1NA1D

The structure of hrv14 when complexed with pleconaril
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1na1D00
2R074 2R064 1HXS4 1R094 1VBB4 1Z7S4 4PDWD 1AR94 1VBC4 4Q4W4 1COV4 4Q4Y4 1POV0 1AL24 1HRI4 2RS14 1OOPD 1HRV4 1AR84 1RVF4 1PO24 2HWB4 2R044 2RM24 1RUF4 1RUJ4 2RMU4 1NA1D 1EV14 3JBG4 1K5MD 2HWC4 1RUC4 2X5ID 1AR74 2RR14 1R084 3J8F4 1BEV4 4GB34 1D4M4 1RUG4 1RUD4 4Q4V4 1H8TD 2RS54 1VRH4 1RHI4 1NCQD 3JD74 1EAH4 1RUE4 1RUH4 1PIV4 1PVC4 1VBD4 4Q4X4 2RS34 4RHV4 1VBE4 1AR64 1MQTD 1VBA4 1RMU4 2PLV4 1PO14 1RUI4 1ASJ4
chains in the Genus database with same CATH superfamily
2R064 1ZOYA 1R094 2WQYA 3AEDA 1AR94 4Q4Y4 3VRBA 3SUCA 1OOPD 1AR84 3ABVA 3JBG4 2RMU4 1RUJ4 2EX3A 3AE8A 3AEAA 3GQKA 1K5MD 2HWC4 5C2TA 2ACZA 3AE1A 4GB34 1RUD4 4Q4V4 1NCQD 3JD74 1EAH4 3AE4A 1NENA 4Q4X4 3AEEA 2FBWA 1MQTD 2H88A 1PO14 1RUI4 3AEGA 1ASJ4 3P4SA 2WU5A 1POV0 1KF6A 3P4QA 1HRI4 1KFYA 2H89A 1XHZA 4YTPA 3VRAA 2X5ID 1AR74 2RR14 1R084 3FI7A 1BEV4 1H8TD 3P4RA 1VRH4 1RUH4 1ZP0A 2R7FA 2WDQA 4YXDA 1NEKA 3VR9A 2PY5A 2PYJA 1VBE4 1AR64 2PLV4 1RMU4 2R074 1HXS4 1VBB4 1Z7S4 4PDWD 1VBC4 3P4PA 2WDVA 3CIRA 2RM24 1RVF4 2R044 1PO24 2HWB4 1NA1D 3AE2A 1RUC4 5C3JA 3J8F4 1RUG4 4YSZA 1YQ3A 1XI1A 2WS3A 4KX6A 3AE5A 1RUE4 1YQ4A 1VBA4 3AE7A 4RHV4 3VR8A 3AECA 4YTMA 4YSYA 2WU2A 3AEFA 4Q4W4 1COV4 2WP9A 3GQHA 2PZSA 3AE9A 1AL24 2RS14 1HRV4 3AE6A 1RUF4 2B76A 4YSXA 4YTNA 1EV14 1L0VA 2PW9A 1D4M4 1XHXA 2WDRA 1RHI4 2PYLA 3SFDA 1PIV4 1PVC4 1VBD4 3SFEA 4YT0A 2RS34 2RS54 3AEBA 3AE3A
chains in the Genus database with same CATH topology
2R074 2R064 1HXS4 1R094 1VBB4 1Z7S4 4PDWD 1AR94 1VBC4 4Q4W4 1COV4 4Q4Y4 1POV0 1AL24 1HRI4 2RS14 1OOPD 1HRV4 1AR84 1RVF4 1PO24 2HWB4 2R044 2RM24 1RUF4 1RUJ4 2RMU4 1NA1D 1EV14 3JBG4 1K5MD 2HWC4 1RUC4 2X5ID 1AR74 2RR14 1R084 3J8F4 1BEV4 4GB34 1D4M4 1RUG4 1RUD4 4Q4V4 1H8TD 2RS54 1VRH4 1RHI4 1NCQD 3JD74 1EAH4 1RUE4 1RUH4 1PIV4 1PVC4 1VBD4 4Q4X4 2RS34 4RHV4 1VBE4 1AR64 1MQTD 1VBA4 1RMU4 2PLV4 1PO14 1RUI4 1ASJ4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R07 4;  2R06 4;  1HXS 4;  1R09 4;  1VBB 4;  1Z7S 4;  4PDW D;  1AR9 4;  1VBC 4;  4Q4W 4;  1COV 4;  4Q4Y 4;  1POV 0;  1AL2 4;  1HRI 4;  2RS1 4;  1OOP D;  1HRV 4;  1AR8 4;  1RVF 4;  1PO2 4;  2HWB 4;  2R04 4;  2RM2 4;  1RUF 4;  1RUJ 4;  2RMU 4;  1NA1 D;  1EV1 4;  3JBG 4;  1K5M D;  2HWC 4;  1RUC 4;  2X5I D;  1AR7 4;  2RR1 4;  1R08 4;  3J8F 4;  1BEV 4;  4GB3 4;  1D4M 4;  1RUG 4;  1RUD 4;  4Q4V 4;  1H8T D;  2RS5 4;  1VRH 4;  1RHI 4;  1NCQ D;  3JD7 4;  1EAH 4;  1RUE 4;  1RUH 4;  1PIV 4;  1PVC 4;  1VBD 4;  4Q4X 4;  2RS3 4;  4RHV 4;  1VBE 4;  1AR6 4;  1MQT D;  1VBA 4;  1RMU 4;  2PLV 4;  1PO1 4;  1RUI 4;  1ASJ 4; 
#chains in the Genus database with same CATH topology
 2R06 4;  1ZOY A;  1R09 4;  2WQY A;  3AED A;  1AR9 4;  4Q4Y 4;  3VRB A;  3SUC A;  1OOP D;  1AR8 4;  3ABV A;  3JBG 4;  2RMU 4;  1RUJ 4;  2EX3 A;  3AE8 A;  3AEA A;  3GQK A;  1K5M D;  2HWC 4;  5C2T A;  2ACZ A;  3AE1 A;  4GB3 4;  1RUD 4;  4Q4V 4;  1NCQ D;  3JD7 4;  1EAH 4;  3AE4 A;  1NEN A;  4Q4X 4;  3AEE A;  2FBW A;  1MQT D;  2H88 A;  1PO1 4;  1RUI 4;  3AEG A;  1ASJ 4;  3P4S A;  2WU5 A;  1POV 0;  1KF6 A;  3P4Q A;  1HRI 4;  1KFY A;  2H89 A;  1XHZ A;  4YTP A;  3VRA A;  2X5I D;  1AR7 4;  2RR1 4;  1R08 4;  3FI7 A;  1BEV 4;  1H8T D;  3P4R A;  1VRH 4;  1RUH 4;  1ZP0 A;  2R7F A;  2WDQ A;  4YXD A;  1NEK A;  3VR9 A;  2PY5 A;  2PYJ A;  1VBE 4;  1AR6 4;  2PLV 4;  1RMU 4;  2R07 4;  1HXS 4;  1VBB 4;  1Z7S 4;  4PDW D;  1VBC 4;  3P4P A;  2WDV A;  3CIR A;  2RM2 4;  1RVF 4;  2R04 4;  1PO2 4;  2HWB 4;  1NA1 D;  3AE2 A;  1RUC 4;  5C3J A;  3J8F 4;  1RUG 4;  4YSZ A;  1YQ3 A;  1XI1 A;  2WS3 A;  4KX6 A;  3AE5 A;  1RUE 4;  1YQ4 A;  1VBA 4;  3AE7 A;  4RHV 4;  3VR8 A;  3AEC A;  4YTM A;  4YSY A;  2WU2 A;  3AEF A;  4Q4W 4;  1COV 4;  2WP9 A;  3GQH A;  2PZS A;  3AE9 A;  1AL2 4;  2RS1 4;  1HRV 4;  3AE6 A;  1RUF 4;  2B76 A;  4YSX A;  4YTN A;  1EV1 4;  1L0V A;  2PW9 A;  1D4M 4;  1XHX A;  2WDR A;  1RHI 4;  2PYL A;  3SFD A;  1PIV 4;  1PVC 4;  1VBD 4;  3SFE A;  4YT0 A;  2RS3 4;  2RS5 4;  3AEB A;  3AE3 A; 
#chains in the Genus database with same CATH homology
 2R07 4;  2R06 4;  1HXS 4;  1R09 4;  1VBB 4;  1Z7S 4;  4PDW D;  1AR9 4;  1VBC 4;  4Q4W 4;  1COV 4;  4Q4Y 4;  1POV 0;  1AL2 4;  1HRI 4;  2RS1 4;  1OOP D;  1HRV 4;  1AR8 4;  1RVF 4;  1PO2 4;  2HWB 4;  2R04 4;  2RM2 4;  1RUF 4;  1RUJ 4;  2RMU 4;  1NA1 D;  1EV1 4;  3JBG 4;  1K5M D;  2HWC 4;  1RUC 4;  2X5I D;  1AR7 4;  2RR1 4;  1R08 4;  3J8F 4;  1BEV 4;  4GB3 4;  1D4M 4;  1RUG 4;  1RUD 4;  4Q4V 4;  1H8T D;  2RS5 4;  1VRH 4;  1RHI 4;  1NCQ D;  3JD7 4;  1EAH 4;  1RUE 4;  1RUH 4;  1PIV 4;  1PVC 4;  1VBD 4;  4Q4X 4;  2RS3 4;  4RHV 4;  1VBE 4;  1AR6 4;  1MQT D;  1VBA 4;  1RMU 4;  2PLV 4;  1PO1 4;  1RUI 4;  1ASJ 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...