1RUH4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruh400
1RHI4 3JD74 1MQTD 1VBE4 1NCQD 1AR74 1R084 4Q4Y4 1HXS4 2R074 2RS14 1RUJ4 2RM24 1VBC4 1NA1D 1Z7S4 1PIV4 2RS34 4PDWD 1AR94 1AR64 1VBA4 1RUI4 1HRI4 1R094 1RMU4 4Q4V4 1D4M4 1RUD4 1H8TD 1PVC4 2RS54 3JBG4 1POV0 2R064 4GB34 1RUF4 1RUE4 1VBB4 1COV4 2PLV4 1ASJ4 1OOPD 1RVF4 2R044 1RUH4 1RUC4 1EV14 1PO24 1AR84 3J8F4 4RHV4 1AL24 1K5MD 2HWB4 2X5ID 4Q4X4 1VBD4 1EAH4 1VRH4 2RMU4 2HWC4 4Q4W4 1HRV4 1BEV4 2RR14 1PO14 1RUG4
chains in the Genus database with same CATH superfamily
1RHI4 3JD74 1MQTD 2B76A 3AEFA 2WU2A 5C3JA 2PW9A 3P4PA 4YSZA 1PIV4 4YSYA 1HRI4 1RMU4 1D4M4 3JBG4 1PVC4 3VRBA 2WDVA 1POV0 1ZOYA 2R064 4YSXA 1RUF4 1COV4 1ASJ4 5C2TA 1RVF4 1EV14 3J8F4 2PY5A 1AL24 3AE3A 3AEEA 3VR9A 4Q4X4 2WP9A 2PYJA 1YQ3A 4YT0A 1PO14 1NEKA 1RUG4 3AEAA 2H88A 3AE4A 3P4RA 3P4QA 1L0VA 1RUJ4 2WU5A 2RS34 2ACZA 4YTPA 4KX6A 1AR64 2EX3A 2WS3A 1R094 3AEDA 4Q4V4 4YTMA 2R7FA 3CIRA 3AE1A 3P4SA 1RUE4 1RUC4 1PO24 1AR84 4YXDA 2HWB4 3AE5A 3AEBA 3AE6A 3VR8A 2RR14 3GQHA 3SFEA 1AR74 1R084 4Q4Y4 3VRAA 2R074 2RS14 3SUCA 2RM24 1NA1D 3ABVA 4PDWD 1H8TD 1VBB4 2PLV4 1OOPD 2R044 1RUH4 3AE2A 1K5MD 2X5ID 1VBD4 1EAH4 2FBWA 2PYLA 2HWC4 4Q4W4 2WDRA 3GQKA 1XI1A 3FI7A 1VBE4 1NCQD 1HXS4 1YQ4A 3AE9A 2H89A 1KF6A 1VBC4 1Z7S4 3AE8A 2WQYA 2PZSA 1AR94 1VBA4 1RUI4 1RUD4 2RS54 4GB34 3SFDA 1KFYA 1ZP0A 3AECA 4RHV4 3AE7A 1VRH4 2RMU4 4YTNA 1HRV4 1NENA 1BEV4 2WDQA 3AEGA 1XHZA 1XHXA
chains in the Genus database with same CATH topology
1RHI4 3JD74 1MQTD 1VBE4 1NCQD 1AR74 1R084 4Q4Y4 1HXS4 2R074 2RS14 1RUJ4 2RM24 1VBC4 1NA1D 1Z7S4 1PIV4 2RS34 4PDWD 1AR94 1AR64 1VBA4 1RUI4 1HRI4 1R094 1RMU4 4Q4V4 1D4M4 1RUD4 1H8TD 1PVC4 2RS54 3JBG4 1POV0 2R064 4GB34 1RUF4 1RUE4 1VBB4 1COV4 2PLV4 1ASJ4 1OOPD 1RVF4 2R044 1RUH4 1RUC4 1EV14 1PO24 1AR84 3J8F4 4RHV4 1AL24 1K5MD 2HWB4 2X5ID 4Q4X4 1VBD4 1EAH4 1VRH4 2RMU4 2HWC4 4Q4W4 1HRV4 1BEV4 2RR14 1PO14 1RUG4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHI 4;  3JD7 4;  1MQT D;  1VBE 4;  1NCQ D;  1AR7 4;  1R08 4;  4Q4Y 4;  1HXS 4;  2R07 4;  2RS1 4;  1RUJ 4;  2RM2 4;  1VBC 4;  1NA1 D;  1Z7S 4;  1PIV 4;  2RS3 4;  4PDW D;  1AR9 4;  1AR6 4;  1VBA 4;  1RUI 4;  1HRI 4;  1R09 4;  1RMU 4;  4Q4V 4;  1D4M 4;  1RUD 4;  1H8T D;  1PVC 4;  2RS5 4;  3JBG 4;  1POV 0;  2R06 4;  4GB3 4;  1RUF 4;  1RUE 4;  1VBB 4;  1COV 4;  2PLV 4;  1ASJ 4;  1OOP D;  1RVF 4;  2R04 4;  1RUH 4;  1RUC 4;  1EV1 4;  1PO2 4;  1AR8 4;  3J8F 4;  4RHV 4;  1AL2 4;  1K5M D;  2HWB 4;  2X5I D;  4Q4X 4;  1VBD 4;  1EAH 4;  1VRH 4;  2RMU 4;  2HWC 4;  4Q4W 4;  1HRV 4;  1BEV 4;  2RR1 4;  1PO1 4;  1RUG 4; 
#chains in the Genus database with same CATH topology
 1RHI 4;  3JD7 4;  1MQT D;  2B76 A;  3AEF A;  2WU2 A;  5C3J A;  2PW9 A;  3P4P A;  4YSZ A;  1PIV 4;  4YSY A;  1HRI 4;  1RMU 4;  1D4M 4;  3JBG 4;  1PVC 4;  3VRB A;  2WDV A;  1POV 0;  1ZOY A;  2R06 4;  4YSX A;  1RUF 4;  1COV 4;  1ASJ 4;  5C2T A;  1RVF 4;  1EV1 4;  3J8F 4;  2PY5 A;  1AL2 4;  3AE3 A;  3AEE A;  3VR9 A;  4Q4X 4;  2WP9 A;  2PYJ A;  1YQ3 A;  4YT0 A;  1PO1 4;  1NEK A;  1RUG 4;  3AEA A;  2H88 A;  3AE4 A;  3P4R A;  3P4Q A;  1L0V A;  1RUJ 4;  2WU5 A;  2RS3 4;  2ACZ A;  4YTP A;  4KX6 A;  1AR6 4;  2EX3 A;  2WS3 A;  1R09 4;  3AED A;  4Q4V 4;  4YTM A;  2R7F A;  3CIR A;  3AE1 A;  3P4S A;  1RUE 4;  1RUC 4;  1PO2 4;  1AR8 4;  4YXD A;  2HWB 4;  3AE5 A;  3AEB A;  3AE6 A;  3VR8 A;  2RR1 4;  3GQH A;  3SFE A;  1AR7 4;  1R08 4;  4Q4Y 4;  3VRA A;  2R07 4;  2RS1 4;  3SUC A;  2RM2 4;  1NA1 D;  3ABV A;  4PDW D;  1H8T D;  1VBB 4;  2PLV 4;  1OOP D;  2R04 4;  1RUH 4;  3AE2 A;  1K5M D;  2X5I D;  1VBD 4;  1EAH 4;  2FBW A;  2PYL A;  2HWC 4;  4Q4W 4;  2WDR A;  3GQK A;  1XI1 A;  3FI7 A;  1VBE 4;  1NCQ D;  1HXS 4;  1YQ4 A;  3AE9 A;  2H89 A;  1KF6 A;  1VBC 4;  1Z7S 4;  3AE8 A;  2WQY A;  2PZS A;  1AR9 4;  1VBA 4;  1RUI 4;  1RUD 4;  2RS5 4;  4GB3 4;  3SFD A;  1KFY A;  1ZP0 A;  3AEC A;  4RHV 4;  3AE7 A;  1VRH 4;  2RMU 4;  4YTN A;  1HRV 4;  1NEN A;  1BEV 4;  2WDQ A;  3AEG A;  1XHZ A;  1XHX A; 
#chains in the Genus database with same CATH homology
 1RHI 4;  3JD7 4;  1MQT D;  1VBE 4;  1NCQ D;  1AR7 4;  1R08 4;  4Q4Y 4;  1HXS 4;  2R07 4;  2RS1 4;  1RUJ 4;  2RM2 4;  1VBC 4;  1NA1 D;  1Z7S 4;  1PIV 4;  2RS3 4;  4PDW D;  1AR9 4;  1AR6 4;  1VBA 4;  1RUI 4;  1HRI 4;  1R09 4;  1RMU 4;  4Q4V 4;  1D4M 4;  1RUD 4;  1H8T D;  1PVC 4;  2RS5 4;  3JBG 4;  1POV 0;  2R06 4;  4GB3 4;  1RUF 4;  1RUE 4;  1VBB 4;  1COV 4;  2PLV 4;  1ASJ 4;  1OOP D;  1RVF 4;  2R04 4;  1RUH 4;  1RUC 4;  1EV1 4;  1PO2 4;  1AR8 4;  3J8F 4;  4RHV 4;  1AL2 4;  1K5M D;  2HWB 4;  2X5I D;  4Q4X 4;  1VBD 4;  1EAH 4;  1VRH 4;  2RMU 4;  2HWC 4;  4Q4W 4;  1HRV 4;  1BEV 4;  2RR1 4;  1PO1 4;  1RUG 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...