1R094

Human rhinovirus 14 complexed with antiviral compound r 61837
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Human rhinovirus 14 complexed with antiviral compound R 61837.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1990-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1r09400
2RS14 1RUI4 1Z7S4 1POV0 4PDWD 3JD74 1PO24 2R044 1AR84 1RHI4 2HWC4 2R074 1EAH4 1MQTD 1AR74 1K5MD 1PO14 4Q4V4 1RVF4 4Q4X4 2HWB4 1R084 1RUJ4 1RUF4 2RS54 1NCQD 1COV4 1PVC4 1D4M4 1PIV4 1RUD4 1VBC4 4Q4Y4 3JBG4 1NA1D 1OOPD 2RM24 1HRV4 1ASJ4 1EV14 4Q4W4 1RUC4 1VBA4 3J8F4 2RR14 1VBB4 1AR94 1R094 1H8TD 1RUH4 1VBE4 2X5ID 1VBD4 2R064 1HRI4 2RMU4 1HXS4 1RUG4 4RHV4 4GB34 1AL24 1AR64 2RS34 1RMU4 1VRH4 1BEV4 1RUE4 2PLV4
chains in the Genus database with same CATH superfamily
2PYJA 3GQHA 5C3JA 3AE2A 2R044 3JD74 2R074 1EAH4 3P4QA 1AR74 1K5MD 1PO14 4Q4V4 1RVF4 3AEGA 1XHXA 1RUF4 3P4PA 3AE7A 3SUCA 1R094 3VR8A 1VBE4 2FBWA 3P4RA 2X5ID 1VBD4 2WDRA 1HRI4 1AL24 2RS34 1BEV4 2PLV4 2WDQA 1Z7S4 4PDWD 1YQ4A 1MQTD 3AEBA 4Q4X4 4YSZA 3AEEA 4YSYA 2PZSA 1COV4 1ZOYA 1PVC4 4YTMA 2WU2A 3AE4A 4Q4Y4 3AEAA 3JBG4 1XHZA 2RM24 1ASJ4 3SFEA 4Q4W4 1VBA4 1ZP0A 2WQYA 1AR94 1H8TD 1RUH4 3AEDA 4YSXA 2R064 2RMU4 1RUG4 3GQKA 3SFDA 1RMU4 1RUE4 3ABVA 1RUI4 2WP9A 1POV0 2EX3A 3VRBA 1AR84 1RHI4 2HWC4 3AE9A 3AEFA 1L0VA 1KF6A 2HWB4 2ACZA 2H89A 2RS54 1NCQD 1PIV4 4YTNA 4YT0A 1NA1D 1OOPD 3VR9A 3FI7A 2WU5A 3P4SA 4KX6A 3AE5A 3CIRA 2B76A 3J8F4 2RR14 1HXS4 4YXDA 2PW9A 2RS14 1NENA 1PO24 3AE3A 2R7FA 2WDVA 2H88A 3AE1A 1R084 1RUJ4 3VRAA 1D4M4 1RUD4 1VBC4 1YQ3A 3AECA 1KFYA 1HRV4 4YTPA 1EV14 1RUC4 2WS3A 1NEKA 2PYLA 3AE8A 1VBB4 2PY5A 4RHV4 4GB34 1AR64 5C2TA 1VRH4 3AE6A 1XI1A
chains in the Genus database with same CATH topology
2RS14 1RUI4 1Z7S4 1POV0 4PDWD 3JD74 1PO24 2R044 1AR84 1RHI4 2HWC4 2R074 1EAH4 1MQTD 1AR74 1K5MD 1PO14 4Q4V4 1RVF4 4Q4X4 2HWB4 1R084 1RUJ4 1RUF4 2RS54 1NCQD 1COV4 1PVC4 1D4M4 1PIV4 1RUD4 1VBC4 4Q4Y4 3JBG4 1NA1D 1OOPD 2RM24 1HRV4 1ASJ4 1EV14 4Q4W4 1RUC4 1VBA4 3J8F4 2RR14 1VBB4 1AR94 1R094 1H8TD 1RUH4 1VBE4 2X5ID 1VBD4 2R064 1HRI4 2RMU4 1HXS4 1RUG4 4RHV4 4GB34 1AL24 1AR64 2RS34 1RMU4 1VRH4 1BEV4 1RUE4 2PLV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS1 4;  1RUI 4;  1Z7S 4;  1POV 0;  4PDW D;  3JD7 4;  1PO2 4;  2R04 4;  1AR8 4;  1RHI 4;  2HWC 4;  2R07 4;  1EAH 4;  1MQT D;  1AR7 4;  1K5M D;  1PO1 4;  4Q4V 4;  1RVF 4;  4Q4X 4;  2HWB 4;  1R08 4;  1RUJ 4;  1RUF 4;  2RS5 4;  1NCQ D;  1COV 4;  1PVC 4;  1D4M 4;  1PIV 4;  1RUD 4;  1VBC 4;  4Q4Y 4;  3JBG 4;  1NA1 D;  1OOP D;  2RM2 4;  1HRV 4;  1ASJ 4;  1EV1 4;  4Q4W 4;  1RUC 4;  1VBA 4;  3J8F 4;  2RR1 4;  1VBB 4;  1AR9 4;  1R09 4;  1H8T D;  1RUH 4;  1VBE 4;  2X5I D;  1VBD 4;  2R06 4;  1HRI 4;  2RMU 4;  1HXS 4;  1RUG 4;  4RHV 4;  4GB3 4;  1AL2 4;  1AR6 4;  2RS3 4;  1RMU 4;  1VRH 4;  1BEV 4;  1RUE 4;  2PLV 4; 
#chains in the Genus database with same CATH topology
 2PYJ A;  3GQH A;  5C3J A;  3AE2 A;  2R04 4;  3JD7 4;  2R07 4;  1EAH 4;  3P4Q A;  1AR7 4;  1K5M D;  1PO1 4;  4Q4V 4;  1RVF 4;  3AEG A;  1XHX A;  1RUF 4;  3P4P A;  3AE7 A;  3SUC A;  1R09 4;  3VR8 A;  1VBE 4;  2FBW A;  3P4R A;  2X5I D;  1VBD 4;  2WDR A;  1HRI 4;  1AL2 4;  2RS3 4;  1BEV 4;  2PLV 4;  2WDQ A;  1Z7S 4;  4PDW D;  1YQ4 A;  1MQT D;  3AEB A;  4Q4X 4;  4YSZ A;  3AEE A;  4YSY A;  2PZS A;  1COV 4;  1ZOY A;  1PVC 4;  4YTM A;  2WU2 A;  3AE4 A;  4Q4Y 4;  3AEA A;  3JBG 4;  1XHZ A;  2RM2 4;  1ASJ 4;  3SFE A;  4Q4W 4;  1VBA 4;  1ZP0 A;  2WQY A;  1AR9 4;  1H8T D;  1RUH 4;  3AED A;  4YSX A;  2R06 4;  2RMU 4;  1RUG 4;  3GQK A;  3SFD A;  1RMU 4;  1RUE 4;  3ABV A;  1RUI 4;  2WP9 A;  1POV 0;  2EX3 A;  3VRB A;  1AR8 4;  1RHI 4;  2HWC 4;  3AE9 A;  3AEF A;  1L0V A;  1KF6 A;  2HWB 4;  2ACZ A;  2H89 A;  2RS5 4;  1NCQ D;  1PIV 4;  4YTN A;  4YT0 A;  1NA1 D;  1OOP D;  3VR9 A;  3FI7 A;  2WU5 A;  3P4S A;  4KX6 A;  3AE5 A;  3CIR A;  2B76 A;  3J8F 4;  2RR1 4;  1HXS 4;  4YXD A;  2PW9 A;  2RS1 4;  1NEN A;  1PO2 4;  3AE3 A;  2R7F A;  2WDV A;  2H88 A;  3AE1 A;  1R08 4;  1RUJ 4;  3VRA A;  1D4M 4;  1RUD 4;  1VBC 4;  1YQ3 A;  3AEC A;  1KFY A;  1HRV 4;  4YTP A;  1EV1 4;  1RUC 4;  2WS3 A;  1NEK A;  2PYL A;  3AE8 A;  1VBB 4;  2PY5 A;  4RHV 4;  4GB3 4;  1AR6 4;  5C2T A;  1VRH 4;  3AE6 A;  1XI1 A; 
#chains in the Genus database with same CATH homology
 2RS1 4;  1RUI 4;  1Z7S 4;  1POV 0;  4PDW D;  3JD7 4;  1PO2 4;  2R04 4;  1AR8 4;  1RHI 4;  2HWC 4;  2R07 4;  1EAH 4;  1MQT D;  1AR7 4;  1K5M D;  1PO1 4;  4Q4V 4;  1RVF 4;  4Q4X 4;  2HWB 4;  1R08 4;  1RUJ 4;  1RUF 4;  2RS5 4;  1NCQ D;  1COV 4;  1PVC 4;  1D4M 4;  1PIV 4;  1RUD 4;  1VBC 4;  4Q4Y 4;  3JBG 4;  1NA1 D;  1OOP D;  2RM2 4;  1HRV 4;  1ASJ 4;  1EV1 4;  4Q4W 4;  1RUC 4;  1VBA 4;  3J8F 4;  2RR1 4;  1VBB 4;  1AR9 4;  1R09 4;  1H8T D;  1RUH 4;  1VBE 4;  2X5I D;  1VBD 4;  2R06 4;  1HRI 4;  2RMU 4;  1HXS 4;  1RUG 4;  4RHV 4;  4GB3 4;  1AL2 4;  1AR6 4;  2RS3 4;  1RMU 4;  1VRH 4;  1BEV 4;  1RUE 4;  2PLV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...