3J8F4

Cryo-em reconstruction of poliovirus-receptor complex
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
68
structure length
68
Chain Sequence
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/signaling protein
molecule keywords Capsid protein VP1
publication title Nectin-Like Interactions between Poliovirus and Its Receptor Trigger Conformational Changes Associated with Cell Entry.
pubmed doi rcsb
source organism Homo sapiens
total genus 1
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 3j8f400
1AL24 1RUJ4 1MQTD 1AR94 1H8TD 1RUD4 1PO14 1RUE4 2R074 1VBE4 4RHV4 4PDWD 1ASJ4 2RM24 2RMU4 1PO24 1PIV4 1AR84 1RUC4 1RUF4 2X5ID 1RVF4 2PLV4 1AR64 1R084 2R044 3JBG4 1EV14 1R094 1RUG4 1VBA4 1COV4 1D4M4 2HWC4 1OOPD 1VBD4 2RS34 4Q4X4 1POV0 1RMU4 2R064 1VBC4 1AR74 1HRI4 2RR14 2RS54 1BEV4 4Q4Y4 1Z7S4 1NCQD 4Q4V4 1RHI4 4Q4W4 1VBB4 3JD74 1EAH4 1K5MD 1RUI4 1NA1D 1PVC4 1HXS4 1HRV4 1VRH4 1RUH4 3J8F4 4GB34 2HWB4 2RS14
chains in the Genus database with same CATH superfamily
3ABVA 1H8TD 1NEKA 4YSYA 1VBE4 4RHV4 4YXDA 5C3JA 3AE1A 3VR9A 1RVF4 2PLV4 1R084 1D4M4 3AE6A 1RMU4 4Q4Y4 3AE8A 1Z7S4 2EX3A 4YTNA 1YQ3A 3GQKA 3AEBA 2WDVA 1XHZA 3VR8A 4GB34 4Q4V4 3SFEA 1ZP0A 2WDRA 4YSZA 1RUD4 2R074 3AE7A 4YTMA 1ASJ4 1KFYA 1PO24 1PIV4 1AR84 1RUC4 1RUF4 2WDQA 1XI1A 1AR64 2R044 3CIRA 1R094 2HWC4 2B76A 2RS54 2RR14 3AEFA 5C2TA 1HRI4 3AECA 1RHI4 1KF6A 1EAH4 1K5MD 2WS3A 1PVC4 3P4PA 1VRH4 4Q4X4 3J8F4 1AL24 1RUJ4 3AEEA 1MQTD 1AR94 1ZOYA 1L0VA 1PO14 3P4QA 4YTPA 4PDWD 2RM24 4YT0A 3AE2A 2X5ID 3FI7A 3JBG4 2PW9A 2WP9A 1RUG4 1VBA4 1COV4 4KX6A 1VBD4 2RS34 1VBC4 1AR74 3P4SA 1BEV4 1NENA 3SFDA 2PYJA 3GQHA 4Q4W4 3AE9A 1RUI4 3AE5A 2ACZA 2PY5A 1HXS4 1HRV4 2R7FA 1RUH4 2H88A 2HWB4 2RS14 3AE4A 3VRAA 1RUE4 1XHXA 2RMU4 2WU2A 2WQYA 3AEAA 2H89A 1EV14 2WU5A 1OOPD 2PZSA 2FBWA 1POV0 2R064 3AE3A 3VRBA 2PYLA 3SUCA 1YQ4A 3AEDA 1NCQD 3AEGA 4YSXA 1VBB4 3JD74 1NA1D 3P4RA
chains in the Genus database with same CATH topology
1AL24 1RUJ4 1MQTD 1AR94 1H8TD 1RUD4 1PO14 1RUE4 2R074 1VBE4 4RHV4 4PDWD 1ASJ4 2RM24 2RMU4 1PO24 1PIV4 1AR84 1RUC4 1RUF4 2X5ID 1RVF4 2PLV4 1AR64 1R084 2R044 3JBG4 1EV14 1R094 1RUG4 1VBA4 1COV4 1D4M4 2HWC4 1OOPD 1VBD4 2RS34 4Q4X4 1POV0 1RMU4 2R064 1VBC4 1AR74 1HRI4 2RR14 2RS54 1BEV4 4Q4Y4 1Z7S4 1NCQD 4Q4V4 1RHI4 4Q4W4 1VBB4 3JD74 1EAH4 1K5MD 1RUI4 1NA1D 1PVC4 1HXS4 1HRV4 1VRH4 1RUH4 3J8F4 4GB34 2HWB4 2RS14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AL2 4;  1RUJ 4;  1MQT D;  1AR9 4;  1H8T D;  1RUD 4;  1PO1 4;  1RUE 4;  2R07 4;  1VBE 4;  4RHV 4;  4PDW D;  1ASJ 4;  2RM2 4;  2RMU 4;  1PO2 4;  1PIV 4;  1AR8 4;  1RUC 4;  1RUF 4;  2X5I D;  1RVF 4;  2PLV 4;  1AR6 4;  1R08 4;  2R04 4;  3JBG 4;  1EV1 4;  1R09 4;  1RUG 4;  1VBA 4;  1COV 4;  1D4M 4;  2HWC 4;  1OOP D;  1VBD 4;  2RS3 4;  4Q4X 4;  1POV 0;  1RMU 4;  2R06 4;  1VBC 4;  1AR7 4;  1HRI 4;  2RR1 4;  2RS5 4;  1BEV 4;  4Q4Y 4;  1Z7S 4;  1NCQ D;  4Q4V 4;  1RHI 4;  4Q4W 4;  1VBB 4;  3JD7 4;  1EAH 4;  1K5M D;  1RUI 4;  1NA1 D;  1PVC 4;  1HXS 4;  1HRV 4;  1VRH 4;  1RUH 4;  3J8F 4;  4GB3 4;  2HWB 4;  2RS1 4; 
#chains in the Genus database with same CATH topology
 3ABV A;  1H8T D;  1NEK A;  4YSY A;  1VBE 4;  4RHV 4;  4YXD A;  5C3J A;  3AE1 A;  3VR9 A;  1RVF 4;  2PLV 4;  1R08 4;  1D4M 4;  3AE6 A;  1RMU 4;  4Q4Y 4;  3AE8 A;  1Z7S 4;  2EX3 A;  4YTN A;  1YQ3 A;  3GQK A;  3AEB A;  2WDV A;  1XHZ A;  3VR8 A;  4GB3 4;  4Q4V 4;  3SFE A;  1ZP0 A;  2WDR A;  4YSZ A;  1RUD 4;  2R07 4;  3AE7 A;  4YTM A;  1ASJ 4;  1KFY A;  1PO2 4;  1PIV 4;  1AR8 4;  1RUC 4;  1RUF 4;  2WDQ A;  1XI1 A;  1AR6 4;  2R04 4;  3CIR A;  1R09 4;  2HWC 4;  2B76 A;  2RS5 4;  2RR1 4;  3AEF A;  5C2T A;  1HRI 4;  3AEC A;  1RHI 4;  1KF6 A;  1EAH 4;  1K5M D;  2WS3 A;  1PVC 4;  3P4P A;  1VRH 4;  4Q4X 4;  3J8F 4;  1AL2 4;  1RUJ 4;  3AEE A;  1MQT D;  1AR9 4;  1ZOY A;  1L0V A;  1PO1 4;  3P4Q A;  4YTP A;  4PDW D;  2RM2 4;  4YT0 A;  3AE2 A;  2X5I D;  3FI7 A;  3JBG 4;  2PW9 A;  2WP9 A;  1RUG 4;  1VBA 4;  1COV 4;  4KX6 A;  1VBD 4;  2RS3 4;  1VBC 4;  1AR7 4;  3P4S A;  1BEV 4;  1NEN A;  3SFD A;  2PYJ A;  3GQH A;  4Q4W 4;  3AE9 A;  1RUI 4;  3AE5 A;  2ACZ A;  2PY5 A;  1HXS 4;  1HRV 4;  2R7F A;  1RUH 4;  2H88 A;  2HWB 4;  2RS1 4;  3AE4 A;  3VRA A;  1RUE 4;  1XHX A;  2RMU 4;  2WU2 A;  2WQY A;  3AEA A;  2H89 A;  1EV1 4;  2WU5 A;  1OOP D;  2PZS A;  2FBW A;  1POV 0;  2R06 4;  3AE3 A;  3VRB A;  2PYL A;  3SUC A;  1YQ4 A;  3AED A;  1NCQ D;  3AEG A;  4YSX A;  1VBB 4;  3JD7 4;  1NA1 D;  3P4R A; 
#chains in the Genus database with same CATH homology
 1AL2 4;  1RUJ 4;  1MQT D;  1AR9 4;  1H8T D;  1RUD 4;  1PO1 4;  1RUE 4;  2R07 4;  1VBE 4;  4RHV 4;  4PDW D;  1ASJ 4;  2RM2 4;  2RMU 4;  1PO2 4;  1PIV 4;  1AR8 4;  1RUC 4;  1RUF 4;  2X5I D;  1RVF 4;  2PLV 4;  1AR6 4;  1R08 4;  2R04 4;  3JBG 4;  1EV1 4;  1R09 4;  1RUG 4;  1VBA 4;  1COV 4;  1D4M 4;  2HWC 4;  1OOP D;  1VBD 4;  2RS3 4;  4Q4X 4;  1POV 0;  1RMU 4;  2R06 4;  1VBC 4;  1AR7 4;  1HRI 4;  2RR1 4;  2RS5 4;  1BEV 4;  4Q4Y 4;  1Z7S 4;  1NCQ D;  4Q4V 4;  1RHI 4;  4Q4W 4;  1VBB 4;  3JD7 4;  1EAH 4;  1K5M D;  1RUI 4;  1NA1 D;  1PVC 4;  1HXS 4;  1HRV 4;  1VRH 4;  1RUH 4;  3J8F 4;  4GB3 4;  2HWB 4;  2RS1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...