1RUD4

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52084
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rud400
1ASJ4 1BEV4 1AR64 1H8TD 2RS34 1VBB4 1PO24 1HXS4 1PO14 1Z7S4 4PDWD 1RUD4 2HWC4 2HWB4 4Q4W4 4Q4Y4 4RHV4 1RVF4 1AR94 1HRV4 2RS54 1AR84 3JBG4 2RM24 1RHI4 1VRH4 1RUF4 1AR74 1K5MD 1VBD4 1R094 2RS14 3J8F4 1VBC4 4Q4V4 1PVC4 4Q4X4 1AL24 4GB34 2R064 1HRI4 1RUI4 1POV0 1VBE4 1EV14 1NCQD 1RUH4 2X5ID 3JD74 1EAH4 1MQTD 2R074 1RUJ4 1RUG4 2R044 1OOPD 1NA1D 1RUE4 1R084 2PLV4 1RMU4 1VBA4 1PIV4 2RR14 2RMU4 1COV4 1RUC4 1D4M4
chains in the Genus database with same CATH superfamily
1XI1A 3AEDA 1VBB4 1PO14 3SUCA 1RUD4 3AE5A 4YTPA 1RVF4 3AEEA 3GQHA 3VR9A 2WDVA 1RHI4 1K5MD 3J8F4 1YQ3A 2WQYA 4YSYA 1KF6A 1EV14 3JD74 3AEFA 3AE8A 5C2TA 3AECA 3AE3A 3VR8A 1RUE4 2WU5A 3SFDA 1PIV4 4YSXA 1XHZA 1RUC4 3AE9A 2WU2A 3P4RA 1PO24 1HXS4 3SFEA 2WDRA 1XHXA 1L0VA 3JBG4 1VRH4 1VBD4 2FBWA 3P4SA 4Q4V4 4Q4X4 4GB34 1RUI4 1VBE4 1RUH4 1MQTD 2R074 3AE7A 1RUG4 2ACZA 1ZOYA 5C3JA 2R044 1YQ4A 1OOPD 2PLV4 1KFYA 3AEBA 2PYJA 1ASJ4 3P4QA 3AE2A 3VRAA 3CIRA 2WS3A 2HWB4 4YTMA 3FI7A 2RS54 4KX6A 1ZP0A 2RM24 4Q4Y4 2RS14 3ABVA 1AR74 1R094 1VBC4 4YSZA 2R064 2R7FA 1NENA 1NCQD 3VRBA 3AE6A 1NEKA 1RUJ4 2H89A 1NA1D 1RMU4 1VBA4 2RMU4 1COV4 3AE1A 2WP9A 4YTNA 2PZSA 3AEGA 1D4M4 1BEV4 1AR64 4YXDA 1H8TD 2RS34 3AEAA 1Z7S4 4PDWD 2HWC4 4Q4W4 4RHV4 1AR94 2PY5A 1HRV4 1AR84 3AE4A 4YT0A 1RUF4 2PYLA 3GQKA 1PVC4 2H88A 1AL24 2PW9A 1HRI4 1POV0 2X5ID 1EAH4 3P4PA 2B76A 1R084 2EX3A 2RR14 2WDQA
chains in the Genus database with same CATH topology
1ASJ4 1BEV4 1AR64 1H8TD 2RS34 1VBB4 1PO24 1HXS4 1PO14 1Z7S4 4PDWD 1RUD4 2HWC4 2HWB4 4Q4W4 4Q4Y4 4RHV4 1RVF4 1AR94 1HRV4 2RS54 1AR84 3JBG4 2RM24 1RHI4 1VRH4 1RUF4 1AR74 1K5MD 1VBD4 1R094 2RS14 3J8F4 1VBC4 4Q4V4 1PVC4 4Q4X4 1AL24 4GB34 2R064 1HRI4 1RUI4 1POV0 1VBE4 1EV14 1NCQD 1RUH4 2X5ID 3JD74 1EAH4 1MQTD 2R074 1RUJ4 1RUG4 2R044 1OOPD 1NA1D 1RUE4 1R084 2PLV4 1RMU4 1VBA4 1PIV4 2RR14 2RMU4 1COV4 1RUC4 1D4M4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASJ 4;  1BEV 4;  1AR6 4;  1H8T D;  2RS3 4;  1VBB 4;  1PO2 4;  1HXS 4;  1PO1 4;  1Z7S 4;  4PDW D;  1RUD 4;  2HWC 4;  2HWB 4;  4Q4W 4;  4Q4Y 4;  4RHV 4;  1RVF 4;  1AR9 4;  1HRV 4;  2RS5 4;  1AR8 4;  3JBG 4;  2RM2 4;  1RHI 4;  1VRH 4;  1RUF 4;  1AR7 4;  1K5M D;  1VBD 4;  1R09 4;  2RS1 4;  3J8F 4;  1VBC 4;  4Q4V 4;  1PVC 4;  4Q4X 4;  1AL2 4;  4GB3 4;  2R06 4;  1HRI 4;  1RUI 4;  1POV 0;  1VBE 4;  1EV1 4;  1NCQ D;  1RUH 4;  2X5I D;  3JD7 4;  1EAH 4;  1MQT D;  2R07 4;  1RUJ 4;  1RUG 4;  2R04 4;  1OOP D;  1NA1 D;  1RUE 4;  1R08 4;  2PLV 4;  1RMU 4;  1VBA 4;  1PIV 4;  2RR1 4;  2RMU 4;  1COV 4;  1RUC 4;  1D4M 4; 
#chains in the Genus database with same CATH topology
 1XI1 A;  3AED A;  1VBB 4;  1PO1 4;  3SUC A;  1RUD 4;  3AE5 A;  4YTP A;  1RVF 4;  3AEE A;  3GQH A;  3VR9 A;  2WDV A;  1RHI 4;  1K5M D;  3J8F 4;  1YQ3 A;  2WQY A;  4YSY A;  1KF6 A;  1EV1 4;  3JD7 4;  3AEF A;  3AE8 A;  5C2T A;  3AEC A;  3AE3 A;  3VR8 A;  1RUE 4;  2WU5 A;  3SFD A;  1PIV 4;  4YSX A;  1XHZ A;  1RUC 4;  3AE9 A;  2WU2 A;  3P4R A;  1PO2 4;  1HXS 4;  3SFE A;  2WDR A;  1XHX A;  1L0V A;  3JBG 4;  1VRH 4;  1VBD 4;  2FBW A;  3P4S A;  4Q4V 4;  4Q4X 4;  4GB3 4;  1RUI 4;  1VBE 4;  1RUH 4;  1MQT D;  2R07 4;  3AE7 A;  1RUG 4;  2ACZ A;  1ZOY A;  5C3J A;  2R04 4;  1YQ4 A;  1OOP D;  2PLV 4;  1KFY A;  3AEB A;  2PYJ A;  1ASJ 4;  3P4Q A;  3AE2 A;  3VRA A;  3CIR A;  2WS3 A;  2HWB 4;  4YTM A;  3FI7 A;  2RS5 4;  4KX6 A;  1ZP0 A;  2RM2 4;  4Q4Y 4;  2RS1 4;  3ABV A;  1AR7 4;  1R09 4;  1VBC 4;  4YSZ A;  2R06 4;  2R7F A;  1NEN A;  1NCQ D;  3VRB A;  3AE6 A;  1NEK A;  1RUJ 4;  2H89 A;  1NA1 D;  1RMU 4;  1VBA 4;  2RMU 4;  1COV 4;  3AE1 A;  2WP9 A;  4YTN A;  2PZS A;  3AEG A;  1D4M 4;  1BEV 4;  1AR6 4;  4YXD A;  1H8T D;  2RS3 4;  3AEA A;  1Z7S 4;  4PDW D;  2HWC 4;  4Q4W 4;  4RHV 4;  1AR9 4;  2PY5 A;  1HRV 4;  1AR8 4;  3AE4 A;  4YT0 A;  1RUF 4;  2PYL A;  3GQK A;  1PVC 4;  2H88 A;  1AL2 4;  2PW9 A;  1HRI 4;  1POV 0;  2X5I D;  1EAH 4;  3P4P A;  2B76 A;  1R08 4;  2EX3 A;  2RR1 4;  2WDQ A; 
#chains in the Genus database with same CATH homology
 1ASJ 4;  1BEV 4;  1AR6 4;  1H8T D;  2RS3 4;  1VBB 4;  1PO2 4;  1HXS 4;  1PO1 4;  1Z7S 4;  4PDW D;  1RUD 4;  2HWC 4;  2HWB 4;  4Q4W 4;  4Q4Y 4;  4RHV 4;  1RVF 4;  1AR9 4;  1HRV 4;  2RS5 4;  1AR8 4;  3JBG 4;  2RM2 4;  1RHI 4;  1VRH 4;  1RUF 4;  1AR7 4;  1K5M D;  1VBD 4;  1R09 4;  2RS1 4;  3J8F 4;  1VBC 4;  4Q4V 4;  1PVC 4;  4Q4X 4;  1AL2 4;  4GB3 4;  2R06 4;  1HRI 4;  1RUI 4;  1POV 0;  1VBE 4;  1EV1 4;  1NCQ D;  1RUH 4;  2X5I D;  3JD7 4;  1EAH 4;  1MQT D;  2R07 4;  1RUJ 4;  1RUG 4;  2R04 4;  1OOP D;  1NA1 D;  1RUE 4;  1R08 4;  2PLV 4;  1RMU 4;  1VBA 4;  1PIV 4;  2RR1 4;  2RMU 4;  1COV 4;  1RUC 4;  1D4M 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...