2HWB4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwb400
4GB34 1NCQD 2RS54 1POV0 3J8F4 4PDWD 1VBA4 1PO14 2PLV4 1HRI4 1AR84 1VBE4 1RVF4 1MQTD 1RUF4 2R044 2RM24 1R084 1AR64 4RHV4 1AR94 2RS34 1VRH4 1PVC4 2R074 1BEV4 1COV4 1RUI4 1Z7S4 1HXS4 1RUE4 2X5ID 1RMU4 1AL24 2R064 1PIV4 2HWC4 4Q4Y4 1PO24 1R094 3JBG4 1EAH4 1RUC4 1OOPD 2RMU4 1NA1D 1RUH4 1ASJ4 1RUJ4 1RUD4 1VBD4 1EV14 1HRV4 1K5MD 1VBB4 2HWB4 1H8TD 1RUG4 2RR14 1RHI4 4Q4X4 1AR74 2RS14 4Q4V4 3JD74 1D4M4 4Q4W4 1VBC4
chains in the Genus database with same CATH superfamily
2WQYA 4GB34 5C3JA 2H88A 3P4SA 3AEFA 1HRI4 1RUF4 4YTNA 1AR64 2WDRA 3P4QA 1VRH4 2PW9A 1RUI4 1Z7S4 1HXS4 3FI7A 2HWC4 3AE6A 3AE5A 4Q4Y4 2PZSA 3JBG4 1EAH4 1OOPD 1ASJ4 2PY5A 2RR14 1NENA 1AR74 1ZOYA 5C2TA 4YTMA 3J8F4 4PDWD 1PO14 2PLV4 3P4PA 3AE9A 1AR84 3SFDA 3AEBA 3SFEA 2R074 3VRAA 3ABVA 2WU5A 2PYJA 1KFYA 3AEAA 2WU2A 4YSXA 1XHZA 2PYLA 1NA1D 1RUH4 3AE7A 1NEKA 3AEEA 3AE3A 3AE8A 2EX3A 2ACZA 3AECA 1VBB4 4KX6A 1ZP0A 3AE1A 4Q4V4 3VRBA 1D4M4 3CIRA 1VBC4 1XI1A 1NCQD 2RS54 3AEGA 1R084 4RHV4 4YXDA 2RS34 1PVC4 3P4RA 2X5ID 1YQ3A 1RMU4 2WP9A 3AE2A 1PO24 1R094 3GQKA 1RUD4 1VBD4 1EV14 4YSYA 1K5MD 2B76A 4YTPA 1RUG4 2WDVA 2WS3A 4YSZA 2RS14 3JD74 3SUCA 4Q4W4 1POV0 1VBA4 4YT0A 3GQHA 1VBE4 1RVF4 1MQTD 2R044 2RM24 2WDQA 1AR94 2H89A 1BEV4 1COV4 1RUE4 3AEDA 3VR9A 1AL24 2R064 1PIV4 2RMU4 1RUC4 1RUJ4 1HRV4 1XHXA 3VR8A 1L0VA 2HWB4 1H8TD 1YQ4A 2R7FA 1RHI4 2FBWA 4Q4X4 1KF6A 3AE4A
chains in the Genus database with same CATH topology
4GB34 1NCQD 2RS54 1POV0 3J8F4 4PDWD 1VBA4 1PO14 2PLV4 1HRI4 1AR84 1VBE4 1RVF4 1MQTD 1RUF4 2R044 2RM24 1R084 1AR64 4RHV4 1AR94 2RS34 1VRH4 1PVC4 2R074 1BEV4 1COV4 1RUI4 1Z7S4 1HXS4 1RUE4 2X5ID 1RMU4 1AL24 2R064 1PIV4 2HWC4 4Q4Y4 1PO24 1R094 3JBG4 1EAH4 1RUC4 1OOPD 2RMU4 1NA1D 1RUH4 1ASJ4 1RUJ4 1RUD4 1VBD4 1EV14 1HRV4 1K5MD 1VBB4 2HWB4 1H8TD 1RUG4 2RR14 1RHI4 4Q4X4 1AR74 2RS14 4Q4V4 3JD74 1D4M4 4Q4W4 1VBC4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB3 4;  1NCQ D;  2RS5 4;  1POV 0;  3J8F 4;  4PDW D;  1VBA 4;  1PO1 4;  2PLV 4;  1HRI 4;  1AR8 4;  1VBE 4;  1RVF 4;  1MQT D;  1RUF 4;  2R04 4;  2RM2 4;  1R08 4;  1AR6 4;  4RHV 4;  1AR9 4;  2RS3 4;  1VRH 4;  1PVC 4;  2R07 4;  1BEV 4;  1COV 4;  1RUI 4;  1Z7S 4;  1HXS 4;  1RUE 4;  2X5I D;  1RMU 4;  1AL2 4;  2R06 4;  1PIV 4;  2HWC 4;  4Q4Y 4;  1PO2 4;  1R09 4;  3JBG 4;  1EAH 4;  1RUC 4;  1OOP D;  2RMU 4;  1NA1 D;  1RUH 4;  1ASJ 4;  1RUJ 4;  1RUD 4;  1VBD 4;  1EV1 4;  1HRV 4;  1K5M D;  1VBB 4;  2HWB 4;  1H8T D;  1RUG 4;  2RR1 4;  1RHI 4;  4Q4X 4;  1AR7 4;  2RS1 4;  4Q4V 4;  3JD7 4;  1D4M 4;  4Q4W 4;  1VBC 4; 
#chains in the Genus database with same CATH topology
 2WQY A;  4GB3 4;  5C3J A;  2H88 A;  3P4S A;  3AEF A;  1HRI 4;  1RUF 4;  4YTN A;  1AR6 4;  2WDR A;  3P4Q A;  1VRH 4;  2PW9 A;  1RUI 4;  1Z7S 4;  1HXS 4;  3FI7 A;  2HWC 4;  3AE6 A;  3AE5 A;  4Q4Y 4;  2PZS A;  3JBG 4;  1EAH 4;  1OOP D;  1ASJ 4;  2PY5 A;  2RR1 4;  1NEN A;  1AR7 4;  1ZOY A;  5C2T A;  4YTM A;  3J8F 4;  4PDW D;  1PO1 4;  2PLV 4;  3P4P A;  3AE9 A;  1AR8 4;  3SFD A;  3AEB A;  3SFE A;  2R07 4;  3VRA A;  3ABV A;  2WU5 A;  2PYJ A;  1KFY A;  3AEA A;  2WU2 A;  4YSX A;  1XHZ A;  2PYL A;  1NA1 D;  1RUH 4;  3AE7 A;  1NEK A;  3AEE A;  3AE3 A;  3AE8 A;  2EX3 A;  2ACZ A;  3AEC A;  1VBB 4;  4KX6 A;  1ZP0 A;  3AE1 A;  4Q4V 4;  3VRB A;  1D4M 4;  3CIR A;  1VBC 4;  1XI1 A;  1NCQ D;  2RS5 4;  3AEG A;  1R08 4;  4RHV 4;  4YXD A;  2RS3 4;  1PVC 4;  3P4R A;  2X5I D;  1YQ3 A;  1RMU 4;  2WP9 A;  3AE2 A;  1PO2 4;  1R09 4;  3GQK A;  1RUD 4;  1VBD 4;  1EV1 4;  4YSY A;  1K5M D;  2B76 A;  4YTP A;  1RUG 4;  2WDV A;  2WS3 A;  4YSZ A;  2RS1 4;  3JD7 4;  3SUC A;  4Q4W 4;  1POV 0;  1VBA 4;  4YT0 A;  3GQH A;  1VBE 4;  1RVF 4;  1MQT D;  2R04 4;  2RM2 4;  2WDQ A;  1AR9 4;  2H89 A;  1BEV 4;  1COV 4;  1RUE 4;  3AED A;  3VR9 A;  1AL2 4;  2R06 4;  1PIV 4;  2RMU 4;  1RUC 4;  1RUJ 4;  1HRV 4;  1XHX A;  3VR8 A;  1L0V A;  2HWB 4;  1H8T D;  1YQ4 A;  2R7F A;  1RHI 4;  2FBW A;  4Q4X 4;  1KF6 A;  3AE4 A; 
#chains in the Genus database with same CATH homology
 4GB3 4;  1NCQ D;  2RS5 4;  1POV 0;  3J8F 4;  4PDW D;  1VBA 4;  1PO1 4;  2PLV 4;  1HRI 4;  1AR8 4;  1VBE 4;  1RVF 4;  1MQT D;  1RUF 4;  2R04 4;  2RM2 4;  1R08 4;  1AR6 4;  4RHV 4;  1AR9 4;  2RS3 4;  1VRH 4;  1PVC 4;  2R07 4;  1BEV 4;  1COV 4;  1RUI 4;  1Z7S 4;  1HXS 4;  1RUE 4;  2X5I D;  1RMU 4;  1AL2 4;  2R06 4;  1PIV 4;  2HWC 4;  4Q4Y 4;  1PO2 4;  1R09 4;  3JBG 4;  1EAH 4;  1RUC 4;  1OOP D;  2RMU 4;  1NA1 D;  1RUH 4;  1ASJ 4;  1RUJ 4;  1RUD 4;  1VBD 4;  1EV1 4;  1HRV 4;  1K5M D;  1VBB 4;  2HWB 4;  1H8T D;  1RUG 4;  2RR1 4;  1RHI 4;  4Q4X 4;  1AR7 4;  2RS1 4;  4Q4V 4;  3JD7 4;  1D4M 4;  4Q4W 4;  1VBC 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...