2PLV4

Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN POLIOVIRUS TYPE 1 (SUBUNIT VP1)
publication title Structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
pubmed rcsb
molecule tags Virus
total genus 3
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1989-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2plv400
1PVC4 1VBC4 3JBG4 4Q4W4 4Q4X4 1HRI4 1OOPD 1PO24 1RUJ4 2R044 4Q4V4 4PDWD 1EV14 2PLV4 1RUE4 1Z7S4 1HRV4 1AL24 1VBD4 1NCQD 1RUD4 2RM24 2RS14 1PO14 1AR94 1R084 1VBA4 1VRH4 2RS34 1D4M4 2RMU4 1COV4 2X5ID 2R064 2RR14 4GB34 1PIV4 1AR84 1POV0 3JD74 1BEV4 1ASJ4 1HXS4 1R094 1RVF4 1VBE4 1RHI4 1RUG4 2HWB4 4RHV4 1K5MD 1MQTD 2R074 1RUI4 2HWC4 3J8F4 4Q4Y4 1NA1D 1EAH4 1AR74 2RS54 1H8TD 1RUF4 1RMU4 1RUC4 1VBB4 1AR64 1RUH4
chains in the Genus database with same CATH superfamily
1PVC4 1KFYA 1HRI4 4PDWD 3P4QA 1RUE4 2WU2A 1HRV4 1VBD4 3VR8A 1AR94 1R084 1NEKA 2RMU4 2WU5A 4GB34 2B76A 3JD74 1POV0 3VRAA 3SFDA 1VBE4 2HWB4 1MQTD 2R074 1RUI4 3J8F4 3GQKA 4YSXA 1RUF4 3VR9A 3AE2A 2WQYA 1RUH4 1VBC4 1OOPD 1PO24 4YSYA 4YTPA 3P4RA 2PLV4 1Z7S4 2RM24 3FI7A 1XHXA 1VRH4 4YT0A 1D4M4 1KF6A 1COV4 1XI1A 2RR14 1NENA 1BEV4 1HXS4 1RVF4 5C2TA 3AE6A 3AE9A 3AE7A 2FBWA 2EX3A 1EAH4 3AECA 1VBB4 2PY5A 4Q4W4 2ACZA 2WDQA 2WS3A 1RUJ4 3AE5A 2R044 3AEDA 4YSZA 1EV14 3AEBA 3AEAA 2WDVA 4YTMA 2H89A 1AL24 2H88A 3P4PA 1NCQD 1RUD4 3P4SA 1L0VA 1PO14 2RS34 1VBA4 3AE4A 2R064 3CIRA 1YQ3A 5C3JA 1ASJ4 4YXDA 1RHI4 1YQ4A 1ZP0A 1ZOYA 3AE3A 1AR74 3AE8A 1RMU4 1RUC4 1XHZA 4Q4Y4 2PYLA 3JBG4 3AEFA 3GQHA 3SUCA 4Q4X4 2PYJA 4Q4V4 2PZSA 2PW9A 2RS14 2WDRA 2X5ID 4KX6A 3AEEA 3ABVA 3AEGA 1PIV4 1AR84 3SFEA 1R094 3VRBA 2R7FA 2WP9A 1RUG4 1K5MD 2HWC4 1NA1D 3AE1A 2RS54 1H8TD 4YTNA 4RHV4 1AR64
chains in the Genus database with same CATH topology
1PVC4 1VBC4 3JBG4 4Q4W4 4Q4X4 1HRI4 1OOPD 1PO24 1RUJ4 2R044 4Q4V4 4PDWD 1EV14 2PLV4 1RUE4 1Z7S4 1HRV4 1AL24 1VBD4 1NCQD 1RUD4 2RM24 2RS14 1PO14 1AR94 1R084 1VBA4 1VRH4 2RS34 1D4M4 2RMU4 1COV4 2X5ID 2R064 2RR14 4GB34 1PIV4 1AR84 1POV0 3JD74 1BEV4 1ASJ4 1HXS4 1R094 1RVF4 1VBE4 1RHI4 1RUG4 2HWB4 4RHV4 1K5MD 1MQTD 2R074 1RUI4 2HWC4 3J8F4 4Q4Y4 1NA1D 1EAH4 1AR74 2RS54 1H8TD 1RUF4 1RMU4 1RUC4 1VBB4 1AR64 1RUH4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVC 4;  1VBC 4;  3JBG 4;  4Q4W 4;  4Q4X 4;  1HRI 4;  1OOP D;  1PO2 4;  1RUJ 4;  2R04 4;  4Q4V 4;  4PDW D;  1EV1 4;  2PLV 4;  1RUE 4;  1Z7S 4;  1HRV 4;  1AL2 4;  1VBD 4;  1NCQ D;  1RUD 4;  2RM2 4;  2RS1 4;  1PO1 4;  1AR9 4;  1R08 4;  1VBA 4;  1VRH 4;  2RS3 4;  1D4M 4;  2RMU 4;  1COV 4;  2X5I D;  2R06 4;  2RR1 4;  4GB3 4;  1PIV 4;  1AR8 4;  1POV 0;  3JD7 4;  1BEV 4;  1ASJ 4;  1HXS 4;  1R09 4;  1RVF 4;  1VBE 4;  1RHI 4;  1RUG 4;  2HWB 4;  4RHV 4;  1K5M D;  1MQT D;  2R07 4;  1RUI 4;  2HWC 4;  3J8F 4;  4Q4Y 4;  1NA1 D;  1EAH 4;  1AR7 4;  2RS5 4;  1H8T D;  1RUF 4;  1RMU 4;  1RUC 4;  1VBB 4;  1AR6 4;  1RUH 4; 
#chains in the Genus database with same CATH topology
 1PVC 4;  1KFY A;  1HRI 4;  4PDW D;  3P4Q A;  1RUE 4;  2WU2 A;  1HRV 4;  1VBD 4;  3VR8 A;  1AR9 4;  1R08 4;  1NEK A;  2RMU 4;  2WU5 A;  4GB3 4;  2B76 A;  3JD7 4;  1POV 0;  3VRA A;  3SFD A;  1VBE 4;  2HWB 4;  1MQT D;  2R07 4;  1RUI 4;  3J8F 4;  3GQK A;  4YSX A;  1RUF 4;  3VR9 A;  3AE2 A;  2WQY A;  1RUH 4;  1VBC 4;  1OOP D;  1PO2 4;  4YSY A;  4YTP A;  3P4R A;  2PLV 4;  1Z7S 4;  2RM2 4;  3FI7 A;  1XHX A;  1VRH 4;  4YT0 A;  1D4M 4;  1KF6 A;  1COV 4;  1XI1 A;  2RR1 4;  1NEN A;  1BEV 4;  1HXS 4;  1RVF 4;  5C2T A;  3AE6 A;  3AE9 A;  3AE7 A;  2FBW A;  2EX3 A;  1EAH 4;  3AEC A;  1VBB 4;  2PY5 A;  4Q4W 4;  2ACZ A;  2WDQ A;  2WS3 A;  1RUJ 4;  3AE5 A;  2R04 4;  3AED A;  4YSZ A;  1EV1 4;  3AEB A;  3AEA A;  2WDV A;  4YTM A;  2H89 A;  1AL2 4;  2H88 A;  3P4P A;  1NCQ D;  1RUD 4;  3P4S A;  1L0V A;  1PO1 4;  2RS3 4;  1VBA 4;  3AE4 A;  2R06 4;  3CIR A;  1YQ3 A;  5C3J A;  1ASJ 4;  4YXD A;  1RHI 4;  1YQ4 A;  1ZP0 A;  1ZOY A;  3AE3 A;  1AR7 4;  3AE8 A;  1RMU 4;  1RUC 4;  1XHZ A;  4Q4Y 4;  2PYL A;  3JBG 4;  3AEF A;  3GQH A;  3SUC A;  4Q4X 4;  2PYJ A;  4Q4V 4;  2PZS A;  2PW9 A;  2RS1 4;  2WDR A;  2X5I D;  4KX6 A;  3AEE A;  3ABV A;  3AEG A;  1PIV 4;  1AR8 4;  3SFE A;  1R09 4;  3VRB A;  2R7F A;  2WP9 A;  1RUG 4;  1K5M D;  2HWC 4;  1NA1 D;  3AE1 A;  2RS5 4;  1H8T D;  4YTN A;  4RHV 4;  1AR6 4; 
#chains in the Genus database with same CATH homology
 1PVC 4;  1VBC 4;  3JBG 4;  4Q4W 4;  4Q4X 4;  1HRI 4;  1OOP D;  1PO2 4;  1RUJ 4;  2R04 4;  4Q4V 4;  4PDW D;  1EV1 4;  2PLV 4;  1RUE 4;  1Z7S 4;  1HRV 4;  1AL2 4;  1VBD 4;  1NCQ D;  1RUD 4;  2RM2 4;  2RS1 4;  1PO1 4;  1AR9 4;  1R08 4;  1VBA 4;  1VRH 4;  2RS3 4;  1D4M 4;  2RMU 4;  1COV 4;  2X5I D;  2R06 4;  2RR1 4;  4GB3 4;  1PIV 4;  1AR8 4;  1POV 0;  3JD7 4;  1BEV 4;  1ASJ 4;  1HXS 4;  1R09 4;  1RVF 4;  1VBE 4;  1RHI 4;  1RUG 4;  2HWB 4;  4RHV 4;  1K5M D;  1MQT D;  2R07 4;  1RUI 4;  2HWC 4;  3J8F 4;  4Q4Y 4;  1NA1 D;  1EAH 4;  1AR7 4;  2RS5 4;  1H8T D;  1RUF 4;  1RMU 4;  1RUC 4;  1VBB 4;  1AR6 4;  1RUH 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...