1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase
molecule keywords DNA polymerase
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
3ZSRA 2KW4A 3AO2A 3PV8A 1SL2A 2QKBA 1ZBLA 3O3FA 4M42A 3L3UA 1A5VA 5D3GA 4BDYA 2YHAA 1IO2A 3AVAA 1D9FA 2YNHA 4GVMA 5SZTA 1LWCA 3NGZA 5CYMA 4FK0A 5HRPA 1BIUA 4ZTFA 1HYZA 1LWFA 4IBNA 2WOMA 4Y1CA 4IFVA 2IC3A 3NGIA 3QO9A 3K5LA 4C8OA 3QINA 2BANA 3ZSOA 1X1PA 1S5JA 4OVLA 2ZE2A 4JLHA 3AO5A 2BE2A 3KLIA 4CJRA 1VRTA 2G8FA 4E3SA 1WN7A 1XI1A 2X78A 2XY8A 2O4IA 4CEAA 4CESA 3OYKA 4ELTA 3AA3A 4JS5A 4CK2A 1VSEA 2HB5A 3E01A 1T8EA 3PY8A 2HHQA 4DQPA 2P5GA 4CFDA 3V9WA 4CJ4A 4BWJA 5KI6A 1UA1A 1X9WA 4DSIA 3OYMA 4F3TA 4FYDA 5HLFA 3I0RA 3TAGA 4CEBA 3OYIA 4KTQA 4O0JA 3VQPA 4E7HA 3KIOA 4HHTA 4W5TA 1U45A 5EU7A 4DS4A 4BDPA 3HP9A 4DSJA 1EP4A 3V6DA 1K6YA 1BIZA 4DFMA 1RDAA 3TAQA 1KFDA 4OPKA 3AO1A 3P5JA 3OYNA 5J2MA 3SV4A 3L2WA 1O1WA 1VSLA 2HNDA 4CF1A 1TKTA 2IOCA 2RN2A 3ZT2A 2Y1JA 4DTUA 4KREA 3V1OA 4KHUA 4AHTA 4CIFA 3BDPA 3K57A 2EHGA 4DQRA 5FDLA 4FJHA 4DTNA 3OYEA 1D9DA 4CEZA 5CYQA 1A5XA 3VQ6A 3HPHA 4Q5VA 3SYZA 3PO5A 3AVHA 3SUOA 2KQ2A 1JXEA 4FJIA 3KLEA 4KRFA 4CEEA 1TAQA 2FBVA 3AVMA 3KKSA 3DOKA 3ULDA 1ZBIA 1YT3A 5HRRA 3AA4A 1RDDA 4I2PA 3MECA 1NKEA 3KD1E 1JL2A 3AA5X 4O44A 4CJFA 3KJVA 4Z4CA 4BACA 1TAUA 1SL0A 2P51A 4IG0A 3AVNA 1CLQA 1EETA 4B8AB 2DFFA 1DLOA 3SQ2A 3O3HA 1ASUA 1HNVA 1NK9A 4CFBA 4OLBA 4Z4EA 1U47A 1YTUA 2HHTA 3VQCA 1T05A 2D0AA 4DTRA 4FM0A 3AVIA 4H4OA 3MXIA 4B9VA 4BE2A 3NE6A 3KK2A 3RR8A 4B08A 3NF8A 1FKOA 1RT4A 4RW9A 5KRSA 1L5UA 3QNOA 4KI6A 1ZBFA 3DI6A 4E7LA 4AILC 1HNIA 1RT3A 3F9KA 4RW7A 3K5MA 3SV3A 2ATQA 4KB0A 3QNNA 1CZ9A 4CJUA 1S9GA 3HSTB 4R5PA 3K5NA 1Q8IA 1FK9A 4FM2A 4CEOA 4Z4FA 5HP1A 3FI7A 3LP3A 3ZT3A 1WSGA 3LZJA 3HL8A 1UWBA 1J53A 4QAGA 1RBVA 3LALA 4DTXA 4FJ5A 3C95A 1QE1A 4OLAA 4DLGA 4GMJB 1LAVA 1W0HA 4DS5A 4BE1A 4KPYA 1J5OA 4JRQA 1GOAA 3LZIA 4YNQA 2G8VA 4KO0A 3JYTA 4PY5A 1TVRA 3U6FA 1NJYA 3DLBA 1S1WA 3P83D 3IS9A 1J54A 3PX4A 1LW0A 4I2QA 2HHUA 1NK5A 2R7FA 1NK8A 3U3YA 4FZYA 4N5SA 3ITHA 3K2PA 2G8HA 2EX3A 4CK1A 3HO1A 2JLEA 4HTUA 1NOZA 3HM9A 1TK8A 3KLGA 2KFZA 1WSEA 2B4JA 5J2QA 1ITGA 3VQ5A 3AVCA 1EXQA 3AVLA 3HT3A 3SPYA 4CIEA 4HCBA 1KTQA 4CHOA 4CGJA 3NFAA 1JL1A 4DWIA 4E1MA 1C6VA 4LSLA 3V4IA 4LH4A 1QSLA 1KFSA 1EKEA 2KZMA 3AVBA 4M3UA 3AO4A 3BGRA 2ZQBA 3PO4A 2DFEA 3CM6A 3NH0A 1SKRA 3SUPA 4J2EA 1KRPA 4E7IA 1KLMA 3SCXA 3S3MA 4DSEA 1TL3A 3M8SA 4XIUA 4NCBA 4DSFA 2HHVA 4FLUA 1JKHA 1LWEA 1TKXA 1WLJA 2YHBA 4CJLA 4MFBA 4CJPA 1SL1A 4HCCA 3RMAA 1EX4A 3D45A 4NYNA 4B9MA 3C6TA 4OGCA 4E19A 2FBTA 3VQ8A 1KVAA 2D0BA 3B6OA 3IRXA 2HHSA 1W9HA 1Y97A 3CFRA 5J1EA 3ZT4A 1FXXA 1S9EA 4WE1A 4FJ7A 5C42A 3CQ8A 3OYCA 3ASMA 3LP2A 1WSFA 3LAKA 2LSNA 3LP0A 1G15A 4OGEA 4CF0A 4Z4HA 4AHRA 4DTPA 4DFJA 5I42A 1IKVA 2OYQA 2DY4A 4IDKA 3OYAA 4FJKA 5JS2A 4FJXA 1S1XA 1TL1A 1REVA 2PY5A 2KFNA 3SJJA 3ZSXA 2NUBA 4EZ6A 1HJRA 2OPPA 3OVNA 3SUNA 4B3OA 2PZSA 3ZT1A 4J2DA 2HHXA 1QHTA 3CM5A 3HPOA 3VQBA 3WNHA 4DLEA 2F96A 3O4NA 2P5OA 2VG7A 4DSKA 2QKKA 2E4LA 3T3FA 1BGXT 4B9LA 3OJSA 1NK7A 1RCHA 3NF7A 2A1RA 2QXFA 3QERA 4J2AA 3M8RA 3DLEA 3QEVA 1QS4A 1RT2A 2Z1JA 3JSMA 3DYAA 3QEPA 2YNIA 3LDSA 3KTQA 2OZSA 3VA0A 1U04A 1ZBUA 2B6AA 3T19A 1N5YA 4CF2A 3SUQA 4DTOA 4RW6A 3CFOA 3T1AA 2OPRA 3LANA 3ZSWA 2XY7A 1ZYQA 4RG8A 3KK3A 4CHZA 5C25A 3KK1A 5FROA 4CJVA 4DU1A 3SQ4A 4PQUA 3QIOA 1VSHA 3O4QA 2HVIA 1RDCA 4DF4A 4FJLA 2YKMA 4OPJA 3VQ7A 4KHNA 3KLFA 5FRMA 4G1QA 1SV5A 3TWHA 4B9SA 1RT1A 3IAYA 4DTJA 4K8ZA 4FW2A 1Q9XA 3HJFA 4H4MA 2D0CA 4FK4A 4OKKA 3HXMA 1F21A 4ELVA 1C1CA 3CFPA 3L3VA 2A1SA 4H8KA 2FC0A 4DQSA 3VQ4A 3V9UA 1XHZA 1U48A 4DMNA 4E0DA 3C94A 2D5RA 3OYDA 3TAFA 1QTMA 2IAJA 4CHNA 1TKDA 5FRNA 4B9TA 3AA2A 3VN5A 4KB1A 4Y1DA 1BI4A 2X6SA 3PX6A 1T7PA 3QEWA 4FM1A 4LY7A 3OJUA 3HVRA 1FKPA 4CEFA 5I3UA 1I3AA 1RTIA 4CJSA 4CGGA 1J9AA 1Z26A 2ZD1A 1RBTA 4AHSA 3L2RA 1VSJA 3LAMA 4W5RA 3EYZA 3RR7A 2B5JA 2RKIA 4HVJA 4M3WA 1S1VA 3LPTA 4N41A 4FJGA 3TR8A 5DK5A 1JLBA 5CY4A 1RBSA 3WNFA 4C8NA 1BCOA 4F3OA 1RBRA 1KLNA 4PUOA 2HHWA 2XRIA 1QQCA 1ASVA 4QOZB 1Q9YA 1BL3A 3FFIA 3IG1A 4FLWA 3L2VA 1DTTA 3NCIA 3VA3A 3MAQA 3V9XA 3LWLA 1U49A 3OS0A 3TABA 2IGIA 1T03A 3SQ1A 4F2RA 2YV0X 1BCMA 1JXBA 1SUQA 3HP6A 4CJTA 3LWMA 5J2PA 1XC9A 4FJ9A 1D5AA 1WSIA 3ZSQA 4FJNA 2KZZA 4C8LA 3VQEA 3RRGA 3B6PA 2I5JA 3A2FA 3DLRA 1WSHA 1WAFA 4HUFA 3AVGA 1JLFA 3C6UA 4CJEA 4CJKA 4OKJA 4FLVA 3HPGA 1RNHA 4RW4A 3NAEA 1XHXA 3NF6A 3DLGA 4B8CA 3QESA 2OA8A 3OS2A 2XO7A 3MEEA 4FJ8A 4CEDA 1IKXA 1U4BA 4FW1A 1BHLA 2E6MA 3AVJA 3QIPA 1I39A 3OYGA 4FVMA 4CIGA 4KHQA 2DFHA 1RT5A 3V9ZA 1JLAA 1YVUA 4O55A 4E1NA 3ZSVA 5J2NA 2BGGA 3ZT0A 1VK0A 4ZTJA 1RT7A 3P1GA 1TK0A 3MXMA 4CGDA 1VSDA 1UA0A 4EP5A 1X9MA 1RTHA 4CCHA 4M3ZA 4FXDA 4O0IA 3RMCA 3ISNC 4CE9A 4W5OA 2Q3SA 3L2QA 4E89A 3QETA 1NK0A 2VWJA 4M3YA 1RT6A 4I7FA 4ZHRA 3S9HA 3S3NA 4FJMA 4NCAA 1HPZA 4UQGA 4I9QA 4LSNA 4DG1A 1BI4B 1JLCA 2HVHA 2DTUA 3V1RA 4DFPA 3V1QA 3HYFA 4OKEA 1B92A 1WSJA 4EP4A 1KCFA 2YNGA 4KV8A 3F73A 4DF8A 3AO3A 3TI0A 1BQNA 1HQEA 1HYVA 3AVKA 2OPSA 2VWKA 1S1UA 2ETJA 1NKBA 1TGOA 1NK4A 3K59A 4CERA 1GOCA 4PWDA 5CZ2A 3SI6A 4C8KA 4CHPA 5HRNA 4CJWA 2Z1HA 1WAJA 4ID5A 4N56A 2W42A 2WONA 4IG3A 3PX0A 4IFYA 3OY9A 3D0PA 4B9NA 4M3TA 2QK9A 3DM2A 3DOLA 4O5BA 3I0SA 1X9SA 2FBXA 3KD5E 5JS1A 4LD0A 4J2BA 5DMRA 4E7KA 4ICLA 4N76A 2Y1IA 4F8RA 3K5OA 2RPIA 1RDBA 4AH9A 4JS4A 4ID1A 3SNNA 3NBPA 4KFBA 4DQQA 3ZCMA 3OYLA 3DMJA 4GW6A 5HBMA 1VSMA 4Z4GA 1SKSA 4FK2A 2PYLA 4FLYA 4M3XA 3V9SA 3RWUA 3PUFA 5T7BA 3DLHA 3L2UA 3SZ2A 2BDPA 4CECA 2F8SA 3S3OA 3MEDA 4I9LA 4M3RA 4HUGA 4FJJA 4AHVA 4FLXA 3G10A 4CJ3A 5KGWA 1SKWA 1RTDA 5SWMA 1JLEA 3TAPA 4W5NA 1S1TA 3OS1A 1TK5A 2G8IA 2HNYA 4CF9A 1NJWA 4E7JA 3DRSA 1IG9A 2X6NA 4DU4A 3M8QA 4DTSA 3U3GA 1Z25A 2OZMA 2R7YA 4CK3A 4DTMA 1VSKA 4CGIA 1C1AA 2ITGA 1HRHA 4NCGA 3ZSZA 1L3TA 4F2SA 2YKNA 1VRUA 2OPQA 4FCYA 1S6PA 1NK6A 3I8DA 1QSSA 1B9DA 4F4KA 1A5WA 4CF8A 3NH2A 4DSLA 3EY1A 1LAWA 2HNZA 4OJRA 3OYFA 4DQIA 1MU2A 1WNSA 4FZZA 1HYSA 1RBUA 3OYHA 4KHWA 3M8PA 3DLKA 1ASWA 5KRTA 1UAXA 5HRSA 3THVA 4Q0BA 1IH7A 2G8KA 3H08A 3NHGA 4CGHA 2IDOA 3O3GA 3KLHA 1N6QA 5C24A 1KSPA 4CHQA 4EZ9A 3EZ5A 3NDKA 2G8UA 4NYFA 1C0TA 2VG5A 4Z4IA 2VG6A 1BISA 1XWLA 4FLTA 4JRPA 1RILA 1CZBA 3SQ0A 4CGFA 3RTVA 4Z0UA 2YNFA 4DFKA 4IKFA 3VQDA 4BWMA 1NKCA 4O4GA 1KVBA 3NF9A 2XY6A 4QCLA 4CJQA 2Z1GA 1VSFA 4LH5A 1D8YA 4KI4A 3HK2A 2XHBA 5K14A 4KTZA 4DU3A 4CFCA 2G8WA 3QEXA 4CHYA 3MXJA 2F8TA 4C8MA 5KTQA 3V81A 1TKZA 4K8XA 4L8RB 4FZXC 4TSXA 3TARA 1GOBA 3RMBA 3UIQA 1NJZA 3MEGA 4M45A 4CFAA 2JGUA 1C0MA 2O4GA 3OYBA 5HROA 3TANA 1NJXA 4KHSA 1L3VA 1UOCA 1LV5A 3WNEA 1QSYA 1JLQA 2HMIA 3DRPA 1CXQA 2GBZA 4AHUA 3L8BA 1B9FA 2AJQA 1IKYA 1JLGA 3LP1A 1HQUA 4MQ3A 2RF2A 4W5QA 1KVCA 3NH1A 3RMDA 1R0AA 1L3SA 3WNGA 4FLZA 3AV9A 1BQMA 2IS3A 3QLHA 2GUIA 4BE0A 1CXUA 4B9UA 3KKRA 3ZSYA 2E6LA 2KTQA 3CG7A 1C0UA 3HVTA 3QEIA 2X74A 4N47A 2FBYA 3RRHA 4KTWA 1RTJA 2HW3A 4ELUA 4KKOA 1L3UA 3NGYA 3VQAA 2PW9A 3ALYA 1IKWA 1TV6A 4KHYA 1NOYA 2P1JA 1HMVA 1LW2A 1S6QA 3DRRA 2PYJA 5E41A 4KAZA 4YFUA 3AVFA 5KGXA 3TAEA 1VSIA 3K58A 1DTQA 2GV9A 3LPUA 3OYJA 3SPZA 1ZBHA 3CYMA 4M41A 4RW8A 3VQQA 3G0ZA 4PA1A 4CJ5A 1YTAA 4CEQA 3TAMA 4BDZA 4AHCA 1C1BA 2Z1IA 5CZ1A 4HUEA 3VQ9A 2XY5A
chains in the Genus database with same CATH superfamily
1W0KG 4HWIA 2IH1C 3STLC 3PV8A 3HR0A 1MQTD 4MW3A 3T2MA 4FSVA 1SL2A 1K9MO 3ABLB 1NGFA 2XAFA 4I50B 3CRAA 4BAYA 2YHAA 1IO2A 4BDYA 3UE5A 1LWCA 5CYMA 2H88A 2A6AA 2ZJQL 5EBWC 2C2AA 1KUQA 2F43G 4IHJB 1B3QA 4X64K 4X66K 5EXWA 4CW7B 3QINA 3VMFB 1IG8A 3JXUA 3CWBH 2R9RB 3OTFA 1X1PA 1YIJN 3KLIA 2BE2A 2CK3G 5AG2A 1YF2A 3M8AA 1KB9F 4ILJA 3CQXA 1LCUA 1M90O 5A9GA 3DC5A 2X5ID 5LMUO 1AROP 3AA3A 4KHPK 1F23A 1QNMA 3S3XA 4GV9A 4CK2A 3CCLV 2HHQA 1Z05A 1OH8A 3IUCA 2P5GA 1KP2A 3OMNB 3IDHA 3JD3A 2DWDC 5E79Z 1AI7A 3ABLC 1RUC4 4U7NA 3N2KA 1P8ZA 4LNUB 3CX5F 3I0RA 5BY1A 3ID8A 3VQPA 5IYBO 2O8EB 1VHXA 3FYEB 5BRHA 1HNXK 3AEFA 2WLNA 1YVNA 3H1HH 2ARHA 1RDUA 3K9KA 4A5BA 3HP9A 4DSJA 4DUYB 2P9PB 4JD2A 3TAQA 1PIV4 3AO1A 3P5JA 4HYOA 3OYNA 4LFAB 3R3LA 5HL7L 1H1VA 1PL0A 1ASJ4 2O8FA 1JVMA 1XMQB 2NRHA 3T1YK 1NTKH 3N27A 2UYTA 4CIFA 3K57A 2P9NB 3QMLA 4DQRA 5FDLA 3FX7A 1R6KA 1VQ8V 2P9SB 4YY3K 1OKJA 2UUBB 4FJIA 3OGIB 1G4YB 4KRFA 1TAQA 3I55V 1NWKA 2FBVA 3DOKA 1ZBIA 5B1AC 1YT3A 4K43A 4BY9C 4I2PA 1XEQA 3N2KB 1WA8A 1NKEA 1TAUA 2UU9B 2AZ2A 1GLCG 2O8CB 4JPRA 1ASUA 1NK9A 2QE7G 5J2TA 5EBMC 3VQCA 1T05A 3FB8C 1R3JC 3LNNA 2JS3A 4FM0A 1IURA 3QVNA 1YHQN 4X8AA 3T1HB 4N23A 3KK2A 1M1KW 3CC4N 1NH2D 2F66C 4LFCB 4JTCB 5D5QA 1FKOA 1CEZA 4RW9A 4JI4B 3SPCA 1XQSC 5KRSA 3SPJA 5M1NA 5BR8B 2D1KA 3FKSG 4LF5K 3G80A 1HNIA 4O4HB 1F7YA 1GLJO 1KP3A 1ZSPA 3QNNA 2FTKA 1S9GA 1SQQH 4JKGA 3ZETA 1FK9A 3SYQA 3CCQN 4FM2A 3ABKC 5HP1A 2HOEA 3LP3A 3ZT3A 1WPBA 3HL8A 4QAGA 1BDGA 2E1ZA 2EWSA 2EBOA 1DGSA 1W0HA 4KPYA 3O9TA 2ZE5A 3ABMC 1J5OA 4JRQA 2G8VA 4YNQA 4PY5A 3JYTA 4PKGA 4TT3G 3U6FA 1S1WA 3DWLA 1OCZC 1SZTA 2H3OA 3JS6A 4I2QA 1NMNA 5GAHP 2HSTA 4OX9K 4O2AA 2JGDA 1G8MA 1H38A 3KWIA 3ULEA 3T1YB 3E9LA 3K2PA 4O2BA 3RWRD 1XREA 4HTUA 1X3NA 1Q86O 1WSEA 2B4JA 1M90W 5J2QA 1ITGA 5DM6V 4DR5O 4JYAB 3AVCA 2IW5A 2FB5A 3P3NA 5LP6A 5BN9A 4QS7A 1JA8A 5AQKA 3OM3B 4DR2O 4CGJA 1ORQC 4G28B 1JL1A 5EOYA 2KQXA 1YEWA 1D2DA 1C6VA 4LSLA 1QSLA 4JAAA 2P22C 2KZMA 3TTDA 2E76B 4PL8A 4DR7O 3B8NA 3ZRWA 3P39A 2QTOA 3H9VA 1SKRA 1VQ8N 3UKMA 4DXWA 2ZKOA 4B3RB 2CGLA 3DXMB 2WUSA 4E7IA 4KFMA 1GN4A 1XDCA 4DV6O 2IH3C 4DSEA 4YHHB 3D2FA 3M8SA 1QVFU 3B8MA 2P4KA 2HHVA 2L6LA 5F1XA 4X20B 1KD1W 3D45A 1KF6A 3CETA 4H44B 2CGKA 4H0YB 4JI0K 3ZHRA 4H13B 3VQ8A 1Z6RA 3FAVA 3ML0A 3ZCCA 5KHHA 4X66B 1R73A 4DR3O 4JI5B 5LOVB 2ZGYA 3SBTA 1Y97A 1NLVA 3CFRA 2VCPA 1FXXA 1QHAA 2ZXWC 3CC4V 4NO7A 5C42A 4H33A 3OYCA 3CQ8A 1QLNA 1Q82O 3ASMA 4YOUA 1SZ2A 2WPDG 3LP0A 2XOKG 1SZXA 2EILC 3H1IH 4DTPA 4DFJA 3VEYA 3E35A 5I42A 1YVWA 2OYQA 1FXVA 3ETQA 2ADPA 5JS2A 4FJXA 3GQHA 2QR4A 4LF8K 2RQ6A 5LMUB 3ZSXA 1NZ6A 4CZIA 2YHWA 4B3OA 4EHUA 1HR0K 2PZSA 1I5XA 3E8GA 1F4MA 2HBLA 1QHTA 1WJZA 4GVEA 1EWQA 3RVYA 3WXKA 4DR2K 2QWPA 2OWOA 3NVMA 3VQBA 3BABA 1IJJA 2F96A 1K8KB 1M57B 3JD0A 2P5OA 3DXKB 1K34A 3EO3A 4DLEA 1MA9B 4DSKA 4B1XB 5HFMA 1OCCB 3ICXA 3TTFA 5AJ3K 1YCIA 4B9LA 3OJSA 4PDWD 2V7YA 1L8DA 2ILMA 1JJ2M 2Z5UA 2PI5A 3QEVA 2A3ZA 3ABVA 4OX9O 2OZSA 3QB0A 1ZC6A 4QGPA 1DKGD 4WQ4C 4JI3K 2Y0IA 5LA6A 3GB7C 1BUPA 1N5YA 3A0HZ 2A3QA 3K03A 4DV4O 1SC5B 3CFOA 3JYCA 2CH6A 3T1AA 3T4DA 3KK3A 3EKSA 1EWRA 1R1BA 5C25A 3CCRN 1H8TD 1W2BM 2VGNA 2QWRA 3ZLJA 1VSHA 4DR5B 4FJLA 4KHNA 4OPJA 3JD74 3KLFA 3TCUA 2YICA 3CMEV 1RT1A 4JI6K 3ETEA 4DTJA 1E3MA 3P4IA 2WAMA 4ZBMA 3HPLC 5GIOA 4FK4A 2YXLA 3HXMA 4YDUC 3HKDB 1F21A 4MVZA 3HOSA 3CFPA 3THWA 3OA9A 1GM8A 4EHTA 3AEEA 2RN9A 2WLIB 5JJEB 4DV0O 1FYJA 2FC0A 2P9KB 4DQSA 2YC0A 2WU5A 4DMNA 2B9ZA 5EC1C 3C94A 2UXBK 1QTMA 1NGAA 2EULA 2BSKB 1SQGA 1V54C 4B9TA 5FRNA 3P38A 3BA8A 2W6KA 1EV14 5EYPA 2X6SA 4JI3B 3LL3A 1T5EA 2QWNB 3QEWA 5IT9O 4E1JA 1GLFO 1IBLB 4Q20A 5AQJA 4CGGA 3OEEG 1J9AA 4AHSA 2ZD1A 3L2RA 3LAMA 5LXTB 2EIMB 3NXSA 4I5SA 4D7TA 1TYQA 1HWYA 5CY4A 4F3OA 3RR8A 4C8NA 1Q3EA 5GONB 2XRIA 4IZ9A 4KUMA 5CA0B 4DR2B 4X20A 4FLWA 3V9XA 4MVUA 3O9QA 2FSKA 3CC2N 3SQ1A 1SA0B 4JTAB 2YV0X 5IYCO 4CJTA 1VQ6V 1WSIA 3WQTA 4YORA 4DV1B 3RRGA 3K0DA 4PKHA 3WG7B 5ITZA 4JKBA 1AJPA 4OKJA 4X1IB 2QTSA 3ASOB 3QESA 4JYBA 3APOA 4TQDA 4PJ0Z 1SAZA 4CH4A 5J2UB 4FW1A 2E6MA 4H5WA 1NS1A 3SBGA 1Q81O 1NBWA 5EIBD 2YEVA 5J2NA 1K5SA 2BGGA 4UCRA 5LGNA 1HX1A 4WF9L 3L71H 1VRH4 5LXTA 1KQSM 4KXRA 1LOTB 4M3ZA 1RTHA 3EEQA 2Q97A 3N4QA 5H2FZ 3THYA 4YTMA 3WB0A 1VQON 4W5OA 1NK0A 3VF6A 2ITDC 4BRFA 1BA1A 1EN6A 4M3YA 3ZX6A 3S9HA 4FJCC 5AQPA 3IC7A 4I4TA 4I9QA 3KKYA 4UVBA 1JLCA 1AR94 1FXKC 4ASUG 2FF6A 3ZHQA 5CBFA 3CJ7A 3GE1A 2O8BA 3HYFA 3F73A 1YJNN 2EIMC 5AQIA 1MDUB 1HQEA 1XMOB 3AVKA 2OPSA 1XUQA 3ENOA 1S1UA 2ZE6A 1S3JA 4PA3A 1NKBA 2P7TC 1C0FA 4FPBA 4OPAA 3O8MA 4PWDA 2DE0X 4CHPA 5AQUA 4BREA 4CJWA 1WAJA 4ID5A 3THOA 4JYAK 2Q0OC 4JASA 2QK9A 3VTIA 3ZRSA 2UUCB 2D0OA 3OGCC 2FBXA 3I0SA 3KD5E 1P4RA 4R50A 1MA1A 1H2NA 5FLXO 4ICLA 2Y1IA 3K5OA 3ZETB 1OCRB 4JS4A 3MN9A 3J81N 3A8YA 2W0XA 3O9OA 4O4LB 1XQ8A 3HKBA 2VQEB 5HBMA 1VQMN 2I7PA 2BOBC 4M3XA 4J7ZA 1JCGA 4O4JA 5AR0A 3TU5A 3ZS8C 1OCOC 2QWQB 3K3WA 4BGAA 3S3OA 2RDCA 3CRMA 4I9LA 4U3FH 4FJJA 2Q9LA 4GKKO 3G10A 5KGWA 3THXB 1SA0A 1X3MA 2N04A 1I08A 4CZZA 2UUCO 2HNYA 4CF9A 1BCCH 3CCVV 1XMQO 4R79A 3FYIB 4H0PA 2A40A 1AP6A 5B1OA 1TA8A 5ITZB 4JNEA 1QVFM 2UXXA 4G2KA 4LBEC 4CGIA 1N36O 1U6ZA 4FFBB 4JI8B 1L3TA 3ZN0A 5K1PA 4AM7A 3IFXA 2YKNA 2UXBB 4GT1A 3JD4A 4DR1B 2OPQA 4IOAL 1IBMK 3SJCC 1NK6A 2UUBK 4F4KA 1VARA 5DN6G 1B9DA 1A5WA 5H9CA 5C2TA 1LAWA 4OJRA 1HYSA 3OYHA 3SFDA 1OCRC 1AR64 2OCEA 1RMU4 2YUAA 4MVRA 1YAGA 1OCCC 2JEUA 3L9DA 3O08A 4WYBA 3HSCA 2RJZA 3EXAA 2IDOA 3KLHA 2UU9K 2E8AA 5C24A 4Q4Y4 4YDUA 1AP5A 3EZ5A 5FNVA 2P4VA 1C0TA 4Z4IA 2F9TA 3A5NC 3J80O 4LFAK 1RILA 4U3JB 1DLBA 2K1EA 2YNFA 4DFKA 3FFQA 1GLBG 4FWNA 1KMIZ 3OW2M 1DTOA 1VSFA 3L0QA 4B3MK 1X4TA 1Q90D 5K14A 2EILB 2ZINA 2AHZA 3IFRA 2F8TA 2N74A 4C8MA 3S3WA 1YJWV 4K8XA 4L8RB 2ODMA 4FZXC 1RDWX 4YJ3B 4TSXA 3O5BA 3TARA 1GOBA 3JCUZ 3RMBA 1L0NH 5AZIA 4CFAA 4IFEA 3HKEA 1O9HA 3OHRA 5BRDA 5HROA 4DV1O 1LV5A 3WNEA 1QSYA 1S0VA 3CJ9A 3DRPA 1A32A 1WB8A 4AHUA 5FL7G 3L8BA 1YF5L 4W5QA 2NZTA 4FWPA 3NH1A 2DOSA 1QLEC 1H2SB 5FPNA 2YXYA 2ZCEA 1HR0B 1BQMA 2HJDA 2PTMA 2GUIA 2IS3A 3IMXA 4FOIA 5AQYA 1LUWA 4B1WB 2E6LA 4LP8A 3CG7A 1C0UA 3C65A 5C2DA 1VF7A 5AQFA 1R094 4O8UA 3AG2B 4KTWA 3AEIA 4DO2A 4GV3A 2XAGA 5M1PA 1GLEG 3VQAA 3PLAA 5BXZA 2OTLN 3VEXA 5IJ0A 4BR0A 1M93A 1RFYA 4UB6Z 3O6WA 2E2OA 2P1JA 1HMVA 1LW2A 4H5VA 4D6TH 2PYJA 2XASA 1I94K 4NXNB 1DT9A 5JLHA 3AGKA 3AVFA 4CS2A 2A7WA 4MTGA 5BPLA 4BR6A 3CCVN 3TAEA 1YJ9V 3CC7N 3LSSA 3OFNG 2XTAA 3EN9A 3I33A 3LPUA 3OYJA 5LMUK 4LF8B 1SQPH 3CXHF 1MWMA 1Y76A 1N33B 1F4NA 2AHYA 3TAMA 4BDZA 2W6IG 4AHCA 1IBKO 5ADXH 2J4RA 4UB8Z 4O4IA 4IHJA 3VQ9A 4BC4A 2HHHK 2KW4A 3KWGA 4PDLA 1S72N 5EZYB 3O3FA 2LW7A 2X0LA 2HVJC 5D3GA 1A5VA 4X65B 2F9WA 1D9FA 2UXBO 5AZJB 2O57A 4DB3A 2UU9O 5HRPA 4X1YB 3APQA 4ZTFA 1FFXA 4IBNA 4IFVA 3QO9A 2VS0A 1VBC4 2Q31A 1GM7A 4NLCA 1S5JA 5L3FA 5GTIZ 4JI0B 3AO5A 1V54B 3F5TA 4CJRA 2O4IA 3CB2A 1AJNA 1QR9A 1WN7A 2DWEC 2LO1A 3LDCA 3UO2A 4KP4A 5BMVB 4DK1A 1SS6A 2PAVA 3DAWA 4JKHA 4JI2K 3OYKA 2ZR2A 2JRIA 5IJ9B 1CZAN 3DXKA 1J95A 3RYCA 1U97A 3E01A 2HBMA 5ADXA 4OXSA 4CFDA 3V9WA 5KI6A 1YDXA 3E9OA 4JKEA 2LJ2A 5LYJA 2P9IB 2GUZA 3I5DA 3G6EV 4DV5B 3OYIA 4JI8K 4KTQA 5KQ8A 3ZEUB 4E7HA 1T6DA 4HHTA 4JI7K 1FXKB 1K97A 3SAHA 4JKCA 2QJ1A 4QPKA 4BDPA 3T1CA 3PSIA 1EP4A 1GO3F 3GDQA 4OPKA 3OTOO 4I50A 5J2MA 3SV4A 1GKFA 1O1WA 3CHWA 4CF1A 3L2WA 3CCRV 1IDSA 3DC6A 3ZT2A 1P7GA 1NTMH 2LW1A 3H6EA 1U96A 4AHTA 4CVNE 1E1QG 3QO5A 2E2QA 2QA4N 1QQNA 2NN4A 4JN4A 3BVOA 2QM1A 1FS0G 3GWKC 1D9DA 3VQ6A 2HF3A 2Z3YA 2B1GA 1VQ9N 1FXKA 2P9KA 3JAWB 4CEEA 3SUCA 3JCZA 1QLEB 1M57C 2UUCK 3ULDA 3CJCA 5HRRA 1RGIA 1RDDA 3AA4A 3MECA 4GKKK 2CTWA 3E8HA 4LCUC 1JL2A 4JI5O 3KJVA 4BACA 4Z4CA 1NGDA 4JZGA 1SL0A 3FZLA 1CLQA 2DYRC 3RFRA 1SESA 2DPNA 2Z0AA 1DLOA 2ZE7A 4CFBA 2HHTA 3BUZB 4A61A 2QKSA 1F51A 2W0FC 4DR3K 3ZYYX 3WXLA 2IVPA 3QFUA 4DTRA 4DR4B 5AQGA 3F7YC 3MXIA 4NYKA 4RO2A 5LHHA 4YTNA 1IXBA 2BE3A 2BH1A 3F7VC 2CE4A 4I9WA 5B66Z 1FFXB 2UUAB 4K0KB 3OMIB 1JOYA 3F9KA 3K5MA 4DR6B 3UB5A 2QEXN 4NXMB 3HSTB 1Q8IA 5JVDA 2FSNA 3C90A 3G71N 1QQMA 2FLOA 3LZJA 1UWBA 3VENA 4FJ5A 2FL4A 5LP6C 3C95A 3F2KA 1V9PA 3M3ZA 4DS5A 3EKUA 1VQ6N 4BE1A 4I6MA 3LZIA 5L3GA 4KO0A 2V7ZA 4H0TB 1FJGK 1TVRA 1NJYA 1OOPD 2OTJV 5LYJB 2P9IA 3P83D 2Y69C 4OX9B 5AQLA 1HKGA 3BF1A 3SYAA 1J54A 1LW0A 1KQSU 1HNXB 1X9JA 3PX4A 2HHUA 2R7FA 3ZRVA 3A5LC 3P3PA 2P9NA 4OPHA 4XH5A 1NK8A 3THYB 3ITHA 3LDQA 3G6BA 3O9RA 1PO14 1R084 3HO1A 4CK1A 4NKGB 2BTQB 4BC5A 3M1FA 1TK8A 3GQKA 5KX5B 4DR3B 4IOXA 4GUNA 1EXQA 3AVLA 3RYFB 1KTQA 1RSOB 2NNWA 4CHOA 4DV7B 3NFAA 2P6JA 5KX5A 4YXDA 3V4IA 1KFSA 1Y66A 5KQDA 3AO4A 1G1XB 2ZQBA 4YIOA 2QI2A 3LM9A 3ZHSA 1QU7A 2P06A 2CDYA 2P9LA 3N4PA 3HKCB 4JKAA 1KRPA 1TVKA 1YITN 1KLMA 3CMEN 4B3SO 4UCVA 3SLCA 5BPNA 3S3MA 4LF7K 1HW7A 4JYYA 4DR4K 4YT0A 3L6QA 1MG1A 1J5EK 4J11A 3EFFK 1IBLK 4I6MB 1K5QA 1NR7A 1K7DA 4JAXA 4MFBA 4ZKIA 1EX4A 3RMAA 1AR74 4NYNA 5KUMA 2ZM6O 5L3BA 3EE9A 4OGCA 4B9MA 4GNIA 1V4TA 2FBTA 4L8JA 5KHGA 3K9JA 4GKKB 4J80A 1EBOA 4JKGB 3IRXA 4B3TK 2DYSC 4Q4W4 4DW0A 2CH5A 3AECA 4P30A 1W9HA 3LM2A 2HKOA 1XNQB 3OT7A 3ZT4A 4WE1A 2BCCH 3RT3C 3ID6A 5CBHA 3LAKA 4TQFA 4CF0A 2F4VK 3CPEA 1ZXOA 4GKJK 3JALB 1KAXA 4IDKA 3OYAA 4FJKA 2D3OW 3BZKA 4DV4K 3TSPA 3MHHC 4B1VA 1FPOA 4YY3O 2QDOA 1WUAA 2QWMA 3JAMO 1REVA 5EY4A 2B5UA 2EINC 5C2FA 1ZLZA 3KCYA 3SUNA 3D36C 1VQ5N 4FL9A 1EFRG 4YSXA 3HPOA 3KCXA 3TXQA 1N34O 1THZA 1E1RG 3AG4C 4HZ3A 4J9YB 4QE7A 3A0BZ 3H3OB 1NK7A 2A1RA 4JI6O 4J2AA 3K0SA 1E4GT 1W97L 4BROA 1QS4A 2ETNA 2GSMB 3JSMA 3UO3A 3QEPA 2UXCK 3LDSA 3KTQA 4BVPA 1U04A 2B6AA 3CCMN 4LC1A 3T19A 3S41A 4ZHQA 3H1QA 4P9PA 3VEWA 2R9AA 5M1KA 2JWKA 3LANA 1N0JA 2ZR3A 5JH7A 3SPIA 1IBKB 2BOCC 3B40A 2UXDO 3MN5A 2KKWA 4JI1K 4PA4A 3ZRXA 5EC2C 1OV9A 4BRAA 1WP8A 2A9HA 1N0NA 3O4QA 2IBZH 1NJIO 4DF4A 1NG9A 5FRMA 4G1QA 3TWHA 1L0LH 4M7YA 1Q6HA 2OANA 4WFGA 2F93B 4K8ZA 2GWKA 3LDLA 1Q9XA 3HJFA 3J7AU 5KPZA 4MVMA 5IWAK 1YI2N 4ELVA 3JSLA 2EZOA 4LF6B 2WLHA 4A62A 1Q82W 4C23A 2VQFK 4XDJA 1E4FT 2JIZG 1U48A 4TV9A 3A0IX 2CGOA 3CCSN 2Q2RA 3E66A 3DTUB 3H1LH 1VQ4V 4D7SA 4IIJB 3VN5A 3E89A 4KB1A 4Y1DA 4UY8O 1BI4A 1KU9A 3G25A 3ABKB 4X1YA 3T69A 1OH7A 4JTDB 3UKUB 3SAFA 3HVRA 2D4WA 4FWQA 2IVNA 3M7MX 3OEHG 1JQ0A 5GINA 4BW5A 5KPRA 1Z26A 3UKUA 1RBTA 3VF2A 4X1KB 5C8YA 4W5RA 3UCSC 3EYZA 1TUYA 2HF4A 2RKIA 4IEEA 4M3WA 2Q0AA 4N41A 4FJGA 1AI6A 5IWAO 1JLBA 2H8PC 1RBSA 1BCOA 1RBRA 4JI0O 3JARB 4QOZB 3ZMZA 3FFIA 4QPJA 3LSUA 3VA3A 2WSSG 3O65A 3QO7A 5C93A 5CE3A 5FPRA 2KSDA 2IGIA 3TABA 2LGQA 2AXTZ 1T03A 1BCMA 3QDKA 4FJ9A 3ZMUA 3JSNA 3THWB 3CIPA 2CH7A 4NXNO 4HBNA 4JI1O 3FR0A 3A2FA 5KMGB 1S5HC 3VQWA 4HUFA 3AVGA 3C6UA 1NU0A 3HPGA 3IJ4A 3NF6A 2OA8A 4V19S 2EIJB 3E1YA 3K08A 3X2QB 4FJ8A 2HR3A 4LF9O 2A5XA 1HPMA 3WXIA 5AQTA 3BFRA 1BHLA 3L75H 1I39A 4DV3O 4FVMA 4A5UB 1VIBA 4GLXA 3L72H 1P49A 1YVUA 4O55A 4E1NA 3LUTB 3ZT0A 3WU2Z 1RT7A 2WDQA 4CGDA 1UA0A 4YOXA 4EP5A 4EFEA 1X9MA 3O1BA 4Q4V4 1QQOA 4O0IA 3RMCA 4BQZA 3ISNC 4CE9A 3L2QA 2Q3SA 4WQ4A 2WLLB 3E8FA 3O1WA 4E89A 3J7ZO 4MW8A 1RT6A 4I7FA 4ZHRA 3QETA 2Y4TA 4EIAA 1RUF4 3J7YP 1HPZA 3AAPA 4DG1A 5BN8A 3DJCA 2HVHA 4CC5A 1COWG 3V1RA 3CCJV 3V1QA 4BRGA 1B92A 1WSJA 2R70A 2ZIOA 4E4EA 1KCFA 2YNGA 4DR1K 1BQNA 3ULEB 4WBNB 4R6ZA 1ROPA 2DQ0A 1US6A 2ZXWB 1BQ0A 2VWKA 2UXCO 3TETA 1UFIA 4BQLA 4AQYK 1NK4A 3K59A 1S5LZ 4H5TA 1Q5OA 2GTAA 1N8RW 1GOCA 2Q0UA 5H6QA 3A5MC 5HRNA 4JI3O 5L3EA 4PA9A 5CA1A 1Y64A 2W42A 3BCCH 3OY9A 1B04A 1PD3A 4EKWA 5IT9N 4BRLA 2ZIMA 1NGGA 3IC9A 2BUPA 4CS4A 3RN4A 3DM2A 1BZKA 2D0PA 3P30A 2VRZA 5JCOA 1BA0A 4I0XB 3T1YO 4AH9A 1HNWB 2FXUA 4ID1A 4DQQA 3UQ8A 3ENBA 3DMJA 4JAUA 1Y74B 4FLYA 2PYLA 4X1IA 1IBLO 1TUEB 4FO0A 3V9SA 3RGBA 3PUFA 5T7BA 4DV3K 3DLHA 4JK7A 1HNWO 3SZ2A 2F8SA 1K5MD 4J42A 2OTLV 4GKJO 1Q43A 5J2UA 4AHVA 1EZVH 2OCCB 4LF8O 1GRJA 4XBFA 4WFAV 1JLEA 3CJ1A 1S1TA 4DW1A 2JVDA 1TK5A 2G8IA 2HG5C 5IYDO 4E7JA 1CXZB 2ZWHA 4DU4A 2QSAA 2OCCC 3HI0A 1Z25A 1YQ3A 4K25A 4K42A 2R7YA 1MSWD 1HRHA 1ATSA 1TAEA 4IYIA 4G27B 4KHPO 1VRUA 2RE2A 4DKWA 4F2SA 4O4LA 3I8DA 1RUH4 5IE9A 4X65K 1OCZB 5AFUH 2HNZA 4DQIA 3B2EE 3OYFA 4BRNA 1NH2B 3CCMV 4FZZA 1I0HA 3A0RA 1K8AW 3B09A 2M7WA 1J5EO 4X64O 4GX2A 3NHGA 4CGHA 4PHZA 3AG4B 1RSOA 3O3GA 2JEXA 4I55A 4EZ9A 1XNQO 3C6AA 4B1YB 1WLEA 2ZGZA 4CHQA 2G8UA 1ZBSA 1RVF4 2VG6A 1HDJA 2HEPA 4DRXB 4F6EA 5IY5B 4CGFA 3SQ0A 1XNRB 3RTVA 1POV0 4BWMA 4FVUA 1NKCA 1JMKC 3SDLA 1KVBA 4FFBA 4BW9A 2IIRA 3BY5A 3SJHA 2VYPA 4AI8A 4UUJC 4LH5A 1D8YA 3QO8A 4GY2B 2XHBA 4ABMA 5CR4A 4KTZA 1NR1A 4UVAA 4CHYA 3D8CA 3QEXA 1HRV4 3G6EN 1M4UA 3L73H 2GTSA 5KUKA 2UXDB 4O4JB 2E74B 1OH6A 3MEGA 4M45A 3SYCA 1RPRA 2NRVA 3IGAC 2QWQA 3MK6A 2HMIA 2DYSB 1JLQA 2P9LB 2MW2B 4BG9A 2PBDA 2F95B 1CXQA 2AJQA 4DUYO 1B9FA 1C0GA 1JLGA 3LP1A 1I94B 4MQ3A 2RF2A 4CZGA 5B1AB 3CPWM 3RMDA 4ZI7B 3L74H 3Q4HB 4IJNA 3AEAA 1YQ4A 2Q36A 2Q1NA 2KTQA 2DQ3A 4YIPA 1KXPA 4DV6K 3QEIA 1HXS4 1IX9A 2X74A 2OT5A 2FBYA 4PDRA 2Q69A 1XC3A 4NB5A 1RTJA 1KKCA 3TPQA 4ELUA 1VBE4 3R9PA 5B1NA 3SMSA 1N8RO 2H94A 2CUGA 1NOYA 2YI1A 3QBXA 4J8FA 1VMGA 3SMPA 1S6QA 1L0VA 2NR5A 4MLHA 3QTCA 5LMNB 4YFUA 5CN0A 4Q4X4 1VSIA 3CE2A 3RSEA 3B4SA 4DR5K 1M1KO 1MOFA 5C3JA 3SPZA 4DUZB 2PFUA 4M41A 4WQ5A 2W40A 4CJ5A 1N34K 1YTAA 2ZM6B 4CEQA 1R6TA 3ABTA 1HRI4 1EN4A 1WB7A 1W0JG 2Q73A 2XAQA 1H2LA 2XY5A 3GBTA 4JAVA 4DV5O 1VF6C 3AO2A 3MHSC 2Q67A 5KHIA 2QKBA 5AQVA 4M42A 4LF4O 1JPXA 1NEKA 5FLXN 3ZRWB 3TK1A 3AVAA 2FF3B 2F1MA 1EZJA 3NGZA 4FK0A 1IBMB 1BIUA 1HYZA 4RUEA 5C15A 4DV2O 4Y1CA 2IC3A 4U7BA 2HJFC 4DUZO 2BANA 3ZSOA 4NTWA 3J80N 4BR4A 3DLLL 2DN9A 1SQBH 4XDKA 5K1XA 2KHOA 4BRPA 1VRTA 4JD2B 5H1SQ 2X78A 1XI1A 3Q7CA 5LMNK 4CEAA 2HFEC 5C10A 1SRYA 2YHXA 4UCUA 2EIKB 5KMGA 1SQVH 4ELTA 4JS5A 3OR7C 4B3TO 1VSEA 2HB5A 3PY8A 4P9OA 1BQZA 3PIOL 4HTLA 1UA1A 1X9WA 4FYDA 2WDRA 4JK9A 5AQMA 5HLFA 3MDQA 4F6RB 4FFKA 4BG8A 4CEBA 1YJWN 4PV1B 2FYUH 3LDDA 4O0JA 3EZWA 4BWAA 3CI5A 1KC8W 4A5AA 1UPGA 1U45A 3O80A 1RUD4 4AQYO 3FZFA 4JV5K 5E1AC 1K6YA 3OR6C 2PF4E 3L70H 1KFDA 5FPMA 2WLLA 4B3TB 5AQQA 1VSLA 1TKTA 2M6YA 1NVPD 2Y1JA 2IJJA 3R66A 5J9PC 4JI2O 4KHUA 4KREA 1ZOYA 3BDPA 2WFBA 4LFCO 4FJHA 4P2ZA 4DTNA 3OYEA 1EO1A 2UUAO 4K0KO 3HPHA 1ZL8A 4Q5VA 3OBWA 1J5EB 4O4IB 5LL6Z 1YITV 3TGUH 3AVHA 3SUOA 1M9NA 2KQ2A 3KLEA 1GN2A 2R044 4MSWC 3E86A 3M6GA 1MMMA 3DXRB 4FZ0A 3J7AP 4M63C 3AEBA 5IYZA 1N4CA 2QM7A 2QTDA 4DR7B 1PP9H 3U10A 4NXMO 3K06A 4CJFA 3CCSV 2E5LO 2CH7B 1KBHA 2P51A 2CTPA 1RFQA 3AVNA 1EETA 1EAH4 4KL1A 3GG4A 4B8AB 2DFFA 3SQ2A 3U11A 3O3HA 1YTUA 3C3TA 4Z4EA 4JKDA 3FZHA 4WFEA 3VETA 4BRMA 1XMOK 4CBCA 1K73O 3AVIA 4HAMA 4B9VA 3RYFA 1BSMA 4LF6O 1IXMA 1GLDG 4BE2A 4Y0WA 2X7RB 1BWFO 3ZBHA 2ZT9B 1L5UA 4EFHA 3VBBA 2QWOA 4LFBO 3VR8A 2YIBA 1ZBFA 4E7LA 5AQHA 1RT3A 4YOWA 3SV3A 2ATQA 3FB5C 2QWOB 4RCHA 4CJUA 1N32K 3K5NA 3EL2A 5EZYA 1KYOF 4CEOA 1M56C 3FI7A 1G99A 1WSGA 2ZDIA 2WLKA 3WXMB 4WBNA 4ISEA 1GLAG 3C6HA 3RBZA 3F9MA 3CC2V 4OLAA 1NT2B 3M5RA 4GMJB 1KAYA 1LAVA 3W3DA 1NU1H 4WFHA 3RYIA 1GOAA 3CJHA 5JCOC 4CD3A 3DLBA 3FD9A 1TUBA 3HB3B 4YHHO 3CD6N 2F23A 4LFBB 5E84A 5AQZA 3G67A 1YUWA 2JS5A 2UUAK 4K0KK 2Q5ZA 4U3JA 3W7SA 3TJTA 3B77A 2CAZC 3U3YA 4FZYA 4RHV4 3WFVA 3HKBB 4BR9A 1GN6A 2EX3A 1CP9A 4DYLA 3T1HO 2JLEA 4XEIA 5CHIA 3KLGA 3OUFA 2KFZA 3SPYA 1P90A 4ILHA 5GAGP 3JALA 1NGIA 5D5PA 2AA4A 5CBGA 3A5OC 4Q6GA 3OBYA 5DM7L 3VQYA 4DWIA 1KFYA 1VP7A 4MDAA 4EB6B 5KHJA 4RQEA 3UKRA 5CA3A 1EKEA 4M3UA 3BGRA 1ZP0A 3D2EB 2ZD9A 5DM6L 3PO4A 3LDEA 5EIBC 2DFEA 3CM6A 4JI4K 3SUPA 4X62K 3CSXA 5GIPA 1VQKV 4FPAA 2Y4UA 3SCXA 2IJKA 2P90A 3R1XA 4WFNL 3BPZA 1Y67A 1DGKN 4XIUA 4IIJA 4X89A 2W6LA 3WT0A 5GW7A 4LF9B 1Z2GA 2L35A 1JKHA 1LWEA 3L4IA 4BRDA 2DJVA 3C6TA 1U2VB 4J10A 4BC3A 2EJRA 4W4KA 2D0BA 5JQGA 3B6OA 3ZMTA 3T7ZA 4X1KA 5C8YB 2O8FB 3T4ZA 3DXMA 4FJ7A 4DV0B 4I0XA 5F2VO 4PKIA 3LP2A 1AILA 3JAKA 3HOTA 1G15A 4RQFA 4WQ5C 4JI6B 4DV5K 2YJEA 1Q7YO 5JVGL 2DY4A 2D2CB 3JAKB 4ISFA 3P31A 1S1XA 3U9DA 4JI7O 5GADP 3G71V 4DV6B 1TL1A 2GELA 2QW9A 2O8EA 2KFNA 2PY5A 2GUZB 1BT8A 4IL6Z 2NUBA 3MX2A 1HJRA 3OVNA 4A59A 4MTOA 3SJJA 1L1FA 3ATVA 1NGCA 5B8HA 3ZT1A 1QVGM 4J2DA 2HHXA 3CM5A 1K73W 3LDPA 3WB1A 1NGEA 3RYIB 3WNHA 3O4NA 5JVHL 3AARA 2QKKA 1PNLA 2E4LA 1BGXT 3FB6C 4GX5A 3SFEA 3NF7A 3QERA 3M8RA 1HNZK 1ZTEA 3DLEA 2JJ1G 2EIJC 3D2FB 2NRWA 4CZFA 2ZNIA 2YNIA 2ZF5O 4O4HA 4KHPB 2CGJA 3MN6A 4GX1A 5MLCQ 2QM4A 3SUQA 4DTOA 4RW6A 1X59A 5C12A 3ZSWA 2OPRA 4J7KA 2FSJA 2XY7A 1ZYQA 1XNQK 1D4M4 2E5LK 5JMVA 4E2LA 1SERA 1XNRK 4EB6A 3UKRB 2G38A 1YTFD 4X64B 3NR7A 4I7ZB 5FROA 4DU1A 3SQ4A 4PQUA 1VQOV 3QICA 2HVIA 1RDCA 1IBKK 1GN3A 4CZKA 3VQ7A 2O8CA 3SJAC 1Q86W 1SV5A 2YS8A 2IU3A 4B9SA 2GX9A 4TV9B 2W6JG 5AQNA 2XAHA 2D0CA 4OKKA 3D3IA 4TUYB 5TISZ 1WOQA 4GX0A 2A06H 2FMLA 3L3VA 4IO8A 3TXSA 1LUVA 3ETGA 2ITCC 2Y69B 2ZDIC 4J41A 4H8KA 1W7AA 3V9UA 1XHZA 1XBLA 3JASB 4E0DA 1O9GA 2X6AA 4H37A 5B3SB 2Q8VA 3TAFA 1ZX3A 2IAJA 4CHNA 1BEV4 1Q6UA 2XAJA 4QS8A 4RWUA 1SQFA 1UJWB 1VBD4 3C0BA 1T7PA 1RM1C 1PPJH 3MWTA 4ZI7A 4LY7A 4NLBA 1GAXA 4CEFA 5I3UA 1I3AA 2YIBD 1JJ2U 3AG3B 2P9UB 2EJ7A 3RR7A 4IEIA 2V7QG 1VSJA 4HNAB 1R3LC 1YZBA 2B5JA 4CZMA 4H0VB 3FAVB 1S1VA 4WCEL 4YOTA 4BRCA 5DK5A 2VWBA 3VPZA 3VGKA 1IZ3A 4ISGA 4AF1A 1KLNA 4PUOA 1QQCA 2K9PA 2UXNA 1BHBA 2VGMA 3FFKB 1BL3A 3IG1A 3L2VA 1Q9YA 3MAQA 3WB2A 1DF5A 1VBA4 4DV2B 3RSEB 3GVMA 4FZ1A 3FZKA 2DYRB 4F2RA 1JXBA 3VEOA 3HP6A 1XC9A 3LWMA 4BIUA 3C7NB 2RS34 5JQGB 1D5AA 3W7WA 3CC7V 5LL6Y 1HUXA 3BAAA 3JASA 4C8LA 4FJNA 3RYHA 2AGAA 3B6PA 2KZZA 2WC9A 3DLRA 3CRQA 4DHYA 3P4SA 1WAFA 4BR5A 1JLFA 2E88A 2OZMA 4CC6A 2DTUA 1RNHA 4RW4A 3DLGA 1MSDA 4B8CA 4LF4K 1ZAUA 3ZMSA 1TYQB 3O9UA 5EVZA 4JHDB 4CEDA 1PO24 1XL4A 1U4BA 2E2NA 1NQTA 3QIPA 3AK2A 4EEQA 3OYGA 3Q4HA 4KHQA 4BRKA 1RT5A 1JLAA 3MCPA 3PIPL 3ZSVA 2IVOA 3LSQA 4OGQB 4ZTJA 5CB4A 4HNAA 1AR1B 1PKXA 3P1GA 1NKDA 3MXMA 1TK0A 1VSDA 3CCUV 4CCHA 5LGTA 1Z7S4 4LR3A 3IKMA 2LGWA 3FE1A 4AQYB 2JGDB 2VWJA 2YI9A 3CRCA 3S3NA 3Q7BA 4NCAA 3ZMVA 5BR8K 1JCHA 4UQGA 1BI4B 1VBB4 2NRTA 4A2BA 2EZPA 4LWSA 1YI2V 3KZBA 4DFPA 4BIOA 4MO5A 4EP4A 3P4PA 1QBZA 4XDLA 3DSQA 4X62B 4W4LA 4PHTX 3AO3A 4DF8A 5B5EZ 3TI0A 5GTHZ 3AE6A 1HYVA 2KG7B 1SF9A 1D5NA 1V4SA 1XILA 2FBWA 3R65A 1TGOA 4LF4B 5KA6A 2LP7A 4FIPC 4CERA 4DV7K 4EZ6A 1RM1B 1Q81W 5FNVB 1PM9A 4N56A 5EX5A 2WONA 4M3TA 3PX0A 4IFYA 2A41A 5M1QA 1LNQA 1YXBA 4O5BA 3K04A 3DOLA 3VEVA 1XOUA 3QG5A 3PSFA 4I4TB 5AQSA 3SGIA 1RPOA 5IDJA 4LD0A 4G9ZA 5DMRA 4K35A 2RPIA 3MDSA 2Q0RA 4FWMA 4YJ2B 2CTQA 3H1KH 2ZE8A 4Z2WA 3ZCMA 4GW6A 2R9IA 3OYLA 4LFBK 4FK2A 2WA3A 5H6RA 4FWLA 3SAGA 4RUFA 1E79G 4MT8A 4UCOA 3BP8A 3P4RA 4CECA 1VQ9V 3MMVA 4M3RA 1TUBB 2IJIA 3JD2A 4CJ3A 1PNMA 5L3DA 1SKWA 4DR6K 3AE8A 5KAIZ 4W5NA 3AE5A 3OS1A 3ZEUA 2E75B 4DUYK 1JJOA 1WAZA 4JI2B 1N32B 1IG9A 1ATRA 4NXMK 3U3GA 3E8BA 5A2QO 4MLEA 4PDMA 2B76A 3AE2A 1NJIW 3K79A 4KH4A 1OCOB 2ITGA 2YJFA 3BEHA 4TV8B 4MS2A 4NCGA 3ZSZA 1AL24 2ZJPL 4FCYA 1S6PA 4X65O 3STZC 1BHAA 4MTFA 1KKDA 1NBMG 2P9UA 3WUHA 3H46O 4I55B 2WP9A 3L4QA 4CF8A 3D7EO 3EY1A 1NTZH 3AK1A 1S72V 3AG2C 1MU2A 2Y48A 1RBUA 3W7TA 3M8PA 3UM7A 1ASWA 5HRSA 3THVA 3AEDA 5EYPB 1N33O 2G8KA 3H08A 1I94O 3ATUA 3CERA 3AE7A 3H01A 1S22A 4QJFB 5LP6B 1KSPA 4JK8A 3NDKA 4NYFA 1BISA 1XWLA 4FLTA 4JRPA 1CZBA 4JGSA 4LNUA 2LQTA 3AEGA 3CP1A 4Z0UA 4O2BB 2E5LB 3RYHB 3E9PA 3D3QA 3VQDA 4IKFA 3DXRA 3CJHB 1WBDA 5IWAB 3SK3A 4CJQA 2WTUA 2RMU4 1AR4A 5KPTA 2OTJN 3ENHA 2YXHA 3U8XA 1JCEA 3MXJA 3ZEDA 1QZ6A 1TKZA 2E20A 4U67L 1NA1D 1OH5A 2E3CA 1AJQA 2QM8A 1VQ4N 4UCTA 3UIQA 3OYBA 3D2EA 2JGUA 1C0MA 3TANA 1Q6IA 1WPXA 1VAZA 3OMAB 1D4XA 5JH7B 5LMNO 1Q7YW 2RR14 4UFZA 4KH5A 4FMTA 4GYCB 4DRXA 4IWVA 3BRCA 1R0AA 1L3SA 1KVCA 1WP7A 4FLZA 3QLHA 3J81O 4BE0A 4MVQA 4B7KA 1DK1A 2PGGA 3CRRA 3CMAV 1VQMV 3HVTA 4N47A 1HNZB 4CD1A 2O8DA 2BSKA 1W2BU 2H89A 3I56V 4GKJB 3AE1A 1TV6A 2BTQA 3EVKA 2HBJA 2V51B 4CZLA 5LY3A 3FLCO 1P7BA 3DRRA 5E41A 3CEIA 4KAZA 4H0LB 5KAFZ 4DV0K 5KGXA 4B7EA 5JJJB 3K58A 1VF5B 2ZM6K 2GV9A 4LWSB 3VEZA 2WLJA 1AR84 3AE9A 1ZBHA 2R064 3E22B 4RW8A 3VQQA 4PA1A 4JEPA 4RAIA 1FW6A 4QS9A 1C1BA 1N36K 5CZ1A 1K8AO 2F4VB 1T3VA 4LF9K 3ZSRA 1TUUA 1B06A 1ZBLA 1QVGU 3J8F4 4DR1O 3L3UA 4IYHA 1SQKA 4UCSA 5HFLA 1H8EG 4UVCA 2YNHA 4GVMA 5SZTA 1VQNV 3AY9A 1K33A 2V4DA 4CJ7A 1N33K 4XH4A 1LWFA 4C8OA 2WOMA 3VOVA 3BZCA 3NGIA 3K5LA 5FPEA 3BA9A 2ZE2A 4OVLA 1HKCA 4JLHA 2WBNA 2G8FA 1Y76B 4PA6A 4E3SA 2XY8A 5JICA 4F6RA 4CESA 3OD4A 3ABUA 3H1VX 2LFSA 4IO9L 2RS54 4MTXA 3NVKA 1T8EA 4GV6A 4DQPA 3CQYA 4FWRA 4DSIA 4F3TA 1YJNV 2OIEA 4TUYA 4BWJA 4CJ4A 4LF7B 4KBOA 4DR6O 4MO4A 1ENVA 5F2RA 3OYMA 3HKCA 1FJGO 4PA7A 1GH6A 2Y0PA 4DCHA 3CCEV 3TAGA 1BU6O 2GTDA 3KZIZ 5CA0A 4YSZA 2GUPA 2IU0A 3KIOA 4EFBA 3N2GA 4W5TA 3CXCU 5EU7A 2GEMA 1FJGB 2GWJA 5HOOA 3QF7A 4IOCL 4DS4A 3V6DA 1BIZA 1IVSA 1RDAA 4GCZA 3SYPA 4DFMA 1TVKB 4N21A 1BL8A 1Z5VA 1W59A 1K4CC 1OZ0A 2HNDA 1G6UA 2IOCA 2RN2A 1OHHG 3VGMA 4BRHA 4DTUA 3V1OA 1COV4 3ZIAG 4B3SB 2P9PA 2KKZA 3RVCA 5EBLC 2EHGA 1SS3A 1VQLN 4GB34 1I5YA 1Z5WA 4NVPA 1XL6A 2NRZA 1A5XA 5CYQA 4CEZA 2AZ0A 3U0ZA 3SYZA 4NTYA 3PO5A 2RNBA 4CS3A 4O8KA 4MVSA 3VRAA 1JXEA 3N2GB 4DV7O 3ASOC 3AGRA 3VQXA 4NB4A 3AVMA 3KKSA 1K92A 3LDNA 1NENA 3UT5B 2Q7EA 1J6ZA 3KD1E 2E1YA 2A42A 3AA5X 4O44A 1BMFG 1BE3H 1R59O 5JVDB 4IG0A 3JATB 1I7FA 3D6RA 5JLFA 3U9ZA 5I9EB 4QIWF 1KD1O 1HNVA 4F4LA 3OTOB 4C7UA 4OLBA 3SYOA 5IJ9A 3BF3A 1U47A 4DR7K 1RHI4 2D0AA 5BRFA 5JWPA 3EHBB 4H4OA 1H2KA 2ZJRL 3NE6A 4B08A 4AM6A 1URFA 3NF8A 1PVC4 1RT4A 3R6MA 4A2AA 3QNOA 2Q6AA 2F7TA 4CBXA 4KI6A 1VQNN 4IJAA 3DI6A 3WQUA 2HP8A 5J2TB 4AILC 1EN5A 5L3CA 3AAQA 3ZX3A 1K3EA 4RW7A 5CB4B 1VF6A 1SETA 1YIJV 1CZ9A 2QXLA 4KB0A 2X6CA 4R5PA 1PL4A 4ZHQB 4OO1J 1H2GA 4YJ3A 3I8BA 3OE7G 4Z4FA 4K3AA 2Q7GA 3HKEB 1J53A 1RBVA 3LALA 4DTXA 1QE1A 3HRGA 4JHDA 3VESA 4DLGA 1R6NA 3OAAG 5CA1B 3CJBA 5B3SC 3MD0A 4WFBL 2ASPA 4TWKA 5H5NA 2RHKA 1OVYA 3IS9A 3WEEB 3SJBC 2P67A 1VEWA 1WA8B 1NK5A 2KG7A 1HNWK 4N5SA 3K9SA 4KX6A 3T1HK 1JCFA 1OJHA 2G8HA 1Y6XA 5TKWA 5IJ0B 4RWTA 1RUG4 1NOZA 5AQXA 3HM9A 4LF5O 1ZUQA 2RCVA 2V1DA 3VQ5A 4BR7A 3HT3A 4CIEA 3OTOK 1GLLO 4PI0A 4HCBA 1SKVA 3E2EA 2GHYA 4R8CA 4E1MA 2NLJC 1BG3A 2QWLA 4LH4A 3RVZA 1ZWIC 3AVBA 1FKAO 1VQLV 3LDOA 3ZJZA 3EE8A 5LJWA 1MABG 2LFRA 3NH0A 2Q4PA 4J2EA 4JKFA 5LHIA 4YY3B 1XUPO 3VQVA 1BS3A 5IYZB 1NGHA 5JJNB 3CCJN 3C7NA 4H0XB 2ATKC 3ZN1A 1TL3A 1HNXO 4NCBA 2DMXA 5M1OA 4X88A 4DSFA 3AE3A 2HHHB 1NI8A 4FLUA 4A57A 4CJLA 1TKXA 1WLJA 2QKAA 2ASOA 2YHBA 4IGGA 4CJPA 1SL1A 4HCCA 3VRBA 3JARA 1M5IA 1ZL8B 2JWLA 4WFBV 4E19A 1AI5A 1N34B 2V52B 2OIGA 3ZHVA 1KVAA 2QWPB 5TKYA 1T44A 4DQ8A 2HHSA 3VTHA 5BZBA 3U4LA 3TSUA 5J1EA 5DEDA 1YSCA 2R72A 1S9EA 1PV0A 4WCEV 4U7OA 2O8DB 2WQYA 2YCHA 4YJ2A 1WSFA 2LSNA 2QWNA 3MN7A 4L3QA 4OGEA 4B1ZA 1JX9A 3KG2A 4AHRA 4Z4HA 2HHHO 2QWRB 4DR4O 3CJAA 4LF7O 1IKVA 4B3SK 2WWWA 1KC8O 1MZFA 2HBKA 3CCQV 4X9QA 4MVOA 2H3GX 4J9ZB 4PDVA 1MZEA 2OPPA 3SPGA 2NLXA 4J7JA 2PLV4 1NGJA 3GWOA 3W7UA 1GK9A 2FKXA 4C1NI 4JV5B 3OUSA 1S76D 4NXNK 3PJSK 4QE9A 2CTRA 4WFAL 4GZRB 2VG7A 3FGUA 4B9UA 2AP1A 3AG7A 5M1FA 3T3FA 1FD9A 4JZ2A 1RCHA 2QXFA 4ICGA 3CHXA 3CCEN 1FXHA 1MWKA 4ZOLA 2GDSA 4XH1A 1RT2A 3THXA 2Z1JA 1DEJA 2BTFA 4BGBA 5BREA 4R7CA 3DYAA 5CMUA 1RUI4 3FZMA 1AB3A 5FPDA 3VA0A 4B3MB 1ZBUA 4BRIA 3CYOA 3WG7C 2RMKB 4PD4F 3GL1A 3MX5A 4CF2A 1GTOA 2MK3A 1Y74A 3WXJA 1S77D 1WB9A 4RG8A 2YIDA 4CHZA 4FPPA 3NMUA 4JI5K 4UV8A 3KK1A 4CBUA 3LNMB 3VR9A 4WF9V 1K9MW 2OCHA 2YEVB 4CJVA 2YX6A 2UXDK 3W7XA 5KA5A 3QIOA 2YKMA 3B8AX 1HNZO 1AR5A 2UUBO 3IAYA 3M99B 4LH6A 4FW2A 1IBMO 1P84F 3OW2U 5BR8O 4H4MA 3H45C 2UXCB 1NMDA 5E26A 3F5WC 4CH6A 2VQFO 1C1CA 1N36B 3AG3C 3UT5A 4B3RO 3BEXA 2A1SA 4PI2A 3VQ4A 3CS5A 4BC2A 1BO5O 4YOYA 4MDBA 2O8BB 5BMVA 2D5RA 1JR9A 4C1NK 3O9SA 3OYDA 3P4QA 4LFAO 1JFFA 1TKDA 2YDEA 3AA2A 1YTFB 4CZJA 4EAHD 2YI8A 3PX6A 1M56B 2Q7HA 2XUMA 5LBQA 1FFTB 2Q68A 4CH3A 3KK7A 3R8EA 1NNEA 4FM1A 3OJUA 3QNEA 2A79B 1NM1A 3MCAB 1IV0A 1FKPA 1YHQV 4B1UB 4CJSA 1RTIA 3ZX2A 3CMAN 5LOVA 4DV3B 3D36A 5AZIB 4HVJA 2F4VO 2NRXA 4PELA 3VF4A 3HBTA 3LPTA 3FB7C 4Z1VA 3TR8A 5F0XA 1VQPN 3J8AA 2VQEK 3K0GA 3JAMN 3WNFA 2HHWA 3VGLA 5B1BC 4LH7A 2R074 1ASVA 1VQ5V 1DTTA 3NCIA 2JJ2G 2KLAA 2ITMA 3SPHA 3LWLA 1U49A 3OS0A 3K9AA 1SUQA 2YHYA 4LC9B 5J2PA 1YJ9N 3HKDA 3ZSQA 3VQEA 3RYCB 4FK5C 1R3KC 2I5JA 2XT9A 3WEEA 2WLIA 1WSHA 3SJQC 1HJOA 4FWOA 4CJEA 4CJKA 1HP8A 4X62O 4FLVA 4YOVA 3G4SN 1XHXA 3NAEA 4JI4O 3OS2A 4IXCA 2XO7A 3MEEA 1K4DC 1DF4A 3PN1A 4LF5B 3W0LA 2IM9A 3TSQA 4QNHB 2HLDG 1IKXA 3X2QC 3AVJA 2WS3A 4CIGA 1N32O 1WBBA 2DFHA 3HTVA 3V9ZA 4B3RK 5BPMA 1Q18A 1VK0A 4CBWA 1T6CA 1V55C 4FXDA 1R3IC 2WA4A 4WFFA 5LA6B 1BOTO 3HM8A 4YTPA 4FJMA 3VOUA 2GBOA 1U2VA 1B6QA 1GM9A 3AK3A 4CI6A 4LSNA 5B1BB 1VQKN 4UV9A 4YHHK 4IT5A 2ZNJA 3H1JH 4OKEA 4CZEA 1KAZA 4KV8A 1YXQA 3AG1B 2NRRA 1VQ7N 2ZQMA 4O2AB 2PUSA 1NGBA 1HLUA 2ETJA 3C3SA 2I7NA 3CXCM 3KVGA 1H2MA 5CZ2A 3SI6A 4C8KA 1H8HG 2EIKC 2Z1HA 4F9OA 4DV1K 4IG3A 2B1IA 2KB1A 1ESVA 3D0PA 4B9NA 2AW9A 1X9SA 2W41A 5JS1A 3SR2C 1S3XA 3CF5L 4J2BA 4TSFG 4E7KA 4N76A 4F8RA 4KH6A 1RDBA 3QBWA 3H3NO 1HKBA 3GOIA 4YSYA 3SNNA 3NBPA 4KFBA 3HZ6A 1XMOO 1RUJ4 2RS14 4Z4GA 1PNKA 4B3MO 1VSMA 1SKSA 2ASMA 2HVKC 5AQRA 3RW0A 3RWUA 3I56N 2WDVA 1OVQA 3ZX0A 3L2UA 2BDPA 4JV5O 1Y4MA 4RTFD 3MEDA 5LGUA 4X66O 4HUGA 2HWC4 3O4WA 4FLXA 5EK0A 4ILGB 2JK5C 1XNRO 5DECA 3P32A 1RTDA 5SWMA 3I55N 3TAPA 2WU2A 5FPOA 2N05A 2RM24 4FWKA 1JFFB 2E2PA 1NJWA 4IDHA 3DRSA 2X6NA 4NTXA 4BIZA 3JATA 3M8QA 5LJVA 4NR1A 4DTSA 5BR9A 3CPWU 2HMPA 4CK3A 4ZIBA 4DTMA 1QCEA 2X6BA 1VSKA 1C1AA 4H0OA 1LR1A 2IJHA 4LFCK 4K41A 3JAWA 1QSSA 3TTCA 3NH2A 4DSLA 3AE4A 1WNSA 2VQEO 4KHWA 1GMGA 3DLKA 5AQWA 3ABMB 1UAXA 5KRTA 4Q0BA 1CPYA 1IH7A 3VERA 3CCUN 5AFUA 1N6QA 2ACZA 2QEXV 3ASNB 1XMQK 4BR2A 1EQYA 5ELZA 4JYCA 5AZJA 2NNUA 2VG5A 1FAFA 1ATNA 3ETDA 3QFPA 3ZHTA 4H03B 2EINB 1AI4A 2VQFB 1ILYA 4M7XA 4O4GA 3NF9A 2XY6A 4TOIA 4TV8A 4QCLA 3BY6A 2Z1GA 3CCLN 3AG1C 4ZOLB 4JI7B 4KI4A 1VQ7V 3HK2A 1RP3B 2YIAA 3E22A 3CD6V 4DU3A 2P9SA 1KECA 4CFCA 4L87A 2G8WA 1NCQD 2HWB4 4O5FA 5KTQA 5LHGA 3V81A 4FOEA 1RUE4 4H5RA 4Z1MG 3A8TA 3CIRA 1NJZA 1EM1A 4DUZK 4JI1B 5KLVH 2O4GA 4BVOA 4KHSA 1NJXA 2YSUB 4UXNA 1NVPB 1UOCA 5IY5C 4DV2K 3BHPA 1V55B 1L3VA 2GBZA 1IKYA 1BGYH 1HQUA 5GAEP 5KHKA 1QZ5A 3ASNC 3WNGA 3AV9A 2CGNA 1AVMA 2PI4A 1CXUA 2QGNA 3KKRA 4H5NA 3ZSYA 4YXWG 4BRQA 2QA4V 1SQXH 4CH5A 3RRHA 4FWSA 2HW3A 2ADQB 4KKOA 1L3UA 3NGYA 2PW9A 1QR8A 2DW4A 1VQPV 3ALYA 1IKWA 4JF3A 4PL7A 4KHYA 4JI8O 2A0LA 2XNDG 4DK0A 3KHYA 3DGEA 2JDIG 3JD1A 3MWPA 2WLMA 1DTQA 5C0YA 5A2QN 4B9QA 2BTOA 3ZHUA 1HR0O 3CYMA 4JYAO 4CZHA 3E83A 5AQOA 5GONA 4Z94A 3G0ZA 4DV4B 3G4SV 1K8KA 1O13A 4LF6K 2Z1IA 4HUEA 2QKCA 3JBG4 1MNGA
chains in the Genus database with same CATH topology
3PV8A 1SL2A 4I50B 4BDYA 2YHAA 1IO2A 1LWCA 5CYMA 4IHJB 3QINA 3OTFA 1X1PA 3KLIA 2BE2A 3AA3A 4CK2A 2HHQA 2P5GA 3N2KA 4LNUB 3I0RA 3VQPA 3HP9A 4DSJA 4DUYB 3TAQA 3AO1A 3P5JA 3OYNA 4LFAB 1XMQB 4CIFA 3K57A 4DQRA 5FDLA 2UUBB 4FJIA 4KRFA 1TAQA 2FBVA 3DOKA 1ZBIA 1YT3A 4I2PA 3N2KB 1NKEA 1TAUA 2UU9B 1ASUA 1NK9A 5J2TA 3VQCA 1T05A 3LNNA 4FM0A 3T1HB 3KK2A 3RR8A 2F66C 4LFCB 5D5QA 1FKOA 4RW9A 5KRSA 4JI4B 5BR8B 1HNIA 4O4HB 3QNNA 1S9GA 1FK9A 4FM2A 5HP1A 3LP3A 3ZT3A 1WPBA 3HL8A 4QAGA 1DGSA 1W0HA 4KPYA 1J5OA 4JRQA 2G8VA 4YNQA 4PY5A 3JYTA 3U6FA 1S1WA 4I2QA 4O2AA 3T1YB 3K2PA 4O2BA 3RWRD 4HTUA 1WSEA 2B4JA 5J2QA 1ITGA 3AVCA 4JYAB 5LP6A 4CGJA 1JL1A 1C6VA 1YEWA 4LSLA 1QSLA 2P22C 2KZMA 1SKRA 4B3RB 4E7IA 4DSEA 4YHHB 3M8SA 2HHVA 4X20B 3D45A 3VQ8A 4X66B 5KHHA 4JI5B 5LOVB 1Y97A 3CFRA 1FXXA 5C42A 3CQ8A 3OYCA 3ASMA 3LP0A 4DTPA 4DFJA 5I42A 2OYQA 3ETQA 5JS2A 4FJXA 2RQ6A 5LMUB 3ZSXA 4B3OA 2PZSA 1QHTA 2OWOA 3VQBA 3BABA 4DLEA 2F96A 2P5OA 4DSKA 3ICXA 4B9LA 3OJSA 1L8DA 3QEVA 2OZSA 5LA6A 1N5YA 3CFOA 3T1AA 3KK3A 5C25A 1VSHA 4DR5B 4FJLA 4KHNA 4OPJA 3KLFA 1RT1A 4DTJA 4FK4A 2YXLA 3HXMA 3HKDB 1F21A 3CFPA 5JJEB 2FC0A 4DQSA 4DMNA 3C94A 1QTMA 1SQGA 5FRNA 4B9TA 3BA8A 5EYPA 2X6SA 4JI3B 1T5EA 3QEWA 1IBLB 4CGGA 1J9AA 4AHSA 2ZD1A 3L2RA 3LAMA 5LXTB 4D7TA 5CY4A 4F3OA 4C8NA 1Q3EA 5GONB 2XRIA 5CA0B 4DR2B 4X20A 4FLWA 3V9XA 3SQ1A 1SA0B 2YV0X 4CJTA 1WSIA 4DV1B 3RRGA 5ITZA 4OKJA 4X1IB 3QESA 4TQDA 4CH4A 5J2UB 4FW1A 2E6MA 5EIBD 5J2NA 2BGGA 4UCRA 5LXTA 4M3ZA 1RTHA 3WB0A 4W5OA 1NK0A 4M3YA 3S9HA 4I4TA 4I9QA 1JLCA 3HYFA 3F73A 1HQEA 1XMOB 3AVKA 2OPSA 1S1UA 1NKBA 4PWDA 4CHPA 4CJWA 1WAJA 4ID5A 3THOA 2QK9A 2UUCB 3I0SA 2FBXA 3KD5E 4ICLA 2Y1IA 3K5OA 4JS4A 4O4LB 1XQ8A 3HKBA 2VQEB 5HBMA 4M3XA 4O4JA 3ZS8C 3S3OA 4I9LA 4FJJA 3G10A 5KGWA 1SA0A 2HNYA 4CF9A 1TA8A 5ITZB 4CGIA 4FFBB 4JI8B 1L3TA 5K1PA 2YKNA 2UXBB 4DR1B 2OPQA 3SJCC 1NK6A 4F4KA 1B9DA 1A5WA 1LAWA 4OJRA 1HYSA 3OYHA 2RJZA 2IDOA 3KLHA 5C24A 3EZ5A 5FNVA 1C0TA 4Z4IA 1RILA 4U3JB 2YNFA 4DFKA 3FFQA 1KMIZ 1VSFA 1X4TA 5K14A 2ZINA 2F8TA 4C8MA 4K8XA 4L8RB 4FZXC 4TSXA 4YJ3B 3TARA 1GOBA 3RMBA 4CFAA 3HKEA 1O9HA 5HROA 1LV5A 3WNEA 1QSYA 3DRPA 3L8BA 4AHUA 4W5QA 3NH1A 1H2SB 1HR0B 2ZCEA 1BQMA 2IS3A 2GUIA 2PTMA 4B9UA 2E6LA 3CG7A 1C0UA 1VF7A 4KTWA 3VQAA 5IJ0A 1M93A 2P1JA 1HMVA 1LW2A 2PYJA 4NXNB 3AVFA 4CS2A 3TAEA 3LPUA 3OYJA 4LF8B 1N33B 3TAMA 4BDZA 4AHCA 4O4IA 4IHJA 3VQ9A 2KW4A 5EZYB 3O3FA 5D3GA 1A5VA 4X65B 1D9FA 5HRPA 4X1YB 4ZTFA 1FFXA 4IBNA 4IFVA 3QO9A 1S5JA 4JI0B 3AO5A 4CJRA 2O4IA 3CB2A 1WN7A 5BMVB 4DK1A 3OYKA 5IJ9B 3RYCA 3E01A 4CFDA 3V9WA 5KI6A 5LYJA 3OYIA 4DV5B 4KTQA 4E7HA 4HHTA 4BDPA 2QJ1A 1EP4A 4OPKA 4I50A 5J2MA 3SV4A 3L2WA 1O1WA 4CF1A 3ZT2A 4AHTA 1D9DA 3VQ6A 3JAWB 4CEEA 3ULDA 5HRRA 3AA4A 1RDDA 3MECA 1JL2A 3KJVA 4BACA 4Z4CA 1SL0A 1CLQA 3RFRA 1DLOA 2HHTA 4CFBA 4DTRA 4DR4B 3MXIA 1FFXB 2UUAB 4K0KB 3F9KA 3K5MA 4DR6B 4NXMB 3HSTB 1Q8IA 5JVDA 3LZJA 1UWBA 4FJ5A 5LP6C 3C95A 1V9PA 4DS5A 4BE1A 3LZIA 4KO0A 1TVRA 1NJYA 5LYJB 3P83D 4OX9B 3PX4A 1J54A 1LW0A 1HNXB 2HHUA 2R7FA 1NK8A 3ITHA 3HO1A 4CK1A 2BTQB 1TK8A 5KX5B 4DR3B 1EXQA 3AVLA 3RYFB 1KTQA 4CHOA 4DV7B 3NFAA 5KX5A 3V4IA 1KFSA 3AO4A 2ZQBA 3HKCB 1KRPA 1TVKA 1KLMA 4UCVA 3S3MA 1HW7A 4MFBA 3RMAA 1EX4A 4NYNA 4B9MA 4OGCA 2FBTA 4L8JA 5KHGA 4GKKB 3IRXA 1W9HA 1XNQB 3ZT4A 4WE1A 3LAKA 4TQFA 4CF0A 3JALB 4IDKA 3OYAA 4FJKA 1REVA 3SUNA 3HPOA 1NK7A 2A1RA 4J2AA 1QS4A 3JSMA 3QEPA 3LDSA 3KTQA 1U04A 2B6AA 3T19A 4ZHQA 2R9AA 3LANA 5JH7A 1IBKB 2KKWA 3O4QA 5FRMA 4DF4A 4G1QA 3TWHA 2F93B 4K8ZA 1Q9XA 3HJFA 4ELVA 3JSLA 4LF6B 1U48A 4TV9A 4D7SA 4IIJB 3VN5A 4KB1A 4Y1DA 1BI4A 1KU9A 4X1YA 3HVRA 3M7MX 1Z26A 1RBTA 4X1KB 5C8YA 4W5RA 3EYZA 2RKIA 4M3WA 2Q0AA 4N41A 4FJGA 1JLBA 1RBSA 1BCOA 1RBRA 3JARB 4QOZB 3FFIA 3VA3A 5FPRA 3TABA 2IGIA 1T03A 1BCMA 4FJ9A 3JSNA 4HBNA 3A2FA 5KMGB 3VQWA 4HUFA 3AVGA 3C6UA 3HPGA 3NF6A 2OA8A 4FJ8A 1BHLA 1I39A 4FVMA 4GLXA 1P49A 1YVUA 4O55A 4E1NA 3ZT0A 1RT7A 4CGDA 1UA0A 4EP5A 4EFEA 1X9MA 4O0IA 3RMCA 3ISNC 4CE9A 3L2QA 2Q3SA 4E89A 3QETA 1RT6A 4I7FA 4ZHRA 1HPZA 4DG1A 2HVHA 4CC5A 3V1RA 3V1QA 1B92A 1WSJA 2R70A 2ZIOA 1KCFA 2YNGA 1BQNA 4WBNB 2VWKA 1NK4A 3K59A 1Q5OA 1GOCA 5HRNA 5CA1A 2W42A 3OY9A 1B04A 2ZIMA 3DM2A 4CS4A 5JCOA 4AH9A 1HNWB 4ID1A 4DQQA 3UQ8A 3DMJA 2PYLA 4FLYA 4X1IA 3V9SA 3RGBA 3PUFA 5T7BA 3DLHA 3SZ2A 2F8SA 1Q43A 5J2UA 4AHVA 1JLEA 1S1TA 2JVDA 1TK5A 2G8IA 4E7JA 4DU4A 1Z25A 2R7YA 1HRHA 1TAEA 4F2SA 1VRUA 4O4LA 3I8DA 2HNZA 4DQIA 3B2EE 3OYFA 4FZZA 3NHGA 4CGHA 4PHZA 3O3GA 1RSOA 4I55A 4EZ9A 4CHQA 2G8UA 2VG6A 2HEPA 4DRXB 3SQ0A 4CGFA 1XNRB 3RTVA 4BWMA 1NKCA 1JMKC 1KVBA 4FFBA 4BW9A 4LH5A 1D8YA 2XHBA 4KTZA 3QEXA 4CHYA 1M4UA 2UXDB 4O4JB 3MEGA 4M45A 2HMIA 1JLQA 2F95B 1CXQA 2AJQA 1B9FA 3LP1A 3RMDA 1JLGA 1I94B 4MQ3A 2RF2A 4ZI7B 2KTQA 3QEIA 2X74A 2FBYA 1RTJA 4ELUA 1NOYA 1S6QA 3QTCA 5LMNB 4YFUA 1VSIA 3SPZA 4DUZB 4M41A 4CJ5A 1YTAA 2ZM6B 4CEQA 2XY5A 3AO2A 5KHIA 2QKBA 4M42A 3AVAA 2F1MA 3NGZA 4FK0A 1IBMB 1BIUA 1HYZA 4Y1CA 2IC3A 2BANA 3ZSOA 5K1XA 1VRTA 2X78A 1XI1A 4CEAA 4UCUA 5KMGA 4ELTA 4JS5A 1VSEA 2HB5A 3PY8A 1UA1A 1X9WA 4FYDA 5HLFA 4F6RB 4CEBA 4O0JA 4BWAA 1U45A 1K6YA 1KFDA 4B3TB 1VSLA 1TKTA 2Y1JA 4KREA 4KHUA 3BDPA 4FJHA 4DTNA 3OYEA 3HPHA 4Q5VA 1J5EB 4O4IB 3AVHA 3SUOA 2KQ2A 3KLEA 5IYZA 4DR7B 3U10A 4CJFA 2P51A 3AVNA 1EETA 4KL1A 4B8AB 2DFFA 3SQ2A 3U11A 3O3HA 1YTUA 4Z4EA 3AVIA 4B9VA 3RYFA 4BE2A 1L5UA 4E7LA 2YIBA 1ZBFA 1RT3A 3SV3A 2ATQA 4CJUA 3K5NA 5EZYA 4CEOA 3FI7A 1WSGA 4WBNA 4OLAA 1NT2B 4GMJB 1LAVA 3RYIA 1GOAA 5JCOC 3DLBA 1TUBA 4LFBB 2JS5A 4U3JA 3U3YA 2CAZC 4FZYA 3HKBB 2EX3A 2JLEA 3KLGA 2KFZA 3SPYA 3JALA 5D5PA 4Q6GA 4DWIA 3VQYA 4EB6B 5KHJA 1EKEA 4M3UA 3BGRA 3PO4A 2DFEA 5EIBC 3CM6A 3SUPA 3CSXA 3SCXA 3BPZA 4XIUA 4IIJA 4LF9B 1JKHA 1LWEA 3C6TA 2D0BA 5JQGA 3B6OA 4X1KA 5C8YB 4FJ7A 4DV0B 3LP2A 3JAKA 1G15A 4JI6B 2DY4A 3JAKB 1S1XA 4DV6B 1TL1A 2KFNA 2PY5A 3SJJA 4EZ6A 2NUBA 1HJRA 3OVNA 3ZT1A 4J2DA 2HHXA 3CM5A 3WB1A 3RYIB 3WNHA 3O4NA 2QKKA 2E4LA 1BGXT 3NF7A 3QERA 3M8RA 3DLEA 2ZNIA 2YNIA 4O4HA 4KHPB 2QM4A 3SUQA 4DTOA 4RW6A 3ZSWA 2OPRA 2XY7A 1ZYQA 4EB6A 4X64B 5FROA 4DU1A 3SQ4A 4PQUA 2HVIA 1RDCA 3VQ7A 3SJAC 1SV5A 4B9SA 4TV9B 2D0CA 4OKKA 4TUYB 3L3VA 4H8KA 3V9UA 1XHZA 3JASB 4E0DA 1O9GA 3TAFA 2IAJA 4CHNA 1SQFA 1T7PA 4ZI7A 4LY7A 4CEFA 5I3UA 1I3AA 2YIBD 3RR7A 1VSJA 4HNAB 2B5JA 1S1VA 5DK5A 1KLNA 4PUOA 1QQCA 1Q9YA 1BL3A 3IG1A 3L2VA 3MAQA 3WB2A 4DV2B 4F2RA 1JXBA 3HP6A 1XC9A 3LWMA 5JQGB 1D5AA 4FJNA 2KZZA 3BAAA 3JASA 4C8LA 3RYHA 3B6PA 3DLRA 1WAFA 1JLFA 2OZMA 4CC6A 2DTUA 1RNHA 4RW4A 3DLGA 4B8CA 1ZAUA 4CEDA 1U4BA 3QIPA 3OYGA 4EEQA 4KHQA 1RT5A 1JLAA 3ZSVA 4ZTJA 5CB4A 4HNAA 3P1GA 1TK0A 3MXMA 1VSDA 4CCHA 4LR3A 4AQYB 2VWJA 2YI9A 3S3NA 4NCAA 4UQGA 1BI4B 4DFPA 4EP4A 4X62B 3DSQA 4DF8A 3AO3A 3TI0A 1HYVA 1TGOA 4LF4B 4CERA