1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase
molecule keywords DNA polymerase
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
4FJJA 1VRTA 2P5GA 3DLGA 4E7KA 5E41A 4C8KA 2PYLA 3KTQA 4CF8A 4E7JA 3LDSA 3FI7A 2DTUA 1KFDA 4DSEA 5KGWA 3NE6A 4OKKA 2YHAA 3V1QA 4HUGA 4E19A 4M3ZA 4B9TA 4C8NA 3SQ4A 2GUIA 2HB5A 1JKHA 2YNHA 1JL2A 2X6SA 4RW4A 1HQUA 1FKPA 3LALA 5C42A 1QQCA 2GBZA 4GMJB 3QINA 4HCCA 3HPGA 3U6FA 3HP9A 4Y1CA 4B9MA 4DTOA 3O3GA 3P5JA 4DU4A 3HSTB 3NAEA 4Q5VA 3ULDA 1SV5A 5J2MA 4H4MA 4BWMA 3M8RA 3QEWA 3K5LA 3HVTA 4KTZA 2KFNA 4NYNA 4ELTA 4O5BA 5CY4A 3DRPA 2R7YA 4CHQA 4L8RB 4M45A 3OYFA 5J2QA 3LAMA 4B9VA 3VQBA 3IAYA 1ZBIA 3LANA 1JLCA 1Z25A 3AVKA 2HHWA 4FLYA 4HHTA 2X78A 1KVBA 3IS9A 1NOZA 3DMJA 4DQPA 2DY4A 1C6VA 3F9KA 3ZT4A 4FJ9A 4O55A 3VQQA 3KD5E 4HUEA 4FJ8A 3NF9A 4RW6A 5DK5A 4F2RA 4CJ4A 1RTIA 4F2SA 1BCMA 2B4JA 4E7IA 4CF1A 1TAUA 1C0MA 4PY5A 2ETJA 1KLMA 4FJLA 5FDLA 4Z0UA 4FM2A 1IH7A 1QS4A 1BHLA 1ITGA 3QLHA 1B9DA 1JLQA 3SQ2A 3PY8A 4CGGA 3NH2A 2B5JA 2ITGA 3VN5A 3OYCA 2PY5A 3AVNA 3HJFA 5FROA 1VSHA 4M3YA 3RR7A 1KCFA 3DOLA 1QSSA 1SL0A 4B8AB 4W5QA 1QSLA 4CJVA 3LP1A 4OKEA 1IKYA 4KHUA 3HYFA 4I9QA 3I8DA 3HK2A 3SUOA 3SNNA 1EETA 4B8CA 1N6QA 3AA2A 1KVCA 3QNOA 3MEDA 1HYSA 4DSLA 3VA0A 5KRTA 5HROA 4MQ3A 3O3FA 2B6AA 1S1TA 4DTPA 3QIPA 4M3TA 3EYZA 4F8RA 4FZYA 4FLZA 1NJYA 3ZSXA 1KRPA 3BDPA 1GOBA 3ZT1A 4BDPA 4NCGA 3CG7A 3SPYA 1A5XA 3DLEA 2G8HA 2HHTA 2HHSA 4I2PA 2YNGA 3KIOA 1UA0A 3VQ5A 4CFBA 1T03A 1F21A 3CYMA 3VQ6A 4H8KA 1KVAA 3HPOA 1EP4A 2G8KA 4BE2A 4CGIA 3T3FA 4DS5A 3SQ0A 2DFEA 3SYZA 1QTMA 4FJXA 4KI4A 1J53A 3MEEA 2IS3A 1WNSA 3KLFA 2YV0X 1TL3A 3NH1A 3QIOA 3NCIA 2XY6A 3AVGA 4FJ7A 3D0PA 1JL1A 4CEEA 2RPIA 3K5MA 1D9DA 4AHSA 2QK9A 1X9WA 4IG3A 3TAEA 2IAJA 1RT3A 3K2PA 2OPQA 3VQ7A 1S9GA 3KJVA 3KK3A 1QHTA 1IO2A 4CF0A 1BI4B 1UAXA 4BACA 4QAGA 1RT2A 2VG5A 5FRMA 4GW6A 1NK9A 1LAWA 3HT3A 3S3MA 4PWDA 1MU2A 1RNHA 3M8SA 4DFKA 2KW4A 3OYJA 4KTWA 3U3YA 2ZQBA 3WNGA 4B9LA 4RW9A 3DOKA 4NYFA 4CEOA 1S5JA 4B9NA 2F8SA 2HHUA 4CF9A 1NKBA 2KZMA 4KHNA 1WSGA 3KK2A 2KFZA 2YKNA 3AV9A 3AVAA 3BGRA 2BGGA 3TAGA 4DWIA 1WLJA 3K5OA 4OGEA 3MXIA 1DTTA 3TANA 4LSNA 4LD0A 3SPZA 4Y1DA 4CHNA 2D0BA 1XHXA 1QE1A 1JXBA 4O0JA 3V4IA 3TAMA 4FK2A 1T05A 3LAKA 1HJRA 4EP5A 1BI4A 3K5NA 1VSEA 2VG6A 2Z1IA 4OVLA 3HO1A 2X74A 1WSJA 5KI6A 2OPPA 1XI1A 4JLHA 4QOZB 3LWMA 4CHZA 1U47A 4DS4A 3LZIA 1SKRA 1TK0A 4O4GA 1U48A 1YVUA 4DMNA 1BIZA 4CJPA 3PX4A 3RMBA 1RBRA 5J2PA 2ATQA 3DLBA 2VWKA 5SZTA 4ID5A 4F4KA 5HRRA 4R5PA 5J2NA 2OYQA 4OPJA 4CK1A 3H08A 4CJTA 5SWMA 3KLGA 1RT1A 4E0DA 1CXQA 3TABA 4FJIA 1CLQA 4CJWA 3V1RA 1C0UA 3V9UA 4DTNA 4F3OA 3E01A 4CEDA 1W9HA 1BISA 3AO1A 1HQEA 4AHRA 4FJGA 3VQPA 2KZZA 4RG8A 2X6NA 4G1QA 3DRRA 4RW7A 3RMAA 1ZYQA 1LWEA 1C1AA 3PO5A 3AVFA 4FXDA 1RT4A 1REVA 3TR8A 1JXEA 2HVHA 2RN2A 4DTMA 3K59A 1RDDA 1UWBA 1HYZA 4JRPA 3V9WA 4OLBA 1VSFA 4Z4IA 3OYIA 1KTQA 3VQ8A 4CHOA 1RT6A 4PA1A 4CJ3A 3NBPA 3AO5A 3TARA 1LW2A 1RT5A 4H4OA 2HNDA 3S3NA 1HMVA 4DU1A 4B9UA 4Z4GA 1WAJA 3CM6A 3ZSQA 1NJZA 4DQQA 2HW3A 4CK3A 3DLHA 4B9SA 4KPYA 4HVJA 4DLGA 1NK5A 4J2DA 4W5TA 4B3OA 4J2BA 1S1VA 4LH4A 1VRUA 4CJ5A 3TAQA 4M42A 2LSNA 3OYEA 4FK0A 3AVCA 3QEVA 4BWJA 1ZBHA 1KLNA 4CEAA 1WAFA 3V9SA 1BCOA 5C25A 5CZ2A 1CZ9A 3RWUA 2OPSA 1RCHA 3OVNA 3TAPA 3THVA 2A1RA 3DLKA 2PYJA 1UOCA 4Z4HA 1S1UA 5HRNA 1ZBLA 4DSJA 4Z4FA 1SL2A 4PUOA 1C0TA 4Z4EA 2QKBA 1VSMA 2EX3A 1TV6A 2IGIA 3SUQA 1JLFA 2Q3SA 2HHQA 1I39A 1RILA 3KLEA 1IKWA 3TI0A 4AILC 4EZ6A 1YT3A 4CIEA 1TGOA 2IOCA 1EX4A 3FFIA 4LSLA 2AJQA 4KRFA 2XHBA 5KGXA 3OYDA 2HNZA 2G8UA 2W42A 4KI6A 1NKCA 2G8FA 3HPHA 3ZCMA 3TWHA 1S9EA 4Z4CA 2XY8A 3IG1A 4CJSA 5CZ1A 3SUNA 4KHYA 3EY1A 4CCHA 3ZT3A 3T1AA 4CEFA 4DFJA 3VQEA 4CJQA 4FW1A 1U04A 3KKSA 3LPUA 2D0CA 4FLWA 3QNNA 1YTUA 4CEBA 1XWLA 4DLEA 4KFBA 3SJJA 4CGHA 1T7PA 4BDZA 4CJKA 3VQDA 4J2AA 3K58A 1TKZA 4M3RA 4FM0A 3ZSZA 1S1WA 1RBSA 4DFMA 3O4NA 1S6PA 4JRQA 2OZSA 2E6MA 1IKXA 1QSYA 4KAZA 1WSIA 2BANA 4WE1A 4BDYA 3RRHA 4DF8A 3ISNC 4AHVA 1L3VA 1X9SA 1TK8A 5HRPA 3QEIA 1BL3A 1J54A 1Z26A 3I0RA 3L8BA 4ZTJA 1VSDA 1HPZA 1LWFA 1YTAA 4ICLA 2PZSA 5C24A 4FM1A 2NUBA 4I9LA 2JGUA 4DQRA 2G8IA 4KV8A 4CHPA 2HVIA 4E89A 4AHTA 1HYVA 2QXFA 5FRNA 3QERA 4OLAA 3OYBA 3OS0A 3NGYA 4I7FA 2KTQA 4AHCA 4N47A 3NF7A 1VK0A 1A5VA 5HP1A 3U3GA 2E4LA 3L3VA 5JS1A 1HNIA 4TSXA 1T8EA 4FW2A 5EU7A 2HMIA 1TVRA 4CFDA 4DSKA 1JLBA 4KHQA 4W5OA 2OA8A 5CYMA 3OJSA 3QEPA 2IDOA 1FK9A 1C1BA 2P1JA 4CIFA 4HUFA 1K6YA 3V81A 1RBUA 2HNYA 4DU3A 4E3SA 1KFSA 1TAQA 3QO9A 3SZ2A 4DTUA 3SUPA 1CXUA 1RTJA 3DRSA 3ZSWA 4JS4A 3KKRA 1I3AA 3LP2A 2G8VA 4ELUA 1NOYA 1ASUA 1HNVA 1RBVA 4E7LA 2PW9A 4ELVA 3V6DA 4EP4A 3M8QA 2P51A 3D45A 1C1CA 2FC0A 1L3TA 3O4QA 2WONA 3O3HA 2XO7A 4CERA 1TKXA 3AVBA 3DYAA 3L2WA 4K8ZA 1X1PA 3V9XA 3AVJA 3ZT0A 3ZT2A 5HRSA 1IG9A 4FJMA 4W5NA 3DLRA 4DG1A 2YHBA 4BE0A 1ZBFA 3ITHA 3WNFA 4DTRA 2QKKA 3VQCA 4DTJA 5CYQA 1GOCA 3EZ5A 3NGZA 2HHVA 1RBTA 3C95A 5JS2A 1D9FA 1DTQA 2JLEA 2F8TA 4QCLA 2FBVA 4DF4A 4HTUA 4CFCA 1R0AA 1EKEA 3OYGA 3M8PA 3AO4A 5I42A 1ASVA 4K8XA 3I0SA 3JYTA 3HL8A 3VA3A 1S6QA 3QESA 1EXQA 2Y1IA 3SI6A 3KLIA 4HCBA 3NFAA 1WSEA 2BE2A 3L2QA 4N41A 1G15A 3TAFA 4DTSA 1WSHA 4XIUA 4C8OA 3OYAA 4FJKA 2YNIA 3DI6A 3PX0A 2G8WA 3C94A 4CGDA 3NF8A 2OZMA 4IG0A 2Y1JA 3OYLA 2O4GA 5KRSA 2BDPA 4KREA 2R7FA 2VWJA 1J5OA 3MAQA 1JLAA 1LAVA 3G0ZA 2E6LA 3WNEA 1UA1A 2XRIA 2FBXA 1TKDA 1RDBA 2XY7A 1TKTA 3RMDA 3OYKA 1J9AA 4IDKA 1D8YA 3AO3A 2GV9A 2WOMA 4E1NA 1A5WA 1Q8IA 4FZZA 4O44A 3NDKA 1NK0A 4LH5A 1X9MA 4B08A 2Z1JA 4FJNA 4N56A 2FBYA 4CEZA 3S9HA 4CE9A 2F96A 4IFVA 4FJ5A 3AA4A 3ZSYA 2OPRA 1VSKA 5T7BA 4KTQA 1VSIA 2O4IA 2RKIA 4RW8A 2YKMA 1N5YA 3KD1E 2ZE2A 1NJXA 4NCAA 4BE1A 3CM5A 3L2UA 4ZHRA 1D5AA 4FLXA 3ASMA 4FVMA 4CHYA 4W5RA 3NH0A 5HLFA 1RDAA 3C6UA 1L5UA 4DQIA 3KLHA 3L2RA 4CJEA 1Q9YA 4M3WA 3S3OA 1ASWA 3NHGA 4KO0A 2I5JA 5I3UA 1RTHA 3HM9A 4E1MA 3RMCA 3LZJA 1LWCA 1WN7A 3CFPA 3LPTA 4J2EA 4C8MA 3LWLA 4CESA 3AVIA 1RDCA 4CK2A 3ZSRA 1B92A 1FKOA 2Z1GA 3MECA 5KTQA 3HVRA 3RRGA 3HP6A 1ZBUA 2RF2A 5HBMA 4N76A 2DFFA 1VSLA 2A1SA 3OYHA 2EHGA 4I2QA 2DFHA 4IKFA 3QEXA 4FLUA 4CJFA 5D3GA 4O0IA 1BQNA 4JS5A 3VQ4A 4KB1A 1VSJA 3NF6A 4DSIA 4IBNA 3A2FA 5K14A 2D0AA 4CFAA 1L3SA 4FLTA 1FXXA 4DSFA 1Q9XA 1U49A 3CFOA 3P83D 2VG7A 2FBTA 3HXMA 3PO4A 3AVMA 1XC9A 3AVHA 1TK5A 3MXMA 3AO2A 4YFUA 5DMRA 3MEGA 3F73A 4F3TA 4OKJA 3NGIA 1NJWA 3B6OA 1U4BA 4DFPA 1BGXT 4IFYA 3G10A 4CJRA 3OS2A 3OYMA 3PX6A 4Q0BA 4KHSA 3AA5X 3ALYA 3T19A 3V1OA 4CIGA 1SKWA 4PQUA 3SV3A 3L3UA 3WNHA 4AHUA 4OGCA 4CEQA 1WSFA 3C6TA 4CECA 1L3UA 3PV8A 3JSMA 3CQ8A 4C8LA 4FZXC 1RTDA 2XY5A 2D5RA 3AA3A 4ID1A 5J1EA 4DQSA 2P5OA 1NKEA 4OPKA 2Z1HA 3QETA 1LV5A 1XHZA 3P1GA 3ZSVA 1BQMA 4LY7A 3VQAA 1DLOA 3L2VA 1JLEA 4FLVA 4UQGA 3OYNA 3V9ZA 4M3UA 4ZTFA 3LP3A 3MXJA 4DTXA 3CFRA 2KQ2A 4NCBA 1Y97A 3PUFA 3OJUA 1IKVA 3LP0A 4FCYA 4FK4A 4YNQA 2HHXA 3RTVA 3SCXA 1S1XA 3OS1A 4CGFA 1RT7A 3RR8A 1KSPA 1TL1A 2IC3A 3AVLA 4CJLA 2YNFA 1SUQA 1NK4A 1NK6A 4KHWA 1HRHA 3IRXA 4AH9A 3SQ1A 4CF2A 4CGJA 4MFBA 1BIUA 2ZD1A 1NK7A 4EZ9A 3VQ9A 3B6PA 4GVMA 4E7HA 1GOAA 4OJRA 4CJUA 3SV4A 1O1WA 3UIQA 4FYDA 1CZBA 1SKSA 3OY9A 3ZSOA 4M41A 4FJHA 1JLGA 1U45A 4KB0A 1LW0A 1NK8A 3DM2A 4KKOA 4M3XA 1SL1A 1B9FA 3K57A 1W0HA 4N5SA 3KK1A
chains in the Genus database with same CATH superfamily
5JLFA 1MA1A 2P9PB 3DXMA 3TPQA 5CN0A 3EXAA 3QG5A 4NO7A 5EIBD 1KFDA 4DSEA 1WP8A 4LF7O 4IWVA 1U6ZA 2BUPA 3TTCA 4EEQA 5E1AC 3V1QA 5LYJB 2W6LA 4E19A 2P9LA 2HB5A 5AJ3K 2QJ1A 3GWKC 3MX2A 4PHTX 4K0KO 3P4SA 2QEXN 5JVGL 4IOAL 2LQTA 4LC1A 4HCCA 5IYCO 1KP2A 3HPGA 4CBUA 1ZXOA 3ZEUB 4A5AA 3EZWA 2F4VB 5LGTA 3HSTB 5C12A 2JGDB 3UE5A 4H4MA 2UYTA 4BWMA 4CJ7A 3G6EN 3OR6C 3K5LA 4NXMB 4JNEA 4NYNA 1R084 1XMQB 4JI4K 3LAMA 1JPXA 2M6YA 5E79Z 3DAWA 3VQBA 2E76B 3FZMA 3TTDA 3RSEA 4HHTA 1K5MD 3FB6C 3DMJA 3JD2A 3M5RA 4JAXA 3W7XA 3F9KA 4FJ9A 4O55A 4DV3B 3KD5E 1MZFA 5LP6A 3OEEG 2YJEA 4CJ4A 2HHHK 1BCMA 1KQSU 2E5LO 1PV0A 2B4JA 4H03B 3VPZA 2P90A 1GM8A 1BE3H 3GDQA 4PY5A 1H2MA 2KQXA 1KLMA 4Y0WA 4KHPB 4LFAK 2CH6A 4Z0UA 4FM2A 1QS4A 3SQ2A 1BHLA 1JLQA 4RTFD 1AP5A 2ZE8A 4GZRB 4CGGA 3K0GA 4RWUA 1KD1O 1YXBA 1AI4A 1WB8A 1XUPO 2B5JA 1WPXA 3L71H 3NH2A 3AVNA 1RHI4 1RUJ4 4PDRA 4M3YA 1AI7A 5CR4A 4QIWF 3QFPA 1SL0A 4W5QA 3LP1A 4KHUA 3WG7C 3HYFA 4I9QA 2GDSA 1L0NH 3QO8A 4DQ8A 3SUOA 3HOTA 2CAZC 2QWQB 1VQ9V 2LO1A 1FXKA 3H3NO 2W0XA 1AL24 1P49A 3UKRA 3VA0A 4OX9B 5KRTA 1IBLK 1R1BA 4DTPA 4X1YB 5C0YA 5J2UA 2A40A 5CBHA 1XNRO 4FZYA 3ZLJA 1NJYA 1XBLA 4J8FA 2ZE7A 3ZHSA 3TSUA 3ZT1A 2W0FC 2EIMB 2RJZA 2JRIA 1NBWA 2HF3A 2ZGZA 2YNGA 4B7KA 1QZ6A 1UA0A 4BRQA 1F21A 3CYMA 2A6AA 4B3MK 3NMUA 2QWLA 3LDQA 2X6AA 2KSDA 4BE2A 1H2GA 3T4DA 3ATVA 1R094 5LP6C 3T3FA 1VQ4N 5KLVH 4DS5A 4YSZA 3CJHA 4X1KB 4BREA 5KA6A 4L87A 1QTMA 3FR0A 4I0XA 2E2PA 1GH6A 3MEEA 2IS3A 4J9YB 4OPHA 3THXB 1E3MA 2JJ2G 2YV0X 1H8EG 1AR1B 4I9WA 3NCIA 3D0PA 4LBEC 1JL1A 1T6DA 4CEEA 4PI2A 4MW8A 5IJ0B 2QK9A 1XOUA 1BUPA 5EBWC 3APOA 2EIJC 3I55N 1S9GA 3TU5A 3KK3A 3CCUN 2BE3A 1IO2A 1RUD4 4CF0A 2ZE5A 5BR8O 3DGEA 4U3JA 4EFBA 4EFHA 2WLIB 2WQYA 2JWKA 4EHUA 2KW4A 3J8AA 5KA5A 1R59O 3OYJA 3IGAC 3EE8A 3GB7C 3O08A 2ZQBA 5AZIA 4DR3B 4RW9A 4FK5C 3WNGA 2HHUA 1G1XB 1VAZA 2UU9B 1NKBA 1FFXA 4KHNA 2RS54 3KK2A 3J81N 2YKNA 3WXLA 2BGGA 3MHHC 1Y66A 3ASNB 3D3QA 5H6RA 5GINA 3OTOK 3K5OA 1Y64A 3RYCB 1DTTA 1N4CA 3CCLN 1I0HA 4JI3B 3D36A 5IE9A 3HZ6A 4LSNA 4K0KB 2WLIA 2A06H 2WPDG 1QE1A 4O0JA 5HOOA 4FK2A 4H13B 2EWSA 4H0PA 2VG6A 5B1AC 1YJ9N 3GOIA 2X74A 1WSJA 4CHZA 1SKRA 3TJTA 2E75B 4O4GA 3SJHA 4JI6O 5KHIA 2ZF5O 1BIZA 3MN7A 3AEAA 1Z5VA 2VWKA 5SZTA 5LMUO 4JZ2A 2EIKC 5B8HA 1IX9A 3LDPA 3TABA 1BQ0A 2XTAA 4MVOA 3V9UA 3GG4A 3THYA 3EVKA 2WSSG 1YSCA 4NYKA 1NKDA 4AQYB 2JDIG 2LFSA 3KZIZ 4EB6A 3WQTA 4RG8A 1ASJ4 4KH6A 4CBXA 4HZ3A 3D8CA 3DRRA 3RMAA 1L8DA 3WEEB 1FXKB 1XNQK 1XMQK 3WXJA 4DR5B 1ZWIC 4FPBA 3AARA 2HVHA 3K59A 2RHKA 3O9UA 1ZC6A 4JRPA 5IWAB 1X4TA 1OCCB 2Y4TA 4CC5A 2ACZA 5IYZB 2OCHA 4O8UA 2OCEA 3L74H 1SAZA 5EZYA 4DU1A 3UQ8A 1VQ4V 1WAJA 3PIOL 4U3FH 3CCUV 2HHHB 2UXXA 4B9SA 4KPYA 3AE4A 3KWIA 2ASPA 3MCPA 3HKCA 4P9PA 4HVJA 1Q7YO 1HRI4 4LH7A 4H0VB 4OGQB 4W5TA 2YS8A 1S1VA 1IBKB 1AVMA 3ZEDA 2H3OA 1GLJO 1GLAG 3SJCC 1BWFO 1ZBHA 5IT9N 1KAYA 1WAFA 3LL3A 1PO24 5B1BC 1S22A 1BCOA 2LFRA 1W97L 1Y76B 3KVGA 4F4LA 3W7SA 1XQSC 3E8GA 3RSEB 2ITDC 1M56C 1UPGA 4C7UA 1BO5O 2OANA 5HRNA 5JMVA 4PUOA 4IOCL 4MVRA 1OHHG 1C0TA 1V9PA 1YVNA 3MWPA 1VSMA 3O9TA 1WBBA 1FYJA 3THYB 2RCVA 1M90W 3SUQA 2BOCC 3A8TA 4OX9K 4JI7B 1I39A 3NXSA 2EZOA 5L3CA 1IXBA 2YC0A 1IKWA 2A7WA 4EZ6A 1SQXH 5EIBC 4GKJB 3E89A 1TGOA 4CIEA 1K8AO 3TETA 2IOCA 1NMDA 2AZ2A 1EX4A 3HOSA 1DGKN 1COWG 5KGXA 1ENVA 3B2EE 3B8NA 3H45C 2XT9A 2G8UA 4KI6A 2UUBK 4J7KA 3WXKA 4NXNB 3U8XA 1TYQB 4JGSA 2O8EA 5FPRA 2F9TA 5CZ1A 4NXNO 2EILC 3VR8A 3T1AA 3VQEA 4CJQA 3FB5C 2Q0RA 3QNNA 4KBOA 4A5BA 3ZRVA 4LF4K 2PGGA 3UKRB 1OCOB 3EKSA 4I55B 3OTOO 5IJ9B 4JD2B 3K58A 4M3RA 5AQMA 3AG4C 4YOWA 1H2NA 3D3IA 3NVKA 4IZ9A 1NCQD 1IKXA 1WSIA 4LWSB 5CMUA 5EX5A 1MG1A 3L4IA 4BDYA 4AHVA 1N32B 3L8BA 3AG7A 4CH4A 3LSUA 1QLNA 1LWFA 2AHYA 3BHPA 3CMEN 3O1BA 3CC4V 3J80O 4PV1B 3LDDA 2HKOA 2QXFA 4AM7A 4X62B 3OYBA 4OLAA 3E86A 2FKXA 4X65B 2XNDG 5EXWA 4UCSA 4AHCA 5LP6B 3G67A 4DV4O 5AFUH 1M90O 1Z05A 2QKCA 2UXBB 5D5PA 3T4ZA 1HW7A 3EO3A 3WB0A 4DR1O 2E4LA 3CCEN 3L3VA 5JS1A 4TSXA 3Q7BA 5EU7A 2AW9A 4CFDA 2ZM6K 3N2GA 1JCFA 3LUTB 1HNWB 2OA8A 4DKWA 3F7YC 4DV0B 5LOVA 3DC5A 2Y0IA 5LHHA 4FOEA 1C1BA 4JI8O 1MA9B 2P1JA 4HUFA 1RBUA 2YSUB 2HNYA 2AA4A 2ASOA 1TAQA 2QM7A 1X59A 1DGSA 3HBTA 1R3JC 4ASUG 1I3AA 4IDHA 5C3JA 4CBWA 2IVOA 2KLAA 1K9MO 3T7ZA 4CZHA 1U96A 5BPNA 5E26A 1TKXA 3AVBA 3L2WA 3V9XA 3ZX2A 3ZT2A 4FJMA 3ML0A 3DLRA 3LSQA 3WT0A 3MMVA 3WNFA 1I94O 1VBE4 1EZJA 3IC7A 4DV1O 1GOCA 4DTJA 3UKUB 3M6GA 2JLEA 4JI6B 1K7DA 3UKMA 4BRPA 2FBVA 4R50A 1MSDA 1EKEA 1VHXA 1NJIO 2LGWA 5M1FA 1ASVA 1X3NA 3SYCA 3LDCA 3ZHRA 3HB3B 3QESA 1Q6HA 3ZJZA 2FLOA 4G2KA 5DN6G 3NFAA 5AQPA 4N41A 4NVPA 3FE1A 1GMGA 3TAFA 2ZDIC 4XIUA 3OYAA 2HR3A 4IEIA 2YNIA 3DI6A 2UXCO 1HPMA 4JN4A 1KF6A 1Y6XA 1Y76A 1P7GA 5LMUK 1OH6A 3LDEA 3WQUA 1M57C 5CA0B 3FB8C 4DUYO 2O4GA 5AQFA 2OCCB 2AXTZ 5DEDA 2VWJA 2X7RB 1J5OA 1LAVA 1JLAA 3U10A 2E6LA 1VQLN 3RYIB 1UA1A 2XRIA 2V52B 4WBNB 2E20A 2FBXA 3UB5A 4MTFA 3VOUA 2FXUA 4IDKA 1D8YA 3OAAG 5JJEB 4E1NA 5C8YB 1A5WA 4FZZA 4O44A 1NK0A 3AEDA 1VQ5N 2GEMA 2Z1JA 4JZGA 2FBYA 1N34O 3AE2A 2WAMA 4IFVA 2OPRA 4DV1K 1BOTO 4JYYA 4KTQA 2WDVA 4QPKA 3QVNA 2YKMA 3KD1E 3JARB 5KPRA 3CM5A 1IBMK 3G4SV 4CHYA 4TSFG 2RE2A 4DRXA 3KLHA 2HG5C 4DV0K 1Y74B 4Q6GA 4CJEA 4B3TK 3BRCA 1R6KA 4M3WA 4MDBA 5EY4A 1IDSA 3A8YA 4LNUB 3HM9A 4WQ5A 3S3WA 4PL7A 3J81O 3LZJA 1NWKA 2B76A 1Q81O 3CRQA 1YHQV 4LF6B 1YXQA 3A5NC 4LFBB 3QFUA 4BC4A 5IT9O 4C8MA 1LR1A 1QLEB 2ZWHA 1M9NA 3E2EA 1RDCA 5KTQA 1VQPV 1FKOA 3SYOA 4UCOA 2ZKOA 3RRGA 2Y48A 2ZCEA 2DFFA 1S5LZ 1MMMA 3J7AP 3AK2A 3AEEA 4IKFA 4I2QA 1SZTA 5J2TB 3QEXA 1IBMB 2R064 4O0IA 4JS5A 2CH7A 2KG7A 3F5TA 2WBNA 1YIJN 1KMIZ 4IBNA 3CCQN 4LR3A 4K42A 3VF4A 2WLLA 4DSIA 3P4QA 1PP9H 5B1AB 3P83D 2VGNA 2NZTA 3HXMA 4JI0K 4YT0A 4UCUA 2YICA 3AVMA 5EK0A 3AVHA 3BZCA 1SQPH 1PL0A 2P9SA 3LM9A 1HKCA 2WFBA 4F3TA 1VQON 5KHHA 3B6OA 1U4BA 4H5NA 2GUZA 4KUMA 5BPMA 4X62K 1BGXT 4DRXB 4CJRA 4JKAA 5KHJA 3UKUA 1S0VA 2A79B 2XOKG 5IJ9A 3UT5B 4JD2A 4FFBB 3AEIA 2E5LB 2P9NA 1L3UA 1B3QA 4BC5A 3PV8A 3AE5A 2IJKA 2GWKA 3JD74 1RTDA 2D5RA 3LSSA 4ID1A 3JYCA 5L3EA 1EM1A 3JD1A 4OPKA 1OZ0A 1LV5A 4ICGA 5EC2C 3B77A 4LY7A 1DLOA 3VQWA 2YIBD 3C65A 3P3NA 3G6EV 2NLJC 3GBTA 2GUZB 3V9ZA 4M3UA 3E8HA 1ORQC 5D5QA 4MO5A 2EINC 3S3XA 4DV6B 5LHIA 4DR6B 3G71V 4JHDB 4YHHK 5JVHL 4QE9A 3LP0A 4NCBA 4YNQA 4Z94A 3K08A 1R73A 4NXMO 3SCXA 1S1XA 3OS1A 5FLXO 4CJLA 4ZOLB 3CJ9A 3CJHB 4O2BA 4YDUC 4B1YB 1HRHA 1Q82O 4WF9L 2WLLB 1OH5A 4CZMA 1BIUA 3ZMUA 1VQMV 1NT2B 1BQZA 4JK8A 3M99B 5JH7B 3SV4A 4D7SA 1O1WA 3A5LC 1CZBA 3W7TA 2Q67A 3ZSOA 4RAIA 2XASA 3T1HO 2VQEO 1S3JA 2FYUH 1NGIA 3QB0A 5E41A 2PYLA 4LF8B 4RUFA 4CF8A 4TV9B 1IURA 1FXHA 1RPRA 5GONA 1M56B 4I5SA 5JVDA 4MO4A 1S77D 1WP7A 3NE6A 4OKKA 1SESA 4M3ZA 1NTKH 1JKHA 2DYSC 1T6CA 2YNHA 4RW4A 4AF1A 5C42A 1QQCA 4JI4B 3CSXA 2PTMA 2WWWA 2YI9A 2P9SB 1K92A 5IJ0A 4YHHO 3A5OC 2QW9A 3CETA 3GQKA 1M1KO 4Y1CA 5LHGA 3O3GA 1Q6UA 2OWOA 4DV7K 5A2QO 1Z7S4 2D1KA 3QEWA 2JJ1G 2KFNA 3CHWA 2A0LA 4RO2A 3AG3B 3JATB 4O5BA 5CY4A 5ADXH 5IYDO 2M7WA 1BEV4 2LJ2A 3ABKB 3FKSG 3I33A 4BAYA 1JLCA 1Z25A 3LANA 5KQDA 2HHWA 2XUMA 1C0GA 3ZT4A 1KKDA 1NMNA 1YJ9V 4LFBO 2Q73A 2QWRA 4RW6A 5DK5A 3BUZB 5I9EB 4F2SA 3CRCA 3JAWB 5FNVA 2IW5A 1EQYA 5LL6Z 2F23A 3BF1A 3FGUA 4E7IA 4WCEV 1HP8A 4FJLA 5FDLA 5J2UB 3AGKA 4B1XB 4YJ2A 5E84A 2G38A 3SAHA 1ROPA 2ZD9A 1MOFA 2ZINA 5FPEA 1BDGA 2ITGA 3VN5A 3HJFA 1AB3A 1V4TA 2E1YA 5FROA 1VSHA 4J80A 4JKGA 1URFA 1K8KA 1H38A 1OVYA 1HKBA 4OKEA 3I8DA 3AECA 2ILMA 1N34B 1DEJA 3QNOA 2P9LB 1ZL8A 3MEDA 2OTLN 2WDRA 5BN9A 3JXUA 1Q81W 4M7XA 3T2MA 1S1TA 3JCUZ 5LMNB 3U4LA 2HVKC 3JASA 5H6QA 3CF5L 3VR9A 4GKKB 3OMIB 3HM8A 4BR4A 2DOSA 3TXQA 3SPYA 2G8HA 1A5XA 1OOPD 1WUAA 2K9PA 3SYQA 3KIOA 4BC2A 5AZJA 4JI2B 3VQ5A 3ZX0A 4DR2K 4CFBA 1T03A 4H8KA 3HPOA 3HKEA 3NR7A 3HKDA 1QVFU 2QXLA 2RNBA 3THWA 4ZHQB 4PDWD 2QWNB 4FJXA 3H9VA 2BTQA 1W7AA 3FAVB 1EWRA 4E1JA 4W4LA 1NZ6A 2F66C 4O2BB 3NH1A 4QPJA 1VMGA 4FJ7A 4GV9A 4LF9K 4IJAA 2F95B 2NRWA 1D9DA 4AHSA 3P38A 5FPOA 1U2VB 3JSLA 3D2EA 3K2PA 4JKEA 3SPHA 4YXDA 4BACA 4XBFA 1RT2A 4CS4A 4GW6A 2O8BA 4PWDA 1XL6A 2QWMA 1Y67A 2CTRA 4ZIBA 1MSWD 1MU2A 1QHAA 4CZFA 3M8SA 3UT5A 2B5UA 3CCJN 4LF8K 3KCXA 2F8SA 3DOKA 4CEOA 4B9NA 1S5JA 2KZMA 1IBLO 1ZLZA 2KFZA 3AV9A 1BS3A 4JKCA 1G99A 1Q7YW 3BGRA 3TAGA 5H9CA 1FKAO 3M7MX 3ZYYX 5FLXN 1PPJH 1KB9F 2A41A 1HJOA 4Y1DA 4CHNA 3SPZA 1YJWN 4PJ0Z 3CCQV 1KKCA 3H1LH 4JPRA 3TAMA 5KHGA 1T05A 3SPGA 3ZHVA 4EP5A 4OVLA 4DR1B 1C0FA 4DW0A 1Q86W 3CQYA 2AHZA 4QJFB 4JLHA 1BZKA 1VQMN 4DS4A 5H5NA 5LA6B 3I56N 1TK0A 3VBBA 1KXPA 4FWSA 1U48A 3AG2C 1EAH4 1QQMA 4X65O 4Z1MG 3VENA 2ZJPL 4FWMA 3CJAA 2OTJV 5J2PA 1VEWA 2ATQA 3DTUB 1VQKV 1SA0B 3H1HH 1XNQB 3BA8A 5HRRA 4R5PA 3K0SA 1RP3B 3ZETB 4CJTA 4CK1A 5LMNK 1IZ3A 3TSPA 1C0UA 2Y69C 2XAHA 3H01A 5GTIZ 1BISA 1O13A 5IY5C 5BR8B 1YF5L 2NRXA 3AO1A 1K5QA 3CMEV 4KX6A 2KZZA 4BRGA 2D0PA 3D7EO 1NS1A 4TQFA 3ULEB 2Q1NA 1ZL8B 1BHAA 1PD3A 3PO5A 1EN6A 2JGDA 3AG2B 1RT4A 4AM6A 3ABLB 1JXEA 1YDXA 2RN2A 2DQ0A 4DTMA 1RDDA 4BRIA 1HYZA 3KG2A 3E9OA 4PDVA 4DV4K 3ZS8C 5LBQA 1RT6A 4CJ3A 3NBPA 5B3SC 3OBWA 1LW2A 1RT5A 3IFRA 4H4OA 1EV14 3CXCM 3FLCO 4B9UA 2GELA 4W4KA 2HW3A 1F51A 4OPAA 2E1ZA 5EZYB 4CK3A 1VQ8N 1FJGB 2RMKB 4LF9B 1KFYA 1OV9A 5H2FZ 4GVEA 3W3DA 4DLGA 2ETNA 4J2DA 4J2BA 4LH4A 2LSNA 3OYEA 4FK0A 1V4SA 3EHBB 5EBMC 1BU6O 2RS14 3CJ1A 3F2KA 3R6MA 4CEAA 4JI7O 1ZAUA 3THVA 3OVNA 3TAPA 1GLDG 1WLEA 3DLKA 5KMGA 4F6RB 4Z4FA 4DSJA 1VF6A 1KC8O 2NRHA 3RYHB 3PIPL 2Q4PA 4BR0A 2EX3A 4DK1A 2DYRB 5AQNA 2YEVA 4BVPA 4BRAA 3SMPA 3OHRA 2O8DA 2O57A 3AG1B 2UUCB 1BG3A 1QU7A 1YT3A 1OH8A 5BRFA 3W7UA 2GHYA 4KRFA 5LA6A 1NJIW 4QS7A 2GBOA 1HDJA 3RW0A 1NKCA 2W6IG 3HPHA 3WB2A 2E5LK 1QBZA 4M7YA 1S9EA 3SUNA 4PA4A 3K9KA 4CJSA 2H89A 2D2CB 2IM9A 1SQVH 3BEHA 2BDPA 2MK3A 1JMKC 1Q86O 3ZT3A 4TQDA 4CEFA 3RBZA 4DFJA 3CIRA 3OUFA 3PN1A 1U04A 3CQXA 3KKSA 2D0CA 3LPUA 4GNIA 3QICA 4BROA 1IBKK 3SAFA 3IMXA 1COV4 1OCRC 4CEBA 1S3XA 2CH5A 3SJJA 4CGHA 4BDZA 4FWNA 1SC5B 3VQDA 4DR5O 2FB5A 3K04A 4FM0A 4I55A 2P9IA 2EJRA 4QS9A 3ZSZA 4LF6K 1HXS4 4DFMA 2OZSA 2RQ6A 2KTQA 3O80A 5LL6Y 1QSYA 2CGJA 4EB6B 2BANA 4BR2A 3RVZA 3RRHA 3AEGA 4DF8A 3AG4B 5BRHA 5HRPA 4CS3A 1BL3A 1J54A 5AQVA 2UXDK 4IGGA 4DV3K 3AE1A 1HPZA 3FZHA 3VGMA 4O4LA 1TAEA 4FM1A 4I9LA 2JGUA 5DM6V 2JEXA 4E89A 1HYVA 2HP8A 3QERA 2DWDC 2UUAB 4V19S 3NGYA 1I7FA 2A3ZA 4I7FA 5LY3A 1V55B 1R3IC 3I56V 1S76D 4N47A 3U11A 1VBC4 2WS3A 3AE6A 1A5VA 2WU5A 3CC4N 1Q5OA 2ITMA 1HNIA 1FJGK 5FPNA 4DSKA 2O8FA 1HRV4 4IYIA 4LF5O 1TA8A 5LXTB 2L6LA 2IDOA 1FK9A 3GQHA 4IEEA 1K6YA 3HKEB 4E3SA 3QO9A 3ABMB 1PNKA 4MVQA 3SZ2A 3SUPA 2HHTA 1RTJA 4BIUA 1YCIA 3LP2A 3KCYA 1NOYA 1ASUA 2PW9A 3VESA 2P51A 1C1CA 2FTKA 4MTOA 1NVPD 2GTDA 3H6EA 3CMAN 4KP4A 3OA9A 3CC2N 3BPZA 4MVMA 3CB2A 1X1PA 5ADXA 5HRSA 4RHV4 4JEPA 2YI1A 1FS0G 2JIZG 3M8AA 4PA6A 1CP9A 1SZXA 1YITV 3IUCA 2WC9A 3SFDA 3D2EB 3EZ5A 5IYZA 1D5NA 1RBTA 4BRMA 4QCLA 1V54B 4DF4A 4C23A 2V7YA 4CFCA 1R0AA 4X64O 3H3OB 3AO4A 1H1VA 4K8XA 1AROP 4BG9A 3BP8A 2QTOA 1S6QA 4WYBA 4MSWC 5ELZA 1ESVA 4DV7O 3OBYA 1G15A 4O4HB 4LP8A 3RGBA 3VEWA 4C8OA 2KG7B 2D0OA 1TUBB 3DJCA 2X5ID 4CGDA 4ILJA 2A9HA 4JI0O 4RQEA 4IJNA 4G27B 5C15A 3RYHA 4LWSA 1VF7A 3JAMN 1OCRB 4FL9A 2VWBA 3FX7A 4ABMA 5AQLA 5LJVA 1HNXK 1RDBA 2XY7A 3AEBA 3OTFA 3OYKA 4IL6Z 1KQSM 3N27A 2GV9A 2F93B 4X1YA 2RS34 4CH3A 1HX1A 2AP1A 2VQEK 3BFRA 1NH2B 4B08A 2I7NA 4LH5A 1X9MA 4N56A 4CEZA 3S9HA 3OR7C 2F96A 3P3PA 4FJ5A 2GSMB 4NKGB 1FW6A 4AI8A 5BR9A 2O4IA 4MTXA 4CI6A 2RKIA 1N5YA 2D3OW 4C1NI 4ZHRA 1D5AA 4QGPA 4W5RA 2UUCK 1WA8B 5BMVA 3C6UA 3RVCA 4DQIA 3OGIB 4LH6A 3BY5A 3FFKB 5AQSA 3JS6A 1J95A 2PLV4 4YORA 2R9RB 4R8CA 4X65K 3S3OA 4KO0A 4X89A 1K4DC 3JALA 3APQA 3K79A 1RSOA 4E1MA 5C10A 4LF8O 2ADQB 1NU1H 5C2TA 2QTSA 2PFUA 2UXCB 3CFPA 5C8YA 2NNUA 2IVNA 3B09A 3C7NA 1NGBA 3DC6A 4FJCC 1YEWA 2VQEB 3T1HB 1P7BA 3LWLA 5TISZ 4LF5B 1YITN 2ADPA 4CK2A 4AQYK 4J9ZB 1B92A 2NLXA 3ZSRA 4JTCB 2HJDA 2RF2A 2KKZA 4H5VA 2R074 2W6JG 3AE8A 1T5EA 3C90A 3JD0A 4JASA 3CMAV 1MQTD 3D36C 4B3SO 3CWBH 3VQ4A 4KB1A 2HF4A 1VSJA 3KKYA 1Q82W 4X20B 3C7NB 1XQ8A 2FBTA 1RDWX 2VG7A 3PO4A 5KMGB 4YJ3B 2YCHA 1VF5B 5C93A 4B3SB 2CGKA 3D6RA 3MEGA 2W41A 4DV6O 1AR64 1NG9A 4YOVA 4IIJB 1NH2D 4DFPA 3IC9A 4DUZB 4K41A 2XAJA 3OS2A 4O5FA 3OYMA 1LUWA 4KHSA 1PVC4 3U0ZA 3V1OA 2QKAA 4PQUA 1VQPN 3E22A 3OD4A 4AHUA 1UJWB 2QM1A 4OGCA 1WSFA 3C6TA 3O1WA 2ZDIA 4U3JB 4CECA 3JSMA 2FBWA 1JJ2M 5J1EA 2YDEA 3M1FA 3K0DA 3QBWA 3ENHA 4JI2K 1EN4A 2QWQA 3QETA 1SQBH 4NTXA 1JCEA 1XHZA 3DXMB 1VQ5V 3R3LA 3LDOA 4UQGA 3K9SA 3OYNA 2QM4A 3LP3A 3MXJA 5AQIA 1XDCA 1UFIA 4DV2O 3HI0A 2KQ2A 1IKVA 2HHXA 1VQ7V 3X2QC 3TK1A 3VTIA 5TKYA 3RTVA 2EINB 1NTMH 4J10A 1SERA 2P67A 4CGFA 3AE3A 1RUH4 4KHWA 3BY6A 4DO2A 2OTLV 1SUQA 3HKBB 2QWNA 2YNFA 1NK4A 2UUCO 1GLFO 3ZMVA 1I08A 4AH9A 2L35A 2Y0PA 4GX5A 2ZD1A 2V1DA 3Q7CA 4BRCA 1GN2A 3VOVA 3EKUA 4GVMA 4OJRA 1GK9A 4JI8K 1IBMO 4CJUA 2HWB4 3P4RA 3UIQA 4FYDA 3JSNA 1NLVA 3OY9A 4M41A 4GUNA 1JLGA 3F9MA 2CGOA 1U45A 3IJ4A 4CZKA 2QSAA 4KB0A 4LFAB 4KHPK 1NK8A 1RVF4 5AZJB 4F9OA 4NR1A 3DM2A 4KKOA 4M3XA 1VBD4 3SGIA 3KK1A 4FJJA 1QZ5A 4M63C 4LC9B 1P84F 4C8KA 5F1XA 4UVAA 4I7ZB 3HKCB 3QBXA 3FI7A 3O6WA 2DTUA 4PA9A 5EC1C 4EAHD 4B3MO 2YHAA 4HUGA 4DV7B 3ENOA 3SQ4A 2GUIA 1SETA 1NBMG 3W7WA 2QA4V 1JL2A 2IH3C 3CD6V 4DUYK 4JYAK 1HQUA 1FKPA 1GLBG 4WFBV 3LALA 1FFTB 3T1YK 4LFBK 1AR4A 2GUPA 4O4JA 2CE4A 3CEIA 2B9ZA 3JD4A 3SDLA 3U6FA 3HP9A 4BY9C 4DU4A 4ZI7A 4Q5VA 4X66K 4JF3A 1XMOK 3GL1A 2ZNJA 4MVSA 3ULEA 3M8RA 1OVQA 3VERA 2WLJA 1AI6A 1NGEA 4Z4IA 4H0OA 5GIOA 2R7YA 4M45A 3OYFA 3ABTA 4JYBA 3R1XA 2BSKB 3IAYA 5B1OA 4DUZK 1ZBIA 2ATKC 1R6NA 3DXRB 4B1VA 2QR4A 1KVBA 3MN5A 4DQPA 2DY4A 3T69A 4QE7A 4JYCA 4C1NK 5EVZA 4DUYB 1FAFA 3NF9A 4F2RA 2EZPA 3ETQA 1RTIA 4Z2WA 4PKGA 4CF1A 1KECA 4FWRA 3HR0A 4GX0A 2V7QG 2ETJA 2HHHO 4K43A 4IO9L 3QLHA 4JKFA 2HBLA 1B9DA 1WPBA 2QWPB 5K1XA 1F23A 1MWMA 2Q97A 1D4M4 4NTYA 2H3GX 5CBGA 3ZX3A 4BRFA 3ZRSA 1KCFA 1Q43A 2PAVA 5BRDA 4R6ZA 2W40A 4O4JB 1VQKN 4JKGB 1J5EK 4FVUA 2JK5C 3HK2A 4UV9A 3KHYA 3SNNA 1EETA 2YX6A 1HWYA 4B8CA 1HYSA 1GRJA 1I94B 1KYOF 3VGLA 5AG2A 3AG1C 5L3DA 3VEYA 3QIPA 3VGKA 3OMAB 3EYZA 5JCOC 1IG8A 4FLZA 4YOTA 4QS8A 3QO5A 3ZSXA 2IU3A 4GLXA 1KAXA 1BHBA 4IHJA 4NCGA 3RYIA 3CG7A 3DLEA 5GIPA 1X3MA 3D2FA 3W0LA 1GLEG 5KQ8A 2Q7HA 2QKSA 2P9UB 3WG7B 3MK6A 3E83A 4B1UB 2OIGA 3VQ6A 3WEEA 3THXA 1Z5WA 2Z3YA 2G8KA 1KVAA 1EP4A 1RFQA 2DPNA 1RPOA 2NN4A 5LOVB 3BZKA 2BTOA 3SQ0A 3MDQA 2DYSB 2DFEA 4UXNA 3SYZA 4KI4A 5JCOA 4FSVA 3SMSA 3U9ZA 2QWRB 2PBDA 3THOA 1WNSA 4E2LA 3KLFA 2QI2A 3HKBA 1IV0A 1XMOO 3D2FB 3AVGA 2XY6A 2A42A 3K9AA 4DV4B 2RPIA 4NLCA 2NRTA 2ZJQL 1X9WA 4IG3A 3TAEA 2IAJA 3MN9A 3CRMA 3L0QA 1GN4A 2UU9O 3KJVA 2ZR3A 1QHTA 5CBFA 2W6KA 4H37A 1BI4B 3ABLC 1UAXA 3EFFK 3IDHA 4UV8A 4BR5A 4PDMA 3HT3A 2Q69A 1RNHA 5IDJA 3ZMSA 5IWAK 4TV8A 4ZI7B 4KTWA 1K8AW 4JKHA 3U3YA 2Q8VA 2J4RA 4B9LA 2HVJC 4YTMA 2UXDB 1QLEC 2HBMA 2X6BA 1U97A 2WA3A 3DWLA 1XUQA 3BA9A 3OTOB 4FWLA 4DWIA 2X0LA 2FSNA 1WLJA 1SF9A 5LGNA 3MXIA 4O4IA 2Q7EA 3B8AX 4YJ2B 2YXHA 4TUYB 1VQ7N 2HOEA 4LD0A 3FZLA 1XHXA 4XH4A 4JI3K 1JXBA 4FIPC 2VGMA 3LAKA 1TUUA 4P30A 5EBLC 3X2QB 3K5NA 1HJRA 1JR9A 2WLMA 1VSEA 2V7ZA 3ZMZA 4B3MB 5KI6A 1OJHA 3ATUA 4I6MB 1XI1A 4QOZB 3AEFA 4J41A 1OKJA 4JK7A 4XEIA 3LZIA 2E8AA 1S72N 5BR8K 4B3TO 1YVUA 4DMNA 2DE0X 1XILA 3E66A 1OCCC 4ISEA 3DLBA 2HWC4 2RMU4 1NGAA 3PSIA 3K9JA 1DTOA 3FAVA 2IJJA 2OYQA 4OPJA 3KLGA 3H08A 3MDSA 4H5TA 5SWMA 2O8CB 1RT1A 1M4UA 1CXQA 1B6QA 4E0DA 1CLQA 4CJWA 2RDCA 2HMPA 3E01A 4KL1A 1BT8A 2R70A 4AHRA 4FJGA 4FZ1A 2P9KA 2QE7G 1IVSA 3VQPA 4X88A 4O4LB 4JI5O 2X6NA 5BREA 4WFBL 3L6QA 1K34A 2Q0AA 3CE2A 3OFNG 1ZYQA 1C1AA 1NNEA 1YAGA 3AVFA 4FXDA 3HSCA 4PA7A 3B4SA 1GO3F 1UWBA 3AGRA 3VF2A 1Y74A 1VSFA 3VRAA 1N36O 5AQGA 5B3SB 3JD3A 2ZIMA 3VQ8A 3OYIA 5GAHP 1W0JG 4Q4X4 4PA1A 3AO5A 4IFEA 5BN8A 1E4FT 1T3VA 2HNDA 4CD3A 2Q0OC 3MWTA 3DXKA 2F9WA 3SR2C 3CM6A 3ZSQA 4GB34 5JLHA 3T1YO 1TYQA 2P4VA 3DLHA 3CX5F 5BZBA 1JVMA 2DYRC 3WB1A 3AE7A 1HR0O 1U2VA 2HBJA 1NK5A 3N2GB 2R9AA 5L3GA 1AR5A 5GAGP 3VEZA 5CE3A 3TAQA 4IIJA 3O65A 3VRBA 4EFEA 1ZX3A 1HNZK 3AVCA 1KU9A 1KLNA 2ZGYA 4U67L 4GCZA 1RFYA 2CK3G 5CZ2A 1CZ9A 4GV6A 1RCHA 4BQLA 4DUZO 3DXRA 2A1RA 2ZJRL 1UOCA 3LNMB 1ZBLA 4HWIA 1SL2A 1G4YB 1CZAN 4X20A 1I5YA 2YHWA 5CHIA 4WQ5C 2IGIA 1JLFA 2Q3SA 2YHYA 3QTCA 4MS2A 4FWPA 4YDUA 1WB9A 3KLEA 4FWOA 5JQGA 1FD9A 4EKWA 5FPMA 2ZM6B 1OCOC 4WFAL 1XL4A 4H5WA 3SYPA 4IO8A 3FFIA 4LSLA 2AJQA 3CCSV 4A59A 4WFEA 2G8FA 4HNAB 4D6TH 1NA1D 3H46O 4YOYA 1K73O 1M5IA 5KAIZ 1NVPB 3IG1A 1J6ZA 5AQJA 2H94A 2ZE6A 4CS2A 1SRYA 4TOIA 3EY1A 4DV2K 5GONB 5DECA 1XC3A 1LNQA 4JI3O 3SPJA 4FLWA 3SBTA 2E74B 1MZEA 1XWLA 3QO7A 1M93A 1PM9A 2ZM6O 1WA8A 5BMVB 3JAKA 3ZX6A 4JI2O 5JJNB 1TKZA 4A62A 4DR1K 3DSQA 1S1WA 2HJFC 3O4NA 2Q68A 4DR3O 1IJJA 2D4WA 4KAZA 1ATNA 2ZR2A 3C6AA 4GKKO 5KAFZ 4WE1A 2EIMC 2UUAK 1Z26A 3I0RA 5A9GA 4BC3A 1NR7A 3OM3B 2A3QA 1VSDA 5AQRA 1YTAA 4H0TB 2PZSA 1JJOA 4ICLA 4X1KA 3ZIAG 4FOIA 4F6EA 1JJ2U 2G8IA 4U7BA 4LF7K 4AHTA 1N33K 4UCTA 4BRNA 2QEXV 3OS0A 5FPDA 2JS5A 2HBKA 5AQHA 3RYFA 4EIAA 3NF7A 1VK0A 1NU0A 1P4RA 1SS6A 4EHTA 3T1YB 5HP1A 1K73W 2Q2RA 5AQZA 2R9IA 1V55C 4IHJB 3AK3A 1F7YA 3C6HA 3CCRN 1FXVA 2LGQA 4CBCA 4WQ4A 1F4MA 1QR9A 3OJSA 4XDLA 1HNWK 3QMLA 3AE9A 1QQNA 2CDYA 2ZIOA 1N36B 3V81A 1PNMA 3ZN1A 3UO2A 2QDOA 4JI1K 3CPEA 3ZRWA 4DTUA 2G8VA 3QF7A 3DRSA 2N04A 4MLHA 3OYLA 3ABMC 4RUEA 1HNVA 1RBVA 2AGAA 2CGNA 4ELVA 3RWRD 3M8QA 4EP4A 2FC0A 1NTZH 2JVDA 3KWGA 1CPYA 4CERA 4DV5K 4K8ZA 4W5NA 3A0IX 2Y69B 1PIV4 2UXCK 1P8ZA 2YHBA 4DK0A 4OX9O 4BE0A 4FFBA 2ODMA 3NGZA 5KUMA 2HHVA 1AP6A 4B3RO 4BRHA 3C95A 5KX5B 2CH7B 1DTQA 5JS2A 2F8TA 4YOUA 3J8F4 1GN6A 3E1YA 4XDJA 3M8PA 2WLNA 2CUGA 4JI4O 3I0SA 3JYTA 3HL8A 4JI5K 5L3FA 3VA3A 1K5SA 3VEOA 2Y1IA 2BE2A 3L2QA 1DKGD 2I7PA 1M1KW 3H1KH 4DTSA 2BSKA 1WSHA 2NRZA 4FJKA 2WA4A 2LW1A 1AJPA 2O8CA 1NGFA 3CCJV 1QVGM 3ASNC 4IG0A 2Y1JA 4DV3O 4P9OA 2NR5A 2LW7A 2UXDO 3MAQA 3G0ZA 1VQ6V 2KKWA 1K4CC 3WNEA 3H1VX 4BQZA 5KHKA 3NVMA 1TKDA 4D7TA 5LJWA 3HPLC 3RMDA 1W2BM 4PD4F 4MVUA 4IOXA 4I4TB 3AO3A 1SQGA 1VARA 4DR5K 3VEVA 1YZBA 1Q8IA 1E1QG 1H8HG 4YIPA 1VQLV 3NDKA 4H44B 2EIJB 3RVYA 2N05A 1Z6RA 2QM8A 4JV5B 2C2AA 2VQFB 1PL4A 3DXKB 3S41A 1QR8A 3CD6N 3EE9A 1XMOB 1S72V 2ZE2A 1KD1W 1KP3A 3TTFA 3NH0A 4FLXA 4Z1VA 4FVMA 4KH5A 4DR6O 3O9RA 3UM7A 1YTFD 4CVNE 3L2RA 4JYAO 3ZHQA 1DT9A 1Q9YA 2ZQMA 1TVKB 4B9QA 1ASWA 2NRVA 2LP7A 3NHGA 2I5JA 1POV0 1K33A 4FPPA 1RTHA 2YIDA 3CCRV 3RMCA 1VIBA 2F1MA 1WN7A 1LWCA 3ABKC 1EWQA 4JAUA 4WFHA 4X9QA 2IJHA 3CERA 4A57A 4KXRA 4J2EA 4XDKA 4N23A 4PKIA 1VBA4 4LFCB 1VQ8V 1HNWO 2DWEC 2Q36A 4CESA 1AR84 4Q4Y4 4ILHA 1MDUB 1JFFB 3HVRA 2VQFK 2BH1A 5HBMA 4YOXA 1VSLA 3OYHA 1L1FA 2EHGA 2DFHA 1EO1A 2MW2B 4X8AA 5AQXA 5L3BA 1QVFM 4FLUA 5EOYA 1G8MA 5D3GA 4NB5A 3O5BA 4XH5A 4X62O 3NF6A 2PUSA 4HYOA 3L75H 3A2FA 2IU0A 3I55V 4RCHA 5K14A 2GTSA 2D0AA 1L3SA 1N33O 2P4KA 1DK1A 1FXXA 1Q9XA 1YI2N 4YY3B 1NGDA 1XC9A 4JTDB 1EN5A 5B5EZ 4JKDA 1E1RG 3AO2A 3MXMA 4YFUA 5DMRA 3UCSC 2P9UA 4CW7B 4E4EA 4OKJA 1NJWA 4ZKIA 5ITZA 4IFYA 3G10A 3PX6A 3CCEV 5KX5A 2EIKB 4Q0BA 2QWOA 3ALYA 3T19A 1KAZA 4CIGA 5GAEP 3SV3A 1L0VA 3ZRWB 1S5HC 3L3UA 4JAAA 1NGCA 4BGBA 1VQOV 4FZXC 2XY5A 4LF6O 3AA3A 2X6CA 5B1NA 1NKEA 4I4TA 2CTQA 4LF5K 3ABUA 3VQVA 3C3SA 3P1GA 2VCPA 3L2VA 1FJGO 1YUWA 3TSQA 4OO1J 3ZCCA 4PL8A 2V4DA 3PLAA 4P2ZA 3Q4HB 4ISFA 1SA0A 2B1GA 2DW4A 3O9OA 3R66A 3CFRA 4DR4K 1YJWV 4FK4A 1Y97A 3SBGA 1DF5A 4DV6K 4FCYA 4YIOA 3AG3C 1NQTA 5IYBO 2ZXWB 3ASOC 2PI5A 4B3RB 1TL1A 3AVLA 1SKVA 4G9ZA 1RUE4 3SK3A 3IRXA 4DV5O 4GV3A 5CA0A 4DV5B 3E9LA 3G25A 4MDAA 2DJVA 4CF2A 4MVZA 4CGJA 1NK7A 4EZ9A 1H2KA 1L0LH 3VQ9A 4BIZA 3B6PA 3JCZA 3MCAB 3CCVV 4ZHQA 5B66Z 3FYEB 3AAPA 5J9PC 3A0HZ 4O4IB 4JAVA 4FJHA 1J5EB 3O4WA 3SJQC 1X9JA 4B1ZA 5BPLA 1XNQO 3BCCH 4U7NA 1SL1A 1W0HA 3K57A 4N5SA 3SYAA 4PI0A 1VRTA 2RM24 3OW2U 1IBKO 2P5GA 3VQYA 3DLGA 4E7KA 4BGAA 3KTQA 2QKBA 4E7JA 1T44A 3LDSA 4LFAO 4UFZA 5KGWA 1E4GT 3RYCA 3UO3A 1HUXA 1P90A 3CRAA 5CA1B 2KHOA 2OT5A 4NLBA 4C8NA 4B9TA 3KK7A 4IT5A 2X6SA 3CC2V 3FD9A 2GBZA 2BOBC 3P31A 4GMJB 1YHQN 3T1CA 1HKGA 3QINA 3WXMB 1BA0A 4YY3O 4K35A 4B9MA 4DTOA 3P5JA 3NAEA 1B04A 3ULDA 1SV5A 5LXTA 5J2MA 4DR3K 2WU2A 3L72H 4LF4B 3OEHG 4UB6Z 2YEVB 1IBLB 1LOTB 3HVTA 1WJZA 4KTZA 1RMU4 4H0YB 4ELTA 4L8RB 4AQYO 1YI2V 1E79G 3DRPA 4DV2B 4CHQA 5J2QA 4B9VA 3OUSA 1RUG4 3CRRA 4H5RA 2V51B 1ILYA 1RUF4 3AVKA 2F4VK 4HAMA 4FLYA 2Q9LA 3G4SN 2X78A 3IS9A 1PNLA 1NOZA 4B1WB 1C6VA 2P6JA 1GLLO 4R79A 3CPWM 1JX9A 2IJIA 3VQQA 4A5UB 1YF2A 1R3LC 3GWOA 1WBDA 1H8TD 4HUEA 4FJ8A 3JATA 5TKWA 2WDQA 1TAUA 3WU2Z 3ETDA 3C3TA 4CC6A 1BA1A 1C0MA 1V54C 2QTDA 2YXYA 3THWB 4DV0O 1IH7A 1JOYA 1ITGA 3CCMN 3PY8A 4JYAB 2HLDG 1NGGA 4FO0A 1Z2GA 4CH5A 2FSKA 4K25A 2P9IB 3OYCA 2PY5A 2Q6AA 4FWQA 4CZEA 4HBNA 3JARA 4J42A 5KPTA 3RR7A 2F43G 3FFQA 1VQNV 2UXBO 3DOLA 1QSSA 4B8AB 2YIAA 5CA3A 3CPWU 4CJVA 1QSLA 2VQFO 1IKYA 4JV5O 5EYPA 3CXCU 1N6QA 3LNNA 1KVCA 1SQQH 3AA2A 3G6BA 4DSLA 3BAAA 1NM1A 3MN6A 4GX2A 5M1QA 5HROA 4MQ3A 3O3FA 2B6AA 4M3TA 5AQTA 3ID8A 2Q7GA 4F8RA 5C2FA 1HNZO 1BSMA 2QWOB 3WUHA 3BDPA 5LMNO 1KRPA 1GOBA 5B1BB 2O8EB 5DM7L 2H88A 4DB3A 4BDPA 2HHSA 4BR9A 4I2PA 5F0XA 4DR2B 2FF3B 2UU9K 4DR6K 2AZ0A 5GTHZ 2E88A 1HR0B 4UB8Z 1XNRK 2P7TC 4K3AA 5M1KA 4CGIA 1H2SB 1R3KC 5JH7A 4I0XB 4H0XB 1BGYH 1N36K 5AQYA 4F6RA 1TUBA 4UUJC 4HTLA 2YJFA 4OXSA 1J53A 3TXSA 4QNHB 1TL3A 3QIOA 2QGNA 3HKDB 2R044 3K5MA 1RUC4 3QDKA 4I50A 1RT3A 1I94K 2OPQA 3VQ7A 4A2BA 1XREA 4JI5B 4FPAA 4QAGA 5FRMA 1SQFA 2VG5A 1NK9A 1NR1A 1LAWA 4BW9A 3S3MA 3AAQA 4KH4A 4DFKA 1YJNV 1XNRB 3O9QA 3P32A 1AJQA 3H1JH 1AJNA 3PSFA 3A0RA 1EZVH 4TWKA 4NYFA 1OH7A 1K8KB 3EN9A 4CF9A 3P4PA 1WSGA 3N4QA 2PF4E 3AVAA 4LCUC 3VF6A 4OGEA 4WFFA 3ABVA 5K1PA 3TANA 1I5XA 5M1PA 3VTHA 2D0BA 5JVDB 3IFXA 3WFVA 1GTOA 5HFLA 4DXWA 4DHYA 3V4IA 4BW5A 4JKBA 1XEQA 4GX1A 3FYIB 1GAXA 1BI4A 3ZETA 3CC7V 2P9KB 2Z1IA 4UY8O 3HO1A 2OPPA 5GADP 4O2AB 3LWMA 1U47A 3SFEA 1JQ0A 3LM2A 3SLCA 4MLEA 2IBZH 2HFEC 2WLKA 2E3CA 4CJPA 3PX4A 3RMBA 5IWAO 1RBRA 2BTFA 4NXMK 2E2NA 1VRH4 3VQXA 4ID5A 2Q31A 4F4KA 5AQKA 1OCZC 4CH6A 5J2NA 3SUCA 2P06A 4BRDA 4FJIA 3V1RA 4DTNA 4F3OA 1YTFB 4CEDA 1W0KG 1W9HA 1H2LA 4YSYA 2H8PC 1HQEA 4Q4V4 5DM6L 3ICXA 5FL7G 1XMQO 3JBG4 1NENA 5CB4A 4WF9V 3CP1A 4G1QA 4RW7A 3EEQA 4CZGA 1LWEA 1FPOA 3BVOA 1R6TA 1REVA 3TR8A 1QVGU 4JI7K 4J7ZA 3QNEA 4OLBA 3V9WA 1DF4A 3FB7C 4YSXA 1KTQA 3L9DA 4CHOA 2GWJA 1D2DA 2FF6A 1WB7A 3TARA 1EFRG 1ATSA 4NXNK 3S3NA 1HMVA 2WTUA 2UUBB 2E2OA 1VQ9N 4Z4GA 4JK9A 5KPZA 4YTPA 3ZRXA 1NJZA 4DQQA 2UUBO 3L70H 3N2KB 4LF7B 2ASMA 1QNMA 4TV9A 2N74A 3LDLA 5EYPB 4B3OA 2WP9A 3MX5A 1MABG 1W59A 5IY5B 2UUAO 1VRUA 5ITZB 2YHXA 5AR0A 4GY2B 4CJ5A 4M42A 4GKKK 3STLC 2ZNIA 1GN3A 3QEVA 4BWJA 2QA4N 1A32A 3SJAC 3V9SA 4A61A 3I5DA 5C25A 2O8DB 3RWUA 2NNWA 2OPSA 2P22C 3OMNB 1D4XA 3R8EA 2PYJA 4Z4HA 1S1UA 4Z4EA 1AR94 4CZZA 1WOQA 4WFAV 3O9SA 3E8FA 1M57B 3ID6A 1TV6A 3KZBA 2K1EA 1RGIA 2O8FB 1JCHA 5M1OA 3GVMA 3E35A 1YJNN 4UVCA 2HHQA 4MTGA 1Q3EA 1RILA 1ZP0A 3B8MA 3TI0A 4AILC 4TUYA 3E9PA 1N0JA 2WUSA 1KC8W 5AQOA 4U7OA 2XHBA 4IYHA 3OYDA 2HNZA 4JHDA 2W42A 1ZUQA 3ZN0A 2ARHA 2YI8A 4R7CA 4FMTA 4UVBA 4B7EA 3ZCMA 3TWHA 4L8JA 4Z4CA 1JA8A 2XY8A 3BF3A 4KHYA 1AI5A 3J7AU 4CZLA 4NB4A 1VQ6N 3CI5A 4X1IA 4CCHA 4GKJK 3J7YP 4BRKA 5AQWA 3N2KA 3CYOA 4FW1A 5F2VO 1YTUA 3CJBA 3CIPA 1T7PA 4DLEA 4KFBA 1RUI4 4Q4W4 3ZBHA 4CJKA 3ZMTA 1BL8A 4IXCA 3RN4A 4J2AA 3CXHF 3F5WC 1TUYA 4Q20A 2GTAA 3JAKB 1FFXB 2FL4A 4TT3G 1RBSA 2OIEA 1MNGA 4FFKA 3ZHUA 1S6PA 4WQ4C 3BEXA 4PHZA 3H1IH 2E6MA 3R9PA 4JRQA 4B3RK 1VQNN 3ISNC 1L3VA 1X9SA 1TK8A 3QEIA 4ZTJA 2F7TA 4X1IB 2BCCH 2DQ3A 4BR7A 1IXMA 4DCHA 5C24A 1VBB4 2NUBA 2Z0AA 1GKFA 3VETA 4DQRA 1JCGA 5A2QN 4KV8A 1BCCH 4CHPA 2HVIA 5FRNA 3F7VC 4DR7B 1O9HA 4B3TB 1KBHA 1GM7A 2CTWA 2EJ7A 3BABA 1ZBSA 1RM1C 4LF9O 3CHXA 4PDLA 4JI1O 1NI8A 3HTVA 4I6MA 3RYFB 3U3GA 1SS3A 2IVPA 1LCUA 4WFNL 1W2BU 1Q90D 3TGUH 4FW2A 1T8EA 2HMIA 1TVRA 4PA3A 4WCEL 1US6A 1JLBA 3AY9A 4W5OA 4KHQA 5CYMA 4DW1A 2IH1C 4JV5K 1LUVA 4KHPO 5KUKA 3QEPA 1YVWA 4O4HA 3TCUA 4CIFA 1QCEA 3ENBA 5JJJB 3SAGA 4DU3A 2HEPA 1KFSA 4LNUA 4UCVA 3JALB 3A0BZ 3U9DA 1CXUA 5AQUA 3ZSWA 4JS4A 4ELUA 3KKRA 4DR2O 3WXIA 2Q5ZA 4E7LA 3V6DA 3ETGA 4G28B 1NGHA 3D45A 3A5MC 1L3TA 3O4QA 3FZKA 2WONA 1Y4MA 3L4QA 3O3HA 2XO7A 3DYAA 1HNZB 1GLCG 3AVJA 3ZT0A 3B40A 4DR4O 1IG9A 1RM1B 3HRGA 2EILB 3CS5A 1HLUA 4DG1A 5BXZA 4ILGB 4DTRA 3GE1A 1ZBFA 3ITHA 2QKKA 3VQCA 1N33B 5CYQA 4LFCK 3E22B 1N8RW 2CTPA 2VRZA 4J11A 4DV1B 1RDUA 4A2AA 2VS0A 2ZT9B 1D9FA 2F4VO 2B1IA 4HTUA 1PO14 1N34K 3OYGA 1EBOA 1Q18A 1THZA 3C0BA 2DN9A 3J80N 4BRLA 5I42A 1F4NA 3LDNA 1VP7A 1JFFA 1EXQA 3SI6A 3KLIA 4HCBA 1WSEA 2OTJN 1DLBA 2FSJA 4LFCO 2JEUA 2Z5UA 2YIBA 3M3ZA 4K0KK 4NTWA 4JTAB 5HFMA 4BIOA 3E8BA 4YY3K 3CCVN 4RWTA 1ZTEA 2BTQB 3PX0A 2G8WA 3C94A 2RR14 2HSTA 4CZIA 3NF8A 1RSOB 2OZMA 4JI8B 1SQKA 4DYLA 2R7FA 4KREA 5KRSA 2XAFA 3SJBC 4CZJA 1O9GA 4MW3A 1NEKA 3O8MA 3R65A 2WLHA 1TKTA 4O2AA 4FZ0A 2ITCC 1J9AA 3K03A 5LYJA 2WOMA 4B3SK 1ZOYA 1ATRA 1CEZA 4X64K 5C2DA 4PELA 3SPCA 4CD1A 4LF4O 4FJNA 1YQ4A 1Q6IA 4CE9A 4J7JA 3AA4A 3ZSYA 3CJCA 3G80A 4N21A 3ZEUA 1VSKA 3N4PA 5MLCQ 1K3EA 1VSIA 5T7BA 2XAGA 4GT1A 2A5XA 2P9NB 4RW8A 1NJXA 4DR4B 4NCAA 5AFUA 4BE1A 4I50B 1N32O 3L2UA 3ASMA 5HLFA 1L5UA 4WBNA 1RDAA 5HL7L 1HR0K 2IIRA 1B06A 3K3WA 5AQQA 4X66B 4BVOA 4H0LB 5JQGB 2RN9A 5I3UA 3I8BA 2JWLA 1FXKC 1YQ3A 5JWPA 2O8BB 3LPTA 3OE7G 2JS3A 3VEXA 4HNAA 3FZFA 1AR74 5BY1A 4ZOLA 3OGCC 3ETEA 1BMFG 3RT3C 3AVIA 3T1HK 3JAWA 5FNVB 1YIJV 2OCCC 4BWAA 2Z1GA 3MECA 1J5EO 1ZBUA 3HP6A 3DLLL 4N76A 5J2TA 2A1SA 1CXZB 4JI1B 2Y4UA 3VMFB 4CJFA 4FWKA 1BQNA 4DR7O 3H1QA 4GYCB 4YXWG 4GKJO 3IKMA 4XH1A 4CFAA 4FLTA 3OW2M 1HNXO 4DSFA 1TVKA 4WFGA 1HNXB 2CGLA 5H1SQ 3CFOA 1U49A 3CC7N 3G71N 3J7ZO 1TK5A 1QQOA 1K97A 2NRRA 2VYPA 3F73A 1N8RO 3NGIA 4RQFA 3P30A 3Q4HA 5CA1A 4DR7K 2GX9A 4PKHA 4MT8A 2R72A 3STZC 4JI0B 3JASB 5GW7A 3AA5X 1SKWA 3JAMO 3WNHA 4CEQA 1ZSPA 4YJ3A 2P9PA 5AZIB 3ZHTA 3P4IA 5CB4B 3CQ8A 2KB1A 4C8LA 1OCZB 4DQSA 2P5OA 3MD0A 4TV8B 2Z1HA 3L73H 3K06A 3ZSVA 1BQMA 2YUAA 2Q0UA 3VQAA 4X66O 1JLEA 2PI4A 4H33A 2E2QA 4FLVA 4ISGA 5F2RA 5M1NA 3RFRA 3SPIA 2FMLA 1VF6C 2UXNA 3ASOB 1TUEB 2ZXWC 4BR6A 3OT7A 3CJ7A 4DTXA 4ZTFA 4X64B 4BG8A 3PUFA 3OJUA 3CCLV 3PJSK 4KFMA 2QWPA 2DMXA 3CCSN 3RR8A 1RT7A 1MWKA 1KSPA 1GM9A 1NGJA 2IC3A 1NK6A 4JI6K 1KUQA 1G6UA 2EBOA 3SQ1A 1N32K 4MFBA 4O8KA 4YHHB 2XAQA 5JICA 1N0NA 4E7HA 2EULA 5LGUA 1GOAA 2YXLA 4UCRA 4L3QA 1SKSA 1AILA 1K9MW 3CCMV 3P39A 3MHSC 1LW0A 4YTNA 2UXBK 4ZBMA 3EL2A 1SZ2A 1WAZA 5LMUB 1B9FA 3AK1A 1PKXA
chains in the Genus database with same CATH topology
3QG5A 5EIBD 1KFDA 4DSEA 4EEQA 3V1QA 5LYJB 4E19A 2HB5A 2QJ1A 4HCCA 3HPGA 2F4VB 3HSTB 4H4MA 4BWMA 3K5LA 4NXMB 4NYNA 1XMQB 3LAMA 3VQBA 4HHTA 3DMJA 3F9KA 4FJ9A 4O55A 4DV3B 3KD5E 5LP6A 4CJ4A 1BCMA 2B4JA 4PY5A 1KLMA 4KHPB 4Z0UA 4FM2A 1QS4A 3SQ2A 1BHLA 1JLQA 4CGGA 3NH2A 2B5JA 3AVNA 4M3YA 1SL0A 4W5QA 3LP1A 4KHUA 3HYFA 4I9QA 3SUOA 2CAZC 1P49A 3VA0A 4OX9B 5KRTA 4DTPA 4X1YB 5J2UA 4FZYA 1NJYA 3ZT1A 2RJZA 2YNGA 1UA0A 1F21A 3CYMA 4BE2A 5LP6C 3T3FA 4DS5A 4X1KB 1QTMA 3MEEA 2IS3A 2YV0X 3NCIA 3D0PA 1JL1A 4CEEA 4PI2A 5IJ0B 2QK9A 1S9GA 3KK3A 1IO2A 4CF0A 4U3JA 4EFBA 2KW4A 3OYJA 2ZQBA 3WNGA 4DR3B 4RW9A 2HHUA 2UU9B 1NKBA 1FFXA 4KHNA 3KK2A 2YKNA 2BGGA 3K5OA 3RYCB 1DTTA 4JI3B 4LSNA 4K0KB 1QE1A 4O0JA 4FK2A 2VG6A 2X74A 1WSJA 4CHZA 1SKRA 4O4GA 5KHIA 1BIZA 1Z5VA 2VWKA 5SZTA 3TABA 3V9UA 4AQYB 4EB6A 4RG8A 3DRRA 3RMAA 1L8DA 4DR5B 2HVHA 3K59A 4JRPA 5IWAB 1X4TA 4CC5A 5IYZB 5EZYA 4DU1A 3UQ8A 1WAJA 2HHHB 4B9SA 4KPYA 3HKCA 4HVJA 4LH7A 4W5TA 1S1VA 1IBKB 3ZEDA 3SJCC 1ZBHA 1WAFA 1BCOA 5HRNA 2QKBA 4PUOA 1C0TA 1V9PA 1VSMA 3SUQA 4JI7B 1I39A 1IKWA 4EZ6A 5EIBC 4GKJB 4CIEA 1TGOA 2IOCA 1EX4A 5KGXA 3B2EE 2G8UA 4KI6A 4NXNB 5FPRA 5CZ1A 3T1AA 3VQEA 4CJQA 3QNNA 2PGGA 4I55B 5IJ9B 3K58A 4M3RA 1IKXA 1WSIA 4BDYA 4AHVA 1N32B 3L8BA 4CH4A 1LWFA 3BHPA 2QXFA 4X62B 3OYBA 4OLAA 4X65B 2KTQA 4UCSA 4AHCA 5LP6B 2UXBB 5D5PA 1HW7A 3WB0A 2E4LA 3L3VA 5JS1A 4TSXA 5EU7A 4CFDA 3N2GA 1HNWB 2OA8A 4DV0B 5LOVA 1C1BA 2P1JA 4HUFA 1RBUA 2HNYA 1TAQA 1DGSA 1I3AA 1TKXA 3AVBA 3L2WA 3V9XA 3ZT2A 4FJMA 3DLRA 3WNFA 4DTJA 1GOCA 2JLEA 4JI6B 2FBVA 1EKEA 1ASVA 3QESA 4N41A 3NFAA 4NVPA 3TAFA 4XIUA 3OYAA 2YNIA 3DI6A 3OYLA 5CA0B 2O4GA 2BDPA 2VWJA 1J5OA 1LAVA 1JLAA 3U10A 2E6LA 3RYIB 1UA1A 2XRIA 4WBNB 2FBXA 4IDKA 1D8YA 5JJEB 4E1NA 5C8YB 1A5WA 4FZZA 4O44A 1NK0A 2Z1JA 2FBYA 4IFVA 2OPRA 4KTQA 2YKMA 3KD1E 3JARB 3CM5A 4CHYA 4DRXA 3KLHA 4Q6GA 4CJEA 3BRCA 4M3WA 4LNUB 3HM9A 3LZJA 4LF6B 4LFBB 4C8MA 1RDCA 5KTQA 3RRGA 1FKOA 4UCOA 2ZCEA 2DFFA 4IKFA 4I2QA 3QEXA 5J2TB 1IBMB 4O0IA 4JS5A 4DSIA 1KMIZ 4IBNA 4LR3A 3P83D 3HXMA 4UCUA 3AVMA 3AVHA 4F3TA 5KHHA 3B6OA 1U4BA 1BGXT 4DRXB 4CJRA 5KHJA 5IJ9A 3UT5B 4FFBB 2E5LB 1L3UA 3PV8A 1RTDA 2D5RA 4ID1A 4OPKA 1LV5A 4LY7A 1DLOA 3VQWA 2YIBD 3V9ZA 4M3UA 5D5QA 4DV6B 4DR6B 4NCBA 3LP0A 4YNQA 3SCXA 1S1XA 3OS1A 4CJLA 4ZOLB 4O2BA 1HRHA 1BIUA 1NT2B 5JH7B 3SV4A 4D7SA 1O1WA 1CZBA 3ZSOA 5E41A 2PYLA 4LF8B 4CF8A 4TV9B 5GONA 5JVDA 3NE6A 4OKKA 4M3ZA 1JKHA 2YNHA 4RW4A 5C42A 1QQCA 4JI4B 3CSXA 2PTMA 2YI9A 5IJ0A 4Y1CA 3O3GA 2OWOA 3QEWA 2KFNA 3JATB 4O5BA 5CY4A 3LANA 1JLCA 1Z25A 2HHWA 3ZT4A 4RW6A 5DK5A 4F2SA 3JAWB 5FNVA 4E7IA 4FJLA 5FDLA 5J2UB 4YJ2A 2ZINA 2ITGA 3VN5A 3HJFA 5FROA 1VSHA 4OKEA 3I8DA 1N34B 3QNOA 3MEDA 1S1TA 5LMNB 3JASA 4GKKB 3SPYA 2G8HA 1A5XA 3KIOA 4JI2B 3VQ5A 4CFBA 1T03A 4H8KA 3HPOA 3HKEA 3HKDA 4ZHQB 4FJXA 2BTQA 2F66C 4O2BB 3NH1A 4FJ7A 2F95B 1D9DA 4AHSA 5FPOA 3JSLA 3K2PA 4BACA 1RT2A 4CS4A 4GW6A 4PWDA 4ZIBA 1MU2A 3M8SA 3UT5A 2F8SA 3DOKA 4CEOA 4B9NA 1S5JA 2KZMA 2KFZA 3AV9A 3BGRA 3TAGA 3M7MX 3SPZA 4Y1DA 4CHNA 3TAMA 5KHGA 1T05A 4EP5A 4OVLA 4DR1B 4JLHA 4DS4A 5LA6B 1TK0A 1U48A 5J2PA 2ATQA 1SA0B 1XNQB 3BA8A 5HRRA 4R5PA 4CK1A 4CJTA 1C0UA 1BISA 3AO1A 5BR8B 2KZZA 4TQFA 3PO5A 1RT4A 1JXEA 2RN2A 4DTMA 1RDDA 1HYZA 3ZS8C 1RT6A 4CJ3A 3NBPA 1LW2A 1RT5A 4H4OA 4B9UA 2HW3A 5EZYB 4CK3A 1FJGB 4LF9B 4DLGA 4J2DA 4J2BA 4LH4A 2LSNA 3OYEA 4FK0A 4CEAA 1ZAUA 3THVA 3OVNA 3TAPA 3DLKA 5KMGA 4F6RB 4Z4FA 4DSJA 3RYHB 2EX3A 4DK1A 2UUCB 1YT3A 4KRFA 5LA6A 1NKCA 3HPHA 3WB2A 1S9EA 3SUNA 4CJSA 2IM9A 1JMKC 3ZT3A 4TQDA 4CEFA 4DFJA 3PN1A 1U04A 3KKSA 3LPUA 2D0CA 4CEBA 3SJJA 4CGHA 4BDZA 3VQDA 4FM0A 4I55A 3ZSZA 4DFMA 2OZSA 2RQ6A 1QSYA 4EB6B 2BANA 3RRHA 4DF8A 5HRPA 4CS3A 1BL3A 1J54A 1HPZA 4O4LA 1TAEA 4FM1A 4I9LA 2JGUA 4E89A 1HYVA 3QERA 2UUAB 3NGYA 1I7FA 4I7FA 4N47A 3U11A 1A5VA 1Q5OA 1HNIA 4DSKA 1TA8A 5LXTB 2IDOA 1FK9A 1K6YA 3HKEB 4E3SA 3QO9A 3SZ2A 3SUPA 2HHTA 1RTJA 3LP2A 1NOYA 1ASUA 2PW9A 2P51A 1C1CA 3BPZA 3CB2A 1X1PA 5HRSA 3EZ5A 5IYZA 1RBTA 4QCLA 4DF4A 4CFCA 1R0AA 3AO4A 4K8XA 1S6QA 1G15A 4O4HB 3RGBA 4C8OA 1TUBB 4CGDA 3RYHA 1VF7A 1RDBA 2XY7A 3OTFA 3OYKA 2GV9A 2F93B 4X1YA 4CH3A 4LH5A 1X9MA 4B08A 4N56A 4CEZA 3S9HA 2F96A 4FJ5A 2O4IA 2RKIA 1N5YA 4ZHRA 1D5AA 4W5RA 5BMVA 3C6UA 4DQIA 4LH6A 3S3OA 4KO0A 3JALA 1RSOA 4E1MA 2UXCB 3CFPA 5C8YA 1YEWA 2VQEB 3T1HB 3LWLA 4LF5B 4CK2A 3ZSRA 1B92A 2RF2A 1T5EA 3VQ4A 4KB1A 1VSJA 4X20B 1XQ8A 2FBTA 2VG7A 3PO4A 5KMGB 4YJ3B 4B3SB 3MEGA 4DFPA 4IIJB 3OS2A 4DUZB 3OYMA 4KHSA 3U0ZA 3V1OA 4PQUA 3E22A 4AHUA 4OGCA 1WSFA 3C6TA 4CECA 4U3JB 3JSMA 5J1EA 3QETA 1XHZA 4UQGA 3OYNA 2QM4A 3LP3A 3MXJA 2KQ2A 1IKVA 2HHXA 3RTVA 4CGFA 4KHWA 2YNFA 1SUQA 1NK4A 3HKBB 4AH9A 2ZD1A 4GVMA 4OJRA 4CJUA 3UIQA 4FYDA 3JSNA 3OY9A 4M41A 1JLGA 1U45A 4KB0A 4LFAB 1NK8A 3DM2A 4KKOA 4M3XA 3SGIA 3KK1A 4FJJA 4C8KA 3HKCB 3FI7A 2DTUA 2YHAA 4HUGA 4DV7B 3SQ4A 2GUIA 1JL2A 1HQUA 1FKPA 3LALA 4O4JA 3U6FA 3HP9A 4DU4A 4ZI7A 4Q5VA 2ZNJA 3M8RA 4Z4IA 2R7YA 4M45A 3OYFA 3IAYA 1ZBIA 1KVBA 4DQPA 2DY4A 4DUYB 3NF9A 4F2RA 3ETQA 1RTIA 4CF1A 2ETJA 3QLHA 1B9DA 1WPBA 5K1XA 1KCFA 1Q43A 4O4JB 3HK2A 3SNNA 1EETA 4B8CA 1HYSA 1I94B 3QIPA 3EYZA 5JCOC 4FLZA 3ZSXA 4GLXA 4IHJA 4NCGA 3RYIA 3CG7A 3DLEA 2Q7HA 3VQ6A 1Z5WA 2G8KA 1KVAA 1EP4A 5LOVB 3SQ0A 2BTOA 2DFEA 3SYZA 4KI4A 5JCOA 3THOA 1WNSA 3KLFA 3HKBA 2XY6A 3AVGA 4DV4B 2RPIA 1X9WA 4IG3A 3TAEA 2IAJA 3KJVA 1QHTA 1BI4B 1UAXA 3HT3A 1RNHA 4TV8A 4ZI7B 4KTWA 3U3YA 4B9LA 2UXDB 3BA9A 3OTOB 4DWIA 1WLJA 3MXIA 4O4IA 2Q7EA 4YJ2B 4TUYB 4LD0A 1XHXA 1JXBA 3LAKA 1HJRA 3K5NA 1VSEA 4B3MB 5KI6A 4QOZB 1XI1A 3LZIA 1YVUA 4DMNA 3DLBA 2OYQA 4OPJA 3KLGA 3H08A 5SWMA 1RT1A 1M4UA 1CXQA 4E0DA 1CLQA 4CJWA 3E01A 4KL1A 2R70A 4AHRA 4FJGA 3VQPA 4O4LB 2X6NA 2Q0AA 1ZYQA 1C1AA 3AVFA 4FXDA 1UWBA 1VSFA 2ZIMA 3VQ8A 3OYIA 4PA1A 3AO5A 2HNDA 3SR2C 3CM6A 3ZSQA 3DLHA 3WB1A 1NK5A 3N2GB 2R9AA 3TAQA 4IIJA 4EFEA 3AVCA 1KU9A 1KLNA 5CZ2A 1CZ9A 1RCHA 2A1RA 1UOCA 1ZBLA 1SL2A 4X20A 2IGIA 1JLFA 2Q3SA 3QTCA 3KLEA 5JQGA 2ZM6B 3FFIA 4LSLA 2AJQA 2G8FA 4HNAB 1M5IA 3IG1A 3EY1A 4CS2A 4TOIA 5GONB 4FLWA 1XWLA 1M93A 5BMVB 3JAKA 1TKZA 5JJNB 3DSQA 1S1WA 3O4NA 4KAZA 4WE1A 1Z26A 3I0RA 1VSDA 1YTAA 4ICLA 2PZSA 1JJOA 4X1KA 2G8IA 4AHTA 4UCTA 3OS0A 2JS5A 3RYFA 3NF7A 1VK0A 5HP1A 3T1YB 4IHJB 3OJSA 2ZIOA 1N36B 3V81A 4DTUA 2G8VA 3QF7A 3DRSA 1HNVA 1RBVA 4ELVA 3RWRD 3M8QA 4EP4A 2FC0A 2JVDA 4CERA 4K8ZA 4W5NA 2YHBA 4DK0A 4BE0A 4FFBA 3NGZA 2HHVA 3C95A 5KX5B 5JS2A 1DTQA 2F8TA 3M8PA 3I0SA 3JYTA 3HL8A 3VA3A 2Y1IA 2BE2A 3L2QA 4DTSA 1WSHA 4FJKA 4IG0A 2Y1JA 3MAQA 3G0ZA 2KKWA 3WNEA 5KHKA 1TKDA 4D7TA 3RMDA 4I4TB 3AO3A 1SQGA 1Q8IA 3NDKA 4JV5B 2VQFB 1XMOB 2ZE2A 3NH0A 4FLXA 4FVMA 3L2RA 1Q9YA 1TVKB 1ASWA 3NHGA 2I5JA 1RTHA 3RMCA 2F1MA 1WN7A 1LWCA 4J2EA 4LFCB 4CESA 3HVRA 1JFFB 5HBMA 1VSLA