4Q4X4

Crystal structure of coxsackievirus a24v soaked with 6'-sialyllactose (6sl)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
56
Chain Sequence
GAQVSSQKVGAVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
total genus 3
structure length 56
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4x400
1AR94 1VRH4 1RUH4 1MQTD 1NCQD 1RUC4 1RUF4 4Q4W4 1VBA4 2X5ID 1AR74 1POV0 1ASJ4 1AR64 1RUJ4 1RUI4 1VBB4 4Q4Y4 2HWB4 1NA1D 4Q4X4 1RVF4 1HXS4 1HRI4 2RS54 2RR14 1RUD4 2R074 1EV14 1RMU4 1VBD4 1VBE4 2RMU4 1PIV4 1COV4 3J8F4 1H8TD 4GB34 1PO14 2RS34 2RM24 4RHV4 1EAH4 1PO24 1D4M4 1VBC4 1PVC4 1Z7S4 4PDWD 1BEV4 2RS14 2HWC4 1R084 2PLV4 2R044 4Q4V4 1RUG4 1AR84 1AL24 1K5MD 1RHI4 1HRV4 1R094 2R064 3JBG4 1OOPD 3JD74 1RUE4
chains in the Genus database with same CATH superfamily
1MQTD 3CIRA 1NEKA 3AEDA 1XHZA 1VBA4 2PYJA 2PW9A 3AEBA 1RUI4 1RVF4 2PYLA 1RUD4 1EV14 1KF6A 4KX6A 2R7FA 3J8F4 2WS3A 4YTPA 2RS34 1PO24 3AE1A 3AEGA 2RS14 3AE2A 3AEEA 2WDVA 4Q4V4 3P4RA 1NENA 1R094 3VRBA 3FI7A 3ABVA 1RUE4 1AR94 3AE3A 3AECA 1RUF4 3AE4A 4YTMA 1NA1D 3GQHA 2R074 1VBD4 2RMU4 2PZSA 2WQYA 1PIV4 1H8TD 1EAH4 1VBC4 1PVC4 1BEV4 1YQ4A 3AE9A 1R084 2PLV4 2WU2A 3P4SA 3VR8A 1AR84 1RHI4 1K5MD 2WDRA 2R064 3P4PA 1RUC4 1XI1A 4YT0A 4Q4W4 5C3JA 2X5ID 1ASJ4 2B76A 3AEFA 1AR64 2H89A 2HWB4 2RS54 1HRI4 2FBWA 2RR14 4YTNA 2H88A 1ZP0A 5C2TA 1COV4 4GB34 3SUCA 4RHV4 1KFYA 1Z7S4 2WDQA 2EX3A 3GQKA 1AL24 3AE5A 4YSYA 4YSXA 3JBG4 2R044 1OOPD 3JD74 1VRH4 1RUH4 1NCQD 1L0VA 3SFDA 1XHXA 1AR74 1POV0 3AE8A 1VBB4 1RUJ4 1YQ3A 4Q4Y4 3AEAA 4Q4X4 4YXDA 1HXS4 3VRAA 2ACZA 1RMU4 1ZOYA 4YSZA 1VBE4 2WP9A 1PO14 2RM24 1D4M4 4PDWD 2HWC4 1RUG4 3SFEA 3AE7A 1HRV4 2WU5A 3VR9A 2PY5A 3P4QA 3AE6A
chains in the Genus database with same CATH topology
1AR94 1VRH4 1RUH4 1MQTD 1NCQD 1RUC4 1RUF4 4Q4W4 1VBA4 2X5ID 1AR74 1POV0 1ASJ4 1AR64 1RUJ4 1RUI4 1VBB4 4Q4Y4 2HWB4 1NA1D 4Q4X4 1RVF4 1HXS4 1HRI4 2RS54 2RR14 1RUD4 2R074 1EV14 1RMU4 1VBD4 1VBE4 2RMU4 1PIV4 1COV4 3J8F4 1H8TD 4GB34 1PO14 2RS34 2RM24 4RHV4 1EAH4 1PO24 1D4M4 1VBC4 1PVC4 1Z7S4 4PDWD 1BEV4 2RS14 2HWC4 1R084 2PLV4 2R044 4Q4V4 1RUG4 1AR84 1AL24 1K5MD 1RHI4 1HRV4 1R094 2R064 3JBG4 1OOPD 3JD74 1RUE4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR9 4;  1VRH 4;  1RUH 4;  1MQT D;  1NCQ D;  1RUC 4;  1RUF 4;  4Q4W 4;  1VBA 4;  2X5I D;  1AR7 4;  1POV 0;  1ASJ 4;  1AR6 4;  1RUJ 4;  1RUI 4;  1VBB 4;  4Q4Y 4;  2HWB 4;  1NA1 D;  4Q4X 4;  1RVF 4;  1HXS 4;  1HRI 4;  2RS5 4;  2RR1 4;  1RUD 4;  2R07 4;  1EV1 4;  1RMU 4;  1VBD 4;  1VBE 4;  2RMU 4;  1PIV 4;  1COV 4;  3J8F 4;  1H8T D;  4GB3 4;  1PO1 4;  2RS3 4;  2RM2 4;  4RHV 4;  1EAH 4;  1PO2 4;  1D4M 4;  1VBC 4;  1PVC 4;  1Z7S 4;  4PDW D;  1BEV 4;  2RS1 4;  2HWC 4;  1R08 4;  2PLV 4;  2R04 4;  4Q4V 4;  1RUG 4;  1AR8 4;  1AL2 4;  1K5M D;  1RHI 4;  1HRV 4;  1R09 4;  2R06 4;  3JBG 4;  1OOP D;  3JD7 4;  1RUE 4; 
#chains in the Genus database with same CATH topology
 1MQT D;  3CIR A;  1NEK A;  3AED A;  1XHZ A;  1VBA 4;  2PYJ A;  2PW9 A;  3AEB A;  1RUI 4;  1RVF 4;  2PYL A;  1RUD 4;  1EV1 4;  1KF6 A;  4KX6 A;  2R7F A;  3J8F 4;  2WS3 A;  4YTP A;  2RS3 4;  1PO2 4;  3AE1 A;  3AEG A;  2RS1 4;  3AE2 A;  3AEE A;  2WDV A;  4Q4V 4;  3P4R A;  1NEN A;  1R09 4;  3VRB A;  3FI7 A;  3ABV A;  1RUE 4;  1AR9 4;  3AE3 A;  3AEC A;  1RUF 4;  3AE4 A;  4YTM A;  1NA1 D;  3GQH A;  2R07 4;  1VBD 4;  2RMU 4;  2PZS A;  2WQY A;  1PIV 4;  1H8T D;  1EAH 4;  1VBC 4;  1PVC 4;  1BEV 4;  1YQ4 A;  3AE9 A;  1R08 4;  2PLV 4;  2WU2 A;  3P4S A;  3VR8 A;  1AR8 4;  1RHI 4;  1K5M D;  2WDR A;  2R06 4;  3P4P A;  1RUC 4;  1XI1 A;  4YT0 A;  4Q4W 4;  5C3J A;  2X5I D;  1ASJ 4;  2B76 A;  3AEF A;  1AR6 4;  2H89 A;  2HWB 4;  2RS5 4;  1HRI 4;  2FBW A;  2RR1 4;  4YTN A;  2H88 A;  1ZP0 A;  5C2T A;  1COV 4;  4GB3 4;  3SUC A;  4RHV 4;  1KFY A;  1Z7S 4;  2WDQ A;  2EX3 A;  3GQK A;  1AL2 4;  3AE5 A;  4YSY A;  4YSX A;  3JBG 4;  2R04 4;  1OOP D;  3JD7 4;  1VRH 4;  1RUH 4;  1NCQ D;  1L0V A;  3SFD A;  1XHX A;  1AR7 4;  1POV 0;  3AE8 A;  1VBB 4;  1RUJ 4;  1YQ3 A;  4Q4Y 4;  3AEA A;  4Q4X 4;  4YXD A;  1HXS 4;  3VRA A;  2ACZ A;  1RMU 4;  1ZOY A;  4YSZ A;  1VBE 4;  2WP9 A;  1PO1 4;  2RM2 4;  1D4M 4;  4PDW D;  2HWC 4;  1RUG 4;  3SFE A;  3AE7 A;  1HRV 4;  2WU5 A;  3VR9 A;  2PY5 A;  3P4Q A;  3AE6 A; 
#chains in the Genus database with same CATH homology
 1AR9 4;  1VRH 4;  1RUH 4;  1MQT D;  1NCQ D;  1RUC 4;  1RUF 4;  4Q4W 4;  1VBA 4;  2X5I D;  1AR7 4;  1POV 0;  1ASJ 4;  1AR6 4;  1RUJ 4;  1RUI 4;  1VBB 4;  4Q4Y 4;  2HWB 4;  1NA1 D;  4Q4X 4;  1RVF 4;  1HXS 4;  1HRI 4;  2RS5 4;  2RR1 4;  1RUD 4;  2R07 4;  1EV1 4;  1RMU 4;  1VBD 4;  1VBE 4;  2RMU 4;  1PIV 4;  1COV 4;  3J8F 4;  1H8T D;  4GB3 4;  1PO1 4;  2RS3 4;  2RM2 4;  4RHV 4;  1EAH 4;  1PO2 4;  1D4M 4;  1VBC 4;  1PVC 4;  1Z7S 4;  4PDW D;  1BEV 4;  2RS1 4;  2HWC 4;  1R08 4;  2PLV 4;  2R04 4;  4Q4V 4;  1RUG 4;  1AR8 4;  1AL2 4;  1K5M D;  1RHI 4;  1HRV 4;  1R09 4;  2R06 4;  3JBG 4;  1OOP D;  3JD7 4;  1RUE 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...