1PO14

Poliovirus (type 1, mahoney) in complex with r80633, an inhibitor of viral replication
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Ligand-induced conformational changes in poliovirus-antiviral drug complexes.
pubmed doi rcsb
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1po1400
1EAH4 1EV14 1RUJ4 1AR64 1VBC4 1RUG4 1RMU4 2RMU4 1K5MD 2RS54 4Q4X4 1R084 2R074 1RUD4 1AR74 1PIV4 2RS14 1COV4 1AR84 1VBE4 1PVC4 4GB34 2RM24 1AL24 1Z7S4 1HRI4 1ASJ4 1PO14 1RUE4 1R094 1RUF4 1AR94 2RS34 2X5ID 3JBG4 1RUH4 2R044 1POV0 4Q4V4 1PO24 1RUC4 1VRH4 4RHV4 4PDWD 1D4M4 1MQTD 2HWB4 1OOPD 2R064 2HWC4 1RVF4 1RUI4 3J8F4 1VBB4 3JD74 4Q4Y4 1H8TD 1NCQD 1BEV4 1VBD4 2PLV4 1VBA4 1HRV4 1NA1D 1RHI4 1HXS4 4Q4W4 2RR14
chains in the Genus database with same CATH superfamily
1ZP0A 1AR64 5C3JA 2ACZA 1VBC4 3AE8A 2WDRA 1R084 1NENA 3GQHA 3AEEA 1PIV4 1AR84 1VBE4 3AE3A 3AE7A 1RUF4 4YTNA 1YQ3A 1AR94 3SFEA 4YXDA 1RUH4 5C2TA 1XHZA 1POV0 4RHV4 4YTPA 3SFDA 3AEAA 2HWB4 2HWC4 1RVF4 1RUI4 1XI1A 4YSZA 3AEBA 1NCQD 3GQKA 1EAH4 1EV14 4KX6A 2RMU4 2RS54 3AEDA 1YQ4A 3P4SA 2RS14 1COV4 3P4QA 2WP9A 1PVC4 2PZSA 2RM24 1Z7S4 1HRI4 1ASJ4 1R094 2H89A 2R7FA 2X5ID 2PYLA 2FBWA 1KF6A 1XHXA 1KFYA 1RUC4 4YSXA 3VRBA 3ABVA 2H88A 3P4RA 1D4M4 3SUCA 1NEKA 2EX3A 1VBA4 4GB34 1VRH4 1RUJ4 3AE6A 3AE2A 4YSYA 3AEGA 1RMU4 2WS3A 3P4PA 3AE5A 1RUD4 3AEFA 2WDVA 3VR8A 1ZOYA 2PW9A 1RUE4 3VR9A 2RS34 4YT0A 2R044 4Q4V4 1PO24 3VRAA 4PDWD 1MQTD 1L0VA 3AE9A 1VBB4 3JD74 1H8TD 1VBD4 1HRV4 1RHI4 4Q4W4 2RR14 2B76A 1RUG4 2WU2A 2WQYA 2WU5A 1K5MD 4Q4X4 3FI7A 1AR74 2PY5A 1AL24 1PO14 3AE1A 3JBG4 3AECA 3AE4A 2WDQA 2R064 1OOPD 4YTMA 3J8F4 3CIRA 1BEV4 2PLV4 2PYJA 1NA1D 2R074 1HXS4 4Q4Y4
chains in the Genus database with same CATH topology
1EAH4 1EV14 1RUJ4 1AR64 1VBC4 1RUG4 1RMU4 2RMU4 1K5MD 2RS54 4Q4X4 1R084 2R074 1RUD4 1AR74 1PIV4 2RS14 1COV4 1AR84 1VBE4 1PVC4 4GB34 2RM24 1AL24 1Z7S4 1HRI4 1ASJ4 1PO14 1RUE4 1R094 1RUF4 1AR94 2RS34 2X5ID 3JBG4 1RUH4 2R044 1POV0 4Q4V4 1PO24 1RUC4 1VRH4 4RHV4 4PDWD 1D4M4 1MQTD 2HWB4 1OOPD 2R064 2HWC4 1RVF4 1RUI4 3J8F4 1VBB4 3JD74 4Q4Y4 1H8TD 1NCQD 1BEV4 1VBD4 2PLV4 1VBA4 1HRV4 1NA1D 1RHI4 1HXS4 4Q4W4 2RR14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAH 4;  1EV1 4;  1RUJ 4;  1AR6 4;  1VBC 4;  1RUG 4;  1RMU 4;  2RMU 4;  1K5M D;  2RS5 4;  4Q4X 4;  1R08 4;  2R07 4;  1RUD 4;  1AR7 4;  1PIV 4;  2RS1 4;  1COV 4;  1AR8 4;  1VBE 4;  1PVC 4;  4GB3 4;  2RM2 4;  1AL2 4;  1Z7S 4;  1HRI 4;  1ASJ 4;  1PO1 4;  1RUE 4;  1R09 4;  1RUF 4;  1AR9 4;  2RS3 4;  2X5I D;  3JBG 4;  1RUH 4;  2R04 4;  1POV 0;  4Q4V 4;  1PO2 4;  1RUC 4;  1VRH 4;  4RHV 4;  4PDW D;  1D4M 4;  1MQT D;  2HWB 4;  1OOP D;  2R06 4;  2HWC 4;  1RVF 4;  1RUI 4;  3J8F 4;  1VBB 4;  3JD7 4;  4Q4Y 4;  1H8T D;  1NCQ D;  1BEV 4;  1VBD 4;  2PLV 4;  1VBA 4;  1HRV 4;  1NA1 D;  1RHI 4;  1HXS 4;  4Q4W 4;  2RR1 4; 
#chains in the Genus database with same CATH topology
 1ZP0 A;  1AR6 4;  5C3J A;  2ACZ A;  1VBC 4;  3AE8 A;  2WDR A;  1R08 4;  1NEN A;  3GQH A;  3AEE A;  1PIV 4;  1AR8 4;  1VBE 4;  3AE3 A;  3AE7 A;  1RUF 4;  4YTN A;  1YQ3 A;  1AR9 4;  3SFE A;  4YXD A;  1RUH 4;  5C2T A;  1XHZ A;  1POV 0;  4RHV 4;  4YTP A;  3SFD A;  3AEA A;  2HWB 4;  2HWC 4;  1RVF 4;  1RUI 4;  1XI1 A;  4YSZ A;  3AEB A;  1NCQ D;  3GQK A;  1EAH 4;  1EV1 4;  4KX6 A;  2RMU 4;  2RS5 4;  3AED A;  1YQ4 A;  3P4S A;  2RS1 4;  1COV 4;  3P4Q A;  2WP9 A;  1PVC 4;  2PZS A;  2RM2 4;  1Z7S 4;  1HRI 4;  1ASJ 4;  1R09 4;  2H89 A;  2R7F A;  2X5I D;  2PYL A;  2FBW A;  1KF6 A;  1XHX A;  1KFY A;  1RUC 4;  4YSX A;  3VRB A;  3ABV A;  2H88 A;  3P4R A;  1D4M 4;  3SUC A;  1NEK A;  2EX3 A;  1VBA 4;  4GB3 4;  1VRH 4;  1RUJ 4;  3AE6 A;  3AE2 A;  4YSY A;  3AEG A;  1RMU 4;  2WS3 A;  3P4P A;  3AE5 A;  1RUD 4;  3AEF A;  2WDV A;  3VR8 A;  1ZOY A;  2PW9 A;  1RUE 4;  3VR9 A;  2RS3 4;  4YT0 A;  2R04 4;  4Q4V 4;  1PO2 4;  3VRA A;  4PDW D;  1MQT D;  1L0V A;  3AE9 A;  1VBB 4;  3JD7 4;  1H8T D;  1VBD 4;  1HRV 4;  1RHI 4;  4Q4W 4;  2RR1 4;  2B76 A;  1RUG 4;  2WU2 A;  2WQY A;  2WU5 A;  1K5M D;  4Q4X 4;  3FI7 A;  1AR7 4;  2PY5 A;  1AL2 4;  1PO1 4;  3AE1 A;  3JBG 4;  3AEC A;  3AE4 A;  2WDQ A;  2R06 4;  1OOP D;  4YTM A;  3J8F 4;  3CIR A;  1BEV 4;  2PLV 4;  2PYJ A;  1NA1 D;  2R07 4;  1HXS 4;  4Q4Y 4; 
#chains in the Genus database with same CATH homology
 1EAH 4;  1EV1 4;  1RUJ 4;  1AR6 4;  1VBC 4;  1RUG 4;  1RMU 4;  2RMU 4;  1K5M D;  2RS5 4;  4Q4X 4;  1R08 4;  2R07 4;  1RUD 4;  1AR7 4;  1PIV 4;  2RS1 4;  1COV 4;  1AR8 4;  1VBE 4;  1PVC 4;  4GB3 4;  2RM2 4;  1AL2 4;  1Z7S 4;  1HRI 4;  1ASJ 4;  1PO1 4;  1RUE 4;  1R09 4;  1RUF 4;  1AR9 4;  2RS3 4;  2X5I D;  3JBG 4;  1RUH 4;  2R04 4;  1POV 0;  4Q4V 4;  1PO2 4;  1RUC 4;  1VRH 4;  4RHV 4;  4PDW D;  1D4M 4;  1MQT D;  2HWB 4;  1OOP D;  2R06 4;  2HWC 4;  1RVF 4;  1RUI 4;  3J8F 4;  1VBB 4;  3JD7 4;  4Q4Y 4;  1H8T D;  1NCQ D;  1BEV 4;  1VBD 4;  2PLV 4;  1VBA 4;  1HRV 4;  1NA1 D;  1RHI 4;  1HXS 4;  4Q4W 4;  2RR1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...