2RS34

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rs3400
1HXS4 4Q4X4 1AR84 3J8F4 1AR74 2RMU4 1HRV4 1POV0 1PVC4 4Q4W4 1RUH4 2RM24 1PIV4 1RMU4 1R094 3JBG4 1RUG4 2PLV4 1Z7S4 2RS34 3JD74 1RUJ4 1EV14 4Q4V4 1AL24 2RS14 1PO24 4PDWD 1VBA4 2R074 2RS54 4GB34 2RR14 1RVF4 4RHV4 1RHI4 1OOPD 1RUF4 1HRI4 1ASJ4 1NCQD 1RUC4 2HWB4 2R064 1R084 1EAH4 1D4M4 1RUD4 1VBB4 4Q4Y4 1COV4 1K5MD 1RUE4 1PO14 1RUI4 1VBE4 1AR64 1VBC4 1VBD4 1H8TD 1BEV4 1VRH4 2R044 2HWC4 1AR94 1NA1D 2X5ID 1MQTD
chains in the Genus database with same CATH superfamily
1AR84 2WDRA 4YTMA 1PIV4 2ACZA 1RMU4 2RS34 2PLV4 1Z7S4 3JD74 3AEBA 1EV14 1NENA 2PYLA 3AE9A 1VBA4 3AE5A 2R074 4GB34 3AE1A 2FBWA 2PYJA 1HRI4 2HWB4 1XI1A 1VBB4 1AR64 1BEV4 3P4RA 1ZOYA 1NA1D 4YSYA 1VBD4 1HXS4 4Q4X4 3SFEA 1AR74 1XHZA 2WU5A 1HRV4 3P4PA 4Q4W4 3P4SA 1R094 2WDVA 1L0VA 4YXDA 3AE7A 2WDQA 1AL24 2WQYA 4PDWD 4KX6A 3FI7A 2RS54 3AE6A 2PY5A 4RHV4 1RHI4 1NCQD 1RUC4 4YTPA 4YSZA 1PO14 3CIRA 3AE8A 3AE4A 5C3JA 1MQTD 3P4QA 4YSXA 5C2TA 3J8F4 2R7FA 2RMU4 1POV0 1RUH4 1RUG4 1ZP0A 2WP9A 1XHXA 2RR14 1RVF4 2PW9A 3GQKA 3VR9A 1RUF4 3VRBA 1ASJ4 2H89A 3VR8A 1R084 1EAH4 1NEKA 1RUD4 1K5MD 3AECA 1VBE4 1VBC4 1VRH4 2RM24 2X5ID 3AE3A 1H8TD 2R044 3AEEA 2HWC4 1AR94 3SUCA 2WS3A 2EX3A 3AE2A 1PVC4 3AEGA 3AEFA 1KF6A 2PZSA 4YTNA 3VRAA 4Q4V4 1RUJ4 2WU2A 2B76A 2RS14 3SFDA 1PO24 3ABVA 3JBG4 1OOPD 2R064 3AEDA 2H88A 3GQHA 1KFYA 1D4M4 3AEAA 4Q4Y4 1COV4 1RUE4 1RUI4 1YQ3A 1YQ4A 4YT0A
chains in the Genus database with same CATH topology
1HXS4 4Q4X4 1AR84 3J8F4 1AR74 2RMU4 1HRV4 1POV0 1PVC4 4Q4W4 1RUH4 2RM24 1PIV4 1RMU4 1R094 3JBG4 1RUG4 2PLV4 1Z7S4 2RS34 3JD74 1RUJ4 1EV14 4Q4V4 1AL24 2RS14 1PO24 4PDWD 1VBA4 2R074 2RS54 4GB34 2RR14 1RVF4 4RHV4 1RHI4 1OOPD 1RUF4 1HRI4 1ASJ4 1NCQD 1RUC4 2HWB4 2R064 1R084 1EAH4 1D4M4 1RUD4 1VBB4 4Q4Y4 1COV4 1K5MD 1RUE4 1PO14 1RUI4 1VBE4 1AR64 1VBC4 1VBD4 1H8TD 1BEV4 1VRH4 2R044 2HWC4 1AR94 1NA1D 2X5ID 1MQTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXS 4;  4Q4X 4;  1AR8 4;  3J8F 4;  1AR7 4;  2RMU 4;  1HRV 4;  1POV 0;  1PVC 4;  4Q4W 4;  1RUH 4;  2RM2 4;  1PIV 4;  1RMU 4;  1R09 4;  3JBG 4;  1RUG 4;  2PLV 4;  1Z7S 4;  2RS3 4;  3JD7 4;  1RUJ 4;  1EV1 4;  4Q4V 4;  1AL2 4;  2RS1 4;  1PO2 4;  4PDW D;  1VBA 4;  2R07 4;  2RS5 4;  4GB3 4;  2RR1 4;  1RVF 4;  4RHV 4;  1RHI 4;  1OOP D;  1RUF 4;  1HRI 4;  1ASJ 4;  1NCQ D;  1RUC 4;  2HWB 4;  2R06 4;  1R08 4;  1EAH 4;  1D4M 4;  1RUD 4;  1VBB 4;  4Q4Y 4;  1COV 4;  1K5M D;  1RUE 4;  1PO1 4;  1RUI 4;  1VBE 4;  1AR6 4;  1VBC 4;  1VBD 4;  1H8T D;  1BEV 4;  1VRH 4;  2R04 4;  2HWC 4;  1AR9 4;  1NA1 D;  2X5I D;  1MQT D; 
#chains in the Genus database with same CATH topology
 1AR8 4;  2WDR A;  4YTM A;  1PIV 4;  2ACZ A;  1RMU 4;  2RS3 4;  2PLV 4;  1Z7S 4;  3JD7 4;  3AEB A;  1EV1 4;  1NEN A;  2PYL A;  3AE9 A;  1VBA 4;  3AE5 A;  2R07 4;  4GB3 4;  3AE1 A;  2FBW A;  2PYJ A;  1HRI 4;  2HWB 4;  1XI1 A;  1VBB 4;  1AR6 4;  1BEV 4;  3P4R A;  1ZOY A;  1NA1 D;  4YSY A;  1VBD 4;  1HXS 4;  4Q4X 4;  3SFE A;  1AR7 4;  1XHZ A;  2WU5 A;  1HRV 4;  3P4P A;  4Q4W 4;  3P4S A;  1R09 4;  2WDV A;  1L0V A;  4YXD A;  3AE7 A;  2WDQ A;  1AL2 4;  2WQY A;  4PDW D;  4KX6 A;  3FI7 A;  2RS5 4;  3AE6 A;  2PY5 A;  4RHV 4;  1RHI 4;  1NCQ D;  1RUC 4;  4YTP A;  4YSZ A;  1PO1 4;  3CIR A;  3AE8 A;  3AE4 A;  5C3J A;  1MQT D;  3P4Q A;  4YSX A;  5C2T A;  3J8F 4;  2R7F A;  2RMU 4;  1POV 0;  1RUH 4;  1RUG 4;  1ZP0 A;  2WP9 A;  1XHX A;  2RR1 4;  1RVF 4;  2PW9 A;  3GQK A;  3VR9 A;  1RUF 4;  3VRB A;  1ASJ 4;  2H89 A;  3VR8 A;  1R08 4;  1EAH 4;  1NEK A;  1RUD 4;  1K5M D;  3AEC A;  1VBE 4;  1VBC 4;  1VRH 4;  2RM2 4;  2X5I D;  3AE3 A;  1H8T D;  2R04 4;  3AEE A;  2HWC 4;  1AR9 4;  3SUC A;  2WS3 A;  2EX3 A;  3AE2 A;  1PVC 4;  3AEG A;  3AEF A;  1KF6 A;  2PZS A;  4YTN A;  3VRA A;  4Q4V 4;  1RUJ 4;  2WU2 A;  2B76 A;  2RS1 4;  3SFD A;  1PO2 4;  3ABV A;  3JBG 4;  1OOP D;  2R06 4;  3AED A;  2H88 A;  3GQH A;  1KFY A;  1D4M 4;  3AEA A;  4Q4Y 4;  1COV 4;  1RUE 4;  1RUI 4;  1YQ3 A;  1YQ4 A;  4YT0 A; 
#chains in the Genus database with same CATH homology
 1HXS 4;  4Q4X 4;  1AR8 4;  3J8F 4;  1AR7 4;  2RMU 4;  1HRV 4;  1POV 0;  1PVC 4;  4Q4W 4;  1RUH 4;  2RM2 4;  1PIV 4;  1RMU 4;  1R09 4;  3JBG 4;  1RUG 4;  2PLV 4;  1Z7S 4;  2RS3 4;  3JD7 4;  1RUJ 4;  1EV1 4;  4Q4V 4;  1AL2 4;  2RS1 4;  1PO2 4;  4PDW D;  1VBA 4;  2R07 4;  2RS5 4;  4GB3 4;  2RR1 4;  1RVF 4;  4RHV 4;  1RHI 4;  1OOP D;  1RUF 4;  1HRI 4;  1ASJ 4;  1NCQ D;  1RUC 4;  2HWB 4;  2R06 4;  1R08 4;  1EAH 4;  1D4M 4;  1RUD 4;  1VBB 4;  4Q4Y 4;  1COV 4;  1K5M D;  1RUE 4;  1PO1 4;  1RUI 4;  1VBE 4;  1AR6 4;  1VBC 4;  1VBD 4;  1H8T D;  1BEV 4;  1VRH 4;  2R04 4;  2HWC 4;  1AR9 4;  1NA1 D;  2X5I D;  1MQT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...