2HWB4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwb400
1VBC4 2RM24 3JD74 4GB34 1RUI4 1VBD4 2R064 1RVF4 4RHV4 1RHI4 1K5MD 2R044 1EV14 1HRI4 1NCQD 2HWC4 1EAH4 1PO24 1VBE4 1VBB4 4Q4X4 2RMU4 1OOPD 3JBG4 1NA1D 1BEV4 1R084 1RMU4 2RS34 1MQTD 3J8F4 1AR64 2X5ID 1AR84 1RUC4 4Q4Y4 1RUE4 1HRV4 4PDWD 1R094 1Z7S4 2PLV4 2R074 1VRH4 1PIV4 1RUF4 1PVC4 1AR74 1RUH4 2RS14 2RS54 1COV4 1ASJ4 2HWB4 1PO14 1AL24 1AR94 1RUD4 1RUJ4 1POV0 4Q4W4 1D4M4 1RUG4 1H8TD 1VBA4 4Q4V4 2RR14 1HXS4
chains in the Genus database with same CATH superfamily
3JD74 2B76A 1XHZA 2H89A 3AE1A 4RHV4 3P4QA 3P4RA 2R044 2WP9A 1XI1A 3AE6A 1EAH4 4YTPA 3ABVA 3GQHA 1BEV4 4YSYA 4Q4Y4 3AE9A 3AEEA 2X5ID 3GQKA 1AR84 1RUC4 3CIRA 1RUE4 3P4PA 1Z7S4 2FBWA 2R074 1PVC4 1AR74 2RS54 4YTMA 1ASJ4 2PW9A 3SUCA 3AEGA 2H88A 4Q4W4 1RUG4 1H8TD 1VBC4 4GB34 2R064 2WQYA 1PO24 2PY5A 4Q4X4 2RMU4 3AE8A 3JBG4 2RS34 1MQTD 1AR64 1VRH4 1PIV4 1RUF4 2RS14 3AEBA 3AE2A 2PZSA 1COV4 2WU2A 3VRAA 1L0VA 5C3JA 3SFDA 1RUJ4 2RR14 2WDVA 1HXS4 3AEFA 3AE4A 1RUI4 1VBD4 3VR8A 1RVF4 3AE7A 2PYLA 1YQ3A 1K5MD 2WU5A 1ZP0A 1EV14 4YT0A 2HWC4 1VBE4 1VBB4 1YQ4A 2R7FA 3AECA 1HRV4 4PDWD 1NEKA 1KF6A 4YSXA 5C2TA 1RUH4 2WS3A 2PYJA 1XHXA 3AE5A 4YTNA 1PO14 1ZOYA 1POV0 4KX6A 2WDQA 3AEDA 1RHI4 1VBA4 4Q4V4 4YXDA 3VR9A 3FI7A 3AE3A 2EX3A 1NCQD 1HRI4 1OOPD 1NA1D 1R084 3J8F4 1RMU4 4YSZA 1NENA 2ACZA 1R094 2PLV4 3P4SA 3VRBA 2WDRA 2HWB4 3SFEA 1AL24 1AR94 1RUD4 1KFYA 1D4M4 3AEAA 2RM24
chains in the Genus database with same CATH topology
1VBC4 2RM24 3JD74 4GB34 1RUI4 1VBD4 2R064 1RVF4 4RHV4 1RHI4 1K5MD 2R044 1EV14 1HRI4 1NCQD 2HWC4 1EAH4 1PO24 1VBE4 1VBB4 4Q4X4 2RMU4 1OOPD 3JBG4 1NA1D 1BEV4 1R084 1RMU4 2RS34 1MQTD 3J8F4 1AR64 2X5ID 1AR84 1RUC4 4Q4Y4 1RUE4 1HRV4 4PDWD 1R094 1Z7S4 2PLV4 2R074 1VRH4 1PIV4 1RUF4 1PVC4 1AR74 1RUH4 2RS14 2RS54 1COV4 1ASJ4 2HWB4 1PO14 1AL24 1AR94 1RUD4 1RUJ4 1POV0 4Q4W4 1D4M4 1RUG4 1H8TD 1VBA4 4Q4V4 2RR14 1HXS4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VBC 4;  2RM2 4;  3JD7 4;  4GB3 4;  1RUI 4;  1VBD 4;  2R06 4;  1RVF 4;  4RHV 4;  1RHI 4;  1K5M D;  2R04 4;  1EV1 4;  1HRI 4;  1NCQ D;  2HWC 4;  1EAH 4;  1PO2 4;  1VBE 4;  1VBB 4;  4Q4X 4;  2RMU 4;  1OOP D;  3JBG 4;  1NA1 D;  1BEV 4;  1R08 4;  1RMU 4;  2RS3 4;  1MQT D;  3J8F 4;  1AR6 4;  2X5I D;  1AR8 4;  1RUC 4;  4Q4Y 4;  1RUE 4;  1HRV 4;  4PDW D;  1R09 4;  1Z7S 4;  2PLV 4;  2R07 4;  1VRH 4;  1PIV 4;  1RUF 4;  1PVC 4;  1AR7 4;  1RUH 4;  2RS1 4;  2RS5 4;  1COV 4;  1ASJ 4;  2HWB 4;  1PO1 4;  1AL2 4;  1AR9 4;  1RUD 4;  1RUJ 4;  1POV 0;  4Q4W 4;  1D4M 4;  1RUG 4;  1H8T D;  1VBA 4;  4Q4V 4;  2RR1 4;  1HXS 4; 
#chains in the Genus database with same CATH topology
 3JD7 4;  2B76 A;  1XHZ A;  2H89 A;  3AE1 A;  4RHV 4;  3P4Q A;  3P4R A;  2R04 4;  2WP9 A;  1XI1 A;  3AE6 A;  1EAH 4;  4YTP A;  3ABV A;  3GQH A;  1BEV 4;  4YSY A;  4Q4Y 4;  3AE9 A;  3AEE A;  2X5I D;  3GQK A;  1AR8 4;  1RUC 4;  3CIR A;  1RUE 4;  3P4P A;  1Z7S 4;  2FBW A;  2R07 4;  1PVC 4;  1AR7 4;  2RS5 4;  4YTM A;  1ASJ 4;  2PW9 A;  3SUC A;  3AEG A;  2H88 A;  4Q4W 4;  1RUG 4;  1H8T D;  1VBC 4;  4GB3 4;  2R06 4;  2WQY A;  1PO2 4;  2PY5 A;  4Q4X 4;  2RMU 4;  3AE8 A;  3JBG 4;  2RS3 4;  1MQT D;  1AR6 4;  1VRH 4;  1PIV 4;  1RUF 4;  2RS1 4;  3AEB A;  3AE2 A;  2PZS A;  1COV 4;  2WU2 A;  3VRA A;  1L0V A;  5C3J A;  3SFD A;  1RUJ 4;  2RR1 4;  2WDV A;  1HXS 4;  3AEF A;  3AE4 A;  1RUI 4;  1VBD 4;  3VR8 A;  1RVF 4;  3AE7 A;  2PYL A;  1YQ3 A;  1K5M D;  2WU5 A;  1ZP0 A;  1EV1 4;  4YT0 A;  2HWC 4;  1VBE 4;  1VBB 4;  1YQ4 A;  2R7F A;  3AEC A;  1HRV 4;  4PDW D;  1NEK A;  1KF6 A;  4YSX A;  5C2T A;  1RUH 4;  2WS3 A;  2PYJ A;  1XHX A;  3AE5 A;  4YTN A;  1PO1 4;  1ZOY A;  1POV 0;  4KX6 A;  2WDQ A;  3AED A;  1RHI 4;  1VBA 4;  4Q4V 4;  4YXD A;  3VR9 A;  3FI7 A;  3AE3 A;  2EX3 A;  1NCQ D;  1HRI 4;  1OOP D;  1NA1 D;  1R08 4;  3J8F 4;  1RMU 4;  4YSZ A;  1NEN A;  2ACZ A;  1R09 4;  2PLV 4;  3P4S A;  3VRB A;  2WDR A;  2HWB 4;  3SFE A;  1AL2 4;  1AR9 4;  1RUD 4;  1KFY A;  1D4M 4;  3AEA A;  2RM2 4; 
#chains in the Genus database with same CATH homology
 1VBC 4;  2RM2 4;  3JD7 4;  4GB3 4;  1RUI 4;  1VBD 4;  2R06 4;  1RVF 4;  4RHV 4;  1RHI 4;  1K5M D;  2R04 4;  1EV1 4;  1HRI 4;  1NCQ D;  2HWC 4;  1EAH 4;  1PO2 4;  1VBE 4;  1VBB 4;  4Q4X 4;  2RMU 4;  1OOP D;  3JBG 4;  1NA1 D;  1BEV 4;  1R08 4;  1RMU 4;  2RS3 4;  1MQT D;  3J8F 4;  1AR6 4;  2X5I D;  1AR8 4;  1RUC 4;  4Q4Y 4;  1RUE 4;  1HRV 4;  4PDW D;  1R09 4;  1Z7S 4;  2PLV 4;  2R07 4;  1VRH 4;  1PIV 4;  1RUF 4;  1PVC 4;  1AR7 4;  1RUH 4;  2RS1 4;  2RS5 4;  1COV 4;  1ASJ 4;  2HWB 4;  1PO1 4;  1AL2 4;  1AR9 4;  1RUD 4;  1RUJ 4;  1POV 0;  4Q4W 4;  1D4M 4;  1RUG 4;  1H8T D;  1VBA 4;  4Q4V 4;  2RR1 4;  1HXS 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...