1RUD4

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rud400
4Q4Y4 1PO14 1EV14 1RUC4 1PVC4 4PDWD 2RR14 1D4M4 2R074 1POV0 2X5ID 1PO24 1AR84 1NCQD 1AR64 1R094 1K5MD 1NA1D 1H8TD 2PLV4 1VBE4 1PIV4 1RUG4 3JD74 1VBA4 1HRV4 2HWC4 2R044 4Q4V4 1HRI4 1AL24 1RHI4 1MQTD 1VRH4 4Q4X4 4GB34 1HXS4 1VBB4 1AR74 1Z7S4 1VBC4 3J8F4 2R064 2RS14 1RUD4 2HWB4 4RHV4 2RMU4 1RVF4 1RUI4 1VBD4 1RUE4 1RUH4 2RS54 4Q4W4 1RUF4 1BEV4 1RMU4 2RS34 1R084 2RM24 1AR94 1COV4 1OOPD 1EAH4 1ASJ4 3JBG4 1RUJ4
chains in the Genus database with same CATH superfamily
4Q4Y4 4PDWD 3AEAA 2RR14 4YT0A 3AE8A 1YQ4A 2X5ID 1PO24 1NCQD 4YSYA 3ABVA 2H88A 5C2TA 1PIV4 4YTMA 3SUCA 2WU5A 1VBA4 1HRV4 2R044 4Q4V4 1HRI4 4Q4X4 3AE6A 1Z7S4 3AE3A 1KFYA 1RUD4 1RUI4 1BEV4 2ACZA 3P4RA 1XHZA 3SFEA 1COV4 1XHXA 1OOPD 1EAH4 1PO14 2H89A 3VRAA 1PVC4 1ZOYA 1D4M4 2WS3A 2WU2A 3P4PA 3AEGA 2PLV4 1R094 1NA1D 1H8TD 2R7FA 1YQ3A 4KX6A 1VBE4 1RUG4 1RHI4 1VRH4 1AR74 3P4SA 2RS14 3AEFA 1KF6A 1L0VA 3AE9A 2RMU4 1RVF4 1VBD4 1XI1A 1RUE4 2PYJA 4YSZA 4YXDA 4YSXA 3AECA 3AEDA 3GQHA 2R074 1POV0 1AR84 2WDVA 3CIRA 1AR64 1K5MD 2WDQA 1NENA 3GQKA 3AE1A 2HWC4 4YTPA 1ZP0A 2B76A 1AL24 1MQTD 2PZSA 1HXS4 3J8F4 1VBC4 2EX3A 1RMU4 3AE7A 2RM24 1ASJ4 1RUJ4 1EV14 1RUC4 3VRBA 3P4QA 3VR8A 3FI7A 2WDRA 3AE5A 2PW9A 3VR9A 3JD74 3AEBA 3AE2A 2PYLA 4GB34 1VBB4 2WQYA 4YTNA 2WP9A 2FBWA 2R064 2HWB4 2PY5A 4RHV4 3AEEA 2RS54 1RUH4 3SFDA 1RUF4 2RS34 1R084 1NEKA 3AE4A 1AR94 5C3JA 4Q4W4 3JBG4
chains in the Genus database with same CATH topology
4Q4Y4 1PO14 1EV14 1RUC4 1PVC4 4PDWD 2RR14 1D4M4 2R074 1POV0 2X5ID 1PO24 1AR84 1NCQD 1AR64 1R094 1K5MD 1NA1D 1H8TD 2PLV4 1VBE4 1PIV4 1RUG4 3JD74 1VBA4 1HRV4 2HWC4 2R044 4Q4V4 1HRI4 1AL24 1RHI4 1MQTD 1VRH4 4Q4X4 4GB34 1HXS4 1VBB4 1AR74 1Z7S4 1VBC4 3J8F4 2R064 2RS14 1RUD4 2HWB4 4RHV4 2RMU4 1RVF4 1RUI4 1VBD4 1RUE4 1RUH4 2RS54 4Q4W4 1RUF4 1BEV4 1RMU4 2RS34 1R084 2RM24 1AR94 1COV4 1OOPD 1EAH4 1ASJ4 3JBG4 1RUJ4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4Y 4;  1PO1 4;  1EV1 4;  1RUC 4;  1PVC 4;  4PDW D;  2RR1 4;  1D4M 4;  2R07 4;  1POV 0;  2X5I D;  1PO2 4;  1AR8 4;  1NCQ D;  1AR6 4;  1R09 4;  1K5M D;  1NA1 D;  1H8T D;  2PLV 4;  1VBE 4;  1PIV 4;  1RUG 4;  3JD7 4;  1VBA 4;  1HRV 4;  2HWC 4;  2R04 4;  4Q4V 4;  1HRI 4;  1AL2 4;  1RHI 4;  1MQT D;  1VRH 4;  4Q4X 4;  4GB3 4;  1HXS 4;  1VBB 4;  1AR7 4;  1Z7S 4;  1VBC 4;  3J8F 4;  2R06 4;  2RS1 4;  1RUD 4;  2HWB 4;  4RHV 4;  2RMU 4;  1RVF 4;  1RUI 4;  1VBD 4;  1RUE 4;  1RUH 4;  2RS5 4;  4Q4W 4;  1RUF 4;  1BEV 4;  1RMU 4;  2RS3 4;  1R08 4;  2RM2 4;  1AR9 4;  1COV 4;  1OOP D;  1EAH 4;  1ASJ 4;  3JBG 4;  1RUJ 4; 
#chains in the Genus database with same CATH topology
 4Q4Y 4;  4PDW D;  3AEA A;  2RR1 4;  4YT0 A;  3AE8 A;  1YQ4 A;  2X5I D;  1PO2 4;  1NCQ D;  4YSY A;  3ABV A;  2H88 A;  5C2T A;  1PIV 4;  4YTM A;  3SUC A;  2WU5 A;  1VBA 4;  1HRV 4;  2R04 4;  4Q4V 4;  1HRI 4;  4Q4X 4;  3AE6 A;  1Z7S 4;  3AE3 A;  1KFY A;  1RUD 4;  1RUI 4;  1BEV 4;  2ACZ A;  3P4R A;  1XHZ A;  3SFE A;  1COV 4;  1XHX A;  1OOP D;  1EAH 4;  1PO1 4;  2H89 A;  3VRA A;  1PVC 4;  1ZOY A;  1D4M 4;  2WS3 A;  2WU2 A;  3P4P A;  3AEG A;  2PLV 4;  1R09 4;  1NA1 D;  1H8T D;  2R7F A;  1YQ3 A;  4KX6 A;  1VBE 4;  1RUG 4;  1RHI 4;  1VRH 4;  1AR7 4;  3P4S A;  2RS1 4;  3AEF A;  1KF6 A;  1L0V A;  3AE9 A;  2RMU 4;  1RVF 4;  1VBD 4;  1XI1 A;  1RUE 4;  2PYJ A;  4YSZ A;  4YXD A;  4YSX A;  3AEC A;  3AED A;  3GQH A;  2R07 4;  1POV 0;  1AR8 4;  2WDV A;  3CIR A;  1AR6 4;  1K5M D;  2WDQ A;  1NEN A;  3GQK A;  3AE1 A;  2HWC 4;  4YTP A;  1ZP0 A;  2B76 A;  1AL2 4;  1MQT D;  2PZS A;  1HXS 4;  3J8F 4;  1VBC 4;  2EX3 A;  1RMU 4;  3AE7 A;  2RM2 4;  1ASJ 4;  1RUJ 4;  1EV1 4;  1RUC 4;  3VRB A;  3P4Q A;  3VR8 A;  3FI7 A;  2WDR A;  3AE5 A;  2PW9 A;  3VR9 A;  3JD7 4;  3AEB A;  3AE2 A;  2PYL A;  4GB3 4;  1VBB 4;  2WQY A;  4YTN A;  2WP9 A;  2FBW A;  2R06 4;  2HWB 4;  2PY5 A;  4RHV 4;  3AEE A;  2RS5 4;  1RUH 4;  3SFD A;  1RUF 4;  2RS3 4;  1R08 4;  1NEK A;  3AE4 A;  1AR9 4;  5C3J A;  4Q4W 4;  3JBG 4; 
#chains in the Genus database with same CATH homology
 4Q4Y 4;  1PO1 4;  1EV1 4;  1RUC 4;  1PVC 4;  4PDW D;  2RR1 4;  1D4M 4;  2R07 4;  1POV 0;  2X5I D;  1PO2 4;  1AR8 4;  1NCQ D;  1AR6 4;  1R09 4;  1K5M D;  1NA1 D;  1H8T D;  2PLV 4;  1VBE 4;  1PIV 4;  1RUG 4;  3JD7 4;  1VBA 4;  1HRV 4;  2HWC 4;  2R04 4;  4Q4V 4;  1HRI 4;  1AL2 4;  1RHI 4;  1MQT D;  1VRH 4;  4Q4X 4;  4GB3 4;  1HXS 4;  1VBB 4;  1AR7 4;  1Z7S 4;  1VBC 4;  3J8F 4;  2R06 4;  2RS1 4;  1RUD 4;  2HWB 4;  4RHV 4;  2RMU 4;  1RVF 4;  1RUI 4;  1VBD 4;  1RUE 4;  1RUH 4;  2RS5 4;  4Q4W 4;  1RUF 4;  1BEV 4;  1RMU 4;  2RS3 4;  1R08 4;  2RM2 4;  1AR9 4;  1COV 4;  1OOP D;  1EAH 4;  1ASJ 4;  3JBG 4;  1RUJ 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...