1R094

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1r09400
1BEV4 4RHV4 2RR14 4Q4X4 1PVC4 2R044 1K5MD 4GB34 1R084 1AR84 1Z7S4 1RVF4 1POV0 1RUC4 1NCQD 1PO24 1VRH4 1AR94 2RS34 1D4M4 1PO14 1RUF4 1MQTD 1RUD4 1AR64 4Q4Y4 2R064 1RHI4 1RUG4 1PIV4 2PLV4 1HXS4 1HRI4 1EAH4 1OOPD 1VBA4 2X5ID 1NA1D 1RUJ4 2RMU4 4PDWD 1RMU4 1RUE4 3JBG4 1VBC4 1AL24 1VBD4 2RS14 3JD74 1RUH4 1AR74 4Q4W4 1ASJ4 4Q4V4 1RUI4 2RS54 1EV14 1HRV4 1COV4 1R094 1VBE4 2RM24 3J8F4 2HWB4 2HWC4 1H8TD 2R074 1VBB4
chains in the Genus database with same CATH superfamily
1XHXA 2PYJA 1Z7S4 3P4QA 1POV0 1RUC4 1NCQD 3VR8A 3AEAA 2RS34 4YXDA 2WU2A 2EX3A 4YSXA 1MQTD 1KF6A 3AE6A 1PIV4 1EAH4 2RMU4 1KFYA 4PDWD 1ASJ4 3AEBA 2WQYA 4YTPA 1COV4 2R074 3SUCA 2WDQA 1BEV4 2PW9A 1K5MD 1R084 2PZSA 1AR94 1D4M4 4Q4Y4 1YQ4A 2R064 3AEDA 3SFEA 4YSYA 1HRI4 1OOPD 2WP9A 1RUJ4 3AE9A 1VBC4 1AR74 2RS54 3AE4A 1XHZA 1VBE4 2ACZA 3AECA 2H89A 2HWC4 4RHV4 3AE8A 3SFDA 2RR14 2R044 1NEKA 1AR84 1RVF4 3GQHA 3P4RA 2WS3A 1PO24 1VRH4 3AE5A 5C3JA 3AEEA 1RUD4 1AR64 3P4SA 3VR9A 3AE3A 2X5ID 1NA1D 3GQKA 1RMU4 1RUE4 1AL24 3JD74 3CIRA 1RUI4 2H88A 4YSZA 1HRV4 3AE2A 2RM24 3VRAA 3ABVA 4YTMA 1YQ3A 1RHI4 1H8TD 3AE1A 1ZOYA 2FBWA 4Q4X4 1PVC4 4GB34 1ZP0A 2R7FA 3P4PA 4KX6A 5C2TA 2PY5A 1PO14 3AEFA 3VRBA 1RUF4 3AEGA 1RUG4 2WU5A 1L0VA 2PLV4 1HXS4 2WDRA 1VBA4 2B76A 1XI1A 3JBG4 2RS14 4YTNA 1VBD4 3FI7A 1RUH4 1NENA 4Q4W4 4Q4V4 4YT0A 2PYLA 1EV14 1R094 3AE7A 3J8F4 2HWB4 2WDVA 1VBB4
chains in the Genus database with same CATH topology
1BEV4 4RHV4 2RR14 4Q4X4 1PVC4 2R044 1K5MD 4GB34 1R084 1AR84 1Z7S4 1RVF4 1POV0 1RUC4 1NCQD 1PO24 1VRH4 1AR94 2RS34 1D4M4 1PO14 1RUF4 1MQTD 1RUD4 1AR64 4Q4Y4 2R064 1RHI4 1RUG4 1PIV4 2PLV4 1HXS4 1HRI4 1EAH4 1OOPD 1VBA4 2X5ID 1NA1D 1RUJ4 2RMU4 4PDWD 1RMU4 1RUE4 3JBG4 1VBC4 1AL24 1VBD4 2RS14 3JD74 1RUH4 1AR74 4Q4W4 1ASJ4 4Q4V4 1RUI4 2RS54 1EV14 1HRV4 1COV4 1R094 1VBE4 2RM24 3J8F4 2HWB4 2HWC4 1H8TD 2R074 1VBB4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BEV 4;  4RHV 4;  2RR1 4;  4Q4X 4;  1PVC 4;  2R04 4;  1K5M D;  4GB3 4;  1R08 4;  1AR8 4;  1Z7S 4;  1RVF 4;  1POV 0;  1RUC 4;  1NCQ D;  1PO2 4;  1VRH 4;  1AR9 4;  2RS3 4;  1D4M 4;  1PO1 4;  1RUF 4;  1MQT D;  1RUD 4;  1AR6 4;  4Q4Y 4;  2R06 4;  1RHI 4;  1RUG 4;  1PIV 4;  2PLV 4;  1HXS 4;  1HRI 4;  1EAH 4;  1OOP D;  1VBA 4;  2X5I D;  1NA1 D;  1RUJ 4;  2RMU 4;  4PDW D;  1RMU 4;  1RUE 4;  3JBG 4;  1VBC 4;  1AL2 4;  1VBD 4;  2RS1 4;  3JD7 4;  1RUH 4;  1AR7 4;  4Q4W 4;  1ASJ 4;  4Q4V 4;  1RUI 4;  2RS5 4;  1EV1 4;  1HRV 4;  1COV 4;  1R09 4;  1VBE 4;  2RM2 4;  3J8F 4;  2HWB 4;  2HWC 4;  1H8T D;  2R07 4;  1VBB 4; 
#chains in the Genus database with same CATH topology
 1XHX A;  2PYJ A;  1Z7S 4;  3P4Q A;  1POV 0;  1RUC 4;  1NCQ D;  3VR8 A;  3AEA A;  2RS3 4;  4YXD A;  2WU2 A;  2EX3 A;  4YSX A;  1MQT D;  1KF6 A;  3AE6 A;  1PIV 4;  1EAH 4;  2RMU 4;  1KFY A;  4PDW D;  1ASJ 4;  3AEB A;  2WQY A;  4YTP A;  1COV 4;  2R07 4;  3SUC A;  2WDQ A;  1BEV 4;  2PW9 A;  1K5M D;  1R08 4;  2PZS A;  1AR9 4;  1D4M 4;  4Q4Y 4;  1YQ4 A;  2R06 4;  3AED A;  3SFE A;  4YSY A;  1HRI 4;  1OOP D;  2WP9 A;  1RUJ 4;  3AE9 A;  1VBC 4;  1AR7 4;  2RS5 4;  3AE4 A;  1XHZ A;  1VBE 4;  2ACZ A;  3AEC A;  2H89 A;  2HWC 4;  4RHV 4;  3AE8 A;  3SFD A;  2RR1 4;  2R04 4;  1NEK A;  1AR8 4;  1RVF 4;  3GQH A;  3P4R A;  2WS3 A;  1PO2 4;  1VRH 4;  3AE5 A;  5C3J A;  3AEE A;  1RUD 4;  1AR6 4;  3P4S A;  3VR9 A;  3AE3 A;  2X5I D;  1NA1 D;  3GQK A;  1RMU 4;  1RUE 4;  1AL2 4;  3JD7 4;  3CIR A;  1RUI 4;  2H88 A;  4YSZ A;  1HRV 4;  3AE2 A;  2RM2 4;  3VRA A;  3ABV A;  4YTM A;  1YQ3 A;  1RHI 4;  1H8T D;  3AE1 A;  1ZOY A;  2FBW A;  4Q4X 4;  1PVC 4;  4GB3 4;  1ZP0 A;  2R7F A;  3P4P A;  4KX6 A;  5C2T A;  2PY5 A;  1PO1 4;  3AEF A;  3VRB A;  1RUF 4;  3AEG A;  1RUG 4;  2WU5 A;  1L0V A;  2PLV 4;  1HXS 4;  2WDR A;  1VBA 4;  2B76 A;  1XI1 A;  3JBG 4;  2RS1 4;  4YTN A;  1VBD 4;  3FI7 A;  1RUH 4;  1NEN A;  4Q4W 4;  4Q4V 4;  4YT0 A;  2PYL A;  1EV1 4;  1R09 4;  3AE7 A;  3J8F 4;  2HWB 4;  2WDV A;  1VBB 4; 
#chains in the Genus database with same CATH homology
 1BEV 4;  4RHV 4;  2RR1 4;  4Q4X 4;  1PVC 4;  2R04 4;  1K5M D;  4GB3 4;  1R08 4;  1AR8 4;  1Z7S 4;  1RVF 4;  1POV 0;  1RUC 4;  1NCQ D;  1PO2 4;  1VRH 4;  1AR9 4;  2RS3 4;  1D4M 4;  1PO1 4;  1RUF 4;  1MQT D;  1RUD 4;  1AR6 4;  4Q4Y 4;  2R06 4;  1RHI 4;  1RUG 4;  1PIV 4;  2PLV 4;  1HXS 4;  1HRI 4;  1EAH 4;  1OOP D;  1VBA 4;  2X5I D;  1NA1 D;  1RUJ 4;  2RMU 4;  4PDW D;  1RMU 4;  1RUE 4;  3JBG 4;  1VBC 4;  1AL2 4;  1VBD 4;  2RS1 4;  3JD7 4;  1RUH 4;  1AR7 4;  4Q4W 4;  1ASJ 4;  4Q4V 4;  1RUI 4;  2RS5 4;  1EV1 4;  1HRV 4;  1COV 4;  1R09 4;  1VBE 4;  2RM2 4;  3J8F 4;  2HWB 4;  2HWC 4;  1H8T D;  2R07 4;  1VBB 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...