1XHXA

Phi29 dna polymerase, orthorhombic crystal form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
571
structure length
571
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA polymerase
publication title Insights into Strand Displacement and Processivity from the Crystal Structure of the Protein-Primed DNA Polymerase of Bacteriophage phi29
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Transferase
total genus 146
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xhxA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1xhxA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 1xhxA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 1xhxA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 1xhxA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 1xhxA06
3V6DA 1YTAA 1UOCA 4CHOA 4J2EA 4FXDA 3VQPA 5KGXA 3K58A 2LSNA 4CJKA 3S3NA 3O3FA 1UA1A 4F2SA 3C6UA 3ITHA 4FJ7A 4CHYA 3OS2A 2IC3A 4CJSA 1C1BA 2ZE2A 3V9SA 3AVIA 1WN7A 3B6OA 3DRSA 4DS5A 4PY5A 4KPYA 2HVHA 4DU4A 3VQCA 5J2MA 4M3ZA 4DLEA 3DRPA 4UQGA 2OZMA 2YV0X 4JRQA 2DY4A 1FK9A 4BACA 4CCHA 3P1GA 5KRSA 4CJQA 4FJLA 1HYSA 2HVIA 3PX0A 4KI6A 3HP9A 2A1SA 4ELVA 3V1RA 4OPKA 3KLFA 1U48A 1LW0A 1U47A 1HMVA 4CF1A 5DMRA 1VSDA 3B6PA 3ZSYA 1T8EA 3L2UA 3LZJA 1NJWA 1S1VA 2ETJA 4C8MA 4F3TA 3K5NA 4AHSA 2IAJA 5FROA 4AILC 1ASUA 1JKHA 3MXMA 5HRNA 4FJMA 2XY5A 4QCLA 4OGEA 4ELUA 1SUQA 3UIQA 3I0SA 1CXUA 1X9MA 1XHXA 3C95A 3NAEA 4BE1A 3HT3A 1HPZA 3OJSA 3SUOA 4PQUA 4DF4A 1XWLA 4B9TA 1Z25A 4EZ9A 3NH2A 4KHQA 3NDKA 3F73A 2YNFA 3IRXA 1VSIA 3PV8A 3TI0A 1WSJA 3S9HA 3AVKA 5E41A 4CJTA 3DI6A 4I2PA 3L3VA 3LP0A 4ZHRA 2KFZA 2YHAA 3ZSZA 2IOCA 1JLAA 4F3OA 4B9NA 1RT1A 2BE2A 3SQ1A 1XHZA 1Q9YA 3AVAA 3OYLA 1JL1A 1FXXA 1WSIA 4FLUA 4JS5A 3TAPA 3L3UA 3ZSWA 4DSEA 4J2DA 3DOLA 4JRPA 4FK2A 1RBTA 5CYQA 1WSFA 2FC0A 2RPIA 1D9DA 4RW9A 1C0MA 2NUBA 1GOCA 1RT4A 4MFBA 1S1TA 2FBTA 4CEQA 4EP4A 3TR8A 3OYEA 3RRGA 3KTQA 1JLCA 1JLGA 1FKOA 4OPJA 4BDZA 4Y1DA 1C6VA 1NK8A 1S5JA 3LZIA 1NKEA 4J2BA 2BANA 4O4GA 4F2RA 4W5NA 1RBSA 3LAMA 4AHVA 1LWFA 2W42A 5HRRA 2X6SA 3OYKA 4LY7A 1KLMA 4M42A 4C8LA 1VRTA 1T7PA 1R0AA 3P83D 1L3SA 1SL1A 2RN2A 3KJVA 4I2QA 3D45A 2KTQA 4M41A 3AO4A 2KZMA 4Z4EA 4HUGA 3VQ8A 1QSYA 2HHSA 4DG1A 4DSIA 1K6YA 3NF7A 3DLHA 2FBXA 3MEGA 4FJ9A 3NGYA 4DTJA 5KTQA 1SKWA 2OZSA 4YFUA 2XY6A 4KHWA 1QTMA 3KIOA 4FW2A 1KVAA 1RT6A 2PY5A 4DFJA 2PZSA 4CHNA 5FRMA 5JS1A 4C8OA 1ZBUA 2KQ2A 4GVMA 2AJQA 1RT3A 5DK5A 3NGZA 3QNOA 4Z0UA 1BIUA 2YNHA 2DFFA 5J1EA 3AO3A 1BHLA 1HQUA 1HNVA 2G8HA 2B5JA 2HHWA 4FJHA 2Q3SA 3ZT0A 3L2QA 1WSEA 1A5XA 3NBPA 3O4NA 4CGIA 1IKYA 3O3GA 3MEDA 5KI6A 3SPYA 1TK0A 4FYDA 2OPRA 3LP1A 4FK4A 4Q5VA 4CF8A 3AO2A 1TVRA 1DTTA 1TK8A 3EZ5A 1LWCA 1RCHA 3VN5A 3P5JA 3TANA 3RMBA 2HHUA 1S1XA 4GMJB 3TAEA 1A5WA 3AO5A 4E89A 1KFSA 1S1UA 1RDDA 3IAYA 4CHZA 4W5OA 1QE1A 3SUNA 3L2VA 3DLEA 4DFKA 1BCMA 3T19A 3VQDA 4I9QA 1BIZA 4O44A 4CGJA 4NCBA 5HBMA 3KLEA 1NJXA 1NJZA 4E19A 3ZSOA 2X78A 5C24A 1KTQA 2ZD1A 4FZYA 2I5JA 4CERA 3DLKA 2Z1IA 3NE6A 1X1PA 3G10A 2D0CA 3OVNA 2O4GA 1KVBA 3LANA 5FDLA 1X9WA 1U04A 4HCCA 4CJ3A 4FLZA 3NH1A 1WAFA 1LWEA 4BWJA 4LSLA 1UA0A 4N41A 3NF6A 3C94A 4DMNA 5C42A 3LDSA 1S6PA 1I39A 1ZYQA 3L2RA 3LPUA 3AVLA 5J2PA 1HNIA 3ALYA 3LPTA 3OYBA 1Q9XA 4B9SA 2XY8A 1VRUA 1JXBA 1TL3A 4CEOA 3L2WA 3MEEA 3RMAA 3F9KA 1T03A 1O1WA 5SWMA 4CHPA 3HPGA 4AHTA 4DU3A 3ULDA 4ELTA 4M3YA 3NCIA 4QAGA 5SZTA 3D0PA 1KRPA 4DSJA 4Z4FA 1SV5A 1L3VA 4CIGA 4IBNA 3SQ2A 3RRHA 3LP2A 2GBZA 4RW4A 2OPSA 4ICLA 3HP6A 4KREA 2OPQA 1W9HA 3VQAA 1NK0A 4HVJA 1BCOA 3QIOA 1WSGA 4BWMA 3S3MA 4E0DA 4FJGA 4CGFA 3SPZA 1RNHA 3ZSRA 1IKXA 4CGGA 4Q0BA 3TWHA 3OYHA 1EKEA 3NFAA 1SL0A 4G1QA 4KFBA 4B9VA 4HTUA 1U45A 3NH0A 4CEEA 1LV5A 1LAWA 1MU2A 3AO1A 3QINA 1Q8IA 3OYGA 3CQ8A 4CFAA 1RT7A 4CJEA 3RTVA 1XI1A 3OYJA 1KVCA 3M8PA 3I0RA 3DOKA 3QETA 1NOYA 4B3OA 4M3RA 1EX4A 4N47A 1L3TA 1C0TA 4RW7A 1J53A 1JL2A 2KFNA 2B6AA 4DTXA 3CFPA 2X6NA 3ZT2A 3SJJA 4HCBA 2E6MA 2JLEA 4DS4A 4DQSA 3AVCA 3PUFA 3I8DA 2VG6A 1C1CA 1G15A 1TGOA 1VSHA 5CYMA 3HPOA 3LWLA 1N6QA 1T05A 1QS4A 3AVNA 4AHCA 2OPPA 1ZBHA 1JXEA 4CEBA 4DSLA 3M8SA 2VWKA 3K5OA 4H4MA 4FCYA 4NYFA 3SV3A 3DMJA 3K59A 3PO5A 4CJPA 3OS0A 1S9EA 4AHRA 3AVFA 5CY4A 3TAFA 4FJ5A 4EZ6A 2D0AA 1VK0A 3CFRA 1J5OA 2QXFA 4O55A 1QHTA 1ITGA 4CK3A 4KTWA 3CM5A 4PWDA 3G0ZA 3WNEA 4CHQA 2A1RA 2F8TA 4N5SA 4CJ4A 1IKVA 5KGWA 3OYDA 1NK9A 1S1WA 4NYNA 2HMIA 3VQQA 4N56A 4OLBA 4N76A 1WNSA 4CIFA 4NCGA 4KTQA 3OYMA 2ZQBA 3OY9A 1S9GA 2E6LA 2IS3A 4CF9A 4E7JA 5HLFA 1RTIA 4LH4A 2E4LA 4I9LA 3ZT4A 3WNFA 2BGGA 4EP5A 3V1QA 4J2AA 1FKPA 3NF9A 1TV6A 3U3GA 1TAQA 4CGHA 1L5UA 4DQQA 3QESA 2X74A 3IS9A 4CK2A 4DTRA 3QEWA 1CZ9A 4PA1A 4YNQA 4E1NA 3TAGA 4CFCA 4JLHA 4FLVA 1IO2A 3AVBA 4CF0A 1NK7A 4KHYA 1D5AA 1RDBA 2Z1JA 2B4JA 2JGUA 2FBVA 1VSKA 4BDYA 2Z1HA 3SV4A 3MXJA 4IG0A 3ZT3A 2EHGA 1EETA 3MXIA 2BDPA 2QKBA 4CFBA 1BISA 2DFEA 2YHBA 5C25A 3OYAA 1U4BA 1NJYA 2QKKA 3KD1E 1TAUA 1RTJA 1B9FA 3E01A 2ATQA 1BI4B 1RTHA 2HNDA 3DRRA 4CEFA 1F21A 3T3FA 3PO4A 4CEAA 4CJRA 3VA3A 2YKMA 1TKTA 3VQ5A 3V81A 2Y1JA 5HP1A 4DFMA 3ZSXA 1TK5A 1ZBIA 2PW9A 1NK5A 3VQ9A 4FLWA 5K14A 3ASMA 2G8WA 1BGXT 1BI4A 3DLBA 5J2QA 4K8XA 3ZCMA 2Y1IA 4F4KA 2OA8A 3V9UA 4E7HA 1SKRA 3EYZA 3KLIA 1D9FA 4KB1A 4DTOA 5HRSA 3HSTB 5T7BA 4FJNA 4KHNA 3AA5X 4ZTFA 2G8FA 1REVA 4FJXA 4FM0A 2P5OA 2DFHA 3VQBA 4OKJA 1RTDA 1TKXA 3M8QA 4FJIA 1YTUA 2F8SA 4KI4A 1LAVA 3AA3A 4RW6A 1VSMA 3JYTA 4M3UA 4DTSA 1DLOA 3HYFA 3HM9A 1J54A 1NOZA 4CF2A 3KD5E 4M3WA 2P51A 4L8RB 2R7YA 1IG9A 1VSLA 4Z4HA 3QEIA 1GOBA 4KAZA 4KHSA 1UWBA 4B9LA 3AV9A 4DTMA 3KKSA 3QNNA 4ZTJA 4FJKA 1VSJA 3KLHA 4CJWA 3U3YA 4M45A 1LW2A 3SQ0A 3C6TA 3CG7A 3V9XA 4NCAA 4XIUA 2HB5A 3CYMA 4FZXC 1TKZA 4KRFA 4BE0A 2F96A 3H08A 4MQ3A 4W5RA 1IH7A 3U6FA 4CJFA 2PYJA 3LP3A 3HJFA 1CLQA 3KK2A 3V1OA 2WONA 2VG7A 4DQIA 4KO0A 3TAQA 2D5RA 4CEDA 3NF8A 1I3AA 4OVLA 3OYCA 4CESA 4FVMA 3OYIA 3VA0A 4FJJA 1BQNA 3CFOA 2G8KA 3ZSVA 3V4IA 4DF8A 3AVGA 4IKFA 4FM2A 1IKWA 4FM1A 2RKIA 4O0IA 1RT5A 4E1MA 4E7KA 3SUPA 3HL8A 3SUQA 1QSLA 1KFDA 3L8BA 4HUEA 2XRIA 5JS2A 3SNNA 3BGRA 4R5PA 3RR8A 4O0JA 1NK4A 4KKOA 1TL1A 3KKRA 3WNHA 3HK2A 5CZ1A 2GV9A 2P1JA 3TARA 1HQEA 3AVHA 4KB0A 1EXQA 4DLGA 4FW1A 1J9AA 3HVTA 3DM2A 4CEZA 4DQPA 1KSPA 2HNZA 2YKNA 2FBYA 3VQ4A 3DLRA 3TAMA 3MAQA 3ZT1A 2XO7A 3M8RA 2VWJA 3K2PA 1KLNA 4FLYA 4LH5A 1A5VA 4CJLA 1D8YA 1HRHA 3HO1A 3CM6A 4OJRA 4E7IA 3HPHA 4OKKA 1CZBA 3AVJA 1HYVA 4RG8A 4IDKA 4TSXA 4LD0A 3BDPA 3SQ4A 1RDCA 3NHGA 4CECA 4DSFA 3NGIA 2HNYA 1S6QA 2ITGA 4DU1A 2YNIA 2KZZA 4KV8A 1Y97A 2KW4A 2HHXA 1JLEA 1YVUA 4FLXA 1GOAA 3WNGA 4DTPA 3A2FA 3S3OA 4QOZB 4C8KA 1RBVA 4CJ5A 2R7FA 3KK3A 1UAXA 1YT3A 2HHTA 1ZBLA 4IFYA 4LSNA 1QSSA 2GUIA 4OKEA 3K5LA 3ZSQA 3OS1A 3KK1A 2HHVA 1ASVA 3QIPA 4H8KA 2HHQA 3THVA 4B9UA 2HW3A 3SCXA 5HRPA 3KLGA 5I42A 2EX3A 1HJRA 1RBRA 2G8IA 1JLQA 2VG5A 3O4QA 4OGCA 4F8RA 3QEVA 1WSHA 3LALA 4KTZA 4HHTA 3QLHA 4ID5A 4M3XA 5EU7A 2IGIA 3RMCA 4Z4IA 1VSEA 4CGDA 1JLFA 3PX4A 4RW8A 3OYFA 5D3GA 4B08A 4KHUA 3AA4A 1RBUA 2RF2A 3T1AA 4AHUA 1SL2A 1QQCA 4Z4CA 5FRNA 3SI6A 4JS4A 2WOMA 4BDPA 3AA2A 3ISNC 2IDOA 3QEPA 3K57A 4C8NA 4BE2A 1XC9A 1SKSA 1CXQA 1EP4A 3RR7A 2QK9A 1JLBA 4CJVA 4CJUA 4CIEA 2PYLA 4E3SA 4K8ZA 4CFDA 4IG3A 2XHBA 3FFIA 4FZZA 4AH9A 1B92A 3QO9A 1B9DA 3TABA 3K5MA 3VQEA 3PY8A 1WAJA 4ID1A 1X9SA 4E7LA 4DTNA 3OYNA 4Y1CA 2D0BA 3LAKA 2O4IA 4O5BA 1ASWA 2XY7A 3O3HA 3HVRA 4B8AB 3QEXA 5J2NA 2Z1GA 4W5QA 1RILA 3LWMA 3FI7A 1W0HA 4DQRA 1C0UA 3SYZA 1HYZA 4I7FA 3VQ7A 1NK6A 4HUFA 4CK1A 1RT2A 1RDAA 2G8UA 1NKBA 1BQMA 5KRTA 4IFVA 3JSMA 3SZ2A 3RMDA 4B9MA 3RWUA 3PX6A 5CZ2A 1KCFA 3QERA 2G8VA 1NKCA 1TKDA 4H4OA 1WLJA 1Z26A 4WE1A 4FLTA 4CE9A 4W5TA 4FK0A 4PUOA 1DTQA 2YNGA 1C1AA 4OLAA 2P5GA 3VQ6A 3AVMA 1U49A 1N5YA 2OYQA 4GW6A 4DTUA 3IG1A 4DSKA 3OJUA 4Z4GA 4DWIA 1L3UA 3V9ZA 3HXMA 3V9WA 5I3UA 3EY1A 3DLGA 5HROA 4DFPA 4FJ8A 4M3TA 2DTUA 3DYAA 1ZBFA 1BL3A 1VSFA 3MECA 4B8CA
chains in the Genus database with same CATH superfamily
5LOVB 1YTAA 5B1OA 4QIWF 4B3SB 3H1QA 4FXDA 3H1JH 2E75B 4YJ3B 1JX9A 2RCVA 1R3IC 2LSNA 4X66K 1LUVA 3FD9A 2PBDA 4OLAA 1XMQO 1UA1A 3C6UA 1G4YB 2ZM6K 5IT9O 1IZ3A 3P4SA 3OS2A 2PLV4 5AZIA 3QB0A 2IC3A 4YY3K 4DV5B 4JTAB 1Q86W 4JKEA 4BR5A 2HVHA 2RS34 5LGTA 3RSEA 3VQCA 1GO3F 3SPJA 5J2MA 4M3ZA 1KB9F 3OGIB 4DRXB 1ZSPA 2DE0X 2N74A 2ZD9A 2WDRA 1KAYA 3BF3A 2EIJB 4WBNA 1NKDA 1AR4A 4YXWG 3CD6V 2AA4A 4ILJA 2FTKA 4Y0WA 1ZUQA 1RFYA 5TKWA 4BVPA 4JRQA 2OZMA 1CEZA 4CZLA 3JSNA 3NXSA 4X8AA 1N32K 3CRCA 5KRSA 2ITDC 1DF4A 1R6NA 1OV9A 2A1SA 4GV3A 3SUCA 4ELVA 4YHHO 1WA8A 1U48A 1LUWA 4O4IB 1CZAN 4CBUA 1VSDA 4TQDA 3OR6C 4IO9L 4JV5O 1ZBSA 1T8EA 3L71H 3L2UA 2ETJA 4UCRA 2PUSA 4B3TB 3VEZA 1ZL8B 2V7YA 4A2AA 2X6AA 1EBOA 1ASUA 4TT3G 4FJMA 5BR8O 3E22B 4QCLA 3A5MC 4OGEA 4JI6K 4PV1B 3UIQA 3I0SA 3VEXA 4KHPK 4KX6A 4MW8A 5EIBD 3B8AX 1XHXA 2IU3A 4FZ0A 2CAZC 4MTFA 3HT3A 4UCSA 4B9TA 5ADXA 4DR6K 5E26A 2HHHK 1SA0A 3IRXA 2CTRA 1PV0A 3DI6A 1M4UA 4DV7B 3LP0A 3A0HZ 4ZHRA 4JK8A 1RUI4 2W0XA 5FPDA 2D2CB 2XAFA 4F3OA 1MNGA 3ZRSA 2P9IB 1HNXB 1RT1A 4LF5K 1Q9YA 2GBOA 1PKXA 3OYLA 3RN4A 3THXB 2W6LA 4MVQA 4X65B 4JI7O 2JS5A 4NB4A 4DSEA 5IWAB 3DOLA 4DR5O 3S41A 4IOAL 4FK2A 1RBTA 5CYQA 3ZMSA 3SJBC 4DR7O 1FJGK 3VOUA 4UVAA 2NUBA 1GOCA 3OYEA 1NTKH 4G27B 1S1TA 3U0ZA 1AR1B 5LYJA 4OPJA 1EN4A 1VQON 1B3QA 1C6VA 1BU6O 1NK8A 1PL0A 4J2BA 2BANA 3T1YK 1NVPD 1KXPA 2QWNA 1RBSA 2W42A 4W5NA 1LWFA 5HRRA 3OYKA 5C8YB 3CCLN 1R1BA 3T1HO 2KHOA 4C8LA 4I0XA 4O2AB 4YOXA 5C93A 1BS3A 4Z2WA 3P83D 1K5SA 2ZNJA 4H5VA 4I2QA 2KTQA 3AO4A 3W7XA 2KZMA 4Z4EA 4BIZA 2QW9A 2GUZA 4DG1A 3ETGA 2GSMB 3KWGA 3B2EE 1VQPN 1K6YA 3MEGA 2KQXA 3JCZA 4BRPA 2OZSA 4YFUA 3OTOK 1QTMA 4HYOA 3KIOA 1K7DA 4FW2A 5F1XA 1ASJ4 1Y6XA 1D4XA 2QEXN 2PY5A 1K8KA 1TVKB 1NM1A 1E3MA 4C8OA 3FB5C 3MN6A 4GVMA 4JAXA 3CJHB 5DK5A 3NGZA 5KMGB 1BIUA 3ZMTA 3CB2A 3W7WA 1YZBA 5JVDA 1THZA 4IFEA 2P67A 1NGEA 3FX7A 2CTWA 3O80A 2EZOA 4A59A 5JVHL 3AAPA 1NZ6A 1WSEA 4CGIA 4GYCB 3WG7C 5JVGL 1R084 1Z5VA 2X6CA 3MEDA 4CZJA 3SPYA 4FYDA 4DKWA 4QPKA 4YOWA 1Q81O 2Z5UA 4I5SA 3LP1A 4FK4A 4BR7A 3K9AA 5KUKA 4Q5VA 3P4RA 2Z0AA 4KXRA 5M1OA 2OTLN 1DTTA 3EZ5A 1LWCA 3VN5A 5LP6B 4TV9A 4GMJB 1AP6A 3AE2A 3TAEA 3K0SA 1S1UA 4W5OA 5CBHA 1QE1A 3CYOA 3GE1A 3RSEB 3SUNA 3L2VA 2R9IA 2JWKA 4I9QA 4O44A 4CGJA 5EK0A 5HBMA 4AQYO 4E19A 2P90A 3JAWA 2X78A 5C24A 2L6LA 4WBNB 2A0LA 2E74B 4BW9A 3ZSOA 4CERA 2R064 2Z1IA 1XREA 4JI8B 2HWC4 1FXKC 4D6TH 2GUPA 5LHHA 5FDLA 1X9WA 1U04A 1WAFA 1LR1A 1LWEA 1C0FA 3CC4N 1WA8B 2YJFA 2EIKB 4U7OA 1BQ0A 4DR3B 1NGIA 2QDOA 1VAZA 1ZYQA 1QQMA 2OCHA 3AVLA 4QS8A 4BVOA 3K03A 3LSSA 4O4LA 4LF7O 2UXDK 3OEHG 3AEIA 1TL3A 3L2WA 5EZYA 2QWRB 3QFPA 4PHZA 5L3FA 4DU3A 1A32A 4KUMA 4G28B 3VQWA 3ULDA 3NCIA 4QAGA 2ARHA 2HBLA 2GTAA 5SZTA 3D0PA 2IBZH 1KRPA 1L3VA 4IBNA 4IWVA 3RRHA 3WXLA 1HNWB 1BG3A 1T6CA 1BMFG 1AR84 2VYPA 5D5PA 3S3WA 3ZIAG 2Q67A 1AJPA 4JZ2A 4ZKIA 4EHTA 1NK0A 3ICXA 4GY2B 1WAZA 4BWMA 3CCVN 2ZDIC 3CJ9A 4FJGA 2E5LK 1Q82W 4UY8O 1SA0B 4CGGA 4LF6K 1XQSC 3RBZA 1N4CA 3NFAA 1SL0A 3DJCA 4KFBA 4GUNA 2P9SA 4HTUA 1XL6A 2OTJN 1MMMA 1R6TA 4ISEA 4C7UA 3P38A 3MD0A 1Q8IA 3ZRXA 4R8CA 2ZE7A 4JPRA 4DV1O 1MDUB 1NMDA 3CQ8A 3X2QC 3AE6A 3H45C 4B3MK 4CZKA 4DV0K 3LDOA 3UQ8A 2JEXA 3EXAA 3I0RA 4HNAA 3J8AA 5B1NA 1L3TA 2VQFO 1NGBA 4JYYA 4PA4A 4DTXA 3SFDA 3FLCO 2JLEA 1BSMA 3AVCA 3RVCA 4A5BA 1XMOB 2VG6A 1C1CA 1IBLB 1G15A 1VSHA 5CYMA 3C3TA 3EE9A 3LWLA 4U3FH 2CH6A 1T05A 1OZ0A 4AHCA 1ZBHA 4CEBA 4DSLA 4GB34 2ZE5A 2VWKA 5F2RA 2QWNB 3M8SA 4FCYA 3SV3A 3AY9A 2X5ID 4Q4X4 3OS0A 1V55B 4O2BA 5M1QA 3AVFA 4B3SK 2YJEA 4FJ5A 4H5NA 4EZ6A 2NR5A 5JQGB 4K0KO 3QF7A 1N33B 3C6AA 1ZXOA 2JGDA 4CHQA 3LDEA 1GK9A 4CJ4A 3OR7C 3ETDA 3LNMB 1S1WA 2HMIA 1IBKO 4B1YB 4N56A 2GUZB 3E9PA 1JCEA 2CE4A 4CIFA 2E6LA 1F51A 4JZGA 5HLFA 3ZT4A 2E4LA 4DV3O 4A62A 5BR9A 5M1KA 1FKPA 1K9MO 5BPNA 4DV6O 1MA1A 1K8KB 3WFVA 2UU9B 3U3GA 4CGHA 2QWLA 4P9PA 3IS9A 4J10A 4YNQA 2F93B 3TAGA 4CFCA 4JLHA 1IO2A 4WQ5C 4EFHA 5JVDB 4LC9B 4KBOA 4X64B 1RUD4 5DEDA 3AEDA 3QO5A 2FKXA 3VRBA 2JGUA 4QE7A 2CGKA 3G25A 1VQLN 3MXJA 5BREA 5IDJA 4LBEC 5EX5A 4B3TK 3SMPA 4CFBA 2QKKA 1U4BA 2EINB 4JKFA 1NJYA 3ZRWB 2IH1C 1Z5WA 4CEFA 3H1KH 3HKEA 1BI4B 4G9ZA 1J95A 4BW5A 1F21A 2H89A 4TV9B 4MVSA 4LF4O 5KHHA 2F43G 2Y1JA 2OIEA 1BT8A 1YTFD 4NXMK 4FLWA 3A0RA 2LFRA 1BGXT 1B06A 3AK2A 3JAWB 3CCMN 1AILA 3A5LC 2IJHA 4X1IA 2Y1IA 2OA8A 3V9UA 3QO8A 3EYZA 1JR9A 2YIDA 3AG4B 2V52B 2Q73A 3QVNA 4DO2A 4KHNA 3AE4A 4ZTFA 2G8FA 3ASNB 1GLEG 1OCRC 1SRYA 2CGOA 3APOA 4FWMA 2YXLA 3TPQA 3TK1A 2QM8A 1HNXK 3CXCM 5BPLA 2YXHA 2ZR2A 1OH8A 4CD3A 4WFNL 5LJWA 3CJBA 3SAFA 4WFAV 5GW7A 3IKMA 4FMTA 4DK0A 1M90W 4CF2A 5IWAK 1BGYH 2MK3A 5EZYB 4ZBMA 1GOBA 4KHSA 3U8XA 4B9LA 4PI2A 4YTNA 1HNZB 3SAHA 1H38A 3UKMA 1I94O 3KLHA 5KX5A 4M45A 3AAQA 4I50A 3CHWA 2Y0PA 3V9XA 3QO7A 3VRAA 2HB5A 1NH2B 2R72A 3RW0A 1GLCG 4KRFA 2HFEC 1S3XA 4A5UB 3HJFA 3M7MX 3U6FA 1US6A 3LP3A 1O9HA 2IVOA 4DR2K 3VENA 3CMAN 2FBWA 3EHBB 3ZN0A 3H3OB 3ZHVA 1ZX3A 1NGJA 4H0VB 4CESA 4X1KA 3OYIA 3D3IA 1WBBA 3V4IA 4DF8A 3OT7A 4IKFA 2N04A 4FM2A 1IKWA 1T5EA 3MDSA 3P3PA 4FM1A 1K73O 4OX9B 4JAVA 4E1MA 4O0IA 3CPWM 5JWPA 1VP7A 5AQGA 1ZWIC 4GX2A 5JS2A 2WWWA 3UT5A 4HNAB 1HR0K 1NGDA 4UVBA 4KKOA 2LO1A 4PKGA 3H9VA 1BE3H 3TARA 4YT0A 5LHGA 4QS7A 2XTAA 1EO1A 4BRQA 3CC2N 5M1FA 4B1WB 2HNZA 4FZ1A 4IIJA 1UFIA 2FBYA 2YKNA 4JI3B 2E2QA 3DLRA 1S22A 4DUZK 1M5IA 2E3CA 4C1NI 5FPRA 4FLYA 1A5VA 4CJLA 4GVEA 3AGKA 3B09A 3CM6A 2QWPA 1VRH4 2X0LA 5KLVH 1CZBA 3OUSA 4RG8A 1EFRG 2Q2RA 1YAGA 1GKFA 3E66A 3BDPA 3VGLA 3SQ4A 2JIZG 2WLKA 1RDCA 1T6DA 3OBWA 1AB3A 2F9WA 4CECA 2HNYA 2ZXWB 1S6QA 4DSFA 4DU1A 4BC3A 2KW4A 2HHXA 1JLEA 4LWSA 2F66C 3S3OA 4WFBV 3SJHA 3M3ZA 3G4SV 4DV5O 4GX0A 2ZQMA 1BO5O 4DV2K 1R3LC 3THOA 5KPTA 4IFYA 2UUCK 2GUIA 4BY9C 3KK1A 2F4VK 2HHVA 3QIPA 4H8KA 1Q3EA 4I9WA 2HHQA 1X4TA 3THVA 5CN0A 4O5FA 4NTYA 3MK6A 2LQTA 3KLGA 1HJRA 3BY5A 1AROP 3D7EO 1WB8A 5AQUA 4M3XA 4HHTA 4Z4IA 3QLHA 1JOYA 5JICA 4DR3K 5D3GA 4RW8A 4BG8A 2O8CA 4B08A 4GV6A 1NS1A 3D2EA 5FRNA 3SI6A 3CXCU 2WOMA 5CA0B 4BDPA 3ISNC 2EIJC 2CH7A 1RP3B 2EILB 1BHAA 1IJJA 1RFQA 3JASB 3ETEA 1XQ8A 1FFXB 1NR1A 3H1LH 1EP4A 4HTLA 3RR7A 2OIGA 3HKEB 1JLBA 1LOTB 3O9UA 1JJ2M 1HNWK 2RE2A 2XHBA 2WPDG 3THWB 1YIJV 4AH9A 3TABA 3QO9A 2HKOA 4LCUC 3WXJA 5GADP 1W7AA 1HLUA 1X9SA 1JFFA 1KMIZ 4BR6A 1GLDG 2A6AA 4HZ3A 5CBGA 1MA9B 4DTNA 4KHPB 2V1DA 2XY7A 4X1IB 4CBCA 4B8AB 2I7PA 5J2NA 4UCOA 2Z1GA 3FI7A 2HJDA 4DV7O 1NK6A 3JARB 2B76A 3I56V 1RT2A 1RDAA 2DWEC 4K41A 5FLXN 5LGNA 2RS54 1PO24 1OCCB 1RPRA 1Z2GA 4B9MA 2IJKA 4I4TA 3ZX6A 5CZ2A 4IEEA 2YHXA 2QWOA 2G8VA 4NYKA 1WLJA 4PUOA 4FLTA 4FK0A 3CPWU 4X65O 5J9PC 3U9ZA 1H2MA 3JD2A 1V9PA 2YNGA 5JCOC 4LF5B 1KC8O 2A3QA 3ABTA 2A06H 2JVDA 3CXHF 3Q4HA 4JAUA 2ZF5O 1U49A 1GAXA 3OW2M 3CCEN 4M7YA 5KX5B 4A5AA 1P7BA 1IV0A 1XMOK 3N27A 1IBLK 5BXZA 3ZETB 1NU0A 1FS0G 3HXMA 1YJNN 3U9DA 1BL3A 1BZKA 4B8CA 3ASOC 1FJGB 2GDSA 3HOSA 1UOCA 3VQPA 1YQ3A 3BA9A 5AQNA 3K79A 4BGAA 2UXCB 1N33K 1E79G 1F7YA 3GQKA 3O3FA 1M57C 4IOXA 4F2SA 5LMNK 2WA4A 1N36B 1BDGA 3T1YB 5AQTA 1K34A 5LOVA 4CJSA 1C1BA 3B40A 3LDQA 4PY5A 4DU4A 3EO3A 3BP8A 5B1AB 1H8HG 3UT5B 4DLEA 4O8KA 3CD6N 1I7FA 2H3OA 4K42A 2O57A 3TXSA 1IXMA 2CUGA 1COWG 2AZ0A 1FK9A 3ABKC 4MTOA 4D7SA 4CCHA 4Z1VA 3P1GA 5AFUH 4CJQA 2JJ1G 4LFAO 2IIRA 4RTFD 5L3CA 3HP9A 2HLDG 3OTOB 1J5EB 1C0GA 3V1RA 3KLFA 4X64K 1LW0A 1XC3A 5EOYA 2QWPB 5DMRA 1Q43A 5EXWA 3AG3B 1JCHA 3ZBHA 2J4RA 4B7EA 2R9RB 1S1VA 4JKBA 3LZJA 1QVFM 3K5NA 2IAJA 3KZIZ 2UYTA 3MXMA 3M99B 5EYPB 3WXKA 2XY5A 4LWSB 4IXCA 1NTZH 1SUQA 1CXUA 2M6YA 4DQ8A 1NMNA 2QSAA 5H5NA 5LMUO 1ZL8A 1VBD4 4UFZA 2HF3A 3SUOA 1KUQA 1JJ2U 1Z25A 4KHQA 3E22A 1GLBG 3ML0A 3F73A 1AR74 2YNFA 5FLXO 4BRMA 3TI0A 5E41A 4JI4B 2JJ2G 1YI2V 4CJTA 4I2PA 1XEQA 5K1PA 4JI8O 3PSFA 3AG2C 4H0OA 2WAMA 2E1ZA 4PA9A 5C10A 2Q1NA 4JV5K 1XHZA 2G38A 3AVAA 3QICA 1JL1A 5C0YA 1VQ5V 1JA8A 1FXXA 1W97L 4JS5A 4GKJO 3L3UA 2KG7B 4N23A 2HMPA 2CH7B 3JALB 4JRPA 2P9IA 1HNZK 1WSFA 5AQKA 2RPIA 1D9DA 3LDNA 4EP4A 4LFCB 4WFAL 1T44A 4D7TA 2FBTA 1NQTA 3WB2A 2UXDB 1VQNV 2EIKC 4UV9A 4FWPA 1S5JA 3OW2U 3LM9A 4UVCA 3GBTA 1H8EG 3RGBA 4DV4O 5A9GA 3G71V 4M42A 3IUCA 1VRTA 1GH6A 3VR9A 2QM1A 1L3SA 4XEIA 2A5XA 2CDYA 2NRZA 2E5LB 4M41A 3N4PA 3E1YA 4OX9K 1QSYA 3E8BA 4LF6B 4B1VA 4U67L 4PDLA 2XT9A 4O2AA 4DR5K 4FJ9A 2Q7GA 4DTJA 4MW3A 5AG2A 5LBQA 2NRWA 1KVAA 1M1KW 4MVZA 1HRV4 1IBMO 3ZHSA 2XNDG 1ENVA 4PA3A 4B3MB 1YF5L 2FSKA 4XDJA 3CQYA 1VHXA 1VQ6V 1MG1A 4MVOA 3QNOA 4JI3K 2YNHA 3O9RA 3R1XA 2CTPA 2HG5C 5J1EA 1RHI4 4GZRB 3ABUA 1BHLA 1HNVA 2G8HA 3T1HK 4DUYO 4FJHA 2QI2A 5CR4A 1A5XA 1IKYA 1S0VA 5KI6A 1VQMN 2W0FC 1DLBA 2ACZA 3EKSA 2PAVA 4YTMA 3CJHA 3KCXA 5KMGA 1BL8A 3SNNA 1AJQA 1AI6A 4DK1A 2OWOA 1QVFU 4FOIA 3ENOA 1OCZB 3P5JA 3RMBA 1S1XA 1A5WA 4I7ZB 1RDDA 3IAYA 4CHZA 1YDXA 1YHQV 3U11A 5FPNA 3VTHA 1BCMA 3VQDA 5MLCQ 2OT5A 1V55C 3JYCA 2NN4A 3SDLA 1NJXA 4XH5A 1DEJA 2HVKC 2LW7A 5LP6A 1KTQA 2ZD1A 3R3LA 1HKCA 1Z05A 3DLKA 4WFBL 2WA3A 3MN7A 4WFHA 4BR9A 3LDLA 1ORQC 2GELA 4V19S 2ZNIA 3LANA 3TTDA 4HCCA 3SJQC 4FLZA 5KAFZ 1U97A 4DR6O 4LSLA 4N41A 1GTOA 3CSXA 4DMNA 1S6PA 4LF9B 4R79A 3AEGA 3D36A 3LPUA 5J2PA 2P4KA 1HNIA 4B9SA 4ZIBA 1FFTB 5JJEB 3APQA 2UUBB 3AK3A 1JXBA 3OBYA 3VQYA 3CRMA 4QJFB 1O1WA 4IJAA 2OCCB 3R66A 5LXTB 1Q7YO 4Z4FA 1SV5A 4NTXA 1GRJA 5CB4A 1IXBA 3C3SA 1VBB4 4Q4W4 4FWOA 2UXBK 2QWRA 3LL3A 3VQAA 4RUEA 3QIOA 4E0DA 3CJCA 3RT3C 3O1BA 1M56C 5LL6Y 4GKKK 1R094 1NCQD 5B1BC 1YJWV 2EINC 4G1QA 4B9VA 1N34O 1YITN 1U45A 3NH0A 1LV5A 2BOBC 5LA6A 3E89A 4NXMB 1OVYA 2UUAK 3SYQA 3PLAA 2F1MA 4JI2B 3OUFA 4JD2A 3OYGA 5C2TA 1RT7A 4LF7K 2WLHA 3A5OC 3C0BA 3VESA 3SYAA 2WSSG 1KVCA 5JMVA 3ID6A 3M8PA 3DOKA 4LF8B 1OCOB 5HFMA 5TISZ 4NXNO 4CC5A 3L0QA 4RW7A 1JL2A 4H0XB 3W0LA 3SPGA 2X6NA 5H6RA 1KD1O 4HCBA 3J81N 3MCPA 2PI4A 1MWMA 2P9LA 2NZTA 3I8DA 1VQ8N 3ULEA 5F2VO 2B9ZA 5EC1C 1NJIO 3HPOA 5KHKA 3I55V 3E2EA 2CGJA 3AVNA 4O8UA 1JXEA 4CVNE 3K5OA 4JASA 4DR1O 4H0PA 3QNEA 3K59A 2ODMA 4CJPA 3BHPA 3VERA 1AI7A 3ZRVA 4LH6A 5CY4A 4FJCC 1VK0A 1OVQA 2UXCK 4JI5O 4O55A 1ITGA 4JI0O 5JLFA 2ATKC 4JGSA 4KTWA 4MLEA 3VEYA 4PWDA 1AR64 1N36K 3IJ4A 1GM9A 1KYOF 3FB8C 2NLXA 4X62B 1NK9A 4DR2B 4NYNA 3CCSN 5FPOA 3VQQA 4A2BA 4OPHA 5JQGA 3B8MA 1NLVA 3OY9A 3ABLC 4EKWA 4LH4A 3FZFA 4CH3A 3EFFK 4CBWA 2VCPA 3V1QA 1MOFA 4J2AA 2L35A 2IJJA 1TV6A 2ADPA 5IY5B 2AHZA 1NOYA 1L5UA 4DQQA 2X74A 2YICA 3VOVA 4DTRA 3UE5A 1Q86O 4PA1A 1K3EA 2YS8A 3C90A 4E1NA 3IGAC 4C1NK 4OPAA 2BTOA 1HR0B 3THYA 1NENA 3PIOL 4FLVA 1J5EK 3AVBA 1D5AA 3GG4A 1SETA 2Z1JA 3AE7A 2FBVA 4K0KK 3GQHA 3ZT3A 4BQLA 3UM7A 2BDPA 1E4GT 2UXNA 1KQSM 5JS1A 1BISA 2YHBA 3TCUA 3SYOA 4DUZB 3MX2A 4H5TA 5C25A 1TAUA 3BZCA 1Q18A 5AQSA 1H8TD 1IBKK 3E01A 3O8MA 4I6MB 1QNMA 2P22C 3E9OA 4CEAA 4O4JA 1SQGA 1I08A 3AG1B 2H88A 1N0JA 1Y74B 1GM7A 3O9TA 3ZRWA 3VQ9A 4DV6K 3CCUV 4X66O 4MVRA 1NGAA 2GTSA 1BI4A 4YOYA 5B3SB 2ZM6O 1P90A 1Q6HA 1U6ZA 4F4KA 4JI4K 1MZEA 4YY3O 4DV2B 3KLIA 2XAGA 4DTOA 1I5XA 4MDAA 4J42A 4NLCA 4LP8A 2UUCB 4WCEV 2WLIB 4FM0A 3VQBA 3G6EN 1RTDA 1RSOA 4AI8A 2K1EA 2F4VB 4KI4A 3CE2A 1XDCA 3AA3A 2B1GA 1DKGD 3MN5A 3VF2A 2DYSC 3LUTB 4X89A 1DLOA 3J81O 3K04A 4RHV4 4H0LB 1EN6A 4M3WA 1IG9A 2ZKOA 1N32O 3QEIA 3D6RA 1S72V 4KAZA 5JLHA 3AV9A 3TSPA 1YSCA 2YXYA 3QNNA 1VSJA 4CJWA 4LFCK 1LW2A 5CB4B 2VRZA 3GL1A 2VQEB 4XIUA 3CYMA 3N2KB 4FZXC 3A5NC 2ZR3A 1K9MW 4BRKA 2WLNA 4BE0A 3IDHA 2WLJA 1IH7A 1JQ0A 3KG2A 2EIMC 4RO2A 3OMAB 5IJ9B 2V51B 4QGPA 2WONA 3L9DA 5KA5A 4JK7A 4JKGB 2KKWA 3NF8A 2EILC 2Y69B 2QXLA 4JI6O 3Q7CA 1Q6IA 4OVLA 4FVMA 3MHHC 1WUAA 3JYTA 3SBGA 5LA6B 3J7AU 2G8KA 3AVGA 4RQEA 3GWOA 4JD2B 5C3JA 2GHYA 3JSLA 3HL8A 2HHHO 3SUQA 4MVMA 1QSLA 2XRIA 4F6RB 2OANA 3BGRA 2WLLA 5AQVA 3ZX3A 4MTXA 1S76D 4M63C 1TL1A 1SS6A 5KHIA 1VQ7V 2CGNA 2F23A 5AQHA 1HQEA 3AVHA 3ZHTA 4KB0A 4DLGA 2IW5A 4CH6A 2Q9LA 4LF5O 1J9AA 4FW1A 1VQKV 1MSDA 3J7ZO 3JD4A 2P9LB 2RS14 4DQPA 3ULEB 4RWUA 3JAKA 4J8FA 2VWJA 1SKVA 4JI1B 1JCFA 4LH5A 2E20A 1HRHA 4MSWC 3L75H 2RR14 4QE9A 4CBXA 1QBZA 3CCJV 3MMVA 1V54C 4U7BA 3RWRD 2AHYA 2DN9A 4ICGA 1YTFB 2YNIA 2KZZA 4M7XA 1VIBA 1MABG 3CMEV 3M6GA 5EBWC 1YVUA 2BTQB 1KQSU 2E2PA 3DAWA 2GTDA 3WNGA 3A2FA 3G4SN 4C8KA 2R7FA 4CJ5A 1N8RW 1ZBLA 4PJ0Z 2YCHA 4OKEA 2IVNA 5BRDA 5LMNB 3K5LA 3KK7A 1XNRK 3H1HH 2YIAA 1RUE4 3I8BA 4MTGA 3MHSC 2Q97A 1S5LZ 3SCXA 5HRPA 3THYB 2G8IA 2EX3A 3G6BA 5JJNB 3A8TA 4QS9A 5FPEA 1XNQO 4F8RA 1AVMA 4KTZA 4ID5A 5H9CA 1VSEA 1FYJA 4MDBA 4CGDA 3EL2A 4LF9K 2DYRC 1SL2A 3T1AA 4YDUA 3L4IA 4JS4A 4B3RK 2UUBK 5H2FZ 2IDOA 4JKDA 3K57A 1OH6A 1OJHA 4C8NA 1CXQA 4ILHA 1FPOA 1P7GA 3HB3B 4E3SA 2PYLA 1YIJN 2LW1A 4JNEA 4O4JB 4P30A 1XMQB 4JTDB 5CA0A 1FAFA 3PY8A 1B9DA 3T7ZA 3JASA 1QR9A 1FFXA 3OYNA 2D0BA 2A42A 5AQOA 3HVRA 3QEXA 4DW1A 4ZHQB 4DR4K 4W5QA 2Y0IA 3THWA 1RILA 3LWMA 1YJ9N 3I56N 4CH4A 1W0HA 4EHUA 5LJVA 3B8NA 3SYZA 3SFEA 4XDKA 1VQPV 2HJFC 3CIRA 4JI2K 4JN4A 3FB6C 1RSOB 3FAVB 1BQMA 3SZ2A 3A0IX 3RMDA 4W4KA 3RWUA 1Q82O 4CI6A 1VQ4V 1KCFA 2W6JG 2AP1A 3QERA 2B1IA 4LF8K 3GB7C 4YHHB 4H4OA 4WE1A 3QDKA 3JARA 2NRTA 1DTQA 5CHIA 3SPHA 4JV5B 2P5GA 1N5YA 2D0OA 4DTUA 5KHGA 4IHJB 3OD4A 3HOTA 4I55B 1RGIA 3F5WC 1L3UA 5L3EA 1KKDA 5BR8B 3Q7BA 3EY1A 5H1SQ 3RVZA 1PL4A 3F7YC 4DFPA 3DYAA 2UXDO 1COV4 4Y1CA 4Q4Y4 3V6DA 4CZIA 4H33A 3BY6A 4CHOA 2Q7EA 3ZETA 3SBTA 5IJ0B 3OMNB 3ATVA 3SAGA 4X62K 1YXBA 5J2TB 1L0NH 3F7VC 1OHHG 4DS5A 3IMXA 4KPYA 3FFQA 1GMGA 3K08A 2Q0OC 3FYEB 3N2GB 4L87A 2WLLB 2QWQA 4BG9A 2CH5A 3PSIA 4H13B 2F95B 1SZ2A 3O65A 4J11A 4IOCL 3ABMC 1G1XB 4JI7B 1DF5A 3CP1A 3TETA 1W59A 2DY4A 3TU5A 2YIBA 4B3MO 4DV0O 4DR5B 5KA6A 4FJLA 2O8EA 3VMFB 4ZOLB 2HVIA 3LNNA 3JAKB 3L73H 4EFEA 5IYCO 1PNLA 1EM1A 1FKAO 4CF1A 3B6PA 3ZSYA 4E1JA 1KECA 1YXQA 2PI5A 2HP8A 3STLC 3NVKA 4F3TA 1PP9H 1ZTEA 2WDVA 3SK3A 4AILC 5HRNA 1H2NA 3EZWA 4FWRA 2RN9A 3T1HB 4PHTX 4ELUA 3GOIA 3SJCC 1ATRA 1GM8A 3P31A 3QMLA 4B3SO 4BE1A 3WQTA 1HPZA 4BRCA 1KC8W 4DF4A 5EYPA 4EZ9A 3ZN1A 1ZC6A 3NDKA 1YI2N 3AEAA 3PV8A 4JK9A 1SQXH 3I5DA 1WSJA 3AVKA 3BRCA 1HP8A 4FPPA 3CCQN 1KF6A 5CBFA 1QZ5A 5BMVA 2YHAA 3ENHA 3WG7B 4NB5A 2IOCA 1OCZC 3FGUA 1EQYA 2YHYA 5F0XA 3SQ1A 1GN4A 1VQ5N 1AI4A 1VQ9V 3L70H 3WUHA 2AZ2A 1WSIA 4WCEL 3ZSWA 1RVF4 3TJTA 2E88A 2R044 5LY3A 5AQMA 5GONA 4NKGB 4KH5A 5C2FA 4J80A 1YCIA 3J7AP 3RRGA 1VQNN 1VARA 3KTQA 2VQEK 2KG7A 1HPMA 4BDZA 4Y1DA 3FB7C 1T3VA 2QJ1A 3LZIA 3JALA 4B3TO 1FXKB 1U96A 5AFUA 4DW0A 3WT0A 3G71N 4F2RA 4IYIA 2WLMA 3QG5A 4U3JB 2FF3B 4LY7A 3RVYA 1T7PA 1AR5A 2JRIA 1JJOA 1R0AA 2QR4A 4K3AA 2IU0A 4AQYB 1SL1A 2UXBB 2RN2A 3KJVA 4IT5A 4WQ4A 4JF3A 3D45A 4PA7A 4HUGA 3VQ8A 4GKKB 4GKJK 3VEOA 4JYAK 2DQ0A 3DLHA 2FBXA 3B77A 3DLLL 2UUAB 3NGYA 4P2ZA 1SKWA 4CC6A 4KHWA 4CS3A 2P9KA 2NNWA 1GN2A 1SC5B 1HDJA 4DFJA 5FRMA 3BA8A 3CJAA 1SQKA 4LF7B 1VQ6N 1HNXO 4YTPA 1NBWA 1ZBUA 2KQ2A 4RWTA 2AJQA 5L3GA 2KLAA 4TSFG 3MDQA 2QKCA 5GTHZ 2EWSA 4Z0UA 3U4LA 2DFFA 4JI1K 5IWAO 3E83A 2B5JA 4IGGA 3L2QA 1OCOC 3NBPA 3O4NA 4BC5A 3FR0A 5I9EB 3O3GA 2JWLA 1TK0A 3X2QB 4FL9A 1P4RA 1BCCH 5AQFA 3ZCCA 1CP9A 2R9AA 3AO2A 4RUFA 3G80A 1TVRA 2N05A 1RCHA 3BABA 1WPXA 2P9PA 1YHQN 3ENBA 5B5EZ 1W0KG 4MO5A 3VQXA 3CWBH 2XAHA 2QWQB 4DV1B 4XDLA 2RNBA 1BIZA 4NCBA 1HJOA 3KLEA 1NJZA 1GLLO 3CJ1A 5AJ3K 4FZYA 2FL4A 2I5JA 3VEWA 4DXWA 3J80N 1X1PA 2P6JA 2D0CA 3SJAC 2O4GA 2O8EB 1EZJA 4CJ3A 5FL7G 2DW4A 1L0VA 1HR0O 1OOPD 4EB6A 1I39A 4LFBK 3L2RA 2WP9A 3O08A 5BN8A 3B4SA 1QZ6A 3OYBA 1U2VA 3E8FA 3ZEDA 2P06A 1T03A 3RMAA 1RUC4 4YXDA 5SWMA 2XOKG 3RFRA 3HPGA 3SR2C 5IY5C 4AHTA 1S3JA 4CHPA 4NR1A 4DUZO 5LHIA 4FWSA 3KVGA 3O5BA 1WP7A 3AE3A 2Z3YA 3OAAG 4K0KB 3SQ2A 1JMKC 2P7TC 1DTOA 5DM6V 1XMQK 1ZOYA 1X3NA 4RW4A 3HP6A 4HVJA 1BCOA 3C65A 1WSGA 3S3MA 5LXTA 3LSUA 1IBKB 4FWQA 5GIOA 3HBTA 3FZLA 3ZSRA 1IKXA 5AQLA 4BRAA 4DHYA 4J7KA 1XILA 2H8PC 2QM4A 3HR0A 3WB0A 3FZKA 5BMVB 2P4VA 4DV3B 1BQZA 1LAWA 2JDIG 3AO1A 1IX9A 5BRHA 3QINA 4DV6B 4PDWD 1NEKA 2F7TA 3QTCA 4CFAA 3CF5L 4IO8A 4CJEA 1BEV4 4F4LA 3R9PA 3AGRA 3L4QA 2F4VO 2BE3A 4H44B 3C7NB 3RTVA 2GWJA 3OYJA 2GEMA 3QETA 3RYFB 3LDPA 4YHHK 4B3OA 4N47A 4BRGA 5B3SC 5LP6C 5GONB 1J53A 1Y76B 3SPIA 3N4QA 1K97A 4LNUB 2B6AA 4RCHA 5AR0A 3ZT2A 1K8AO 3AARA 2YEVB 2KFNA 2E6MA 1KFYA 4YIOA 1TUYA 3L6QA 1P8ZA 2YDEA 5JJJB 3PUFA 4DR3O 3I55N 4J9YB 1TYQB 3DGEA 5HOOA 5BR8K 2OPPA 3F5TA 4MT8A 4CZEA 3D36C 3CHXA 4JTCB 1OCRB 4BIUA 5EBLC 3H1VX 3R6MA 4H4MA 1S9EA 4XBFA 1O9GA 4PD4F 2UXXA 3WQUA 1J5OA 3TTFA 3HKCA 1VEWA 1HNWO 5FNVA 5IT9N 1TUEB 2ZIMA 2QWMA 3G0ZA 3WNEA 2A1RA 3JATA 2CGLA 1RDUA 1IKVA 4H0YB 3UKRB 3OYDA 4K35A 2W40A 4EAHD 1H2GA 5L3DA 4OLBA 3L74H 3P4QA 4N76A 3CJ7A 4KTQA 3OYMA 1RUJ4 2ZQBA 2QA4V 1S9GA 2IS3A 3EN9A 4E7JA 2BGGA 1Q7YW 4I9LA 5A2QN 3TTCA 3WNFA 4UV8A 1KP2A 2P9KB 3ATUA 3NF9A 3KCYA 1RPOA 2ZJQL 3D2FA 1TAQA 4DSIA 4JI7K 4GV9A 2A41A 3ID8A 4CK2A 3VBBA 2D3OW 3JCUZ 1WB7A 4QPJA 4DR1K 4DR7K 2QE7G 2DOSA 4CF0A 4KHYA 1NK7A 4ISGA 4ZI7B 3VR8A 1RDBA 5AQRA 1OH5A 2D0PA 3NVMA 4BDYA 4JI5K 2D4WA 2Z1HA 3SV4A 4UB6Z 4JI0K 3AG7A 2ZGZA 3MXIA 2EHGA 2QKBA 3OYAA 1XMOO 1IBLO 3J8F4 1RTJA 1SS3A 1WBDA 3HSCA 1B9FA 1PM9A 2ATQA 2EJRA 2HNDA 3DRRA 3HZ6A 3U10A 2E2OA 3T2MA 2P9PB 3NR7A 3LDCA 2ILMA 3VQ5A 1NGHA 4DFMA 4E2LA 2VGNA 3ZSXA 3PN1A 3K9JA 3CCUN 1NG9A 4BRDA 2ZINA 3DC5A 1N33O 1KD1W 4FWKA 3F9MA 2Q6AA 2EULA 5CA1B 2ETNA 4JYCA 2HBMA 3EEQA 1Q5OA 5LMNO 4I6MA 3DLBA 1NWKA 3ZCMA 5AQQA 2E1YA 4IL6Z 1NJIW 2W6KA 2DJVA 4KB1A 5JH7A 5HRSA 3HSTB 1TAEA 1P84F 1Y74A 3ZX2A 4WFFA 1DGKN 4FJXA 3AEFA 2P5OA 3CI5A 1TUBA 5IYBO 3IFXA 3CCRV 3JD0A 3M8QA 1XNRB 1YTUA 2F8SA 1LAVA 3G67A 4RW6A 2CK3G 2XAQA 4KL1A 4EB6B 1ATSA 1VSMA 4FWLA 4DTSA 4FK5C 4X20A 3UO2A 2UU9O 2LJ2A 4GCZA 1U2VB 4DB3A 1K4DC 3FYIB 5BY1A 2P51A 5IYZA 1WLEA 2WLIA 5GIPA 2R7YA 4L8RB 3HKDB 4Z4HA 2Q7HA 1UWBA 5AQZA 4ASUG 4FJKA 4EFBA 4LH7A 4X64O 4J7ZA 2WBNA 4CW7B 1SF9A 5GAEP 1PNMA 4NCAA 1P49A 4B3RB 3H46O 1TKZA 1S5HC 1J6ZA 2F96A 1IDSA 1XL4A 5HFLA 4YSYA 4CJFA 2PYJA 3AEEA 2FMLA 1NGFA 3KK2A 3V1OA 1NVPB 2VG7A 1BA0A 4H03B 1G8MA 3FE1A 4K25A 3T4ZA 5GAHP 1I3AA 3TAQA 3OYCA 3VA0A 4FJJA 3A8YA 3N2KA 4BGBA 3CFOA 4AQYK 2ZJPL 3ZSVA 5BZBA 3OA9A 4FIPC 5A2QO 1F4NA 4H5RA 5IJ9A 1WOQA 2Q5ZA 3OTFA 3SUPA 4JKGA 4R7CA 4DR4B 1YUWA 5ELZA 3ZS8C 3L8BA 4HUEA 4BRIA 4R5PA 1VQ7N 2FB5A 2HR3A 3CEIA 4O0JA 4O4HB 1XUPO 3KKRA 3WNHA 4BRFA 5CZ1A 2QM7A 2A9HA 1F23A 3CRQA 3D3QA 4OGQB 3LSQA 3W7UA 2IVPA 1VQKN 4IJNA 3P3NA 1AR94 4FFBB 1Q81W 4TQFA 4F6RA 2IH3C 3VQ4A 2HVJC 4MS2A 4C23A 3S3XA 4UUJC 3MAQA 3ZT1A 2XO7A 1D8YA 5LGUA 3CCJN 1NGGA 2AGAA 4BAYA 4OJRA 4BR2A 3AG4C 4E7IA 3HPHA 1VBE4 2NRHA 3AVJA 3RYCB 1HNZO 4OKKA 4IDKA 3ASNC 1M1KO 4TSXA 5CA3A 1GLFO 3HKCB 3NHGA 2DWDC 4UB8Z 5FNVB 1MWKA 3CMEN 2ITGA 1KKCA 3DC6A 4NTWA 4UCVA 4KV8A 1Y97A 3JATB 5ITZB 5GTIZ 4FLXA 1GOAA 1VF6A 5E1AC 1MZFA 2C2AA 2YX6A 4DTPA 4QOZB 2X6BA 4FVUA 3I33A 3BVOA 3VGMA 2HHTA 3JBG4 4LSNA 2LGQA 4DV1K 5E79Z 1PIV4 4L3QA 4WYBA 1QLEB 3OS1A 2ADQB 2BTQA 1ASVA 2VGMA 3D2FB 5KPZA 3D8CA 1TUUA 3ASOB 2V4DA 4OX9O 2VQFK 4N21A 2HW3A 3FZMA 1R6KA 4NVPA 3ZMVA 3O4QA 1V4SA 3QEVA 1WSHA 1KU9A 2ZGYA 3W7SA 3DXKA 1M57B 5TKYA 4JHDA 1W2BM 3PX4A 3OYFA 4KHUA 3AA4A 1RBUA 3ZHUA 4Z4CA 2O8BB 2Q31A 3AA2A 4IDHA 3QEPA 3OFNG 2NRVA 4BC2A 4EIAA 3MWPA 4H0TB 4JI3O 1XC9A 2Y48A 2QK9A 3J7YP 3H01A 1RUH4 2RQ6A 2WS3A 4K8ZA 4CFDA 1SQQH 5HL7L 3FFIA 2ZJRL 5J2UB 4FZZA 4ISFA 1AI5A 4UCUA 3K5MA 2EBOA 3ABKB 3SYCA 1MSWD 2FYUH 1CXZB 4PA6A 1EWRA 4ID1A 4E7LA 2O4IA 3LAKA 4O5BA 3DXMA 5DM6L 4FPBA 3CC7V 1BWFO 1K33A 5JH7B 3DTUB 5IYDO 4JAAA 2Y4UA 1C0UA 4DV3K 3FFKB 1XNQK 2JS3A 4I7FA 5AQJA 1QU7A 4HUFA 4PL8A 3TXQA 1TUBB 3P4PA 4AM7A 3FKSG 2G8UA 1NKBA 5KRTA 1DGSA 1B04A 4IFVA 1SZXA 1NT2B 2QTSA 2V7ZA 3M5RA 1VQ4N 2ASPA 4ZHQA 4LFAB 1BA1A 3WEEB 4X20B 3PX6A 2ZXWC 4PI0A 1Y67A 2M7WA 2X7RB 3HRGA 1TKDA 2YI9A 4CE9A 5IYZB 4W5TA 4J9ZB 3K9SA 3LDDA 3O1WA 1GN3A 3FAVA 1C1AA 3VQ6A 3AVMA 1VMGA 2OYQA 4FPAA 4GW6A 4DSKA 3OJUA 3JD74 4DWIA 3TSQA 2YSUB 1HKBA 4J41A 4TOIA 2WFBA 3V9ZA 1VQMV 5ADXH 5C12A 3QFUA 3V9WA 1XUQA 1Z7S4 3DLGA 4FJ8A 4Z1MG 1LCUA 4M3TA 1ZBFA 1VSFA 3MECA 3W7TA 4LF4K 4CEDA 3AG2B 4YDUC 5B66Z 1W0JG 2KKZA 3BPZA 4IHJA 2CTQA 5AZIB 4I55A 5LMUB 4J2EA 1Q90D 4KH4A 4AM6A 3BFRA 3K58A 5KGXA 3CRAA 4PDMA 4CJKA 3O9SA 3S3NA 4ABMA 3E9LA 4FJ7A 3ITHA 4BROA 4MLHA 4CHYA 2UXBO 4NLBA 3V9SA 2ZE2A 2AW9A 4FFKA 3AVIA 5BRFA 3HTVA 1WN7A 3B6OA 3DRSA 5C15A 2PF4E 4KHPO 5CMUA 1N0NA 4GKKO 2WU2A 5IJ0A 1RUF4 2Q69A 2Q0AA 3DRPA 2ZT9B 2UUAO 5J2TA 4KP4A 2R074 4UQGA 4CJ7A 1URFA 1RM1B 2YV0X 4GKJB 3MX5A 4BACA 5KHJA 4JYAB 3N2GA 4BRNA 1HYSA 3PX0A 4KI6A 4YOVA 4B9QA 2NLJC 3QBWA 1I94K 4OPKA 1X3MA 1U47A 1HMVA 5D5QA 5CE3A 1RMU4 4WF9V 2XAJA 2A7WA 4YSXA 2RMU4 2BSKA 1NBMG 1NJWA 4C8MA 4AHSA 4ZOLA 1W2BU 2LFSA 1YQ4A 5FROA 1RUG4 4DV4B 3LM2A 1OCCC 1JKHA 4R6ZA 2XASA 3HPLC 4YOTA 1QQNA 1FJGO 1X9MA 3AE8A 3C95A 3NAEA 2P9UA 1D5NA 3PIPL 3OJSA 2F9TA 1YITV 4PQUA 2UXCO 3AE1A 1XWLA 1FD9A 2QKSA 3NH2A 2DMXA 2FF6A 1GLAG 1N36O 1VSIA 2DQ3A 5BN9A 3S9HA 3T1YO 2BCCH 2BOCC 3L3VA 2KFZA 4CS2A 4BIOA 3A0BZ 4BWAA 4RQFA 3ZSZA 1JLAA 3ZMUA 4EEQA 5KAIZ 1IBMB 1VQ9N 2GWKA 4B9NA 2BE2A 3DXKB 1BHBA 4JHDB 4BQZA 2E8AA 1L8DA 4FLUA 2Y4TA 3TAPA 4UCTA 3IC9A 5LYJB 4J2DA 1VQ8V 4DUYB 3VGKA 2O8DA 2JEUA 3E8GA 5LL6Z 2WU5A 2FC0A 3OTOO 1J5EO 4B1ZA 4LFBB 1WB9A 4RW9A 5B1AC 1C0MA 4CEQA 1RT4A 4MFBA 2P9NA 4LC1A 2W6IG 3TR8A 4TWKA 4I0XB 1JLCA 1JLGA 1FKOA 3BEXA 1IG8A 1K73W 1NKEA 1FW6A 1SQBH 1VQOV 3C6HA 4O4GA 1X9JA 3LAMA 4AHVA 4GT1A 2X6SA 3O9QA 4DV5K 1EAH4 2RM24 3M8AA 1KLMA 3DXMB 3P30A 3CCSV 3P39A 3CCLV 2NRRA 2PTMA 4FWNA 1FXKA 4YJ2A 3VTIA 1HXS4 3AG3C 4U3JA 2HHSA 2GX9A 2VS0A 3EKUA 1K5MD 2PFUA 3ZX0A 4JI4O 2WUSA 1KBHA 3NF7A 4DR6B 2ASOA 4JYBA 5KTQA 1BUPA 4JEPA 2XY6A 3K9KA 1QVGM 1B6QA 1RT6A 3VF6A 2E2NA 3ZHQA 2PZSA 4CHNA 2YC0A 2QEXV 3VEVA 1M56B 1DK1A 5AZJA 3KWIA 1RT3A 5B1BB 3ETQA 3SPCA 3HM8A 3AO3A 4FSVA 1HQUA 3K06A 3ZLJA 2HHWA 2FSNA 2Q36A 4F9OA 2Q3SA 3ZT0A 4GX1A 3WB1A 1R73A 2ZDIA 3AE9A 3W3DA 1Y4MA 1NTMH 1YVWA 4LFCO 3OM3B 4JKAA 1HX1A 2OPRA 2YI1A 4IZ9A 1NNEA 2ZE8A 4CF8A 2HWB4 3GVMA 3T1CA 1TK8A 3TANA 2HHUA 1H2LA 1Z6RA 1YF2A 2OCEA 2OTLV 3WU2Z 1N34B 3FZHA 4FO0A 3AO5A 4E89A 2QTOA 4DV7K 4AF1A 4PL7A 1AP5A 3DLEA 1GN6A 4DFKA 3T19A 2BUPA 2BH1A 4CS4A 3H1IH 1QLNA 1G99A 3G6EV 2QKAA 4YIPA 3NE6A 3SLCA 2E5LO 1PPJH 1BOTO 3G10A 3TGUH 4LF6O 3HKBA 4O4LB 3OVNA 4NXNB 4BREA 1KVBA 1QQOA 4X65K 4WQ4C 4L8JA 1N8RO 3NH1A 4BWJA 1UA0A 3NF6A 1HKGA 3C94A 5C42A 3LDSA 3BF1A 1Y64A 2WDQA 4GX5A 3CC4V 1R3KC 4HAMA 3ZEUA 1UPGA 3ALYA 3LPTA 2BSKB 2QTDA 1Q9XA 3K3WA 2XY8A 4CH5A 1VRUA 4CEOA 3MEEA 3F9KA 4DR1B 4DR7B 1SESA 5GINA 4OXSA 5C2DA 3ABLB 4DSJA 4CIGA 2MW2B 5EVZA 4JI5B 2ZCEA 2W41A 3LP2A 2GBZA 4JI0B 4HBNA 3AEBA 2P9SB 2OPSA 4XH4A 2LGWA 2P9UB 4ICLA 4KREA 2OPQA 4P9OA 1W9HA 2QGNA 3DXRA 1JCGA 4CGFA 3SPZA 1RNHA 3CCVV 1R59O 4WFGA 4Q0BA 3UKUA 3OYHA 3TWHA 1EKEA 1PVC4 4Q4V4 4CEEA 2FLOA 3L72H 1MU2A 1FXHA 1AJNA 2OTJV 1IVSA 5KPRA 1NU1H 3TSUA 5EIBC 1UJWB 4WQ5A 1XNRO 3OGCC 4LFAK 3SGIA 1XI1A 4H37A 2H3GX 3NMUA 4ELTA 5K1XA 3DWLA 5BPMA 4M3RA 1EX4A 4CD1A 2RDCA 1C0TA 4F6EA 2YI8A 2FSJA 5DM7L 2O8DB 2K9PA 3CFPA 3E86A 3K0DA 3SJJA 1WP8A 2KSDA 4TUYA 3PJSK 5AQPA 4DS4A 4O2BB 1QCEA 1QVGU 2A40A 2HF4A 4LF9O 3C7NA 4DQSA 2P9NB 2RJZA 3IC7A 1TGOA 4JKCA 3RYFA 3KHYA 1N6QA 1QS4A 2JGDB 5EC2C 4B3RO 1Y76A 2UUBO 4LNUA 3CQXA 2YEVA 4PDVA 3DMJA 3MN9A 4NYFA 3PO5A 4AHRA 1HRI4 5LMUK 3TAFA 4YSZA 2NNUA 1NH2D 1QR8A 2D0AA 1TYQA 1O13A 5B8HA 3CFRA 2QXFA 1QHTA 2DYSB 5FPMA 1M93A 1K4CC 4X66B 4GLXA 4CK3A 3CM5A 2RMKB 3CPEA 2F8TA 4YJ2B 1EWQA 2ZM6B 4X1YA 1M90O 3JD1A 2NRXA 4N5SA 1H2SB 3VETA 5KGWA 4YY3B 1SQFA 2QA4N 4JI8K 1WNSA 4NCGA 3P32A 3OE7G 2OCCC 4DR4O 4CF9A 1KFSA 1RTIA 1NA1D 1ZLZA 4EP5A 4NXMO 2E76B 3UKRA 1ZAUA 5AQIA 1CPYA 4JI2O 1D4M4 2BTFA 4B1XB 1HWYA 1KSPA 3QESA 3QEWA 2EIMB 1N32B 5AZJB 1CZ9A 3VQVA 3O4WA 1E1RG 1L1FA 4LF8O 1D2DA 3CERA 5AQYA 2B4JA 1VF5B 3RYIA 1VSKA 1OKJA 4BRLA 1WJZA 3CS5A 3ABVA 1Q6UA 3JAMN 2DPNA 4IG0A 1EETA 5M1NA 1VQLV 2DFEA 3KZBA 3KD1E 4DV4K 4ZI7A 2O8FA 2ASMA 3M1FA 2H94A 1RTHA 3H3NO 4WF9L 4CZMA 4JI6B 3T3FA 3PO4A 1SERA 4CJRA 2EZPA 3OHRA 3VA3A 1SQVH 3GWKC 1TKTA 2EJ7A 2YKMA 3V81A 5HP1A 1ZBIA 1TK5A 2PW9A 1K8AW 1V4TA 1YJ9V 4H5WA 1NK5A 3AK1A 5L3BA 1OH7A 5K14A 1WPBA 3ASMA 3H6EA 1X59A 2WC9A 4PKHA 2G8WA 2HHHB 5J2QA 4K8XA 3CIPA 3CCMV 4X62O 4E7HA 4DR2O 1SKRA 1D9FA 4FJNA 1L0LH 5T7BA 3HKBB 1H2KA 5DECA 2VWBA 3AA5X 3CCRN 1V54B 1REVA 3RYHA 4CZFA 3ZJZA 2DFHA 4ILGB 1YEWA 2A79B 5CA1A 4OKJA 1TKXA 1IBMK 4FJIA 2HBJA 4M3UA 4JKHA 3O6WA 3HYFA 3HM9A 4I50B 3JS6A 3ZEUB 1J54A 1NOZA 3VF4A 2VQFB 1VF7A 1FXVA 3KD5E 1QLEC 1VSLA 3P4IA 2JK5C 4DUYK 4K43A 3SMSA 1XBLA 3KKSA 4DTMA 1K92A 4ZTJA 2HOEA 3U3YA 1GLJO 3SQ0A 3C6TA 4BC4A 3CG7A 4RAIA 4PDRA 4X1KB 4MVUA 4LR3A 1LNQA 4PELA 2R70A 1PNKA 4CZZA 3T69A 3HKDA 1ESVA 3H08A 4MQ3A 4W5RA 3DXRB 4TV8A 3F2KA 4X9QA 4NO7A 1CLQA 1XOUA 3UB5A 1AL24 2D1KA 4B1UB 3K0GA 4DCHA 3STZC 4KO0A 4DQIA 2YUAA 2D5RA 3UKUB 3CMAV 1KAXA 2WQYA 4U7NA 4YJ3A 3JD3A 4X88A 3OMIB 1BQNA 1M9NA 2DYRB 1MQTD 1I5YA 4IEIA 3ZYYX 1POV0 4IYHA 2RKIA 1QHAA 1YJWN 4E7KA 1RT5A 2UU9K 1ILYA 1JVMA 3UO3A 1S77D 4KH6A 1RDWX 1KAZA 1KFDA 1EN5A 4IIJB 1XNQB 4XH1A 4DV2O 3WXIA 4Z94A 1NK4A 4DRXA 5IE9A 3RR8A 3HK2A 2GV9A 2P1JA 3AECA 2UUCO 3CX5F 3CETA 2Q4PA 1ZP0A 1EXQA 5EBMC 3AG1C 4TUYB 3HVTA 4J7JA 3DM2A 4CEZA 1F4MA 4KFMA 1VBA4 4A57A 4CZGA 3JAMO 3DSQA 4R50A 3CC2V 3TAMA 4O4HA 3M8RA 3K2PA 4Q6GA 1KLNA 4O4IA 1YVNA 2ITMA 3HO1A 1G6UA 3E35A 3T4DA 3JXUA 4FFBA 1HYVA 5M1PA 4LD0A 2KB1A 2FXUA 2HEPA 3NGIA 1KP3A 3OEEG 2VQEO 4A61A 5KUMA 4X1YB 1DT9A 1ATNA 4LF4B 4BR0A 4QNHB 3UCSC 5KQDA 2HSTA 2Q68A 3RYCA 1N34K 3R8EA 1RBVA 1R3JC 4CZHA 5H6QA 3KK3A 3KKYA 1UAXA 1YT3A 4BR4A 3CCQV 3E8HA 1QSSA 1HUXA 4M3YA 3ZSQA 3IFRA 3BUZB 5EY4A 5ITZA 3R65A 1I0HA 2O8CB 5JCOA 2YIBD 3J80O 4B9UA 4W4LA 3D2EB 4WFEA 4NXNK 5I42A 1H1VA 1RBRA 2Q8VA 4OO1J 1JLQA 4JYAO 2VG5A 4OGCA 3LALA 3O9OA 4PKIA 5E84A 2Y69C 2IGIA 3MCAB 3SYPA 5EU7A 2IM9A 3RMCA 1JLFA 1IURA 3BZKA 2Q0UA 1EZVH 1ROPA 3BEHA 3RYIB 4GNIA 2RF2A 4AHUA 3THXA 1QQCA 3AE5A 2V7QG 5AQXA 4DYLA 1SQPH 2ZE6A 1RM1C 1JFFB 1I94B 4BE2A 1SKSA 2O8FB 2LP7A 2RHKA 4BRHA 1TA8A 4JI1O 3MWTA 2AXTZ 4CJVA 4CJUA 4CIEA 4B7KA 4IG3A 1E4FT 5KQ8A 2O8BA 3ABMB 3EVKA 1B92A 3VQEA 2XUMA 1WAJA 2I7NA 5DN6G 5GAGP 2PGGA 4Q20A 4YOUA 1E1QG 1NR7A 3CC7N 1EV14 2A3ZA 5C8YA 1ASWA 3O3HA 1VBC4 4I4TB 2ITCC 5J2UA 2ZIOA 2QWOB 4YORA 4E4EA 4HWIA 4DQRA 2IJIA 1HYZA 3WXMB 1PO14 3VQ7A 3RYHB 3HI0A 1JPXA 4CK1A 1VF6C 1S72N 5AQWA 3JSMA 2Q0RA 3Q4HB 4MO4A 1NGCA 1NI8A 4DV0B 4FOEA 2ZWHA 2HBKA 3CRRA 4G2KA 1NKCA 3VPZA 4UXNA 1Z26A 1PD3A 3BAAA 3ZMZA 2WTUA 2YHWA 3GDQA 1TVKA 2B5UA 3QBXA 1K5QA 3BCCH 3IG1A 3WEEA 4Z4GA 4LFBO 3CCEV 1SAZA 5I3UA 1Y66A 5HROA 3EE8A 2DTUA 1YJNV 3ZHRA 4TV8B 1SZTA 1HW7A
chains in the Genus database with same CATH topology
5LOVB 1YTAA 4B3SB 4FXDA 2LSNA 4YJ3B 1UA1A 3C6UA 3OS2A 2IC3A 4DV5B 2HVHA 3VQCA 5J2MA 4M3ZA 4DRXB 4WBNA 2OZMA 4JRQA 3JSNA 5KRSA 2A1SA 4ELVA 1U48A 4O4IB 1VSDA 4TQDA 1T8EA 3L2UA 2ETJA 4UCRA 2PUSA 4B3TB 1ASUA 4FJMA 3E22B 4QCLA 4OGEA 3UIQA 3I0SA 5EIBD 1XHXA 2CAZC 3HT3A 4UCSA 4B9TA 1SA0A 3IRXA 3DI6A 1M4UA 4DV7B 3LP0A 4ZHRA 4F3OA 1HNXB 1RT1A 1Q9YA 3OYLA 4X65B 2JS5A 4DSEA 5IWAB 3DOLA 4FK2A 1RBTA 5CYQA 3SJBC 2NUBA 1GOCA 3OYEA 1S1TA 3U0ZA 5LYJA 4OPJA 1C6VA 1NK8A 4J2BA 2BANA 4W5NA 1RBSA 2W42A 1LWFA 5HRRA 3OYKA 5C8YB 4C8LA 4O2AB 3P83D 2ZNJA 4I2QA 2KTQA 3AO4A 2KZMA 4Z4EA 4DG1A 3B2EE 1K6YA 3MEGA 2OZSA 4YFUA 1QTMA 3KIOA 4FW2A 2PY5A 1TVKB 4C8OA 4GVMA 5DK5A 3NGZA 5KMGB 1BIUA 3CB2A 5JVDA 1WSEA 4CGIA 4GYCB 1Z5VA 3MEDA 3SPYA 4FYDA 3LP1A 4FK4A 4Q5VA 1DTTA 3EZ5A 1LWCA 3VN5A 5LP6B 4TV9A 4GMJB 3TAEA 1S1UA 4W5OA 1QE1A 3SUNA 3L2VA 4I9QA 4O44A 4CGJA 5HBMA 4E19A 3ZSOA 3JAWA 2X78A 5C24A 4WBNB 4BW9A 4CERA 2Z1IA 4JI8B 5FDLA 1X9WA 1U04A 1WAFA 1LWEA 4DR3B 1ZYQA 3AVLA 4O4LA 1TL3A 3L2WA 5EZYA 4PHZA 4ELTA 4DU3A 3VQWA 3ULDA 4M3YA 3NCIA 4QAGA 5SZTA 3D0PA 1KRPA 1L3VA 4IBNA 3RRHA 1HNWB 5D5PA 1NK0A 3ICXA 4FJGA 4BWMA 1SA0B 4CGGA 3NFAA 1SL0A 4KFBA 4HTUA 1Q8IA 3CQ8A 3UQ8A 3I0RA 4HNAA 1L3TA 4DTXA 2JLEA 3AVCA 1XMOB 2VG6A 1C1CA 1IBLB 1G15A 1VSHA 5CYMA 3LWLA 1T05A 4AHCA 1ZBHA 4CEBA 4DSLA 3M8SA 2VWKA 4FCYA 3SV3A 3OS0A 4O2BA 3AVFA 4FJ5A 4EZ6A 5JQGB 3QF7A 1N33B 4CHQA 4CJ4A 1S1WA 2HMIA 4N56A 4CIFA 2E6LA 5HLFA 3ZT4A 2E4LA 1FKPA 2UU9B 3U3GA 4CGHA 3IS9A 4YNQA 2F93B 3TAGA 4CFCA 4JLHA 1IO2A 5JVDB 4X64B 2JGUA 3MXJA 4CFBA 2QKKA 1U4BA 1NJYA 1Z5WA 4CEFA 1BI4B 3HKEA 1F21A 4TV9B 5KHHA 2Y1JA 4FLWA 1BGXT 3JAWB 4X1IA 2Y1IA 2OA8A 3V9UA 3EYZA 4KHNA 4ZTFA 2G8FA 2YXLA 4DK0A 4CF2A 5EZYB 1GOBA 4KHSA 4B9LA 4PI2A 1HNZB 3KLHA 5KX5A 4M45A 4I50A 3V9XA 2HB5A 2R72A 4KRFA 3HJFA 3M7MX 3U6FA 3LP3A 1O9HA 3OYIA 4CESA 4X1KA 3V4IA 4DF8A 4IKFA 4FM2A 1IKWA 1T5EA 4FM1A 4OX9B 4O0IA 4E1MA 5JS2A 3UT5A 4HNAB 4KKOA 3TARA 2HNZA 4IIJA 2FBYA 2YKNA 3DLRA 4JI3B 1M5IA 2E3CA 5FPRA 4FLYA 1A5VA 4CJLA 3CM6A 4RG8A 1CZBA 3BDPA 3SQ4A 1RDCA 4CECA 4DSFA 2HNYA 1S6QA 4DU1A 2KW4A 2HHXA 1JLEA 2F66C 3S3OA 3THOA 4IFYA 2GUIA 3KK1A 2HHVA 3QIPA 4H8KA 1Q3EA 2HHQA 1X4TA 3THVA 3KLGA 1HJRA 4M3XA 4Z4IA 4HHTA 3QLHA 5D3GA 4RW8A 4B08A 5FRNA 3SI6A 2WOMA 5CA0B 4BDPA 3ISNC 3JASB 1XQ8A 1FFXB 1EP4A 3RR7A 3HKEB 1JLBA 2XHBA 4AH9A 3TABA 3QO9A 1X9SA 1JFFA 1KMIZ 4DTNA 4KHPB 2XY7A 4X1IB 4B8AB 5J2NA 4UCOA 2Z1GA 3FI7A 1NK6A 3JARB 1RT2A 1RDAA 4B9MA 4I4TA 5CZ2A 2G8VA 1WLJA 4PUOA 4FLTA 4FK0A 1V9PA 2YNGA 5JCOC 4LF5B 4OLAA 2JVDA 1U49A 5KX5B 3HXMA 1BL3A 4B8CA 1FJGB 1UOCA 3VQPA 3BA9A 2UXCB 3O3FA 4F2SA 1N36B 3T1YB 5LOVA 4CJSA 1C1BA 4PY5A 4DU4A 3UT5B 4DLEA 1I7FA 1FK9A 4D7SA 4CCHA 3P1GA 4CJQA 3HP9A 3OTOB 1J5EB 3V1RA 3KLFA 1LW0A 5DMRA 1Q43A 3LZJA 1S1VA 3K5NA 2IAJA 3MXMA 5EYPB 2XY5A 1SUQA 1CXUA 4UFZA 3SUOA 1Z25A 4KHQA 3E22A 3F73A 2YNFA 3TI0A 5E41A 4JI4B 4CJTA 4I2PA 5K1PA 1XHZA 3AVAA 1JL1A 1FXXA 4JS5A 3L3UA 3JALB 4JRPA 1WSFA 2RPIA 1D9DA 4EP4A 4LFCB 2FBTA 4D7TA 3WB2A 2UXDB 1S5JA 3RGBA 4M42A 1VRTA 1L3SA 2E5LB 4M41A 1QSYA 4LF6B 4O2AA 4FJ9A 2Q7GA 4DTJA 1KVAA 4B3MB 3QNOA 2YNHA 5J1EA 1BHLA 2G8HA 1HNVA 4FJHA 1A5XA 1IKYA 5KI6A 5KMGA 4DK1A 2OWOA 3P5JA 3RMBA 1S1XA 1A5WA 1RDDA 3IAYA 4CHZA 3U11A 1BCMA 3VQDA 1NJXA 1KTQA 2ZD1A 5LP6A 3DLKA 2ZNIA 3LANA 4HCCA 4FLZA 4LSLA 4N41A 3CSXA 4DMNA 1S6PA 4LF9B 3LPUA 5J2PA 1HNIA 4B9SA 4ZIBA 5JJEB 2UUBB 1JXBA 3VQYA 1O1WA 5LXTB 4Z4FA 1SV5A 5CB4A 3VQAA 3QIOA 4E0DA 4G1QA 4B9VA 1U45A 3NH0A 1LV5A 5LA6A 4NXMB 2F1MA 4JI2B 3OYGA 1RT7A 1KVCA 3M8PA 3DOKA 4LF8B 4RW7A 4CC5A 1JL2A 2X6NA 4HCBA 3I8DA 3HPOA 5KHKA 3AVNA 1JXEA 3K5OA 3K59A 4CJPA 3BHPA 5CY4A 4LH6A 1VK0A 4O55A 1ITGA 4KTWA 4PWDA 4X62B 1NK9A 4DR2B 4NYNA 5FPOA 3VQQA 5JQGA 3OY9A 4LH4A 4CH3A 3V1QA 4J2AA 1TV6A 1NOYA 1L5UA 4DQQA 2X74A 4DTRA 4PA1A 4E1NA 2BTOA 1HR0B 4FLVA 3AVBA 1D5AA 2Z1JA 2FBVA 3ZT3A 2BDPA 5JS1A 1BISA 2YHBA 5C25A 4DUZB 1TAUA 3E01A 2P22C 4CEAA 4O4JA 1SQGA 3VQ9A 1BI4A 4F4KA 4DV2B 3KLIA 4DTOA 2UUCB 4FM0A 3VQBA 1RTDA 1RSOA 2F4VB 4KI4A 3AA3A 3JYTA 1DLOA 4M3WA 1IG9A 3QEIA 4KAZA 3AV9A 3QNNA 1VSJA 4CJWA 1LW2A 5CB4B 2VQEB 4XIUA 3CYMA 3N2KB 4FZXC 4BE0A 1IH7A 5IJ9B 2WONA 2KKWA 3NF8A 4OVLA 4FVMA 5LA6B 2G8KA 3AVGA 3JSLA 3HL8A 3SUQA 1QSLA 2XRIA 4F6RB 3SNNA 3BGRA 1TL1A 5KHIA 1HQEA 3AVHA 4KB0A 4DLGA 4CH6A 4FW1A 1J9AA 4DQPA 3JAKA 2VWJA 1SKVA 4JI1B 4LH5A 1HRHA 3RWRD 2YNIA 2KZZA 1YVUA 2BTQB 3WNGA 3A2FA 4C8KA 2R7FA 4CJ5A 1ZBLA 4OKEA 5LMNB 3K5LA 2YIAA 3SCXA 5HRPA 2G8IA 2EX3A 5JJNB 4F8RA 4KTZA 4ID5A 1VSEA 4CGDA 1SL2A 3T1AA 4JS4A 2IDOA 3K57A 4C8NA 1CXQA 4E3SA 2PYLA 4O4JB 1XMQB 5CA0A 3PY8A 1B9DA 3JASA 3OYNA 1FFXA 2D0BA 3HVRA 3QEXA 4ZHQB 4W5QA 1RILA 3LWMA 4CH4A 1W0HA 3SYZA 1BQMA 3SZ2A 3RMDA 3RWUA 1KCFA 3QERA 4H4OA 4YHHB 4WE1A 3JARA 1DTQA 4JV5B 2P5GA 1N5YA 4DTUA 5KHGA 4IHJB 4I55B 1L3UA 5BR8B 3EY1A 4DFPA 3DYAA 4Y1CA 3V6DA 4CHOA 2Q7EA 5IJ0B 5J2TB 4DS5A 4KPYA 3FFQA 3N2GB 2F95B 4JI7B 2DY4A 2YIBA 4DR5B 4FJLA 4ZOLB 2HVIA 3LNNA 3JAKB 4EFEA 4CF1A 3B6PA 3ZSYA 4F3TA 4AILC 5HRNA 3T1HB 4ELUA 3SJCC 4BE1A 1HPZA 4DF4A 5EYPA 4EZ9A 3NDKA 3PV8A 1WSJA 3AVKA 3BRCA 5BMVA 2YHAA 2IOCA 3SQ1A 1WSIA 3ZSWA 5GONA 3RRGA 3KTQA 4BDZA 4Y1DA 2QJ1A 3LZIA 3JALA 4F2RA 4U3JB 3QG5A 4LY7A 1T7PA 1JJOA 1R0AA 4AQYB 1SL1A 2UXBB 2RN2A 3KJVA 3D45A 4HUGA 3VQ8A 4GKKB 3DLHA 2FBXA 2UUAB 3NGYA 1SKWA 4CC6A 4KHWA 4CS3A 5FRMA 4DFJA 3BA8A 4LF7B 1ZBUA 2KQ2A 2AJQA 4Z0UA 2DFFA 2B5JA 3L2QA 3NBPA 3O4NA 3O3GA 1TK0A 2R9AA 3AO2A 1TVRA 1RCHA 3BABA 3VQXA 4DV1B 1BIZA 4NCBA 3KLEA 1NJZA 4FZYA 2I5JA 1X1PA 2D0CA 3SJAC 2O4GA 4CJ3A 4EB6A 1I39A 3L2RA 3OYBA 3ZEDA 1T03A 3RMAA 5SWMA 3RFRA 3HPGA 4CHPA 3SR2C 4AHTA 4K0KB 3SQ2A 1JMKC 4RW4A 3HP6A 4HVJA 1BCOA 3S3MA 1WSGA 5LXTA 1IBKB 3ZSRA 1IKXA 2QM4A 3WB0A 5BMVB 4DV3B 1LAWA 3AO1A 3QINA 4DV6B 3QTCA 4CFAA 4CJEA 3RTVA 3OYJA 3QETA 3RYFB 4B3OA 4N47A 5LP6C 5GONB 1J53A 4LNUB 2KFNA 2B6AA 3ZT2A 2E6MA 3PUFA 5JJJB 2OPPA 3CHXA 4H4MA 1S9EA 1O9GA 1J5OA 3HKCA 5FNVA 2ZIMA 3G0ZA 3WNEA 2A1RA 3JATA 1IKVA 3OYDA 4OLBA 4N76A 4KTQA 3OYMA 2ZQBA 1S9GA 2IS3A 4E7JA 2BGGA 4I9LA 3WNFA 3NF9A 1TAQA 4DSIA 4CK2A 4CF0A 4KHYA 1NK7A 4ZI7B 1RDBA 4BDYA 2Z1HA 3SV4A 3MXIA 2EHGA 2QKBA 3OYAA 1RTJA 1B9FA 2ATQA 2HNDA 3DRRA 3U10A 3VQ5A 4DFMA 3ZSXA 3PN1A 2ZINA 5CA1B 3DLBA 1Q5OA 3ZCMA 4KB1A 5JH7A 5HRSA 3HSTB 1TAEA 4FJXA 2P5OA 1TUBA 3M8QA 1XNRB 1YTUA 2F8SA 1LAVA 4RW6A 1VSMA 4KL1A 4EB6B 4DTSA 4X20A 2P51A 4L8RB 5IYZA 2R7YA 3HKDB 4Z4HA 2Q7HA 1UWBA 4FJKA 4EFBA 4LH7A 4NCAA 1P49A 4B3RB 1TKZA 2F96A 4CJFA 2PYJA 3KK2A 3V1OA 2VG7A 3TAQA 1I3AA 3OYCA 3VA0A 4FJJA 3N2KA 3CFOA 3ZSVA 5IJ9A 3OTFA 3SUPA 4DR4B 3ZS8C 3L8BA 4HUEA 4R5PA 4O0JA 4O4HB 3WNHA 3KKRA 5CZ1A 4FFBB 4TQFA 4F6RA 3VQ4A 3ZT1A 3MAQA 2XO7A 1D8YA 4E7IA 4OJRA 3HPHA 4OKKA 3AVJA 3RYCB 4IDKA <