2PLV4

Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP1)
publication title Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
pubmed rcsb
total genus 3
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2plv400
1HRI4 1VBD4 1VBB4 3J8F4 2RS34 1NA1D 1RUE4 1Z7S4 2R064 1R084 1VBE4 1RUG4 1PO14 1ASJ4 1AR84 4RHV4 1VBA4 4Q4W4 1MQTD 3JBG4 1VBC4 2RMU4 1RHI4 1RUC4 1RUJ4 1HXS4 3JD74 1D4M4 4Q4V4 1NCQD 1POV0 1H8TD 2HWC4 2R044 1K5MD 2HWB4 4Q4Y4 1OOPD 4PDWD 4Q4X4 1RMU4 1RUI4 1AL24 1AR74 1AR64 2R074 1AR94 2X5ID 1RUH4 1HRV4 2RS54 1PIV4 1PO24 1BEV4 1RUF4 2RM24 2RS14 1EAH4 1PVC4 1R094 2RR14 4GB34 2PLV4 1RUD4 1RVF4 1EV14 1VRH4 1COV4
chains in the Genus database with same CATH superfamily
3J8F4 1NA1D 2PW9A 1XHXA 2PYJA 1R084 3AEBA 1ASJ4 1HRV4 1MQTD 1VBC4 2RMU4 1D4M4 4Q4V4 3VRAA 1XHZA 3AECA 2WQYA 3AE6A 3P4PA 4YTNA 4Q4Y4 3GQKA 1RUI4 1AL24 1AR74 1AR64 2X5ID 1XI1A 4YTPA 2H88A 1PO24 1BEV4 1KFYA 4YXDA 1R094 3SFDA 2PLV4 1RUD4 1VBD4 1KF6A 1NEKA 1COV4 2RS34 3AE9A 2WP9A 1VBE4 1VBA4 3JD74 1RUC4 1HXS4 3AE5A 1NCQD 1POV0 1K5MD 2HWB4 4KX6A 3AE4A 4Q4X4 3GQHA 2WU2A 2PZSA 2RS54 3FI7A 4YTMA 2RS14 2H89A 2RR14 3AE2A 2FBWA 4PDWD 5C3JA 2PYLA 3VR9A 1YQ4A 1VBB4 3AEEA 1RUE4 2R064 1PO14 3JBG4 3VR8A 2PY5A 3AEFA 2HWC4 1H8TD 3AE8A 3P4RA 2R044 3P4SA 1ZOYA 1OOPD 2EX3A 2R7FA 2WDVA 2WU5A 1RMU4 3VRBA 1NENA 2R074 1PIV4 2B76A 4YT0A 1EAH4 1PVC4 4YSYA 5C2TA 4GB34 1AR84 1EV14 1ZP0A 2ACZA 1VRH4 2WDRA 3AE1A 1HRI4 1L0VA 3SFEA 1YQ3A 1Z7S4 3AEDA 3AE7A 1RUG4 2WDQA 4RHV4 4Q4W4 3AEGA 1RHI4 1RUJ4 3CIRA 3AEAA 3ABVA 1AR94 4YSZA 1RUH4 2WS3A 3AE3A 1RUF4 2RM24 3SUCA 4YSXA 3P4QA 1RVF4
chains in the Genus database with same CATH topology
1HRI4 1VBD4 1VBB4 3J8F4 2RS34 1NA1D 1RUE4 1Z7S4 2R064 1R084 1VBE4 1RUG4 1PO14 1ASJ4 1AR84 4RHV4 1VBA4 4Q4W4 1MQTD 3JBG4 1VBC4 2RMU4 1RHI4 1RUC4 1RUJ4 1HXS4 3JD74 1D4M4 4Q4V4 1NCQD 1POV0 1H8TD 2HWC4 2R044 1K5MD 2HWB4 4Q4Y4 1OOPD 4PDWD 4Q4X4 1RMU4 1RUI4 1AL24 1AR74 1AR64 2R074 1AR94 2X5ID 1RUH4 1HRV4 2RS54 1PIV4 1PO24 1BEV4 1RUF4 2RM24 2RS14 1EAH4 1PVC4 1R094 2RR14 4GB34 2PLV4 1RUD4 1RVF4 1EV14 1VRH4 1COV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRI 4;  1VBD 4;  1VBB 4;  3J8F 4;  2RS3 4;  1NA1 D;  1RUE 4;  1Z7S 4;  2R06 4;  1R08 4;  1VBE 4;  1RUG 4;  1PO1 4;  1ASJ 4;  1AR8 4;  4RHV 4;  1VBA 4;  4Q4W 4;  1MQT D;  3JBG 4;  1VBC 4;  2RMU 4;  1RHI 4;  1RUC 4;  1RUJ 4;  1HXS 4;  3JD7 4;  1D4M 4;  4Q4V 4;  1NCQ D;  1POV 0;  1H8T D;  2HWC 4;  2R04 4;  1K5M D;  2HWB 4;  4Q4Y 4;  1OOP D;  4PDW D;  4Q4X 4;  1RMU 4;  1RUI 4;  1AL2 4;  1AR7 4;  1AR6 4;  2R07 4;  1AR9 4;  2X5I D;  1RUH 4;  1HRV 4;  2RS5 4;  1PIV 4;  1PO2 4;  1BEV 4;  1RUF 4;  2RM2 4;  2RS1 4;  1EAH 4;  1PVC 4;  1R09 4;  2RR1 4;  4GB3 4;  2PLV 4;  1RUD 4;  1RVF 4;  1EV1 4;  1VRH 4;  1COV 4; 
#chains in the Genus database with same CATH topology
 3J8F 4;  1NA1 D;  2PW9 A;  1XHX A;  2PYJ A;  1R08 4;  3AEB A;  1ASJ 4;  1HRV 4;  1MQT D;  1VBC 4;  2RMU 4;  1D4M 4;  4Q4V 4;  3VRA A;  1XHZ A;  3AEC A;  2WQY A;  3AE6 A;  3P4P A;  4YTN A;  4Q4Y 4;  3GQK A;  1RUI 4;  1AL2 4;  1AR7 4;  1AR6 4;  2X5I D;  1XI1 A;  4YTP A;  2H88 A;  1PO2 4;  1BEV 4;  1KFY A;  4YXD A;  1R09 4;  3SFD A;  2PLV 4;  1RUD 4;  1VBD 4;  1KF6 A;  1NEK A;  1COV 4;  2RS3 4;  3AE9 A;  2WP9 A;  1VBE 4;  1VBA 4;  3JD7 4;  1RUC 4;  1HXS 4;  3AE5 A;  1NCQ D;  1POV 0;  1K5M D;  2HWB 4;  4KX6 A;  3AE4 A;  4Q4X 4;  3GQH A;  2WU2 A;  2PZS A;  2RS5 4;  3FI7 A;  4YTM A;  2RS1 4;  2H89 A;  2RR1 4;  3AE2 A;  2FBW A;  4PDW D;  5C3J A;  2PYL A;  3VR9 A;  1YQ4 A;  1VBB 4;  3AEE A;  1RUE 4;  2R06 4;  1PO1 4;  3JBG 4;  3VR8 A;  2PY5 A;  3AEF A;  2HWC 4;  1H8T D;  3AE8 A;  3P4R A;  2R04 4;  3P4S A;  1ZOY A;  1OOP D;  2EX3 A;  2R7F A;  2WDV A;  2WU5 A;  1RMU 4;  3VRB A;  1NEN A;  2R07 4;  1PIV 4;  2B76 A;  4YT0 A;  1EAH 4;  1PVC 4;  4YSY A;  5C2T A;  4GB3 4;  1AR8 4;  1EV1 4;  1ZP0 A;  2ACZ A;  1VRH 4;  2WDR A;  3AE1 A;  1HRI 4;  1L0V A;  3SFE A;  1YQ3 A;  1Z7S 4;  3AED A;  3AE7 A;  1RUG 4;  2WDQ A;  4RHV 4;  4Q4W 4;  3AEG A;  1RHI 4;  1RUJ 4;  3CIR A;  3AEA A;  3ABV A;  1AR9 4;  4YSZ A;  1RUH 4;  2WS3 A;  3AE3 A;  1RUF 4;  2RM2 4;  3SUC A;  4YSX A;  3P4Q A;  1RVF 4; 
#chains in the Genus database with same CATH homology
 1HRI 4;  1VBD 4;  1VBB 4;  3J8F 4;  2RS3 4;  1NA1 D;  1RUE 4;  1Z7S 4;  2R06 4;  1R08 4;  1VBE 4;  1RUG 4;  1PO1 4;  1ASJ 4;  1AR8 4;  4RHV 4;  1VBA 4;  4Q4W 4;  1MQT D;  3JBG 4;  1VBC 4;  2RMU 4;  1RHI 4;  1RUC 4;  1RUJ 4;  1HXS 4;  3JD7 4;  1D4M 4;  4Q4V 4;  1NCQ D;  1POV 0;  1H8T D;  2HWC 4;  2R04 4;  1K5M D;  2HWB 4;  4Q4Y 4;  1OOP D;  4PDW D;  4Q4X 4;  1RMU 4;  1RUI 4;  1AL2 4;  1AR7 4;  1AR6 4;  2R07 4;  1AR9 4;  2X5I D;  1RUH 4;  1HRV 4;  2RS5 4;  1PIV 4;  1PO2 4;  1BEV 4;  1RUF 4;  2RM2 4;  2RS1 4;  1EAH 4;  1PVC 4;  1R09 4;  2RR1 4;  4GB3 4;  2PLV 4;  1RUD 4;  1RVF 4;  1EV1 4;  1VRH 4;  1COV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...