4Q4X4

Crystal structure of coxsackievirus a24v soaked with 6'-sialyllactose (6sl)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
56
Chain Sequence
GAQVSSQKVGAVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 56
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4x400
2RM24 4GB34 1AR94 4Q4V4 1PVC4 4PDWD 1R094 2RS34 1MQTD 1OOPD 1POV0 1PIV4 2HWC4 2RS54 1RUJ4 1RUH4 2R064 1K5MD 1NA1D 2RR14 3JBG4 1AL24 1RUI4 3J8F4 1PO14 1RUG4 2R044 1Z7S4 2R074 1HXS4 1AR84 1RUE4 1R084 1VBC4 1HRI4 1NCQD 1RVF4 1RUF4 4Q4X4 1RHI4 1EAH4 1VBA4 2RS14 3JD74 4Q4Y4 1D4M4 4RHV4 1VBD4 2PLV4 2RMU4 1BEV4 4Q4W4 1VRH4 1ASJ4 1RUD4 1PO24 2HWB4 1RUC4 1H8TD 1EV14 1AR64 1VBB4 1RMU4 1VBE4 2X5ID 1HRV4 1AR74 1COV4
chains in the Genus database with same CATH superfamily
3SUCA 3P4QA 4GB34 1AR94 4Q4V4 3AEDA 1R094 5C3JA 3VRBA 1L0VA 1OOPD 4YSYA 4YSXA 1POV0 1RUH4 2R064 2RR14 1K5MD 3JBG4 3SFDA 1RUI4 2PY5A 3J8F4 2EX3A 2R044 3VRAA 1VBC4 3ABVA 1VBA4 3JD74 3VR9A 4Q4Y4 1D4M4 4YXDA 3FI7A 2X5ID 1VBB4 1RMU4 2PLV4 1AR74 1COV4 3AEBA 3AEAA 3AE5A 1ZOYA 1PIV4 2HWC4 1RUJ4 3AEEA 3AE8A 3AE6A 2H89A 2R7FA 4KX6A 1AR84 4YTMA 1RUE4 1NCQD 1RVF4 1RUF4 1NENA 3P4RA 2WP9A 2PYLA 1VRH4 3GQKA 1PO24 3CIRA 1HRV4 1EV14 1AR64 1KF6A 2FBWA 1KFYA 3VR8A 2RM24 2WDVA 1PVC4 2H88A 2RS34 4PDWD 2WU2A 2RS54 2B76A 1NA1D 1AL24 1Z7S4 1R084 2WDQA 1HRI4 3AE3A 3AE9A 4Q4X4 1RHI4 4YTNA 2PYJA 2WQYA 4RHV4 1ZP0A 1VBD4 1BEV4 3P4PA 4Q4W4 1ASJ4 1RUD4 2HWB4 1RUC4 2PW9A 2WS3A 4YTPA 2WU5A 3GQHA 3AE7A 3AECA 1MQTD 1PO14 1RUG4 2R074 1HXS4 1XHZA 3SFEA 4YSZA 2PZSA 1XI1A 3AE2A 2WDRA 3P4SA 3AE4A 1EAH4 1NEKA 2RS14 1YQ3A 4YT0A 1YQ4A 2RMU4 2ACZA 5C2TA 3AEFA 3AEGA 1H8TD 1XHXA 1VBE4 3AE1A
chains in the Genus database with same CATH topology
2RM24 4GB34 1AR94 4Q4V4 1PVC4 4PDWD 1R094 2RS34 1MQTD 1OOPD 1POV0 1PIV4 2HWC4 2RS54 1RUJ4 1RUH4 2R064 1K5MD 1NA1D 2RR14 3JBG4 1AL24 1RUI4 3J8F4 1PO14 1RUG4 2R044 1Z7S4 2R074 1HXS4 1AR84 1RUE4 1R084 1VBC4 1HRI4 1NCQD 1RVF4 1RUF4 4Q4X4 1RHI4 1EAH4 1VBA4 2RS14 3JD74 4Q4Y4 1D4M4 4RHV4 1VBD4 2PLV4 2RMU4 1BEV4 4Q4W4 1VRH4 1ASJ4 1RUD4 1PO24 2HWB4 1RUC4 1H8TD 1EV14 1AR64 1VBB4 1RMU4 1VBE4 2X5ID 1HRV4 1AR74 1COV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RM2 4;  4GB3 4;  1AR9 4;  4Q4V 4;  1PVC 4;  4PDW D;  1R09 4;  2RS3 4;  1MQT D;  1OOP D;  1POV 0;  1PIV 4;  2HWC 4;  2RS5 4;  1RUJ 4;  1RUH 4;  2R06 4;  1K5M D;  1NA1 D;  2RR1 4;  3JBG 4;  1AL2 4;  1RUI 4;  3J8F 4;  1PO1 4;  1RUG 4;  2R04 4;  1Z7S 4;  2R07 4;  1HXS 4;  1AR8 4;  1RUE 4;  1R08 4;  1VBC 4;  1HRI 4;  1NCQ D;  1RVF 4;  1RUF 4;  4Q4X 4;  1RHI 4;  1EAH 4;  1VBA 4;  2RS1 4;  3JD7 4;  4Q4Y 4;  1D4M 4;  4RHV 4;  1VBD 4;  2PLV 4;  2RMU 4;  1BEV 4;  4Q4W 4;  1VRH 4;  1ASJ 4;  1RUD 4;  1PO2 4;  2HWB 4;  1RUC 4;  1H8T D;  1EV1 4;  1AR6 4;  1VBB 4;  1RMU 4;  1VBE 4;  2X5I D;  1HRV 4;  1AR7 4;  1COV 4; 
#chains in the Genus database with same CATH topology
 3SUC A;  3P4Q A;  4GB3 4;  1AR9 4;  4Q4V 4;  3AED A;  1R09 4;  5C3J A;  3VRB A;  1L0V A;  1OOP D;  4YSY A;  4YSX A;  1POV 0;  1RUH 4;  2R06 4;  2RR1 4;  1K5M D;  3JBG 4;  3SFD A;  1RUI 4;  2PY5 A;  3J8F 4;  2EX3 A;  2R04 4;  3VRA A;  1VBC 4;  3ABV A;  1VBA 4;  3JD7 4;  3VR9 A;  4Q4Y 4;  1D4M 4;  4YXD A;  3FI7 A;  2X5I D;  1VBB 4;  1RMU 4;  2PLV 4;  1AR7 4;  1COV 4;  3AEB A;  3AEA A;  3AE5 A;  1ZOY A;  1PIV 4;  2HWC 4;  1RUJ 4;  3AEE A;  3AE8 A;  3AE6 A;  2H89 A;  2R7F A;  4KX6 A;  1AR8 4;  4YTM A;  1RUE 4;  1NCQ D;  1RVF 4;  1RUF 4;  1NEN A;  3P4R A;  2WP9 A;  2PYL A;  1VRH 4;  3GQK A;  1PO2 4;  3CIR A;  1HRV 4;  1EV1 4;  1AR6 4;  1KF6 A;  2FBW A;  1KFY A;  3VR8 A;  2RM2 4;  2WDV A;  1PVC 4;  2H88 A;  2RS3 4;  4PDW D;  2WU2 A;  2RS5 4;  2B76 A;  1NA1 D;  1AL2 4;  1Z7S 4;  1R08 4;  2WDQ A;  1HRI 4;  3AE3 A;  3AE9 A;  4Q4X 4;  1RHI 4;  4YTN A;  2PYJ A;  2WQY A;  4RHV 4;  1ZP0 A;  1VBD 4;  1BEV 4;  3P4P A;  4Q4W 4;  1ASJ 4;  1RUD 4;  2HWB 4;  1RUC 4;  2PW9 A;  2WS3 A;  4YTP A;  2WU5 A;  3GQH A;  3AE7 A;  3AEC A;  1MQT D;  1PO1 4;  1RUG 4;  2R07 4;  1HXS 4;  1XHZ A;  3SFE A;  4YSZ A;  2PZS A;  1XI1 A;  3AE2 A;  2WDR A;  3P4S A;  3AE4 A;  1EAH 4;  1NEK A;  2RS1 4;  1YQ3 A;  4YT0 A;  1YQ4 A;  2RMU 4;  2ACZ A;  5C2T A;  3AEF A;  3AEG A;  1H8T D;  1XHX A;  1VBE 4;  3AE1 A; 
#chains in the Genus database with same CATH homology
 2RM2 4;  4GB3 4;  1AR9 4;  4Q4V 4;  1PVC 4;  4PDW D;  1R09 4;  2RS3 4;  1MQT D;  1OOP D;  1POV 0;  1PIV 4;  2HWC 4;  2RS5 4;  1RUJ 4;  1RUH 4;  2R06 4;  1K5M D;  1NA1 D;  2RR1 4;  3JBG 4;  1AL2 4;  1RUI 4;  3J8F 4;  1PO1 4;  1RUG 4;  2R04 4;  1Z7S 4;  2R07 4;  1HXS 4;  1AR8 4;  1RUE 4;  1R08 4;  1VBC 4;  1HRI 4;  1NCQ D;  1RVF 4;  1RUF 4;  4Q4X 4;  1RHI 4;  1EAH 4;  1VBA 4;  2RS1 4;  3JD7 4;  4Q4Y 4;  1D4M 4;  4RHV 4;  1VBD 4;  2PLV 4;  2RMU 4;  1BEV 4;  4Q4W 4;  1VRH 4;  1ASJ 4;  1RUD 4;  1PO2 4;  2HWB 4;  1RUC 4;  1H8T D;  1EV1 4;  1AR6 4;  1VBB 4;  1RMU 4;  1VBE 4;  2X5I D;  1HRV 4;  1AR7 4;  1COV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...