2HWB4

A comparison of the anti-rhinoviral drug binding pocket in hrv14 and hrv1a
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title A comparison of the anti-rhinoviral drug binding pocket in HRV14 and HRV1A.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2hwb400
1R094 2RS14 1EV14 1RUC4 4GB34 2RS54 1D4M4 1PVC4 2PLV4 2HWC4 1AR94 1H8TD 1RVF4 1HRV4 3J8F4 2R064 4Q4Y4 1HXS4 1RUI4 2RMU4 1R084 1COV4 1VBA4 1VBE4 1BEV4 4Q4X4 1VBD4 2X5ID 1AR84 2RR14 1PIV4 2RM24 1OOPD 1HRI4 1AL24 1POV0 2HWB4 1RUG4 1Z7S4 1AR64 1ASJ4 4RHV4 1K5MD 1RUE4 1RUD4 1VBB4 2R074 1VBC4 1RHI4 3JD74 1RMU4 1VRH4 2RS34 1RUH4 3JBG4 1MQTD 1NA1D 1PO24 4PDWD 1AR74 4Q4W4 1RUJ4 1RUF4 1EAH4 1PO14 4Q4V4 2R044 1NCQD
chains in the Genus database with same CATH superfamily
3VR9A 4YSYA 1RUC4 3SFEA 2RS54 2B76A 3AE5A 1RVF4 4YTMA 3SUCA 2RMU4 3AE4A 2PYLA 1VBA4 1VBE4 3AEDA 2X5ID 3GQHA 3AE6A 1YQ4A 3AE1A 1XHZA 1XHXA 3AEAA 3P4SA 2EX3A 1RMU4 3AE9A 2WP9A 3JBG4 3SFDA 1PO14 2R044 3AE7A 4YXDA 2PLV4 1AR94 4KX6A 1H8TD 2R064 1HXS4 1RUI4 4Q4X4 3GQKA 1AR84 2R7FA 2RR14 1POV0 3VR8A 1ASJ4 3P4RA 3VRAA 1VBB4 2R074 4YT0A 1VRH4 2RS34 3AEBA 1RUH4 2WU5A 1EAH4 4GB34 3AEEA 4Q4V4 1AL24 1NEKA 2H89A 2WS3A 1PVC4 2HWC4 3AECA 1HRV4 1ZOYA 2PW9A 4Q4Y4 2WQYA 1VBD4 1XI1A 4YTPA 2H88A 3AE3A 3AEFA 4YSXA 2HWB4 1L0VA 2PY5A 4RHV4 1K5MD 2PZSA 5C2TA 3VRBA 1PO24 1AR74 1RUF4 2WDVA 1NCQD 4YTNA 1KFYA 3P4PA 1R094 2RS14 1EV14 2PYJA 1D4M4 3FI7A 3P4QA 1KF6A 2ACZA 2WDQA 1ZP0A 3J8F4 3AEGA 1YQ3A 1R084 1COV4 1BEV4 3AE2A 1PIV4 2RM24 2WU2A 1OOPD 1HRI4 5C3JA 1RUG4 1Z7S4 1AR64 1RUE4 1RUD4 2WDRA 1VBC4 1RHI4 2FBWA 3JD74 3ABVA 3CIRA 1MQTD 1NA1D 4PDWD 4Q4W4 1RUJ4 3AE8A 4YSZA 1NENA
chains in the Genus database with same CATH topology
1R094 2RS14 1EV14 1RUC4 4GB34 2RS54 1D4M4 1PVC4 2PLV4 2HWC4 1AR94 1H8TD 1RVF4 1HRV4 3J8F4 2R064 4Q4Y4 1HXS4 1RUI4 2RMU4 1R084 1COV4 1VBA4 1VBE4 1BEV4 4Q4X4 1VBD4 2X5ID 1AR84 2RR14 1PIV4 2RM24 1OOPD 1HRI4 1AL24 1POV0 2HWB4 1RUG4 1Z7S4 1AR64 1ASJ4 4RHV4 1K5MD 1RUE4 1RUD4 1VBB4 2R074 1VBC4 1RHI4 3JD74 1RMU4 1VRH4 2RS34 1RUH4 3JBG4 1MQTD 1NA1D 1PO24 4PDWD 1AR74 4Q4W4 1RUJ4 1RUF4 1EAH4 1PO14 4Q4V4 2R044 1NCQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R09 4;  2RS1 4;  1EV1 4;  1RUC 4;  4GB3 4;  2RS5 4;  1D4M 4;  1PVC 4;  2PLV 4;  2HWC 4;  1AR9 4;  1H8T D;  1RVF 4;  1HRV 4;  3J8F 4;  2R06 4;  4Q4Y 4;  1HXS 4;  1RUI 4;  2RMU 4;  1R08 4;  1COV 4;  1VBA 4;  1VBE 4;  1BEV 4;  4Q4X 4;  1VBD 4;  2X5I D;  1AR8 4;  2RR1 4;  1PIV 4;  2RM2 4;  1OOP D;  1HRI 4;  1AL2 4;  1POV 0;  2HWB 4;  1RUG 4;  1Z7S 4;  1AR6 4;  1ASJ 4;  4RHV 4;  1K5M D;  1RUE 4;  1RUD 4;  1VBB 4;  2R07 4;  1VBC 4;  1RHI 4;  3JD7 4;  1RMU 4;  1VRH 4;  2RS3 4;  1RUH 4;  3JBG 4;  1MQT D;  1NA1 D;  1PO2 4;  4PDW D;  1AR7 4;  4Q4W 4;  1RUJ 4;  1RUF 4;  1EAH 4;  1PO1 4;  4Q4V 4;  2R04 4;  1NCQ D; 
#chains in the Genus database with same CATH topology
 3VR9 A;  4YSY A;  1RUC 4;  3SFE A;  2RS5 4;  2B76 A;  3AE5 A;  1RVF 4;  4YTM A;  3SUC A;  2RMU 4;  3AE4 A;  2PYL A;  1VBA 4;  1VBE 4;  3AED A;  2X5I D;  3GQH A;  3AE6 A;  1YQ4 A;  3AE1 A;  1XHZ A;  1XHX A;  3AEA A;  3P4S A;  2EX3 A;  1RMU 4;  3AE9 A;  2WP9 A;  3JBG 4;  3SFD A;  1PO1 4;  2R04 4;  3AE7 A;  4YXD A;  2PLV 4;  1AR9 4;  4KX6 A;  1H8T D;  2R06 4;  1HXS 4;  1RUI 4;  4Q4X 4;  3GQK A;  1AR8 4;  2R7F A;  2RR1 4;  1POV 0;  3VR8 A;  1ASJ 4;  3P4R A;  3VRA A;  1VBB 4;  2R07 4;  4YT0 A;  1VRH 4;  2RS3 4;  3AEB A;  1RUH 4;  2WU5 A;  1EAH 4;  4GB3 4;  3AEE A;  4Q4V 4;  1AL2 4;  1NEK A;  2H89 A;  2WS3 A;  1PVC 4;  2HWC 4;  3AEC A;  1HRV 4;  1ZOY A;  2PW9 A;  4Q4Y 4;  2WQY A;  1VBD 4;  1XI1 A;  4YTP A;  2H88 A;  3AE3 A;  3AEF A;  4YSX A;  2HWB 4;  1L0V A;  2PY5 A;  4RHV 4;  1K5M D;  2PZS A;  5C2T A;  3VRB A;  1PO2 4;  1AR7 4;  1RUF 4;  2WDV A;  1NCQ D;  4YTN A;  1KFY A;  3P4P A;  1R09 4;  2RS1 4;  1EV1 4;  2PYJ A;  1D4M 4;  3FI7 A;  3P4Q A;  1KF6 A;  2ACZ A;  2WDQ A;  1ZP0 A;  3J8F 4;  3AEG A;  1YQ3 A;  1R08 4;  1COV 4;  1BEV 4;  3AE2 A;  1PIV 4;  2RM2 4;  2WU2 A;  1OOP D;  1HRI 4;  5C3J A;  1RUG 4;  1Z7S 4;  1AR6 4;  1RUE 4;  1RUD 4;  2WDR A;  1VBC 4;  1RHI 4;  2FBW A;  3JD7 4;  3ABV A;  3CIR A;  1MQT D;  1NA1 D;  4PDW D;  4Q4W 4;  1RUJ 4;  3AE8 A;  4YSZ A;  1NEN A; 
#chains in the Genus database with same CATH homology
 1R09 4;  2RS1 4;  1EV1 4;  1RUC 4;  4GB3 4;  2RS5 4;  1D4M 4;  1PVC 4;  2PLV 4;  2HWC 4;  1AR9 4;  1H8T D;  1RVF 4;  1HRV 4;  3J8F 4;  2R06 4;  4Q4Y 4;  1HXS 4;  1RUI 4;  2RMU 4;  1R08 4;  1COV 4;  1VBA 4;  1VBE 4;  1BEV 4;  4Q4X 4;  1VBD 4;  2X5I D;  1AR8 4;  2RR1 4;  1PIV 4;  2RM2 4;  1OOP D;  1HRI 4;  1AL2 4;  1POV 0;  2HWB 4;  1RUG 4;  1Z7S 4;  1AR6 4;  1ASJ 4;  4RHV 4;  1K5M D;  1RUE 4;  1RUD 4;  1VBB 4;  2R07 4;  1VBC 4;  1RHI 4;  3JD7 4;  1RMU 4;  1VRH 4;  2RS3 4;  1RUH 4;  3JBG 4;  1MQT D;  1NA1 D;  1PO2 4;  4PDW D;  1AR7 4;  4Q4W 4;  1RUJ 4;  1RUF 4;  1EAH 4;  1PO1 4;  4Q4V 4;  2R04 4;  1NCQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...