4Q4X4

Crystal structure of coxsackievirus a24v soaked with 6'-sialyllactose (6sl)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
56
Chain Sequence
GAQVSSQKVGAVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coxsackievirus capsid protein VP1
publication title A sialic Acid binding site in a human picornavirus.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 56
sequence length 68
ec nomenclature
pdb deposition date 2014-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 4q4x400
1AR64 1VBA4 2HWB4 1HXS4 1D4M4 2RR14 1OOPD 2HWC4 1PO24 1POV0 2RM24 1H8TD 1VBD4 1Z7S4 1VRH4 1PVC4 4Q4V4 1RUJ4 1RMU4 1BEV4 2R074 1RVF4 3JBG4 1ASJ4 2RS54 4PDWD 2R064 1K5MD 1COV4 1RHI4 1VBE4 1VBC4 3JD74 1RUI4 1R094 4GB34 4RHV4 1MQTD 4Q4W4 1RUH4 3J8F4 2R044 2X5ID 1HRI4 1RUF4 2RMU4 1NA1D 1AR74 1PO14 1R084 1RUE4 1VBB4 4Q4X4 1EV14 1AR84 1AR94 4Q4Y4 2RS34 1HRV4 1AL24 1RUC4 1RUG4 1NCQD 1EAH4 2RS14 2PLV4 1RUD4 1PIV4
chains in the Genus database with same CATH superfamily
1VBA4 1D4M4 1PO24 1POV0 5C2TA 4YSYA 1Z7S4 3AEDA 2EX3A 3SFEA 1PVC4 4YTPA 2RS54 5C3JA 1COV4 1VBE4 1VBC4 1R094 4RHV4 3J8F4 3AE6A 2WQYA 3AE4A 1HRI4 3AECA 4YTMA 3VRAA 2B76A 3AEBA 3SUCA 2H88A 1EV14 2PYLA 4Q4Y4 1RUC4 3AEGA 4YSZA 3VR9A 1NCQD 1EAH4 2X5ID 2ACZA 3P4SA 2WDQA 2HWB4 1NENA 3P4RA 2R7FA 1YQ4A 1L0VA 4Q4V4 1RMU4 1BEV4 2R074 1RVF4 2FBWA 3AE8A 3JBG4 3VRBA 3P4QA 3JD74 3GQKA 1ZP0A 1RUH4 4KX6A 1XI1A 2PZSA 1R084 4YXDA 1RUE4 3AE5A 2WS3A 3ABVA 2WP9A 1VBD4 3AEFA 2RR14 1KFYA 2PY5A 3FI7A 3SFDA 1KF6A 4PDWD 4YTNA 1ASJ4 2R064 1RHI4 1RUI4 2PYJA 4GB34 1MQTD 3VR8A 4YT0A 2R044 3P4PA 1RUF4 3AE3A 1AR74 1PO14 3AE9A 4Q4X4 1AR94 1NEKA 3AE1A 1AL24 3AE2A 1HRV4 1RUG4 2RS14 1RUD4 1PIV4 4Q4W4 1AR64 1HXS4 1OOPD 2HWC4 2RM24 2WDRA 1H8TD 2H89A 1VRH4 1RUJ4 2WDVA 1ZOYA 1K5MD 2WU2A 3AE7A 2RMU4 1XHXA 1NA1D 1VBB4 3AEEA 1AR84 1YQ3A 3CIRA 2RS34 4YSXA 1XHZA 2PW9A 2WU5A 3AEAA 2PLV4 3GQHA
chains in the Genus database with same CATH topology
1AR64 1VBA4 2HWB4 1HXS4 1D4M4 2RR14 1OOPD 2HWC4 1PO24 1POV0 2RM24 1H8TD 1VBD4 1Z7S4 1VRH4 1PVC4 4Q4V4 1RUJ4 1RMU4 1BEV4 2R074 1RVF4 3JBG4 1ASJ4 2RS54 4PDWD 2R064 1K5MD 1COV4 1RHI4 1VBE4 1VBC4 3JD74 1RUI4 1R094 4GB34 4RHV4 1MQTD 4Q4W4 1RUH4 3J8F4 2R044 2X5ID 1HRI4 1RUF4 2RMU4 1NA1D 1AR74 1PO14 1R084 1RUE4 1VBB4 4Q4X4 1EV14 1AR84 1AR94 4Q4Y4 2RS34 1HRV4 1AL24 1RUC4 1RUG4 1NCQD 1EAH4 2RS14 2PLV4 1RUD4 1PIV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR6 4;  1VBA 4;  2HWB 4;  1HXS 4;  1D4M 4;  2RR1 4;  1OOP D;  2HWC 4;  1PO2 4;  1POV 0;  2RM2 4;  1H8T D;  1VBD 4;  1Z7S 4;  1VRH 4;  1PVC 4;  4Q4V 4;  1RUJ 4;  1RMU 4;  1BEV 4;  2R07 4;  1RVF 4;  3JBG 4;  1ASJ 4;  2RS5 4;  4PDW D;  2R06 4;  1K5M D;  1COV 4;  1RHI 4;  1VBE 4;  1VBC 4;  3JD7 4;  1RUI 4;  1R09 4;  4GB3 4;  4RHV 4;  1MQT D;  4Q4W 4;  1RUH 4;  3J8F 4;  2R04 4;  2X5I D;  1HRI 4;  1RUF 4;  2RMU 4;  1NA1 D;  1AR7 4;  1PO1 4;  1R08 4;  1RUE 4;  1VBB 4;  4Q4X 4;  1EV1 4;  1AR8 4;  1AR9 4;  4Q4Y 4;  2RS3 4;  1HRV 4;  1AL2 4;  1RUC 4;  1RUG 4;  1NCQ D;  1EAH 4;  2RS1 4;  2PLV 4;  1RUD 4;  1PIV 4; 
#chains in the Genus database with same CATH topology
 1VBA 4;  1D4M 4;  1PO2 4;  1POV 0;  5C2T A;  4YSY A;  1Z7S 4;  3AED A;  2EX3 A;  3SFE A;  1PVC 4;  4YTP A;  2RS5 4;  5C3J A;  1COV 4;  1VBE 4;  1VBC 4;  1R09 4;  4RHV 4;  3J8F 4;  3AE6 A;  2WQY A;  3AE4 A;  1HRI 4;  3AEC A;  4YTM A;  3VRA A;  2B76 A;  3AEB A;  3SUC A;  2H88 A;  1EV1 4;  2PYL A;  4Q4Y 4;  1RUC 4;  3AEG A;  4YSZ A;  3VR9 A;  1NCQ D;  1EAH 4;  2X5I D;  2ACZ A;  3P4S A;  2WDQ A;  2HWB 4;  1NEN A;  3P4R A;  2R7F A;  1YQ4 A;  1L0V A;  4Q4V 4;  1RMU 4;  1BEV 4;  2R07 4;  1RVF 4;  2FBW A;  3AE8 A;  3JBG 4;  3VRB A;  3P4Q A;  3JD7 4;  3GQK A;  1ZP0 A;  1RUH 4;  4KX6 A;  1XI1 A;  2PZS A;  1R08 4;  4YXD A;  1RUE 4;  3AE5 A;  2WS3 A;  3ABV A;  2WP9 A;  1VBD 4;  3AEF A;  2RR1 4;  1KFY A;  2PY5 A;  3FI7 A;  3SFD A;  1KF6 A;  4PDW D;  4YTN A;  1ASJ 4;  2R06 4;  1RHI 4;  1RUI 4;  2PYJ A;  4GB3 4;  1MQT D;  3VR8 A;  4YT0 A;  2R04 4;  3P4P A;  1RUF 4;  3AE3 A;  1AR7 4;  1PO1 4;  3AE9 A;  4Q4X 4;  1AR9 4;  1NEK A;  3AE1 A;  1AL2 4;  3AE2 A;  1HRV 4;  1RUG 4;  2RS1 4;  1RUD 4;  1PIV 4;  4Q4W 4;  1AR6 4;  1HXS 4;  1OOP D;  2HWC 4;  2RM2 4;  2WDR A;  1H8T D;  2H89 A;  1VRH 4;  1RUJ 4;  2WDV A;  1ZOY A;  1K5M D;  2WU2 A;  3AE7 A;  2RMU 4;  1XHX A;  1NA1 D;  1VBB 4;  3AEE A;  1AR8 4;  1YQ3 A;  3CIR A;  2RS3 4;  4YSX A;  1XHZ A;  2PW9 A;  2WU5 A;  3AEA A;  2PLV 4;  3GQH A; 
#chains in the Genus database with same CATH homology
 1AR6 4;  1VBA 4;  2HWB 4;  1HXS 4;  1D4M 4;  2RR1 4;  1OOP D;  2HWC 4;  1PO2 4;  1POV 0;  2RM2 4;  1H8T D;  1VBD 4;  1Z7S 4;  1VRH 4;  1PVC 4;  4Q4V 4;  1RUJ 4;  1RMU 4;  1BEV 4;  2R07 4;  1RVF 4;  3JBG 4;  1ASJ 4;  2RS5 4;  4PDW D;  2R06 4;  1K5M D;  1COV 4;  1RHI 4;  1VBE 4;  1VBC 4;  3JD7 4;  1RUI 4;  1R09 4;  4GB3 4;  4RHV 4;  1MQT D;  4Q4W 4;  1RUH 4;  3J8F 4;  2R04 4;  2X5I D;  1HRI 4;  1RUF 4;  2RMU 4;  1NA1 D;  1AR7 4;  1PO1 4;  1R08 4;  1RUE 4;  1VBB 4;  4Q4X 4;  1EV1 4;  1AR8 4;  1AR9 4;  4Q4Y 4;  2RS3 4;  1HRV 4;  1AL2 4;  1RUC 4;  1RUG 4;  1NCQ D;  1EAH 4;  2RS1 4;  2PLV 4;  1RUD 4;  1PIV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...