1PO14

Poliovirus (type 1, mahoney) in complex with r80633, an inhibitor of viral replication
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
b'GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1po1400
1HXS4 1PVC4 3JBG4 1PIV4 1AL24 1RUE4 2R074 1EV14 1RUD4 1PO14 1VBA4 4Q4Y4 1RMU4 1RHI4 4Q4X4 1D4M4 2RM24 2R064 1VBE4 1RUI4 1RUF4 1R084 1RUJ4 1HRV4 2HWC4 2RMU4 4PDWD 1PO24 1BEV4 1H8TD 2HWB4 3JD74 1COV4 2RR14 4Q4W4 1OOPD 1AR84 1EAH4 4RHV4 1R094 1ASJ4 1MQTD 1RUG4 1RVF4 2X5ID 1NA1D 4Q4V4 1POV0 2RS54 1HRI4 1Z7S4 4GB34 2R044 1NCQD 1VRH4 1AR64 3J8F4 2PLV4 1VBC4 1VBD4 1AR94 1K5MD 1RUC4 1RUH4 1VBB4 2RS34 2RS14 1AR74
chains in the Genus database with same CATH superfamily
1YQ3A 2ACZA 3AEGA 3P4QA 1PIV4 2R074 1VBA4 1RUD4 1RMU4 2WS3A 2PY5A 1RHI4 2RM24 3AE7A 3AE4A 1R084 1RUJ4 3ABVA 1H8TD 3VR8A 3JD74 2B76A 3VRAA 1ZP0A 2R7FA 3AE5A 3AEEA 3AEFA 2WDRA 4YTNA 1NENA 4KX6A 1VBD4 4YTMA 4GB34 4YTPA 1AL24 1XHZA 3AE8A 3P4PA 1NEKA 2R064 3AE9A 3AE6A 1PO24 4YXDA 1BEV4 3AEDA 3P4SA 4RHV4 2EX3A 1R094 2FBWA 5C3JA 4Q4V4 1HRI4 1KFYA 1NCQD 3SFEA 3FI7A 2PLV4 2WP9A 2RS54 2WDQA 1XHXA 1AR84 1KF6A 1HXS4 1PVC4 3JBG4 1RUE4 3SFDA 2WU2A 3AE3A 4Q4X4 2H89A 1VBE4 1HRV4 2PW9A 3GQKA 1YQ4A 2H88A 4Q4W4 1EAH4 3VR9A 1ASJ4 1MQTD 3SUCA 4YT0A 1L0VA 1NA1D 3AEBA 3CIRA 3AECA 1VRH4 1AR64 1VBC4 2WU5A 2RS14 1AR74 2PYLA 4Q4Y4 1EV14 1ZOYA 1PO14 4YSZA 1D4M4 1RUI4 3P4RA 1RUF4 2PZSA 2HWC4 2RMU4 4PDWD 3AE2A 2HWB4 4YSXA 1COV4 2RR14 1OOPD 2PYJA 3AEAA 1RVF4 1RUG4 2X5ID 3GQHA 2WQYA 1POV0 1Z7S4 2WDVA 2R044 5C2TA 3J8F4 3VRBA 1XI1A 1AR94 1K5MD 1RUC4 1RUH4 1VBB4 2RS34 4YSYA 3AE1A
chains in the Genus database with same CATH topology
1HXS4 1PVC4 3JBG4 1PIV4 1AL24 1RUE4 2R074 1EV14 1RUD4 1PO14 1VBA4 4Q4Y4 1RMU4 1RHI4 4Q4X4 1D4M4 2RM24 2R064 1VBE4 1RUI4 1RUF4 1R084 1RUJ4 1HRV4 2HWC4 2RMU4 4PDWD 1PO24 1BEV4 1H8TD 2HWB4 3JD74 1COV4 2RR14 4Q4W4 1OOPD 1AR84 1EAH4 4RHV4 1R094 1ASJ4 1MQTD 1RUG4 1RVF4 2X5ID 1NA1D 4Q4V4 1POV0 2RS54 1HRI4 1Z7S4 4GB34 2R044 1NCQD 1VRH4 1AR64 3J8F4 2PLV4 1VBC4 1VBD4 1AR94 1K5MD 1RUC4 1RUH4 1VBB4 2RS34 2RS14 1AR74
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXS 4;  1PVC 4;  3JBG 4;  1PIV 4;  1AL2 4;  1RUE 4;  2R07 4;  1EV1 4;  1RUD 4;  1PO1 4;  1VBA 4;  4Q4Y 4;  1RMU 4;  1RHI 4;  4Q4X 4;  1D4M 4;  2RM2 4;  2R06 4;  1VBE 4;  1RUI 4;  1RUF 4;  1R08 4;  1RUJ 4;  1HRV 4;  2HWC 4;  2RMU 4;  4PDW D;  1PO2 4;  1BEV 4;  1H8T D;  2HWB 4;  3JD7 4;  1COV 4;  2RR1 4;  4Q4W 4;  1OOP D;  1AR8 4;  1EAH 4;  4RHV 4;  1R09 4;  1ASJ 4;  1MQT D;  1RUG 4;  1RVF 4;  2X5I D;  1NA1 D;  4Q4V 4;  1POV 0;  2RS5 4;  1HRI 4;  1Z7S 4;  4GB3 4;  2R04 4;  1NCQ D;  1VRH 4;  1AR6 4;  3J8F 4;  2PLV 4;  1VBC 4;  1VBD 4;  1AR9 4;  1K5M D;  1RUC 4;  1RUH 4;  1VBB 4;  2RS3 4;  2RS1 4;  1AR7 4; 
#chains in the Genus database with same CATH topology
 1YQ3 A;  2ACZ A;  3AEG A;  3P4Q A;  1PIV 4;  2R07 4;  1VBA 4;  1RUD 4;  1RMU 4;  2WS3 A;  2PY5 A;  1RHI 4;  2RM2 4;  3AE7 A;  3AE4 A;  1R08 4;  1RUJ 4;  3ABV A;  1H8T D;  3VR8 A;  3JD7 4;  2B76 A;  3VRA A;  1ZP0 A;  2R7F A;  3AE5 A;  3AEE A;  3AEF A;  2WDR A;  4YTN A;  1NEN A;  4KX6 A;  1VBD 4;  4YTM A;  4GB3 4;  4YTP A;  1AL2 4;  1XHZ A;  3AE8 A;  3P4P A;  1NEK A;  2R06 4;  3AE9 A;  3AE6 A;  1PO2 4;  4YXD A;  1BEV 4;  3AED A;  3P4S A;  4RHV 4;  2EX3 A;  1R09 4;  2FBW A;  5C3J A;  4Q4V 4;  1HRI 4;  1KFY A;  1NCQ D;  3SFE A;  3FI7 A;  2PLV 4;  2WP9 A;  2RS5 4;  2WDQ A;  1XHX A;  1AR8 4;  1KF6 A;  1HXS 4;  1PVC 4;  3JBG 4;  1RUE 4;  3SFD A;  2WU2 A;  3AE3 A;  4Q4X 4;  2H89 A;  1VBE 4;  1HRV 4;  2PW9 A;  3GQK A;  1YQ4 A;  2H88 A;  4Q4W 4;  1EAH 4;  3VR9 A;  1ASJ 4;  1MQT D;  3SUC A;  4YT0 A;  1L0V A;  1NA1 D;  3AEB A;  3CIR A;  3AEC A;  1VRH 4;  1AR6 4;  1VBC 4;  2WU5 A;  2RS1 4;  1AR7 4;  2PYL A;  4Q4Y 4;  1EV1 4;  1ZOY A;  1PO1 4;  4YSZ A;  1D4M 4;  1RUI 4;  3P4R A;  1RUF 4;  2PZS A;  2HWC 4;  2RMU 4;  4PDW D;  3AE2 A;  2HWB 4;  4YSX A;  1COV 4;  2RR1 4;  1OOP D;  2PYJ A;  3AEA A;  1RVF 4;  1RUG 4;  2X5I D;  3GQH A;  2WQY A;  1POV 0;  1Z7S 4;  2WDV A;  2R04 4;  5C2T A;  3J8F 4;  3VRB A;  1XI1 A;  1AR9 4;  1K5M D;  1RUC 4;  1RUH 4;  1VBB 4;  2RS3 4;  4YSY A;  3AE1 A; 
#chains in the Genus database with same CATH homology
 1HXS 4;  1PVC 4;  3JBG 4;  1PIV 4;  1AL2 4;  1RUE 4;  2R07 4;  1EV1 4;  1RUD 4;  1PO1 4;  1VBA 4;  4Q4Y 4;  1RMU 4;  1RHI 4;  4Q4X 4;  1D4M 4;  2RM2 4;  2R06 4;  1VBE 4;  1RUI 4;  1RUF 4;  1R08 4;  1RUJ 4;  1HRV 4;  2HWC 4;  2RMU 4;  4PDW D;  1PO2 4;  1BEV 4;  1H8T D;  2HWB 4;  3JD7 4;  1COV 4;  2RR1 4;  4Q4W 4;  1OOP D;  1AR8 4;  1EAH 4;  4RHV 4;  1R09 4;  1ASJ 4;  1MQT D;  1RUG 4;  1RVF 4;  2X5I D;  1NA1 D;  4Q4V 4;  1POV 0;  2RS5 4;  1HRI 4;  1Z7S 4;  4GB3 4;  2R04 4;  1NCQ D;  1VRH 4;  1AR6 4;  3J8F 4;  2PLV 4;  1VBC 4;  1VBD 4;  1AR9 4;  1K5M D;  1RUC 4;  1RUH 4;  1VBB 4;  2RS3 4;  2RS1 4;  1AR7 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...