1HRV4

Hrv14/sdz 35-682 complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title SDZ 35-682, a new picornavirus capsid-binding agent with potent antiviral activity.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1hrv400
1VRH4 1ASJ4 2RMU4 1RUE4 1NCQD 1R084 1PO14 1RUH4 1OOPD 4Q4Y4 1PO24 2X5ID 1NA1D 1MQTD 1D4M4 3JD74 4RHV4 1VBB4 1AR94 1RUD4 2HWB4 1POV0 1RMU4 1EV14 1RHI4 1PVC4 1RUG4 1RUI4 1H8TD 1VBD4 1VBC4 2R044 4Q4V4 1HRI4 2RR14 1RUC4 1VBA4 2RM24 1AL24 3J8F4 1RUF4 2RS54 3JBG4 1COV4 2R074 1AR84 1R094 4Q4X4 1BEV4 1PIV4 2R064 1K5MD 4Q4W4 1HXS4 4GB34 1HRV4 1VBE4 4PDWD 2HWC4 1AR74 2PLV4 1EAH4 1RVF4 1RUJ4 2RS34 2RS14 1AR64 1Z7S4
chains in the Genus database with same CATH superfamily
1RUE4 1NCQD 1PO14 2WQYA 1RUH4 2WDQA 1PO24 3ABVA 1NA1D 3JD74 3AEFA 1EV14 3AEAA 1HRI4 2RR14 3GQKA 1YQ4A 1BEV4 2R064 2WDVA 4GB34 1VBE4 2WDRA 2HWC4 2PLV4 3AEEA 2RS34 2PW9A 1R084 2PZSA 3AE9A 2X5ID 1NEKA 3AE7A 1XHXA 3AE6A 3FI7A 3GQHA 1POV0 2FBWA 4YTNA 3AEDA 1VBC4 4Q4V4 1XI1A 3P4SA 1RUC4 1VBA4 2RM24 1XHZA 2RS54 3JBG4 2R074 1AR84 1PIV4 4Q4W4 1K5MD 1HXS4 1HRV4 4PDWD 1AR74 1YQ3A 2PYJA 1EAH4 2H88A 2WP9A 1NENA 3AE5A 3AE1A 2RS14 2PY5A 1Z7S4 3P4RA 1ASJ4 4YTMA 3AEBA 1MQTD 1KF6A 3P4PA 4RHV4 2HWB4 1RMU4 3VR9A 4KX6A 1PVC4 1RUG4 1VBD4 1H8TD 3VRBA 4YT0A 2WS3A 1ZP0A 1RUF4 3VRAA 1COV4 4YTPA 3AE8A 4YXDA 3AE3A 3CIRA 4YSYA 2WU2A 1ZOYA 3SUCA 3P4QA 3SFDA 2WU5A 2EX3A 1VRH4 2ACZA 2RMU4 3VR8A 2R7FA 2H89A 1OOPD 4Q4Y4 1D4M4 1VBB4 3AE4A 1AR94 1RUD4 3SFEA 1RHI4 4YSZA 1RUI4 3AEGA 2R044 1L0VA 2B76A 1AL24 3J8F4 5C3JA 4Q4X4 1R094 3AECA 4YSXA 5C2TA 2PYLA 1RVF4 1RUJ4 3AE2A 1KFYA 1AR64
chains in the Genus database with same CATH topology
1VRH4 1ASJ4 2RMU4 1RUE4 1NCQD 1R084 1PO14 1RUH4 1OOPD 4Q4Y4 1PO24 2X5ID 1NA1D 1MQTD 1D4M4 3JD74 4RHV4 1VBB4 1AR94 1RUD4 2HWB4 1POV0 1RMU4 1EV14 1RHI4 1PVC4 1RUG4 1RUI4 1H8TD 1VBD4 1VBC4 2R044 4Q4V4 1HRI4 2RR14 1RUC4 1VBA4 2RM24 1AL24 3J8F4 1RUF4 2RS54 3JBG4 1COV4 2R074 1AR84 1R094 4Q4X4 1BEV4 1PIV4 2R064 1K5MD 4Q4W4 1HXS4 4GB34 1HRV4 1VBE4 4PDWD 2HWC4 1AR74 2PLV4 1EAH4 1RVF4 1RUJ4 2RS34 2RS14 1AR64 1Z7S4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRH 4;  1ASJ 4;  2RMU 4;  1RUE 4;  1NCQ D;  1R08 4;  1PO1 4;  1RUH 4;  1OOP D;  4Q4Y 4;  1PO2 4;  2X5I D;  1NA1 D;  1MQT D;  1D4M 4;  3JD7 4;  4RHV 4;  1VBB 4;  1AR9 4;  1RUD 4;  2HWB 4;  1POV 0;  1RMU 4;  1EV1 4;  1RHI 4;  1PVC 4;  1RUG 4;  1RUI 4;  1H8T D;  1VBD 4;  1VBC 4;  2R04 4;  4Q4V 4;  1HRI 4;  2RR1 4;  1RUC 4;  1VBA 4;  2RM2 4;  1AL2 4;  3J8F 4;  1RUF 4;  2RS5 4;  3JBG 4;  1COV 4;  2R07 4;  1AR8 4;  1R09 4;  4Q4X 4;  1BEV 4;  1PIV 4;  2R06 4;  1K5M D;  4Q4W 4;  1HXS 4;  4GB3 4;  1HRV 4;  1VBE 4;  4PDW D;  2HWC 4;  1AR7 4;  2PLV 4;  1EAH 4;  1RVF 4;  1RUJ 4;  2RS3 4;  2RS1 4;  1AR6 4;  1Z7S 4; 
#chains in the Genus database with same CATH topology
 1RUE 4;  1NCQ D;  1PO1 4;  2WQY A;  1RUH 4;  2WDQ A;  1PO2 4;  3ABV A;  1NA1 D;  3JD7 4;  3AEF A;  1EV1 4;  3AEA A;  1HRI 4;  2RR1 4;  3GQK A;  1YQ4 A;  1BEV 4;  2R06 4;  2WDV A;  4GB3 4;  1VBE 4;  2WDR A;  2HWC 4;  2PLV 4;  3AEE A;  2RS3 4;  2PW9 A;  1R08 4;  2PZS A;  3AE9 A;  2X5I D;  1NEK A;  3AE7 A;  1XHX A;  3AE6 A;  3FI7 A;  3GQH A;  1POV 0;  2FBW A;  4YTN A;  3AED A;  1VBC 4;  4Q4V 4;  1XI1 A;  3P4S A;  1RUC 4;  1VBA 4;  2RM2 4;  1XHZ A;  2RS5 4;  3JBG 4;  2R07 4;  1AR8 4;  1PIV 4;  4Q4W 4;  1K5M D;  1HXS 4;  1HRV 4;  4PDW D;  1AR7 4;  1YQ3 A;  2PYJ A;  1EAH 4;  2H88 A;  2WP9 A;  1NEN A;  3AE5 A;  3AE1 A;  2RS1 4;  2PY5 A;  1Z7S 4;  3P4R A;  1ASJ 4;  4YTM A;  3AEB A;  1MQT D;  1KF6 A;  3P4P A;  4RHV 4;  2HWB 4;  1RMU 4;  3VR9 A;  4KX6 A;  1PVC 4;  1RUG 4;  1VBD 4;  1H8T D;  3VRB A;  4YT0 A;  2WS3 A;  1ZP0 A;  1RUF 4;  3VRA A;  1COV 4;  4YTP A;  3AE8 A;  4YXD A;  3AE3 A;  3CIR A;  4YSY A;  2WU2 A;  1ZOY A;  3SUC A;  3P4Q A;  3SFD A;  2WU5 A;  2EX3 A;  1VRH 4;  2ACZ A;  2RMU 4;  3VR8 A;  2R7F A;  2H89 A;  1OOP D;  4Q4Y 4;  1D4M 4;  1VBB 4;  3AE4 A;  1AR9 4;  1RUD 4;  3SFE A;  1RHI 4;  4YSZ A;  1RUI 4;  3AEG A;  2R04 4;  1L0V A;  2B76 A;  1AL2 4;  3J8F 4;  5C3J A;  4Q4X 4;  1R09 4;  3AEC A;  4YSX A;  5C2T A;  2PYL A;  1RVF 4;  1RUJ 4;  3AE2 A;  1KFY A;  1AR6 4; 
#chains in the Genus database with same CATH homology
 1VRH 4;  1ASJ 4;  2RMU 4;  1RUE 4;  1NCQ D;  1R08 4;  1PO1 4;  1RUH 4;  1OOP D;  4Q4Y 4;  1PO2 4;  2X5I D;  1NA1 D;  1MQT D;  1D4M 4;  3JD7 4;  4RHV 4;  1VBB 4;  1AR9 4;  1RUD 4;  2HWB 4;  1POV 0;  1RMU 4;  1EV1 4;  1RHI 4;  1PVC 4;  1RUG 4;  1RUI 4;  1H8T D;  1VBD 4;  1VBC 4;  2R04 4;  4Q4V 4;  1HRI 4;  2RR1 4;  1RUC 4;  1VBA 4;  2RM2 4;  1AL2 4;  3J8F 4;  1RUF 4;  2RS5 4;  3JBG 4;  1COV 4;  2R07 4;  1AR8 4;  1R09 4;  4Q4X 4;  1BEV 4;  1PIV 4;  2R06 4;  1K5M D;  4Q4W 4;  1HXS 4;  4GB3 4;  1HRV 4;  1VBE 4;  4PDW D;  2HWC 4;  1AR7 4;  2PLV 4;  1EAH 4;  1RVF 4;  1RUJ 4;  2RS3 4;  2RS1 4;  1AR6 4;  1Z7S 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...