1RUH4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52084
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruh400
1NCQD 1OOPD 1PO14 1PO24 1VRH4 1HRV4 4Q4Y4 1EV14 4Q4V4 1RHI4 1VBB4 1AR64 1H8TD 1RUJ4 4Q4W4 2RS34 1HRI4 1HXS4 1EAH4 3JBG4 1COV4 1POV0 4PDWD 1VBC4 1RUE4 1RUF4 2RMU4 4GB34 1MQTD 1PVC4 3JD74 3J8F4 1NA1D 1R084 1ASJ4 1RUC4 1RMU4 4Q4X4 1RUD4 1PIV4 1RVF4 2HWB4 2RM24 4RHV4 1AL24 1AR84 1VBA4 2X5ID 1RUI4 2HWC4 2RR14 1RUG4 1D4M4 2R064 1AR74 2R074 1RUH4 1VBE4 1BEV4 2R044 1Z7S4 1VBD4 2PLV4 2RS14 1AR94 1K5MD 1R094 2RS54
chains in the Genus database with same CATH superfamily
1NCQD 1PO24 3VRAA 4Q4V4 1VBB4 4Q4W4 1HXS4 2RMU4 2WP9A 3AE7A 1R084 4Q4X4 1RMU4 2HWB4 1RVF4 3AEEA 4YSZA 2WQYA 4YSYA 1RUG4 2PW9A 2R074 1BEV4 1AR94 1K5MD 1R094 2RS54 2PY5A 1XHXA 1KFYA 1RUJ4 4KX6A 2RS34 4YTMA 1HRI4 3JBG4 3AEAA 3VR8A 1RUE4 1RUF4 3GQKA 1MQTD 1PVC4 3JD74 1L0VA 2FBWA 3J8F4 1RUC4 3FI7A 2R7FA 4RHV4 2X5ID 2HWC4 3AEFA 2RR14 1D4M4 2WU2A 2R064 4YTNA 3GQHA 1RUH4 1NENA 2H89A 2PLV4 1ZP0A 2RS14 1XHZA 3P4SA 1PO14 1OOPD 1VRH4 3SFEA 2WDRA 1HRV4 3AECA 3AE4A 3SFDA 3CIRA 1EV14 3AEGA 1AR64 1H8TD 3VR9A 3AE1A 1POV0 1ASJ4 2ACZA 1YQ3A 2RM24 5C3JA 2B76A 3VRBA 1AL24 2WDQA 3ABVA 5C2TA 2WDVA 2WU5A 1AR74 1VBE4 1XI1A 1VBD4 4Q4Y4 3P4QA 2PZSA 2H88A 3AE6A 2PYLA 1RHI4 4YSXA 3AE8A 3AE5A 3AE2A 4YXDA 3AEBA 3P4PA 1EAH4 1COV4 4PDWD 1VBC4 4GB34 1NA1D 1YQ4A 4YT0A 4YTPA 1RUD4 1PIV4 2WS3A 2PYJA 1VBA4 1AR84 1ZOYA 2EX3A 3AE3A 1RUI4 3AE9A 3SUCA 3AEDA 2R044 1NEKA 1Z7S4 1KF6A 3P4RA
chains in the Genus database with same CATH topology
1NCQD 1OOPD 1PO14 1PO24 1VRH4 1HRV4 4Q4Y4 1EV14 4Q4V4 1RHI4 1VBB4 1AR64 1H8TD 1RUJ4 4Q4W4 2RS34 1HRI4 1HXS4 1EAH4 3JBG4 1COV4 1POV0 4PDWD 1VBC4 1RUE4 1RUF4 2RMU4 4GB34 1MQTD 1PVC4 3JD74 3J8F4 1NA1D 1R084 1ASJ4 1RUC4 1RMU4 4Q4X4 1RUD4 1PIV4 1RVF4 2HWB4 2RM24 4RHV4 1AL24 1AR84 1VBA4 2X5ID 1RUI4 2HWC4 2RR14 1RUG4 1D4M4 2R064 1AR74 2R074 1RUH4 1VBE4 1BEV4 2R044 1Z7S4 1VBD4 2PLV4 2RS14 1AR94 1K5MD 1R094 2RS54
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCQ D;  1OOP D;  1PO1 4;  1PO2 4;  1VRH 4;  1HRV 4;  4Q4Y 4;  1EV1 4;  4Q4V 4;  1RHI 4;  1VBB 4;  1AR6 4;  1H8T D;  1RUJ 4;  4Q4W 4;  2RS3 4;  1HRI 4;  1HXS 4;  1EAH 4;  3JBG 4;  1COV 4;  1POV 0;  4PDW D;  1VBC 4;  1RUE 4;  1RUF 4;  2RMU 4;  4GB3 4;  1MQT D;  1PVC 4;  3JD7 4;  3J8F 4;  1NA1 D;  1R08 4;  1ASJ 4;  1RUC 4;  1RMU 4;  4Q4X 4;  1RUD 4;  1PIV 4;  1RVF 4;  2HWB 4;  2RM2 4;  4RHV 4;  1AL2 4;  1AR8 4;  1VBA 4;  2X5I D;  1RUI 4;  2HWC 4;  2RR1 4;  1RUG 4;  1D4M 4;  2R06 4;  1AR7 4;  2R07 4;  1RUH 4;  1VBE 4;  1BEV 4;  2R04 4;  1Z7S 4;  1VBD 4;  2PLV 4;  2RS1 4;  1AR9 4;  1K5M D;  1R09 4;  2RS5 4; 
#chains in the Genus database with same CATH topology
 1NCQ D;  1PO2 4;  3VRA A;  4Q4V 4;  1VBB 4;  4Q4W 4;  1HXS 4;  2RMU 4;  2WP9 A;  3AE7 A;  1R08 4;  4Q4X 4;  1RMU 4;  2HWB 4;  1RVF 4;  3AEE A;  4YSZ A;  2WQY A;  4YSY A;  1RUG 4;  2PW9 A;  2R07 4;  1BEV 4;  1AR9 4;  1K5M D;  1R09 4;  2RS5 4;  2PY5 A;  1XHX A;  1KFY A;  1RUJ 4;  4KX6 A;  2RS3 4;  4YTM A;  1HRI 4;  3JBG 4;  3AEA A;  3VR8 A;  1RUE 4;  1RUF 4;  3GQK A;  1MQT D;  1PVC 4;  3JD7 4;  1L0V A;  2FBW A;  3J8F 4;  1RUC 4;  3FI7 A;  2R7F A;  4RHV 4;  2X5I D;  2HWC 4;  3AEF A;  2RR1 4;  1D4M 4;  2WU2 A;  2R06 4;  4YTN A;  3GQH A;  1RUH 4;  1NEN A;  2H89 A;  2PLV 4;  1ZP0 A;  2RS1 4;  1XHZ A;  3P4S A;  1PO1 4;  1OOP D;  1VRH 4;  3SFE A;  2WDR A;  1HRV 4;  3AEC A;  3AE4 A;  3SFD A;  3CIR A;  1EV1 4;  3AEG A;  1AR6 4;  1H8T D;  3VR9 A;  3AE1 A;  1POV 0;  1ASJ 4;  2ACZ A;  1YQ3 A;  2RM2 4;  5C3J A;  2B76 A;  3VRB A;  1AL2 4;  2WDQ A;  3ABV A;  5C2T A;  2WDV A;  2WU5 A;  1AR7 4;  1VBE 4;  1XI1 A;  1VBD 4;  4Q4Y 4;  3P4Q A;  2PZS A;  2H88 A;  3AE6 A;  2PYL A;  1RHI 4;  4YSX A;  3AE8 A;  3AE5 A;  3AE2 A;  4YXD A;  3AEB A;  3P4P A;  1EAH 4;  1COV 4;  4PDW D;  1VBC 4;  4GB3 4;  1NA1 D;  1YQ4 A;  4YT0 A;  4YTP A;  1RUD 4;  1PIV 4;  2WS3 A;  2PYJ A;  1VBA 4;  1AR8 4;  1ZOY A;  2EX3 A;  3AE3 A;  1RUI 4;  3AE9 A;  3SUC A;  3AED A;  2R04 4;  1NEK A;  1Z7S 4;  1KF6 A;  3P4R A; 
#chains in the Genus database with same CATH homology
 1NCQ D;  1OOP D;  1PO1 4;  1PO2 4;  1VRH 4;  1HRV 4;  4Q4Y 4;  1EV1 4;  4Q4V 4;  1RHI 4;  1VBB 4;  1AR6 4;  1H8T D;  1RUJ 4;  4Q4W 4;  2RS3 4;  1HRI 4;  1HXS 4;  1EAH 4;  3JBG 4;  1COV 4;  1POV 0;  4PDW D;  1VBC 4;  1RUE 4;  1RUF 4;  2RMU 4;  4GB3 4;  1MQT D;  1PVC 4;  3JD7 4;  3J8F 4;  1NA1 D;  1R08 4;  1ASJ 4;  1RUC 4;  1RMU 4;  4Q4X 4;  1RUD 4;  1PIV 4;  1RVF 4;  2HWB 4;  2RM2 4;  4RHV 4;  1AL2 4;  1AR8 4;  1VBA 4;  2X5I D;  1RUI 4;  2HWC 4;  2RR1 4;  1RUG 4;  1D4M 4;  2R06 4;  1AR7 4;  2R07 4;  1RUH 4;  1VBE 4;  1BEV 4;  2R04 4;  1Z7S 4;  1VBD 4;  2PLV 4;  2RS1 4;  1AR9 4;  1K5M D;  1R09 4;  2RS5 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...