1NA1D

The structure of hrv14 when complexed with pleconaril
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1na1D00
1EV14 1PIV4 2X5ID 1RUC4 1COV4 4Q4Y4 1ASJ4 1EAH4 1RUJ4 3JBG4 4Q4V4 1RHI4 2RS14 1PO24 1AR64 1VBE4 1AR74 1PO14 1R094 1RUF4 2R044 1RUI4 1VRH4 1HRV4 1RMU4 1HRI4 1Z7S4 2HWC4 1OOPD 1AL24 1RUH4 4Q4X4 2R074 2HWB4 1VBB4 3J8F4 4GB34 1VBA4 1POV0 4PDWD 1D4M4 1VBD4 1MQTD 1NA1D 2RR14 2PLV4 4RHV4 2RS54 1K5MD 1RUG4 1BEV4 1RUD4 1AR84 2R064 1PVC4 3JD74 1RVF4 4Q4W4 1HXS4 1R084 2RMU4 1H8TD 1AR94 1VBC4 1NCQD 2RM24 1RUE4 2RS34
chains in the Genus database with same CATH superfamily
1EV14 2H88A 3JBG4 3P4PA 2RS14 2EX3A 1AR74 1PO14 1R094 2R044 4YSXA 4YXDA 1RMU4 1YQ3A 3AECA 1XI1A 2HWC4 1OOPD 1RUH4 2R074 3AEAA 2HWB4 3J8F4 1VBA4 1POV0 1VBD4 2R7FA 2RS54 2WP9A 3VR8A 2PZSA 3SUCA 1K5MD 1RUG4 1BEV4 3P4QA 1L0VA 3GQHA 1RVF4 1AR94 1VBC4 2RS34 4GB34 1RUJ4 3ABVA 3SFEA 3P4SA 1AR64 4YTPA 1XHXA 4YTNA 1HRV4 2PYJA 2B76A 3AE2A 2WDQA 4YSYA 3VRBA 3CIRA 5C2TA 2H89A 3AE6A 2PLV4 4RHV4 2PYLA 4YTMA 1NEKA 2WDVA 1RUD4 1ZP0A 4Q4W4 1HXS4 1H8TD 4YT0A 2FBWA 2RM24 2ACZA 1RUC4 4Q4Y4 1ASJ4 1EAH4 2WS3A 3P4RA 4Q4V4 1PO24 1RUF4 1RUI4 3FI7A 2WU2A 3VRAA 1VBB4 4PDWD 1YQ4A 3AEBA 1KFYA 1MQTD 2RR14 1XHZA 3AE8A 2WDRA 3AE7A 2PY5A 1PVC4 3JD74 1NENA 3SFDA 2RMU4 3AEEA 3GQKA 4KX6A 1NCQD 3AEFA 1PIV4 3AE5A 2X5ID 1COV4 1RHI4 3AE3A 1VBE4 1VRH4 3VR9A 1KF6A 3AEGA 1HRI4 3AE4A 1Z7S4 4YSZA 2PW9A 1AL24 4Q4X4 1D4M4 1NA1D 2WU5A 5C3JA 1ZOYA 2R064 1AR84 3AEDA 1R084 3AE9A 3AE1A 2WQYA 1RUE4
chains in the Genus database with same CATH topology
1EV14 1PIV4 2X5ID 1RUC4 1COV4 4Q4Y4 1ASJ4 1EAH4 1RUJ4 3JBG4 4Q4V4 1RHI4 2RS14 1PO24 1AR64 1VBE4 1AR74 1PO14 1R094 1RUF4 2R044 1RUI4 1VRH4 1HRV4 1RMU4 1HRI4 1Z7S4 2HWC4 1OOPD 1AL24 1RUH4 4Q4X4 2R074 2HWB4 1VBB4 3J8F4 4GB34 1VBA4 1POV0 4PDWD 1D4M4 1VBD4 1MQTD 1NA1D 2RR14 2PLV4 4RHV4 2RS54 1K5MD 1RUG4 1BEV4 1RUD4 1AR84 2R064 1PVC4 3JD74 1RVF4 4Q4W4 1HXS4 1R084 2RMU4 1H8TD 1AR94 1VBC4 1NCQD 2RM24 1RUE4 2RS34
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV1 4;  1PIV 4;  2X5I D;  1RUC 4;  1COV 4;  4Q4Y 4;  1ASJ 4;  1EAH 4;  1RUJ 4;  3JBG 4;  4Q4V 4;  1RHI 4;  2RS1 4;  1PO2 4;  1AR6 4;  1VBE 4;  1AR7 4;  1PO1 4;  1R09 4;  1RUF 4;  2R04 4;  1RUI 4;  1VRH 4;  1HRV 4;  1RMU 4;  1HRI 4;  1Z7S 4;  2HWC 4;  1OOP D;  1AL2 4;  1RUH 4;  4Q4X 4;  2R07 4;  2HWB 4;  1VBB 4;  3J8F 4;  4GB3 4;  1VBA 4;  1POV 0;  4PDW D;  1D4M 4;  1VBD 4;  1MQT D;  1NA1 D;  2RR1 4;  2PLV 4;  4RHV 4;  2RS5 4;  1K5M D;  1RUG 4;  1BEV 4;  1RUD 4;  1AR8 4;  2R06 4;  1PVC 4;  3JD7 4;  1RVF 4;  4Q4W 4;  1HXS 4;  1R08 4;  2RMU 4;  1H8T D;  1AR9 4;  1VBC 4;  1NCQ D;  2RM2 4;  1RUE 4;  2RS3 4; 
#chains in the Genus database with same CATH topology
 1EV1 4;  2H88 A;  3JBG 4;  3P4P A;  2RS1 4;  2EX3 A;  1AR7 4;  1PO1 4;  1R09 4;  2R04 4;  4YSX A;  4YXD A;  1RMU 4;  1YQ3 A;  3AEC A;  1XI1 A;  2HWC 4;  1OOP D;  1RUH 4;  2R07 4;  3AEA A;  2HWB 4;  3J8F 4;  1VBA 4;  1POV 0;  1VBD 4;  2R7F A;  2RS5 4;  2WP9 A;  3VR8 A;  2PZS A;  3SUC A;  1K5M D;  1RUG 4;  1BEV 4;  3P4Q A;  1L0V A;  3GQH A;  1RVF 4;  1AR9 4;  1VBC 4;  2RS3 4;  4GB3 4;  1RUJ 4;  3ABV A;  3SFE A;  3P4S A;  1AR6 4;  4YTP A;  1XHX A;  4YTN A;  1HRV 4;  2PYJ A;  2B76 A;  3AE2 A;  2WDQ A;  4YSY A;  3VRB A;  3CIR A;  5C2T A;  2H89 A;  3AE6 A;  2PLV 4;  4RHV 4;  2PYL A;  4YTM A;  1NEK A;  2WDV A;  1RUD 4;  1ZP0 A;  4Q4W 4;  1HXS 4;  1H8T D;  4YT0 A;  2FBW A;  2RM2 4;  2ACZ A;  1RUC 4;  4Q4Y 4;  1ASJ 4;  1EAH 4;  2WS3 A;  3P4R A;  4Q4V 4;  1PO2 4;  1RUF 4;  1RUI 4;  3FI7 A;  2WU2 A;  3VRA A;  1VBB 4;  4PDW D;  1YQ4 A;  3AEB A;  1KFY A;  1MQT D;  2RR1 4;  1XHZ A;  3AE8 A;  2WDR A;  3AE7 A;  2PY5 A;  1PVC 4;  3JD7 4;  1NEN A;  3SFD A;  2RMU 4;  3AEE A;  3GQK A;  4KX6 A;  1NCQ D;  3AEF A;  1PIV 4;  3AE5 A;  2X5I D;  1COV 4;  1RHI 4;  3AE3 A;  1VBE 4;  1VRH 4;  3VR9 A;  1KF6 A;  3AEG A;  1HRI 4;  3AE4 A;  1Z7S 4;  4YSZ A;  2PW9 A;  1AL2 4;  4Q4X 4;  1D4M 4;  1NA1 D;  2WU5 A;  5C3J A;  1ZOY A;  2R06 4;  1AR8 4;  3AED A;  1R08 4;  3AE9 A;  3AE1 A;  2WQY A;  1RUE 4; 
#chains in the Genus database with same CATH homology
 1EV1 4;  1PIV 4;  2X5I D;  1RUC 4;  1COV 4;  4Q4Y 4;  1ASJ 4;  1EAH 4;  1RUJ 4;  3JBG 4;  4Q4V 4;  1RHI 4;  2RS1 4;  1PO2 4;  1AR6 4;  1VBE 4;  1AR7 4;  1PO1 4;  1R09 4;  1RUF 4;  2R04 4;  1RUI 4;  1VRH 4;  1HRV 4;  1RMU 4;  1HRI 4;  1Z7S 4;  2HWC 4;  1OOP D;  1AL2 4;  1RUH 4;  4Q4X 4;  2R07 4;  2HWB 4;  1VBB 4;  3J8F 4;  4GB3 4;  1VBA 4;  1POV 0;  4PDW D;  1D4M 4;  1VBD 4;  1MQT D;  1NA1 D;  2RR1 4;  2PLV 4;  4RHV 4;  2RS5 4;  1K5M D;  1RUG 4;  1BEV 4;  1RUD 4;  1AR8 4;  2R06 4;  1PVC 4;  3JD7 4;  1RVF 4;  4Q4W 4;  1HXS 4;  1R08 4;  2RMU 4;  1H8T D;  1AR9 4;  1VBC 4;  1NCQ D;  2RM2 4;  1RUE 4;  2RS3 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...