1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA polymerase
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
3WNGA 4LSNA 1ZBIA 1RDCA 4O5BA 4FM0A 5SWMA 1BI4A 3NGYA 1HYZA 2EHGA 3AO4A 3CQ8A 4DQSA 4FJGA 4FJLA 3DYAA 1NK7A 3F73A 4IKFA 3NDKA 1ZBFA 2F8TA 3RMBA 3OYIA 3PX0A 4OPJA 1ASWA 3QNOA 1TKZA 4CJTA 5J2QA 1RNHA 4M41A 4NCGA 3O3FA 4HCCA 2EX3A 3ZSOA 2W42A 2HHQA 4IG0A 1X1PA 4CFCA 3NH0A 2R7FA 4B9VA 2KZZA 4ID5A 4DFJA 1KLMA 2JLEA 3VQPA 3EY1A 4DTPA 4OVLA 4Z4IA 4RG8A 3V1RA 1CXQA 2P1JA 1IKVA 3AVLA 2FBVA 3FFIA 1L3VA 1N6QA 3M8SA 2HMIA 3TABA 4Z4FA 4QOZB 2KW4A 2KTQA 4RW6A 3V4IA 4CK1A 3ZCMA 4CHZA 1YTAA 1TKXA 4KHNA 3MAQA 2Y1IA 1BIUA 1DTTA 2O4IA 5C25A 3THVA 1BGXT 4N41A 1REVA 4FM1A 1RBSA 3HM9A 3BGRA 4AILC 3LP2A 1W0HA 2IGIA 1KVAA 4NYFA 4M3WA 3L2VA 4C8LA 5HRSA 2DFEA 4DU3A 4DWIA 1RT7A 2ZQBA 3ZSRA 3ZSQA 3A2FA 2PZSA 1Z25A 4CJUA 1L3UA 4DG1A 1NJXA 4JLHA 2GV9A 3AVMA 3S3OA 4Z4CA 3NH1A 3HT3A 4FJ7A 1RDDA 3O3GA 4DLGA 2PW9A 3OS1A 4AHSA 3VQ8A 1S5JA 3G0ZA 4CGDA 4DLEA 3VQCA 1IKWA 5JS1A 1WSEA 4RW7A 4M42A 3O3HA 1S1VA 1RT1A 3CM5A 5CZ1A 2I5JA 4CEZA 5HBMA 1FKPA 3OYNA 4FCYA 1VSEA 3WNHA 1HJRA 5DMRA 4FJ8A 2VG5A 3VQ5A 1QSSA 2R7YA 1GOAA 3SJJA 3SPZA 2VWJA 3C94A 1U4BA 1QTMA 3OYKA 4ELVA 3V9UA 1KVBA 3PY8A 4ICLA 1K6YA 3NF6A 4KTWA 4KHWA 1S1XA 4HUFA 4CGIA 3QESA 1L5UA 3K5OA 2HNDA 4QAGA 3HVRA 4DQQA 1ASVA 4O4GA 1T05A 4NCBA 2F8SA 1DTQA 1WSGA 3PUFA 4CFAA 2G8VA 1C6VA 3LP0A 4EZ9A 3DOLA 2IOCA 4HTUA 4M3XA 2ATQA 2P51A 3LPTA 2HHXA 3K5NA 4FJNA 4DTMA 5E41A 4I9QA 3KK1A 4FVMA 4KRFA 3JYTA 3DI6A 4BACA 3L2RA 2HHTA 3T19A 2ETJA 4ELTA 3C6TA 3VQQA 1EX4A 2A1RA 4B9LA 4FJJA 3NGIA 2BANA 3NF8A 3RMCA 4QCLA 4CGFA 3HXMA 1JLQA 2YHBA 1HMVA 1JLAA 1SL1A 3AO5A 2QKBA 3QEXA 2BGGA 3LAMA 3FI7A 5CZ2A 4FJIA 1LWFA 3NF9A 4M3RA 4CK3A 4KI4A 3ZT4A 3V9WA 2IS3A 4FW2A 3MXJA 3KLGA 2Z1HA 4B08A 3K5MA 1YTUA 1JLCA 4G1QA 3LPUA 1VK0A 1NJWA 1GOBA 3IRXA 3AVHA 1C0UA 1IG9A 4E1NA 1TKTA 4K8ZA 3AA4A 1C1BA 2FBTA 2Z1GA 4E7HA 4M3ZA 3MXIA 1NK6A 4WE1A 4HHTA 4DSLA 3QEWA 3M8RA 1BHLA 5KI6A 1Q8IA 3HL8A 4Y1DA 4LH5A 4AHRA 2Q3SA 2YNHA 4OKKA 3ZSZA 4FJHA 4YFUA 4CF1A 2P5OA 3HSTB 3V9XA 4KB0A 1HYSA 3OYBA 1J53A 1YT3A 4KB1A 4KPYA 1HRHA 3NBPA 1DLOA 4MFBA 4JS4A 3SQ1A 4C8OA 5HRRA 2NUBA 2OPSA 1SUQA 1U04A 3HPGA 1GOCA 2XRIA 1LWCA 3HP9A 3PX4A 4W5NA 1WN7A 2D5RA 3IAYA 3V1OA 5HRPA 3ZT3A 2PYJA 3OYAA 3K59A 4EP4A 4E1MA 3WNEA 1X9SA 4CJKA 3NH2A 3AO2A 4I2PA 3LAKA 3DRPA 3VQAA 4CJ5A 4E7LA 4M3TA 3DRSA 2HNZA 1NJZA 4NYNA 3DLGA 1SKRA 4ELUA 3T3FA 4F3OA 1F21A 2XY7A 3KLIA 3LWMA 4R5PA 4RW4A 4W5OA 4E7KA 3QETA 5J2PA 1CZBA 4O44A 3VQDA 1Y97A 1L3TA 3OJUA 1I3AA 4DS5A 3DOKA 3DLBA 5J2MA 2B4JA 4CGGA 3P5JA 3AVGA 3MXMA 4E19A 3TAPA 4M3UA 3AVKA 3KK2A 1S9GA 4B3OA 5HLFA 4E7JA 2WONA 2AJQA 2E6LA 2X78A 4HCBA 1SV5A 2YKNA 1O1WA 3MEEA 4CGJA 3DLEA 4K8XA 2GUIA 3L3VA 1X9MA 1VSKA 3OS2A 1D8YA 3K5LA 1VRUA 1JLFA 4CK2A 4HVJA 4ZTFA 3RR8A 4AHVA 4CECA 3L2QA 5SZTA 3HJFA 3DLKA 3MEDA 3KLFA 4Z4HA 3CFPA 5FROA 1QE1A 4CJFA 4KHUA 2ZD1A 3AV9A 3ZT1A 4CHNA 4RW8A 3RR7A 3KD1E 4KHYA 4TSXA 3QIOA 1A5XA 4CIEA 3SV4A 3LZJA 4L8RB 1HQEA 4CJ4A 1JKHA 3KKSA 3T1AA 4CEQA 1ZBUA 3VQ4A 4E0DA 1RT4A 4CJPA 4J2EA 1IH7A 5KRTA 4HUEA 1NK5A 4FZZA 3KKRA 3TAGA 2PYLA 4EP5A 3QEPA 3KD5E 1C1AA 4BWJA 4CEBA 4DTSA 4CEFA 2G8UA 1JLEA 4CJEA 2HNYA 4B9MA 4IFVA 3S9HA 4KI6A 1CZ9A 3U3GA 4CJ3A 1C0TA 3HPOA 1RT2A 3QNNA 4F8RA 4J2DA 1RBUA 1C1CA 5D3GA 2RKIA 4I2QA 2ITGA 4XIUA 4FZYA 3DRRA 5FRMA 3TAQA 1ASUA 4KV8A 3RMDA 2XHBA 1IKXA 2BDPA 3KLEA 4CIFA 4N47A 3SNNA 1J9AA 4I7FA 1JLBA 2PY5A 3QEVA 1WNSA 1N5YA 4OLAA 2X6SA 1S9EA 2YNIA 4C8NA 3CG7A 1VSJA 2OPPA 4CJSA 4DSJA 4F4KA 3O4QA 2Z1JA 3ISNC 4H4MA 4DF8A 3LP1A 2KZMA 4BDPA 3AVAA 3MEGA 1UAXA 4B8CA 4CFDA 2F96A 3OYDA 3RRGA 3OVNA 2IAJA 3OYMA 1RT5A 3O4NA 3SQ4A 2HW3A 3RRHA 1XI1A 4DMNA 4E89A 3LWLA 4B9UA 4DSIA 4OGCA 1XHXA 1ZBLA 4FJKA 3PO5A 4GVMA 4DQPA 1SL0A 2O4GA 3IS9A 3PX6A 2E6MA 3L2WA 3SUNA 3OJSA 1TVRA 3OYLA 4DTOA 3HVTA 1TK8A 4PWDA 2RF2A 2Z1IA 4CEOA 1QQCA 4O0JA 3OYFA 4LD0A 4YNQA 3TR8A 3V1QA 1WAJA 4IBNA 3SZ2A 3K2PA 4E3SA 4B9TA 4FLXA 1LWEA 4DS4A 4CJLA 4FLTA 1WSIA 3TAFA 5J2NA 2X74A 3LALA 1JL1A 1J54A 1HPZA 1TAQA 1WLJA 4KO0A 4H8KA 4CEDA 1I39A 4Z4GA 3AVBA 3LDSA 4DTUA 3KTQA 4B9NA 2HVHA 4DTJA 2YNGA 2KFNA 1RILA 5DK5A 1U47A 4CEEA 1RT3A 4F2SA 4B8AB 5J1EA 3VQ9A 3AA3A 4W5RA 1TK0A 4KTQA 4CESA 2WOMA 1LAWA 3ITHA 3C95A 4FLZA 2FC0A 3K58A 1UA1A 3I0SA 4DU1A 1Q9XA 4C8KA 2DTUA 1VSDA 4DSFA 3E01A 1NK0A 3KLHA 4KTZA 1UA0A 1A5VA 2QK9A 4GMJB 5C24A 3TWHA 3SUPA 5K14A 1D9FA 3DMJA 3DLRA 4H4OA 1D5AA 1BQNA 3MECA 3M8QA 3VQ7A 3VA3A 3DLHA 4Z4EA 1NOYA 5I3UA 1S1TA 3CFOA 3L8BA 5EU7A 2G8FA 4FJXA 2G8IA 4M45A 1BL3A 4MQ3A 3OYGA 3ZT0A 5HP1A 1TGOA 1G15A 4PA1A 1B92A 1JXBA 3SV3A 3SYZA 1NKCA 4DTXA 4CF0A 1ITGA 4B9SA 1Z26A 4CERA 3SCXA 2X6NA 2DY4A 1NK8A 4FYDA 1NKEA 3JSMA 1KFDA 3VQBA 3IG1A 4CHQA 2ZE2A 4DSKA 1TAUA 3B6OA 3HK2A 4DQRA 1BCOA 1KRPA 1JL2A 1MU2A 1EXQA 4OPKA 2RN2A 2E4LA 3ALYA 3P83D 2HHVA 4C8MA 4N56A 4PQUA 2Y1JA 4CFBA 3SPYA 2YKMA 4CE9A 4CJWA 4BE1A 2LSNA 4FJ5A 1HNVA 3CYMA 1NKBA 4BE0A 2DFFA 1C0MA 4Y1CA 4CIGA 3VA0A 1T8EA 4CHYA 5CYQA 4AH9A 5KTQA 1CLQA 1EETA 3AVIA 1QHTA 1KTQA 1S1WA 3UIQA 3QINA 3QERA 4FJMA 3ZSXA 1S1UA 2IDOA 2YV0X 1T03A 4M3YA 4ID1A 1TL3A 1TK5A 2G8WA 2IC3A 4I9LA 5KGWA 2D0AA 2HB5A 1RBVA 5FRNA 3HYFA 2D0CA 1RCHA 1X9WA 1TV6A 1R0AA 1UWBA 1WSFA 1B9FA 3OY9A 3OYCA 3CM6A 2GBZA 3PO4A 1BIZA 3EYZA 1VSMA 3OYJA 2FBXA 3LP3A 4Q0BA 5CY4A 1EKEA 3KK3A 2OPQA 4GW6A 4JRPA 4DFPA 4FLUA 1VRTA 3HP6A 2XY6A 3TANA 3BDPA 3RMAA 4E7IA 1KLNA 3ZSYA 2OPRA 1BI4B 3TAEA 2KFZA 3F9KA 2XO7A 3SUOA 3EZ5A 5T7BA 4HUGA 1HNIA 4LY7A 1QS4A 1WSJA 4Z0UA 1QSYA 2XY5A 4PY5A 1LW0A 2D0BA 1B9DA 5C42A 3NHGA 4BE2A 1J5OA 1KFSA 2P5GA 2B5JA 5FDLA 4FK2A 3NAEA 4OJRA 4FXDA 3DM2A 3P1GA 4ZHRA 1NK9A 3WNFA 1SKWA 1ZBHA 1FXXA 2HHSA 4BDZA 2B6AA 4FW1A 3RTVA 1SL2A 1D9DA 3D45A 1Q9YA 4OKEA 1SKSA 2RPIA 1RTHA 4CJQA 3TI0A 1XWLA 1S6QA 3KJVA 5JS2A 4DF4A 4CEAA 4JS5A 3L2UA 1WAFA 4J2AA 3OS0A 3V9ZA 1EP4A 3TARA 4O0IA 4KREA 1RT6A 1ZYQA 1TKDA 3C6UA 3S3MA 5CYMA 1JLGA 4FLWA 4IG3A 4LH4A 4FZXC 2HHWA 3NCIA 3AVNA 3D0PA 1A5WA 3VQEA 3U6FA 3CFRA 4BDYA 3NGZA 2OA8A 5HRNA 2QXFA 5KGXA 4NCAA 2YHAA 1UOCA 4Q5VA 1CXUA 1U45A 3QO9A 2HVIA 2OZMA 4ZTJA 1BQMA 4J2BA 4CHOA 3NE6A 4CJRA 4W5QA 4JRQA 1VSIA 3H08A 2YNFA 4BWMA 3SQ0A 3S3NA 1S6PA 3RWUA 3V81A 3OYEA 4KAZA 2HHUA 3V6DA 3ZSWA 3AO3A 3SI6A 4CJVA 3V9SA 4EZ6A 2A1SA 3AVJA 4DSEA 4DFKA 3G10A 4CHPA 1NK4A 1LAVA 1KCFA 4DQIA 1XHZA 1TL1A 1HYVA 4IDKA 3SUQA 2KQ2A 1RTIA 1VSLA 3ULDA 3TAMA 4OLBA 1RBRA 1FK9A 1FKOA 4KKOA 3VN5A 1HQUA 1JXEA 3VQ6A 4AHUA 1RDAA 3QIPA 3NF7A 3PV8A 2VG7A 4OKJA 5HROA 3K57A 1L3SA 4F3TA 3HPHA 1NOZA 3L3UA 1NJYA 4KHSA 2VG6A 5KRSA 4UQGA 1VSFA 4FLYA 4F2RA 1RTJA 2OYQA 1U48A 3AVFA 1IKYA 4CGHA 1KVCA 1RBTA 2DFHA 2FBYA 2XY8A 3M8PA 4RW9A 4O55A 4DTNA 4N5SA 1QSLA 3KIOA 4W5TA 3U3YA 4DU4A 4N76A 2G8KA 4FLVA 4CF9A 3AVCA 1RDBA 3OYHA 2JGUA 4KHQA 3HO1A 4AHCA 4IFYA 1LW2A 1WSHA 3ZSVA 3LZIA 3I8DA 1LV5A 3NFAA 4LSLA 3QEIA 3SQ2A 3AA2A 1BISA 3ZT2A 1XC9A 1KSPA 4DTRA 3AO1A 4FJ9A 4CF2A 3QLHA 3AA5X 2QKKA 1T7PA 4CF8A 2G8HA 4CCHA 1YVUA 3B6PA 4FM2A 1VSHA 2OZSA 4PUOA 1U49A 4OGEA 4AHTA 3I0RA 2VWKA 2BE2A 1IO2A 1BCMA 5I42A 1W9HA 4FK4A 1RTDA 4FK0A 4KFBA 4DFMA 3LANA 3ASMA
chains in the Genus database with same CATH superfamily
2ZE5A 2E5LB 1VAZA 4LSNA 1Y4MA 4O5BA 4WFEA 4FM0A 3J7ZO 2EHGA 3AO4A 1HPMA 4QGPA 1KAXA 4YOVA 4FJLA 3DYAA 1JX9A 3F73A 4IKFA 4LR3A 4L87A 3S41A 2B9ZA 3A5MC 3D6RA 3PX0A 2UUAB 5KUMA 3VR8A 4IGGA 1RNHA 4NCGA 2EX3A 2IVNA 1NU1H 2R7FA 1K4DC 2BE3A 4FWLA 4B9VA 3JARB 4ID5A 4DFJA 2JLEA 5JJEB 1S77D 2F43G 1Y76B 2W40A 4Z4IA 3V1RA 4TQDA 1RSOB 4H0TB 3CB2A 4O4JB 1J5EB 1XC3A 4IYIA 2E2NA 1NU0A 1THZA 2PI5A 4B1YB 3TABA 1VBE4 2IH3C 3P3NA 3V4IA 5JVGL 4CK1A 1YTAA 4KHNA 1WOQA 1GN3A 2QWRA 5LJVA 3EKUA 2NR5A 3O9SA 3R3LA 1RVF4 4N41A 3LDCA 3HM9A 4AM7A 3EHBB 4JI8O 3E1YA 2P6JA 4BGAA 1DGKN 3SPIA 4J7KA 4WFBV 1BG3A 3CC4N 4DU3A 4B1VA 4J11A 4FWPA 3ZSRA 1H38A 3UKRB 5FLXO 3NMUA 2PZSA 4BY9C 3NR7A 1X9JA 5LHHA 1N0JA 4CJUA 3GOIA 1YJWN 4JI3K 1GRJA 2GV9A 5GAGP 1MMMA 2NLJC 4MVMA 3F7VC 1XBLA 2IJHA 3G0ZA 4JI4K 2DWEC 1IKWA 1HLUA 2QWQA 2GTDA 3D2FB 3VGLA 1RT1A 3SJAC 2XTAA 3VTIA 3WXMB 2OWOA 3OYNA 2E76B 1T44A 4FCYA 2A3QA 1VSEA 2HVJC 3HKEA 3WG7C 1QU7A 1HJRA 1EN6A 1I7FA 1P49A 2CGJA 3H46O 1YTFB 3ZMVA 2HVKC 1VHXA 3VQ5A 4LC1A 1QTMA 4TWKA 1QSSA 1U4BA 1XOUA 5M1QA 5J2UB 4I4TA 5JJJB 5EXWA 2XOKG 3ZMZA 3CCJN 1NR1A 4KL1A 3B8MA 1MDUB 1SC5B 1S1XA 4HUFA 3CD6N 2ZXWC 4G2KA 1NBWA 3CMAN 2CK3G 2R9IA 1L5UA 4LF5K 2OIEA 2LGWA 3LNNA 2ADPA 2HNDA 5FNVB 1QLEB 1K7DA 4JPRA 1WSGA 4WFNL 4EZ9A 1KQSU 1VQPV 2IOCA 1YDXA 2ATQA 3AGKA 2QWPA 4H5NA 3JASB 1Z05A 1US6A 4DTMA 1YHQN 1M1KO 4FVMA 1M9NA 3LDEA 1RFQA 4JGSA 2ETJA 4B3RO 1C0FA 5JMVA 2AZ2A 1YITV 2RHKA 3RW0A 1FFXA 3ZHQA 5LL6Y 4NTYA 5KHHA 4QCLA 2YHBA 3O9RA 4YXWG 4M7YA 5LA6A 3ZRWB 5EVZA 4IEEA 3SJQC 3FZKA 5D5QA 4LF5O 3O9QA 2UUBK 4I55B 2RM24 1IXBA 1FS0G 5H5NA 4I5SA 3ZT4A 2LO1A 4PA3A 2YI1A 4H0OA 1RM1C 2WA4A 1S72V 1OZ0A 1NGIA 2GTSA 4G1QA 4FOIA 1YTUA 2WLMA 2YIBA 4LF4O 1XNQK 2LFSA 4KUMA 4HWIA 1IG9A 1M93A 4K8ZA 3CXCM 1OH7A 4B1WB 3HL8A 5AQWA 1H8EG 1I94K 1XL6A 2QWOB 4OKKA 3ZSZA 2E20A 2P5OA 4CF1A 4KFMA 3SK3A 2UUBO 5AZJB 3VRBA 1HJOA 1VF6A 2IJJA 1J53A 1YT3A 3ABLC 4QS9A 3NBPA 2B1GA 3CI5A 4MFBA 2P4KA 1PP9H 1YXBA 4JS4A 3H1LH 3GDQA 3QICA 2F9WA 2OPSA 4UVAA 4CC5A 3HPGA 2DOSA 1GOCA 2K9PA 1XNQO 2YX6A 3IAYA 5HRPA 5AQLA 3OAAG 1RUH4 1Q90D 4BR2A 4JI3B 3B8NA 5BMVB 3STLC 4UUJC 4KHPO 1XQSC 3WNEA 1X9SA 4E7LA 2A7WA 3AO2A 4OGQB 4I2PA 3VQAA 3NH2A 4DUYK 4M3TA 2HNZA 4JI4B 1I94O 2VRZA 2L6LA 1N34B 1F21A 3E83A 4JAUA 2DW4A 3ZHRA 1F4MA 3KLIA 4RW4A 3VESA 4X66K 3LWMA 4W5OA 1BT8A 3QF7A 5TKYA 3ETEA 4BC5A 4M7XA 4BGBA 4BRQA 3OM3B 3WG7B 4PA7A 1I3AA 3OJUA 1R084 4QPJA 1EO1A 3RYHA 3RT3C 3H6EA 4JK7A 1SS3A 2F93B 4O4IA 5EBWC 3L72H 3FKSG 2AJQA 3JD74 3D2EB 3Q4HA 2X78A 4HCBA 4BQZA 1O1WA 4CGJA 1Z2GA 4K8XA 1JR9A 3ICXA 2O8BB 2ZXWB 1PNMA 5L3GA 4GCZA 1GKFA 4CK2A 4LF5B 4MVQA 3JAMO 1VBB4 1OOPD 4BVOA 1BO5O 4H5RA 4AHVA 1WB9A 3RR8A 4NXNK 4IXCA 1JJ2U 3DLKA 3MEDA 4LNUA 3L0QA 4XEIA 3JD3A 4X66O 4WFAL 1JFFA 5BREA 2W6IG 4LF6K 4RW8A 3IDHA 2A42A 1S3JA 3CX5F 4O2BA 3BA8A 4BWAA 3M1FA 5TISZ 5EBMC 4O2AB 4H0LB 1IBMO 4KXRA 4I0XB 3G80A 3ZHUA 4I50A 1ZBUA 4E0DA 2YJFA 3JYCA 3EKSA 4J2EA 1LOTB 2ZCEA 3QEPA 4YJ2B 3ZLJA 1ATRA 5C8YB 4Z2WA 1T5EA 1D8YA 2E74B 1SA0B 4NXMB 2Q7HA 2ZKOA 1ZTEA 3P4PA 4CJEA 2UUBB 4B9MA 3KZIZ 2F95B 3QVNA 4NXNO 2JDIG 1CZ9A 1SZTA 4H5TA 4JHDA 4BG9A 5B1BB 1Q81O 1RBUA 4DKWA 2QWMA 2WP9A 1JMKC 1FXKA 4LF6O 2E3CA 2ITGA 3SBGA 4FZYA 1XNQB 3F5WC 3VERA 3AAPA 4PHTX 3TAQA 4J42A 1P7GA 5FRMA 1IG8A 3GB7C 4JD2B 2P4VA 2QM7A 4JI5K 1J9AA 3CWBH 1JLBA 1WNSA 2HJDA 2YXYA 2KTQA 4FZ0A 3CG7A 2OPPA 5AQHA 1S5LZ 4HAMA 3AVAA 3HKCB 5C0YA 3SQ4A 4BREA 3E9LA 3LWLA 4E89A 2ARHA 5IJ0A 2QM1A 4DSIA 1HNXK 4FJKA 1OVQA 3IFRA 2AGAA 1SL0A 1ATNA 1NH2B 3QBXA 4X9QA 2A3ZA 2P9PA 3FB6C 1FW6A 2Z1IA 2IH1C 3SFEA 4DUYB 1QQCA 3OYFA 2PI4A 4YNQA 3TR8A 3SZ2A 4TUYB 4E3SA 5LMNB 3BZKA 1TUBB 1R3LC 3TAFA 3RYIB 2V4DA 4BRGA 4B1UB 4K35A 3H01A 1JL1A 3CJBA 1YJ9N 2ATKC 1J54A 3ABUA 3IC9A 4H8KA 4CEDA 5B1AC 3AVBA 5CHIA 2KFNA 1UFIA 3SYAA 4DTJA 2RJZA 2HBMA 4F2SA 5J1EA 2Z3YA 3SMSA 4CVNE 3C95A 2ODMA 4K43A 1GM7A 3ULEA 2FC0A 3VGKA 4ILGB 3KZBA 3UB5A 2DTUA 4IHJA 4O5FA 1VQ8V 4NXNB 3KLHA 3C0BA 5KPTA 1A5VA 3CHXA 4PI2A 5IT9N 4DCHA 2X6BA 3SUPA 3BABA 2QA4V 1EAH4 4H5VA 5KAFZ 2CAZC 3DMJA 5GONA 3DLHA 2JWLA 3ZX6A 3VA3A 3AE6A 1YI2V 3CFOA 3IUCA 3WB0A 4X65O 3OEHG 2CH7A 3ATVA 3UQ8A 1Q82W 1NTKH 3D3QA 4DR4K 5HP1A 3O08A 1VQ9N 1B92A 3PLAA 4XH4A 1ITGA 4B9SA 3RGBA 4CERA 1TVKA 4UV9A 2DY4A 1E3MA 1TAUA 3B6OA 1I5XA 3H45C 3LSSA 2IBZH 4HNAB 1YZBA 5AQOA 3OMIB 4BRLA 2O8FA 1K92A 4W4KA 3ALYA 1T6DA 3WFVA 4CZZA 2QXLA 3P83D 4PI0A 5M1PA 5AQSA 4B1ZA 2HHVA 3F7YC 1NCQD 3QMLA 2OCHA 4BW5A 2FF3B 1HNVA 2ZJPL 3TXSA 3SPCA 2DYSC 2FLOA 1PPJH 4GYCB 4GX1A 1T8EA 4JI5B 5CYQA 4DR4O 1Q86O 2F1MA 5L3BA 2A0LA 4Z1VA 4ZIBA 4GV3A 4DV0O 1W2BM 3UIQA 3QINA 1Q6UA 4FJMA 4WQ5A 3ZSXA 2M7WA 5AQYA 4WBNA 1T03A 2E1ZA 4O4HA 4PDWD 1RGIA 4JKAA 5KGWA 5IWAO 3P38A 1HNXB 4DR7B 2NRRA 2P9NB 2R074 1VP7A 2KG7B 1TV6A 3MDSA 3CXCU 1K5QA 2JEXA 4K0KO 2RMKB 3LDPA 4DUZK 2H3OA 3E22B 1NJIO 3TARA 3WT0A 4IO9L 1GAXA 4GW6A 4DFPA 3TANA 3SMPA 4BRDA 2QWLA 2ITMA 4PKHA 3O8MA 4WCEL 4YTNA 4DR6B 4UFZA 5E1AC 3O80A 4YXDA 3JASA 3TPQA 1HNIA 4LY7A 5B1AB 1QSYA 4FL9A 2D0BA 2Y48A 4PJ0Z 5H2FZ 5C42A 4DW0A 2B5JA 2QW9A 5FDLA 1Z7S4 3MK6A 4FXDA 4OJRA 3SPJA 3MDQA 5LMUK 1NVPD 1FXXA 1HXS4 1ZOYA 2HHSA 3TXQA 4OKEA 1ILYA 1N36K 3AE9A 3TI0A 1XWLA 2FSJA 4CEAA 4JS5A 3ZMUA 3L2UA 5ELZA 5EX5A 2QWRB 2ASMA 1QZ5A 4JV5O 1HKCA 4MT8A 1G1XB 1VF6C 3S3MA 4CC6A 5CYMA 4LH4A 4YIPA 1DT9A 2BOBC 3G4SV 1AR5A 5LMUO 4XDKA 3MX5A 3CFRA 3NGZA 4FJ8A 3SGIA 2WLNA 2ZJQL 1VRH4 2YHAA 4MVSA 3AE1A 2M6YA 3HKDA 4BR6A 4JF3A 1I5YA 1BQMA 2WSSG 4J2BA 4IZ9A 4CJRA 4U7NA 1VSIA 2QSAA 2C2AA 2HEPA 2FMLA 2JJ2G 2Q68A 3E35A 3SFDA 2QWQB 4J41A 4LF8K 3SI6A 2A40A 3V9SA 3RBZA 2DYSB 3RN4A 3AVJA 3E66A 4CHPA 4DQIA 1LAVA 3HKEB 1BU6O 1TL1A 4DV5K 4I7ZB 3ULDA 1HR0K 3WXLA 2R72A 3VN5A 2V7YA 4KKOA 2DYRC 2HWB4 1RDAA 4FO0A 3FE1A 4I4TB 5KX5A 3CJ7A 1B06A 3NF7A 4AM6A 1BEV4 1EV14 5IDJA 3ETQA 4NVPA 2VG7A 3K57A 3FB5C 4KP4A 3ENHA 3L3UA 4LF9K 4F3TA 2ACZA 1VBA4 1K3EA 3L71H 4BRKA 1YJNN 3SLCA 1VQOV 4F2RA 5AQUA 2EIMB 2WPDG 2A9HA 4JTCB 2DFHA 3TTCA 2P9IA 3KWGA 1YUWA 3M8PA 2OCCB 4IL6Z 1JCFA 4DUZB 1ROPA 2QWPB 2MW2B 4DV5O 3AVCA 1KMIZ 3HO1A 3QBWA 4YSYA 1ZAUA 4IFYA 3ZSVA 3LZIA 4LFAK 4JYYA 3NFAA 4LSLA 4NB4A 3RVCA 3QEIA 1U96A 5EK0A 4WQ4A 2WDVA 4Q4W4 4CI6A 1RUE4 1FFXB 4FJ9A 2QGNA 1GLCG 4AQYK 2ASOA 5AG2A 2YIAA 1BQZA 3AE2A 3E8HA 3G71N 5LA6B 3B6PA 4FM2A 4BIUA 1XNRO 3GL1A 4PUOA 4OGEA 3M8AA 2CUGA 5B5EZ 3HTVA 3CJCA 5B3SB 3FR0A 1NGFA 1VQ7N 1FXKC 5LMUB 4F4LA 4DFMA 2KKZA 3ASMA 3UO3A 2D4WA 3WNGA 3P4RA 2ZJRL 2QWNA 4BRFA 3SYCA 1HYZA 4FJGA 3H1IH 2GWJA 1IBKK 2Y4TA 2DPNA 2QM4A 5JJNB 2P67A 5IYZA 1P4RA 1N36B 1ZBFA 3HI0A 4AQYO 2F8TA 3RMBA 3ZN0A 3VQXA 4OPJA 3QNOA 5J2QA 4BW9A 4M41A 2ZE7A 4FPPA 5L3EA 2HHQA 3NH0A 3CCLN 5AR0A 2KZZA 1KLMA 4DTPA 2Y0PA 2GUZA 4RG8A 2FTKA 4JI2K 1WLEA 3FFIA 4W5NA 4JASA 4ZHQA 1AP5A 2HMIA 3M8SA 4BRCA 3I56N 5FPRA 2VQEO 2WA3A 4DQ8A 2WQYA 1MWKA 4HTLA 3AECA 3GVMA 3ZCMA 1IBKO 5EYPA 2EINC 1VQMN 3E86A 1MG1A 4MW3A 4QPKA 1Q7YW 1DTTA 2FKXA 5AQQA 4LF8B 5C25A 3THVA 4H33A 1VQ4V 5FPMA 3VMFB 3OBYA 3LP2A 3J81O 1W0HA 2IGIA 5LL6Z 2D0OA 4B3MK 4M3WA 4DV5B 3RYHB 3QO8A 1HR0B 3AG1C 2WTUA 2DYRB 5M1FA 4O4IB 1L3UA 4JI2O 5KPRA 1NJXA 4JLHA 3Q4HB 3OA9A 2H88A 1RDDA 3O3GA 3OS1A 4LF9B 4AHSA 5JS1A 1SESA 3MN9A 1WSEA 1NMDA 4JI7B 3K08A 1WPXA 1S1VA 3EFFK 4DR2O 3O1BA 3CM5A 5CZ1A 4CEZA 1FKPA 1FXVA 4LNUB 4JKHA 5JH7A 3LDDA 2FL4A 3BP8A 4CZMA 1EZJA 1JFFB 1XMOB 3KVGA 2Q97A 4CZGA 1YF2A 3SJJA 3C94A 4O2BB 3C3TA 4FFKA 4MS2A 3OYKA 1GTOA 1SQBH 1W2BU 3U11A 1KVBA 3PY8A 3ENOA 1NA1D 4LFAB 3F2KA 3IFXA 4I50B 1LCUA 4BRPA 4IJNA 4JKBA 1JVMA 4CGIA 2Y69B 1SZ2A 1K5MD 5L3FA 2NRZA 4AQYB 3BFRA 1MABG 3K5OA 1X4TA 2CGNA 4ZI7A 2F8SA 2HHHK 3UKMA 1OJHA 1C6VA 3LP0A 2H89A 4JHDB 5BR9A 1SETA 4DV1O 4NTXA 3LPTA 3K5NA 1GLFO 5E41A 2ZGYA 4I9QA 3KK1A 1FXKB 2NN4A 3DI6A 3JYTA 4RO2A 4YHHB 1Y6XA 4OX9B 1SQFA 4PELA 5LGNA 1XREA 2A1RA 4ICGA 3L75H 3IKMA 3NF8A 1HKBA 2GHYA 4LFCK 4FIPC 1P8ZA 1I08A 2BGGA 5AQVA 3APQA 4H03B 4FJIA 3NF9A 4M3RA 3ETGA 1HUXA 2HHHO 4WQ5C 4LBEC 1NZ6A 1WJZA 3MXJA 4JI6K 3O5BA 3KLGA 3H9VA 1R3KC 4UCSA 4B08A 5AQFA 3K5MA 1CP9A 3A5OC 1S0VA 3LPUA 1POV0 5IJ0B 4E1NA 1TKTA 3AA4A 1C1BA 2YI8A 4E7HA 3ATUA 2Q69A 3MXIA 1NK6A 5KHKA 4WE1A 3ZX2A 4DSLA 1DKGD 2IVPA 2XNDG 1BHLA 3M8RA 3ZHSA 4LH5A 2YNHA 2O8EA 5EIBD 3E9OA 3AAQA 3ZIAG 4LFCO 1OCCC 1K4CC 3BRCA 1T3VA 3THXA 4YFUA 4KB0A 3V9XA 1VQNV 1F51A 1OH8A 2P9NA 5AQNA 1ZBSA 2WUSA 4GNIA 1QLEC 4KB1A 2Q73A 2PGGA 3CC4V 1AR94 2Q67A 4JI6O 4B3MB 4BRMA 2XRIA 1QR9A 4JKCA 1VQLN 4LFBK 2R064 3OYAA 4EP4A 4E1MA 1GM8A 1YQ3A 3MCAB 2EILC 5HOOA 4CJ5A 4BRHA 1VQKV 2ASPA 3ULEB 1SKRA 2WFBA 4ELUA 4TT3G 3T3FA 4IHJB 1VF5B 5GAHP 3N2KA 4BRNA 1HNWO 4DV6B 2LGQA 1P7BA 2JEUA 3K04A 2XT9A 5L3CA 5TKWA 4BROA 5BRDA 4E7KA 3QETA 1Y97A 1KF6A 3DOKA 1GN4A 2I7NA 2LW1A 3DLBA 4JI8K 5KHJA 3CC2V 3AVGA 3MXMA 3FGUA 4A5BA 5GONB 3ZJZA 4M3UA 1S9GA 4E7JA 1RHI4 3W7SA 1MSWD 5DN6G 2E6LA 2HMPA 3AEDA 2YKNA 3CCUN 3CD6V 2CH7B 4LFBO 5BXZA 3CMAV 3VEYA 2GUIA 5EBLC 1U2VA 1VSKA 5EZYA 2JGDA 1YEWA 3K5LA 4F6EA 2YI9A 1JLFA 1VRUA 2WDQA 1TVKB 3L2QA 2HHHB 1K73W 3T4DA 4KHUA 1F4NA 1BSMA 3AV9A 4GLXA 5IJ9A 4P9PA 3AEFA 5J9PC 1N8RW 1Q5OA 3SAFA 2O8FB 3O65A 3QIOA 4DV4K 3JAKA 2O8CB 3D36A 1P84F 1KB9F 2YHXA 3SV4A 3N2GA 3D7EO 1RUI4 1JQ0A 5AZIB 3OHRA 5JVHL 1IH7A 2Q1NA 3EE8A 2PYLA 3KKRA 4GV9A 4KBOA 2QTOA 1NT2B 4C1NI 1L0NH 4CEBA 2P90A 4DTSA 4JYAK 2UXXA 3U9ZA 1B04A 5KHIA 1C0TA 1RT2A 2Q0AA 4F8RA 4H0PA 1R3IC 4WBNB 4J8FA 4J2DA 2PLV4 4HYOA 2RCVA 1EFRG 4O4HB 4UCTA 1K9MW 3JD4A 2GX9A 3DRRA 4DV4O 4RWTA 1R1BA 3VEOA 1ASUA 4KV8A 3RMDA 4PV1B 4NLCA 4B3RK 2XHBA 1IKXA 3SJBC 1U6ZA 4RAIA 4MLEA 3CRRA 3LDOA 2NNUA 5CA0A 1V9PA 1SQXH 4OLAA 3CCEN 3CHWA 1S9EA 1OCCB 4C8NA 3T1CA 4JYAO 1BDGA 2FSNA 3H3OB 3M6GA 1WBBA 2EJRA 4B8CA 4PDRA 1GLDG 4QE9A 2F96A 2HHWA 4QIWF 2Q36A 3MHHC 4WQ4C 4YT0A 3VEWA 1Y67A 1M56C 1XHXA 4OGCA 4H5WA 4LF4K 5FPNA 4GVMA 5M1NA 3SBTA 3O9UA 4DQPA 3VOVA 3E89A 3OYLA 5AQIA 1TK8A 2EILB 3S3WA 2UU9K 4O0JA 3PSIA 4IOCL 2YHYA 3MN7A 3JALA 4PDMA 5BRFA 4CJLA 2DMXA 2F4VK 4A5AA 1WB8A 2RQ6A 3ZHTA 3FB7C 3MN6A 2HBLA 5H6QA 4YTPA 4J9ZB 3QG5A 3K9SA 5B1BC 4JI8B 3GQHA 1HPZA 4DO2A 4KO0A 4Z4GA 1COV4 1NQTA 5LHGA 1RILA 2FXUA 2VYPA 4CEEA 1R73A 2WLIA 4UXNA 1H1VA 4EHUA 3KKYA 1EQYA 3O9OA 4BR0A 4CESA 3J8F4 2FB5A 4KHPK 3ITHA 2VWBA 4FLZA 3J8AA 4EFBA 4UY8O 4JAAA 3I0SA 1Q9XA 1RUC4 1VSDA 4DK1A 2UU9O 4M63C 1NK0A 2DWDC 4EFHA 5JCOC 5IE9A 4XH5A 2UXCO 3N4PA 2JWKA 5D5PA 4GMJB 5KMGA 2F4VO 5C24A 1ZL8A 1XQ8A 3HKDB 1D9FA 1OHHG 1WAZA 2X6AA 3AG7A 1EBOA 2ILMA 4DV4B 4IDHA 1BWFO 3MECA 1MQTD 2E8AA 3KCXA 1NOYA 5I3UA 3AE8A 3L8BA 4JKGA 2W0XA 1SQQH 3TSQA 4YOUA 4MQ3A 4Z1MG 3ZT0A 1TGOA 5B1NA 3W3DA 3SYZA 3K0GA 1KFYA 5LYJA 4FWMA 3U9DA 1XEQA 4CF0A 1ZX3A 2YCHA 4JYAB 1BE3H 3CRQA 1NKEA 3JSMA 5BY1A 1M1KW 1KFDA 3HM8A 3VQBA 5KX5B 1BCOA 4CD3A 3NVMA 1EXQA 4OPKA 1OCOC 1CZAN 4CZIA 3R9PA 5DM6V 2W0FC 3ASNC 4J9YB 5JLHA 4N56A 2YKMA 1IBMK 4FJ5A 1HNZO 4B3RB 5LGTA 2P9IB 4Y1CA 1D2DA 1NS1A 5HFMA 2D1KA 2WWWA 3PSFA 3AVIA 5ITZB 1KTQA 2NRWA 1TAEA 3QERA 3N27A 2GEMA 4Q20A 5DM7L 2ITCC 2YV0X 3BEXA 4M3YA 1X3NA 4ID1A 4WFGA 2G8WA 5BR8K 3CCVN 3L9DA 1JJOA 1M56B 3QNEA 3H1JH 4WFFA 4LF4B 3B8AX 4WFHA 2QKSA 1UWBA 1B9FA 2HJFC 1Y74A 3STZC 1N33K 3CM6A 2GBZA 1AR4A 1BIZA 1S72N 1VSMA 2LW7A 2FBXA 3OT7A 2P9SA 5CY4A 1EKEA 3KK3A 5B8HA 2XY6A 3HKBA 4JKFA 1AJNA 3RMAA 1KLNA 2QWNB 3ZSYA 2F4VB 2PAVA 1YJ9V 4FZ1A 2OPRA 4KH4A 3TSUA 2KFZA 1GK9A 4IFEA 1B6QA 4UCUA 3F9KA 1AI7A 4MDAA 4MTFA 3O1WA 2XO7A 4DR1K 3EZ5A 5T7BA 4HUGA 5IYZB 5BZBA 1QZ6A 4Z0UA 1PO14 5BR8O 4CJ7A 4PY5A 3AEBA 1B9DA 3NHGA 2P5GA 4C23A 4ILHA 1AJPA 2GBOA 1AI4A 5BN9A 1NEKA 3ML0A 1Q43A 5CA1A 1N33O 3DXRA 3AG3C 4KHPB 1ZSPA 3F5TA 4DV7O 1SS6A 1TUUA 3P1GA 4CW7B 3K0DA 1NK9A 1D4XA 1HWYA 2GUZB 1I94B 4JI1K 5F1XA 4J7JA 1R094 2CH6A 3G6EV 2B6AA 4FW1A 4ZHQB 1D9DA 4B3SK 4PKGA 3AE7A 3ASOC 1RTHA 1O9HA 4DR1O 4GKKO 4JN4A 4F6RA 5JS2A 5DEDA 3KJVA 4CH5A 1MWMA 5EYPB 1QVGM 1WAFA 2NLXA 2QEXN 1VF7A 4WF9V 3GG4A 1UJWB 4JAVA 4RWUA 1RT6A 4KREA 1VQ9V 1ZYQA 4V19S 2HG5C 3C6UA 3CRAA 3A5LC 1FPOA 3LDQA 1ZLZA 4R8CA 2WS3A 1IX9A 2Q0OC 2QTDA 3ZEDA 1GLAG 3AVNA 4FWKA 3J80N 4K41A 1SQPH 1A5WA 3PIPL 2HWC4 1OH6A 3KHYA 3L6QA 4O8UA 4BDYA 3OW2M 1KC8W 2QXFA 4TV9A 3JAWA 5HRNA 4NCAA 4JI1O 4CS4A 4Q5VA 4B7EA 1NBMG 1L0VA 2HVIA 4B3SO 2P9KA 5ADXH 2H94A 4ZTJA 4X66B 2NZTA 4CHOA 5GIPA 1OCOB 4W5QA 3FD9A 1Q82O 4BWMA 3SQ0A 3S3NA 1S6PA 3ASNB 5HL7L 3OYEA 4U7OA 1HW7A 1IBMB 2HBJA 1OCRB 2J4RA 4K3AA 5F2RA 4X65K 3G10A 5JH7B 3R8EA 3ZN1A 3CCSV 1NK4A 5EC1C 5B66Z 4OLBA 3BZCA 1RBRA 2QM8A 1GLBG 1HQUA 1JXEA 4AHUA 4AI8A 2H3GX 4Q4X4 4OKJA 5HROA 4BR5A 3HPHA 1NOZA 3I5DA 2VG6A 5GAEP 3HR0A 5BR8B 4WFBL 4LF6B 2OYQA 4UB6Z 3AVFA 4ZI7B 2BSKA 4DTNA 3MCPA 4O55A 3GWOA 2CGLA 3DC6A 4DU4A 1AI5A 2G8KA 4FLVA 2ZF5O 2Q0UA 2JGUA 3OYHA 3CJAA 4DV0K 3CE2A 1LW2A 3I8DA 1LV5A 3FZFA 3AA2A 1BISA 3AARA 4DV3K 2I7PA 1D4M4 1KSPA 4ISGA 2GDSA 5AJ3K 5CBFA 4TSFG 3U10A 2GTAA 3VRAA 2AXTZ 2OZSA 5IWAK 1DF5A 1VSHA 1Z6RA 2IW5A 1AJQA 3FFQA 3JSLA 3J7AP 5C15A 3OFNG 4FWRA 2VWKA 2Y4UA 5AZIA 4K0KK 4GZRB 1ESVA 4FWNA 1B3QA 1MA1A 1BCMA 5I42A 3AG3B 2X5ID 2YEVA 3UM7A 1OKJA 1PNLA 1NGAA 4RTFD 4JI1B 5FPDA 3NXSA 1BI4A 3NGYA 1BMFG 2QR4A 3CC7N 1NK7A 3SDLA 4DV3O 1LNQA 3ASOB 3NDKA 4X1IA 2O8EB 1AR1B 3OYIA 2JJ1G 3THXB 3K3WA 2LP7A 4PA4A 1W7AA 3AG2C 3O3FA 2EIMC 4HCCA 4XDJA 1FFTB 5KA6A 2W42A 4OO1J 2WU2A 2E2QA 1X1PA 3CPWM 5LHIA 1S5HC 2OCCC 3CCMV 2Q7GA 4OVLA 3DXKA 1HDJA 1AILA 3KG2A 4DR5O 1CXQA 3AVLA 3C6HA 1GLEG 1L3VA 1EN4A 5LP6A 2KW4A 3CCRN 5E26A 4RW6A 1XMQK 2IIRA 1BA1A 3CRMA 1TKXA 4JEPA 3MAQA 1YXQA 1DF4A 1M90W 2Y1IA 1BIUA 3VETA 3N2KB 4DW1A 3ZRVA 1BGXT 4JV5K 1RBSA 3CF5L 2CDYA 3J7AU 4X65B 4NYFA 3P4QA 3L2VA 4X20A 4X1YA 1YTFD 3VGMA 5B3SC 4DWIA 1RT7A 2ZQBA 2NNWA 3O9TA 3ZSQA 3A2FA 1YI2N 3CERA 3IJ4A 4O4LA 3H1HH 2FF6A 3WQTA 3NH1A 1QR8A 3HT3A 4FJ7A 2P22C 2PW9A 1FJGK 2OTLV 3VQ8A 4CGDA 4DLEA 3VQCA 1U2VB 3JS6A 1XMQO 5EZYB 2JGDB 3UT5A 4JK9A 4M42A 4JK8A 4GB34 2HOEA 3AGRA 3HOSA 3H3NO 5HBMA 3EN9A 4BAYA 3WNHA 1JCEA 3IMXA 5IJ9B 2VG5A 3DAWA 4BIZA 3OBWA 2R7YA 1H8TD 4ELVA 2VWJA 3B09A 3CMEV 4DR4B 4IT5A 3JXUA 3JAKB 3K9KA 4YORA 3V9UA 4DV0B 1UPGA 3EO3A 2ZM6K 1PL4A 3N2GB 3NF6A 1PM9A 3RFRA 4DK0A 2PUSA 2Q4PA 3QESA 3G71V 3ID6A 1FJGO 4L8JA 3MN5A 4NCBA 4RUFA 5IWAB 5C2DA 1T05A 1N0NA 3PUFA 4K25A 4CFAA 2DJVA 3VOUA 4ABMA 4HTUA 4M3XA 2P51A 1EM1A 1L0LH 2ZDIA 1VQ7V 4K0KB 4FJNA 1C0GA 4GY2B 2E75B 3ZETA 3L2RA 2HHTA 3T19A 3I55N 4ELTA 2ZD9A 3C6TA 1BL8A 2ZM6O 4FJJA 2BANA 3GE1A 4JKDA 3RMCA 1PV0A 3CIPA 4OPAA 3HXMA 5CA0B 3AO5A 5FPEA 2RS14 5IY5C 5FLXN 3LAMA 3FI7A 1X3MA 1LWFA 4CK3A 5F2VO 4PKIA 4KI4A 2CH5A 1XNRK 1VBD4 1MOFA 2IS3A 3AG2B 1E1RG 4UVBA 2Z1HA 2W41A 4B1XB 1JLCA 1VK0A 3L4QA 1GOBA 1VBC4 3AVHA 3C65A 3M3ZA 1Q18A 1JOYA 4YOTA 4OXSA 2FBTA 2Z1GA 3VENA 5ITZA 3EE9A 3B77A 3GBTA 5JQGA 1N32O 3QEWA 2YC0A 3M99B 4YY3O 4Y1DA 4AHRA 1RPRA 1VQMV 2F7TA 2Y69C 4FJHA 1EWQA 1QVGU 2V7ZA 3GWKC 3AEAA 1KU9A 4IWVA 4EAHD 2Q31A 2W6JG 3JALB 4CZKA 1IZ3A 2YXLA 2OTJN 3O4WA 1LR1A 4JV5B 2CGKA 1HRHA 2WBNA 2BH1A 3E9PA 4KPYA 3DWLA 1H2NA 4LH7A 3QFPA 3THYA 4C8OA 3P4SA 1WPBA 4YSZA 2P9LA 3VEXA 1PNKA 3LL3A 1WBDA 5GTHZ 1LWCA 3HP9A 3PX4A 2D5RA 4MTOA 2YXHA 3OW2U 2FYUH 2BTQA 3JD2A 1G99A 5LGUA 2WLIB 3ZT3A 1Q7YO 2VQEK 1W59A 4CJKA 3G4SN 4B3TK 1FJGB 1VARA 5AQGA 1OVYA 4KRFA 4F3OA 2ZQMA 2XY7A 1RFYA 4YTMA 5IYCO 3CETA 1D5NA 4YJ3A 5J2PA 5FPOA 1YIJN 3VQDA 4I6MA 1GLLO 4EKWA 5KMGB 4DS5A 1ZL8B 2CTWA 2R9RB 1CEZA 4A61A 5EC2C 4A57A 1ZP0A 3TAPA 4DR3O 1KKCA 3KK2A 3OGCC 4X8AA 5HLFA 1QLNA 2WONA 3CQXA 1IVSA 4HZ3A 2ZM6B 3BY5A 4JKGB 3TK1A 5GTIZ 3MEEA 3OE7G 4MVOA 3DLEA 1SF9A 3L3VA 1X9MA 1FYJA 1H2MA 1BOTO 3K06A 2L35A 4CH4A 3ABTA 5LYJB 3T1HO 4B3TO 4HVJA 5AFUA 4ZTFA 4CECA 4A59A 5SZTA 4JAXA 4DR2K 1RUF4 4BC2A 4Z4HA 5FROA 3CFPA 4GKJO 1JCHA 2HF3A 3KD1E 4KHYA 1YQ4A 4TSXA 1VQON 1A5XA 2XAQA 3JCUZ 3LUTB 4CIEA 3AE3A 5JVDA 1JA8A 4NYKA 1HQEA 4CJ4A 3KKSA 4NKGB 3T1AA 2RMU4 5LOVA 2XAJA 1KD1W 2IJIA 1QQMA 3BEHA 5KRTA 4HUEA 1NK5A 2RS34 1NGDA 3ZRXA 4BWJA 5ADXA 5IY5B 4CEFA 4BR9A 3ZX0A 2HNYA 4IFVA 3S9HA 1XNRB 4KI6A 4CJ3A 3QNNA 3OUFA 1QNMA 3FAVA 3HB3B 2UUCK 3LM2A 1C1CA 2A6AA 4DV1K 5D3GA 2Q7EA 4I2QA 3QO5A 4CZLA 4XIUA 5F0XA 1TYQA 1YVWA 1M4UA 4EEQA 1NH2D 3PIOL 3KLEA 1Y74B 4N47A 5IT9O 4ZKIA 2CGOA 3VEVA 1X59A 2PY5A 2P9SB 1Q6HA 1N5YA 2YNIA 4DSJA 3HKBB 3EVKA 1VSJA 4F4KA 1K8AW 4GX2A 3LP1A 4DV2O 4BDPA 3MEGA 4CFDA 1UAXA 5KQ8A 2EIKB 2JVDA 2IAJA 3W7XA 2HW3A 3AK1A 3RRHA 2UUCO 3CPWU 4DMNA 3JAMN 1ZBLA 4GV6A 4C7UA 1M5IA 1VQ6V 3JBG4 3PO5A 4IO8A 2O4GA 3IS9A 4H0XB 4FMTA 2E6MA 2QE7G 1SQGA 4PHZA 1TVRA 4PWDA 1KKDA 3HVTA 2VQEB 5CA1B 2RF2A 3L4IA 4CEOA 4B3TB 3DXRB 2E5LO 3HOTA 1IBKB 3TSPA 3V1QA 1WAJA 4IBNA 3CRCA 3K2PA 4B9TA 4FLXA 1LWEA 4DS4A 1QQOA 3TCUA 4R79A 5J2NA 3R1XA 3AG4C 3I33A 3FYEB 3H1QA 3LALA 1IXMA 3WXJA 5A9GA 3CP1A 4P30A 1TAQA 1WLJA 1AR64 3MWTA 1AROP 1I39A 2UUAO 4B9NA 4F6RB 4DTUA 3KTQA 2Q5ZA 3M7MX 3IC7A 2N05A 4WFAV 5A2QN 3CCUV 1RT3A 4FWSA 4B8AB 3AA3A 1U47A 1TK0A 4KTQA 5KUKA 4JI2B 4FPAA 2WOMA 4MDBA 3VF2A 3N4QA 1UA1A 3LDLA 4DU1A 4C8KA 3O6WA 3FFKB 3E01A 1NR7A 1BS3A 4TV9B 3JAWB 1HNWK 4DR2B 4J10A 1IDSA 2QK9A 5J2TA 3SUCA 3WXKA 2JS5A 3TWHA 2P9KB 5K14A 5CBHA 2DQ3A 4H4OA 1Z5WA 4UVCA 1BQNA 4QJFB 1ASJ4 1QBZA 4Z4EA 1V54C 4X88A 4PDLA 2G8FA 3E8FA 4M45A 1YJWV 1BL3A 3HBTA 3OYGA 3ABMC 1K73O 3VQVA 4ISEA 3BY6A 1G15A 2NRVA 1JXBA 3SV3A 1SERA 3RYFA 4DTXA 1NKCA 4FK5C 3JD1A 3SCXA 3F9MA 1QQNA 2X6NA 1EN5A 1N8RO 1EZVH 1NK8A 2VCPA 4CS3A 1RPOA 4CHQA 2ZE2A 4IIJA 2X7RB 3DTUB 3JATA 3HK2A 5IYBO 1MU2A 2UUCB 3P31A 2RN2A 2E4LA 1FD9A 4DV1B 1Q6IA 4BIOA 1AL24 4C8MA 3RYCA 3P30A 3ZHVA 5GINA 2Y1JA 4PQUA 4CJWA 2LSNA 4P2ZA 3CYMA 2BSKB 3CCJV 4BE0A 3QFUA 5EOYA 3WQUA 3VA0A 3W7UA 3CCEV 1VQ5N 3AEIA 4AH9A 5KTQA 2JK5C 1R6TA 4UV8A 1EETA 3CCQN 3U0ZA 2UXNA 2Z5UA 1QHTA 2ADQB 3D3IA 1K9MO 1AVMA 1XL4A 4YOXA 1XUPO 1KYOF 1S1UA 2X6CA 5M1KA 3CS5A 2Q8VA 1TK5A 5AQRA 4CBCA 2IC3A 2X0LA 1YHQV 4I9LA 2D0AA 4A2AA 1RBVA 1ZXOA 2ZNIA 2D0CA 1TUYA 1X9WA 2AZ0A 1V55C 4QS8A 1R0AA 3SPHA 3OY9A 3OYCA 3APOA 4H0YB 2NRHA 3ZEUA 2RE2A 3VQYA 3PO4A 4BC4A 3OYJA 3A0RA 2ZDIC 2F66C 4MVUA 3LP3A 3OTOK 2RS54 3ZCCA 4MSWC 2OPQA 3MHSC 3SAHA 3RVYA 3HP6A 2YEVB 3BDPA 3ABVA 4LFCB 4NB5A 4J80A 4YOWA 3E8BA 1G4YB 2Z0AA 3AG4B 1BI4B 3TAEA 3K0SA 3BHPA 3SUOA 4X1IB 4JI6B 3EL2A 1L8DA 1QS4A 1WSJA 1VQNN 2XY5A 1LW0A 1NGJA 3DXMA 5CB4A 3BF3A 4H13B 4FK2A 1Y66A 4QE7A 3NAEA 3MD0A 1VIBA 5CMUA 2QJ1A 3U8XA 2F9TA 3DM2A 2A5XA 3OTOO 3T2MA 4ZHRA 1FXHA 3G25A 2V52B 3DXKB 4U7BA 4BC3A 5BRHA 4DRXA 3E8GA 3FLCO 3SYQA 1HNWB 3D45A 3KK7A 2AW9A 5BPNA 2A79B 1ZC6A 2ZR3A 5LP6B 2RPIA 1N34K 2WC9A 1VQKN 1S6QA 1SRYA 3Q7CA 1RDWX 2YSUB 4FFBA 4DF4A 4J2AA 3OS0A 1V54B 3MWPA 1EP4A 5JICA 2E88A 1NGGA 3KWIA 3CSXA 3QTCA 1BA0A 3ABMB 3PJSK 4PA9A 3CC2N 4LFBB 4FZXC 1CXZB 2V7QG 4X20B 1VEWA 4X1YB 3D0PA 3ENBA 1NVPB 3X2QC 2OA8A 4JI3O 5KGXA 3AK2A 1XILA 3RSEB 4O4LB 1UOCA 1YAGA 2UXCK 1NTZH 3QO9A 1U45A 3W7WA 2O57A 4JI4O 5LJWA 1YVNA 1QVFM 1N34O 1V4SA 3RWUA 1GM9A 3UT5B 3V6DA 4O8KA 3ZSWA 3AO3A 4GX0A 3DGEA 4RQEA 4CJVA 2WDRA 4EZ6A 2A1SA 5BPLA 1RMU4 3EEQA 1HKGA 4DSEA 4DFKA 1H2LA 2FSKA 4J7ZA 1DK1A 1HYVA 4IDKA 3SUQA 1RTIA 1VSLA 4TV8A 3TAMA 2OT5A 4CZHA 1FK9A 1O9GA 1R3JC 2LJ2A 3QIPA 3PV8A 4LH6A 2XAFA 4NXMK 4UCVA 1BUPA 3CCVV 1QHAA 4KHSA 2R9AA 2ZGZA 4QS7A 4UCRA 4FLYA 2D3OW 3MMVA 1RTJA 3T69A 1V55B 4JZ2A 4WCEV 1IJJA 1RBTA 2FBYA 2XY8A 1Z5VA 4FJCC 1KUQA 4N5SA 1HNZK 2ZNJA 3KIOA 4FOEA 4CD1A 4W5TA 3U3YA 4N76A 4CZFA 3OTOB 4CF9A 4Q4V4 1RDBA 1PKXA 4KHQA 3A8TA 4AHCA 2YIBD 4LWSA 3ZETB 4IOAL 3HSCA 1RP3B 4ZOLA 3ID8A 3Q7BA 3FZLA 3SJHA 3SQ2A 5E84A 1XC9A 2WLLA 1DTOA 2AHZA 4DTRA 3AO1A 4NXMO 1KBHA 2GUPA 2IJKA 2GWKA 1ORQC 4PDVA 3AA5X 3QLHA 4E1JA 4CF2A 1T7PA 2R044 2G8HA 1YVUA 5KLVH 2NRTA 2KKWA 4JZGA 4AHTA 1W0KG 2BTOA 3BA9A 3I0RA 5CR4A 1V4TA 2HFEC 4Z94A 1OCRC 3PN1A 1VQPN 1RTDA 4JI0K 3EXAA 1R59O 4TOIA 1GMGA 3A0HZ 4Q6GA 4RQFA 1ZBIA 1RDCA 5SWMA 3CQ8A 5JQGB 4DQSA 2EIJC 3SPGA 1YITN 2P9UA 1LUVA 4X1KA 2ZE6A 3DJCA 3CEIA 5LMNK 2QEXV 1XDCA 2AP1A 1FAFA 3R65A 4BVPA 3LM9A 1ASWA 1BHAA 1TKZA 4CJTA 2A41A 2JIZG 5DECA 1XUQA 3ZSOA 3AE4A 4PL8A 1MSDA 4IG0A 4CFCA 1ATSA 4MTXA 3THYB 1GH6A 3VQPA 3EY1A 4DV7K 2P9LB 1HRV4 3X2QB 4JI0O 4CS2A 2P1JA 1IKVA 1RUD4 2FBVA 2UU9B 1N6QA 4Z4FA 4QOZB 2BTQB 5KAIZ 2UXCB 3C6AA 2DN9A 4DUYO 3M5RA 4K42A 4CHZA 4X64K 1PVC4 2HBKA 3TGUH 2B76A 4A62A 4GKKK 5LMNO 5C2TA 2V1DA 1WA8B 3FZHA 2O4IA 4U3JA 1S22A 1KC8O 1REVA 4YJ3B 4FM1A 3JSNA 3BGRA 4YIOA 2H8PC 4AILC 4I6MB 3UKUA 1KVAA 2VGMA 3WEEA 1BHBA 4BQLA 3WUHA 1AR84 1DGSA 4C8LA 5HRSA 2DFEA 1R6NA 3OD4A 2G38A 3UO2A 2QI2A 2IVOA 1Z25A 2OIGA 4DG1A 2YUAA 3AVMA 3S3OA 1NGHA 4Z4CA 4YSXA 1GLJO 1YF5L 2CTQA 4DLGA 4KX6A 5EIBC 1S5JA 1KECA 4RW7A 5AFUH 4X64O 3O3HA 2I5JA 1RM1B 1NM1A 4Q4Y4 2YIDA 4U3FH 5I9EB 1HNZB 1I0HA 5DMRA 3MX2A 2O8DA 3AE5A 3SPZA 1GOAA 3OR7C 4KH6A 1BQ0A 2QTSA 1S3XA 5JVDB 4ICLA 1K6YA 3L74H 2B1IA 4EFEA 4DHYA 5LOVB 4KTWA 1E4FT 3BUZB 4JTDB 4FWOA 2UXBK 4KHWA 2F23A 2P06A 4JYCA 1KP2A 1IURA 2YHWA 3OS2A 3HVRA 4QAGA 1BCCH 1ASVA 3ABLB 3WB2A 1H2SB 4LC9B 4O4GA 1DTQA 4DQQA 3ABKC 2G8VA 1KXPA 1NLVA 1OCZC 3DOLA 4JYBA 3FAVB 2BUPA 2HHXA 1A32A 4DR7K 1WP7A 3K9AA 2O8CA 2PFUA 4BACA 4B9QA 4JI0B 2Q2RA 3VQQA 3CC7V 1Q81W 1EX4A 1TYQB 5AQKA 4B9LA 3THWA 4JI5O 3NGIA 3J81N 2EIJB 5H9CA 3ZS8C 5A2QO 4KH5A 4CGFA 2HLDG 1K8KA 2UXBO 1JLQA 1JCGA 3AY9A 2E1YA 1HMVA 1JLAA 5E79Z 1SL1A 2QKBA 3QEXA 1NGEA 2UXDK 5CZ2A 1H2KA 4FSVA 4L3QA 4DR6K 3V9WA 1K33A 5LXTA 2BTFA 3P4IA 4FW2A 3K9JA 3AEEA 4UB8Z 1W97L 3C7NA 3VBBA 1N33B 3CJHA 2WLKA 3TETA 1HNXO 4DR7O 3IRXA 4MLHA 2OCEA 1NJWA 2VGNA 1C0UA 4DV7B 1BZKA 2P7TC 3VTHA 4XBFA 1SAZA 4UCOA 4M3ZA 4EB6B 3CCRV 4GT1A 4HHTA 3D36C 4FWQA 4AF1A 5KI6A 2RR14 1Q8IA 3UE5A 2Q3SA 2ZIMA 4IOXA 4X64B 4DR1B 4GKKB 1HYSA 4G27B 3HSTB 3G6EN 2UXDO 4FPBA 3R6MA 3T1YK 3OYBA 3UCSC 1YSCA 4DR6O 1DLOA 2VQFK 3SQ1A 2WU5A 3JARA 5HRRA 2NUBA 1Y76A 2ZR2A 1SUQA 1U04A 5C93A 1RSOA 1WN7A 5FL7G 3V1OA 3SJCC 4O4JA 1M90O 4ILJA 4H37A 4DR5K 2PYJA 3K59A 3BVOA 1AP6A 3LAKA 3C3SA 4B3SB 3DRPA 5AQMA 3DRSA 1NJZA 1SQVH 1QVFU 3DLGA 4NYNA 3JCZA 3SAGA 4OPHA 4RUEA 4R5PA 1CZBA 2LFRA 4NTWA 3ZRSA 4O44A 3KCYA 3T1YO 4LP8A 1L3TA 4GX5A 3S3XA 4CH3A 5J2TB 2OANA 5J2MA 3J7YP 2B4JA 4CGGA 2VQFO 3P5JA 4EIAA 4E19A 3UKRA 3AVKA 4B3OA 1NKDA 2JS3A 3IGAC 1SV5A 3RVZA 4BG8A 3CCSN 1TA8A 2DQ0A 3VEZA 2UXBB 5IYDO 5JLFA 1DEJA 4ASUG 3OUSA 3G6BA 3RYFB 2B5UA 4IYHA 2N04A 3D2FA 5H1SQ 2BCCH 2K1EA 1J6ZA 1E79G 3HJFA 1PO24 5CA3A 2XUMA 3ABKB 3KLFA 1VQ8N 4IIJB 4H44B 1OCZB 3JATB 3K03A 1QE1A 3U4LA 4CJFA 2ZD1A 3ZT1A 4CHNA 4PL7A 3RR7A 2N74A 1S76D 2QA4N 4YOYA 3I55V 2ZT9B 2WAMA 2KHOA 2NRXA 5J2UA 4IJAA 1NTMH 3RYCB 3LZJA 4L8RB 1JKHA 4CEQA 4R50A 3VQ4A 1RT4A 5AQPA 1G6UA 1J95A 2ZINA 4CJPA 3QDKA 5K1XA 1G8MA 3L73H 3RSEA 4FZZA 2KLAA 3TAGA 4EP5A 1GN6A 3KD5E 3BPZA 3L70H 1C1AA 4DB3A 2PTMA 1YJNV 2QKAA 5FNVA 2G8UA 5L3DA 2UXDB 1JLEA 4F9OA 5AQJA 3U3GA 3HPOA 4WYBA 5LY3A 4RHV4 1Q86W 4N21A 4YDUA 4D6TH 2RKIA 1PD3A 3LSQA 5AQTA 3BCCH 4DUZO 2HP8A 4BRAA 2BDPA 2FBWA 4CIFA 3CJ1A 3ZEUB 1KP3A 3SNNA 3WB1A 4I7FA 3R66A 3QEVA 3ZRWA 4DV3B 1HP8A 3HPLC 2X6SA 4CJSA 3A8YA 5DM6L 4I55A 2Z1JA 3ISNC 3O4QA 2OTJV 4H4MA 4Y0WA 4DF8A 2KZMA 3OYDA 3RRGA 3T1YB 1NJIW 4RCHA 2JRIA 3OVNA 4XDLA 2YS8A 3OYMA 1RT5A 3O4NA 1MZEA 2YDEA 2VQFB 3P39A 1XI1A 1K97A 4B9UA 5K1PA 3ZMSA 1EWRA 2YICA 2CE4A 1E4GT 3P3PA 1OH5A 3DXMB 5CB4B 4DR5B 3L2WA 3PX6A 3OJSA 3SUNA 1N32K 4DTOA 2QWOA 4YY3K 5B1OA 3CCMN 1HRI4 3QO7A 1KAZA 4LD0A 1IV0A 4MW8A 4JNEA 3FB8C 4HBNA 2EZPA 5H6RA 3T4ZA 1YIJV 4JKEA 5AZJA 4FLTA 1WSIA 2E2PA 3QB0A 3OTFA 4DRXB 2X74A 3OEEG 1N36O 3GQKA 3CCLV 5GADP 3LDSA 3C90A 3JD0A 2HVHA 4FFBB 2YNGA 3WXIA 5DK5A 4P9OA 5BMVA 3VQ9A 1SZXA 4W5RA 2EZOA 2AHYA 3I56V 2RNBA 1IBLK 3FYIB 1LAWA 4FVUA 2GSMB 1NI8A 3K58A 3CYOA 2UYTA 5C12A 1BGYH 2D2CB 1XMQB 1COWG 4DSFA 4KTZA 1UA0A 4EHTA 4DXWA 1O13A 2LQTA 4X62K 4JI7K 2OTLN 2DE0X 2EIKC 1L1FA 3DLRA 1D5AA 3M8QA 3VQ7A 4DR3K 4B7KA 4LF8O 1MA9B 3D2EA 1XMOK 1S1TA 5EU7A 4FJXA 2Q9LA 2G8IA 1K5SA 3ZMTA 3SYOA 3AK3A 2O8BA 4PA1A 1HR0O 3TU5A 1IBLO 1NG9A 2HSTA 1WB7A 3CMEN 1FKAO 3OR6C 1Z26A 4TV8B 1SQKA 3T1HK 2PF4E 4FYDA 1E1QG 3IG1A 4DSKA 5KA5A 3CPEA 4MO5A 1WA8A 2EWSA 4WF9L 3DC5A 4DQRA 2QKCA 4LF9O 1JL2A 1KRPA 1KD1O 4GKJK 3VR9A 4X62O 4JI7O 1QCEA 1W0JG 4O2AA 1H8HG 3NVKA 4BRIA 4I0XA 3SPYA 4CFBA 4PA6A 4ZBMA 1U97A 4CE9A 4BE1A 3CIRA 1LUWA 3TTDA 1NKBA 1M57C 3DSQA 5CBGA 1XMOO 3OMNB 2DFFA 1C0MA 4MO4A 1JPXA 4YJ2A 1Q3EA 4CIGA 4CHYA 5C8YA 4YHHK 4OX9K 1SA0A 1DLBA 3I8BA 1CLQA 3CXHF 5JWPA 1HX1A 4IEIA 4LFAO 1S1WA 3G67A 3THOA 4LWSB 4U67L 1NNEA 3BF1A 4ZOLB 4C1NK 4H0VB 2PBDA 2XASA 2KB1A 2IDOA 2WLLB 1TL3A 2R70A 3TTFA 4LF7K 2RN9A 5MLCQ 2ETNA 4BR4A 1ZWIC 2HB5A 3J80O 3A0IX 1AR74 5FRNA 3HYFA 3SR2C 1RCHA 4CBUA 1H2GA 4JD2A 1WSFA 1KQSM 1K8AO 5BPMA 3FX7A 1N32B 4MVZA 3EYZA 3AEGA 3RWRD 3CQYA 4Q0BA 4E2LA 4YY3B 5AQZA 4YHHO 3ZYYX 4JRPA 3VF6A 5JCOA 4FLUA 1VRTA 4OX9O 3LSUA 4G28B 3W0LA 4G9ZA 1AB3A 3CJ9A 5M1OA 3HKCA 5HFLA 4DV2K 4E7IA 1PIV4 3BAAA 1N4CA 1SKVA 2P9UB 1R6KA 5AQXA 1RDUA 4X1KB 4LF7O 1OV9A 1F7YA 1PL0A 3TJTA 1GO3F 3B4SA 1KFSA 4BE2A 1J5OA 2IU3A 4PD4F 2KQXA 2CTPA 1IBLB 4CZEA 3K79A 3WNFA 4TUYA 1SKWA 2E5LK 1ZBHA 4JTAB 1TUBA 5C10A 3RYIA 5EY4A 4BDZA 1VMGA 4R7CA 3RTVA 5CE3A 1KAYA 1SL2A 1Q9YA 1P90A 5LBQA 4X62B 2E2OA 2Q6AA 1SKSA 4CJQA 3EZWA 4DV6K 3D8CA 2UUAK 3A0BZ 2ITDC 4DR3B 5GIOA 2D0PA 3WU2Z 3V9ZA 4O0IA 4U3JB 2ZWHA 1VQLV 1WP8A 1TKDA 2RDCA 3B2EE 4EB6A 4B3MO 1JLGA 3LDNA 3UKUB 4FLWA 4IG3A 3WEEB 2XAGA 3NCIA 2HR3A 1WUAA 3VQEA 3U6FA 3T1HB 2IM9A 1J5EK 5KQDA 3ZX3A 1CXUA 2W6KA 4CBXA 4LCUC 4X89A 2OZMA 3VQWA 1ENVA 1MZFA 4GKJB 2AA4A 3NE6A 3H08A 2GELA 2YNFA 1K34A 4JRQA 3V81A 4KAZA 3OMAB 4NLBA 4DV6O 4CBWA 2HHUA 2V51B 3ZBHA 1TUEB 2HKOA 4CH6A 2EBOA 2MK3A 4GVEA 2W6LA 4A2BA 1NMNA 1M57B 1T6CA 1VQ5V 4XH1A 3VPZA 5KPZA 2BOCC 1KCFA 1XHZA 2WLJA 2YJEA 4CZJA 3CCQV 1VQ4N 2WLHA 1Y64A 2KQ2A 3P32A 2O8DB 1RUJ4 1FKOA 3VQ6A 1MNGA 3HZ6A 2ZIOA 1J5EO 4HNAA 2HF4A 1L3SA 1NJYA 3W7TA 5KRSA 4LF7B 4TQFA 4UQGA 3VF4A 1AI6A 5LP6C 2CTRA 1VSFA 4GUNA 2KSDA 3T7ZA 2Q0RA 3B40A 1NGCA 3FZMA 1U48A 4A5UB 1IKYA 1KVCA 4CGHA 1JJ2M 3A5NC 5BN8A 4NO7A 2EJ7A 3HRGA 2VS0A 4MTGA 4RW9A 1QSLA 5C3JA 1URFA 2EULA 1F23A 2XAHA 1CPYA 5KHGA 3ETDA 1NENA 4D7TA 4QNHB 4I9WA 2QDOA 1NGBA 3OGIB 1WSHA 3E2EA 4DYLA 2Y0IA 4E4EA 1NWKA 2P9PB 3ZT2A 4DV2B 1RUG4 2A06H 4MVRA 3THWB 5C2FA 2EINB 4R6ZA 2QKKA 1K8KB 3LNMB 4BR7A 1GN2A 4CF8A 4CCHA 1YCIA 3H1KH 2KG7A 2IU0A 3H1VX 1U49A 4N23A 5GW7A 5LXTB 3E22A 1ZUQA 4W4LA 4NR1A 3AG1B 5CN0A 1IO2A 4D7SA 2BE2A 2ZE8A 1W9HA 4ISFA 4YDUC 3C7NB 4FK0A 4FK4A 3DLLL 4KFBA 3CJHB 1VQ6N 3SYPA 3LANA
chains in the Genus database with same CATH topology
2E5LB 4LSNA 4O5BA 4FM0A 2EHGA 3AO4A 4FJLA 3DYAA 3F73A 4IKFA 4LR3A 3PX0A 2UUAB 1RNHA 4NCGA 2EX3A 2R7FA 4B9VA 3JARB 4ID5A 4DFJA 2JLEA 5JJEB 4Z4IA 3V1RA 4TQDA 3CB2A 4O4JB 1J5EB 3TABA 3V4IA 4CK1A 1YTAA 4KHNA 4N41A 3HM9A 4DU3A 3ZSRA 2PZSA 4CJUA 2GV9A 3G0ZA 1IKWA 1RT1A 3SJAC 2OWOA 3OYNA 4FCYA 1VSEA 3HKEA 1HJRA 1I7FA 1P49A 4FJ8A 3VQ5A 1QSSA 1QTMA 1U4BA 5J2UB 4I4TA 5JJJB 4KL1A 1S1XA 4HUFA 1L5UA 3LNNA 2HNDA 5FNVB 1WSGA 4EZ9A 2IOCA 2ATQA 3JASB 4DTMA 4FVMA 2ETJA 1FFXA 5KHHA 4QCLA 2YHBA 5LA6A 5D5QA 4I55B 3ZT4A 1YTUA 4G1QA 2YIBA 1IG9A 1M93A 4K8ZA 3HL8A 4OKKA 3ZSZA 4CF1A 2P5OA 1J53A 1YT3A 3NBPA 4MFBA 4JS4A 2OPSA 4CC5A 3HPGA 1GOCA 3IAYA 5HRPA 4JI3B 5BMVB 3WNEA 1X9SA 4E7LA 3NH2A 3AO2A 4I2PA 3VQAA 4M3TA 2HNZA 4JI4B 1F21A 1N34B 3KLIA 3LWMA 4RW4A 4W5OA 3QF7A 3OJUA 1I3AA 3RYHA 2F93B 4O4IA 2AJQA 2X78A 4HCBA 1O1WA 4CGJA 4K8XA 3ICXA 4CK2A 4LF5B 3RR8A 4AHVA 3DLKA 3MEDA 4LNUA 1JFFA 4RW8A 4O2BA 3BA8A 4BWAA 4O2AB 4I50A 1ZBUA 4E0DA 4J2EA 2ZCEA 3QEPA 4YJ2B 5C8YB 1T5EA 1SA0B 4NXMB 2Q7HA 4CJEA 2UUBB 4B9MA 2F95B 1CZ9A 1RBUA 1JMKC 2E3CA 2ITGA 4FZYA 1XNQB 5FRMA 3TAQA 1J9AA 1JLBA 1WNSA 2KTQA 3CG7A 2OPPA 3AVAA 3HKCB 3SQ4A 3LWLA 4E89A 5IJ0A 4DSIA 4FJKA 1SL0A 2Z1IA 4DUYB 1QQCA 3OYFA 4YNQA 3TR8A 3SZ2A 4TUYB 4E3SA 5LMNB 1TUBB 3TAFA 3RYIB 2V4DA 1JL1A 1J54A 4H8KA 4CEDA 3AVBA 2KFNA 4DTJA 2RJZA 4F2SA 5J1EA 3C95A 2FC0A 2DTUA 4IHJA 4NXNB 3KLHA 1A5VA 3CHXA 4PI2A 3SUPA 3BABA 2CAZC 3DMJA 5GONA 3DLHA 3VA3A 3CFOA 3WB0A 3UQ8A 5HP1A 1B92A 1ITGA 4B9SA 3RGBA 4CERA 1TVKA 2DY4A 1TAUA 3B6OA 4HNAB 3ALYA 3P83D 4PI0A 2HHVA 1HNVA 4GYCB 1T8EA 4JI5B 5CYQA 2F1MA 4ZIBA 3UIQA 3QINA 4FJMA 3ZSXA 4WBNA 1T03A 4O4HA 5KGWA 1HNXB 4DR7B 1TV6A 3E22B 3TARA 4GW6A 4DFPA 3TANA 4DR6B 4UFZA 3JASA 1HNIA 4LY7A 1QSYA 2D0BA 5C42A 2B5JA 5FDLA 4FXDA 4OJRA 1FXXA 2HHSA 4OKEA 3TI0A 1XWLA 4CEAA 4JS5A 3L2UA 3S3MA 4CC6A 5CYMA 4LH4A 3CFRA 3NGZA 3SGIA 2YHAA 3HKDA 1BQMA 4J2BA 4CJRA 1VSIA 2HEPA 3SI6A 3V9SA 3AVJA 4CHPA 4DQIA 1LAVA 3HKEB 1TL1A 3ULDA 2R72A 3VN5A 4KKOA 1RDAA 4I4TB 5KX5A 3NF7A 3ETQA 4NVPA 2VG7A 3K57A 4F3TA 3L3UA 4F2RA 2DFHA 3M8PA 4DUZB 3AVCA 1KMIZ 3HO1A 1ZAUA 4IFYA 3ZSVA 3LZIA 3NFAA 4LSLA 3QEIA 1FFXB 4FJ9A 2YIAA 5LA6B 3B6PA 4FM2A 4PUOA 4OGEA 5LMUB 4DFMA 3ASMA 3WNGA 1HYZA 4FJGA 2QM4A 5JJNB 5IYZA 1N36B 1ZBFA 2F8TA 3RMBA 3VQXA 4OPJA 3QNOA 5J2QA 4BW9A 4M41A 2HHQA 3NH0A 2KZZA 1KLMA 4DTPA 4RG8A 3FFIA 4W5NA 4ZHQA 2HMIA 3M8SA 5FPRA 3ZCMA 5EYPA 1DTTA 5C25A 4LF8B 3THVA 3LP2A 1W0HA 2IGIA 4M3WA 4DV5B 3RYHB 1HR0B 4O4IB 1L3UA 1NJXA 4JLHA 1RDDA 3O3GA 3OS1A 4LF9B 4AHSA 5JS1A 1WSEA 4JI7B 1S1VA 3CM5A 5CZ1A 4CEZA 1FKPA 4LNUB 5JH7A 1XMOB 1JFFB 3SJJA 3C94A 4O2BB 3OYKA 1KVBA 3U11A 3PY8A 4LFAB 4I50B 4CGIA 4AQYB 3K5OA 1X4TA 4ZI7A 2F8SA 1C6VA 3LP0A 3LPTA 3K5NA 5E41A 4I9QA 3KK1A 3JYTA 3DI6A 4YHHB 4OX9B 1SQFA 2A1RA 3NF8A 2BGGA 4FJIA 3NF9A 4M3RA 3MXJA 3KLGA 4B08A 4UCSA 3K5MA 3LPUA 5IJ0B 4E1NA 1TKTA 3AA4A 1C1BA 2YI8A 4E7HA 3MXIA 1NK6A 5KHKA 4WE1A 4DSLA 3M8RA 1BHLA 4LH5A 2YNHA 5EIBD 3BRCA 4YFUA 4KB0A 3V9XA 4KB1A 2PGGA 4B3MB 2XRIA 3OYAA 4EP4A 4E1MA 4CJ5A 4ELUA 1SKRA 3T3FA 4IHJB 3N2KA 4DV6B 3QETA 4E7KA 1Y97A 3DOKA 3DLBA 5KHJA 3AVGA 3MXMA 5GONB 4M3UA 1S9GA 4E7JA 2E6LA 2YKNA 2GUIA 1VSKA 3OS2A 5EZYA 3K5LA 1YEWA 1VRUA 1D8YA 2YI9A 1JLFA 1TVKB 3L2QA 2HHHB 4KHUA 3AV9A 4GLXA 5IJ9A 1Q5OA 3QIOA 3JAKA 3SV4A 3N2GA 1IH7A 3KKRA 2PYLA 1NT2B 4CEBA 4DTSA 1B04A 5KHIA 1C0TA 1RT2A 2Q0AA 4F8RA 4J2DA 4WBNB 4O4HB 4UCTA 3DRRA 1ASUA 4KV8A 3RMDA 2XHBA 1IKXA 3SJBC 5CA0A 1V9PA 4OLAA 1S9EA 4C8NA 4B8CA 2F96A 4OGCA 1XHXA 4GVMA 4DQPA 3OYLA 1TK8A 4O0JA 3JALA 4CJLA 2RQ6A 3QG5A 4JI8B 1HPZA 4KO0A 4Z4GA 1RILA 4CEEA 4CESA 3ITHA 4FLZA 4EFBA 3I0SA 1Q9XA 1VSDA 4DK1A 1NK0A 5JCOC 5D5PA 4GMJB 5KMGA 5C24A 3HKDB 1XQ8A 1D9FA 4DV4B 3MECA 1NOYA 5I3UA 3L8BA 4MQ3A 3ZT0A 1TGOA 3SYZA 5LYJA 4CF0A 4JYAB 1NKEA 3JSMA 1KFDA 3VQBA 5KX5B 1BCOA 1EXQA 4OPKA 4N56A 2YKMA 4FJ5A 4B3RB 4Y1CA 3AVIA 5ITZB 1KTQA 1TAEA 3QERA 2YV0X 4M3YA 4ID1A 2G8WA 1JJOA 4LF4B 1UWBA 1B9FA 3CM6A 2GBZA 1BIZA 1VSMA 2FBXA 5CY4A 1EKEA 3KK3A 2XY6A 3HKBA 3RMAA 1KLNA 3ZSYA 2F4VB 2OPRA 2KFZA 3F9KA 4UCUA 2XO7A 3EZ5A 5T7BA 4HUGA 5IYZB 4Z0UA 4PY5A 1B9DA 3NHGA 2P5GA 1Q43A 5CA1A 4KHPB 3P1GA 1NK9A 1I94B 2B6AA 4FW1A 4ZHQB 1D9DA 1RTHA 1O9HA 4F6RA 5JS2A 3KJVA 4CH5A 5EYPB 1WAFA 1VF7A 4KREA 1RT6A 1ZYQA 3C6UA 2HHWA 3ZEDA 3AVNA 1A5WA 4BDYA 5HRNA 2QXFA 4TV9A 3JAWA 4NCAA 4CS4A 4Q5VA 2HVIA 4ZTJA 4X66B 4CHOA 4W5QA 4BWMA 3SQ0A 3S3NA 1S6PA 3OYEA 1HW7A 1IBMB 3G10A 5JH7B 1NK4A 4OLBA 1RBRA 1HQUA 1JXEA 4AHUA 4OKJA 5HROA 3HPHA 1NOZA 2VG6A 5BR8B 4LF6B 2OYQA 3AVFA 4ZI7B 4DTNA 4O55A 4DU4A 2G8KA 4FLVA 3OYHA 2JGUA 1LW2A 3I8DA 1LV5A 3AA2A 1BISA 1KSPA 3U10A 2OZSA 1VSHA 3JSLA 3FFQA 2VWKA 1BCMA 5I42A 4JI1B 1BI4A 3NGYA 1NK7A 3NDKA 4X1IA 3OYIA 3O3FA 4HCCA 2W42A 1X1PA 2Q7GA 4OVLA 1CXQA 1L3VA 3AVLA 2KW4A 5LP6A 4RW6A 1TKXA 3MAQA 2Y1IA 1BIUA 3N2KB 1BGXT 1RBSA 4X65B 4NYFA 3L2VA 4X20A 4X1YA 4DWIA 1RT7A 2ZQBA 3ZSQA 3A2FA 4O4LA 3NH1A 3HT3A 4FJ7A 2P22C 2PW9A 3VQ8A 4CGDA 4DLEA 3VQCA 4M42A 5EZYB 3UT5A 5HBMA 3WNHA 5IJ9B 2VG5A 2R7YA 4ELVA 2VWJA 4DR4B 3JAKB 3V9UA 4DV0B 3N2GB 3NF6A 3RFRA 4DK0A 2PUSA 3QESA 4L8JA 4NCBA 5IWAB 1T05A 3PUFA 4CFAA 4HTUA 4M3XA 2P51A 4K0KB 4FJNA 3L2RA 2HHTA 3T19A 4ELTA 3C6TA 4FJJA 2BANA 3RMCA 3HXMA 5CA0B 3AO5A 3LAMA 3FI7A 1LWFA 4CK3A 4KI4A 2IS3A 2Z1HA 1JLCA 1VK0A 1GOBA 3AVHA 2FBTA 2Z1GA 5ITZA 5JQGA 3QEWA 4AHRA 4Y1DA 4FJHA 1KU9A 3JALB 2YXLA 4JV5B 4KPYA 1HRHA 4LH7A 4C8OA 1WPBA 1LWCA 3HP9A 3PX4A 2D5RA 3ZT3A 2BTQA 4CJKA 1FJGB 4KRFA 4F3OA 2XY7A 4YJ3A 5J2PA 5FPOA 3VQDA 5KMGB 4DS5A 3TAPA 3KK2A 5HLFA 2WONA 2ZM6B 3MEEA 3DLEA 3L3VA 1X9MA 5LYJB 4CH4A 4HVJA 4ZTFA 4CECA 5SZTA 4Z4HA 3CFPA 5FROA 3KD1E 4KHYA 4TSXA 1A5XA 4CIEA 5JVDA 1HQEA 4CJ4A 3KKSA 3T1AA 5LOVA 5KRTA 4HUEA 1NK5A 4BWJA 4CEFA 2HNYA 4IFVA 3S9HA 1XNRB 4KI6A 4CJ3A 3QNNA 1C1CA 5D3GA 2Q7EA 4I2QA 4XIUA 4EEQA 1M4UA 3KLEA 4N47A 2PY5A 1N5YA 2YNIA 4DSJA 3HKBB 1VSJA 4F4KA 3LP1A 4BDPA 3MEGA 4CFDA 1UAXA 2JVDA 2IAJA 2HW3A 3RRHA 4DMNA 1ZBLA 1M5IA 3PO5A 2O4GA 3IS9A 2E6MA 1SQGA 4PHZA 1TVRA 4PWDA 3HVTA 2VQEB 5CA1B 2RF2A 4CEOA 4B3TB 1IBKB 3V1QA 1WAJA 4IBNA 3K2PA 4B9TA 4FLXA 1LWEA 4DS4A 5J2NA 3LALA 1TAQA 1WLJA 1I39A 4B9NA 4F6RB 4DTUA 3KTQA 3M7MX 1U47A 1RT3A 4B8AB 4KTQA 3AA3A 1TK0A 4JI2B 2WOMA 1UA1A 4DU1A 4C8KA 3E01A 4TV9B 3JAWB 4DR2B 2QK9A 5J2TA 2JS5A 3TWHA 5K14A 4H4OA 1Z5WA 1BQNA 4Z4EA 2G8FA 4M45A 1BL3A 3OYGA 3VQVA 1G15A 1JXBA 3SV3A 3RYFA 4DTXA 1NKCA 3SCXA 2X6NA 1NK8A 4CS3A 4CHQA 2ZE2A 4IIJA 3JATA 3HK2A 1MU2A 2UUCB 2RN2A 2E4LA 4DV1B 4C8MA 3RYCA 4PQUA 2Y1JA 4CJWA 2LSNA 3CYMA 4BE0A 3VA0A 4AH9A 5KTQA 1EETA 3U0ZA 1QHTA 1S1UA 1TK5A 2IC3A 4I9LA 2D0AA 1RBVA 2ZNIA 2D0CA 1X9WA 1R0AA 3OY9A 3OYCA 3VQYA 3PO4A 3OYJA 2F66C 3LP3A 2OPQA 3HP6A 3BDPA 4LFCB 1BI4B 3TAEA 3BHPA 3SUOA