1NA1D

The structure of hrv14 when complexed with pleconaril
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1na1D00
1AR84 2HWC4 1EAH4 1EV14 4RHV4 4Q4W4 1NCQD 1ASJ4 1BEV4 2RS34 1H8TD 1POV0 4GB34 1RHI4 2RMU4 2R044 1HXS4 1RUG4 1RUD4 4Q4V4 4Q4X4 1AR74 1AL24 1MQTD 3J8F4 1RUI4 1HRI4 3JD74 1AR94 1RVF4 1RUE4 2RR14 1COV4 2X5ID 1PIV4 1PVC4 3JBG4 1NA1D 1RUC4 1RUH4 1VRH4 1OOPD 1R094 1RMU4 1AR64 2HWB4 2RS14 4PDWD 1K5MD 2PLV4 2RM24 1Z7S4 2R064 2RS54 1RUF4 1VBE4 1PO24 1R084 1RUJ4 1PO14 1VBD4 1VBB4 1D4M4 4Q4Y4 2R074 1VBC4 1HRV4 1VBA4
chains in the Genus database with same CATH superfamily
2R7FA 2HWC4 1ASJ4 4YSZA 2RMU4 2R044 1HXS4 4Q4V4 1MQTD 3J8F4 1RUI4 4YTPA 2WDQA 3AE3A 1PVC4 3JBG4 1NA1D 1RUC4 3AECA 4YSXA 1ZOYA 3AE9A 2HWB4 5C3JA 3P4QA 2PW9A 2EX3A 3FI7A 1Z7S4 2RS54 2H89A 3GQKA 2PYLA 1ZP0A 2PYJA 1PO24 1PO14 3SUCA 2WDVA 3P4RA 2ACZA 1VBA4 1AR84 3SFDA 4RHV4 4Q4W4 2RS34 1BEV4 1H8TD 2WU5A 1RUG4 1RUD4 3ABVA 1HRI4 1XI1A 5C2TA 1COV4 3SFEA 1RUH4 1VRH4 3AE7A 1OOPD 3CIRA 2PZSA 1RMU4 1AR64 2RS14 3AEDA 2WDRA 2H88A 4PDWD 3AE8A 3AEGA 2RM24 3AE4A 3AE5A 2R074 1L0VA 1NEKA 4YT0A 1EAH4 1EV14 4YTMA 3P4PA 1RHI4 3AEAA 1AR74 1AL24 2WP9A 2B76A 1AR94 1RVF4 3AEFA 4YSYA 3AE2A 1PIV4 3VR9A 4YXDA 1R094 2WS3A 1XHXA 1NENA 1KF6A 4KX6A 4YTNA 1VBD4 1VBB4 1D4M4 3GQHA 4Q4Y4 1VBC4 1HRV4 2FBWA 1NCQD 1POV0 3AEEA 1YQ4A 4GB34 3AE1A 4Q4X4 3VRBA 3JD74 1RUE4 2RR14 2X5ID 3VRAA 3P4SA 3AE6A 1XHZA 1K5MD 2PLV4 1YQ3A 2R064 2WQYA 1RUF4 1VBE4 1R084 2WU2A 1RUJ4 3VR8A 1KFYA 2PY5A 3AEBA
chains in the Genus database with same CATH topology
1AR84 2HWC4 1EAH4 1EV14 4RHV4 4Q4W4 1NCQD 1ASJ4 1BEV4 2RS34 1H8TD 1POV0 4GB34 1RHI4 2RMU4 2R044 1HXS4 1RUG4 1RUD4 4Q4V4 4Q4X4 1AR74 1AL24 1MQTD 3J8F4 1RUI4 1HRI4 3JD74 1AR94 1RVF4 1RUE4 2RR14 1COV4 2X5ID 1PIV4 1PVC4 3JBG4 1NA1D 1RUC4 1RUH4 1VRH4 1OOPD 1R094 1RMU4 1AR64 2HWB4 2RS14 4PDWD 1K5MD 2PLV4 2RM24 1Z7S4 2R064 2RS54 1RUF4 1VBE4 1PO24 1R084 1RUJ4 1PO14 1VBD4 1VBB4 1D4M4 4Q4Y4 2R074 1VBC4 1HRV4 1VBA4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR8 4;  2HWC 4;  1EAH 4;  1EV1 4;  4RHV 4;  4Q4W 4;  1NCQ D;  1ASJ 4;  1BEV 4;  2RS3 4;  1H8T D;  1POV 0;  4GB3 4;  1RHI 4;  2RMU 4;  2R04 4;  1HXS 4;  1RUG 4;  1RUD 4;  4Q4V 4;  4Q4X 4;  1AR7 4;  1AL2 4;  1MQT D;  3J8F 4;  1RUI 4;  1HRI 4;  3JD7 4;  1AR9 4;  1RVF 4;  1RUE 4;  2RR1 4;  1COV 4;  2X5I D;  1PIV 4;  1PVC 4;  3JBG 4;  1NA1 D;  1RUC 4;  1RUH 4;  1VRH 4;  1OOP D;  1R09 4;  1RMU 4;  1AR6 4;  2HWB 4;  2RS1 4;  4PDW D;  1K5M D;  2PLV 4;  2RM2 4;  1Z7S 4;  2R06 4;  2RS5 4;  1RUF 4;  1VBE 4;  1PO2 4;  1R08 4;  1RUJ 4;  1PO1 4;  1VBD 4;  1VBB 4;  1D4M 4;  4Q4Y 4;  2R07 4;  1VBC 4;  1HRV 4;  1VBA 4; 
#chains in the Genus database with same CATH topology
 2R7F A;  2HWC 4;  1ASJ 4;  4YSZ A;  2RMU 4;  2R04 4;  1HXS 4;  4Q4V 4;  1MQT D;  3J8F 4;  1RUI 4;  4YTP A;  2WDQ A;  3AE3 A;  1PVC 4;  3JBG 4;  1NA1 D;  1RUC 4;  3AEC A;  4YSX A;  1ZOY A;  3AE9 A;  2HWB 4;  5C3J A;  3P4Q A;  2PW9 A;  2EX3 A;  3FI7 A;  1Z7S 4;  2RS5 4;  2H89 A;  3GQK A;  2PYL A;  1ZP0 A;  2PYJ A;  1PO2 4;  1PO1 4;  3SUC A;  2WDV A;  3P4R A;  2ACZ A;  1VBA 4;  1AR8 4;  3SFD A;  4RHV 4;  4Q4W 4;  2RS3 4;  1BEV 4;  1H8T D;  2WU5 A;  1RUG 4;  1RUD 4;  3ABV A;  1HRI 4;  1XI1 A;  5C2T A;  1COV 4;  3SFE A;  1RUH 4;  1VRH 4;  3AE7 A;  1OOP D;  3CIR A;  2PZS A;  1RMU 4;  1AR6 4;  2RS1 4;  3AED A;  2WDR A;  2H88 A;  4PDW D;  3AE8 A;  3AEG A;  2RM2 4;  3AE4 A;  3AE5 A;  2R07 4;  1L0V A;  1NEK A;  4YT0 A;  1EAH 4;  1EV1 4;  4YTM A;  3P4P A;  1RHI 4;  3AEA A;  1AR7 4;  1AL2 4;  2WP9 A;  2B76 A;  1AR9 4;  1RVF 4;  3AEF A;  4YSY A;  3AE2 A;  1PIV 4;  3VR9 A;  4YXD A;  1R09 4;  2WS3 A;  1XHX A;  1NEN A;  1KF6 A;  4KX6 A;  4YTN A;  1VBD 4;  1VBB 4;  1D4M 4;  3GQH A;  4Q4Y 4;  1VBC 4;  1HRV 4;  2FBW A;  1NCQ D;  1POV 0;  3AEE A;  1YQ4 A;  4GB3 4;  3AE1 A;  4Q4X 4;  3VRB A;  3JD7 4;  1RUE 4;  2RR1 4;  2X5I D;  3VRA A;  3P4S A;  3AE6 A;  1XHZ A;  1K5M D;  2PLV 4;  1YQ3 A;  2R06 4;  2WQY A;  1RUF 4;  1VBE 4;  1R08 4;  2WU2 A;  1RUJ 4;  3VR8 A;  1KFY A;  2PY5 A;  3AEB A; 
#chains in the Genus database with same CATH homology
 1AR8 4;  2HWC 4;  1EAH 4;  1EV1 4;  4RHV 4;  4Q4W 4;  1NCQ D;  1ASJ 4;  1BEV 4;  2RS3 4;  1H8T D;  1POV 0;  4GB3 4;  1RHI 4;  2RMU 4;  2R04 4;  1HXS 4;  1RUG 4;  1RUD 4;  4Q4V 4;  4Q4X 4;  1AR7 4;  1AL2 4;  1MQT D;  3J8F 4;  1RUI 4;  1HRI 4;  3JD7 4;  1AR9 4;  1RVF 4;  1RUE 4;  2RR1 4;  1COV 4;  2X5I D;  1PIV 4;  1PVC 4;  3JBG 4;  1NA1 D;  1RUC 4;  1RUH 4;  1VRH 4;  1OOP D;  1R09 4;  1RMU 4;  1AR6 4;  2HWB 4;  2RS1 4;  4PDW D;  1K5M D;  2PLV 4;  2RM2 4;  1Z7S 4;  2R06 4;  2RS5 4;  1RUF 4;  1VBE 4;  1PO2 4;  1R08 4;  1RUJ 4;  1PO1 4;  1VBD 4;  1VBB 4;  1D4M 4;  4Q4Y 4;  2R07 4;  1VBC 4;  1HRV 4;  1VBA 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...