 2DAFA 3DBHB 4YSZB 2KN5A 1E6EB 1I7HA 5D3IB 1AYFA 5CHWA 4YT0A 1XHXA 1YQ4A 1WMHB 3DBRB 4LNOA 4KDLB 1TJEA 2KKSA 1ENFA 1UF0A 1FCCC 2EKEC 4WQMA 3IT6B 2KHWB 2NR2A 1OQQA 4RF1A 1Q10A 4LNNA 4ZRIA 3AEEA 3ZRFA 3H7PB 1H8CA 3TBLD 2KOXA 4OW0A 4DXFA 1F2RC 4I6PA 4DHZE 2K6DB 2J0MA 2LVQA 5D3DA 5MPOA 4XYCA 3AMZA 1UNSA 2LWPA 2IDYA 3EUB2 1WRDB 1FRDA 1K50A 3KVFB 1L0VB 2Y3AA 4I6NB 1F9JA 3ENEA 4BKSA 4YTMA 5IAAC 3MC8A 1NVID 1NBFC 1KF6B 1FXTB 2MJ3A 2ZPYA 1TZOA 2HTME 5EE9A 3DBLI 4CQNA 2L32A 1ZABA 3I57A 3U2SC 2CR5A 4HPMB 1TBEA 3MHSD 4WIPA 1TIFA 4REZA 1YN5A 3VUXA 2J42A 2EX3A 2WXMA 2GBJA 3ZPGA 1AARA 3H9DA 3RZVA 3AE1A 1MPEA 3HM6X 4TMAB 1WN5A 5E6JA 1L0YB 3TEWA 2MX2A 1BMLC 3TJPA 2KLGA 2WQYB 3URYA 1UBQA 2HWB4 1XXGA 2W82A 4KSLC 1P1AA 3DQVA 2Z8LA 1K52A 4NAMA 2BKRB 4IM3A 3RN9C 3EX8A 4BZAA 4HEA1 4BKTA 3ZJTA 1IGDA 3IT4B 4ANXA 3ABVA 1MJDA 2W3SA 2GBMA 4FULA 1WM3A 4PS7A 3KLSX 2JRHA 1GAQB 3M3JA 4ZYNA 1UX0A 2JT4B 4K3CA 2M0XA 3V60A 1IUEA 2BGFA 3ZTDA 1QILA 2NYTA 2FCSA 3B0AA 2BS3B 1KOTA 5J18A 2REXA 3FI7A 3RNCC 2KFKA 3PHWB 4GSWA 2OHFA 4KKJA 1XEEA 1WX8A 2LGDA 3P4RB 3PPAA 4X57B 4G3MA 1RYJA 1YX5B 1FCLA 1ZXIA 3Q2AC 4AJYB 3UF8A 4US8A 1JROA 4LCDE 3AEGB 1WJNA 4ACFA 4HRWA 1TS2A 3QA8A 3VFKA 3VTUA 3W1SA 2JZZA 2RPVA 2K25A 3FILA 4MJSA 3X0WA 4P16A 3VH4B 1UH6A 3MTNB 4MJSB 1WGYA 2RR9A 4IDIA 2HJ8A 4MGIE 2FUHB 1L0VA 1WI0A 4F1SA 3VAWA 3WAOA 4YTMB 4C56C 1GOZA 3QJZA 2KT7A 3QWZB 2K3UA 3Q3MC 1DGJA 1K5MD 2JF5A 3C8YA 3L10B 2LFIA 1V5OA 2ZPNA 1LFDA 4IWPA 3RD2A 4Q2JA 1E8XA 2JWUA 1VRAB 2RPZA 2MA9B 1GJZA 2INPE 4GDLB 1D3ZA 1DOIA 3HM3A 1PQSA 2QLCA 2C7MB 3AE1B 3BK1A 3VRBA 1D5ZC 3PS6A 4XGAB 4ZHPA 1OTRB 1WJ6A 2ON8A 4GGMX 2BB6A 5E6NA 3A4RA 4A8XC 1I4PA 1VZ7A 1ZPSA 4XWWA 2L76A 1KFYA 4YSZA 2A5UA 1RFAA 4A3PA 4GDKB 4MH8A 1GPXA 3FAHA 3NG0A 3TL5A 2G4SA 3R3MA 4BOZB 2KX3A 1KRHA 3S2AA 2KCQA 3GE8C 3V61A 3R2IA 4OWPA 3AEBA 3BZDB 2BS2B 4IM0A 2FNJB 3RPFC 1QOGA 2KDIA 3L0WB 3N9YC 2JQRB 3AH7A 3JD74 2WS3A 3AE4A 4B0EA 3W5VB 4ITKA 4CO7A 2KWUB 1DOXA 4M8NA 3R66C 5AEKB 3U4EG 4W9GA 1RM6C 2MBQA 1RHI4 3GS2A 1ASJ4 3PV1A 3QX1A 1SIFA 2ASQA 1THZA 3B2FA 1XT9B 4W9JA 2Z0EB 4L23A 4KSKC 4G0NB 5DCAJ 3VR8B 5EE0A 2LJ5A 3ECIA 2LGIA 1CTUA 3SFEA 3PT2B 1V5TA 2KMCA 1Y8RC 1RAXA 1IBXA 1WYGA 2WXRA 3R2NA 4GU2A 1YMHE 4AQ7A 4LLGM 1RUG4 1YJIA 4RNAA 2N9LA 4KX6B 3ALBA 1FNVA 4XZ4A 2N9KA 3N3KB 4A3OA 1PKXA 3NHEB 4NNJB 4OZCA 2JZPA 3NOBA 4BBNC 2INDC 3L08A 3R7QA 2KFJA 2QEJC 3HVDA 1P4RA 2EELA 2M0AA 2H88A 3SDLC 3SEBA 3NJTA 3VR9A 3W2DA 5LXIB 3TIXA 4AJWA 1NENB 4OHJA 2D3GA 2GB1A 1NDDA 2IO1B 1RWSA 1SEBD 3QK0A 4D10F 3W5UB 2PVOD 1KM7A 3TEXA 5J17A 1UGJA 3W1YA 4C80A 2RS14 1WYWB 4FLHA 4ZFTA 2M1MA 3AECA 2XBBC 5GMVA 3APDA 3BYTB 4A9AA 2N9PC 4DDGD 1PGAA 1WX7A 3ZNID 1WGRA 2G9HD 1WR6E 2PTLA 2KDEB 1QF6A 4HPPA 1XHZA 1QZEA 3OJ6A 1YIWA 3FKYA 4IC7B 1WIAA 2M56B 2BS4B 1XCTL 3JSVB 2KTFA 3I9V1 3GZNI 2D5NA 1T6BX 5KHQA 3H7PA 3VXWA 2AQ1B 2B3AA 4A6QA 4ANUA 2QJLA 4A55A 5FR3A 3Q6BA 5JH5C 4HKQA 4EZKA 4W9CA 1KH0A 3HIZA 1SGHA 3JBG4 5C23A 2G1EA 2JSVX 1P9DU 2KVRA 3NZ3A 2Z3JA 3APFA 3T3NA 2WDRA 1QKZA 4YTPA 4F8CB 4US9A 1UELA 5T8IA 4KZCA 3OAWA 3BH1A 2V3PA 2GMIC 4BGDC 5HFYA 1ISNA 2LUMA 2KC1A 2M19A 1J7CA 2N7EA 1BT0A 1RFKA 2R2OA 5G55A 2PE9A 5JHAA 1V86A 4P1BC 1YN4A 3L17A 2IGGA 4M0WA 5LNK1 1E8ZA 1L4DB 2WXNA 1QT9A 5JXVA 4WJQA 2LGXA 4JWUC 2BT6A 4J3OD 4GXBA 4K7UA 1D6EC 1COV4 3IXSA 1AL24 4URKA 3CMMB 1E9MA 4OVVA 4LCNA 2L05A 2KO3A 4NQKE 4LD2A 2IBIB 4DHZB 4NJCA 1HZ6A 1WGGA 1UX1A 2FBWB 4ZFRA 2D3CA 3L54A 1KFYB 2V0GA 3DDCB 3L4PA 1P3QU 2DZKA 2TSSA 3UIOB 2J53A 2O96A 3AE6B 4E0QA 1M9NA 1ZKHA 1P7EA 4ASWC 3AEBB 4OWPB 3ZNGC 3AE6A 2SAKA 5BYSA 3QC8B 3GB1A 4LC5A 4RGTA 1V9JA 3NZUA 2B3JA 3I5JC 4YXDA 2CHWA 2L7RA 1SJED 3AEGA 2INCC 4EOYA 2EMSA 5IOIA 4EE2A 1F77A 1WF9A 1WRIA 4C4VB 4KDIC 3WALA 2FE8A 3FC4A 4YL8A 1NCQD 1ZOYA 3H1UA 3MJWA 4F3WA 1TTNA 3ONSA 2IO3B 4BKGA 4ZRPA 2VZKD 4QFTA 2K1FA 2ZNVA 1R4NI 5G5HA 3HHMA 2MH7A 4YSYA 2KVZA 2ZNVB 3WAMA 1JQ4A 2V3SA 4KX6A 1WXSA 1SE3A 1EU4A 2JVCA 1PGBA 2AYOB 1VZ8A 4ZOHC 3DH1A 5BYQA 1KF6A 2MJDA 1HRV4 2N4FA 1I4QA 2MEKA 3AE5B 2ZW0A 4O1NA 4RFBA 2KQ7A 1V1PA 2ACZB 1WXVA 1UBIA 2O2VA 3DHIC 1PVC4 3VRBB 1WH3A 4N9F4 5LLIA 3PLVA 2AL6A 2J0KA 2DWQA 1R5XA 2BVCA 3W9CB 2FR5A 1R4MB 1WY8A 1EF5A 3ZZMA 4II2B 2KX0A 2OJWA 3RCZA 5JZEB 2LXAA 2DHZA 1VJKA 2RMU4 1E8YA 2DZJA 3OJ3A 2L0FA 1C77A 2AQ3B 2GRIA 2H89A 4NZLB 3ZKJC 2KDBA 1WMHA 2NTSA 2MSED 2DZMA 1L2NA 1RLFA 3A1QB 1J19A 1GNUA 3A1QA 3ZW3A 2RDHA 3VDZA 3T9LA 5DPRA 2WDQA 3VVWB 3AULA 2LRWA 1WSPA 3DBLB 1FO4A 2ZCBA 2MQJA 2JY6A 1WZ3A 1GG3A 2W3RA 4KVGB 3DMOA 2DYBA 5GAOA 1WE7A 2LVOA 4DWFA 2JX5A 2D2QA 3AN1A 5BMGA 4P1CC 3N20C 1WJ4A 2O95A 1VRH4 4BVUC 3QARA 4FHKA 1K53A 1UD7A 4B95A 2YLMA 4WWNA 4P9CA 3SFEB 3BY4B 1TT5B 4AOFA 2HVWA 3QAQA 1T3QA 2IO0B 1YN3A 1LGRA 3P4PB 4Q4W4 2B76A 2PE6B 1VBE4 1HA5A 1TY2A 3DVGX 4OVUA 3C19A 1MQ0A 4ICUA 2N9EB 4AUQC 4AWJA 1VBB4 3OG5A 1IPGA 4HDOA 1M94A 4O8YA 1MVKA 4K1RA 3BVGA 3RNEC 1ACCA 3M62B 2WXQA 2XN9C 3ZRCA 4O8YB 2K6QA 2R61A 2BYEA 2Z3GA 4MSQA 4Q4Y4 4OVZA 4N59A 5TSSA 1WGHA 4WIFA 1WXQA 4NJ7A 1LO5D 4W9LA 4DHJB 1H4RA 2N1VA 2E6XA 1STEA
chains in the Genus database with same CATH topology
3P42A 3BK1A 1N5WA 1D5ZC 1J7BA 4ARIA 4KGSA 1D4BA 4ZHPA 4IKGA 4RGMA 1ALNA 1B1ZA 1JCKB 4EG2A 1ZXHA 2ON8A 2BB6A 3P4SB 1P7FA 4A8XC 1SB3C 3AECB 4DQOC 1I4PA 1F2RI 1VZ7A 1ZPSA 4XWWA 2I2YA 4MSDA 3AEFB 5BMIA 1WN6A 2BB5A 2HVVA 4P9EA 1AW7A 4OCLB 4GDKB 2EKIA 4MH8A 1GPXA 3FAHA 4KGTA 2JXTA 1L6VA 1RB7A 1I4GA 4I43B 2WNMA 1KRHA 2KCQA 4WIGA 1FNWA 2LEKA 4LCPA 1UWXA 3R2IA 1XI1A 1L0XB 4OWPA 3V3XA 3WCQA 1FMAD 1JMLA 3BZDB 2BS2B 1YQ4B 1E10A 2QILA 1JWBD 3V05A 4YXDB 2KQ4X 3RPFC 1QOGA 2DYMA 1MHXA 3AV8A 3P63A 1WGKA 4JX1C 2WS3B 4LK0M 3N9YC 4WURA 2JQRB 1FFVA 2WXPA 3AH7A 2XNAC 3EA6A 4TSSA 1KLUD 1CK1A 1N62A 4JPSA 3Q69A 3W5VB 4ITKA 4B0EA 3MHZA 1FD6A 1DOXA 3BVMA 3AE4B 4TQ0A 2G84A 5CW6A 3NVVA 5C2TB 1FIQA 1I4RA 4O8XA 3U4EG 2JYTA 1RM6C 2CU3A 2WDRB 1JWSD 5M52C 1MHHE 1SJHD 2AQ2B 2Z3IA 3LXFA 1AF2A 3GS2A 3ZQ4A 1VR9A 3G8QA 1N5XA 2R7FA 1EWCA 1BUIC 4XE0A 3B2FA 4WH4A 5DCAJ 4L23A 1EM7A 1ZUD2 1TS4A 2WXKA 3FILB 5EE0A 3VR8B 3CWIA 3BWUD 2LGIA 2NTTA 4HKZE 5D7GA 1CTUA 1NEKB 5H8YE 3P1MA 5HHDG 1IBXA 1TKGA 4IOIE 1WYGA 2L83A 2WXRA 4XWTA 3R2NA 1YMHE 1HZ5A 1FRRA 4LLGM 4AQ7A 1YJIA 4HRQA 2DYOA 4RNAA 2N9LA 1PGXA 4KX6B 1FNVA 4LTUA 4N58A 3U7ZA 1MI0A 2BBCA 2WDVB 4OCMA 2N9KA 4OCNA 1ROEA 4RH6A 3E1UA 5HI1A 3OCQA 4OZCA 2FR6A 2DLBA 2JZPA 1TY0A 2K0PA 1ESFA 2INNE 3LYYA 4KGRA 4L1BA 2QEJC 3HVDA 1YSDA 1PDXA 2EELA 3TSSA 2M0AA 2N0SB 3SEBA 1J7AA 2AX5A 3W2DA 1R7SA 2IGHA 1NYRA 1V97A 2WXIA 5EE1A 4MSJA 1OQRA 4F7OA 1SSNA 1NENB 2Y5PA 4OHJA 2L52A 2HXVA 1WKQA 1I4XA 2GB1A 3CIRB 2V3NA 3Q8BA 5HG2A 3EGRA 1RWSA 2YEPB 1K51A 1SEBD 3SR6A 2O3KA 2K5PA 2KWDA 2FUG1 3AEDB 4D10F 2HDEA 3AB5A 3W5UB 2OG4A 1XLPA 2MJEA 2PVOD 3TEXA 1GB4A 1UGJA 1EWYC 4C80A 1FXAA 4ZFTA 2ICIA 4P6VF 4C7YA 3NVWA 3NVYA 1E7PB 2PYJA 3DWMA 3BYYB 3BYTB 4PQTA 4A9AA 1HXYD 3IJFX 1PGAA 4MM3B 1Z3AA 1XLNA 2LMCA 3ABVB 4R3DA 2G9HD 1ET6A 1KLGD 1QOFA 2PTLA 1VDVA 1QF6A 2L1AA 3H8HA 1XHZA 1SIJA 4OZAA 2KAJA 3OJ6A 3MJ5A 1L5PA 2D30A 3SFDB 4OZBA 4YT0B 3ZEFB 1SF0A 1XF5L 1C9FA 2M56B 2BS4B 1XCTL 1IGCA 1JWMD 1UWZA 3AEEB 1C78A 2QSDA 3I9V1 1T6BX 2D5NA 2J52A 1YJJA 2AQ1B 3TUOA 3MPZA 1PUTA 5FKAC 3AE2B 1TS5A 2N7JA 1QLBB 3Q8FA 4A6QA 2I38A 2QJLA 3KWLA 4A55A 1XLOA 5FR3A 4HKQA 4O8XB 5C3JB 1C76A 1ET9A 1XCQL 1L4ZB 1V1OA 1GB1A 1KH0A 2J4XA 4NQLA 1XLQA 1HEZE 3R8BA 2G1EA 2JSVX 3BK2A 3AE8B 2PMVA 2WU2B 2RDGA 3NZ3A 2Z3JA 3T3NA 1P6OA 1FFUA 1QKZA 4D2KA 4FXCA 4US9A 5T8IA 2X38A 4YTPB 1E0ZA 4WAFA 1D5MC 1ZDVA 2PIAA 2V3PA 4BGDC 5HFYA 3HVZA 2LUMA 2KN4A 2M19A 1J7CA 1SE4A 1RFKA 4YSXB 1TIYA 1L6UA 1EU3A 1TKEA 2SEBD 1YN4A 2B76B 2NMQA 1NI3A 4MS7A 4JXEA 2KMMA 4A90A 2ZW1A 2IGGA 1A70A 1R5TA 4M0WA 4OCMB 2V4IB 2JYEA 4HJGE 5LNK1 2Y5CA 3ZJVA 2ZNRA 1SBBB 1UUPA 1L4DB 2WXNA 2VZKB 2CJOA 3U52E 1QT9A 2A8NA 5JXVA 3VR9B 4GLSC 4JWUC 2BT6A 4WWMA 4J3OD 1D6EC 3IXSA 1E9MA 1V1PB 4LCNA 2JU6X 1JW9D 3AM9A 2YEPF 1DOYA 2KDMA 4LD2A 2B3ZA 4NJCA 1HZ6A 2W4LA 3B2GA 2WLBA 1OX7A 1UX1A 2KACA 3BIID 3LB8C 4PT5A 2FBWB 4UDUC 1I4HA 2IPKD 4ZFRA 4RGNA 1D5XC 3Q8EA 4LCOA 1KFYB 5M59B 2V0GA 1FM0D 1WWTA 4KITC 3L4PA 1B9RA 1JRPA 2H89B 2G6VA 4MACA 2D5GA 4NAWB 2Z3HA 2TSSA 2J53A 2BYTA 2O96A 1C4PA 4YSZB 1ZE3D 1F0ZA 3AE6B 2BW2A 4E0QA 4ZD4A 4OCLA 3Q8AA 1E6EB 3AE7B 1P7EA 4H2AA 2WU5B 1I7HA 3AEBB 4OWPB 5D3IB 1AYFA 2E3TA 2QMTA 4ZYSA 1JWAD 1XHXA 2SAKA 2GI9A 5BYSA 1TJEA 5GXGB 3GB1A 1TS3A 2KKSA 3AE9B 4RGTA 4LC5A 1N63A 4AS1A 2ONQA 1ENFA 1FCCC 2B3JA 1TKYA 2W55A 4XDDA 2WDQB 3IT6B 1PYWD 4WQMA 4RF1A 1OQQA 1Q10A 1YQ3B 3PZ7A 1SJED 4LD4A 3NS1A 3NVZA 4OW0A 2PVGC 5FK9C 1CJEA 4DXFA 4EE2A 1F2RC 2K22A 1F77A 4N6EB 5AUIA 2PYLA 2PY5A 1WRIA 2P8RA 5D3DA 5MPOA 1PFDA 2WXOA 5H92C 2FE8A 3KWVA 3AMZA 3FC4A 2O7PA 4TQ1A 1VQ2A 4F3WA 1UNSA 3NUHB 5I4DA 2LJIA 2IDYA 1ZOYB 4HROA 4ZRPA 3EUB2 2VZKD 1FRDA 3IAS1 4QFTA 1K50A 2ZNVA 1IBXB 1L0VB 2Y3AA 3E56A 5G5HA 2CJNA 2MH7A 2WP9B 3RZUA 4JWSC 1JALA 4YTNB 3PZ8A 3ZGZA 1JQ4A 3O13A 1UWMA 3MP9A 1VZ6A 1NVID 1EU4A 1SE3A 1KF6B 1CZPA 1PGBA 4YSYB 5G5GA 1VZ8A 3T3OA 3B8FA 2MJ3A 4ZOHC 3HUIA 1TZOA 2HTME 5EE9A 5BYQA 3DH1A 2WXJA 4ZHOA 1UAQA 4CQNA 2L32A 2MJDA 3UI3A 1WWRA 3I57A 1ZABA 3U2SC 1I4QA 5EE3A 1NYQA 2MEKA 3J9CA 3AE5B 4ZRQA 2ZW0A 2OEDA 4WIPA 4O1NA 4REZA 1YN5A 1OI0A 4RFBA 4HRSA 2J42A 3PO0A 2EX3A 4ILGC 1V1PA 1ZDXA 2ACZB 2WXMA 3ZPGA 3RZVA 1MPEA 4TMAB 3VRBB 3TEYA 3VQIA 5E6JA 1WN5A 1L0YB 1TYGB 3TEWA 1BMLC 2DWQA 1R5XA 3W9CB 2WQYB 3URYA 2FR5A 4MSMA 2LHDA 1M4VA 1JTKA 3BVZA 1XXGA 2W82A 3MFGA 1FXIA 2Z8LA 2PLPA 1K52A 1C79A 1KTKA 2K9XA 2LHEA 5BMHA 1FNUA 4NAMA 3E9SA 1HQRD 1VJKA 3ZJUA 3EX8A 3ZJTA 4HEA1 2W54A 3NRZA 1C77A 1IGDA 2AQ3B 2QIEB 3IT4B 1QQRA 2GRIA 1N60A 2W3SA 3R2TA 3ZPCA 4NZLB 5BYRA 1VLBA 3IAM1 3KLSX 1GAQB 1V8CA 2P87A 2NTSA 1UX0A 3RFZB 3P4QB 1XO3A 1IUEA 1QILA 2NYTA 4B0MA 4YWGG 1AWDA 2RDHA 1C4CA 2BS3B 4MT5A 2IGDA 1QOAA 1WSPA 4DXGA 1FO4A 3FI7A 3SBGA 2RMMA 4JE3B 3MC0B 2OHFA 4KKJA 1XEEA 4USAA 1N61A 3P4RB 4G3MA 1RYJA 4P9DA 2DBYA 2W3RA 1FCLA 1ZXIA 3DMOA 5C2OA 2WXHA 3TEZA 5GAOA 1OFFA 1AN8A 4US8A 1JROA 4L2YA 2JX5A 3AEGB 3AN1A 5BMGA 2WXFA 1YNTE 1C4AA 4HRWA 3AE3B 1TS2A 1FEHA 3KQ4A 3W1SA 2PW9A 3HRDD 2RPVA 4C7ZA 2BTEA 1CTTA 2O95A 3FILA 1SXTA 2PZSA 1K53A 4P9CA 3DWGC 3SFEB 2Q5WD 4P16A 1Y56A 1BXTA 2HVWA 1T5XD 1T3QA 1YSBA 4IDIA 1YN3A 3B9JA 3Q8CA 3P4PB 1HA5A 1SE2A 1TY2A 3AEAB 3OWEB 4YTMB 4OCNB 2WXGA 4C56C 1MQ0A 1GOZA 2IJ0A 5AUKA 4ZD5A 2K3UA 1DGJA 4O8YA 1MVKA 4K1RA 3BVGA 1ACCA 2OBCA 2WXQA 2WXLA 3C8YA 2XN9C 4XDCA 4O8YB 1JWUD 2LFIA 2R61A 1QOBA 3ZYYX 2Z3GA 3ETRA 4KKIA 4OVZA 4N59A 4MSQA 5TSSA 4Q2JA 3VRAB 2JWUA 4WIFA 1VRAB 2PKOA 1WXQA 4RF0A 4ARCA 1ZP0B 4RCOA 2RPZA 1LO5D 2INPE 4GDLB 1DOIA 2E6XA 4RGOS 1STEA 2NX8A 3GP7A 1CQVA 1DYQA 2QLCA 2H88B 3AE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5X A;  2KDM A;  4LD2 A;  2B3Z A;  2HXV A;  2FR5 A;  1D4B A;  1WKQ A;  2LHD A;  4KGS A;  4MSM A;  1HZ6 A;  1JTK A;  2GB1 A;  4IKG A;  2W4L A;  1ALN A;  5HG2 A;  1OX7 A;  1UX1 A;  4EG2 A;  2KAC A;  1K51 A;  1ZXH A;  2O3K A;  4ZFR A;  2KWD A;  2ON8 A;  2PLP A;  1K52 A;  4D10 F;  2LHE A;  4LCO A;  5BMH A;  2OG4 A;  5M59 B;  1P7F A;  4KIT C;  1GB4 A;  1F2R I;  2I2Y A;  4MSD A;  2G6V A;  3EX8 A;  4MAC A;  5BMI A;  1WN6 A;  4ZFT A;  1IGD A;  2HVV A;  2Z3H A;  4P9E A;  2J53 A;  4OCL B;  2O96 A;  2PYJ A;  4KGT A;  3ZPC A;  4PQT A;  2JXT A;  4E0Q A;  3IJF X;  1PGA A;  1RB7 A;  1Z3A A;  4ZD4 A;  4OCL A;  2P87 A;  1P7E A;  4I43 B;  1UX0 A;  4OWP B;  2PTL A;  2KCQ A;  2QMT A;  4WIG A;  4LCP A;  1XHX A;  1UWX A;  1XI1 A;  1XHZ A;  4OZA A;  2NYT A;  4OWP A;  3V3X A;  2GI9 A;  3OJ6 A;  2D30 A;  1JML A;  4OZB A;  3GB1 A;  2KKS A;  4LC5 A;  3ZEF B;  1XF5 L;  1C9F A;  2ONQ A;  2IGD A;  2KQ4 X;  3FI7 A;  1FCC C;  1XCT L;  3SBG A;  2B3J A;  2RMM A;  1MHX A;  1IGC A;  1UWZ A;  2D5N A;  2QSD A;  1Q10 A;  2J52 A;  3MPZ A;  4G3M A;  2N7J A;  4P9D A;  2I38 A;  1FCL A;  4LD4 A;  3DMO A;  1FD6 A;  4O8X B;  5C2O A;  5GAO A;  1XCQ L;  1F2R C;  2G84 A;  1GB1 A;  1KH0 A;  4NQL A;  5CW6 A;  2PYL A;  4O8X A;  2PY5 A;  1HEZ E;  5BMG A;  1YNT E;  2P8R A;  4HRW A;  5M52 C;  2JSV X;  1MHH E;  2Z3I A;  2Z3J A;  1AF2 A;  2O7P A;  2PW9 A;  1CTT A;  2RPV A;  1P6O A;  1VQ2 A;  2O95 A;  3G8Q A;  4F3W A;  3FIL A;  2R7F A;  2PZS A;  1QKZ A;  4D2K A;  1K53 A;  4WH4 A;  4P9C A;  4O8Y A;  5DCA J;  1EM7 A;  4QFT A;  3FIL B;  1K50 A;  2LGI A;  2ZNV A;  1IBX B;  4HKZ E;  1CTU A;  2HVW A;  4BGD C;  1YSB A;  5HFY A;  3RZU A;  2LUM A;  2KN4 A;  5HHD G;  1IBX A;  4IOI E;  3MP9 A;  3R2N A;  1YMH E;  1HZ5 A;  1TIY A;  1PGB A;  4OCN B;  4HRQ A;  3B8F A;  1PGX A;  2N9L A;  1MQ0 A;  1MI0 A;  2NMQ A;  3DH1 A;  4MS7 A;  4OCM A;  2N9K A;  4OCN A;  4ZD5 A;  4JXE A;  1UAQ A;  3E1U A;  2ZW1 A;  5HI1 A;  3OCQ A;  4OZC A;  2IGG A;  1MVK A;  3UI3 A;  1WWR A;  1ZAB A;  2FR6 A;  2JZP A;  1R5T A;  2OBC A;  4K1R A;  2K0P A;  4OCM B;  4HJG E;  2ZNR A;  4O8Y B;  4KGR A;  4MSQ A;  2ZW0 A;  2OED A;  2Z3G A;  1OI0 A;  1YSD A;  2A8N A;  2JWU A;  5JXV A;  4WIF A;  4GLS C;  2EX3 A;  4ILG C;  2EEL A;  2RPZ A;  3ZPG A;  3RZV A;  1MPE A;  2NX8 A;  1WN5 A;  4LCN A;  2JU6 X;  2QLC A;  4F7O A;  2IGH A;  4MSJ A; 
#chains in the Genus database with same CATH topology
 1D4B A;  4BOS C;  1ALN A;  1B1Z A;  1ZXH A;  1P7F A;  3CF6 E;  1SB3 C;  3AEC B;  4MSD A;  5BMI A;  4HPL B;  2EKI A;  3WAP A;  4KIK A;  1I4G A;  3WIM A;  4WIG A;  1XI1 A;  3WCQ A;  1FMA D;  1JML A;  3ZNH B;  1D4M 4;  4YXD B;  2DYM A;  1MHX A;  3AV8 A;  3ZO5 B;  1WGK A;  4LK0 M;  1FFV A;  2WXP A;  3EA6 A;  2B1G A;  1KLU D;  2CKH B;  4LDT D;  3SD5 A;  3BVM A;  4EHI A;  3JW0 X;  3AE4 B;  2PPH A;  3NVV A;  5C2T B;  4O8X A;  3A4S C;  2CU3 A;  2WDR B;  3W1S C;  3KUZ A;  5M52 C;  2WWZ A;  2Z3I A;  1PO2 4;  1RUD 4;  3B1L X;  3LXF A;  2UWQ A;  4CYE A;  1AF2 A;  2FCQ A;  1VR9 A;  2D11 A;  2PEA A;  4IG7 B;  1EM7 A;  3A9J B;  3DCG A;  5CTR C;  4HKZ E;  5D7G A;  2M4N A;  2KD0 A;  1EF1 A;  1K8R B;  1TKG A;  3IFW B;  2RS5 4;  3GQK A;  1FRR A;  2DYO A;  2KWV B;  3ZNZ B;  1PGX A;  3U7Z A;  2KJH B;  4EEW A;  1MI0 A;  4M0W B;  4DBG A;  1ROE A;  2FR6 A;  3VRA A;  3R7R A;  4KGR A;  4L1B A;  2HWC 4;  1SE9 A;  4JIO U;  3TSS A;  4G50 A;  2DX5 B;  4GB3 4;  4MSJ A;  2NBU A;  2L52 A;  1WKQ A;  1UGM A;  3EGR A;  4E74 A;  2J7Q B;  3SR6 A;  2KWD A;  2KTR B;  2OG4 A;  3AEF A;  1XLP A;  1GB4 A;  1EWY C;  3RYT A;  2D10 A;  1FXA A;  2I1K A;  4P6V F;  4C7Y A;  2WYQ A;  3DWM A;  2PYJ A;  3BYY B;  2EMT A;  1HXY D;  2J0J A;  2CHX A;  1R08 4;  1V6E A;  1KLG D;  4PS8 A;  2DZI A;  4FJV B;  2L1A A;  2LGS A;  4MGY E;  2RM2 4;  4OZA A;  3K9O B;  3MJ5 A;  1L5P A;  2D3A A;  5E6P A;  5IN7 A;  4FJY A;  3ZEF B;  1XF5 L;  1V81 A;  2V9H A;  3DOW A;  1IGC A;  4NJ6 A;  1UWZ A;  2DNF A;  5L83 A;  1TS5 A;  2JXX A;  3RUI B;  2MWS B;  3QHT A;  1N6Z A;  1C76 A;  1FPY A;  1XLQ A;  3KYC D;  2MRP A;  2D3B A;  3BK2 A;  3AE8 B;  2VRR B;  2PMV A;  3WA0 A;  4K7W A;  1MG4 A;  4FXC A;  1VCB A;  3RNG C;  4W9E A;  4YTP B;  4WAF A;  1E0Z A;  1WM2 A;  2L00 B;  1IYF A;  3EFC A;  3HVZ A;  2C9W B;  2KN4 A;  5TR5 A;  3WAN A;  2WP9 A;  1TIY A;  1L6U A;  5FR6 A;  2Z59 B;  2R07 4;  3DVG Y;  1RMU 4;  4JXE A;  1PO1 4;  2KMM A;  4GGQ A;  1A70 A;  1R5T A;  3ZXV A;  2JYE A;  4HJG E;  2Y5C A;  1OEY J;  2ZNR A;  4G3X B;  2A8N A;  2NBV B;  4JGH B;  3VR9 B;  1GC6 A;  2IU0 A;  5L95 C;  3AXC A;  4S17 A;  1ZGU B;  2LZ6 A;  2JU6 X;  1PL0 A;  2B3Z A;  3N1Y C;  3B2G A;  2WX1 A;  3I3T B;  3LB8 C;  4B6W A;  4UDU C;  4GN1 A;  3Q8E A;  2RD0 A;  2K39 A;  5DPW A;  1B9R A;  1JRP A;  2H89 B;  1HTQ A;  2G4D B;  2BYT A;  3AE7 A;  1F0Z A;  4OCL A;  3Q8A A;  2WU5 B;  1G6J A;  1JWA D;  1S1Q B;  3PHX B;  1OQY A;  2GI9 A;  3M95 A;  2MHJ A;  3AE9 B;  4AS1 A;  2ONQ A;  2YVC A;  3V6C B;  1TKY A;  5G2N A;  1LM8 B;  4XDD A;  2BKF A;  1PYW D;  3AE9 A;  4LD4 A;  3N32 A;  1NI2 A;  4RHV 4;  5IO9 A;  2PY5 A;  2P8R A;  4TQ1 A;  3NUH B;  4KZ0 A;  3PRE A;  1ZOY B;  4HRO A;  3KUC B;  4M00 A;  1IBX B;  4DDI D;  2CJN A;  3RZU A;  1R09 4;  4JWS C;  3VTW A;  3PZ8 A;  2IU3 A;  1UWM A;  3MP9 A;  1A5R A;  1VZ6 A;  4YSY B;  3T3O A;  2GBR A;  3B8F A;  1TGZ B;  3LDZ E;  2QC8 A;  3SUC A;  3AU4 A;  3N1Z C;  3CSF A;  3VTV A;  2WDV A;  4HDQ A;  3DBR I;  5EE3 A;  1NYQ A;  3L16 A;  4MDK E;  1OI0 A;  4HRS A;  3VHT C;  2IY1 B;  3AE5 A;  2L0T A;  1HTO A;  1ZDX A;  2IYD B;  3HK0 A;  3VQI A;  1NA1 D;  1YD8 U;  1BEV 4;  2BWF A;  2BYF A;  2LHD A;  3CST A;  4Q4X 4;  2FBW A;  2CS4 A;  4B9K A;  2PJH A;  1C79 A;  2K9X A;  2WHI A;  5BMH A;  3QIJ A;  3E9S A;  1HQR D;  1YX6 B;  3ZJU A;  1T0Y A;  3R2T A;  5BYR A;  3U7D A;  1EO6 A;  2OOB B;  3P4Q A;  3RI7 C;  3IAM 1;  1V8C A;  2P87 A;  2MBE A;  2O6V B;  3JSV A;  1AWD A;  1C4C A;  4MGZ E;  3X23 A;  2IGD A;  2RMM A;  4JE3 B;  4USA A;  2IY0 B;  1N61 A;  4P9D A;  3KH0 A;  1YQ3 A;  5C2O A;  3TEZ A;  2WGS A;  1OFF A;  1XQQ A;  3DBS A;  1AN8 A;  2XK5 A;  4C4V A;  3AE3 A;  2LAS A;  2WXF A;  1YNT E;  3AE3 B;  2K8H A;  4NQL B;  3AU5 A;  3HRD D;  2BTE A;  4C7Z A;  4WJP A;  1VBC 4;  2DAJ A;  2RGF A;  3A9J A;  1SXT A;  2PZS A;  3PVL A;  1V2Y A;  1T0S C;  3DWG C;  1OEY A;  2Q5W D;  1Y56 A;  2Y5B B;  3JYU A;  1I35 A;  1RUI 4;  3RT3 B;  1T5X D;  4IUM B;  3PRZ A;  5IA7 A;  3B9J A;  2A4Z A;  4FJZ A;  3AEA B;  4OCN B;  3P4P A;  2WXG A;  4II3 B;  1LQB A;  5AUK A;  2HD5 B;  3EC8 A;  5D6J B;  2G3Q B;  3QQ8 B;  1EV1 4;  2UYZ B;  5LXH A;  2OBC A;  3ML9 A;  5DCN A;  3U8Z A;  4XDC A;  2JRI B;  3ZYY X;  2VH2 A;  3ZDM C;  4DXA B;  4MSQ B;  1ZP0 B;  4PS3 A;  3DHH C;  3KW5 B;  4RGO S;  2NX8 A;  2WQY A;  1C3T A;  4Q4V 4;  1CQV A;  1DYQ A;  2WX0 A;  1RUF 4;  1N5W A;  4ARI A;  4IKG A;  3ZXR A;  4RGM A;  5AZF A;  2GLS A;  2C7N B;  4IWO A;  4EG2 A;  2KTR A;  4MH0 E;  3IG3 A;  1J0G A;  3P4S B;  4M01 A;  4DQO C;  1F2R I;  2MW5 A;  5AZG A;  2BB5 A;  2HVV A;  4P9E A;  3QCA A;  3J8F 4;  4KGT A;  2WU5 A;  1L6V A;  1RB7 A;  3Q3O C;  3RNA C;  3NZS A;  3PZD A;  2LEK A;  4LCP A;  1UWX A;  4HWI B;  1L0X B;  2LUE A;  3V62 A;  5CHV C;  1YQ4 B;  1E10 A;  2HE7 A;  2KDF B;  2QIL A;  2NPT A;  4EZJ A;  4JX1 C;  1H8T D;  1Z7S 4;  3PRP B;  4WUR A;  2FCM A;  2NVU I;  2XNA C;  4TSS A;  4IWQ A;  5JHB A;  3Q69 A;  2R04 4;  5J2R A;  3AE8 A;  2G84 A;  1I4R A;  5IP4 D;  1I42 A;  2JYT A;  2M17 A;  1UZX B;  1JWS D;  2AQ2 B;  2K8B A;  3ZDT A;  2BWE S;  2LRU A;  1EWC A;  4WH4 A;  3KYD D;  3VUY A;  2MBB B;  3Q3J A;  1ZUD 2;  1TS4 A;  1EAH 4;  2KK8 A;  3BWU D;  2NTT A;  1NEK B;  3P1M A;  1WX9 A;  2MLB A;  4HRQ A;  3P2B A;  2JPH A;  4LTU A;  4N58 A;  2WDV B;  1V80 A;  4OCN A;  3AEA A;  2KYW A;  4RH6 A;  5HI1 A;  4JL9 A;  3OCQ A;  2DLB A;  2B1I A;  1ESF A;  4TV3 A;  3LYY A;  1YSD A;  4GDL A;  1PDX A;  4G11 A;  2N0S B;  1E7V A;  5EDS A;  4K7S A;  2AX5 A;  2NBW B;  4F7O A;  2IGH A;  3O65 B;  1V97 A;  5EE1 A;  1OQR A;  2Y5P A;  1R4M I;  1T0Q C;  2V3N A;  5DPT A;  1K51 A;  2N1W A;  2ZJD A;  3AED B;  3AB5 A;  4AP4 C;  2MJE A;  3T8M A;  2ZVN A;  4PYU A;  4GDK A;  3P4S A;  3A33 B;  2ICI A;  2D07 B;  2MP2 B;  1E7P B;  2KWC A;  1RUC 4;  4MM3 B;  1MQT D;  2R06 4;  2N7D A;  1QOF A;  3SFD A;  1YJ1 A;  2D30 A;  3SFD B;  4YT0 B;  3AI5 A;  1WR1 A;  4W9I A;  4LNF A;  4A1O A;  2QSD A;  2J52 A;  1YJJ A;  4RM9 A;  2W9N A;  3TUO A;  3MPZ A;  5FKA C;  3AE2 B;  1AR8 4;  2XK5 B;  2ZNV C;  2I38 A;  4PDW D;  3KWL A;  4W9D A;  3H6N A;  1VBA 4;  1Z5S B;  1L4Z B;  1V1O A;  2J4X A;  3R8B A;  2AL3 A;  1C1Y B;  4WWO A;  1YOV B;  1P6O A;  1FFU A;  4M02 A;  4D2K A;  2KKC A;  1PIV 4;  3DVN V;  1TZ1 A;  1ZDV A;  4K3B A;  4S0R A;  1IP9 A;  4IM2 A;  2I1J A;  1Q0W B;  4FAD A;  1NI3 A;  4MS7 A;  4A90 A;  3GQH A;  4TUU A;  3SU8 X;  4OCM B;  2V4I B;  3ZJV A;  1UUP A;  2CJO A;  4ICV A;  4GLS C;  5D94 A;  2Z0D B;  3PRM B;  2K8C A;  4WWM A;  1V1P B;  2ACZ A;  2O2V B;  2YEP F;  1DOY A;  3M63 B;  4F7Z A;  2KDM A;  1AR6 4;  2KAC A;  3BII D;  1I4H A;  3N1X C;  3PTF C;  4E3C A;  5M59 B;  1FM0 D;  3IBE A;  4KIT C;  4A20 A;  4KIK B;  2D5G A;  4ZDV A;  4NAW B;  5DPS A;  2Z3H A;  4K81 A;  2WDT B;  4HCN B;  3RMK C;  1C4P A;  2JZ3 B;  2ZEQ A;  1ZE3 D;  2BW2 A;  4WAA A;  1OZ0 A;  4ZD4 A;  2G45 B;  3AE7 B;  4H2A A;  3APC A;  3IVF A;  2E3T A;  2QMT A;  3I63 C;  4J6I A;  4ZYS A;  5C1Z A;  1GUA B;  1V49 A;  4ANV A;  2M8S A;  5GXG B;  1TS3 A;  1N63 A;  1KLV A;  2W55 A;  2WDQ B;  1YQ3 B;  3PZ7 A;  2RDB C;  1F1H A;  2MCN B;  5C2T A;  3NS1 A;  3NVZ A;  2LI5 A;  3AE2 A;  2PVG C;  5FK9 C;  4LNI A;  3P4R A;  1CJE A;  2K22 A;  3U30 A;  5HKH A;  4N6E B;  1YQB A;  3EEC A;  5AUI A;  2PYL A;  1PFD A;  2WXO A;  1Q5W B;  5H92 C;  1T0R C;  3KWV A;  3ZUN A;  2O7P A;  1VQ2 A;  5I4D A;  2LJI A;  2WU2 A;  3A9K B;  3IAS 1;  3RNF C;  3E56 A;  4HK2 A;  4LNK A;  3VR8 A;  2QDF A;  2WP9 B;  4P7I A;  4WJO A;  1JAL A;  4YTN B;  3ZGZ A;  2KXJ A;  3KUD B;  3O13 A;  3ML8 A;  4ZRK A;  2CU1 A;  5G5G A;  1CZP A;  1RUJ 4;  4MEL A;  3VUW A;  1VBD 4;  3HUI A;  2WXJ A;  4ZHO A;  1UAQ A;  3UI3 A;  1WWR A;  2BYV E;  2KNB A;  5CHF A;  3J9C A;  4XX5 A;  4ZRQ A;  2OED A;  1U4A A;  2XEW A;  1WE6 A;  2C7H A;  3PO0 A;  2QHO A;  4ILG C;  1JRU A;  3TEY A;  4MSM B;  1TYG B;  4CHK A;  2C5L C;  2MBO A;  3RZW C;  4E71 A;  4MSM A;  1WGD A;  1J8C A;  1M4V A;  2LVP A;  1JTK A;  3BVZ A;  3PSE B;  3ZTC A;  3L13 A;  3MFG A;  1FXI A;  4NPN A;  2PLP A;  1KTK A;  2LHE A;  1FNU A;  2PLV 4;  1WJU A;  2W54 A;  3NRZ A;  4WQO B;  2L8J A;  2QIE B;  1F52 A;  1QQR A;  1N60 A;  4MGK E;  3ZPC A;  2HJ1 A;  2KJ6 A;  1VLB A;  1R4N B;  4GB9 A;  3UGB B;  2L3Z A;  2KJR A;  4EFO A;  3RFZ B;  3P4Q B;  1XO3 A;  4B0M A;  3Q14 C;  2NPT B;  1MG8 A;  4YWG G;  2NCN A;  1RVF 4;  4MT5 A;  1QOA A;  4DXG A;  2RSU A;  3ZLZ A;  3SBG A;  3MC0 B;  2LD9 A;  3RNB C;  1E7U A;  1Z2M A;  1GC7 A;  2DBY A;  5BO4 B;  4QAY A;  2WXH A;  2FID A;  4HCP B;  4BBN F;  4L2Y A;  3PGE A;  4M8M A;  3B08 A;  1WFY A;  1C4A A;  1FEH A;  3KQ4 A;  2PW9 A;  1CTT A;  4ANW A;  1P0R A;  4JLC A;  1HRI 4;  1NEK A;  2ZZP B;  1BXT A;  4PYZ A;  3NS8 A;  3NY5 A;  1YSB A;  3Q8C A;  3JVZ X;  4FN2 A;  3RZF A;  4WWP A;  3OWE B;  1SE2 A;  4EZL A;  4C00 A;  4YTN A;  4EUT A;  2NS5 A;  2IJ0 A;  2RS3 4;  4YSX A;  1RRB A;  4ZD5 A;  3UIP B;  4BKS D;  2WXL A;  2QCZ A;  3PLU A;  1JWU D;  1QOB A;  1MFW A;  3ETR A;  4KKI A;  3VRA B;  1KJT A;  3UQA A;  2PKO A;  4RF0 A;  4ARC A;  4RCO A;  2LGY A;  3RUL A;  1E90 A;  5AZH A;  1E8W A;  3GP7 A;  5E6O A;  2H88 B;  3CIR A;  3P42 A;  4HJK A;  1X1M A;  1J7B A;  4KGS A;  3GZN B;  4KV2 A;  2DEN B;  1JCK B;  1NEN A;  3V6E B;  2HTH A;  3Q3F A;  4LDT B;  3TMP B;  4NAW A;  2MP2 A;  4FHJ A;  2I2Y A;  3AEF B;  1WN6 A;  4MM3 A;  1AW7 A;  4OCL B;  1VD2 A;  2C60 A;  2FIF A;  1XD3 B;  2KC2 A;  4JQW C;  2JXT A;  4I43 B;  3DPD A;  2WNM A;  1FNW A;  4J6E A;  3V3X A;  4LJP B;  1JWB D;  3V05 A;  2KQ4 X;  3C0R B;  3P63 A;  2WS3 B;  3OJ4 B;  2X5I D;  2KFK B;  4BFR A;  1CK1 A;  1N62 A;  4JPS A;  4EKU A;  2OJR A;  3MHZ A;  1FD6 A;  4TQ0 A;  2LXC A;  3ZVV A;  3EHV A;  3D32 A;  5CW6 A;  1AR7 4;  1ZCZ A;  1FIQ A;  1MHH E;  1OOP D;  1SJH D;  4DHJ D;  3A9K A;  3ZQ4 A;  2BF8 B;  3G8Q A;  1N5X A;  2R7F A;  4HLE A;  1BUI C;  3H7S A;  4XE0 A;  3OLM D;  2WXK A;  3FIL B;  2FAZ A;  3CWI A;  2KLC A;  4HXD A;  5H8Y E;  2KZR A;  1HXS 4;  5HHD G;  5CX3 A;  4IOI E;  4XWT A;  2L83 A;  2GBN A;  4FA6 A;  1HZ5 A;  2KAN A;  4RMA A;  1AR9 4;  4K1R B;  2BBC A;  4OCM A;  4TKN A;  1S3S G;  3BIN A;  3TCA A;  3E1U A;  1TY0 A;  2K0P A;  5IKC M;  2INN E;  1EUV B;  1ZP0 A;  4WJN A;  3DVN U;  2RR1 4;  2BQQ A;  1J7A A;  4LJO B;  1CMX B;  1R7S A;  1NYR A;  1ZW7 A;  2WXI A;  1SSN A;  2ZCC A;  2HXV A;  1I4X A;  2R2Q A;  1RUE 4;  3CIR B;  3Q8B A;  5HG2 A;  2YEP B;  4GMV A;  3ZIM A;  2O3K A;  1Q1O A;  2K5P A;  2FUG 1;  2HDE A;  3SHQ A;  2GBK A;  3Q3N C;  4NY0 A;  2AEH A;  2N9X A;  4ZRJ A;  3MC9 A;  3AED A;  2IZV B;  3NVW A;  3NVY A;  2JWZ A;  4PQT A;  3LJ3 A;  3IJF X;  1Z3A A;  1XLN A;  2LMC A;  3ABV B;  4R3D A;  4W9F A;  1ET6 A;  2O6V A;  1VDV A;  3H8H A;  1SIJ A;  2KAJ A;  4GOC A;  4OZB A;  2V4L A;  1SF0 A;  1C9F A;  3DHG C;  1VK9 A;  2GOW A;  4FBJ B;  1E5W A;  1WXM A;  2JUO A;  1JWM D;  3DBH I;  4W9K A;  3AEE B;  1C78 A;  3IHP C;  1PUT A;  4I6L B;  2N7J A;  4XC2 A;  1QLB B;  2RPQ A;  3Q8F A;  4O8X B;  1XLO A;  5D2M B;  5C3J B;  1XCQ L;  1ET9 A;  1GB1 A;  4NQL A;  2V1Y A;  2O6V D;  1HEZ E;  5C3J A;  1HE8 A;  2WU2 B;  2RDG A;  4RM8 A;  2AWT A;  3GOE A;  2IO2 B;  4GIV A;  3N30 A;  2X38 A;  2KQS A;  2X8X X;  1D5M C;  2PIA A;  2ZVO A;  2UU7 A;  3K9P B;  1SE4 A;  1G8M A;  4YSX B;  1EU3 A;  1TKE A;  2SEB D;  2FCN A;  4BAX A;  1L7Y A;  2B76 B;  2NMQ A;  1RUH 4;  2ZW1 A;  3UQB A;  1SBB B;  3EFU A;  2VZK B;  2CHZ A;  2MBH A;  4IW0 A;  3U52 E;  1POV 0;  3VH3 B;  1WXA A;  1LXD A;  2KMA A;  3UIN B;  1WZ0 A;  2BPS A;  1P98 A;  1JW9 D;  3AM9 A;  5KHO A;  4DK5 A;  4W9H A;  3VX8 A;  2W4L A;  2WLB A;  1OX7 A;  1OGW A;  4PT5 A;  2IPK D;  4PK1 A;  4RGN A;  1D5X C;  4LCO A;  4HVB A;  3GE3 C;  1WWT A;  2G6V A;  4MAC A;  2VH1 A;  4MEM A;  2DAF A;  3DBH B;  4YSZ B;  2KN5 A;  1E6E B;  1I7H A;  5D3I B;  1AYF A;  5CHW A;  4YT0 A;  1XHX A;  1YQ4 A;  1WMH B;  3DBR B;  4LNO A;  4KDL B;  1TJE A;  2KKS A;  1ENF A;  1UF0 A;  1FCC C;  2EKE C;  4WQM A;  3IT6 B;  2KHW B;  2NR2 A;  1OQQ A;  4RF1 A;  1Q10 A;  4LNN A;  4ZRI A;  3AEE A;  3ZRF A;  3H7P B;  1H8C A;  3TBL D;  2KOX A;  4OW0 A;  4DXF A;  1F2R C;  4I6P A;  4DHZ E;  2K6D B;  2J0M A;  2LVQ A;  5D3D A;  5MPO A;  4XYC A;  3AMZ A;  1UNS A;  2LWP A;  2IDY A;  3EUB 2;  1WRD B;  1FRD A;  1K50 A;  3KVF B;  1L0V B;  2Y3A A;  4I6N B;  1F9J A;  3ENE A;  4BKS A;  4YTM A;  5IAA C;  3MC8 A;  1NVI D;  1NBF C;  1KF6 B;  1FXT B;  2MJ3 A;  2ZPY A;  1TZO A;  2HTM E;  5EE9 A;  3DBL I;  4CQN A;  2L32 A;  1ZAB A;  3I57 A;  3U2S C;  2CR5 A;  4HPM B;  1TBE A;  3MHS D;  4WIP A;  1TIF A;  4REZ A;  1YN5 A;  3VUX A;  2J42 A;  2EX3 A;  2WXM A;  2GBJ A;  3ZPG A;  1AAR A;  3H9D A;  3RZV A;  3AE1 A;  1MPE A;  3HM6 X;  4TMA B;  1WN5 A;  5E6J A;  1L0Y B;  3TEW A;  2MX2 A;  1BML C;  3TJP A;  2KLG A;  2WQY B;  3URY A;  1UBQ A;  2HWB 4;  1XXG A;  2W82 A;  4KSL C;  1P1A A;  3DQV A;  2Z8L A;  1K52 A;  4NAM A;  2BKR B;  4IM3 A;  3RN9 C;  3EX8 A;  4BZA A;  4HEA 1;  4BKT A;  3ZJT A;  1IGD A;  3IT4 B;  4ANX A;  3ABV A;  1MJD A;  2W3S A;  2GBM A;  4FUL A;  1WM3 A;  4PS7 A;  3KLS X;  2JRH A;  1GAQ B;  3M3J A;  4ZYN A;  1UX0 A;  2JT4 B;  4K3C A;  2M0X A;  3V60 A;  1IUE A;  2BGF A;  3ZTD A;  1QIL A;  2NYT A;  2FCS A;  3B0A A;  2BS3 B;  1KOT A;  5J18 A;  2REX A;  3FI7 A;  3RNC C;  2KFK A;  3PHW B;  4GSW A;  2OHF A;  4KKJ A;  1XEE A;  1WX8 A;  2LGD A;  3P4R B;  3PPA A;  4X57 B;  4G3M A;  1RYJ A;  1YX5 B;  1FCL A;  1ZXI A;  3Q2A C;  4AJY B;  3UF8 A;  4US8 A;  1JRO A;  4LCD E;  3AEG B;  1WJN A;  4ACF A;  4HRW A;  1TS2 A;  3QA8 A;  3VFK A;  3VTU A;  3W1S A;  2JZZ A;  2RPV A;  2K25 A;  3FIL A;  4MJS A;  3X0W A;  4P16 A;  3VH4 B;  1UH6 A;  3MTN B;  4MJS B;  1WGY A;  2RR9 A;  4IDI A;  2HJ8 A;  4MGI E;  2FUH B;  1L0V A;  1WI0 A;  4F1S A;  3VAW A;  3WAO A;  4YTM B;  4C56 C;  1GOZ A;  3QJZ A;  2KT7 A;  3QWZ B;  2K3U A;  3Q3M C;  1DGJ A;  1K5M D;  2JF5 A;  3C8Y A;  3L10 B;  2LFI A;  1V5O A;  2ZPN A;  1LFD A;  4IWP A;  3RD2 A;  4Q2J A;  1E8X A;  2JWU A;  1VRA B;  2RPZ A;  2MA9 B;  1GJZ A;  2INP E;  4GDL B;  1D3Z A;  1DOI A;  3HM3 A;  1PQS A;  2QLC A;  2C7M B;  3AE1 B;  3BK1 A;  3VRB A;  1D5Z C;  3PS6 A;  4XGA B;  4ZHP A;  1OTR B;  1WJ6 A;  2ON8 A;  4GGM X;  2BB6 A;  5E6N A;  3A4R A;  4A8X C;  1I4P A;  1VZ7 A;  1ZPS A;  4XWW A;  2L76 A;  1KFY A;  4YSZ A;  2A5U A;  1RFA A;  4A3P A;  4GDK B;  4MH8 A;  1GPX A;  3FAH A;  3NG0 A;  3TL5 A;  2G4S A;  3R3M A;  4BOZ B;  2KX3 A;  1KRH A;  3S2A A;  2KCQ A;  3GE8 C;  3V61 A;  3R2I A;  4OWP A;  3AEB A;  3BZD B;  2BS2 B;  4IM0 A;  2FNJ B;  3RPF C;  1QOG A;  2KDI A;  3L0W B;  3N9Y C;  2JQR B;  3AH7 A;  3JD7 4;  2WS3 A;  3AE4 A;  4B0E A;  3W5V B;  4ITK A;  4CO7 A;  2KWU B;  1DOX A;  4M8N A;  3R66 C;  5AEK B;  3U4E G;  4W9G A;  1RM6 C;  2MBQ A;  1RHI 4;  3GS2 A;  1ASJ 4;  3PV1 A;  3QX1 A;  1SIF A;  2ASQ A;  1THZ A;  3B2F A;  1XT9 B;  4W9J A;  2Z0E B;  4L23 A;  4KSK C;  4G0N B;  5DCA J;  3VR8 B;  5EE0 A;  2LJ5 A;  3ECI A;  2LGI A;  1CTU A;  3SFE A;  3PT2 B;  1V5T A;  2KMC A;  1Y8R C;  1RAX A;  1IBX A;  1WYG A;  2WXR A;  3R2N A;  4GU2 A;  1YMH E;  4AQ7 A;  4LLG M;  1RUG 4;  1YJI A;  4RNA A;  2N9L A;  4KX6 B;  3ALB A;  1FNV A;  4XZ4 A;  2N9K A;  3N3K B;  4A3O A;  1PKX A;  3NHE B;  4NNJ B;  4OZC A;  2JZP A;  3NOB A;  4BBN C;  2IND C;  3L08 A;  3R7Q A;  2KFJ A;  2QEJ C;  3HVD A;  1P4R A;  2EEL A;  2M0A A;  2H88 A;  3SDL C;  3SEB A;  3NJT A;  3VR9 A;  3W2D A;  5LXI B;  3TIX A;  4AJW A;  1NEN B;  4OHJ A;  2D3G A;  2GB1 A;  1NDD A;  2IO1 B;  1RWS A;  1SEB D;  3QK0 A;  4D10 F;  3W5U B;  2PVO D;  1KM7 A;  3TEX A;  5J17 A;  1UGJ A;  3W1Y A;  4C80 A;  2RS1 4;  1WYW B;  4FLH A;  4ZFT A;  2M1M A;  3AEC A;  2XBB C;  5GMV A;  3APD A;  3BYT B;  4A9A A;  2N9P C;  4DDG D;  1PGA A;  1WX7 A;  3ZNI D;  1WGR A;  2G9H D;  1WR6 E;  2PTL A;  2KDE B;  1QF6 A;  4HPP A;  1XHZ A;  1QZE A;  3OJ6 A;  1YIW A;  3FKY A;  4IC7 B;  1WIA A;  2M56 B;  2BS4 B;  1XCT L;  3JSV B;  2KTF A;  3I9V 1;  3GZN I;  2D5N A;  1T6B X;  5KHQ A;  3H7P A;  3VXW A;  2AQ1 B;  2B3A A;  4A6Q A;  4ANU A;  2QJL A;  4A55 A;  5FR3 A;  3Q6B A;  5JH5 C;  4HKQ A;  4EZK A;  4W9C A;  1KH0 A;  3HIZ A;  1SGH A;  3JBG 4;  5C23 A;  2G1E A;  2JSV X;  1P9D U;  2KVR A;  3NZ3 A;  2Z3J A;  3APF A;  3T3N A;  2WDR A;  1QKZ A;  4YTP A;  4F8C B;  4US9 A;  1UEL A;  5T8I A;  4KZC A;  3OAW A;  3BH1 A;  2V3P A;  2GMI C;  4BGD C;  5HFY A;  1ISN A;  2LUM A;  2KC1 A;  2M19 A;  1J7C A;  2N7E A;  1BT0 A;  1RFK A;  2R2O A;  5G55 A;  2PE9 A;  5JHA A;  1V86 A;  4P1B C;  1YN4 A;  3L17 A;  2IGG A;  4M0W A;  5LNK 1;  1E8Z A;  1L4D B;  2WXN A;  1QT9 A;  5JXV A;  4WJQ A;  2LGX A;  4JWU C;  2BT6 A;  4J3O D;  4GXB A;  4K7U A;  1D6E C;  1COV 4;  3IXS A;  1AL2 4;  4URK A;  3CMM B;  1E9M A;  4OVV A;  4LCN A;  2L05 A;  2KO3 A;  4NQK E;  4LD2 A;  2IBI B;  4DHZ B;  4NJC A;  1HZ6 A;  1WGG A;  1UX1 A;  2FBW B;  4ZFR A;  2D3C A;  3L54 A;  1KFY B;  2V0G A;  3DDC B;  3L4P A;  1P3Q U;  2DZK A;  2TSS A;  3UIO B;  2J53 A;  2O96 A;  3AE6 B;  4E0Q A;  1M9N A;  1ZKH A;  1P7E A;  4ASW C;  3AEB B;  4OWP B;  3ZNG C;  3AE6 A;  2SAK A;  5BYS A;  3QC8 B;  3GB1 A;  4LC5 A;  4RGT A;  1V9J A;  3NZU A;  2B3J A;  3I5J C;  4YXD A;  2CHW A;  2L7R A;  1SJE D;  3AEG A;  2INC C;  4EOY A;  2EMS A;  5IOI A;  4EE2 A;  1F77 A;  1WF9 A;  1WRI A;  4C4V B;  4KDI C;  3WAL A;  2FE8 A;  3FC4 A;  4YL8 A;  1NCQ D;  1ZOY A;  3H1U A;  3MJW A;  4F3W A;  1TTN A;  3ONS A;  2IO3 B;  4BKG A;  4ZRP A;  2VZK D;  4QFT A;  2K1F A;  2ZNV A;  1R4N I;  5G5H A;  3HHM A;  2MH7 A;  4YSY A;  2KVZ A;  2ZNV B;  3WAM A;  1JQ4 A;  2V3S A;  4KX6 A;  1WXS A;  1SE3 A;  1EU4 A;  2JVC A;  1PGB A;  2AYO B;  1VZ8 A;  4ZOH C;  3DH1 A;  5BYQ A;  1KF6 A;  2MJD A;  1HRV 4;  2N4F A;  1I4Q A;  2MEK A;  3AE5 B;  2ZW0 A;  4O1N A;  4RFB A;  2KQ7 A;  1V1P A;  2ACZ B;  1WXV A;  1UBI A;  2O2V A;  3DHI C;  1PVC 4;  3VRB B;  1WH3 A;  4N9F 4;  5LLI A;  3PLV A;  2AL6 A;  2J0K A;  2DWQ A;  1R5X A;  2BVC A;  3W9C B;  2FR5 A;  1R4M B;  1WY8 A;  1EF5 A;  3ZZM A;  4II2 B;  2KX0 A;  2OJW A;  3RCZ A;  5JZE B;  2LXA A;  2DHZ A;  1VJK A;  2RMU 4;  1E8Y A;  2DZJ A;  3OJ3 A;  2L0F A;  1C77 A;  2AQ3 B;  2GRI A;  2H89 A;  4NZL B;  3ZKJ C;  2KDB A;  1WMH A;  2NTS A;  2MSE D;  2DZM A;  1L2N A;  1RLF A;  3A1Q B;  1J19 A;  1GNU A;  3A1Q A;  3ZW3 A;  2RDH A;  3VDZ A;  3T9L A;  5DPR A;  2WDQ A;  3VVW B;  3AUL A;  2LRW A;  1WSP A;  3DBL B;  1FO4 A;  2ZCB A;  2MQJ A;  2JY6 A;  1WZ3 A;  1GG3 A;  2W3R A;  4KVG B;  3DMO A;  2DYB A;  5GAO A;  1WE7 A;  2LVO A;  4DWF A;  2JX5 A;  2D2Q A;  3AN1 A;  5BMG A;  4P1C C;  3N20 C;  1WJ4 A;  2O95 A;  1VRH 4;  4BVU C;  3QAR A;  4FHK A;  1K53 A;  1UD7 A;  4B95 A;  2YLM A;  4WWN A;  4P9C A;  3SFE B;  3BY4 B;  1TT5 B;  4AOF A;  2HVW A;  3QAQ A;  1T3Q A;  2IO0 B;  1YN3 A;  1LGR A;  3P4P B;  4Q4W 4;  2B76 A;  2PE6 B;  1VBE 4;  1HA5 A;  1TY2 A;  3DVG X;  4OVU A;  3C19 A;  1MQ0 A;  4ICU A;  2N9E B;  4AUQ C;  4AWJ A;  1VBB 4;  3OG5 A;  1IPG A;  4HDO A;  1M94 A;  4O8Y A;  1MVK A;  4K1R A;  3BVG A;  3RNE C;  1ACC A;  3M62 B;  2WXQ A;  2XN9 C;  3ZRC A;  4O8Y B;  2K6Q A;  2R61 A;  2BYE A;  2Z3G A;  4MSQ A;  4Q4Y 4;  4OVZ A;  4N59 A;  5TSS A;  1WGH A;  4WIF A;  1WXQ A;  4NJ7 A;  1LO5 D;  4W9L A;  4DHJ B;  1H4R A;  2N1V A;  2E6X A;  1STE A; 
#chains in the Genus database with same CATH homology
 3P42 A;  3BK1 A;  1N5W A;  1D5Z C;  1J7B A;  4ARI A;  4KGS A;  1D4B A;  4ZHP A;  4IKG A;  4RGM A;  1ALN A;  1B1Z A;  1JCK B;  4EG2 A;  1ZXH A;  2ON8 A;  2BB6 A;  3P4S B;  1P7F A;  4A8X C;  1SB3 C;  3AEC B;  4DQO C;  1I4P A;  1F2R I;  1VZ7 A;  1ZPS A;  4XWW A;  2I2Y A;  4MSD A;  3AEF B;  5BMI A;  1WN6 A;  2BB5 A;  2HVV A;  4P9E A;  1AW7 A;  4OCL B;  4GDK B;  2EKI A;  4MH8 A;  1GPX A;  3FAH A;  4KGT A;  2JXT A;  1L6V A;  1RB7 A;  1I4G A;  4I43 B;  2WNM A;  1KRH A;  2KCQ A;  4WIG A;  1FNW A;  2LEK A;  4LCP A;  1UWX A;  3R2I A;  1XI1 A;  1L0X B;  4OWP A;  3V3X A;  3WCQ A;  1FMA D;  1JML A;  3BZD B;  2BS2 B;  1YQ4 B;  1E10 A;  2QIL A;  1JWB D;  3V05 A;  4YXD B;  2KQ4 X;  3RPF C;  1QOG A;  2DYM A;  1MHX A;  3AV8 A;  3P63 A;  1WGK A;  4JX1 C;  2WS3 B;  4LK0 M;  3N9Y C;  4WUR A;  2JQR B;  1FFV A;  2WXP A;  3AH7 A;  2XNA C;  3EA6 A;  4TSS A;  1KLU D;  1CK1 A;  1N62 A;  4JPS A;  3Q69 A;  3W5V B;  4ITK A;  4B0E A;  3MHZ A;  1FD6 A;  1DOX A;  3BVM A;  3AE4 B;  4TQ0 A;  2G84 A;  5CW6 A;  3NVV A;  5C2T B;  1FIQ A;  1I4R A;  4O8X A;  3U4E G;  2JYT A;  1RM6 C;  2CU3 A;  2WDR B;  1JWS D;  5M52 C;  1MHH E;  1SJH D;  2AQ2 B;  2Z3I A;  3LXF A;  1AF2 A;  3GS2 A;  3ZQ4 A;  1VR9 A;  3G8Q A;  1N5X A;  2R7F A;  1EWC A;  1BUI C;  4XE0 A;  3B2F A;  4WH4 A;  5DCA J;  4L23 A;  1EM7 A;  1ZUD 2;  1TS4 A;  2WXK A;  3FIL B;  5EE0 A;  3VR8 B;  3CWI A;  3BWU D;  2LGI A;  2NTT A;  4HKZ E;  5D7G A;  1CTU A;  1NEK B;  5H8Y E;  3P1M A;  5HHD G;  1IBX A;  1TKG A;  4IOI E;  1WYG A;  2L83 A;  2WXR A;  4XWT A;  3R2N A;  1YMH E;  1HZ5 A;  1FRR A;  4LLG M;  4AQ7 A;  1YJI A;  4HRQ A;  2DYO A;  4RNA A;  2N9L A;  1PGX A;  4KX6 B;  1FNV A;  4LTU A;  4N58 A;  3U7Z A;  1MI0 A;  2BBC A;  2WDV B;  4OCM A;  2N9K A;  4OCN A;  1ROE A;  4RH6 A;  3E1U A;  5HI1 A;  3OCQ A;  4OZC A;  2FR6 A;  2DLB A;  2JZP A;  1TY0 A;  2K0P A;  1ESF A;  2INN E;  3LYY A;  4KGR A;  4L1B A;  2QEJ C;  3HVD A;  1YSD A;  1PDX A;  2EEL A;  3TSS A;  2M0A A;  2N0S B;  3SEB A;  1J7A A;  2AX5 A;  3W2D A;  1R7S A;  2IGH A;  1NYR A;  1V97 A;  2WXI A;  5EE1 A;  4MSJ A;  1OQR A;  4F7O A;  1SSN A;  1NEN B;  2Y5P A;  4OHJ A;  2L52 A;  2HXV A;  1WKQ A;  1I4X A;  2GB1 A;  3CIR B;  2V3N A;  3Q8B A;  5HG2 A;  3EGR A;  1RWS A;  2YEP B;  1K51 A;  1SEB D;  3SR6 A;  2O3K A;  2K5P A;  2KWD A;  2FUG 1;  3AED B;  4D10 F;  2HDE A;  3AB5 A;  3W5U B;  2OG4 A;  1XLP A;  2MJE A;  2PVO D;  3TEX A;  1GB4 A;  1UGJ A;  1EWY C;  4C80 A;  1FXA A;  4ZFT A;  2ICI A;  4P6V F;  4C7Y A;  3NVW A;  3NVY A;  1E7P B;  2PYJ A;  3DWM A;  3BYY B;  3BYT B;  4PQT A;  4A9A A;  1HXY D;  3IJF X;  1PGA A;  4MM3 B;  1Z3A A;  1XLN A;  2LMC A;  3ABV B;  4R3D A;  2G9H D;  1ET6 A;  1KLG D;  1QOF A;  2PTL A;  1VDV A;  1QF6 A;  2L1A A;  3H8H A;  1XHZ A;  1SIJ A;  4OZA A;  2KAJ A;  3OJ6 A;  3MJ5 A;  1L5P A;  2D30 A;  3SFD B;  4OZB A;  4YT0 B;  3ZEF B;  1SF0 A;  1XF5 L;  1C9F A;  2M56 B;  2BS4 B;  1XCT L;  1IGC A;  1JWM D;  1UWZ A;  3AEE B;  1C78 A;  2QSD A;  3I9V 1;  1T6B X;  2D5N A;  2J52 A;  1YJJ A;  2AQ1 B;  3TUO A;  3MPZ A;  1PUT A;  5FKA C;  3AE2 B;  1TS5 A;  2N7J A;  1QLB B;  3Q8F A;  4A6Q A;  2I38 A;  2QJL A;  3KWL A;  4A55 A;  1XLO A;  5FR3 A;  4HKQ A;  4O8X B;  5C3J B;  1C76 A;  1ET9 A;  1XCQ L;  1L4Z B;  1V1O A;  1GB1 A;  1KH0 A;  2J4X A;  4NQL A;  1XLQ A;  1HEZ E;  3R8B A;  2G1E A;  2JSV X;  3BK2 A;  3AE8 B;  2PMV A;  2WU2 B;  2RDG A;  3NZ3 A;  2Z3J A;  3T3N A;  1P6O A;  1FFU A;  1QKZ A;  4D2K A;  4FXC A;  4US9 A;  5T8I A;  2X38 A;  4YTP B;  1E0Z A;  4WAF A;  1D5M C;  1ZDV A;  2PIA A;  2V3P A;  4BGD C;  5HFY A;  3HVZ A;  2LUM A;  2KN4 A;  2M19 A;  1J7C A;  1SE4 A;  1RFK A;  4YSX B;  1TIY A;  1L6U A;  1EU3 A;  1TKE A;  2SEB D;  1YN4 A;  2B76 B;  2NMQ A;  1NI3 A;  4MS7 A;  4JXE A;  2KMM A;  4A90 A;  2ZW1 A;  2IGG A;  1A70 A;  1R5T A;  4M0W A;  4OCM B;  2V4I B;  2JYE A;  4HJG E;  5LNK 1;  2Y5C A;  3ZJV A;  2ZNR A;  1SBB B;  1UUP A;  1L4D B;  2WXN A;  2VZK B;  2CJO A;  3U52 E;  1QT9 A;  2A8N A;  5JXV A;  3VR9 B;  4GLS C;  4JWU C;  2BT6 A;  4WWM A;  4J3O D;  1D6E C;  3IXS A;  1E9M A;  1V1P B;  4LCN A;  2JU6 X;  1JW9 D;  3AM9 A;  2YEP F;  1DOY A;  2KDM A;  4LD2 A;  2B3Z A;  4NJC A;  1HZ6 A;  2W4L A;  3B2G A;  2WLB A;  1OX7 A;  1UX1 A;  2KAC A;  3BII D;  3LB8 C;  4PT5 A;  2FBW B;  4UDU C;  1I4H A;  2IPK D;  4ZFR A;  4RGN A;  1D5X C;  3Q8E A;  4LCO A;  1KFY B;  5M59 B;  2V0G A;  1FM0 D;  1WWT A;  4KIT C;  3L4P A;  1B9R A;  1JRP A;  2H89 B;  2G6V A;  4MAC A;  2D5G A;  4NAW B;  2Z3H A;  2TSS A;  2J53 A;  2BYT A;  2O96 A;  1C4P A;  4YSZ B;  1ZE3 D;  1F0Z A;  3AE6 B;  2BW2 A;  4E0Q A;  4ZD4 A;  4OCL A;  3Q8A A;  1E6E B;  3AE7 B;  1P7E A;  4H2A A;  2WU5 B;  1I7H A;  3AEB B;  4OWP B;  5D3I B;  1AYF A;  2E3T A;  2QMT A;  4ZYS A;  1JWA D;  1XHX A;  2SAK A;  2GI9 A;  5BYS A;  1TJE A;  5GXG B;  3GB1 A;  1TS3 A;  2KKS A;  3AE9 B;  4RGT A;  4LC5 A;  1N63 A;  4AS1 A;  2ONQ A;  1ENF A;  1FCC C;  2B3J A;  1TKY A;  2W55 A;  4XDD A;  2WDQ B;  3IT6 B;  1PYW D;  4WQM A;  4RF1 A;  1OQQ A;  1Q10 A;  1YQ3 B;  3PZ7 A;  1SJE D;  4LD4 A;  3NS1 A;  3NVZ A;  4OW0 A;  2PVG C;  5FK9 C;  1CJE A;  4DXF A;  4EE2 A;  1F2R C;  2K22 A;  1F77 A;  4N6E B;  5AUI A;  2PYL A;  2PY5 A;  1WRI A;  2P8R A;  5D3D A;  5MPO A;  1PFD A;  2WXO A;  5H92 C;  2FE8 A;  3KWV A;  3AMZ A;  3FC4 A;  2O7P A;  4TQ1 A;  1VQ2 A;  4F3W A;  1UNS A;  3NUH B;  5I4D A;  2LJI A;  2IDY A;  1ZOY B;  4HRO A;  4ZRP A;  3EUB 2;  2VZK D;  1FRD A;  3IAS 1;  4QFT A;  1K50 A;  2ZNV A;  1IBX B;  1L0V B;  2Y3A A;  3E56 A;  5G5H A;  2CJN A;  2MH7 A;  2WP9 B;  3RZU A;  4JWS C;  1JAL A;  4YTN B;  3PZ8 A;  3ZGZ A;  1JQ4 A;  3O13 A;  1UWM A;  3MP9 A;  1VZ6 A;  1NVI D;  1EU4 A;  1SE3 A;  1KF6 B;  1CZP A;  1PGB A;  4YSY B;  5G5G A;  1VZ8 A;  3T3O A;  3B8F A;  2MJ3 A;  4ZOH C;  3HUI A;  1TZO A;  2HTM E;  5EE9 A;  5BYQ A;  3DH1 A;  2WXJ A;  4ZHO A;  1UAQ A;  4CQN A;  2L32 A;  2MJD A;  3UI3 A;  1WWR A;  3I57 A;  1ZAB A;  3U2S C;  1I4Q A;  5EE3 A;  1NYQ A;  2MEK A;  3J9C A;  3AE5 B;  4ZRQ A;  2ZW0 A;  2OED A;  4WIP A;  4O1N A;  4REZ A;  1YN5 A;  1OI0 A;  4RFB A;  4HRS A;  2J42 A;  3PO0 A;  2EX3 A;  4ILG C;  1V1P A;  1ZDX A;  2ACZ B;  2WXM A;  3ZPG A;  3RZV A;  1MPE A;  4TMA B;  3VRB B;  3TEY A;  3VQI A;  5E6J A;  1WN5 A;  1L0Y B;  1TYG B;  3TEW A;  1BML C;  2DWQ A;  1R5X A;  3W9C B;  2WQY B;  3URY A;  2FR5 A;  4MSM A;  2LHD A;  1M4V A;  1JTK A;  3BVZ A;  1XXG A;  2W82 A;  3MFG A;  1FXI A;  2Z8L A;  2PLP A;  1K52 A;  1C79 A;  1KTK A;  2K9X A;  2LHE A;  5BMH A;  1FNU A;  4NAM A;  3E9S A;  1HQR D;  1VJK A;  3ZJU A;  3EX8 A;  3ZJT A;  4HEA 1;  2W54 A;  3NRZ A;  1C77 A;  1IGD A;  2AQ3 B;  2QIE B;  3IT4 B;  1QQR A;  2GRI A;  1N60 A;  2W3S A;  3R2T A;  3ZPC A;  4NZL B;  5BYR A;  1VLB A;  3IAM 1;  3KLS X;  1GAQ B;  1V8C A;  2P87 A;  2NTS A;  1UX0 A;  3RFZ B;  3P4Q B;  1XO3 A;  1IUE A;  1QIL A;  2NYT A;  4B0M A;  4YWG G;  1AWD A;  2RDH A;  1C4C A;  2BS3 B;  4MT5 A;  2IGD A;  1QOA A;  1WSP A;  4DXG A;  1FO4 A;  3FI7 A;  3SBG A;  2RMM A;  4JE3 B;  3MC0 B;  2OHF A;  4KKJ A;  1XEE A;  4USA A;  1N61 A;  3P4R B;  4G3M A;  1RYJ A;  4P9D A;  2DBY A;  2W3R A;  1FCL A;  1ZXI A;  3DMO A;  5C2O A;  2WXH A;  3TEZ A;  5GAO A;  1OFF A;  1AN8 A;  4US8 A;  1JRO A;  4L2Y A;  2JX5 A;  3AEG B;  3AN1 A;  5BMG A;  2WXF A;  1YNT E;  1C4A A;  4HRW A;  3AE3 B;  1TS2 A;  1FEH A;  3KQ4 A;  3W1S A;  2PW9 A;  3HRD D;  2RPV A;  4C7Z A;  2BTE A;  1CTT A;  2O95 A;  3FIL A;  1SXT A;  2PZS A;  1K53 A;  4P9C A;  3DWG C;  3SFE B;  2Q5W D;  4P16 A;  1Y56 A;  1BXT A;  2HVW A;  1T5X D;  1T3Q A;  1YSB A;  4IDI A;  1YN3 A;  3B9J A;  3Q8C A;  3P4P B;  1HA5 A;  1SE2 A;  1TY2 A;  3AEA B;  3OWE B;  4YTM B;  4OCN B;  2WXG A;  4C56 C;  1MQ0 A;  1GOZ A;  2IJ0 A;  5AUK A;  4ZD5 A;  2K3U A;  1DGJ A;  4O8Y A;  1MVK A;  4K1R A;  3BVG A;  1ACC A;  2OBC A;  2WXQ A;  2WXL A;  3C8Y A;  2XN9 C;  4XDC A;  4O8Y B;  1JWU D;  2LFI A;  2R61 A;  1QOB A;  3ZYY X;  2Z3G A;  3ETR A;  4KKI A;  4OVZ A;  4N59 A;  4MSQ A;  5TSS A;  4Q2J A;  3VRA B;  2JWU A;  4WIF A;  1VRA B;  2PKO A;  1WXQ A;  4RF0 A;  4ARC A;  1ZP0 B;  4RCO A;  2RPZ A;  1LO5 D;  2INP E;  4GDL B;  1DOI A;  2E6X A;  4RGO S;  1STE A;  2NX8 A;  3GP7 A;  1CQV A;  1DYQ A;  2QLC A;  2H88 B;  3AE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...