1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
4Q5VA 4DQRA 1VRUA 4CGFA 1W9HA 1JLGA 3VQ7A 3OYKA 3G0ZA 1EKEA 2ATQA 1RT2A 3C6TA 4LD0A 2Y1IA 2YNHA 1QTMA 1S6QA 3KLHA 4CIGA 3RTVA 4FJHA 3C94A 3K58A 3FFIA 4NYFA 4RW8A 3RR7A 4FM1A 2VG7A 4O0JA 4CFDA 3VA3A 4DU1A 3TR8A 3T3FA 1BIUA 1JLBA 4FJLA 3ALYA 5FRNA 3UIQA 1WSGA 1Z25A 1RBSA 3M8SA 4FLWA 4FLYA 1L3SA 4GMJB 2GV9A 1RBUA 4DU3A 3DRPA 3QEWA 3S3OA 2PY5A 3AVGA 1WLJA 2HHXA 2HHWA 4I7FA 2FBTA 4AILC 1J54A 5HRPA 4E19A 3KK3A 4C8OA 3QO9A 2IS3A 2XO7A 4FZYA 2A1SA 1BQMA 4CJSA 4CK3A 5KGWA 1BISA 1HQUA 4FCYA 3AVMA 1U47A 4AHUA 1NJXA 1SUQA 4L8RB 1BIZA 3THVA 3MXMA 3DLRA 4FJKA 1CXUA 4PQUA 4K8ZA 1HNVA 3NBPA 1L3TA 4PY5A 4JRPA 1BCOA 1B92A 1FKPA 1RT3A 3KK2A 3SQ4A 3MXIA 4C8NA 2F8TA 3DRRA 4O55A 3OS2A 3C6UA 3D0PA 4J2AA 4FLUA 3P5JA 1BI4A 1QQCA 2KTQA 3V9SA 4AHRA 3OYGA 3L8BA 1IH7A 3LANA 4B9SA 1UOCA 2BE2A 2OA8A 3SI6A 4LH4A 1WSEA 1NK7A 4E7IA 4DQIA 4FYDA 3OYLA 4CFBA 2X6SA 3V9WA 1KVAA 3KIOA 4FLTA 4CEOA 3PX0A 1RBRA 4CJPA 3DOKA 1NKBA 2KZMA 2OYQA 2RF2A 1T8EA 4FJGA 3V81A 2IC3A 5K14A 3S3MA 1YTAA 3DLEA 4OPKA 1WSFA 2GBZA 2RKIA 3HPGA 4AH9A 2HHUA 4JRQA 3KD5E 1RDAA 4O0IA 3OYNA 2A1RA 3K5LA 4UQGA 3TARA 4J2EA 1YTUA 5SWMA 3SQ2A 2P51A 2NUBA 3OS1A 3U6FA 2F8SA 4KI6A 1HPZA 1YT3A 2YNIA 5J1EA 3HJFA 3ZSWA 3KLEA 4CEBA 3I0RA 1WSIA 1BHLA 3T19A 4CEQA 4DTJA 3LALA 3HM9A 3HP6A 1DTQA 3CM6A 3M8PA 5EU7A 4Z4CA 2G8KA 1VSMA 2QK9A 5I42A 3PUFA 4XIUA 1IKVA 2DFFA 1BGXT 2DFEA 4OGCA 4CGIA 1A5XA 3F73A 4BACA 2YNFA 5HLFA 1ZBLA 1NJYA 4W5NA 1X1PA 4CEFA 1IKYA 4F2RA 3IRXA 3P83D 4GW6A 4CJ5A 5JS2A 1JXEA 4W5OA 3ITHA 2XY5A 3BDPA 1Q8IA 2D0CA 3DYAA 4B9UA 3OYCA 3ZT0A 1TKXA 3V1OA 2ZQBA 1XC9A 3U3GA 3F9KA 4KFBA 3OYMA 3DLKA 3ZSVA 1NK8A 4NCBA 3IAYA 4DWIA 3B6PA 1C1CA 3LP3A 4NYNA 1C0MA 1GOAA 3VQQA 4B8AB 3SPZA 4HUGA 1R0AA 1NKEA 4JS4A 4HTUA 1JLAA 3QIPA 3VQCA 1VSFA 3V1RA 4FK2A 4DTOA 5J2MA 4N76A 2G8WA 3OYBA 4CCHA 4LSNA 1KLMA 2IDOA 1LWEA 3HK2A 4F4KA 3HYFA 3EZ5A 2VWJA 1NJZA 3OS0A 3V1QA 4M42A 4IG3A 3NFAA 4W5QA 5FRMA 1KFDA 3K57A 4HHTA 1VRTA 3OYJA 2KFZA 3BGRA 1C1AA 2B6AA 2VG5A 2ZD1A 1KSPA 4DQSA 4CEDA 3LP0A 3TAQA 4LY7A 3AVCA 3VQEA 1WAJA 3LPTA 5FROA 3QEPA 2EX3A 4IDKA 4E7HA 2VG6A 3CG7A 3LP2A 4OKJA 1RT6A 4DSKA 4NCGA 2YHBA 1ZBIA 1DLOA 1TL1A 1UAXA 2FBYA 1ASWA 4DG1A 4M3ZA 1Q9YA 3HT3A 3RMCA 4N47A 4DQQA 4DSJA 2VWKA 1BI4B 3AA3A 1TKZA 4IFYA 3SUOA 1L3VA 1TKTA 1SKWA 4CERA 4JS5A 1QSLA 2DY4A 1J53A 3HPHA 4KV8A 1DTTA 3CFPA 1QS4A 4BWJA 2X78A 3OJSA 4DTMA 3KD1E 3O3FA 2GUIA 4CEAA 3AVJA 4IFVA 4DFMA 4FJIA 3AO1A 5CY4A 3ZSZA 4KHNA 1LWFA 1KCFA 4FK4A 3AVNA 4I9QA 3CQ8A 3ISNC 3HSTB 3ASMA 3SQ1A 2PW9A 3CFRA 1TK0A 3TANA 4E7LA 2KFNA 3T1AA 5HRNA 2B5JA 1BQNA 1KVCA 1X9WA 1Q9XA 5FDLA 2P1JA 1HMVA 1SL1A 3IS9A 1N6QA 4GVMA 4CF8A 4CIEA 3TAPA 3LP1A 4FLZA 3LZJA 3ZSXA 4FLVA 3OYHA 4FJJA 2BDPA 3AV9A 3ZSOA 3HO1A 1EXQA 4BE1A 4MFBA 4YFUA 3V6DA 3RMBA 1GOCA 2G8HA 4CJRA 1EX4A 4RW4A 1CXQA 1RILA 2QXFA 3O3HA 3KLGA 3HVRA 3L2QA 4Y1CA 5T7BA 4OLAA 5KGXA 1SKRA 3QINA 4FJ8A 2R7YA 4DLGA 1HQEA 2WONA 3KLFA 4KB0A 3VN5A 3AVFA 4H4MA 3CM5A 4Z4HA 2E6MA 2LSNA 4WE1A 3TAMA 3VQ4A 4CEZA 4DFJA 4C8MA 1FKOA 3RMAA 4Z4FA 2IOCA 1RT5A 4DTPA 2QKBA 4KHYA 3V9XA 1FK9A 4M3TA 4CJQA 4IKFA 2YKNA 1D5AA 4FM0A 4CFCA 5JS1A 5D3GA 1RDDA 4Z4EA 4DS4A 1ASUA 2E6LA 1RT7A 3ZSQA 4DTSA 1B9FA 4DQPA 1D9DA 4QCLA 4KAZA 3V9UA 2W42A 2OPQA 2O4GA 1S9GA 4DFKA 4Z4GA 3DLBA 3OY9A 3L2RA 3QIOA 4E0DA 3ULDA 1XHXA 3H08A 3CFOA 4CF1A 3WNHA 3VQ5A 4ELVA 3FI7A 4W5RA 3JYTA 2XRIA 3ZT1A 5HP1A 1TVRA 3O4QA 1C0TA 4CJEA 4N41A 5KTQA 2HMIA 4OVLA 3LWMA 4KI4A 1RTIA 4DFPA 2DTUA 1Z26A 4DF4A 4ZTJA 2JLEA 1S1TA 4CEEA 3DLGA 3SUNA 3HXMA 4B3OA 3TWHA 3QESA 1KVBA 3HPOA 3ZT4A 1D8YA 4AHTA 3L2VA 3VA0A 4BWMA 4M45A 1RCHA 4C8KA 4HCCA 4FJXA 2X74A 2XY7A 4KTZA 3NCIA 2Y1JA 4FLXA 4CK2A 1O1WA 1U4BA 1U49A 3NE6A 2OZSA 2F96A 1SV5A 3AVHA 3QEIA 3SCXA 4KTQA 4I9LA 4DSEA 1HJRA 2Z1JA 1HYVA 4CGGA 3AVKA 3SV3A 4ZHRA 4CJ4A 1NK9A 4AHCA 3JSMA 3WNFA 1BL3A 4JLHA 4H8KA 1EETA 4ID5A 4CF9A 4EP5A 3VQDA 1KLNA 4J2BA 3AO5A 4J2DA 2IGIA 1VSLA 4DMNA 4N5SA 4KKOA 1KRPA 3MAQA 3TI0A 2I5JA 4QOZB 1TAUA 1LAVA 4EZ6A 3I0SA 4IBNA 1HYSA 3HL8A 3HVTA 1ZYQA 2G8IA 4M41A 5HROA 4CHYA 3DOLA 1ASVA 4E89A 3AA5X 4FZZA 5HRSA 3VQBA 3VQ9A 2D5RA 1WNSA 1XHZA 3AO2A 1LW2A 3AO3A 3SZ2A 3SYZA 3QEXA 4B9MA 1W0HA 1TGOA 1TL3A 2HHSA 4M3YA 2YKMA 3VQAA 1JLQA 2HHTA 1FXXA 3OYIA 3SUPA 4DSIA 4B9LA 1GOBA 4CJWA 1NK6A 1C0UA 2E4LA 3M8RA 1NKCA 1RBTA 4CIFA 1KTQA 2HB5A 3AVBA 5CZ2A 3SJJA 1T03A 1LWCA 1CZ9A 2D0AA 2YNGA 1ZBHA 1JLEA 3DRSA 1ZBFA 4B8CA 1VSDA 3O4NA 3NGIA 2OZMA 3OVNA 4OGEA 3QNOA 2HW3A 1QE1A 5SZTA 1YVUA 3LZIA 4BDZA 1VK0A 4K8XA 2YV0X 4FVMA 3LAKA 1WSJA 1U48A 3OYDA 1J5OA 1QHTA 1NOZA 1TV6A 3RWUA 4DSFA 2HHQA 4B08A 1NK5A 1ITGA 4MQ3A 1TK5A 4Z0UA 3NAEA 1RTDA 5CYMA 4DF8A 4PA1A 1HYZA 3PV8A 4E1NA 2FBVA 5C25A 2XY6A 4CHPA 2YHAA 2XHBA 3IG1A 4CGHA 1JLFA 1IKWA 2Z1IA 3EY1A 4EP4A 1LAWA 3MEGA 3VQ6A 1G15A 3EYZA 1SKSA 4LSLA 4M3RA 2ZE2A 3LAMA 5DMRA 4CK1A 1SL2A 2G8FA 4I2QA 3NF8A 1N5YA 4C8LA 1REVA 5J2PA 4DS5A 1SL0A 5KRSA 2HNYA 1VSKA 3AA2A 1LV5A 4F2SA 3KLIA 4ID1A 3V4IA 1ZBUA 4BDPA 4H4OA 4ICLA 4TSXA 1RDBA 5C42A 3SPYA 3RRGA 3ZT2A 3CYMA 2D0BA 1WSHA 3LPUA 3OYEA 2AJQA 2ETJA 3PO5A 1S1WA 4E1MA 3TABA 4AHVA 5E41A 2XY8A 3KTQA 3D45A 2Q3SA 3AVIA 3OJUA 4YNQA 3ZCMA 5J2NA 3AVLA 3VQPA 5DK5A 1NK4A 1X9MA 3PY8A 3SUQA 3L2WA 2WOMA 3KKSA 4O5BA 3O3GA 3SQ0A 4R5PA 2Z1GA 3WNEA 1IKXA 1K6YA 3TAGA 1L3UA 4OLBA 5I3UA 4CGJA 5C24A 1X9SA 4DSLA 3M8QA 4O44A 1RT4A 2OPPA 4CHQA 4E7JA 1U04A 3RRHA 4FJNA 2FC0A 3C95A 4ELUA 4DTRA 4BE0A 3NF7A 3AVAA 5CYQA 2QKKA 3K5OA 4B9TA 4KHUA 4BE2A 3HP9A 4EZ9A 2HVHA 3NF6A 4FZXC 1UA1A 4CHNA 4DTNA 4CJFA 3K59A 4OKEA 3DI6A 3LDSA 3MXJA 3RR8A 4FK0A 4KPYA 1JL1A 4I2PA 3QLHA 4OKKA 4CF2A 5J2QA 4RW9A 2KZZA 4CHOA 4M3XA 4F3OA 3SV4A 3MECA 3ZSRA 2ITGA 3B6OA 1RDCA 3SNNA 4G1QA 4ELTA 4CE9A 4E7KA 2KW4A 1T05A 3K5NA 4KB1A 2JGUA 1A5WA 3NH1A 1UWBA 4FJMA 1MU2A 2KQ2A 3OYAA 4BDYA 1D9FA 4PUOA 4M3WA 1BCMA 1I39A 1I3AA 1IO2A 4RG8A 4DTUA 4FJ7A 1RBVA 2EHGA 4OJRA 4Y1DA 4B9VA 2DFHA 1S1VA 1TKDA 3RMDA 4KHWA 2G8VA 4CFAA 4PWDA 4CJ3A 4KHQA 2P5OA 2HVIA 1TAQA 1C1BA 1RTHA 3AA4A 3G10A 4FW1A 4M3UA 4HCBA 1A5VA 1XI1A 1VSHA 5CZ1A 3NH0A 3TAFA 4FJ5A 4NCAA 1S9EA 2R7FA 1NK0A 1HRHA 3S9HA 1VSEA 1Y97A 4F8RA 3DLHA 1HNIA 1XWLA 4CECA 4N56A 4KO0A 2PZSA 1RTJA 3NHGA 1QSYA 1S6PA 1WN7A 3QETA 3KK1A 5KI6A 3AO4A 4AHSA 4KTWA 3ZSYA 4OPJA 4CJUA 1VSJA 4CJTA 3QEVA 1IG9A 3PO4A 4KRFA 4FM2A 1S1XA 3KJVA 3NGYA 4RW6A 3L3VA 1RT1A 3L3UA 3QERA 4CGDA 4Q0BA 3NDKA 3OYFA 4O4GA 1KFSA 1WAFA 2B4JA 4QAGA 2PYJA 4DU4A 1JKHA 4ZTFA 2Z1HA 4RW7A 3DMJA 3TAEA 1VSIA 1JLCA 5HBMA 3PX6A 2RPIA 1TK8A 4E3SA 1T7PA 3P1GA 3NGZA 2HNZA 3K2PA 1NJWA 2G8UA 1LW0A 1J9AA 4KHSA 2O4IA 3NF9A 1S1UA 4W5TA 4HUEA 5HRRA 2PYLA 3S3NA 1JL2A 1C6VA 2P5GA 1CZBA 1L5UA 1U45A 4HVJA 3LWLA 4HUFA 4B9NA 2FBXA 4LH5A 4CJLA 3A2FA 1QSSA 2IAJA 4CESA 1RNHA 1S5JA 2X6NA 4FXDA 4FJ9A 3MEDA 3V9ZA 1B9DA 3KKRA 2HHVA 2OPSA 3K5MA 4CHZA 4CJKA 3VQ8A 3MEEA 1JXBA 3NH2A 4KREA 3QNNA 4DTXA 2HNDA 3I8DA 4IG0A 3WNGA 4DLEA 4CJVA 1CLQA 3E01A 3ZT3A 1NOYA 1F21A 1EP4A 2RN2A 3L2UA 3U3YA 4Z4IA 1UA0A 2BANA 4F3TA 4FW2A 3DM2A 3PX4A 4CF0A 2BGGA 5KRTA 2OPRA
chains in the Genus database with same CATH superfamily
1ATSA 4Q5VA 1VQ7N 1ENVA 2ARHA 1OH8A 4CGFA 1V54C 4DV1K 2ATQA 3C6TA 3WXLA 3ZEUA 4DR7K 2RCVA 4AQYB 3BY6A 1S6QA 2WS3A 4J7ZA 3O5BA 1OCRC 4DV0K 2CH7A 4I4TB 4FJHA 2XASA 2P9SB 2BSKB 4FO0A 2VG7A 2OTLV 3HKCB 4CZGA 3TR8A 1HR0K 1Q7YW 5GONA 1JLBA 3UIQA 1RBSA 4FLWA 1S72V 2M6YA 2ASMA 1S22A 5AQKA 4GMJB 1G4YB 2K9PA 2A0LA 3VQYA 4UV9A 1J95A 2EIKB 2IH1C 3E35A 3GWKC 5JVDB 1C0FA 4BIZA 4DU3A 2HHXA 4CH3A 3OEEG 1N32K 3L74H 4FK5C 4C8OA 3J7AP 3LSSA 4L87A 4K3AA 3RVZA 1XMOB 4CJ7A 1WAZA 1ORQC 4DR3K 4J80A 1HNWB 2P9NA 4J9ZB 1NJIW 4L8RB 4B3SB 3THVA 4FJKA 4J10A 4YTPA 4K8ZA 5EC2C 3CC2V 1IV0A 1B92A 1FKPA 3KK2A 3G6EV 4D6TH 4DR4O 3L72H 3LNNA 3D0PA 2QWOB 3FB7C 2F66C 3BVOA 1V54B 4FLUA 1QQCA 3ETDA 4LFBB 1WUAA 3V9SA 4YY3B 1GAXA 3B8AX 4JKBA 3OYGA 2FF3B 3SGIA 3JAWA 3SI6A 1VQ5N 3O1WA 1OCRB 2D2CB 2NRRA 3OYLA 1YIJV 1PL0A 1FYJA 4ILHA 3V9WA 3TSUA 1VQPV 1VQNN 4CEOA 3OHRA 3PX0A 4PHTX 3UO2A 1EO1A 2WDQA 2OYQA 1T8EA 5AQJA 3HKEB 4OPKA 3G80A 2GBZA 4AH9A 3FAVB 2HJFC 2VQEK 3RW0A 2HWB4 1TUBB 1RDAA 4I0XA 3IFXA 4YHHO 4O0IA 3HKDA 4UQGA 4DV6K 4CD3A 5BR8O 3SQ2A 4GKJB 5FLXO 1T3VA 4FWSA 4H0OA 1GN6A 2LO1A 2WLMA 2F8SA 1HPZA 4MVUA 3VGMA 4QNHB 3K0SA 3I0RA 4H0TB 1WSIA 1BHLA 1DGSA 3KG2A 1I94O 1VRH4 1WA8A 5LL6Z 3M8PA 3HP6A 2G8KA 4Z4CA 1VQ8V 4X62O 5JVGL 2B5UA 4LC9B 3PUFA 4IJAA 4KX6A 4DR1B 2WA4A 1A5XA 2IJIA 5AQHA 1YI2V 2WTUA 1ZBLA 1IKYA 2QA4V 4O4JA 3SR2C 4TSFG 5L3CA 3P83D 5IYZB 3S41A 4PI0A 1TVKA 4B3TO 3QMLA 2ZE8A 2FSKA 4PA3A 4PJ0Z 3EL2A 2XNDG 1XC9A 3CCLN 2F4VO 2WWWA 4J7JA 3T4ZA 3OYMA 3VTHA 5GW7A 1VQ9N 1VHXA 3VTIA 4NYNA 1G8MA 3FX7A 4IFEA 3VQQA 4B1UB 3ZETB 4W4LA 2ZIMA 2NRVA 4AQYO 1MSWD 4MT8A 4DTOA 4N76A 2E76B 1WBBA 2W6LA 3TCUA 4LSNA 2E8AA 2IDOA 1LWEA 1AB3A 2WP9A 1Q6IA 3NMUA 3HYFA 4H0VB 4JGSA 3VEVA 3OS0A 3JD3A 5BN9A 3CC4N 3H1LH 1K4CC 5LGUA 2GSMB 1Q82O 1C1AA 2B6AA 2VG5A 2QWNA 2NRZA 1WP8A 1J5EK 1RUH4 4NLCA 3VQEA 1R3LC 5FROA 2HW3A 4FJGA 4DSKA 1RVF4 3NXSA 3CSXA 3T69A 4M3ZA 1PVC4 1DF5A 2KHOA 2R044 1VQMN 1NTMH 3OGIB 4GCZA 1XNQB 1YUWA 3ZX2A 5H1SQ 2O8BA 4JS5A 1HKCA 1J53A 1GN2A 3HPHA 2JRIA 3DXMB 2BE3A 4FFBB 3OJSA 3K9KA 4LFBO 2E2QA 1SQQH 4E1JA 3DJCA 3ASNB 2HSTA 4CZFA 2JJ1G 4IFVA 4YY3O 3AO1A 4LH6A 4IL6Z 1BUPA 5AJ3K 4UVAA 4GT1A 3CQ8A 3LSUA 1H2NA 1G6UA 3STLC 1N0NA 4RWUA 4TUYA 3W7WA 1K7DA 3SYPA 3P30A 1SQXH 4E7LA 4GKKB 1YF2A 2JVDA 4JTDB 1W0JG 3ZMUA 1Q9XA 5L3GA 5IYBO 3RYCB 1HLUA 1HMVA 1YZBA 4JI3K 3MN7A 4GX2A 1XREA 1P4RA 3LP1A 4FLVA 1GLEG 3CD6N 2H94A 2NNWA 3OFNG 4JAAA 2E5LO 1E4GT 3T1HB 1EXQA 3B8NA 2QW9A 4KBOA 2E88A 4DR4K 3AAQA 3CRQA 2G8HA 4U67L 3J7AU 3F2KA 2AHYA 5C2DA 3L2QA 3CJCA 1P8ZA 5KGXA 2UYTA 2WONA 1WBDA 4KB0A 1U2VB 4BRLA 5C93A 4WE1A 1BT8A 1FFXB 3QFPA 4CEZA 1H2GA 3BUZB 1L0LH 3J8AA 4C8MA 3RMAA 3CC7N 5AZJB 4DCHA 1B3QA 2EINC 4Z4FA 5M1PA 4CD1A 4CZKA 5CN0A 3THYA 2WBNA 1D5AA 4FM0A 5IY5C 1F23A 2GBOA 2O8CA 4DS4A 1ASUA 4WYBA 4IO8A 1BMFG 3JALB 1B9FA 3UKRA 2FXUA 4X20A 2FLOA 5BR8K 3OMIB 1OCCC 3E1YA 1D9DA 3V9UA 4QCLA 2W42A 2CDYA 5K1XA 3DLLL 3C7NB 2WA3A 4CF1A 4DW0A 1MWKA 2CTRA 1L0NH 4FIPC 2HHHB 1Z6RA 3WNHA 1I94K 4ELVA 1VBB4 3AE8A 3ZT1A 2YIBA 4U7NA 3RYHB 5HP1A 4X62K 2XAHA 2QWLA 4IOXA 4JHDA 1C0TA 4BC5A 2AA4A 4CJEA 5GIPA 1YHQV 2YCHA 4Z2WA 3GWOA 4OVLA 2DTUA 3O80A 3N27A 4KXRA 4ZTJA 2WDVA 5BPNA 3HXMA 3VENA 3QESA 3CMEV 3FZMA 3WG7C 2PFUA 5IYDO 4M45A 4TOIA 1RCHA 2D0PA 4X1KA 3ZMTA 3N4PA 4B3TK 3OUFA 2QEXN 4FLXA 4CK2A 1QLEC 2F4VK 1KD1O 2OZSA 1SAZA 4MDAA 2EINB 1ZL8A 4JI1B 4F4LA 4ZHRA 5KLVH 4TT3G 1JX9A 4FOEA 1XDCA 5IY5B 2AZ0A 2RE2A 2P6JA 4AQYK 1AVMA 3QVNA 1KLNA 1NBWA 1OCCB 4YJ2A 4J2DA 1KRPA 3I55N 3TI0A 2QKCA 5AG2A 3C0BA 1TAUA 1KYOF 2BTQB 2QR4A 4K43A 4HNAB 3I0SA 1E4FT 1RPRA 4EEQA 3ZJZA 3CJ7A 1TYQA 3HL8A 3VEOA 4PDVA 2G8IA 3VEYA 3BEXA 2NN4A 4CHYA 4E89A 4JK9A 1RFQA 5HRSA 1RPOA 2L35A 3VQBA 2D5RA 3BCCH 3L73H 1XHZA 3QEXA 4LC1A 1TGOA 4M3YA 1XMOK 1JLQA 2HHTA 2ZIOA 3D2EB 3VEWA 1PNLA 4DSIA 3WG7B 3E8FA 1SKVA 4H0XB 2OTJV 2E4LA 4F6EA 2ZM6O 4CIFA 1KTQA 1T03A 4PA9A 1QLEB 4FWQA 3RSEA 2A3ZA 2D0AA 4GV6A 5JMVA 2X6BA 1DF4A 2WLHA 1NH2B 2FSJA 3NGIA 3CQXA 1RUJ4 3OVNA 4LFBK 5HFMA 5AQRA 3LZIA 2JK5C 3ZRWA 4BDZA 3SBTA 4K8XA 4GB34 4YY3K 2QTSA 4FVMA 3CCRN 3G25A 3CCQN 1WSJA 3JARB 2XAFA 4CH4A 4H0PA 3P3NA 2VGNA 2HHQA 4B08A 2V7ZA 1NGHA 1NK5A 4MQ3A 3S3WA 4IOCL 1TK5A 1AL24 2DYSC 4Z0UA 4DR5B 5CYMA 3MWPA 1HYZA 3PV8A 2Q36A 2KKZA 2CUGA 2ZE7A 2RJZA 2XT9A 3CX5F 4U7BA 3DGEA 3IG1A 3D36A 1IKWA 5B3SC 2E5LK 1FS0G 3K06A 4PDMA 2NRWA 5BRFA 4M3RA 2WAMA 4CC5A 3LAMA 3ETEA 4BIOA 5JQGB 3SMSA 2QM7A 5C10A 2ZE5A 4X1IA 1REVA 4CVNE 5FNVB 2HHHO 1W0KG 3F7YC 4NTYA 1SZTA 1VSKA 3AA2A 4F2SA 4ID1A 2F23A 3BA9A 1NGBA 4GX5A 3EE9A 4H4OA 4ICLA 5AFUH 4JI5B 3OYEA 1FPOA 4LR3A 4ASUG 1JFFA 2AJQA 4CS2A 4CS3A 2WLLA 5B1BC 3TABA 3SPJA 4AHVA 4X1YA 4WFBL 2Q3SA 3DC5A 4QPKA 3FZKA 4BRHA 5EZYA 3VQPA 3PY8A 3D3QA 2WOMA 2YJFA 3NR7A 3E22A 5AQSA 2OPRA 1AR84 4O5BA 3SQ0A 3H1HH 4KP4A 4OLBA 5LXTB 4JD2B 5I3UA 1VEWA 4Q20A 4DSLA 4P2ZA 3CRAA 3UCSC 2XAJA 2DYSB 4O4LB 3SJCC 1KAZA 3ABLC 3QICA 4UXNA 4CHQA 2RMKB 1U04A 3RRHA 3WB2A 4FJNA 1JCEA 4DTRA 4IEEA 3JAKB 1KB9F 2WFBA 4BRIA 4FZXC 4JKAA 2Q31A 3K59A 1LOTB 5B3SB 3DI6A 5B8HA 3MXJA 2UU9O 3QLHA 2ZNJA 4RO2A 4DV1B 3N2GA 1VAZA 4OKKA 5LP6C 4M3XA 1HUXA 3MECA 3B6OA 3K0GA 4DV0B 4DV4B 3CCSV 2P9SA 1L0VA 1A5WA 4FJMA 3HKCA 5K1PA 2PTMA 4LBEC 1UWBA 2KQ2A 2P9KA 1VQKN 3GQHA 4RG8A 1SQBH 1S76D 4JASA 1MWMA 1RBVA 1M56C 1PP9H 3EKSA 1XL4A 1NG9A 1BOTO 4KHWA 4CFAA 3G10A 2VYPA 4FW1A 1URFA 4Q4V4 4DO2A 4YJ3B 4HCBA 4X9QA 1XI1A 4DR3B 3ABLB 3RYIA 3B09A 3DLHA 4NR1A 1ZWIC 1HNIA 4L3QA 1ASJ4 3AARA 2ATKC 4N56A 3PSIA 2PZSA 2FBWA 1OH5A 4UCOA 3KK7A 4R8CA 3QETA 2WQYA 1S0VA 5KI6A 4AHSA 4GX1A 2EIJC 4CJUA 1VSJA 2QWOA 3OA9A 3TXQA 4BROA 4CJTA 5HOOA 4OPJA 3KJVA 1Q18A 5LP6B 1GLLO 2YJEA 5AQOA 3L3VA 3K04A 2UXCB 3L3UA 2ZF5O 2QM4A 4OX9O 2ITCC 1OV9A 4O4GA 1TA8A 4DUYB 1KFSA 3SJHA 3SJQC 4E4EA 3THXB 5ADXA 1BHAA 2ZM6K 3A0BZ 2Q7EA 5JLHA 4LF8B 1TK8A 1NGGA 3P1GA 3NGZA 3ABUA 3OBYA 4OPHA 5LGNA 1V55C 1AJPA 3NF9A 1M56B 3HKEA 5IJ9A 1S1UA 2PYLA 4UVCA 1JL2A 3FAVA 1C6VA 4DV6B 1U45A 3LWLA 1NBMG 2ZDIC 3RYFA 3A2FA 4Q6GA 4JI5O 1RNHA 3OMNB 2GDSA 3FLCO 4CZJA 2PLV4 4DV5B 2DW4A 2ZKOA 3VF4A 2OPSA 4CI6A 3CJ9A 3FYEB 4DW1A 1Q7YO 4BW5A 5CBGA 1NR7A 4KREA 4DTXA 1H8EG 3I8DA 4JI6B 1HKBA 4GVEA 4IG0A 5B1AC 1CLQA 2N74A 3VEXA 1BE3H 1NOYA 2EIJB 4YIOA 2BANA 4F3TA 1HXS4 3DM2A 3WEEB 3UM7A 2GTSA 2B1IA 3CCEV 1N34O 1W9HA 3THWB 5BXZA 1BCCH 3R6MA 1NJIO 3OYKA 3OTOB 2HHHK 1EKEA 4LH7A 1RSOB 4LFCO 1GLCG 3O08A 5F2RA 2YNHA 1QTMA 5JCOC 5AFUA 2JJ2G 1V55B 3C94A 3SYQA 3RR7A 2H8PC 4CFDA 5FRNA 3AG4C 3T3FA 2YEVB 1WSGA 2P9LA 3CPWM 3OEHG 1H2SB 5FPOA 4DR2O 3LDPA 3MX5A 1NGCA 3QTCA 2V7YA 4DV4O 1E1RG 4DXWA 2GV9A 1RBUA 2NNUA 3S3OA 1MA1A 1WLJA 2HHWA 2W6KA 3DAWA 3KK3A 2V52B 3H1KH 1EBOA 5H6QA 2A1SA 3R66A 1U47A 3GOIA 3AVMA 4AI8A 4QJFB 2PI4A 3MX2A 4F9OA 1J5EB 1NJXA 5B1AB 1RUI4 2RDCA 3ZX6A 2LW7A 4ZHQB 1BIZA 1VBD4 4ISFA 4BR6A 2O57A 4I55B 4JRPA 3BPZA 4PDWD 5EVZA 3SQ4A 3MXIA 4ZI7A 5EBLC 4NKGB 2KTQA 4J2AA 2R9RB 3FR0A 3UKUB 2WU5A 3CCJN 3H46O 3CRRA 4R79A 2OA8A 5E1AC 3DXMA 3O1BA 3JCZA 4FFBA 3E8GA 4E7IA 2Q5ZA 4DQIA 2MW2B 2X7RB 1HNZB 2X6SA 3MK6A 4BRCA 3AG4B 2UXCO 1KVAA 3M8AA 1I0HA 3HOTA 5B1NA 3DOKA 3MD0A 2RF2A 3R9PA 1VQ7V 3G4SN 4A5AA 1RFYA 3HPGA 2IVPA 2A1RA 1FXKC 3K5LA 4LF8O 3H1QA 3TARA 4IHJB 4NXNB 1QQOA 3U6FA 3ZCCA 2PAVA 4RTFD 1YT3A 2Q4PA 2PUSA 3VESA 3H1JH 3KLEA 3LDEA 3E8BA 1YTFB 4B3MB 1AI7A 4DTJA 3LALA 3HM9A 1DTQA 2RN9A 3IC7A 5I42A 2ADQB 4XIUA 1YTFD 4DV5O 2DFEA 4CGIA 4W5NA 4BACA 4B1WB 1SQPH 3JD2A 3WQUA 3CCVN 3BF1A 1M1KW 4E2LA 3U9DA 1N33O 3IRXA 4OX9K 4BAYA 1F51A 2RS14 1COV4 3JSLA 4O2AB 2ZGZA 4JI6O 4W5OA 3BDPA 1U2VA 1GLDG 1Q8IA 2XUMA 4CC6A 3DYAA 3FFKB 1FFXA 4B9UA 4GV9A 4FWOA 5F1XA 2C2AA 4I6MA 4B3RB 5AZJA 2Q1NA 2UUBB 4NCBA 3TXSA 2LJ2A 4DWIA 1C1CA 4YHHB 3EHBB 1GOAA 3OTOO 4HUGA 1GTOA 4YSXA 3JALA 3DSQA 2GUZA 5BZBA 4FK2A 1FXKB 4BC2A 4JI5K 2QI2A 5J2MA 3P39A 2Q6AA 4ZKIA 1VQ5V 1X9JA 1XC3A 3OYBA 4CCHA 1I94B 1KLMA 3C7NA 3A5MC 4XDKA 4F4KA 2P7TC 5EC1C 3HK2A 3EZ5A 3RYHA 3V1QA 1VQNV 1KFDA 4Q4Y4 1Q86W 3FZHA 4HHTA 2KFZA 1KSPA 1BGYH 1YJWV 4JKGB 4DQSA 1RUG4 5L3EA 2RM24 1VMGA 2NRTA 4JKDA 4NB4A 3P4SA 4ABMA 3AVCA 3TETA 2EX3A 1N34K 5KX5B 5HFLA 3LP2A 2DQ3A 5BRDA 3WT0A 2JEXA 3SPGA 1DLOA 4JI0O 2F4VB 1ASWA 1TL1A 3I5DA 1UAXA 3PSFA 4PL8A 4WFNL 4DSJA 3SJAC 3SLCA 4DQQA 4LFCK 3VR8A 1THZA 5KHIA 1MMMA 1TKZA 3SUOA 2M7WA 2R074 3CXCM 5KAFZ 4LF5O 4YDUC 1TKTA 4CERA 1AILA 1FJGO 1NGAA 5BPMA 2LQTA 1NLVA 1XQSC 1DTTA 2JWLA 1QS4A 3CFPA 2X78A 3KD1E 3JATB 2HEPA 4IZ9A 1JOYA 3O9SA 3O3FA 4DFMA 2W0FC 4FJIA 4H0LB 2O8EB 4MVOA 4MTGA 5CY4A 4DR2K 4KHNA 1LWFA 4FK4A 4DV4K 5KHKA 4X65B 3ISNC 2R70A 4EB6B 1BZKA 4UY8O 1TK0A 3U9ZA 3TANA 2BTQA 3RN4A 1HWYA 1HNZO 2KFNA 1NU1H 3CCLV 1TAEA 3VOVA 5HRNA 5KQDA 1KVCA 5EX5A 3AE1A 4H03B 3BEHA 5FDLA 4JF3A 3WXMB 1N6QA 2ZR2A 1VQ9V 3P38A 3HTVA 4FLZA 3LZJA 1VQ6N 3GVMA 3HR0A 3OT7A 4DV3O 3HO1A 4NXNO 2ZXWC 3A8YA 3T4DA 3VQXA 2DWDC 4MFBA 4YFUA 1NENA 4YSZA 3D2EA 4IDHA 4M7XA 3RMBA 2DN9A 4J9YB 1FAFA 3HVRA 1RILA 1NTZH 2QXFA 3KLGA 4B3MO 2X6AA 4OLAA 4ILJA 4YXDA 1SKRA 3CC4V 3QINA 4DLGA 1H1VA 1QBZA 2CK3G 2GTAA 5HL7L 1IXMA 4H4MA 4TQFA 3CM5A 2Q9LA 4Z94A 2E6MA 3MDQA 1FKOA 4BVOA 2UXCK 3JAMO 1JA8A 1M4UA 4DRXB 3FZLA 3T7ZA 3V9XA 4DUYK 3G6BA 5JS1A 1QR9A 5AQPA 1EQYA 3ZSQA 4DTSA 4LF8K 1H2KA 2YXLA 4YIPA 4B3RO 4DQPA 1K5QA 1Z5VA 2UUBO 3HM8A 3IMXA 1S9GA 2E74B 5LL6Y 2BH1A 3L2RA 2EJRA 3AEBA 2J4RA 1XHXA 2E5LB 1DGKN 4QPJA 3K08A 3VQ5A 3FI7A 1P90A 4FPBA 1TVRA 4HWIA 3L0QA 2UXNA 2ZXWB 5KTQA 4DV5K 3UT5B 5JICA 3OR7C 3LWMA 2HMIA 4KI4A 4DFPA 3W0LA 4FSVA 2Q97A 4JI4O 3SUNA 3L9DA 3LL3A 4KH4A 4RCHA 3TWHA 2QGNA 4TV9B 1VF6C 4JI6K 2JEUA 4AHTA 1D8YA 3ABMB 1FXVA 1AR1B 4FJXA 3J8F4 4LFAB 2XY7A 3NCIA 1Z7S4 3CD6V 2FSNA 5LJWA 4JV5B 1SQVH 2DQ0A 3NE6A 3UKMA 3P3PA 1K33A 1SV5A 3AVHA 4WQ5C 3QEIA 3SCXA 4KTQA 3ZMZA 1Y6XA 4CGGA 3LNMB 3IFRA 3SV3A 1YVWA 4MW8A 4CJ4A 5LXTA 4JD2A 1NGJA 3OTOK 2DPNA 3G71N 1MDUB 1VQON 4DV2O 3LM2A 4O4LA 3KWIA 4ILGB 4G9ZA 4EP5A 4YOTA 3VQDA 3ASNC 3IUCA 3AY9A 3AO5A 2QM8A 4ICGA 2CH6A 1VSLA 5E79Z 2E1YA 1JQ0A 4IYIA 4KKOA 4DMNA 3JD4A 2P9UB 2Q0UA 2JS3A 3ZN1A 4DYLA 2P9PA 3CJ1A 1LAVA 2CGNA 1YEWA 5JH7B 2ZINA 3CC7V 1F4MA 2UXDO 2QSAA 5EY4A 5I9EB 1ZYQA 2OTLN 1ZSPA 4X65O 5HROA 3CYOA 1ASVA 2ASOA 3CQYA 3AO3A 1WNSA 3I33A 4NXMO 4CZZA 1LW2A 3SYZA 3AE6A 1MQTD 5KHJA 5J2TB 4CZIA 1YXQA 3GBTA 4O5FA 3AE9A 4UUJC 4GNIA 3SUPA 3OYIA 4JI0K 1Q5OA 1EN4A 1XEQA 1F7YA 5C8YB 3ZBHA 4LF5K 3AVBA 5CZ2A 4LF7B 1G99A 1FJGK 4WFAL 4JYYA 2H3GX 4EHUA 3MCPA 1X59A 2A79B 1VSDA 2YX6A 2R064 3R8EA 2OZMA 5AQNA 3CC2N 4WBNB 1QE1A 5SZTA 1YVUA 3P4QA 1LNQA 4JTCB 5CB4B 4YJ3A 2YV0X 3TTFA 4B1VA 1AR5A 3D8CA 2Q8VA 5C2FA 4YORA 2QWRB 1D5NA 4DSFA 2D1KA 3L4IA 1HNZK 2QEXV 5M1KA 3F7VC 1RTDA 4DF8A 3ULEA 1H2MA 4X66O 4GX0A 4E1NA 2QKAA 3VOUA 2YIAA 4G28B 2W6IG 4CHPA 3CETA 1VQPN 5L3DA 5IJ0A 2XHBA 2CGKA 2Z1IA 1OVYA 1QQNA 5LP6A 1BSMA 1BS3A 4EP4A 4DV3K 3EYZA 4CBCA 4XDLA 1K8KB 3AK3A 5J2UA 4JK7A 4NXNK 1XOUA 1SL2A 3QB0A 3SMPA 4CK1A 5DMRA 1CP9A 1L1FA 3WXJA 2E3CA 2ZM6B 3ABTA 3THXA 1SS3A 2NR5A 1R6TA 3CPWU 1EV14 3GG4A 1SERA 4B3MK 2HLDG 3KLIA 1VQLN 4TSXA 4BR2A 2IU0A 1RDBA 3SPYA 2IH3C 1FFTB 3MHSC 5AQFA 3ZT2A 5TKYA 2WSSG 5CBFA 4K41A 2ETJA 1NCQD 1S1WA 4E1MA 5LHIA 1IDSA 2ZT9B 3KTQA 3SPIA 4YNQA 3D2FB 1DK1A 5D5PA 4BGAA 5F0XA 3ZS8C 2Z1GA 1L3UA 4LFAO 2RS34 4J8FA 4PDRA 2FKXA 3C6AA 4B3RK 4EFHA 4JV5O 1RT4A 3TJTA 3EN9A 2UUBK 4E7JA 5AQVA 2AHZA 1S5LZ 4IGGA 2D4WA 2FC0A 4ELUA 4QE7A 4YHHK 1FD9A 4LP8A 2QKKA 3ETQA 4JI2O 3NF6A 4EZ9A 1UA1A 2WDRA 3TSPA 3WEEA 3CXHF 3CCQV 1QNMA 4ZOLB 1XNRO 3JASB 4OKEA 3LDSA 4GV3A 1Y76B 3RR8A 1T44A 4KPYA 3OTFA 1JL1A 4I2PA 3ZMSA 4KH6A 1B6QA 2DYRC 4D7TA 4WCEL 4CF2A 3THWA 3JSNA 1KXPA 1KMIZ 2JWKA 4NB5A 1TUYA 4JI4K 4EFBA 1BQ0A 3SNNA 3VPZA 1H8TD 4WQ4A 4ELTA 2O8DB 5AZIA 3R3LA 1NU0A 4E7KA 2KW4A 3GB7C 1HW7A 1VQ4N 3AECA 3I56V 3Q4HA 3NH1A 4MTXA 1YJ9V 3OYAA 4BDYA 2E75B 3G67A 1BCMA 1VBE4 4Y1DA 3N2KB 2DFHA 1S1VA 1TKDA 4QIWF 5EYPA 2LP7A 1PNMA 4KHPO 1QZ5A 3MN6A 3EKUA 4PWDA 2P5OA 2GTDA 2IJJA 1TAQA 1C1BA 2A41A 3AA4A 4BRFA 4DKWA 4JI7B 1Q90D 2IU3A 4LF7O 4NCAA 1VSHA 4FJ5A 1KBHA 2OWOA 1S9EA 2R7FA 1NK0A 1S5HC 5CA1B 1Y97A 2JIZG 4F8RA 3DXRB 5JJJB 2BTFA 4WFBV 1RGIA 1AR64 1YCIA 4DR6O 3JS6A 2UU9B 4KO0A 2UXDK 2Y4UA 3NHGA 1QSYA 1N36O 4X65K 3BF3A 5DM6L 3KK1A 3AO4A 3ZSYA 5L3FA 1IG9A 2DYRB 4NXMK 3PO4A 4R7CA 4FM2A 3RGBA 4AM6A 3UKUA 2ITMA 4BG8A 1PIV4 3AEAA 1GN3A 1K92A 4MTFA 5JCOA 2ZQMA 2A9HA 4OGQB 3CCUN 2PYJA 3VBBA 3L75H 3Q7CA 4IOAL 3EVKA 4RW7A 1GLFO 2YUAA 1WPXA 3TAEA 3PX6A 2RPIA 1T7PA 4E3SA 4LWSB 2HNZA 3K2PA 1MZFA 4F6RA 3J80N 1IJJA 1BQZA 5HRRA 5ADXH 1ZAUA 3S3NA 4U3JA 2P5GA 1L5UA 3E2EA 1MG1A 3LDNA 3O6WA 3HOSA 4IHJA 3T1YO 2KG7B 3H9VA 4PELA 4PV1B 1EAH4 3D6RA 2PBDA 3LDDA 4FXDA 1AP6A 1NH2D 4IXCA 3VMFB 5GINA 3UQ8A 3CMAV 1B9DA 3KKRA 3M3ZA 3V9ZA 5BR9A 1VQKV 3K5MA 3CIRA 5LA6A 2O8FA 1Q81W 2P9NB 3VQ8A 3MEEA 2UUAB 4DQ8A 4X66K 3RT3C 5CMUA 1ZLZA 3CPEA 1IBLO 1MNGA 3C3SA 1FW6A 1KP3A 4L8JA 3CXCU 2CGLA 4OX9B 3L2UA 4Z4IA 4FJCC 2AXTZ 4IYHA 3PX4A 1GLJO 3EXAA 4EAHD 5KRTA 2BGGA 1Q43A 1YQ4A 4BRDA 3UB5A 1KP2A 5AR0A 4O2AA 3U10A 1VRUA 4IJNA 5JWPA 3KWGA 1JLGA 3VQ7A 5CA3A 1KF6A 1MOFA 4IIJA 2XOKG 2Y1IA 5KA5A 1LR1A 2IJKA 4PDLA 3KLHA 3RTVA 4GY2B 1NKDA 3ZIAG 1ZUQA 4RW8A 4PL7A 1RP3B 1Q6UA 4O0JA 3VA3A 4DFJA 4FJLA 1BIUA 1NGEA 3O9RA 1QVGM 1FXKA 4PKIA 3M8SA 3FKSG 3E66A 1DLBA 1DT9A 1RDWX 1L3SA 5EIBC 4I0XB 3JCUZ 5KHHA 3AGRA 4FZ1A 3QG5A 1YAGA 3DRPA 4LFAK 2PY5A 3ZX0A 3AVGA 4JV5K 4I7FA 2FBTA 5HRPA 3ETGA 4Q4X4 1QLNA 2RNBA 4YOVA 1BG3A 5LYJB 4J41A 4R50A 1YF5L 3CJHB 1BQMA 2V51B 2ODMA 4CK3A 4FCYA 1BISA 1HQUA 5CE3A 1WA8B 3J81N 4JI2K 2GEMA 3O8MA 4AHUA 3SAGA 5BY1A 2X5ID 3MXMA 1N34B 4JI7O 3DLRA 1CXUA 3BA8A 4UCVA 1BA1A 1HNVA 3NBPA 4BC4A 1XNRK 5KX5A 4PY5A 2H88A 1BCOA 3AE2A 1E79G 4O4JB 3K9JA 4FWPA 5LMNB 4LFCB 3DRRA 4XH1A 2X6CA 4O55A 3OS2A 5LMUB 4BRQA 5H9CA 3TU5A 2YICA 3HBTA 4EKWA 1OCOC 3BFRA 5FPDA 3BABA 2EBOA 1IH7A 3J80O 3L8BA 1UOCA 1NVPB 4B9SA 1M93A 3JATA 3A0RA 3CS5A 4MO4A 2Q7HA 4H5NA 2D0OA 4DR2B 1M1KO 3ABVA 4EFEA 2O8EA 4I4TA 2B9ZA 1JJOA 3KIOA 2KLAA 3OMAB 2BSKA 4YXWG 4LF4O 1RBRA 5AQYA 1NKBA 4WF9L 3TTDA 5CBHA 3MWTA 5K14A 3V81A 4EB6A 1YTAA 3DLEA 3S3MA 1NGDA 1WSFA 4KHPK 2HHUA 4NVPA 4JRQA 4J42A 3OYNA 4J2EA 3A0HZ 4LF7K 4XEIA 5EIBD 3A5NC 4CZEA 5JVDA 2NLJC 2YHYA 2P51A 3OS1A 1Q6HA 5KQ8A 4MVMA 5J1EA 3PIOL 1PKXA 4DR6K 3SFDA 4CEQA 1WPBA 4HAMA 3DWLA 4O4HB 5EU7A 3P31A 2QWNB 1VSMA 2QK9A 4YTMA 5MLCQ 5B66Z 1IKVA 2DFFA 1BGXT 2P9IB 4OGCA 3JBG4 5HLFA 3IKMA 2VQFO 2YNFA 3F73A 4DUZO 1X1PA 4FMTA 4A5BA 4F2RA 3B40A 4J11A 2UUAO 3ENBA 1KKDA 4YDUA 4GW6A 3IGAC 1PO24 1OCOB 1Q86O 1JXEA 4X89A 2E1ZA 1SZ2A 3ITHA 3MCAB 3H6EA 3LDQA 2D0CA 5FPNA 2XY5A 3OYCA 3ZT0A 3GL1A 1TUEB 2BOBC 1TKXA 3V1OA 3M1FA 1IG8A 3U3GA 2QWMA 4BRMA 3F9KA 4KFBA 2ZWHA 3M99B 1NK8A 5C15A 3IAYA 1IURA 4EHTA 3QBWA 1AROP 3ZHRA 1R0AA 1PD3A 2WLKA 2DWEC 4HTUA 3T1YK 3QIPA 5GAGP 3BZCA 1IVSA 5CR4A 3K0DA 2UXBO 1TUBA 2WLJA 1V4SA 1NZ6A 3J81O 1PO14 1VBA4 1ATNA 1GMGA 1QCEA 2L6LA 2VWJA 4BREA 1DTOA 3E9LA 4M42A 2HJDA 4IG3A 3NFAA 4W5QA 3OE7G 4H5WA 3G4SV 3UT5A 1DKGD 4RWTA 1IBLK 1VRTA 3OYJA 3ZRVA 4UFZA 1KC8W 1N33B 2ZD1A 3CHXA 4UB6Z 1NI8A 4LY7A 2FMLA 1NMNA 1WAJA 3CERA 3LPTA 4E7HA 2VG6A 1I5XA 1RT6A 2YHBA 4FWRA 1Q9YA 3HT3A 3EO3A 3RMCA 3AEFA 2VWKA 2VS0A 5IYZA 1BI4B 4IFYA 4HZ3A 3AGKA 2N04A 1QSLA 4UV8A 5M1NA 5KAIZ 5LBQA 2PGGA 2XAGA 5LMNO 2HF4A 2Y4TA 2RHKA 1VF7A 3CCVV 5LMUO 2GUIA 1X4TA 2Y0IA 3AVJA 4A2AA 4CEAA 1N0JA 2Q69A 5IE9A 2WLNA 3ZSZA 5JJNB 3ZETA 4A5UB 3HSTB 3ASMA 3ID6A 1CZAN 3UKRB 5TKWA 2PW9A 5EOYA 3CFRA 1NNEA 3ABKC 5JH7A 2ACZA 3ZRXA 1X9WA 2IBZH 3CB2A 2KB1A 2JS5A 2P1JA 1B04A 1QU7A 4MVRA 4CF8A 4CIEA 2IJHA 2WLIB 3ZSXA 4JI7K 1BEV4 2HF3A 5AQGA 2BDPA 4FJJA 1NQTA 4BE1A 3QO8A 4JI0B 3OBWA 4NYKA 3V6DA 1GOCA 3WQTA 1S3JA 2FTKA 2QTDA 4CJRA 4W4KA 4LF5B 5C8YA 3W7UA 1FJGB 3O3HA 2UU9K 3ZLJA 1N8RW 4FZ0A 4P9PA 4Y1CA 4FWMA 5T7BA 1HRI4 3HSCA 4WQ5A 1HQEA 4JPRA 3KLFA 1EN5A 1SESA 3RBZA 4WBNA 1OJHA 5IT9O 3R1XA 4Z4HA 3VQ4A 3W7TA 5CB4A 3U4LA 2UXXA 1VIBA 1OHHG 1LUVA 4DTPA 4LF4K 2Q0RA 4FFKA 1K8AW 4KHYA 1FK9A 4M3TA 4CJQA 4MSWC 2QWRA 4LNUB 4CFCA 1RDDA 4Z4EA 2W0XA 2BCCH 1T5EA 3LSQA 5AQUA 3VF2A 1W2BM 3VR9A 2X0LA 3Q7BA 4I5SA 4BG9A 2OCCB 1GM9A 2CTQA 3ABKB 1GLBG 3A5OC 2FL4A 2ETNA 4KAZA 5B1OA 2O4GA 2ZJPL 3KZBA 4DFKA 4Z4GA 3DLBA 3OY9A 4DV3B 3FB8C 1TYQB 4UCRA 3SAFA 3KZIZ 2P67A 1R6NA 2YDEA 3RYCA 3CFOA 3EE8A 1HNXO 3CP1A 1BHBA 1K8KA 3SBGA 4W5RA 3JYTA 3CF5L 2HG5C 3O4QA 2BOCC 4KFMA 4N41A 1HP8A 3KVGA 2NZTA 1G1XB 3HI0A 1J6ZA 1WB7A 2VQFK 3MMVA 4DUZK 2K1EA 3UO3A 1RTIA 3P4PA 2JLEA 3VGKA 4CEEA 3DLGA 4Q4W4 2UUAK 2CH5A 3AE5A 3IC9A 2FYUH 3HPOA 1BU6O 1U6ZA 3ZT4A 4BWMA 4C8KA 4QGPA 2X74A 2Y1JA 1VQ6V 1O1WA 1U4BA 3D2FA 3BRCA 5LOVB 1BDGA 2QXLA 3AEDA 1P49A 2VQEO 2Z3YA 4I9LA 1HJRA 1HYVA 1HPMA 1I7FA 3RVCA 3AVKA 2ZD9A 3D3IA 3SPCA 2HMPA 3WFVA 3CCMN 4WFEA 5C0YA 3WNFA 2LFSA 3ML0A 3STZC 1QHAA 4JLHA 4H8KA 1EETA 4ID5A 5BMVB 4CF9A 3C65A 5LJVA 2UXBK 2P90A 5FPEA 4N5SA 3MAQA 4YOWA 3JAMN 2LGWA 3C3TA 4QOZB 4BRNA 1X3NA 2AZ2A 1HYSA 3JASA 1R1BA 4MTOA 3DOLA 4JI4B 2YIDA 3VQ9A 4PI2A 1BWFO 3AO2A 5KPRA 1C0GA 1TL3A 2HHSA 2O8DA 4B7KA 2YXYA 3CWBH 1Y4MA 4H37A 4AM7A 2YKMA 3VQAA 1K9MW 1M57C 3CIPA 3H1VX 2FB5A 1DEJA 1FXXA 1P7GA 4B9LA 2PF4E 5AQXA 4CJWA 1NK6A 4Z1MG 1OH7A 2XTAA 3KHYA 1ZXOA 3KKYA 1SC5B 1JFFB 4O2BB 3RFRA 1RBTA 1I08A 2GUPA 2HB5A 3SJJA 1LWCA 3N2KA 1CZ9A 5ITZB 2YNGA 4IO9L 1JLEA 3DRSA 1ZBHA 5LMNK 2QKSA 4DV2B 1SS6A 5GIOA 5EZYB 1S3XA 5FPRA 5LMUK 1EZJA 1K97A 1VK0A 3O65A 2OT5A 1NWKA 2EILC 3LAKA 3ENOA 1U48A 5H6RA 4BWAA 3OYDA 1BA0A 1J5OA 1TV6A 3RWUA 5CA1A 4JN4A 2YI9A 3DXRA 1ITGA 1CPYA 3AE7A 2UXDB 3ENHA 3NAEA 4PA1A 2PI5A 1R3JC 3OM3B 1EWRA 2FBVA 4BR9A 2XY6A 4NXMB 3PLAA 1POV0 4MDBA 4HNAA 3OW2U 3AK2A 1K3EA 2YI8A 4OPAA 4CGHA 3EY1A 1K34A 2IVNA 1VQOV 4DB3A 1LAWA 3MEGA 1G15A 3QBXA 1RHI4 3N2GB 5AQZA 1U96A 1SKSA 2G8FA 1RM1C 5AQTA 1JJ2U 2A5XA 1NMDA 4C8LA 1R094 1M57B 1E3MA 1TUUA 1PPJH 5E26A 5KRSA 4BW9A 1QVGU 2VGMA 2WC9A 4D7SA 2HNYA 1LV5A 1YJNN 3AK1A 4JNEA 3V4IA 4LWSA 2LW1A 4IWVA 2P9KB 3CHWA 3RRGA 3E9OA 3CYMA 3A0IX 1K5SA 3KCXA 1WSHA 3LPUA 4CZHA 3DXKB 4BY9C 1GH6A 5E41A 2XY8A 3ABMC 4DHYA 4MS2A 2KG7A 3M5RA 1PV0A 3U0ZA 5DK5A 1X9MA 4N23A 3SUQA 2EILB 1MZEA 1ZBSA 3L2WA 1Q3EA 2BTOA 4R5PA 1QR8A 3WNEA 1K6YA 3ZX3A 3JARA 5C24A 4X66B 4JI3O 2Y69C 4DV7O 3M8QA 3RYIB 4JI8O 4O44A 4A2BA 2OPPA 4WFAV 1IZ3A 3SAHA 3R65A 3C95A 5BPLA 2YS8A 1VQMV 3NF7A 3AVAA 5CYQA 3K5OA 4BE2A 3HP9A 3B2EE 5EBMC 1HNXK 3E83A 4CHNA 4DTNA 3E9PA 3K03A 4C23A 4JZGA 4LF9B 2DMXA 2A6AA 2Q67A 1WB8A 1RM1B 3P4IA 3T1CA 3PIPL 1NGFA 1Z5WA 4CHOA 4KUMA 3SV4A 5JQGA 3ZSRA 4B1XB 1RDCA 3B4SA 3ZHQA 5FNVA 5H2FZ 3RVYA 1T05A 1N33K 3B8MA 3ID8A 2HBLA 1YITN 5DEDA 4TV8B 1MU2A 4PUOA 1KQSU 5IJ9B 4I50B 1I3AA 2HBJA 1YSCA 1IO2A 3MN5A 3HKBB 4RUEA 4OJRA 1YJWN 3O4WA 4B9VA 3ZMVA 2WUSA 2H89A 2OCEA 3RMDA 3W7XA 3RYFB 2LFRA 3AG7A 3H01A 4CJ3A 4KHQA 5LHGA 5KMGB 1SF9A 4JAXA 1RTHA 3ZHTA 1SZXA 2Z5UA 4XH5A 2Y69B 1VQLV 4JZ2A 4KL1A 5LYJA 4YT0A 2R72A 3NH0A 3RWRD 3CJHA 4JI2B 1HRHA 1OCZC 3ICXA 5EK0A 2G38A 1XNRB 2YSUB 1XWLA 4CECA 3JAKA 1UFIA 4JYBA 1SQGA 2HOEA 4H5TA 4BQLA 4KTWA 3APQA 5JLFA 4JTAB 3QEVA 3TPQA 2E2NA 1S1XA 4U7OA 2OIGA 4RW6A 5JVHL 1Q81O 1S72N 1AI5A 5M1QA 4CGDA 4Q0BA 3NDKA 3UE5A 2E2PA 2H3OA 2A40A 2F7TA 3I8BA 1WAFA 2B4JA 4ZTFA 1JKHA 3TK1A 2JGDB 3DMJA 1N4CA 1VSIA 1P7BA 1K73W 4JYCA 4KHPB 2YHWA 3O9QA 5ELZA 1LW0A 4KHSA 4CBUA 4WCEV 1Z05A 2P9LB 4R6ZA 1CZBA 2CTPA 3L71H 2UUCB 4HVJA 3K3WA 2BUPA 4HUFA 2YI1A 1JMKC 4B9NA 2FBXA 4LH5A 3CRMA 1QSSA 2NRHA 4HYOA 4CESA 1CEZA 3EZWA 3G6EN 1EM1A 1VQ4V 4DR6B 2RR14 3BHPA 1XUQA 2P4KA 4H0YB 1OCZB 4NTWA 3OGCC 1N36B 5JJEB 1H38A 2HBKA 1K4DC 4CJKA 4O4HA 1SRYA 1JXBA 4ZIBA 2OANA 5LY3A 4JEPA 2P9IA 3WNGA 4DLEA 4CJVA 4RQEA 1VARA 3HPLC 1M9NA 4JKCA 3MDSA 2RN2A 1XMOO 1EP4A 3U3YA 1YIJN 1UA0A 1OVQA 2JDIG 4ZI7B 1HNWO 4CF0A 3OAAG 4YOYA 4B3SO 1X3MA 3TSQA 1JR9A 4XBFA 1H8HG 4QS9A 3FE1A 4DQRA 1O9HA 3AG2C 1AI4A 4JKEA 3FB6C 5CA0B 3G0ZA 5FL7G 3P32A 1UPGA 1RT2A 4LD0A 2QWPB 1HX1A 4LF9O 1S77D 1M90W 4GZRB 3I55V 1L8DA 5DM6V 1JCFA 4OXSA 4CIGA 2I7PA 1WJZA 3K58A 3FFIA 3VRBA 4NYFA 3T1YB 4FM1A 4DU1A 4UVBA 4JK8A 4H13B 3ALYA 1Z25A 1JPXA 3AG1C 5C12A 1IBMB 5AQMA 4FLYA 3EEQA 1VQ8N 4AF1A 3CCUV 1EWQA 2EIMC 2QJ1A 1EZVH 1RUC4 1NS1A 4XDJA 3QEWA 2F93B 1YI2N 2EZOA 4C7UA 4DV7K 2QA4N 4JI8K 2N05A 1SA0B 4AILC 1J54A 4E19A 1I5YA 3QO9A 1IBLB 2IS3A 2XO7A 1W7AA 4FZYA 1YDXA 1D4XA 3BZKA 4CZLA 4CJSA 5KGWA 4GKJO 1RDUA 2AW9A 3EFFK 4O4IB 4QS7A 2ADPA 1SUQA 4PQUA 3A8TA 1AJQA 5TISZ 1L3TA 2HWC4 2ZE6A 1RT3A 5A9GA 3ZHVA 3L4QA 4C8NA 3C6HA 3HZ6A 2F8TA 4PHZA 3CCRV 2EZPA 3C6UA 3AG2B 1YXBA 3SJBC 1BI4A 3P5JA 4EIAA 4AHRA 1PNKA 3DC6A 4DR1O 3VERA 3LANA 4Z1VA 2BE2A 4LH4A 1WSEA 1RSOA 4I6MB 1W2BU 1NK7A 3QO7A 4FYDA 2FF6A 4CFBA 3FFQA 5KHGA 5J9PC 3H3OB 4FVUA 3CI5A 2KZMA 4FLTA 4HTLA 4CJPA 3AG1B 1R73A 3X2QC 2YEVA 2GUZB 2IC3A 1T6CA 4CBWA 2DE0X 4IT5A 3LDOA 2RKIA 3FZFA 2A7WA 2ZDIA 2EIMB 4MVQA 1GRJA 3JYCA 3KD5E 3JD74 1YTUA 5SWMA 1R084 1FKAO 4J7KA 2QWQB 2VCPA 2Q68A 4CH6A 2W6JG 2NUBA 4DV2K 4KI6A 1WLEA 2YNIA 2R9IA 2WLIA 3OUSA 1F4NA 2UUCO 3ZSWA 3HJFA 4CEBA 1RMU4 1JCGA 3T19A 4N21A 4LF6B 3F5WC 3CM6A 4O8KA 1GO3F 4BRGA 4ZHQA 1OOPD 1Y74B 3C90A 1NJYA 2GX9A 2AGAA 2A3QA 4I55A 5H5NA 4CEFA 1D2DA 4BR4A 5IDJA 3ZRSA 4GYCB 4NTXA 4CJ5A 5JS2A 3J7YP 1KC8O 4LF4B 2ILMA 2ZQBA 2NRXA 4BVPA 4BRKA 3ZEUB 4ISEA 2ITDC 2I7NA 3DLKA 3ZSVA 1NA1D 4FWNA 1XNQO 4LNUA 3B6PA 3X2QB 2CH7B 3LP3A 4X8AA 1C0MA 2V1DA 1HKGA 4B8AB 3SPZA 3A5LC 1LUWA 1NKEA 3IDHA 4JS4A 5GONB 1JLAA 3VQCA 1VSFA 3V1RA 1LCUA 1VP7A 2LGQA 5KUKA 3QO5A 2B1GA 3ZEDA 4JKFA 3U8XA 2G8WA 1VBC4 4BQZA 1NEKA 2F43G 4BR0A 2ZJRL 1NJZA 3N4QA 1KKCA 1IBMO 1NGIA 4MLEA 2VQFB 4WF9V 4GKKO 4DUZB 4K25A 5FRMA 5C3JA 3K57A 4WFHA 1XMQB 1QVFM 3SUCA 3BGRA 3WU2Z 4CEDA 1HNWK 3LP0A 2F9TA 4H5VA 3WUHA 3TAQA 4TWKA 4B3SK 2IW5A 3APOA 2GWKA 4IDKA 1ESVA 3CG7A 1HDJA 3AAPA 4OKJA 3QEPA 4PA4A 4NCGA 1ZBIA 3T1HO 2FBYA 4DG1A 1Y64A 4N47A 3WB0A 3AA3A 2ASPA 5LOVA 1AI6A 4LCUC 1XUPO 1ILYA 3GQKA 3GDQA 4LF9K 2ZR3A 4C1NK 2VRZA 1L3VA 1SKWA 3JAWB 2DY4A 4KV8A 3OW2M 1AP5A 1HJOA 2R9AA 3MN9A 4BWJA 4DTMA 1GK9A 4DK0A 3KCYA 1SETA 3AEIA 3H08A 3AE4A 1N8RO 2UXBB 5BMVA 4XH4A 1O9GA 1KCFA 3AVNA 1JJ2M 4I9QA 2F95B 1YHQN 4UB8Z 4X88A 3CJAA 5DECA 3SQ1A 4RAIA 3P4RA 1Q82W 1R59O 4MLHA 3O9UA 3VGLA 3T1AA 2B5JA 3CE2A 3TTCA 3HKDB 1BQNA 3I56N 4BR5A 1K8AO 3FYIB 1YJ9N 3CMEN 3NVMA 3SDLA 1SL1A 3IS9A 4GKJK 5GTIZ 4GVMA 3TAPA 2HFEC 3ZHUA 4FPPA 3OYHA 1R3IC 1ZC6A 2HR3A 3VQWA 1GKFA 4UCSA 3AV9A 3ZSOA 5DM7L 4P9OA 1R6KA 4JKGA 1IBKB 2KQXA 4CZMA 1EX4A 5GAEP 4RW4A 3W7SA 1CXQA 4O2BA 4DR1K 4TQDA 2Y48A 4LF6O 5ITZA 4FJ8A 2R7YA 3WXKA 1EFRG 3VN5A 4OO1J 3AVFA 1OKJA 1TVKB 3B77A 1KFYA 1RUE4 2LSNA 3TAMA 4K0KB 4JYAB 2F9WA 4X64B 2GHYA 2IIRA 3OD4A 1AR4A 2IOCA 1RT5A 1KUQA 1WOQA 4PKGA 4A61A 4BIUA 2QKBA 5BRHA 3ATVA 4IKFA 5IWAB 2YKNA 1NVPD 4K35A 5D3GA 3O9OA 4JI1O 1ZX3A 1GN4A 1MABG 1KECA 2QE7G 5F2VO 1RT7A 2E6LA 5L3BA 2VWBA 3QFUA 4WFGA 4YOXA 3DTUB 2OPQA 1NT2B 2Y0PA 2P9PB 1ATRA 1W97L 1T6DA 2EJ7A 3HRGA 3O9TA 4QS8A 3WB1A 2UUCK 3QIOA 4E0DA 4PA6A 3ULDA 1KQSM 2OTJN 3SFEA 3VETA 4A57A 1GLAG 4RQFA 2XRIA 4DR7B 4PA7A 3VQVA 3WXIA 4HBNA 3AE3A 2RQ6A 1Z26A 1N36K 3T2MA 4DF4A 1BO5O 1S1TA 1HR0B 3PJSK 5KPTA 2KSDA 4KH5A 5M1FA 4Y0WA 4G27B 3CMAN 1KVBA 4B3OA 5B1BB 3AEGA 3PN1A 3DXKA 3VA0A 3HB3B 1GM8A 3JD1A 1XMQO 1QQMA 3H45C 4YOUA 3L2VA 4HCCA 4IEIA 3LDCA 2CGJA 4B1ZA 4KTZA 5GTHZ 2EULA 3CJBA 1U49A 3S3XA 2CAZC 1N32B 5AQQA 2F96A 4C1NI 5DN6G 1K9MO 3FB5C 2O8BB 4DSEA 1PM9A 2Z1JA 1XNQK 2DOSA 2YC0A 3H1IH 3W3DA 1NK9A 1ROPA 3SYAA 4AHCA 4DRXA 5LHHA 4FWLA 2B76A 3JSMA 1BL3A 4B9QA 4ZBMA 4J2BA 3ZN0A 5IT9N 2IGIA 5B5EZ 2ZJQL 1HNXB 3ULEB 3ASOC 3CCJV 2WPDG 4TUYB 2I5JA 1W59A 4EZ6A 4H33A 3E8HA 1IBMK 1XILA 5AQLA 4IBNA 5IJ0B 3MHHC 3HVTA 3JD0A 4GKKK 2HP8A 4DR5O 4FWKA 4I7ZB 4M41A 4A62A 5KPZA 3CEIA 1YVNA 3AA5X 5J2UB 1WB9A 4FZZA 3SZ2A 2Z0AA 4B9MA 2HBMA 1W0HA 1COWG 2CTWA 1KD1W 5GADP 4BR7A 1ZOYA 1AJNA 3SPHA 4CH5A 4WQ4C 3T1HK 4BC3A 3K9AA 1GOBA 2OCHA 4TV8A 1C0UA 4BGBA 4I50A 1IX9A 4TV9A 2VQEB 4M63C 3M8RA 1NKCA 3HKBA 5KUMA 3L6QA 4B8CA 1ZBFA 1ZTEA 1JVMA 3O4NA 4OGEA 1IBKO 3QNOA 5KMGA 1PL4A 1GM7A 3H3NO 1KAYA 2HKOA 1V9PA 4PD4F 1V4TA 4FOIA 1MA9B 4MO5A 5AQIA 3FD9A 1QHTA 1NOZA 3THYB 4RUFA 4A59A 4RHV4 2F1MA 4H5RA 4CS4A 2O8CB 4UCTA 4K0KO 4JYAO 3ATUA 4X64O 1NTKH 3ASOB 1JCHA 4YTNA 4B7EA 1XL6A 4X20B 2P9UA 1U97A 3QNEA 3QDKA 5C25A 2OCCC 5IWAO 3CCSN 2YHAA 5EXWA 1JLFA 3E86A 3CCMV 2GELA 5FPMA 3F5TA 3M7MX 3VQ6A 1RUF4 1XQ8A 2HVJC 1NM1A 2P22C 4LSLA 2ZE2A 4JHDB 2AP1A 4MVZA 5D5QA 3NF8A 4I2QA 1N5YA 3ZYYX 5J2TA 4DS5A 5J2PA 4K42A 2JGDA 1Y66A 5AZIB 1SL0A 2Q73A 2YIBD 4CW7B 4DV1O 3SYCA 5A2QN 2Q2RA 4LF6K 4BDPA 1VF6A 4DR7O 3Q4HB 1ZBUA 5C42A 2YHXA 1OZ0A 2D0BA 4DV0O 3AG3C 3PO5A 3LUTB 4X1KB 1Z2GA 3D45A 3AVIA 3OJUA 2RS54 1HR0O 5EYPB 3ZCMA 5J2NA 1HRV4 3AVLA 3E89A 1NK4A 4G2KA 3THOA 3KKSA 1US6A 1B06A 4FL9A 1ZL8B 2ZNIA 2DJVA 5BN8A 3CRCA 3O3GA 3TAGA 1IKXA 4JI1K 4CGJA 1ZP0A 1X9SA 3J7ZO 4O8UA 1N32O 4NLBA 1OH6A 1WP7A 4M7YA 1AR74 4YJ2B 4BE0A 1SQKA 4DR3O 2P06A 4B9TA 4KHUA 2HVHA 1YQ3A 4GUNA 1P84F 3AEEA 4QE9A 3VF6A 4DK1A 4I9WA 4CJFA 1FXHA 2EWSA 4FK0A 3VRAA 5LGTA 1SQFA 3D36C 2GWJA 2KZZA 3L70H 4RW9A 5CA0A 5J2QA 1D4M4 2CE4A 4F3OA 4PKHA 2W40A 2ITGA 2QWPA 4CBXA 1KU9A 1E1QG 4G1QA 4CE9A 3D7EO 1R3KC 3K79A 2QTOA 1XMQK 3K5NA 4FPAA 4KB1A 2JGUA 2XAQA 4P30A 3AG3B 4F6RB 4DUYO 5M1OA 4BRAA 1D9FA 4M3WA 4FJ7A 1I39A 4DTUA 4U3JB 3F9MA 2EHGA 4H44B 1A32A 4MVSA 4WFFA 3RSEB 2QDOA 2G8VA 4JI3B 4DV7B 2NLXA 3QF7A 4JI8B 2HVIA 3SYOA 2YXHA 3ZRWB 1K73O 1SA0A 2Q7GA 1YJNV 5GAHP 4M3UA 4JAUA 1A5VA 4DV6O 1NR1A 5CZ1A 1CXZB 3SK3A 3TAFA 3CCEN 3M6GA 4ISGA 3FGUA 5LA6B 4DR4B 1O13A 3S9HA 2O8FB 1VSEA 4O4IA 3LM9A 3JXUA 4B1YB 2OIEA 5IYCO 1RTJA 4DR5K 3TGUH 1WN7A 1S6PA 3GE1A 1UJWB 4V19S 3VEZA 4JAVA 1AR94 4ZOLA 4KRFA 1Y76A 5A2QO 5C2TA 3NGYA 1RT1A 3OR6C 3QERA 3K9SA 4IIJB 3OYFA 2RMU4 4BRPA 2ZGYA 4QAGA 3BP8A 4X1IB 2ZCEA 2CGOA 2KKWA 4DU4A 1K5MD 3IJ4A 2E20A 2W41A 2Z1HA 2Q0AA 5E84A 1H2LA 1JLCA 5HBMA 2A42A 5BR8B 2G8UA 1MSDA 3ZHSA 1QZ6A 1NJWA 1J9AA 2O4IA 4HUEA 4W5TA 1KAXA 1IBKK 4U3FH 4YSYA 1M5IA 2IM9A 5CHIA 2WLLB 2P4VA 3NVKA 4X1YB 1EN6A 2E2OA 2IVOA 1M90O 3BAAA 4GLXA 4MW3A 2QWQA 5EBWC 4CJLA 4X62B 1QVFU 2IAJA 5BREA 2EIKC 3E22B 1S5JA 5KA6A 2X6NA 5AQWA 1RUD4 1XBLA 4FJ9A 2HVKC 3MEDA 4K0KK 1YITV 4JYAK 1BL8A 4X64K 2V4DA 2D3OW 2HHVA 4CHZA 2A06H 2MK3A 3NH2A 3QNNA 5IWAK 5FLXN 3BY5A 2HNDA 1Y74A 4UCUA 3U11A 4JKHA 3E01A 3ZT3A 2Q0OC 4B3TB 1F21A 2QM1A 4NO7A 3LDLA 1IXBA 1VF5B 4FW2A 2WU2A 1Y67A 2V7QG 1J5EO 3G71V
chains in the Genus database with same CATH topology
4Q5VA 4CGFA 2ATQA 3C6TA 4AQYB 1S6QA 4FJHA 4I4TB 2VG7A 3HKCB 3TR8A 5GONA 1JLBA 3UIQA 1RBSA 4FLWA 4GMJB 3VQYA 4DU3A 5JVDB 2HHXA 4CH3A 4C8OA 1XMOB 1HNWB 4L8RB 4B3SB 3THVA 4FJKA 4K8ZA 1B92A 1FKPA 3KK2A 3LNNA 3D0PA 2F66C 4FLUA 4LFBB 1QQCA 3V9SA 4YY3B 3OYGA 3SGIA 3JAWA 3SI6A 3OYLA 3V9WA 4CEOA 3PX0A 2OYQA 1T8EA 3HKEB 4OPKA 2GBZA 4AH9A 1TUBB 1RDAA 4O0IA 3HKDA 4UQGA 3SQ2A 4GKJB 2F8SA 1HPZA 3I0RA 1WSIA 1BHLA 1DGSA 3HP6A 3M8PA 2G8KA 4Z4CA 3PUFA 4DR1B 1A5XA 1ZBLA 1IKYA 4O4JA 3SR2C 3P83D 5IYZB 4PI0A 1TVKA 1XC9A 3OYMA 4NYNA 3VQQA 2ZIMA 4DTOA 4N76A 4LSNA 2IDOA 1LWEA 3HYFA 3OS0A 1C1AA 2B6AA 2VG5A 3VQEA 5FROA 2HW3A 4FJGA 4DSKA 3CSXA 4M3ZA 1XNQB 4JS5A 1J53A 3HPHA 4FFBB 3OJSA 4IFVA 3AO1A 4LH6A 3CQ8A 1G6UA 4TUYA 4E7LA 4GKKB 2JVDA 1Q9XA 1HMVA 3RYCB 3LP1A 4FLVA 1EXQA 3T1HB 2G8HA 3L2QA 5KGXA 2WONA 4KB0A 4WE1A 4DFJA 1FFXB 4CEZA 4C8MA 3RMAA 4Z4FA 1D5AA 4FM0A 4DS4A 1ASUA 3JALB 1B9FA 4X20A 1D9DA 4QCLA 3V9UA 2W42A 5K1XA 4CF1A 2HHHB 3WNHA 4ELVA 3ZT1A 2YIBA 3RYHB 5HP1A 1C0TA 4CJEA 4OVLA 2DTUA 4ZTJA 3HXMA 3QESA 4M45A 4TOIA 1RCHA 4X1KA 4FLXA 4CK2A 2OZSA 4JI1B 4ZHRA 1KLNA 4YJ2A 4J2DA 1KRPA 3TI0A 1TAUA 2BTQB 4HNAB 3I0SA 4EEQA 3HL8A 2G8IA 4CHYA 4E89A 5HRSA 3VQBA 2D5RA 1XHZA 3QEXA 1TGOA 4M3YA 1JLQA 2HHTA 2ZIOA 4DSIA 1SKVA 2E4LA 4CIFA 1KTQA 1T03A 2D0AA 3NGIA 3OVNA 3LZIA 4BDZA 4K8XA 4FVMA 1WSJA 3JARB 4CH4A 2HHQA 4B08A 1NK5A 4MQ3A 1TK5A 4Z0UA 4DR5B 5CYMA 1HYZA 3PV8A 2RJZA 3IG1A 1IKWA 4M3RA 4CC5A 3LAMA 5JQGB 4X1IA 1REVA 5FNVB 4F2SA 1VSKA 3AA2A 4ID1A 3BA9A 4H4OA 4ICLA 4JI5B 3OYEA 4LR3A 2AJQA 1JFFA 4CS2A 4CS3A 3TABA 4AHVA 4X1YA 2Q3SA 5EZYA 3VQPA 3PY8A 2WOMA 3E22A 4O5BA 3SQ0A 4OLBA 5LXTB 5I3UA 4DSLA 4O4LB 3SJCC 4CHQA 1U04A 3RRHA 3WB2A 4FJNA 4DTRA 3JAKB 4FZXC 3K59A 3DI6A 3MXJA 3QLHA 4OKKA 2ZNJA 4DV1B 3N2GA 5LP6C 4M3XA 3MECA 3B6OA 4DV0B 4DV4B 1A5WA 4FJMA 3HKCA 5K1PA 2PTMA 1UWBA 2KQ2A 4RG8A 1RBVA 4KHWA 4CFAA 3G10A 4FW1A 4YJ3B 4HCBA 1XI1A 4DR3B 3RYIA 3DLHA 1HNIA 4N56A 2PZSA 4UCOA 3QETA 5KI6A 4AHSA 4OPJA 4CJUA 1VSJA 4CJTA 3KJVA 5LP6B 3L3VA 2UXCB 3L3UA 2QM4A 4O4GA 1TA8A 4DUYB 1KFSA 2Q7EA 1TK8A 4LF8B 3P1GA 3NGZA 3NF9A 1S1UA 3HKEA 5IJ9A 2PYLA 1JL2A 1C6VA 4DV6B 1U45A 3LWLA 3RYFA 3A2FA 4Q6GA 1RNHA 4DV5B 2OPSA 4KREA 4DTXA 3I8DA 4JI6B 4IG0A 1CLQA 1NOYA 2BANA 4F3TA 3DM2A 1W9HA 3OYKA 3OTOB 1EKEA 4LH7A 2YNHA 1QTMA 5JCOC 3C94A 3RR7A 4CFDA 5FRNA 3T3FA 1WSGA 1H2SB 5FPOA 3QTCA 2GV9A 1RBUA 3S3OA 1WLJA 2HHWA 3KK3A 2A1SA 1U47A 3AVMA 1J5EB 1NJXA 4ZHQB 1BIZA 4I55B 4JRPA 3BPZA 3SQ4A 3MXIA 4ZI7A 2KTQA 4J2AA 2OA8A 4FFBA 4E7IA 4DQIA 1HNZB 2X6SA 1KVAA 3DOKA 2RF2A 3HPGA 2A1RA 3K5LA 3TARA 4IHJB 4NXNB 3U6FA 1YT3A 2PUSA 3KLEA 4B3MB 4DTJA 3LALA 3HM9A 1DTQA 5I42A 4XIUA 2DFEA 4CGIA 4W5NA 4BACA 3IRXA 3JSLA 4O2AB 4W5OA 3BDPA 1Q8IA 4CC6A 3DYAA 4B9UA 1FFXA 4B3RB 2UUBB 4NCBA 4DWIA 1C1CA 4YHHB 1GOAA 4HUGA 3JALA 3DSQA 4FK2A 5J2MA 3OYBA 4CCHA 1I94B 1KLMA 3HK2A 4F4KA 3EZ5A 3RYHA 3V1QA 1KFDA 4HHTA 2KFZA 1KSPA 4DQSA 3AVCA 2EX3A 5KX5B 3LP2A 1DLOA 1TL1A 1UAXA 2F4VB 1ASWA 4DSJA 3SJAC 4DQQA 5KHIA 1TKZA 3SUOA 1TKTA 4CERA 1DTTA 3CFPA 1QS4A 3KD1E 2X78A 3JATB 2HEPA 3O3FA 4DFMA 4FJIA 5CY4A 4KHNA 1LWFA 4FK4A 5KHKA 4X65B 3ISNC 2R70A 4EB6B 1TK0A 3TANA 2BTQA 2KFNA 5HRNA 1TAEA 1KVCA 5FDLA 1N6QA 4FLZA 3LZJA 3HO1A 3VQXA 4MFBA 4YFUA 3RMBA 3HVRA 1RILA 2QXFA 3KLGA 4OLAA 1SKRA 3QINA 4DLGA 4H4MA 4TQFA 3CM5A 2E6MA 1FKOA 1M4UA 4DRXB 3V9XA 5JS1A 3ZSQA 4DTSA 2YXLA 4DQPA 1Z5VA 1S9GA 3L2RA 1XHXA 2E5LB 3VQ5A 3FI7A 1TVRA 5KTQA 2HMIA 3UT5B 3LWMA 4KI4A 4DFPA 3SUNA 3TWHA 4TV9B 1D8YA 4AHTA 4FJXA 4LFAB 2XY7A 3NCIA 4JV5B 3NE6A 1SV5A 3AVHA 3QEIA 3SCXA 4KTQA 4CGGA 3SV3A 4CJ4A 5LXTA 4O4LA 4EP5A 3VQDA 3AO5A 1VSLA 4DMNA 4KKOA 1LAVA 1YEWA 5JH7B 2ZINA 1ZYQA 5HROA 1ASVA 3AO3A 1WNSA 1LW2A 3SYZA 5KHJA 5J2TB 3SUPA 3OYIA 1Q5OA 5C8YB 3AVBA 5CZ2A 4LF7B 1VSDA 2OZMA 4WBNB 1QE1A 5SZTA 1YVUA 5CB4B 4YJ3A 2YV0X 4DSFA 1RTDA 4DF8A 4E1NA 2YIAA 4CHPA 2XHBA 5IJ0A 2Z1IA 5LP6A 4EP4A 3EYZA 5J2UA 1SL2A 4CK1A 5DMRA 2E3CA 2ZM6B 3KLIA 4TSXA 1RDBA 3SPYA 3ZT2A 2ETJA 1S1WA 4E1MA 3KTQA 4YNQA 5D5PA 3ZS8C 2Z1GA 1L3UA 1RT4A 4E7JA 2FC0A 4ELUA 2QKKA 3ETQA 4EZ9A 3NF6A 1UA1A 4OKEA 4ZOLB 3LDSA 3JASB 3RR8A 4KPYA 3OTFA 1JL1A 4I2PA 4D7TA 4CF2A 3JSNA 1KMIZ 4EFBA 3SNNA 4ELTA 4E7KA 2KW4A 1HW7A 3NH1A 3OYAA 4BDYA 1BCMA 4Y1DA 3N2KB 2DFHA 1S1VA 1TKDA 5EYPA 4PWDA 2P5OA 1TAQA 1C1BA 3AA4A 4JI7B 4NCAA 1VSHA 4FJ5A 2OWOA 1S9EA 2R7FA 1NK0A 5CA1B 1Y97A 4F8RA 5JJJB 2UU9B 4KO0A 3NHGA 1QSYA 3KK1A 3AO4A 3ZSYA 1IG9A 3PO4A 4FM2A 3RGBA 5JCOA 2PYJA 4RW7A 3TAEA 3PX6A 2RPIA 1T7PA 4E3SA 2HNZA 3K2PA 4F6RA 5HRRA 1ZAUA 3S3NA 4U3JA 2P5GA 1L5UA 4IHJA 4FXDA 3UQ8A 1B9DA 3KKRA 3V9ZA 3K5MA 5LA6A 3VQ8A 3MEEA 2UUAB 4L8JA 3L2UA 4OX9B 4Z4IA 3PX4A 2BGGA 5KRTA 1Q43A 4O2AA 3U10A 1VRUA 1JLGA 3VQ7A 4IIJA 2Y1IA 3KLHA 3RTVA 4RW8A 4O0JA 3VA3A 4FJLA 1BIUA 3M8SA 1L3SA 5EIBC 5KHHA 3QG5A 3DRPA 2PY5A 3AVGA 4I7FA 2FBTA 5HRPA 5LYJB 1BQMA 4CK3A 4FCYA 1BISA 1HQUA 4AHUA 3MXMA 1N34B 3DLRA 1CXUA 3BA8A 4UCVA 3NBPA 1HNVA 4PY5A 5KX5A 1BCOA 4O4JB 5LMNB 4LFCB 3DRRA 4O55A 3OS2A 5LMUB 3L8BA 3BABA 1IH7A 4B9SA 1UOCA 1M93A 3JATA 2Q7HA 4DR2B 4EFEA 4I4TA 1JJOA 3KIOA 1NKBA 1RBRA 3V81A 5K14A 4EB6A 1YTAA 3DLEA 3S3MA 1WSFA 2HHUA 4NVPA 4JRQA 3OYNA 4J2EA 5EIBD 5JVDA 2P51A 3OS1A 5J1EA 4CEQA 1WPBA 4O4HB 5EU7A 1VSMA 2QK9A 1IKVA 2DFFA 1BGXT 4OGCA 5HLFA 3F73A 2YNFA 1X1PA 4F2RA 4GW6A 1JXEA 3ITHA 2XY5A 2D0CA 3OYCA 3ZT0A 1TKXA 3V1OA 3U3GA 3F9KA 4KFBA 1NK8A 3IAYA 1R0AA 4HTUA 3QIPA 1TUBA 2VWJA 4M42A 4IG3A 3NFAA 4W5QA 3UT5A 1VRTA 3OYJA 4UFZA 1N33B 2ZD1A 3CHXA 4LY7A 1WAJA 3LPTA 4E7HA 2VG6A 1RT6A 2YHBA 1Q9YA 3HT3A 3RMCA 2VWKA 5IYZA 1BI4B 4IFYA 1QSLA 2PGGA 1VF7A 2GUIA 1X4TA 3AVJA 4CEAA 3ZSZA 5JJNB 3HSTB 3ASMA 2PW9A 3CFRA 5JH7A 1X9WA 3CB2A 2JS5A 2P1JA 1B04A 4CF8A 4CIEA 3ZSXA 4FJJA 2BDPA 4BE1A 4JI0B 3V6DA 1GOCA 4CJRA 4LF5B 5C8YA 1FJGB 3O3HA 4Y1CA 5T7BA 1HQEA 3KLFA 4WBNA 4Z4HA 3VQ4A 5CB4A 4DTPA 4KHYA 1FK9A 4M3TA 4CJQA 4LNUB 4CFCA 1RDDA 4Z4EA 1T5EA 4KAZA 2O4GA 4DFKA 4Z4GA 3DLBA 3OY9A 4DV3B 4UCRA 3H08A 3RYCA 3CFOA 4W5RA 3JYTA 3O4QA 4N41A 1RTIA 2JLEA 4CEEA 3DLGA 3HPOA 3ZT4A 4BWMA 4C8KA 2X74A 2Y1JA 1O1WA 1U4BA 3BRCA 5LOVB 1P49A 4I9LA 1HJRA 1HYVA 1I7FA 3AVKA 3WNFA 4JLHA 4H8KA 1EETA 4ID5A 5BMVB 4CF9A 4N5SA 3MAQA 4QOZB 1HYSA 3JASA 3DOLA 4JI4B 3VQ9A 4PI2A 3AO2A 1TL3A 2HHSA 2YKMA 3VQAA 1FXXA 4B9LA 4CJWA 1NK6A 1RBTA 1JFFB 4O2BB 3RFRA 2HB5A 3SJJA 1LWCA 3N2KA 1CZ9A 5ITZB 2YNGA 1ZBHA 1JLEA 3DRSA 4DV2B 5EZYB 5FPRA 1VK0A 3LAKA 1U48A 4BWAA 3OYDA 1J5OA 1TV6A 3RWUA 5CA1A 2YI9A 1ITGA 2UXDB 3NAEA 4PA1A 2FBVA 2XY6A 4NXMB 4HNAA 2YI8A 4CGHA 3EY1A 1LAWA 3MEGA 1G15A 3N2GB 1SKSA 2G8FA 4C8LA 5KRSA 4BW9A 4D7SA 2HNYA 1LV5A 3V4IA 3RRGA 3CYMA 1WSHA 3LPUA 5E41A 2XY8A 1X9MA 3U0ZA 5DK5A 3SUQA 3L2WA 1Q3EA 2BTOA 4R5PA 3WNEA 1K6YA 3JARA 5C24A 4X66B 3M8QA