1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
4DU4A 4DFPA 3E01A 1QS4A 2G8UA 1TKDA 5KRTA 4DLGA 4F8RA 1J54A 4CFAA 3HPOA 5KI6A 3TABA 3ZT1A 4CFCA 3CM6A 3D45A 4MQ3A 3BGRA 3OYCA 1Z25A 4B9VA 1HYVA 1Y97A 3AA3A 3V1QA 3QEIA 1SV5A 4CHNA 2XY6A 3KJVA 2HHWA 1C1AA 4CJ3A 4OLAA 3ALYA 3VQAA 3SI6A 1IKXA 3T3FA 4CEOA 4KI6A 3K5NA 2F8SA 2FBXA 2P5GA 1S9EA 4EP4A 3TAFA 2WOMA 4FJKA 4Y1DA 1S9GA 2QK9A 3PY8A 3HL8A 4W5QA 3F73A 3SUOA 4HCBA 1XHXA 3AO2A 4NCGA 3OYNA 3ZT0A 1RTJA 1RBVA 1QE1A 2YNGA 2RPIA 1KFSA 3CG7A 3CQ8A 2PW9A 1RCHA 4FLZA 2BDPA 1QSSA 2G8FA 2YHBA 4KHNA 5C25A 3DOLA 4Z0UA 4BDZA 3B6OA 3RTVA 1I3AA 3QNOA 5J2PA 4AHCA 4FK4A 1GOBA 3VQCA 4CJSA 3AVMA 1A5XA 1JLFA 5KRSA 4HTUA 1FKPA 2OPSA 3CM5A 4DTMA 4CEQA 3PX4A 1J5OA 2KFZA 1G15A 3VQPA 4FW2A 3KKSA 1L5UA 3CFRA 4KKOA 3ZSVA 3V9WA 1JLGA 3KD1E 4IFYA 4CGDA 4CGGA 3DRSA 4E7LA 4RW4A 1KVAA 2B4JA 4B9TA 4F2RA 2LSNA 3VQ5A 3ZT3A 4BDYA 4CK3A 4N41A 3MAQA 3OVNA 2X6SA 4JRPA 3ZT2A 3VQ4A 4DSJA 2DFFA 4OPKA 3KTQA 1CXUA 1CZ9A 2PY5A 3V9SA 4EZ9A 1UWBA 2X74A 3CFOA 5HRRA 4BE1A 2OPPA 4EP5A 4N56A 3F9KA 3QLHA 4E89A 1UOCA 3OYJA 4NCAA 1JL1A 3AA2A 4XIUA 4O5BA 2WONA 2ITGA 3AVGA 4KHYA 3LWLA 4DSLA 4CHZA 1RNHA 1T8EA 4IBNA 1VSHA 1T05A 1NJWA 4NYFA 4KI4A 3V9XA 4GVMA 4CHYA 3TI0A 1BL3A 4HUEA 1O1WA 3OS2A 4K8ZA 1DTTA 3QO9A 1YTAA 2D0BA 1NOYA 4FLUA 2ZD1A 3D0PA 1LW0A 3TAMA 1BQNA 3VQDA 5KTQA 4DU3A 3KD5E 4KB1A 2RKIA 4M3XA 4CJFA 3KKRA 3AVAA 3QIPA 1BI4B 3NF9A 4CF8A 3OYEA 3AVNA 4DSKA 4KRFA 3VQEA 4KV8A 5T7BA 3RMBA 4CFDA 1B9FA 4M3UA 4GMJB 3KLFA 3ZSWA 3RRHA 1RBSA 2VWJA 1REVA 5HRPA 4KB0A 5HRSA 2XY8A 2IAJA 2D0CA 4B08A 2IGIA 3THVA 2IS3A 4W5OA 4H4MA 1LAVA 1HJRA 3PO4A 3NF6A 4O0JA 3NE6A 4CJRA 3NGZA 4FJIA 3KLEA 1W9HA 2HNZA 3I8DA 1S1TA 4FXDA 1ZYQA 1VK0A 3FI7A 4O55A 4F3TA 3WNGA 4OLBA 4B9NA 5J2NA 3OY9A 4I2PA 3S3MA 2Z1JA 1QSLA 1VRUA 1WSIA 3DI6A 3NFAA 3PV8A 3SQ2A 1BIZA 3QIOA 4KHSA 1RTDA 3NF7A 5K14A 1XI1A 2VG6A 3AV9A 3LZIA 4CEDA 1EETA 3AO5A 3K5MA 3EYZA 4CJ5A 3L2VA 2Z1GA 1RT5A 2FC0A 3LAMA 3QETA 1LAWA 3NBPA 3AA4A 4Z4GA 1CXQA 3O4QA 4CK1A 4IFVA 1S1XA 3HYFA 3RR8A 3V4IA 2P5OA 3OYHA 3DLRA 3M8SA 4MFBA 3L2UA 3SPYA 1KVCA 1WAFA 3AVBA 4Q0BA 1RT7A 2E6LA 2Y1IA 1XWLA 4FLYA 1HNVA 2KFNA 4CECA 1NOZA 4DFKA 2P1JA 1K6YA 4KFBA 3TANA 2R7YA 4NCBA 4CEZA 3M8RA 1KRPA 1SKSA 4K8XA 1S1WA 1LWCA 3G10A 4RW8A 1HRHA 1DTQA 4PWDA 4DTNA 4BDPA 1JXEA 5KGWA 3RMAA 2JGUA 2KQ2A 4O4GA 3VN5A 4BWJA 4OKEA 1IG9A 1FK9A 3OS0A 4FJ8A 4H4OA 2YKNA 4C8MA 4AHVA 4CIFA 1WAJA 4BWMA 4CHOA 3V9UA 5CZ1A 3VQBA 1BIUA 4DG1A 3ZCMA 4C8KA 2X6NA 3V1OA 2KW4A 3ZSQA 4QAGA 1SKWA 3LZJA 3LP1A 5E41A 3RMDA 4E1MA 4F2SA 3AO1A 3K58A 4J2EA 3OYBA 1S1VA 4CEBA 4CGIA 4AHTA 1C0UA 4CJQA 5I42A 4C8LA 2RF2A 2F96A 2ZQBA 5J1EA 1X9MA 4CGHA 1VSFA 1A5VA 4CHPA 4FM1A 1T03A 4ID1A 4HVJA 1YTUA 2HHSA 5FROA 3SV3A 4O44A 3LP0A 4Z4EA 4B3OA 2OPQA 3AVFA 3VQ6A 1UAXA 2YKMA 3JYTA 4Z4HA 4J2BA 1ASUA 4TSXA 4E7JA 3LPTA 3V1RA 4OGEA 1C6VA 4OVLA 3SYZA 4FZYA 1EKEA 1FKOA 4M3RA 4BE2A 1TK8A 4DQIA 2FBVA 3HP9A 4I7FA 3V9ZA 3TAQA 1U45A 2R7FA 4YFUA 4FCYA 3HK2A 4LH5A 1JKHA 3ZSYA 3BDPA 1C0MA 1TAQA 2YNHA 1RT1A 2GUIA 4CERA 3AVCA 4NYNA 3V6DA 2Q3SA 1RT2A 4CJKA 5CY4A 3VA0A 3MEDA 3HM9A 3QESA 1QHTA 1C1CA 3U3YA 1DLOA 3S3OA 1RDAA 3WNFA 1JLCA 4KTWA 3OJSA 2P51A 3LP2A 2BANA 3TR8A 1J9AA 1BISA 5CYQA 1HMVA 3DYAA 1SL1A 3OYFA 4FJXA 1BGXT 1WNSA 2F8TA 1ZBFA 4B8CA 2OYQA 3SUNA 1TK5A 1GOAA 1WSJA 1A5WA 1U4BA 2G8VA 4Z4IA 1HYSA 2HW3A 1KFDA 3CFPA 4L8RB 4CEFA 1D5AA 4C8NA 4LSNA 1RBUA 3OYLA 1Z26A 1ASVA 4E7IA 2KZZA 4I9QA 2HNYA 1KVBA 1S6QA 1TV6A 4Z4FA 3ZSOA 4QOZB 4OKKA 1KLNA 3TARA 2Z1IA 1VSMA 4RG8A 2FBYA 2HNDA 5HLFA 4DWIA 3QEWA 3AVHA 1XC9A 4FJMA 3NH0A 1S5JA 1NKBA 4M42A 4RW6A 4IG0A 1VRTA 1LWEA 1NK8A 4FJLA 3HJFA 3AO3A 4DSEA 1NJYA 4O0IA 2IDOA 3P5JA 3U6FA 3KK2A 1L3TA 3PX0A 4FLTA 2AJQA 1X1PA 1WSFA 3HVTA 3U3GA 3VQQA 3HPHA 2FBTA 3LWMA 4CESA 1X9SA 2BGGA 3SQ4A 2G8IA 1X9WA 1ZBIA 3NAEA 1TGOA 1F21A 1HQUA 3FFIA 4DLEA 4LD0A 3L2WA 2GV9A 4FJGA 5EU7A 1BCOA 1W0HA 4KO0A 1WSHA 4PY5A 1BCMA 4E7KA 2DTUA 1NJZA 1VSKA 1YT3A 4YNQA 4PA1A 1U04A 4N5SA 3KK1A 4PUOA 3RWUA 3HPGA 1MU2A 3HVRA 3DOKA 2XO7A 3L2QA 3K59A 4E3SA 1NJXA 4E19A 3PUFA 1TKZA 5SWMA 1KTQA 1SL2A 3A2FA 2E4LA 1HQEA 3I0SA 2X78A 4ZHRA 3KLGA 4ICLA 1Q9XA 1TL1A 4IDKA 3UIQA 1JLAA 3C6UA 4CHQA 4W5RA 1NK0A 4CJTA 2PZSA 4FK0A 4DMNA 5CYMA 1TVRA 4DTXA 3QEVA 5SZTA 1VSLA 4J2AA 3P1GA 4FW1A 5I3UA 1NKEA 4KHWA 4M3WA 4W5NA 4I2QA 4DU1A 1KCFA 4CF9A 3O3GA 3OYMA 3AO4A 4B9LA 3KIOA 3HT3A 4DTJA 5J2MA 5DK5A 4OJRA 1ASWA 4AH9A 1XHZA 4M3YA 1ZBHA 1WSGA 3B6PA 4E0DA 2OA8A 5HRNA 4CE9A 1CZBA 4QCLA 3G0ZA 3MXMA 3TAEA 4GW6A 2EX3A 1ZBLA 1IKWA 1LV5A 1JLQA 1HNIA 4DQSA 1U47A 4CK2A 2G8WA 4ZTJA 3AVIA 1C0TA 3WNHA 4DQQA 1VSIA 3ULDA 2OZMA 3SNNA 3MXIA 1NKCA 1BI4A 3L8BA 2IOCA 5C42A 4CJWA 1B92A 2HB5A 3ASMA 4LY7A 3K5OA 2B5JA 2E6MA 4FLVA 4EZ6A 4CIGA 3SV4A 3C95A 4B8AB 4ZTFA 4H8KA 1JLEA 4F3OA 1RT6A 2HMIA 4KPYA 3DLGA 5FDLA 4LSLA 2ZE2A 2XY5A 3V81A 1L3SA 3H08A 2RN2A 3MXJA 3C6TA 3S9HA 4M3ZA 5DMRA 4CF2A 2BE2A 4FZZA 2O4GA 1TL3A 4CCHA 4OKJA 1ITGA 3HO1A 3WNEA 1RILA 2IC3A 4FJHA 3ZT4A 1IH7A 1UA0A 4FM2A 3DLHA 2QXFA 1D8YA 4FLXA 1N5YA 3NGYA 3KLIA 4AILC 1RT3A 1IKVA 4BE0A 3PO5A 5HBMA 3M8PA 4B9SA 3LPUA 3T19A 3LDSA 4ELTA 4FJ5A 4FJ7A 4CIEA 3SPZA 4HUFA 3SQ1A 1S1UA 3AVLA 4DQPA 3ZSRA 2Z1HA 3NH1A 3OYIA 2ATQA 3VQ8A 3SZ2A 3L2RA 4FJNA 3TWHA 1Q8IA 4B9UA 4HCCA 2DFEA 1QTMA 3O3FA 4CJ4A 1JXBA 4M45A 5KGXA 2HVHA 3CYMA 1LW2A 3NCIA 1TKTA 1ZBUA 3C94A 4J2DA 3DRPA 3OJUA 4DQRA 4M3TA 4DTOA 4CF1A 1QQCA 4BACA 2A1RA 4I9LA 4JS4A 4DTUA 4CEEA 2XY7A 4RW7A 4DS5A 3K5LA 3DM2A 2D5RA 1YVUA 1TKXA 3ITHA 4DFMA 5J2QA 4CF0A 3QEXA 3DLEA 4UQGA 4C8OA 3K2PA 1NK4A 3OYKA 4Z4CA 4E1NA 1NK7A 3HXMA 4KHUA 2DFHA 2HHVA 1KSPA 4RW9A 1L3VA 2GBZA 1D9FA 2YV0X 4CJLA 4CJVA 3SUQA 2NUBA 1CLQA 1R0AA 4KHQA 4CFBA 4KTZA 3RMCA 5HROA 1RDCA 2A1SA 4IKFA 4Q5VA 3LAKA 1SUQA 1RBTA 4OPJA 4HUGA 4IG3A 2JLEA 4JLHA 3SCXA 1VSEA 1D9DA 4F4KA 4DSFA 2YNIA 1IO2A 3P83D 4N47A 2HHXA 2XRIA 3MEGA 3NF8A 3SJJA 1BQMA 3NDKA 1QSYA 4DFJA 3L3UA 2G8KA 2HHTA 2KZMA 4CJEA 2HHUA 4FLWA 3T1AA 1GOCA 1RT4A 4CJUA 3MECA 4AHUA 4DTPA 1VSDA 3K57A 3QEPA 1UA1A 1LWFA 3JSMA 4CJPA 3LANA 3OYGA 3VA3A 1Q9YA 1TAUA 4KTQA 3M8QA 1WN7A 1L3UA 4DTRA 2Y1JA 2XHBA 2I5JA 3LALA 2PYLA 1VSJA 2ETJA 2PYJA 1C1BA 3IS9A 4JRQA 3NGIA 5FRNA 1HYZA 3OS1A 3AVJA 4B9MA 4ID5A 3O4NA 4ELUA 2D0AA 5D3GA 2HVIA 4CGFA 2W42A 3NHGA 3S3NA 4OGCA 1BHLA 2OPRA 1RBRA 3QNNA 3PX6A 3RR7A 5CZ2A 1B9DA 4FZXC 4W5TA 1WSEA 2KTQA 1I39A 3SQ0A 2VG7A 3KLHA 4FJJA 1IKYA 4LH4A 3VQ7A 3RRGA 1HPZA 1JLBA 4KAZA 1T7PA 1JL2A 4DSIA 1FXXA 2VWKA 4ELVA 3L3VA 2YNFA 4AHSA 3TAGA 3OYDA 2VG5A 1N6QA 4E7HA 2B6AA 1EX4A 3QINA 3IAYA 4DTSA 4WE1A 4DS4A 3I0RA 4N76A 4FYDA 4FK2A 3TAPA 2HHQA 1RDBA 3SUPA 1NK5A 4PQUA 1U48A 1WLJA 3IRXA 4M41A 3HP6A 1EXQA 3HSTB 2QKKA 4Y1CA 4KREA 5HP1A 2O4IA 3ZSZA 4HHTA 4CEAA 1NK9A 3QERA 4DF8A 1EP4A 1TK0A 3ISNC 4G1QA 3ZSXA 3KK3A 1U49A 1SL0A 2DY4A 2EHGA 3DRRA 3IG1A 4CGJA 4FVMA 4R5PA 2G8HA 3DMJA 5C24A 5FRMA 3MEEA 3DLBA 3VQ9A 4AHRA 2OZSA 3EZ5A 4JS5A 3LP3A 5JS1A 4FM0A 1SKRA 3OYAA 1J53A 1NK6A 1S6PA 2QKBA 1KLMA 4FJ9A 3EY1A 3NH2A 5JS2A 1RTIA 3O3HA 3AA5X 2YHAA 3AVKA 1RTHA 4DF4A 3DLKA 1RDDA
chains in the Genus database with same CATH superfamily
4DFPA 4WYBA 5M1QA 1G99A 4EAHD 2Q7GA 3E01A 1QS4A 2G8UA 5KRTA 5GAHP 1T44A 2VQEO 1J54A 2RQ6A 1IBLO 3EE9A 4B3RB 5M1OA 2YEVB 3CM6A 3ZS8C 3D45A 3BGRA 4WQ5A 3T7ZA 3OYCA 5JJNB 3S41A 5M1PA 4HZ3A 2XY6A 2GTSA 1W7AA 2ZCEA 4CJ3A 2WSSG 3L6QA 3SI6A 1IKXA 3AE7A 4KI6A 5LHIA 2LGQA 5LA6B 3K5NA 2P5GA 2HKOA 2LP7A 1S9EA 1VF6C 2WOMA 4I0XB 3OW2M 4Z2WA 3HL8A 3AE2A 3SFDA 1GLFO 3TTFA 2OIEA 3CXHF 4NCGA 3OYNA 1BS3A 1Y4MA 2ZXWC 3ZT0A 2YI1A 2PW9A 2YNGA 2WTUA 3IJ4A 5AQKA 1FXKC 2JEUA 4CH5A 1VQ8V 4I5SA 4YDUC 3GWOA 3O1BA 4FLZA 4UXNA 1QSSA 2BDPA 5C25A 5L3CA 3DOLA 3HOTA 4JHDA 2FLOA 4Z0UA 3B6OA 1KQSM 3RTVA 1I3AA 4DV3O 4JI0K 4MLEA 2UXDO 3CCRN 1OCZB 1OCOC 1GOBA 4G2KA 1A5XA 1GN6A 3AVMA 5KRSA 3STZC 4HTUA 4DTMA 2KFZA 4CEQA 3BPZA 4CVNE 4GUNA 1G15A 3VQPA 4FW2A 2L6LA 1G8MA 1SA0A 1VQPV 1SERA 3UCSC 4JAVA 3LSSA 2YICA 3KG2A 2P9PA 4CGDA 3DRSA 4E7LA 3JAKA 1VQNV 1BGYH 3MAQA 4CK3A 4JRPA 4DV2B 1AROP 4N41A 4Z1VA 4H0TB 4DB3A 3VEZA 4DR2K 1U2VA 3VPZA 4J7ZA 4R6ZA 4IEEA 5C15A 3CCSN 2Q1NA 4BR4A 2OPPA 3LDLA 2XAGA 3F9KA 4ILHA 4CBUA 1UOCA 4N56A 4LF9K 1JL1A 3ID6A 4DR5O 1JOYA 3AVGA 3BFRA 4UV9A 1GM8A 3CXCM 1WOQA 3CYOA 4IBNA 1VSHA 5LOVA 1QCEA 5AQVA 4ZHQA 3TI0A 1T3VA 4YOYA 3RWRD 1BL3A 2WDVA 4X62K 1O1WA 3JCUZ 1J5EK 3MDSA 4PD4F 4FPBA 4JF3A 3JYCA 1YCIA 4R7CA 3QO9A 1VMGA 1RDUA 3D0PA 5EBLC 1AILA 1BQNA 3WEEA 1VF7A 3KD5E 4KB1A 2RKIA 5LL6Z 3KKRA 3QIPA 4J41A 3OYEA 2GUZA 5BXZA 3UKMA 3VQEA 5T7BA 3RMBA 3AG4B 1B9FA 3SPHA 3AAPA 3ZETA 4O8KA 3AG4C 3AEAA 2VWJA 3CP1A 2DYRB 1MA1A 1AI6A 1B04A 3OUFA 3C6AA 3A5OC 1Y76A 2IH1C 2PUSA 2UUBO 2P9LB 2IS3A 3HBTA 5AQZA 4MDBA 4B3SK 1RUF4 1SESA 3ASNB 4O0JA 3CB2A 4A59A 4CJRA 5KMGA 3NGZA 2UUAO 3JD74 3ASNC 4P9PA 4TQDA 3J80O 1NNEA 1NH2B 3CCMN 5FL7G 1NI8A 2RJZA 3ZHTA 4MLHA 4F3TA 2EULA 1WLEA 2UYTA 5AJ3K 1N32K 3AY9A 2NRHA 3RT3C 1EO1A 4YTPA 1BIZA 4H0YB 1RTDA 1BL8A 5KX5A 2VG6A 1VQ6N 3WFVA 5CBFA 3HSCA 1BHBA 1H2KA 4LF4O 5GAGP 1IJJA 1OCRC 3TSPA 3NBPA 1KXPA 5BR9A 4JAXA 5B1BB 1CXQA 2P22C 3O4QA 5B1BC 2EIKB 4IFVA 3HYFA 4CZMA 3N27A 2EIKC 1Q43A 2Q31A 2P9NB 3JXUA 4Q4Y4 2FYUH 1FAFA 3AG3B 4O4LA 2IJJA 4IO8A 1HNXK 2AGAA 2Z0AA 1RT7A 2E6LA 2Y1IA 1N0NA 1PO24 1XMOK 3JD2A 4GZRB 5CBHA 4ZI7A 4DR4B 4KFBA 3M8RA 1KRPA 2R72A 3Q4HB 4BRPA 4MTGA 4K8XA 2F4VO 1YITN 1HRHA 2HLDG 4PWDA 3E22B 4U67L 4DTNA 4EHUA 4BDPA 3WXIA 2ASOA 3RMAA 3RFRA 4BWJA 3VENA 3N2KA 4FJ8A 2O8DA 5BY1A 4YJ3B 5I9EB 3QTCA 3MDQA 4PDMA 1VBC4 4BW5A 5JVHL 3RYFA 2V52B 1MABG 3WT0A 2E1YA 1E1QG 3LZJA 3LP1A 3RMDA 3QO8A 3K58A 2P9SA 3OW2U 3TXSA 3H1VX 1C0UA 3O9UA 4C8LA 5H6QA 4GLXA 2F96A 2ZQBA 5KHKA 3CCLN 2RS34 1PV0A 1A5VA 4CHPA 4FM1A 5LJWA 3CIRA 2HHSA 5FROA 5FPMA 3E89A 5AQSA 3JASA 4LF6B 4B3OA 4E2LA 2OPQA 1OOPD 2OTLV 1M57B 1OHHG 4YY3B 2CTPA 3UT5B 3W7SA 4B3RO 1ZXOA 2QWQA 2BOCC 2ZE7A 4OVLA 3SYZA 1EKEA 1FKOA 3ZX6A 4M3RA 3THWB 3HP9A 2EJ7A 5KQDA 3ZRWA 1IZ3A 4YFUA 4UFZA 1W97L 3ZSYA 3BDPA 1C0MA 4JI2B 1TUEB 4IIJB 1LR1A 1OH5A 3AVCA 1X9JA 3CCVN 2QKAA 3V6DA 4CJKA 1KMIZ 3MEDA 4AQYK 4I9WA 2HVJC 3U3YA 2CGLA 1ZC6A 4A5AA 4LFBB 4PHZA 1JLCA 3C0BA 4KTWA 5ADXH 4DV6K 2BANA 4L3QA 5BN9A 4A5UB 3DYAA 5AQTA 2PI5A 2F8TA 2XAJA 1ZBFA 1THZA 1EWRA 3CCJN 1GOAA 1B3QA 2P4VA 3JCZA 4GV6A 5KUKA 1U4BA 4LWSA 2P9UB 3CFPA 5B1NA 4L8RB 1BSMA 4IYHA 1VQ9V 3CXCU 4GB34 5ELZA 1YF2A 4C8NA 1VQON 4MTFA 3OYLA 3LSQA 2QWLA 3SYAA 1KVBA 3RYHA 1S6QA 4Z4FA 4QNHB 1P7BA 4OKKA 1KLNA 4Q4X4 4EFHA 1NGCA 2MK3A 1H2SB 1SZTA 2XNDG 1XC9A 1VBA4 4NR1A 1S5JA 4I4TB 4DV4B 1L8DA 3ETDA 4RW6A 4CZFA 1NKBA 4M42A 1VRTA 1LWEA 2V7ZA 1NK8A 3N2GB 3AO3A 4O0IA 5IT9O 4DV2O 1SZXA 3E35A 4H33A 4BW9A 1WSFA 3SJBC 2HSTA 4BRQA 4PELA 3JATA 5GW7A 3EN9A 3HRGA 4DV5B 2NN4A 2WLLA 1WP8A 5KLVH 2ZWHA 3ZLJA 1X9WA 2UXCK 1LNQA 3ABVA 4DR3K 1RM1C 3KCXA 4BAYA 3THYB 4FJGA 2D4WA 3FB6C 5EU7A 5LJVA 5AQFA 4E7KA 1SQXH 2FF6A 1SQBH 2XTAA 1YT3A 2W6KA 5BR8B 1HR0K 4PUOA 3SYQA 4WCEL 4YJ2B 3E9LA 3K59A 3H1JH 2HBMA 1NGAA 1NJIW 3I0SA 2E4LA 1O9HA 5EK0A 4ICLA 1GK9A 4P9OA 1TL1A 3UIQA 1EFRG 2EILB 1NJIO 2PZSA 4CBWA 2EILC 1M90W 1Q6IA 2L35A 1I94B 1TVRA 1C0GA 1VSLA 4FW1A 5I3UA 3GQKA 1MWKA 5J2TA 3FX7A 3ABKB 1KYOF 1M90O 4U3JA 3OYMA 2IH3C 3CRAA 1YJWV 5L3FA 3KIOA 4X66K 1YIJV 5DK5A 4E4EA 4OJRA 1ASWA 2Q67A 3J7ZO 3B6PA 5AQRA 4E0DA 1VQ4N 5HRNA 3TGUH 1JMKC 4RUEA 4CE9A 4YT0A 1Y64A 2V7QG 5JVDB 3TAEA 3P4PA 4GW6A 1FXVA 1LV5A 2YSUB 5J9PC 2R9AA 4H0PA 1EN5A 3AVIA 1ZTEA 2GUPA 2FB5A 3E9PA 1SQVH 5IWAK 3VR8A 4O2AA 1QVFU 1AVMA 2AHZA 1S3XA 3MXIA 4J9ZB 3W7WA 1EZJA 1GN2A 2BCCH 1H8HG 1BI4A 2AA4A 1JVMA 4DQ8A 1V4SA 4TUYA 2E75B 3IMXA 2IJKA 2KSDA 3K5OA 3VEYA 3L4QA 4NVPA 1JQ0A 2N05A 5JJEB 3UE5A 1R59O 2ASMA 4LF8K 2JWLA 1NTKH 3C95A 2B76A 5CA0B 4H8KA 2QWRA 3CHXA 5CBGA 4YHHB 4KPYA 4H5NA 3IFXA 2HHHB 3DLGA 1XDCA 3V81A 3LNMB 2UU9B 2E76B 2KKWA 4O4IB 4U7NA 5JQGB 5DMRA 2Q7EA 4PDVA 2CE4A 4IYIA 4DR4O 2CH6A 2LJ2A 5EYPB 3RBZA 2Q0OC 1RILA 2FF3B 2O8CB 2QTDA 3ABMB 3WXLA 4FM2A 3SBTA 3ABMC 2QXFA 1ZP0A 1D8YA 4J10A 4L87A 5C8YA 1YAGA 3NGYA 4AILC 1N32O 1BO5O 2OTJV 3PO5A 5KPZA 1K5QA 1POV0 1IG8A 2HJDA 5DEDA 4O4JA 4FJ7A 3H3OB 4ILGB 3UKUB 3SDLA 2P9IA 3NH1A 1WPBA 3L2RA 1I7FA 4I7ZB 4HCCA 2ARHA 4JI4K 3JATB 3O3FA 3FZLA 5KGXA 3CYMA 4LC9B 2YIAA 1NGDA 3BEXA 4DQRA 5BZBA 4DTOA 1QQCA 2E2OA 2YJFA 3MMVA 2LQTA 4BRMA 3VQXA 4MO5A 4CEEA 4RW7A 5ADXA 2XY7A 3BF1A 3MN5A 3JARA 2QWOA 4DFMA 5KPTA 1RPOA 3E8BA 4LF6O 2Y0PA 5LYJB 4H5RA 3ULEA 2YIBD 2HR3A 1NK4A 1S3JA 4GX0A 4ZIBA 3O9SA 4Z4CA 3F9MA 4H44B 1NK7A 3VQYA 4KHUA 1HRI4 5J2UB 3CE2A 2WUSA 2EZOA 1D9FA 2ZNJA 2WFBA 1VQ7V 1E4GT 3OFNG 4CJLA 1CLQA 3WXKA 3MX5A 4J42A 3RMCA 4IWVA 1RDCA 4O5FA 5IJ9A 2O8BB 4JI2O 2NLXA 1E1RG 4KH6A 4JLHA 1VSEA 4BQZA 4IZ9A 4F4KA 1KFYA 1KF6A 5J2TB 2OIGA 3JALA 1IO2A 2YNIA 3CJHB 3DXRA 3KK7A 3W3DA 2E20A 3CHWA 4LFBO 4MVMA 1HKCA 4DFJA 2CTWA 2G8KA 4DV7B 2HHUA 5AQXA 2BH1A 4R50A 1RT4A 3NMUA 3K57A 2ZIMA 3G71V 4TV9B 1UA1A 4JI3K 2LW1A 4FWLA 2VQEK 1IBLK 5AFUA 2BTQB 2HVKC 3UO2A 5FRNA 1HYZA 2QWPA 1ZL8B 3OS1A 4WFAL 4UVAA 3IC9A 2QM1A 4ID5A 1SAZA 3O4NA 1RUD4 4YOXA 3AECA 3ZMVA 2VQFB 1HNZB 1QLEB 3PX6A 3RR7A 1K8KB 5CZ2A 3VRBA 1B9DA 1XOUA 2ASPA 1I39A 3ASOC 4FWNA 3VQ7A 3RRGA 4R79A 1PM9A 1NR1A 3RGBA 2YHXA 4ELVA 4C23A 4AHSA 4XDKA 2FSKA 5L3GA 3OR7C 3CMEV 3IKMA 4FFBB 4DV6O 1I0HA 2QEXV 2I7NA 2UXBK 1K97A 1SQKA 2QDOA 2J4RA 4WFEA 3OE7G 1E4FT 4CJ7A 1JPXA 1DKGD 1NK5A 5BR8O 1K73W 4M41A 4JK9A 1JJOA 1EXQA 1XQSC 4KREA 4I6MA 4MO4A 5LBQA 3CC4V 1TK0A 4X9QA 2DY4A 2DYSB 3DRRA 3LNNA 3A5NC 2DYSC 3DMJA 2PGGA 5C24A 1DF4A 2Q0UA 4BRHA 4CZKA 5FRMA 4GKJK 3WG7B 4AHRA 4GV9A 1I94O 4GX1A 3M3ZA 4CZZA 2FBWA 5K1XA 3WG7C 1S5HC 1MNGA 4A62A 5C2DA 1D2DA 2Q73A 3G4SV 1KLMA 1URFA 3WQUA 3I56N 1SC5B 2ADPA 3D2EA 1EWQA 4DR5K 3DLKA 4EFBA 5FNVB 3OGCC 4BY9C 4Q0BA 3AK1A 1BG3A 3KVGA 5TKWA 3E86A 1V55B 3ZBHA 3A5LC 3SLCA 2ZGZA 4CFAA 3HPOA 5KI6A 3TABA 2GELA 4CFCA 4MQ3A 3SMSA 5DECA 4D7SA 4IHJA 3HOSA 1HR0O 1Y97A 3RYCA 1SV5A 1Z05A 1GM9A 1F4NA 2ZF5O 1EQYA 5A2QO 3K9AA 4CHNA 4DR7K 3HZ6A 3VQAA 2RM24 3T3FA 4YXDA 2JDIG 1YJNV 4A2BA 1HKBA 4EP4A 3VGMA 4MT8A 4GKJB 2LFRA 4Y1DA 1P7GA 2ZD9A 3D3IA 3JAMO 4JGSA 2QK9A 3P30A 2ZGYA 4JKEA 1JFFA 5BMVA 4YHHO 1XHXA 4X1IA 2HHHO 3J8AA 3TTDA 1KAZA 2UUBK 4IJAA 2UU9O 5EZYA 1RBVA 1QE1A 1M1KW 2RPIA 2HWC4 3CQ8A 2IIRA 4FWOA 1RCHA 3K9SA 5AQYA 4BC5A 2YHBA 2G8FA 4KHNA 1R1BA 2ILMA 3O6WA 1QHAA 4F4LA 3AE1A 4WF9L 1JX9A 5LXTB 5AZJB 4DV0K 3QO5A 4JD2A 5J2PA 2WS3A 1MOFA 4FK4A 1NLVA 2CDYA 2KB1A 3O9RA 3VQCA 4CJSA 1ILYA 1FKPA 2OPSA 5TKYA 1BT8A 4LF4K 4BREA 2X5ID 3SPGA 2ZR3A 3STLC 3KKSA 4MTXA 4X20A 1RUE4 2A06H 3EE8A 4KKOA 3ZSVA 3KD1E 1Y74B 3O9OA 5LGTA 4RW4A 2B4JA 4B9TA 4BRFA 4BVPA 1JCGA 3FZFA 3U11A 1MZFA 1V54C 4PV1B 3RVYA 1Z2GA 2DFFA 4OPKA 1CZ9A 2ZDIC 4IDHA 4EZ9A 3HB3B 3CFOA 5IYBO 3D36C 2GDSA 3QLHA 1WPXA 3M8AA 1XMQB 3AA2A 4UUJC 2ITGA 3BF3A 4BQLA 4CZLA 3LWLA 4DSLA 4AI8A 1T05A 3CMAV 4A61A 2F7TA 4NYFA 3F2KA 4GVMA 2ZJPL 2F4VK 3VEOA 3E8FA 4PL8A 1SQQH 4H03B 3QBXA 5LMUB 3CRQA 5EC1C 5EOYA 4C1NI 1YTAA 4PDWD 1Q86W 2P06A 1LW0A 2EWSA 2CUGA 5KTQA 3VQDA 4WFNL 1Q3EA 3OTFA 2Q7HA 2VGNA 4AM6A 2XAFA 4CJFA 4KRFA 3BCCH 4N23A 3SPJA 4B7EA 3AVNA 4CFDA 5GIOA 1XUPO 1P49A 3VBBA 3D8CA 3GG4A 1WUAA 1REVA 4IO9L 1FXKA 1TVKA 2XY8A 4V19S 1VQLV 2IGIA 2E88A 4W5OA 3A0HZ 4DV7O 4H4MA 1HJRA 3PO4A 1NA1D 3AEFA 3KLEA 1Z7S4 5KPRA 3P31A 2HNZA 5HL7L 1KC8W 2F1MA 1S1TA 4CC6A 4MDAA 3ZRSA 3VEVA 2QWMA 4FXDA 3SJCC 4F6RA 1ZYQA 3AG1B 1N36B 5LY3A 4B9NA 3S3MA 4I2PA 2Z1JA 1WSIA 4X64B 4B3RK 4GVEA 1D4M4 1BMFG 1P84F 4D7TA 2BTFA 4CZJA 1R6KA 3NF7A 3I55N 4KXRA 2OT5A 2HOEA 3W7XA 2JGDA 1EZVH 3BZKA 5AQNA 1X4TA 3QO7A 3ML0A 1RGIA 3E83A 2VQFO 3L2VA 2UXNA 2FC0A 3BRCA 2HBKA 3LAMA 4PKHA 1S76D 1N33B 5CB4A 4CK1A 1BUPA 3H1LH 3SGIA 2RR14 1U96A 4RTFD 1NG9A 2Q97A 1AL24 1JFFB 3IFRA 3OYHA 1XC3A 5CN0A 3DLRA 3P38A 3M8SA 1HXS4 3L2UA 3CETA 1PL4A 1N34B 3FZMA 3SPYA 3AVBA 1MSWD 4CBCA 4YSXA 1HNVA 2KFNA 2Z5UA 4B7KA 4DFKA 2P1JA 3D2FA 3WQTA 3TANA 3PIPL 1CPYA 4BGAA 2WPDG 2O8EB 2IW5A 1BA0A 4NCBA 3MD0A 4A2AA 4YSZA 5GONB 1S1WA 4BIUA 4B3MK 3VA3A 3G10A 4X65B 5EXWA 5IYZA 2E2NA 4NTYA 4OPAA 3VN5A 1IG9A 1L0NH 1WP7A 4OKEA 3OS0A 3L73H 4DCHA 4H37A 1WAJA 5LGNA 2UUCK 4BWMA 1NU0A 3VQBA 2Q0AA 2WDQA 4MVUA 4DG1A 4C8KA 2X6NA 1EAH4 3V1OA 1AJNA 3LM2A 3ZSQA 5KA5A 1SKWA 3E2EA 1NCQD 2W40A 4DV2K 5E41A 1FFTB 1Q5OA 3U8XA 2DWDC 3CX5F 4J2EA 1S1VA 4CEBA 3ZMUA 3X2QB 3PIOL 1FFXB 1S0VA 3AGRA 3G80A 1PP9H 1RPRA 2VS0A 2GX9A 4AHTA 4CJQA 1XNRK 4GX5A 1X9MA 4CGHA 2OCEA 1T03A 4FWMA 3C3SA 2R044 4MW3A 3ZEUB 4BR5A 4JKFA 3A0BZ 2UXBO 1Q6UA 4EHTA 3LP0A 3LUTB 2ZM6B 3JYTA 2FMLA 1RUI4 2EIJB 3QB0A 1YI2V 3LPTA 2EIJC 4FZYA 4GKKK 4P30A 4MVSA 4BE2A 2FBVA 4B3MB 4E1JA 4BRAA 3E9OA 4FFKA 3V9ZA 1U45A 2IVOA 2DQ3A 3VESA 1OCZC 2IU3A 1H8EG 4LH5A 2A3QA 4RCHA 2GTAA 1TAQA 1RT1A 1TUBB 4OX9B 4CERA 1SKVA 3QG5A 3IUCA 4GKJO 2ZJRL 1DLBA 2UUCB 1RT2A 4YOUA 3FE1A 3VTHA 1P4RA 4JASA 1BHAA 3S3OA 2RNBA 1RDAA 3WB0A 4QJFB 3K0GA 1VAZA 3LP2A 2NRXA 5CYQA 2BSKA 3TR8A 5H6RA 4KFMA 1HMVA 3CF5L 1SL1A 1F4MA 1HP8A 1BGXT 2XT9A 3AE4A 2CH7B 1TK5A 2ACZA 1XNRB 1J5EB 1NGJA 3EFFK 3UO3A 2G8VA 1HYSA 2QKSA 3T1HB 4CEFA 1AB3A 1VP7A 4LSNA 1QVGM 4H5WA 3AEGA 2P9KA 4E7IA 4JI7B 2HNYA 2CTQA 2NNUA 2QM8A 3QF7A 3EL2A 3GOIA 3QFUA 3ZSOA 5AZIB 1W2BM 3TARA 1B6QA 1NGEA 2FBYA 2HNDA 4GKKB 3QEWA 3AVHA 4MTOA 4PA6A 4PKGA 4DR7O 2A40A 4HTLA 4JV5B 3HKBB 3R66A 3DXMA 4ILJA 2Q6AA 1SF9A 3C65A 4O2BB 2M6YA 3BABA 2Q0RA 3KK2A 4J11A 2PFUA 4IL6Z 3U3GA 4HNAA 1KKDA 3HPHA 4EB6A 1IVSA 4CESA 4IFEA 1P8ZA 2DYRC 4B1WB 5C2FA 2EINB 2X6AA 1SS6A 1ZBIA 4CH3A 1YJ9N 1XMQO 1TGOA 1HQUA 4UCVA 3FFIA 2Q68A 2X7RB 1YF5L 4DLEA 3L2WA 4LNUB 1IURA 2GV9A 4DR4K 3J8F4 1W0HA 3AE9A 1WSHA 4PY5A 4KL1A 1BCMA 2A79B 4LF5B 1VSKA 3KK1A 4PA1A 2Q69A 3HPGA 1MU2A 4JZ2A 3HVRA 2XO7A 5LMUO 1RSOA 4E19A 3PUFA 5SWMA 3OTOK 5FPOA 3A2FA 4DV0O 1PD3A 2Q2RA 3OHRA 1Q9XA 2WLJA 4AM7A 3CJCA 3DC6A 3C6UA 4WQ5C 2H3OA 2YHWA 1ENVA 2QTSA 1Q18A 4DYLA 4R8CA 3ZN0A 5IDJA 4FK0A 4M7YA 3QEVA 4DTXA 3CCRV 4J2AA 1NKEA 1GKFA 1YDXA 5H2FZ 4DU1A 1R3JC 1KCFA 4ISGA 4CF9A 3AO4A 2R9RB 3HT3A 1TYQA 2C2AA 3J80N 4YXWG 4IEIA 1WSGA 3AE8A 3B8NA 1D4XA 4RQFA 3WXJA 4BC2A 3R8EA 2OWOA 2E74B 3RYIA 1VQ5N 3AG3C 4QCLA 3MXMA 1N36O 4LF6K 1BZKA 1KAXA 1S77D 3CCSV 4X64O 4YY3K 3DGEA 4DQSA 1U47A 4JHDB 1NR7A 1PKXA 2WWWA 4MSWC 1NKCA 3H3NO 2ZKOA 4Q4V4 3OTOB 4J9YB 4JI2K 4ZOLA 4CJWA 4UCSA 3DSQA 1N33O 1SA0B 1K34A 3D6RA 4CD1A 4FLVA 5IYDO 3G6EN 2P9PB 3I8BA 1CP9A 4LFBK 1JLEA 4F3OA 3JAKB 1Z6RA 3HKCA 1YXBA 1N34O 4LSLA 5FDLA 2ZE2A 2XY5A 1L3SA 2LGWA 3SUCA 4DRXA 1U2VB 2RN2A 3H08A 3S9HA 2QTOA 4M3ZA 2P7TC 4CF2A 2QKCA 4I50A 3VR9A 4CCHA 4EIAA 3VEXA 3FB8C 1LUWA 2AHYA 2IC3A 3ZT4A 1IH7A 4FJHA 5LOVB 1UA0A 4ZHQB 2P9KB 4JK7A 1AI4A 3EVKA 4FLXA 1N5YA 4X65O 5M1NA 5MLCQ 4W4KA 1NS1A 3CCMV 5KAFZ 1M57C 4B9SA 2W6IG 4NXMB 3T19A 3O65A 1KQSU 4DO2A 2NRZA 3PN1A 2D0OA 4ELTA 3WEEB 4DV4K 2LO1A 4CIEA 3M6GA 3CCQN 1RUG4 2D3OW 3SQ1A 5LL6Y 2GUZB 5D5PA 2Z1HA 4YIOA 1SZ2A 2ATQA 3O4WA 3VQ8A 3SZ2A 4FJNA 4CZIA 3OAAG 3TWHA 3ZETB 2DFEA 1PL0A 3FB7C 4HNAB 3ZRXA 3THXA 2Q36A 4DV5K 1OV9A 4DHYA 2IJHA 3NCIA 5CE3A 1Y76B 1ATNA 1HX1A 3AE3A 3PSIA 4DUYK 4I9LA 4DTUA 3DXKA 5KMGB 3GB7C 5JVGL 3K04A 2D5RA 4H5VA 1XNQB 3QEXA 3UKRA 3DLEA 4A57A 4UQGA 4C8OA 2ZM6O 5BR8K 3SYOA 5TISZ 2XASA 3CCEN 3H1QA 1KUQA 5LP6A 3R9PA 5JICA 1L3VA 2GBZA 3ZX2A 2YV0X 5KX5B 4B3MO 4JI6B 5AQIA 4CJVA 4FVUA 4CFBA 3FZHA 4RUFA 4KTZA 1W2BU 1LUVA 4IKFA 4RWUA 3MN7A 4Q5VA 1I94K 4OX9O 1SUQA 1Y66A 2V4DA 2UUCO 1S72N 2B1IA 4FPAA 1TUUA 2ETNA 3TPQA 2XRIA 1OJHA 4O4HA 3EZWA 4CJEA 1K4DC 4FLWA 3DWLA 3T1AA 5JLFA 4JKBA 3O5BA 4CJUA 1FW6A 3DLLL 1VQKN 4CS4A 4DTPA 4O4LB 1VSDA 1XNRO 1JR9A 1H8TD 1J5EO 3SJQC 2DPNA 3TCUA 1LWFA 3O08A 3OYGA 3T1HO 2BTOA 4TSFG 5L3DA 4DUYB 3TSQA 4ZI7B 3JAWA 3BY6A 5AFUH 4DTRA 3CPEA 2P6JA 3LALA 2PYLA 4JI7O 2ETJA 3IS9A 4JRQA 2CGKA 3CCLV 3SAGA 4QPKA 1GH6A 2A3ZA 3AVJA 4M63C 4JKAA 2RS54 5C2TA 4PJ0Z 2HVIA 3PSFA 2D0AA 4FK5C 3N2KB 4GKKO 3AEBA 1QBZA 4ZOLB 5IT9N 2O8DB 2OPRA 4LFCB 5DM6V 1DTOA 1F7YA 1HW7A 4JV5O 2V7YA 3VEWA 3RYFB 2AXTZ 2KTQA 2VG7A 1HLUA 4ICGA 3KLHA 4FJJA 3CD6N 3KHYA 3FR0A 3J7AU 1IKYA 4YHHK 4JTCB 5CA1A 2HHHK 4DSIA 1ZAUA 1NT2B 2P9SB 2YNFA 3I5DA 2UU9K 3ABKC 4I55A 3CCVV 1N6QA 4PDRA 3ETQA 3RW0A 2KKZA 3QINA 4N76A 4Q20A 4FYDA 4GX2A 1PNKA 3TAPA 2HHQA 3P4QA 1R3LC 2JWKA 4LF5O 1U48A 1CZAN 1WLJA 2HMPA 3IC7A 1Q7YW 3JASB 2NRTA 4TV8A 3L0QA 1H2NA 4HHTA 1R6TA 2QWQB 3CCJV 3CC7N 4G1QA 3KK3A 1Q7YO 1P90A 4YOWA 4R5PA 3IG1A 4DV1B 1NGFA 2PF4E 3ZRWB 3B8AX 3BZCA 3MEEA 3SFEA 4QGPA 1AR4A 1DEJA 1GAXA 4HYOA 3EZ5A 3LP3A 5IYCO 2E3CA 1NWKA 4G27B 4FO0A 1WA8A 1KU9A 4FJ9A 2KQXA 3NH2A 3ZIAG 5JS2A 3CCUN 3VOUA 1NGGA 3O3HA 1W0JG 3AA5X 3AVKA 5C0YA 1EX4A 3QBWA 1RDDA 5AG2A 4OGQB 2H3GX 4BR9A 3Q7BA 1BOTO 4X1YA 2GWJA 4MVRA 1TKDA 2NLJC 4LWSB 4WFBV 4DLGA 4F8RA 4FIPC 1ZOYA 3ZT1A 3ZX3A 1RMU4 1VIBA 4FMTA 1Z25A 4A5BA 4B9VA 3RYHB 3QEIA 2HHWA 4CH4A 1C1AA 2PTMA 3OTOO 2VRZA 4J80A 3EEQA 4WQ4A 4CEOA 4U7BA 3L71H 3U9DA 2EJRA 3MK6A 3TAFA 1DGKN 4FZ0A 4FJKA 3K3WA 2W6JG 5GTIZ 3GWKC 3L74H 1YHQN 3SAHA 2XUMA 2A42A 3PJSK 4AF1A 1MG1A 4OPHA 4DV7K 1RTJA 1FJGB 1UJWB 4YTNA 2ODMA 1YSCA 2WLLB 1WB7A 3A0IX 4J7JA 1NGIA 2JEXA 3C90A 1QZ5A 5AQPA 4IXCA 3RN4A 1S22A 3M99B 5IY5B 2Q4PA 4NYKA 3QNOA 1RP3B 1NK0A 2F66C 4ZBMA 3AARA 2XAHA 4AHCA 4YY3O 1HPMA 2OCCB 2G8HA 3OBYA 3EHBB 3BY5A 3CM5A 4NXMO 4BRNA 5EX5A 2VQFK 1HNZK 2HFEC 2FSNA 1NMNA 3BVOA 5BRHA 3C7NA 3CFRA 1K33A 4NTWA 3V9WA 5EC2C 4CS2A 1JLGA 3L9DA 1FXHA 4IFYA 4YOTA 4CGGA 5KUMA 3M1FA 4F2RA 2LSNA 2E8AA 3VQ4A 4DSJA 1TAEA 3FYEB 1CXUA 3KTQA 2PY5A 4U3JB 3AEDA 1UWBA 3OM3B 4BE1A 3CC4N 4JYBA 3OYJA 1MA9B 5M1KA 4KHYA 2WONA 4YIPA 3AGKA 1RNHA 1T8EA 3HKDA 4XH1A 1XNQO 1NJWA 4KI4A 3V9XA 1Q90D 3FZKA 5FLXO 2WA4A 4X1KA 3L72H 4TV8B 1DTTA 3CEIA 1YXQA 3KCYA 1NOYA 4FLUA 5IJ0A 2B5UA 2ZQMA 4JI6O 2ZD1A 2HF4A 2GBOA 3TAMA 1COWG 4O2AB 2HBJA 4MVZA 2XAQA 1BI4B 3KZBA 3NF9A 3VGKA 4CF8A 3AK2A 2P67A 3IGAC 4DSKA 2LW7A 4M3UA 4GMJB 1FD9A 4TUYB 3RRHA 3GVMA 4DV4O 1BWFO 3NVKA 4DK1A 5HRPA 1QLEC 4TQFA 5EBWC 3A0RA 1YVNA 1W59A 1VQMN 2QWRB 4JI1B 3H1KH 4KH5A 4FJIA 4DV5O 1RFQA 1ESVA 3I8DA 5GTHZ 1YUWA 2FKXA 3FI7A 5JH7A 4O55A 4DUYO 3WNGA 5J2NA 2X0LA 3CPWM 1QSLA 1L0LH 1VRUA 3SK3A 3PV8A 4BVOA 1PO14 3QIOA 4KHSA 3G67A 1FKAO 5K14A 4C1NK 5C8YB 3AV9A 4TT3G 1AR1B 3LZIA 1V9PA 3F5TA 4CEDA 3EYZA 5H9CA 2Z1GA 1RT5A 1M93A 1N8RW 4CI6A 4DR1B 2ZDIA 4O4JB 3CC2V 4Z4GA 3D36A 2QE7G 4QE9A 1CEZA 1OVYA 2P9IB 4KHPB 4UVCA 1N8RO 3RR8A 2X6BA 2UXXA 2P5OA 1R084 2YIDA 2A41A 3J81O 4ISFA 4B1VA 4JKGA 4DKWA 2RMU4 1PPJH 1YZBA 1XL6A 3BA8A 3E66A 2EIMB 1K6YA 2WLKA 5BN8A 4K3AA 2EIMC 2Q5ZA 4CEZA 4XDJA 2QWOB 3JARB 1SKSA 3EXAA 4WFHA 1LWCA 3ULEB 5EVZA 2QGNA 1E3MA 1V55C 3AG7A 2JGUA 2KQ2A 2O8FA 1FK9A 4JI8K 3L70H 4X88A 2PBDA 4AHVA 4DV1O 4CIFA 4JN4A 4JI3B 1PIV4 4CHOA 2YXHA 5CZ1A 2QWNA 3K08A 3B8MA 5IJ9B 2BUPA 3CMAN 3APOA 2KW4A 2QR4A 5B1AB 5KHJA 5CHIA 2Y69B 3JALB 5B1AC 4BR2A 4F2SA 3DXRB 3ZMZA 2Y69C 1YQ4A 4XH5A 3WB2A 1XMQK 1SQGA 2RF2A 2YI9A 4UVBA 1SQPH 1VSFA 3AEEA 1YTUA 4ID1A 1Z5VA 4BRLA 3CJ1A 2QJ1A 4O44A 4CZGA 3HKEA 4Z4EA 2VWBA 3VQ6A 1F51A 5A2QN 5LMUK 4TSXA 1C6VA 5IJ0B 2RHKA 1VQLN 4XEIA 1TK8A 4FJMA 4LR3A 2QWPB 4BRKA 2ITDC 2R7FA 3FAVA 4HBNA 1K3EA 2KG7A 3NXSA 3QVNA 3DTUB 4NO7A 3VF4A 4JI8B 2YNHA 2WLIA 4JKHA 4WBNA 4NYNA 4DK0A 3ZMSA 3G6BA 1R3IC 2M7WA 3DAWA 5CY4A 1QU7A 3QESA 4NTXA 3O9QA 1DLOA 3UB5A 2HBLA 3WNFA 4DS4A 5HROA 3S3XA 4LC1A 1J9AA 2F9WA 1FJGO 2JJ2G 2WLHA 1WNSA 2YJEA 4B8CA 2BOBC 3ATVA 1WSJA 5FPEA 1RFYA 1M5IA 2DQ0A 1N36K 3WXMB 4JYAK 2P90A 3CJAA 1GLLO 3JD3A 1NGHA 1D5AA 4X64K 2R70A 2YEVA 5AQJA 4JI5B 5AQLA 3I56V 2QA4N 4UCRA 1ASVA 4I9QA 2I7PA 4PHTX 4TOIA 4I6MB 2ZE6A 1T6CA 2Z1IA 4B3TB 4BGBA 4RG8A 5HLFA 4K41A 5LA6A 1VF6A 3UM7A 5LHGA 3FGUA 4XH4A 5KA6A 4H0XB 4IG0A 5AQQA 4I0XA 3U4LA 1N33K 3HJFA 3FD9A 1N0JA 5K1PA 2WA3A 3EKUA 2IDOA 1T5EA 3JS6A 1NJYA 4IT5A 3PX0A 1L3TA 4FLTA 1X1PA 3VQQA 4LCUC 1N34K 2FBTA 2R074 2UUAB 4YDUA 2BGGA 2G8IA 2K9PA 3TK1A 3NAEA 1MZEA 5HFMA 1NTMH 1TA8A 2QM4A 2IVPA 3D2EB 2DW4A 1WB8A 4LBEC 3SPCA 3ZHVA 4KO0A 4UCUA 5E1AC 1XEQA 4LFAB 4N5SA 4GCZA 4JYAB 3RWUA 1IBMK 2PLV4 2D0PA 1JJ2M 4DR6B 3AG1C 4X65K 2YXLA 2ZIOA 3CPWU 2WBNA 1TKZA 3CJBA 1KTQA 1SL2A 1EV14 1HQEA 4RQEA 4ZHRA 4IHJB 3KLGA 1Q81W 3AE5A 4FOEA 4CHQA 3RYCB 1OKJA 4W5RA 1Y6XA 3TTCA 3J7YP 3EO3A 4DMNA 4KX6A 4DW0A 3L75H 1Q81O 1HNZO 5SZTA 4KHWA 1NZ6A 3P1GA 4M3WA 2NRRA 4BRIA 2VYPA 1VQ8N 4W5NA 3QICA 3A8TA 4K0KB 2A5XA 1E79G 1US6A 1GN3A 4KBOA 3KZIZ 3CRCA 4DTJA 3ABUA 5AQUA 5J2MA 2H89A 1AJPA 1HNWB 5BMVB 3AEIA 4JI1O 4AH9A 4X1IB 4JYCA 3GDQA 4M3YA 1NMDA 3H1IH 1ZBHA 1I5XA 5BRFA 4ASUG 3B77A 5EZYB 2YIBA 3SJAC 1NM1A 3ATUA 3G0ZA 2EBOA 4DUZK 2ZM6K 2EX3A 1ZX3A 1IKWA 1ZBLA 3SYCA 1AR5A 1R094 1VQPN 3JD0A 2G8WA 4ZTJA 1NVPD 3WNHA 4DQQA 2RS14 1GO3F 1VQNN 1KD1W 3T1CA 1IBMB 5LMNB 4JD2B 3MN9A 2OZMA 3L8BA 2A7WA 2IOCA 3CI5A 2HB5A 3ASMA 1KD1O 4OX9K 4X20B 2NRWA 1UFIA 2E6MA 3SJHA 4CIGA 4KHPO 4EZ6A 3KWIA 3SV4A 2P9LA 3CJ7A 2HMIA 1U6ZA 2H8PC 3MXJA 3C6TA 3BHPA 3W7UA 5LHHA 3X2QC 2JS5A 1TL3A 2BE2A 2AZ0A 3GL1A 1ITGA 3G25A 4H5TA 3WNEA 3T1HK 3ZHRA 1VRH4 3DLHA 1G4YB 1ZWIC 4JI7K 3LDPA 4DUZB 3ABLB 2W6LA 2D2CB 4DXWA 4BE0A 3ABLC 4Y0WA 1IBKB 3VETA 3M8PA 3L4IA 4G9ZA 1GLEG 4FJ5A 2Y48A 4JI3O 1RUC4 1QNMA 4J7KA 1S1UA 4JV5K 3I55V 1NBWA 3ZSRA 1R73A 3OYIA 4KH4A 2ZXWB 5JCOC 3PLAA 1K7DA 1PNLA 4B9UA 2P9NA 5AQOA 3OGIB 5E84A 1N4CA 5EIBD 1QTMA 4CJ4A 1FXKB 1MMMA 1NBMG 1TVKB 3U0ZA 1JXBA 3GQHA 4QS7A 5F2VO 1VBE4 3DC5A 3TXQA 2ADQB 4CF1A 4M3TA 4BACA 3K06A 1VF5B 4FPPA 1HUXA 4DS5A 3K5LA 3F7YC 1TKXA 3Q4HA 5CR4A 4LF5K 2ZE8A 1OCOB 1X3NA 3K2PA 4F6RB 1B06A 3E22A 2HHVA 4E1NA 1SRYA 3HXMA 2DFHA 4PA9A 4RW9A 3K0SA 1Y67A 5C10A 2XOKG 2Y4TA 1COV4 4YJ3A 4Z94A 1MQTD 3O1WA 1D5NA 2NUBA 3P32A 3WUHA 4BG8A 4LF7K 5C3JA 2JGDB 4WFGA 2YUAA 3C3TA 1BA1A 2A1SA 2W41A 4JI8O 1QZ6A 3LAKA 5AQWA 2WU2A 2RDCA 4HUGA 2ZINA 2NZTA 2JLEA 3HR0A 4LH7A 3SCXA 1D9DA 1ZUQA 2DE0X 4FWSA 5H1SQ 4Q4W4 3MWPA 5CB4B 3P83D 4H0OA 1K9MW 4PDLA 2A9HA 4K35A 4N47A 1GN4A 4PA7A 3NF8A 1ORQC 2Q9LA 2E1ZA 3SJJA 1QSYA 1OVQA 3L3UA 3LDNA 2KZMA 1G1XB 1K9MO 2YDEA 1GOCA 2EZPA 1L1FA 4AHUA 3QEPA 2BE3A 2AW9A 2EINC 2W0XA 3LANA 1TAUA 2ZJQL 3D2FB 3UT5A 3M8QA 4KTQA 1WN7A 4MS2A 3F7VC 2XHBA 4JI5O 4GY2B 2Y1JA 1NEKA 4JI0B 2PYJA 1C1BA 3THWA 3RVZA 3OMNB 5IYZB 1JJ2U 4B3TO 3LL3A 4ELUA 4IIJA 2W42A 4UB6Z 3NHGA 3S3NA 1XL4A 1BHLA 1RBRA 1YTFB 3RVCA 1RUJ4 4LF7B 4FZXC 1XUQA 5FPNA 2OANA 2YS8A 1QQNA 2CH5A 1AR94 4FL9A 1L0VA 4LH4A 3OR6C 1JL2A 2WU5A 2VWKA 3BP8A 3L3VA 4DR2B 1K8AW 2OTLN 3B40A 3OYDA 3VMFB 4NXNK 3K9JA 5GAEP 3O8MA 4LF9B 1YEWA 1G6UA 3IAYA 3CQXA 4KUMA 2P9UA 3I0RA 1WAZA 4WE1A 1K8AO 3CERA 2JVDA 2RMKB 3SUPA 3AAQA 4LFAO 3IRXA 1H2LA 3JSNA 4QPJA 4JYAO 2E5LK 4X62B 1X3MA 3HSTB 2QKKA 4DR6O 4X89A 1GLAG 2QW9A 4JEPA 1DF5A 3ZSZA 1OCRB 1NK9A 3QERA 3QDKA 4HWIA 4DF8A 3ISNC 4NXMK 3ZSXA 4H0LB 1GLCG 2DMXA 1U49A 1SL0A 2EHGA 4I4TA 1RHI4 4BC3A 1NU1H 2ITCC 4Q6GA 4B1YB 3UQ8A 4PA4A 3N2GA 3VQ9A 1H2GA 2IM9A 1XQ8A 3JD1A 4JS5A 5JS1A 4JNEA 3OEHG 4K0KO 4XBFA 1S6PA 2R064 4CC5A 1GLDG 1ASJ4 1VQ9N 1PVC4 1HNWO 4B3SB 3ID8A 2E2PA 2DJVA 1RTIA 5KAIZ 4WFFA 5EY4A 2BSKB 2HP8A 5L3BA 2YHAA 4BG9A 5FPDA 2F23A 4DF4A 3THYA 4DU4A 4PA3A 1KBHA 3R3LA 1F23A 4NXNB 1XNQK 1QVFM 3H01A 4B1XB 3J7AP 1S5LZ 2HF3A 4YJ2A 2WP9A 2HJFC 1OH6A 4UY8O 1N32B 1Q82W 2N04A 1YJ9V 1WBDA 5GADP 2E5LB 1VARA 1HYVA 3AA3A 1IBMO 5LMNO 3I33A 4JI6K 3V1QA 3OMAB 3P4IA 3KJVA 1Q82O 4YSYA 4OLAA 3ALYA 1GMGA 2WLMA 4FWRA 5E26A 1XBLA 1Q6HA 2CK3G 2F8SA 2FBXA 4M7XA 2F9TA 1RUH4 2VCPA 3DJCA 1MDUB 4GNIA 1S9GA 3DXMB 4K43A 4W5QA 3F73A 3SUOA 1VQ6V 2X6CA 3R6MA 4HCBA 3AO2A 1BQ0A 5BREA 3ZJZA 4EB6B 1HNXB 3AG2B 1J6ZA 3CG7A 1KFSA 3K9KA 4UCTA 5JVDA 3AG2C 4WCEV 1XMOB 5ITZA 4LH6A 4K42A 2GSMB 4PL7A 4BDZA 3MN6A 4DUZO 5CA3A 1QLNA 1AP6A 3VTIA 4CZHA 2CGNA 1IBKO 1RSOB 1JLFA 5B3SB 3PX4A 1YQ3A 1J5OA 1VQ5V 5AQMA 1YJWN 5IE9A 5B3SC 1QVGU 3ZHQA 2WQYA 1YIJN 2DWEC 3ZRVA 3VF6A 4CZEA 1L5UA 4LFCK 4NLCA 2Z3YA 5CA0A 1KVAA 3VQ5A 3ZT3A 4BDYA 4YTMA 1YITV 3OVNA 5D5QA 2X6SA 1EM1A 2N74A 3OBWA 3ZT2A 1QQMA 5CMUA 3V9SA 2X74A 5HRRA 1U97A 4O4IA 5JQGA 1TYQB 4E89A 2FL4A 2YXYA 3P3PA 4EP5A 4NCAA 4XIUA 2D1KA 4O5BA 3T69A 5EYPA 3ABTA 3G6EV 3ZX0A 4CHZA 3A8YA 3HI0A 2GHYA 2O8CA 3LDOA 3ZMTA 3OT7A 3WU2Z 3RYIB 4CHYA 1KP2A 2AZ2A 2RE2A 4G28B 4HUEA 3OS2A 3VRAA 1Z5WA 3E8GA 4K8ZA 1SQFA 4OXSA 3FFKB 4JTDB 1LOTB 2D0BA 3T1YK 4EKWA 4M3XA 4JAAA 5GINA 4DU3A 3UKUA 4DV1K 5C93A 3KWGA 3AVAA 1R6NA 5AQGA 4KV8A 4MVQA 5JJJB 3KLFA 3H6EA 3ZSWA 2CGJA 3P4SA 2HWB4 1RBSA 3P39A 1HJOA 2MW2B 1OH7A 1TUYA 3ETGA 5HRSA 4KB0A 4AQYB 2IAJA 1EBOA 1RM1B 2D0CA 4RAIA 4B08A 2VGMA 3R65A 2IBZH 1HDJA 3THVA 4DV6B 1DGSA 3HKCB 3CCQV 1LAVA 4IOCL 3NF6A 3NE6A 3ZCCA 2OTJN 1W9HA 4DRXB 2QI2A 4JZGA 5LYJA 1FS0G 1VK0A 3P4RA 1JA8A 4I50B 4OLBA 3OY9A 3DI6A 5J2UA 3NFAA 3SQ2A 4JI0O 1BCCH 2JRIA 4DW1A 1KB9F 3QNEA 1XI1A 4BR7A 2O8BA 1EETA 3AO5A 3K5MA 3O80A 4CJ5A 3T1YB 2WAMA 3GE1A 3SYPA 3QETA 1BE3H 4NB5A 4LF7O 1LAWA 3AA4A 3CCEV 1AI7A 4BR6A 2NR5A 3CJHA 1VQOV 1S1XA 3FB5C 4C7UA 3V4IA 1O13A 3OMIB 3KKYA 1UPGA 4MFBA 2FSJA 1FPOA 1I5YA 4DR2O 1KVCA 1WAFA 3THXB 3BEHA 3BUZB 5AR0A 1FJGK 1CXZB 4BRCA 2UXCB 4CD3A 4P2ZA 2DOSA 4TV9A 4FLYA 4LF9O 1S72V 4DR3B 1T6DA 1XWLA 4BC4A 4CECA 1VQ7N 1NOZA 2FXUA 5ITZB 1NGBA 1IV0A 3E8HA 4H13B 3DXKB 2R7YA 1WB9A 1GTOA 4FOIA 1H38A 2BTQA 3U10A 3EKSA 3HTVA 4X62O 3UKRB 5JMVA 1HR0B 1ZL8A 2GWKA 4RW8A 1DTQA 3MHSC 1VQKV 1JXEA 5KGWA 4O4GA 1NVPB 5LP6B 4H4OA 5LP6C 2YKNA 4C8MA 1AR74 2ZNIA 1K8KA 5HOOA 3V9UA 3SMPA 4Z1MG 3ICXA 1BIUA 2NNWA 3ZCMA 4UB8Z 4QAGA 2WLNA 3G71N 3SAFA 4E1MA 5HFLA 1H2MA 3AO1A 1QR8A 5DM6L 3OYBA 4XDLA 1V4TA 4BRGA 4O4HB 4CGIA 4B3SO 3CRMA 4FFBA 4LP8A 4X66B 2ITMA 5I42A 3K0DA 3CWBH 3TETA 5GIPA 3ZYYX 5J1EA 3CD6V 4FWPA 1BU6O 4CH6A 4NXNO 4HVJA 3SV3A 5C12A 5BPLA 4WFAV 1QR9A 3AVFA 1UAXA 2YKMA 3D7EO 3APQA 4HAMA 2JIZG 2JK5C 3JAWB 1JCFA 4Z4HA 1ASUA 1RDWX 4E7JA 4J2BA 3V1RA 2CAZC 4OGEA 2E5LO 4FZ1A 3CQYA 5IWAB 4DQIA 5IY5C 4I7FA 1VQ4V 1VBD4 3TAQA 2AP1A 2QM7A 3NR7A 4FCYA 3HK2A 1JKHA 2OCCC 3W7TA 2GUIA 3CMEN 2Q3SA 2QEXN 4JPRA 4JK8A 4W4LA 3D3QA 3VA0A 1IDSA 3CC7V 3HM9A 1QHTA 5FPRA 4QIWF 1C1CA 4LF8B 2YCHA 5KHHA 3B09A 3OJSA 2P51A 1ZSPA 4JI1K 5CA1B 1BISA 3CS5A 5EIBC 3HM8A 3OYFA 4FJXA 5FNVA 1HNXO 3T4DA 4PKIA 2OYQA 3SUNA 4I55B 2GTDA 1XMOO 1A5WA 2V1DA 2Q8VA 4Z4IA 1OCCB 2HW3A 1KFDA 2RN9A 3LDEA 5L3EA 3CC2N 1OCCC 5KHIA 2LFSA 1RBUA 1Z26A 3CCUV 2KZZA 3T2MA 1TV6A 2WC9A 4CBXA 4NLBA 4WFBL 1VSMA 2RCVA 2HEPA 3FYIB 4DWIA 2E2QA 2B9ZA 4GYCB 3G4SN 1M56B 3NH0A 4DR1K 5H5NA 3VF2A 1M56C 4BIZA 5JWPA 1YTFD 1HKGA 4FJLA 4DSEA 3B2EE 2K1EA 2YC0A 3P5JA 3U6FA 4KHPK 1GLJO 1VEWA 4ABMA 4YOVA 2AJQA 1AR84 3HVTA 4B1UB 3A5MC 5F1XA 4JI4B 3O9TA 3LWMA 5M1FA 1X9SA 3SR2C 3SQ4A 1NENA 4NB4A 1WA8B 3ETEA 1F21A 3JBG4 1HRV4 2HG5C 1NH2D 5FLXN 4D6TH 3QFPA 4LD0A 4GT1A 1YHQV 1BCOA 4TWKA 2DTUA 5LXTA 2OCHA 4IOXA 5AZJA 4YNQA 1NJZA 1U04A 1AR64 4X1YB 1YJNN 3DOKA 3L2QA 1IXMA 4QE7A 4E3SA 2DN9A 1NJXA 2NRVA 3PY8A 3HPLC 2X78A 3ZEDA 4IDKA 4NKGB 1AI5A 1XILA 1PNMA 3ZHUA 4BIOA 1JLAA 1KAYA 2V51B 1AJQA 1Y74A 4CJTA 3ASOB 1ATRA 1OZ0A 3CJ9A 5CYMA 3BAAA 4LFCO 1YVWA 3GBTA 1NQTA 1JCHA 4I2QA 1KP3A 3BA9A 4UV8A 4WQ4C 3RSEA 4AQYO 3O3GA 4B9LA 1KECA 4IOAL 1XHZA 3H1HH 3MX2A 1QQOA 2OA8A 4WF9V 1ZLZA 4X8AA 1CZBA 4JKDA 3F5WC 4DV3K 4ISEA 2UXDK 1GLBG 4JYYA 1JLQA 3NVMA 1HNIA 5AQHA 2VQEB 4CK2A 1IBLB 3VQWA 1K73O 1C0TA 1X59A 5BPNA 1VSIA 3ULDA 3SNNA 2CGOA 3ENHA 2W0FC 3SBGA 4PI0A 3T1YO 4YORA 1KKCA 5C42A 4O8UA 1VBB4 1B92A 1XREA 3T4ZA 4LY7A 3VQVA 3C7NB 5EBMC 2B5JA 3J81N 4ZKIA 1HWYA 4B8AB 4ZTFA 1WJZA 1NTZH 1RT6A 1A32A 4BROA 4L8JA 1K4CC 3H9VA 4CS3A 2F95B 2UXCO 4DR3O 4BRDA 2UXBB 3CRRA 2O4GA 4FZZA 4OKJA 3HO1A 2YHYA 2Y0IA 2H94A 3U9ZA 3HKDB 1VQMV 2IVNA 4JI5K 4U7OA 5E79Z 4DV3B 2UXDB 1OH8A 1O9GA 3KLIA 3S3WA 4EEQA 1IKVA 4X1KB 1RT3A 3OEEG 3TJTA 5HBMA 4B3TK 2KLAA 3LPUA 3Q7CA 1RVF4 3LDSA 4QS8A 2ZT9B 3E1YA 4F6EA 1BEV4 1H1VA 3SPZA 5B8HA 4HUFA 5BPMA 2H88A 4CW7B 3MCPA 5B66Z 3AVLA 3ENOA 4DQPA 3JAMN 3LM9A 3AE6A 1Q8IA 3MHHC 3K03A 4PI2A 4IGGA 2GEMA 3LDQA 3ENBA 2UUAK 2HVHA 2QXLA 4M45A 4X66O 3VGLA 1LW2A 2IJIA 4MW8A 1TKTA 1ZBUA 3C94A 3IDHA 4J2DA 2O57A 5DN6G 1DK1A 3DRPA 3OJUA 2A1RA 4DR5B 4JS4A 1IX9A 1M1KO 3JD4A 2O8EA 4JTAB 3DM2A 3ITHA 1YVUA 3N4PA 4BR0A 1W0KG 3B4SA 5GONA 4CF0A 5J2QA 4RHV4 4LFAK 5JH7B 1MSDA 4U3FH 3TSUA 3W0LA 1K92A 3OYKA 3MCAB 4DR6K 1KSPA 1LCUA 1BDGA 5IWAO 3MWTA 3LDDA 4FWKA 1MWMA 3SUQA 1R0AA 4KHQA 5LGUA 4K25A 4DR7B 2A6AA 2QSAA 1V54B 1EN6A 1RBTA 4IG3A 4B9QA 5KQ8A 4RWTA 4OPJA 2PAVA 4DSFA 4B1ZA 4JAUA 1I08A 5A9GA 3RSEB 4K0KK 5F0XA 4J8FA 4LF8O 2Y4UA 2HHXA 1ROPA 3MEGA 1EN4A 1FFXA 1BQMA 3NDKA 1HNWK 3ZN1A 2UUBB 2HHTA 5DM7L 1K5SA 4F9OA 2IU0A 3C6HA 1FYJA 4KP4A 1VHXA 5B5EZ 3MECA 4FWQA 4H0VB 3ZEUA 3FFQA 4JKGB 3JSMA 1IXBA 4MVOA 4CJPA 1Q9YA 1GM7A 1ATSA 4JKCA 4QS9A 2FTKA 3M7MX 1L3UA 3CSXA 3H46O 4EFEA 3OA9A 2A0LA 2I5JA 3TU5A 1VSJA 5F2RA 2CTRA 3CIPA 4DV0B 3NGIA 2P4KA 1JCEA 5LMNK 4B9MA 4RO2A 2O8FB 5JCOA 3VERA 5JLHA 2B1GA 4LF4B 1Q86O 1ZBSA 1GRJA 5D3GA 4CGFA 1TUBA 4OGCA 2F93B 2JS3A 1AP5A 3R1XA 3QNNA 2ZR2A 1BQZA 4W5TA 2G38A 2QWNB 1WSEA 3SQ0A 4BWAA 2KHOA 4FJCC 4KAZA 1HPZA 1JLBA 2WDRA 5KHGA 4JI4O 1T7PA 3VOVA 1FXXA 2ATKC 3JSLA 3TAGA 3K79A 2CH7A 1M9NA 3FKSG 2F43G 2VG5A 1YI2N 4E7HA 2B6AA 3LSUA 4OO1J 4DTSA 1C0FA 1K5MD 4FK2A 1KC8O 1WBBA 1RDBA 1J95A 2JJ1G 3SPIA 4PQUA 3HKEB 1DT9A 1SETA 2F4VB 3HP6A 5AZIA 4Y1CA 2O4IA 5HP1A 3AK3A 2YX6A 3QMLA 4CEAA 3FLCO 1IBKK 1EP4A 5BRDA 1SS3A 4N21A 4CGJA 4FVMA 3THOA 4IJNA 3H45C 3HKBA 3LDCA 2QA4V 3FAVB 5B1OA 3DLBA 2KG7B 2ZE5A 2OZSA 3WB1A 4O2BA 2WLIB 1NKDA 4DR1O 4WBNB 4FM0A 3OUSA 1M4UA 1SKRA 2YI8A 2R9IA 1J53A 3OYAA 4GV3A 1NK6A 4FSVA 2QKBA 3ZHSA 3OD4A 3EY1A 4UCOA 2PI4A 3N4QA 3P3NA 3M5RA 4LNUA 1RTHA 4QOZB 1R3KC
chains in the Genus database with same CATH topology
4DFPA 2Q7GA 3E01A 1QS4A 2G8UA 5KRTA 1J54A 2RQ6A 4B3RB 3CM6A 3ZS8C 3D45A 3BGRA 3OYCA 5JJNB 2XY6A 2ZCEA 4CJ3A 3SI6A 1IKXA 4KI6A 5LA6B 3K5NA 2P5GA 1S9EA 2WOMA 3HL8A 4NCGA 3OYNA 3ZT0A 2PW9A 2YNGA 4CH5A 4FLZA 2BDPA 1QSSA 5C25A 3DOLA 4Z0UA 3B6OA 3RTVA 1I3AA 1GOBA 3AVMA 1A5XA 5KRSA 4HTUA 4DTMA 2KFZA 4CEQA 3BPZA 1G15A 3VQPA 4FW2A 1SA0A 4CGDA 3DRSA 4E7LA 3JAKA 4CK3A 4N41A 3MAQA 4JRPA 4DV2B 2OPPA 4N56A 3F9KA 1UOCA 1JL1A 3AVGA 4IBNA 1VSHA 5LOVA 4ZHQA 3TI0A 3RWRD 1BL3A 1O1WA 3QO9A 3D0PA 1BQNA 1VF7A 3KD5E 4KB1A 2RKIA 3KKRA 3QIPA 3OYEA 3VQEA 5T7BA 3RMBA 1B9FA 2VWJA 1B04A 2PUSA 2IS3A 4O0JA 3CB2A 4CJRA 3NGZA 5KMGA 4TQDA 2RJZA 4F3TA 1BIZA 1RTDA 5KX5A 2VG6A 3NBPA 1CXQA 2P22C 3O4QA 4IFVA 3HYFA 1Q43A 4O4LA 4Q0BA 1RT7A 2E6LA 2Y1IA 4ZI7A 4DR4B 4KFBA 3M8RA 1KRPA 2R72A 4K8XA 1HRHA 4PWDA 3E22B 4DTNA 4BDPA 3RMAA 3RFRA 4BWJA 4FJ8A 3N2KA 4YJ3B 3QTCA 3RYFA 3LZJA 3LP1A 3RMDA 3K58A 1C0UA 4C8LA 4GLXA 2F96A 2ZQBA 5KHKA 1A5VA 4CHPA 4FM1A 2HHSA 5FROA 3JASA 4LF6B 4B3OA 2OPQA 4YY3B 3UT5B 4OVLA 3SYZA 1EKEA 1FKOA 4M3RA 3HP9A 4YFUA 4UFZA 3ZSYA 3BDPA 1C0MA 4JI2B 4IIJB 3AVCA 3V6DA 4CJKA 1KMIZ 3MEDA 3U3YA 4LFBB 4PHZA 1JLCA 4KTWA 2BANA 3DYAA 2F8TA 1ZBFA 1GOAA 1U4BA 3CFPA 4L8RB 4C8NA 3OYLA 1KVBA 3RYHA 1S6QA 4Z4FA 4OKKA 1KLNA 1H2SB 1XC9A 1NKBA 1S5JA 4I4TB 4DV4B 1L8DA 4RW6A 4M42A 1VRTA 1LWEA 1NK8A 3N2GB 3AO3A 4O0IA 1WSFA 4BW9A 3SJBC 3JATA 4DV5B 1X9WA 4FJGA 5EU7A 4E7KA 1YT3A 5BR8B 4PUOA 4YJ2B 3K59A 3I0SA 2E4LA 1O9HA 4ICLA 1TL1A 3UIQA 2PZSA 1I94B 1TVRA 1VSLA 4FW1A 5I3UA 5J2TA 4U3JA 3OYMA 3KIOA 5DK5A 4OJRA 1ASWA 3B6PA 4E0DA 5HRNA 1JMKC 4CE9A 5JVDB 3TAEA 4GW6A 1LV5A 2R9AA 3AVIA 4O2AA 3MXIA 1BI4A 4TUYA 3K5OA 4NVPA 5JJEB 3C95A 5CA0B 4H8KA 3CHXA 4YHHB 4KPYA 2HHHB 3DLGA 3V81A 2UU9B 2KKWA 4O4IB 5JQGB 5DMRA 2Q7EA 1RILA 5EYPB 4FM2A 2QXFA 1D8YA 5C8YA 3NGYA 4AILC 3PO5A 4O4JA 4FJ7A 3NH1A 1WPBA 3L2RA 1I7FA 4HCCA 3JATB 3O3FA 5KGXA 3CYMA 2YIAA 4DQRA 4DTOA 1QQCA 3VQXA 4CEEA 2XY7A 4RW7A 3JARA 4DFMA 5LYJB 2YIBD 1NK4A 4ZIBA 4Z4CA 1NK7A 4KHUA 3VQYA 5J2UB 1D9FA 2ZNJA 4CJLA 1CLQA 3RMCA 1RDCA 5IJ9A 4JLHA 1VSEA 4F4KA 5J2TB 2YNIA 3JALA 1IO2A 4DFJA 2G8KA 4DV7B 2HHUA 1RT4A 3K57A 2ZIMA 4TV9B 1UA1A 2BTQB 5FRNA 1HYZA 3OS1A 4ID5A 3O4NA 2VQFB 1HNZB 3PX6A 3RR7A 5CZ2A 1B9DA 1I39A 3VQ7A 3RRGA 3RGBA 4ELVA 4AHSA 4FFBB 1NK5A 4M41A 1JJOA 1EXQA 4KREA 1TK0A 2DY4A 3DRRA 3LNNA 3DMJA 2PGGA 5C24A 5FRMA 4AHRA 5K1XA 1KLMA 3DLKA 4EFBA 5FNVB 3HPOA 4CFAA 5KI6A 3TABA 4CFCA 4MQ3A 4D7SA 4IHJA 1Y97A 3RYCA 1SV5A 4CHNA 3VQAA 3T3FA 4EP4A 4GKJB 4Y1DA 2QK9A 1JFFA 5BMVA 1XHXA 4X1IA 5EZYA 1RBVA 1QE1A 2RPIA 3CQ8A 1RCHA 2G8FA 4KHNA 2YHBA 5LXTB 5J2PA 4FK4A 3VQCA 4CJSA 1FKPA 2OPSA 3KKSA 4X20A 4KKOA 3ZSVA 3KD1E 4RW4A 2B4JA 4B9TA 3U11A 2DFFA 4OPKA 1CZ9A 4EZ9A 3CFOA 3QLHA 1XMQB 3AA2A 2ITGA 3LWLA 4DSLA 1T05A 4NYFA 4GVMA 5LMUB 1YTAA 1LW0A 5KTQA 3VQDA 1Q3EA 3OTFA 2Q7HA 4CJFA 4KRFA 3AVNA 4CFDA 1P49A 1REVA 1TVKA 2XY8A 2IGIA 4W5OA 4H4MA 1HJRA 3PO4A 3KLEA 2HNZA 1S1TA 2F1MA 4CC6A 4FXDA 3SJCC 4F6RA 1ZYQA 1N36B 4B9NA 3S3MA 4I2PA 2Z1JA 1WSIA 4X64B 4D7TA 3NF7A 1X4TA 3L2VA 2FC0A 3LAMA 3BRCA 1N33B 5CB4A 4CK1A 3SGIA 1JFFB 3OYHA 3DLRA 3M8SA 3L2UA 1N34B 3SPYA 3AVBA 1HNVA 2KFNA 4DFKA 2P1JA 3TANA 4NCBA 5GONB 1S1WA 3G10A 4X65B 5IYZA 3VN5A 1IG9A 4OKEA 3OS0A 1WAJA 4BWMA 3VQBA 2Q0AA 4DG1A 4C8KA 2X6NA 3V1OA 3ZSQA 1SKWA 5E41A 1Q5OA 4J2EA 1S1VA 4CEBA 1FFXB 4AHTA 4CJQA 1X9MA 4CGHA 1T03A 3LP0A 2ZM6B 3JYTA 3LPTA 4FZYA 4BE2A 2FBVA 4B3MB 3V9ZA 1U45A 4LH5A 1TAQA 1RT1A 1TUBB 4OX9B 4CERA 1SKVA 3QG5A 2UUCB 1RT2A 3S3OA 1RDAA 3WB0A 3LP2A 3TR8A 5CYQA 1HMVA 1SL1A 1BGXT 1TK5A 1XNRB 1J5EB 2G8VA 1HYSA 3T1HB 4CEFA 4LSNA 4E7IA 4JI7B 2HNYA 3QF7A 3ZSOA 3TARA 2FBYA 2HNDA 4GKKB 3QEWA 3AVHA 4JV5B 3HKBB 4O2BB 3BABA 3KK2A 3U3GA 4HNAA 3HPHA 4EB6A 4CESA 1ZBIA 4CH3A 1TGOA 1HQUA 4UCVA 3FFIA 4DLEA 3L2WA 4LNUB 2GV9A 1W0HA 1WSHA 4PY5A 4KL1A 1BCMA 4LF5B 1VSKA 3KK1A 4PA1A 3HPGA 1MU2A 3HVRA 2XO7A 1RSOA 4E19A 3PUFA 5SWMA 5FPOA 3A2FA 1Q9XA 3C6UA 4FK0A 3QEVA 4DTXA 4J2AA 1NKEA 4DU1A 1KCFA 4CF9A 3AO4A 3HT3A 1WSGA 2OWOA 3RYIA 4QCLA 3MXMA 4DQSA 1U47A 1NKCA 3OTOB 4ZOLA 4CJWA 4UCSA 3DSQA 1SA0B 4FLVA 1JLEA 4F3OA 3JAKB 3HKCA 5FDLA 4LSLA 2ZE2A 2XY5A 1L3SA 4DRXA 2RN2A 3H08A 3S9HA 4M3ZA 4CF2A 4I50A 4CCHA 2IC3A 4FJHA 3ZT4A 1IH7A 5LOVB 1UA0A 4ZHQB 4FLXA 1N5YA 4B9SA 4NXMB 3T19A 4ELTA 3PN1A 4CIEA 3SQ1A 5D5PA 2Z1HA 2ATQA 3VQ8A 3SZ2A 4FJNA 3TWHA 2DFEA 4HNAB 3NCIA 4I9LA 4DTUA 5KMGB 2D5RA 1XNQB 3QEXA 3DLEA 4UQGA 4C8OA 5LP6A 1L3VA 2GBZA 2YV0X 5KX5B 4JI6B 4CJVA 4CFBA 4KTZA 4IKFA 4Q5VA 1SUQA 2V4DA 2XRIA 4O4HA 4CJEA 4FLWA 3T1AA 4CJUA 4CS4A 4DTPA 4O4LB 1VSDA 1LWFA 3OYGA 3VA3A 2BTOA 4DUYB 4ZI7B 3JAWA 4DTRA 3LALA 2PYLA 2ETJA 3IS9A 4JRQA 3AVJA 2HVIA 2D0AA 3N2KB 4ZOLB 2OPRA 4LFCB 1HW7A 3RYFB 2KTQA 2VG7A 3KLHA 4FJJA 1IKYA 5CA1A 4DSIA 1ZAUA 1NT2B 2YNFA 4I55A 1N6QA 3ETQA 3QINA 4N76A 4FYDA 3TAPA 2HHQA 1U48A 1WLJA 3JASB 4TV8A 4HHTA 4G1QA 3KK3A 4R5PA 3IG1A 4DV1B 3MEEA 3EZ5A 3LP3A 2E3CA 1KU9A 4FJ9A 3NH2A 5JS2A 3O3HA 3AA5X 3AVKA 1EX4A 1RDDA 4X1YA 1TKDA 4DLGA 4F8RA 3ZT1A 1Z25A 4B9VA 3RYHB 3QEIA 2HHWA 4CH4A 1C1AA 2PTMA 4CEOA 4FJKA 3TAFA 1RTJA 1FJGB 3QNOA 2F66C 4AHCA 2G8HA 3CM5A 3CFRA 3V9WA 1JLGA 4CS2A 4IFYA 4CGGA 4F2RA 2LSNA 3VQ4A 4DSJA 1TAEA 3KTQA 1CXUA 2PY5A 4U3JB 1UWBA 4BE1A 3OYJA 4KHYA 2WONA 1RNHA 1T8EA 3HKDA 1NJWA 4KI4A 3V9XA 4X1KA 4TV8B 1DTTA 1NOYA 4FLUA 5IJ0A 2ZD1A 3TAMA 4O2AB 1BI4B 3NF9A 4CF8A 4DSKA 4M3UA 4GMJB 4TUYB 3RRHA 4DK1A 5HRPA 4TQFA 4JI1B 4FJIA 3I8DA 3FI7A 5JH7A 4O55A 3WNGA 5J2NA 1QSLA 1VRUA 3PV8A 3QIOA 4KHSA 5K14A 5C8YB 3AV9A 3LZIA 1V9PA 4CEDA 3EYZA 2Z1GA 1RT5A 1M93A 4DR1B 4O4JB 4Z4GA 4KHPB 3RR8A 2P5OA 3BA8A 1K6YA 4CEZA 3JARB 1SKSA 1LWCA 2JGUA 2KQ2A 1FK9A 4AHVA 4CIFA 4JI3B 4CHOA 5CZ1A 5IJ9B 2KW4A 5KHJA 3JALB 4F2SA 3WB2A 1SQGA 2RF2A 2YI9A 1VSFA 1YTUA 4ID1A 1Z5VA 2QJ1A 4O44A 3HKEA 4Z4EA 3VQ6A 4TSXA 1C6VA 5IJ0B 4FJMA 1TK8A 4LR3A 2R7FA 4HBNA 4JI8B 2YNHA 4WBNA 4NYNA 4DK0A 5CY4A 3QESA 1DLOA 4DS4A 3WNFA 5HROA 1J9AA 1WNSA 4B8CA 1WSJA 1M5IA 1D5AA 2R70A 4JI5B 4UCRA 1ASVA 4I9QA 4TOIA 2Z1IA 4B3TB 4RG8A 5HLFA 5LA6A 4IG0A 3HJFA 5K1PA 1NJYA 2IDOA 1T5EA 1L3TA 3PX0A 4FLTA 1X1PA 3VQQA 2FBTA 2UUAB 2BGGA 2G8IA 3NAEA 1TA8A 2QM4A 4KO0A 4UCUA 4LFAB 4N5SA 4JYAB 3RWUA 4DR6B 2YXLA 2ZIOA 1TKZA 1KTQA 1SL2A 1HQEA 4ZHRA 4IHJB 3KLGA 4CHQA 3RYCB 4W5RA 4DMNA 5SZTA 4KHWA 4M3WA 3P1GA 4W5NA 4K0KB 4DTJA 5J2MA 1HNWB 5BMVB 4AH9A 4X1IB 1ZBHA 4M3YA 5EZYB 2YIBA 3SJAC 3G0ZA 2EX3A 1ZBLA 1IKWA 2G8WA 4ZTJA 3WNHA 4DQQA 2OZMA 1IBMB 5LMNB 3L8BA 2IOCA 2HB5A 3ASMA 4X20B 2E6MA 4EZ6A 4CIGA 3SV4A 2HMIA 3MXJA 3C6TA 3BHPA 2BE2A 2JS5A 1TL3A 1ITGA 3WNEA 3DLHA 4DUZB 4BE0A 1IBKB 3M8PA 4FJ5A 1S1UA 3ZSRA 3OYIA 5JCOC 4B9UA 5EIBD 1QTMA 4CJ4A 1JXBA 1TVKB 3U0ZA 4M3TA 4CF1A 4BACA 4DS5A 3K5LA 1TKXA 3K2PA 4F6RB 3E22A 2HHVA