1RUH4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruh400
2X5ID 1HRI4 1RVF4 2R064 1RUJ4 4RHV4 1RUG4 1AR84 1EAH4 1NCQD 2RR14 2RS34 3JBG4 1Z7S4 1VBD4 1NA1D 2HWC4 4Q4Y4 1VBE4 4Q4V4 4Q4X4 4PDWD 1H8TD 1PO24 1RUE4 1PO14 2R044 1D4M4 1PIV4 1HXS4 1VBC4 1POV0 3JD74 2RS54 1COV4 1MQTD 2R074 2RS14 4GB34 1AR94 1ASJ4 1AR64 1AL24 1BEV4 1K5MD 1R084 1EV14 1RUD4 1RUC4 1RUH4 1VRH4 2PLV4 1HRV4 1RMU4 1RUF4 1PVC4 2HWB4 1VBA4 3J8F4 1OOPD 1RUI4 1AR74 1R094 2RMU4 4Q4W4 1RHI4 1VBB4 2RM24
chains in the Genus database with same CATH superfamily
4RHV4 3AE4A 3AEAA 3JBG4 2WP9A 4YSXA 2WU2A 1ZP0A 1NENA 1XI1A 2R044 1D4M4 3VRAA 3AE2A 1COV4 1MQTD 1ASJ4 2H89A 3AE7A 3AE6A 1AR64 3AECA 2WDQA 1RUD4 1RMU4 3AEFA 4YT0A 3J8F4 1VBA4 2B76A 4YSYA 1VBB4 2RM24 2X5ID 4YXDA 1RVF4 1XHXA 1AR84 1EAH4 1NCQD 2PYJA 3SFEA 1NA1D 4Q4X4 4PDWD 4YTNA 1PO24 3AE3A 2H88A 1PIV4 1HXS4 1VBC4 1POV0 3JD74 2RS14 3AE1A 2WU5A 1YQ3A 4Q4V4 3AEDA 2PLV4 3FI7A 3P4QA 1PVC4 2HWB4 2ACZA 3VR9A 2RMU4 2WS3A 2PY5A 1HRI4 3P4PA 2PYLA 1KFYA 2RS34 1Z7S4 1VBD4 2FBWA 2PW9A 1VBE4 3ABVA 1NEKA 1H8TD 1PO14 1XHZA 1YQ4A 5C2TA 4YTPA 4GB34 2WDVA 3VR8A 1K5MD 1BEV4 1EV14 1VRH4 1RUC4 1HRV4 3P4RA 1RUF4 1OOPD 2EX3A 3AE5A 1R094 4YTMA 3VRBA 4Q4W4 4KX6A 2R064 3AEGA 2WQYA 1RUJ4 3AE9A 1RUG4 2RR14 1L0VA 3AEEA 4Q4Y4 2HWC4 4YSZA 3AE8A 1RUE4 2RS54 1KF6A 3GQKA 2R074 1AR94 3SFDA 1AL24 1R084 1RUH4 1ZOYA 3AEBA 2WDRA 3CIRA 3GQHA 3P4SA 5C3JA 1RUI4 1AR74 2PZSA 3SUCA 1RHI4 2R7FA
chains in the Genus database with same CATH topology
2X5ID 1HRI4 1RVF4 2R064 1RUJ4 4RHV4 1RUG4 1AR84 1EAH4 1NCQD 2RR14 2RS34 3JBG4 1Z7S4 1VBD4 1NA1D 2HWC4 4Q4Y4 1VBE4 4Q4V4 4Q4X4 4PDWD 1H8TD 1PO24 1RUE4 1PO14 2R044 1D4M4 1PIV4 1HXS4 1VBC4 1POV0 3JD74 2RS54 1COV4 1MQTD 2R074 2RS14 4GB34 1AR94 1ASJ4 1AR64 1AL24 1BEV4 1K5MD 1R084 1EV14 1RUD4 1RUC4 1RUH4 1VRH4 2PLV4 1HRV4 1RMU4 1RUF4 1PVC4 2HWB4 1VBA4 3J8F4 1OOPD 1RUI4 1AR74 1R094 2RMU4 4Q4W4 1RHI4 1VBB4 2RM24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5I D;  1HRI 4;  1RVF 4;  2R06 4;  1RUJ 4;  4RHV 4;  1RUG 4;  1AR8 4;  1EAH 4;  1NCQ D;  2RR1 4;  2RS3 4;  3JBG 4;  1Z7S 4;  1VBD 4;  1NA1 D;  2HWC 4;  4Q4Y 4;  1VBE 4;  4Q4V 4;  4Q4X 4;  4PDW D;  1H8T D;  1PO2 4;  1RUE 4;  1PO1 4;  2R04 4;  1D4M 4;  1PIV 4;  1HXS 4;  1VBC 4;  1POV 0;  3JD7 4;  2RS5 4;  1COV 4;  1MQT D;  2R07 4;  2RS1 4;  4GB3 4;  1AR9 4;  1ASJ 4;  1AR6 4;  1AL2 4;  1BEV 4;  1K5M D;  1R08 4;  1EV1 4;  1RUD 4;  1RUC 4;  1RUH 4;  1VRH 4;  2PLV 4;  1HRV 4;  1RMU 4;  1RUF 4;  1PVC 4;  2HWB 4;  1VBA 4;  3J8F 4;  1OOP D;  1RUI 4;  1AR7 4;  1R09 4;  2RMU 4;  4Q4W 4;  1RHI 4;  1VBB 4;  2RM2 4; 
#chains in the Genus database with same CATH topology
 4RHV 4;  3AE4 A;  3AEA A;  3JBG 4;  2WP9 A;  4YSX A;  2WU2 A;  1ZP0 A;  1NEN A;  1XI1 A;  2R04 4;  1D4M 4;  3VRA A;  3AE2 A;  1COV 4;  1MQT D;  1ASJ 4;  2H89 A;  3AE7 A;  3AE6 A;  1AR6 4;  3AEC A;  2WDQ A;  1RUD 4;  1RMU 4;  3AEF A;  4YT0 A;  3J8F 4;  1VBA 4;  2B76 A;  4YSY A;  1VBB 4;  2RM2 4;  2X5I D;  4YXD A;  1RVF 4;  1XHX A;  1AR8 4;  1EAH 4;  1NCQ D;  2PYJ A;  3SFE A;  1NA1 D;  4Q4X 4;  4PDW D;  4YTN A;  1PO2 4;  3AE3 A;  2H88 A;  1PIV 4;  1HXS 4;  1VBC 4;  1POV 0;  3JD7 4;  2RS1 4;  3AE1 A;  2WU5 A;  1YQ3 A;  4Q4V 4;  3AED A;  2PLV 4;  3FI7 A;  3P4Q A;  1PVC 4;  2HWB 4;  2ACZ A;  3VR9 A;  2RMU 4;  2WS3 A;  2PY5 A;  1HRI 4;  3P4P A;  2PYL A;  1KFY A;  2RS3 4;  1Z7S 4;  1VBD 4;  2FBW A;  2PW9 A;  1VBE 4;  3ABV A;  1NEK A;  1H8T D;  1PO1 4;  1XHZ A;  1YQ4 A;  5C2T A;  4YTP A;  4GB3 4;  2WDV A;  3VR8 A;  1K5M D;  1BEV 4;  1EV1 4;  1VRH 4;  1RUC 4;  1HRV 4;  3P4R A;  1RUF 4;  1OOP D;  2EX3 A;  3AE5 A;  1R09 4;  4YTM A;  3VRB A;  4Q4W 4;  4KX6 A;  2R06 4;  3AEG A;  2WQY A;  1RUJ 4;  3AE9 A;  1RUG 4;  2RR1 4;  1L0V A;  3AEE A;  4Q4Y 4;  2HWC 4;  4YSZ A;  3AE8 A;  1RUE 4;  2RS5 4;  1KF6 A;  3GQK A;  2R07 4;  1AR9 4;  3SFD A;  1AL2 4;  1R08 4;  1RUH 4;  1ZOY A;  3AEB A;  2WDR A;  3CIR A;  3GQH A;  3P4S A;  5C3J A;  1RUI 4;  1AR7 4;  2PZS A;  3SUC A;  1RHI 4;  2R7F A; 
#chains in the Genus database with same CATH homology
 2X5I D;  1HRI 4;  1RVF 4;  2R06 4;  1RUJ 4;  4RHV 4;  1RUG 4;  1AR8 4;  1EAH 4;  1NCQ D;  2RR1 4;  2RS3 4;  3JBG 4;  1Z7S 4;  1VBD 4;  1NA1 D;  2HWC 4;  4Q4Y 4;  1VBE 4;  4Q4V 4;  4Q4X 4;  4PDW D;  1H8T D;  1PO2 4;  1RUE 4;  1PO1 4;  2R04 4;  1D4M 4;  1PIV 4;  1HXS 4;  1VBC 4;  1POV 0;  3JD7 4;  2RS5 4;  1COV 4;  1MQT D;  2R07 4;  2RS1 4;  4GB3 4;  1AR9 4;  1ASJ 4;  1AR6 4;  1AL2 4;  1BEV 4;  1K5M D;  1R08 4;  1EV1 4;  1RUD 4;  1RUC 4;  1RUH 4;  1VRH 4;  2PLV 4;  1HRV 4;  1RMU 4;  1RUF 4;  1PVC 4;  2HWB 4;  1VBA 4;  3J8F 4;  1OOP D;  1RUI 4;  1AR7 4;  1R09 4;  2RMU 4;  4Q4W 4;  1RHI 4;  1VBB 4;  2RM2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...