3FI7A

Crystal structure of the autolysin auto (lmo1076) from listeria monocytogenes, catalytic domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
EPVFSLEQNRDDAMAALASTPTFQQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGKAPNYNLFGIKGSYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSSYYKGAWRENAKTYKDATAWLQGRYATDNTYASKLNTLISSYNLTQYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1076 protein
publication title Structural basis for autoinhibition and activation of Auto, a virulence-associated peptidoglycan hydrolase of Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Hydrolase
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01832 Glucosaminidase Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3fi7A01
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 3fi7A02
1G7JC 1WQRA 1KIQC 1IP6A 4TSCA 1LJIA 4NEBA 4II8A 3QNGA 1FDLY 4NG8A 5FSTA 1XHXA 2D4JA 1GFTA 4B0DA 1LZGA 3B0OA 4H1PA 3BKVA 4WM1A 5KXSA 1HF4A 1LMCA 5I4XA 4DDAA 1TAYA 5B06A 1CNSA 4BAFA 2I6ZA 1IY4A 1IO5A 1NHEA 1VDTA 1NBYC 2HEEA 4NGLA 2FYCA 135LA 2BQAA 1IC7Y 4NSIA 1W08A 1IP4A 4WLYA 1XHZA 2HEAA 4NHIA 3RU5A 4PPOA 1BWIA 2H5ZA 4TSBA 3AJNA 2ZWBA 5KXRA 3TXIA 4LYOA 1B5VA 2HUBA 4GCDA 1DI3A 3W6FA 1LZ8A 1LSFA 2N5ZA 4YENA 1KIRC 2DQHY 1QSWA 1UIAA 5IHGA 5KXTA 4RW2A 1JSEA 5LIOA 3IJUA 4XJGA 2BQNA 1LZYA 4OWAA 4W96A 3A6BY 3WULA 4DWXA 1UIDA 2BQMA 4BS7A 1XEJA 4HP0A 5IDDA 5F14A 1GB7A 1WQQA 4KL7A 1XGPC 4N5RA 2BLXA 1GFAA 1LJJA 1B2KA 1GF4A 3P64A 1GF6A 1RFPA 4LYBA 1GBYA 5I4WA 1YAQA 1GBXA 1D0MA 1REZA 1UICA 1HSWA 3LYMA 3RW8A 1IP3A 1F0WA 1GF7A 4NGVA 1NWGA 3B6LA 4NY5A 1OUCA 4GLVA 1XGRC 4YF2A 1AM7A 2Z38A 3WL2A 1UIEA 1B5ZA 4N8ZA 2EIZC 1NKHA 1D0KA 2BLYA 4WL7A 1I1ZA 2Z19A 1LSAA 2AUBA 2ZILA 5D5FA 1CJ9A 2BQLA 5B07A 3W6EA 4B49A 1C10A 2DQAA 3A3QA 1A4VA 1IWVA 4ETBA 1HFXA 3P65A 3A3RX 2BPUA 1DZBX 1IC5Y 1IOQA 1IP7A 2Z39A 3LZTA 4HSFA 3WUMA 4H9IA 5KY1A 2GV0A 1B0DA 4G4BA 4N9RA 1OUBA 3HBDA 4Z41A 5LINA 4DD9A 1GF0A 1LYZA 1UIBA 1GB2A 2CGIA 4HJZA 1CKFA 1OUIA 1C7PA 1BVXA 4NSHA 1HEWA 1CJ8A 1G7HC 2G4NA 3MGWA 3TXGA 1LMOA 1IORA 4G4HA 1LCNA 1JKDA 1JTPL 2H9JA 1IIZA 3P4ZA 4W94A 1BHZA 2CDSA 3KAMA 4HV2A 4H91A 1GB8A 1LMPA 2HEDA 3N9CA 4OWCA 1LJ4A 4XYYA 1UUZC 3LHMA 1NBZC 1KXWA 1FBIX 5LVGA 1C08C 1JIYA 2HECA 4Z3MA 4H8XA 1IEEA 2G4PA 1NDGC 1GB3A 2BQOA 3ULRA 1YAMA 4DC4A 1LZEA 1JISA 4WLXA 1BB4A 3AW6A 1OUDA 1B7OA 2IFFY 3AYQA 1BB3A 1FKVA 4B4IA 3CT5A 5KXKA 1LZCA 4NFVA 1CKDA 3WPJA 5AMYA 1BVKC 3HBEX 4XN6A 2DQFC 1GDWA 2PC2A 4Z46A 4O34A 3CSQA 1IWZA 4GN5C 2I25L 2MEDA 1CKHA 1GAZA 4HTNA 2FBBA 2MEIA 1JWRA 2XBRA 1PS5A 1GF3A 3TXHA 5LAFA 3VWOA 4H8ZA 2YBHA 5E9RA 3T6UA 1GBZA 2Z18A 3WW6A 2MEBA 4B4EA 1JHLA 1YANA 3ATOA 1XI1A 6LYTA 8LYZA 4NHTA 2BQKA 2MEGA 4J1AA 1BQLY 3P68A 2G4QA 1I56A 2ZNXY 4HPIA 1RCMA 1GE0A 1IWYA 1YAPA 3A96A 2MEHA 1IY3A 3ZEKA 1IOTA 5HMJA 1XSFA 1YILA 3AGIA 4QDNA 3A91A 1WQOA 3RT5X 3AW7A 2EX3A 1YROA 2ZNWY 3LYOA 1C45A 1J1OY 1UIFA 5KXZA 1VDQA 2A7FA 4KPMA 4TWSA 1UACY 4Z98A 3CSZA 1JTTL 1B7QA 1LSEA 1C46A 4OW1A 4DD0A 4DYGA 1B9OA 1PZYA 2HEFA 1LZBA 1GHLA 4ZIXA 1FN5A 5C6JA 5I4YA 1QQYA 2PW9A 4NGYA 1F6RA 1LZ1A 1XGTC 3WVXA 4E3UA 1GF5A 1DQJC 4XADA 1GB6A 1LKRA 5APEA 1IOCA 4M6DA 1WQNA 4MR1A 3TMUA 2DBTA 4GLAA 3J4GA 2BAAA 3N9EA 3W3EA 1AKIA 3QE8A 5FELA 3TMWA 4NHQA 1GEVA 2DQCY 2F2NA 4AGAA 5LVJA 3WH1A 5M1YA 1LHKA 1VDPA 2LYMA 4WG1A 1HELA 4WG7A 5KXOA 3TMXA 4ETCA 4ET9A 1QDTA 1LKSA 5I53A 4LFXA 4NIJA 1NF5A 1Z55A 3A94A 3TXJA 1DPXA 153LA 2XJWA 2F30A 4WMGA 3WU9A 5LAGA 1XEKA 4N1EI 5E4PA 2YBNA 4ZFPA 1QDRA 2FBDA 4QGZA 1RI8B 1RJCB 1DI5A 1GFRA 1T6VL 4H90A 3J6KA 4NGOA 1KIPC 3M3UA 4LYCA 4ETDA 4LYMA 1DKJA 1GE3A 4CFOA 4GCEA 4BADA 5ILCA 3P66A 3W6CA 1IWTA 208LA 4EOFA 2YBLA 4GCCA 1VFBC 1VAUA 1BGIA 4H94A 1LMAA 1A2YC 2A7DA 3A90A 4U3XB 134LA 1LZNA 4XJDA 5KXMA 2BQDA 4P2EA 1FLUA 4R0FA 5B05A 1GFGA 4G4CA 5K7OA 4HV1A 3T36A 1AT6A 1JKAA 1LJNA 4NWHA 3TMVA 2W1LA 2D4KA 4B1AA 9LYZA 1SQ2L 4LT1A 3W6BA 1NQIA 4DDCA 1BB7A 1JITA 3EXDA 4WLTA 5C6IA 3A67Y 5HNCA 1V7TA 2ZYPA 2C8OA 1QTKA 4NSJA 1HNLA 2MEEA 5LYMA 2D91A 4OWBA 1XGUC 1GFVA 4N1CC 3WXUA 4HPEA 5APDA 1QUSA 2YBJA 3A8ZA 2MECA 4PRQA 3SP3A 193LA 3AZ7A 1WQPA 1LHLA 1LHMA 1HSXA 4WLDA 3TXFA 4ZEEA 1LSDA 4WOAA 3HFMY 4XJHA 3WUAA 5KKIA 4IJ4A 5APFA 1IX0A 2ZIKA 4G49A 5HLLA 1YL1X 1LJKA 5I5QA 2CJLA 4XJFA 4LYTA 2ZQ4A 1HMKA 2EKSC 4NWEA 4XENA 1D0LA 1IR9A 4I8SA 3CSRA 4WM4A 1LJEA 2X0AA 2BQEA 1B7LA 1LZAA 4HJVA 1DKKA 1LMNA 1LPIA 4NSGA 1RE2A 1G7MC 5KXLA 1LSBA 4KXIA 1FLYA 4H9FA 4EMNA 2DQDY 1HEOA 3CT0A 4QEQA 3W6AA 1IWXA 3WPLA 5C6LA 1H6MA 2ZYCA 3A92A 4UWNA 5DN4A 154LA 3EO5A 4UWVA 3AGHA 1EQ4A 3W6DA 1KXYA 4XJIA 4J0LA 1LZRA 3RNXA 3EBAB 1B5XA 4H93A 1XEIA 3A95A 4H9EA 1F10A 4H9AA 1LSCA 4WL6A 2BQCA 2YVBA 5B1FA 4DDBA 4FDYA 1INUA 2LYOA 3B0IA 4GN4A 1JKCA 4YEOA 5FCPA 1ZVYB 1LYOA 3ZVQB 1QIOA 4WM3A 1CKGA 1B7PA 1EL1A 1AZFA 1B5YA 2DQJY 4FJRA 2NWDX 207LA 1GBWA 1IP5A 1LHJA 1UIGA 5LYTA 1GF8A 4H92A 4IASA 1LHHA 1W6ZA 4LZTA 1JTOL 3K3TA 2B5ZA 1TBYA 4TX7A 1B7SA 4DD2A 3QY4A 1FLWA 1GB0A 2BQIA 1GXV2 2Z37A 1FLQA 1GF9A 3ZVQA 1UA6Y 1HHLA 1JUGA 3CT1A 3LN2A 1KXXA 1LJHA 1ZV5L 194LA 4NG1A 5DLAA 4C3WA 1LSGA 4H9HA 5B59A 4D9ZA 3HBHA 2YBMA 5II3A 2ZIJA 5FHWA 1OUEA 1WVVA 1XGQC 1SLYA 1G7LC 2DKVA 2DQGY 4WO9A 5L9JA 1DXJA 4J7VA 5LVHA 4XJBA 1LJFA 133LA 1WTMA 4DD1A 2LHMA 4WM2A 4QY9A 1YKZX 2ZQ3A 3G3AB 5LYZA 3D9AC 2YBIA 1GAYA 1UC0A 4HTKA 3TXKA 1GFKA 1YKYX 1IP1A 1GE1A 3AB6A 4HTQA 3WXTA 1WVUA 3FE0A 1BB6A 2BQBA 3A6CY 3WUNA 5F9XA 4OWHA 1GBSA 1HFYA 2LYZA 4CJ2A 3N9AA 4TTDA 2F4AA 4ET8A 1WQMA 2EPEA 1F6SA 2W1MA 2YSSC 4H8YA 1D9UA 3G3BB 1YQVY 1OUFA 3WW5A 1N4FA 1CJ7A 1IR8A 1IVMA 2RSCA 1UIHA 2D4IA 1IC4Y 1LZ4A 1IOSA 1LYSA 1REXA 1J1PY 1VDSA 4WO6A 5APCA 5L3HA 1FKQA 3WU8A 4ANRA 1LSMA 4J1BA 1J1XY 1LZSA 1I20A 1OUJA 4H9CA 3WYHA 1B5WA 3TXDA 1MLCE 1UCOA 1GFHA 3D3DA 2DQEY 3WVYA 2MEAA 4LYZA 1LSPA 5DL9A 4GCFA 1OP9B 1HC0A 3LYZA 1NDMC 1GB5A 4WM6A 5LA8A 5JENB 2PYJA 1IP2A 4AXTA 1D6QA 3M18B 1OUGA 2D6BA 4M4OA 1DPWA 1TCYA 4LFPA 1EQEA 1JJ0A 4N0JA 1E8LA 2XBSA 5KXPA 4ML7A 4DD7A 5F16A 1LOZA 1GFEA 2BQFA 4GCBA 5HQ1A 4OWEA 4YM8A 1LJ3A 3EMSA 4RDSA 4DT3A 5IELA 1GE2A 2HU1A 1LJGA 4LGKA 1GPQC 1GEZA 4RLNA 5ILFA 5KKJA 1ALCA 1LHIA 4MCKA 1B5UA 1LMTA 5EBHA 1IR7A 1OUAA 1GFUA 3F6ZA 3AGGG 1YKXX 1LZ6A 3A93A 4CHXA 2HU3A 1CJ6A 5D5CA 3OJPA 4R6CA 3OK0A 3B72A 5FEKA 2FYDA 4MSTA 4YEMA 2PYLA 4L41A 4NHSA 1HEMA 4TUNA 1MELL 1HMLA 5KJ9A 3AZ6A 1GDXA 3WPKA 1OQMA 1DI4A 1HERA 5LVIA 4X3BA 132LA 4RW1A 4CGEA 1IWWA 4LT0A 4LT2A 4PRUA 3CQLA 2C8PA 1HEQA 4C5FA 4OOOA 3GXRA 5F81A 2Z2FA 5KXYA 1T3PA 2W1XA 2CWIA 1CKCA 1H87A 1D6PA 1UBZA 2LZTA 3GXKA 4BAPA 5LXWA 1GE4A 3FI7A 4NHPA 2VB1A 1JJ1A 1B7RA 2DQIY 4PGJB 5J7CA 2BQJA 1WTNA 1JPOA 3AZ4A 5KXNA 5LVKA 3TXBA 1JKBA 5DM9A 2YDGA 3CB7A 1LSZA 1GBOA 2Y8PA 5A3EA 5KXXA 5I54A 1EQ5A 2BQGA 2EQLA 1O23A 1TEWA 1GXXA 1VATA 1QUTA 2XTHA 3BKHA 1LAAA 5F9UA 1GD6A 3IJVA 1JSFA 3IWRA 1LSYA 2I26L 3A34A 1REYA 1AT5A 4ETAA 2LZ2A 4LT3A 2BQHA 1IWUA 1GWDA 4G9SA 5T3FA 1OUHA 1VEDA 1BWJA 1LMQA 1LZTA 1LYYA 4H9BA 4CFPA 4YOPA 2PY5A 5DN5A 3B0KA 5B1GA 5HNLA 1B7NA 1NMMA 1YAOA 1LZ9A 3LYTA 1HEPA 1LZDA 1YL0X 6LYZA 1JEFA 5LA5A 4HJYA 2H9KA 2HEBA 3WU7A 2HTXA 4OOTA 4UWUA 1C43A 1ZVHL 5KXWA 2Q0MX 4PJ2C 4DD3A 4RLMA 3LZ2A 2PZSA 1TDYA 3WMKA 3AZ5A 3TXEA 2R7FA 1LZ5A 2IHLA 2F4GA 1HFZA 1P2CC 2Z12A 5FDJA 1V7SA 1BB5A 4IATA 2W1YA 4GN3A 1REMA 4NGWA 1BWHA 4B4JA 1GB9A 1QTEA 1ZMYL 4NGZA 1LSNA 5HMVA 5L3IA 4NGIA 2Z2EA 4KT3A 1HENA 4I0CA 4ETEA 1G7IC 1XFPL 2WARA 4PHIA 4NGKA 1YIKA 7LYZA 1GFJA 3E3DA 1LTMA 4A7DA 3RZ4A 1JJ3A 5A3ZA 2MEFA 3ATNA 4WM5A 1B7MA 4NGJA 1QSAA
chains in the Genus database with same CATH superfamily
1WQRA 257LA 1IP6A 1RUF4 4YTMA 3QNGA 1FDLY 217LA 234LA 4NG8A 1GFTA 3B0OA 3BKVA 2B72A 1LI2A 4BAFA 209LA 1IO5A 2HEEA 224LA 1BWIA 2ZWBA 2NTGA 3W6FA 1KS3A 1KIRC 170LA 1JSEA 1SX2A 4OWAA 2RBQA 1G07A 1WQQA 1GFAA 173LA 2HULA 1GBYA 4EKPA 1YAQA 3VRBA 1GF7A 1NWGA 4NY5A 2BLYA 3CDTA 2AUBA 5D5FA 4ETBA 1DZBX 1IOQA 3L2XA 1C6GA 1L0JA 253LA 5LINA 215LA 4N9RA 3HBDA 2CGIA 4HJZA 1CKFA 4NSHA 1HEWA 2G4NA 1QTVA 1RUC4 3CDOA 4G4HA 1XEPA 4YXDA 4W94A 4HV2A 4H91A 3HT6A 1LMPA 4OWCA 2NTHA 1LJ4A 1UUZC 1C08C 1JIYA 1BEV4 2HECA 4Z3MA 3GUIA 2BQOA 2IGCA 4DC4A 1LZEA 2RH1A 2IFFY 252LA 3D4SA 1L60A 3GUKA 1LZCA 1CKDA 3WPJA 1QTHA 1C6MA 2DQFC 1GDWA 5C3JA 3CSQA 1IWZA 1G0GA 1L54A 4DQ5A 5E9RA 2Z18A 1YANA 1XI1A 6LYTA 2BQKA 1L23A 1KY0A 4HPIA 1RCMA 1C6HA 142LA 2B6ZA 3A96A 2F47A 2MEHA 3ZEKA 2XQOA 4ARJA 3AGIA 1WQOA 3RT5X 1JTMA 3NY8A 2ZNWY 1WTHA 2B6WA 3LYOA 1C45A 1VDQA 205LA 4I7PA 3AE2A 4Z98A 3JBG4 1B9OA 1C69A 222LA 1EAH4 1L18A 3C7YA 1LZ1A 3HT9A 4XADA 123LA 3SN6R 1RUI4 5APEA 3TMUA 2DBTA 3W3EA 1AKIA 3QE8A 3SB8A 4AGAA 5LVJA 3WH1A 1LHKA 1VDPA 3SUCA 198LA 141LA 4KX6A 3TMXA 4ETCA 3OE9A 4ET9A 1LKSA 4NIJA 3A94A 3WU9A 4ARLA 1P37A 3HUAA 1RJCB 1DI5A 3OE6A 3M3UA 4LYCA 4LYMA 1DKJA 183LA 4GCEA 4BADA 3JR6A 2LCBA 4GCCA 1LLHA 1OOPD 1VFBC 1BGIA 2A7DA 2B75A 5KXMA 1DYDA 4S0WA 210LA 4G4CA 4NWHA 2W1LA 2D4KA 9LYZA 152LA 1LYIA 3EMLA 3GUNA 1V7TA 1HNLA 3AEAA 3DKEX 3DN0A 3SP3A 4WLDA 3TXFA 1LSDA 4WOAA 3WUAA 1LJKA 3DMZA 2CJLA 5I5QA 4LYTA 1POV0 1HMKA 1C6JA 1D0LA 1IR9A 4I8SA 3HH4A 1LPIA 1QS9A 4NSGA 1RE2A 3HUKA 1L17A 4KXIA 1RHI4 1L12A 3CT0A 3W6AA 2ZYCA 3A92A 4UWNA 151LA 176LA 128LA 1LZRA 1B5XA 1F10A 1LSCA 1INUA 2LYOA 1JKCA 1ZVYB 1QIOA 1EL1A 1AZFA 199LA 1L37A 4FJRA 1IP5A 1L57A 4H92A 3K3TA 1L90A 1GB0A 242LA 1L95A 1P2RA 1L26A 3LN2A 1ZV5L 2RB2X 1L21A 4D9ZA 4PDWD 1QUGA 2ZIJA 1CUQA 1SLYA 1G7LC 2DQGY 4WO9A 1P5CA 1DXJA 5LVHA 133LA 4DD1A 3AE8A 119LA 2ZQ3A 3D9AC 1IP1A 3AB6A 3FE0A 3WUNA 3QAKA 2B6XA 2O79A 3WW5A 1N4FA 3AEBA 1CJ7A 1IVMA 2RSCA 1B6IA 1VDSA 1J1PY 5APCA 3WU8A 4J1BA 1LZSA 1I20A 1JTNA 3SFEA 1B5WA 1GFHA 2DQEY 1LSPA 3HH6A 3SB9A 5DL9A 1GB5A 146LA 1L55A 4AXTA 4GCBA 2BQFA 4OWEA 3HT8A 4RDSA 1GE2A 5KKJA 1ALCA 1LMTA 1OUAA 1GFUA 3C81A 4AQNA 1CJ6A 5D5CA 4R6CA 3OK0A 5FEKA 4YEMA 1MELL 3WPKA 1HERA 4LT2A 1C6EA 2C8PA 180LA 3AEEA 4OOOA 2Z2FA 2CWIA 1C6TA 4NHPA 3C8SA 1B7RA 3C83A 1JPOA 5KXNA 3FADA 5DM9A 1K28A 4I7TA 4PK0A 167LA 1O23A 1GXXA 1LAAA 5F9UA 3IJVA 1JSFA 3DN8A 3A34A 1AT5A 1QSBA 1OUHA 109LA 1BWJA 1LMQA 4H9BA 4CFPA 2PY5A 3B0KA 1L02A 163LA 3DN4A 1B7NA 1ZWNA 1YAOA 3LYTA 1LZDA 1YL0X 1ASJ4 1L65A 1QS5A 1ZVHL 1NHBA 5KXWA 4DD3A 3LZ2A 1TDYA 3WMKA 2R7FA 251LA 1HFZA 1P2CC 1BB5A 4B4JA 4GN3A 1REMA 4ARQB 1QTEA 5HMVA 5L3IA 2OU8A 4KT3A 1HENA 1VBD4 1SSWA 1XFPL 7LYZA 1JJ3A 5A3ZA 1G1VA 169LA 4TSCA 1LJIA 4NEBA 4II8A 1OV7A 1XHXA 2D4JA 4B0DA 5I4XA 1LZGA 4WM1A 1HF4A 1LMCA 4DDAA 2I6ZA 1NHEA 130LA 1VDTA 2FYCA 135LA 3ABVA 1IP4A 200LA 3RU5A 4PPOA 5KXRA 1C63A 4TSBA 3AJNA 1QUDA 3TXIA 4LYOA 3L64A 1B5VA 2HUBA 1L59A 3AE7A 2LC9A 2DQHY 1QSWA 4RW2A 5LIOA 3IJUA 4XJGA 1L82A 1LZYA 3WULA 2BQMA 125LA 3SFDA 1XEJA 4KL7A 1XGPC 231LA 1L05A 2RM24 1AR94 4DAJA 1GF4A 3P64A 1L13A 259LA 1PO24 1R084 1QTZA 1GBXA 3NYAA 4YF2A 1L98A 190LA 2Z38A 3WL2A 1UIEA 4N8ZA 1NKHA 1G0KA 1LI6A 1CJ9A 3GQKA 1VBB4 5B07A 3W6EA 2DQAA 1A4VA 244LA 1HFXA 158LA 2ACZA 3LZTA 2GV0A 1B0DA 4G4BA 1OUBA 1GF0A 1LYZA 1UIBA 1CTWA 1L62A 3MGWA 1CU3A 1L50A 1L99A 3VRAA 1BHZA 3KAMA 3N9CA 4ARMA 1P56A 3ULRA 2HWB4 1YAMA 166LA 1OUDA 162LA 3AYQA 4EKSA 1BB3A 3CT5A 1L04A 110LA 4ZPUA 5AMYA 3HBEX 246LA 2PC2A 4O34A 2WU2A 1PQMA 4GN5C 235LA 237LA 108LA 2FBBA 2XBRA 1PS5A 241LA 2B6TA 3PDSA 5LAFA 3TXHA 3VWOA 4H8ZA 2YBHA 1GBZA 1JHLA 1KFYA 3ATOA 8LYZA 4NHTA 3GUJA 150LA 4J1AA 225LA 1XSFA 1TLAA 1L61A 1AR64 1J1OY 2A7FA 1L43A 1L30A 1P46A 1LSEA 4OW1A 2HEFA 2PW9A 1LI3A 1QT6A 5I4YA 4NGYA 4E3UA 1GF5A 1DQJC 1L40A 1NEKA 3HU9A 1JQUA 1D3NA 1LKRA 1IOCA 3VR9A 1WQNA 1L24A 1L56A 1GEVA 1L52A 2LYMA 4WG1A 1HELA 4DQ7A 4WG7A 3AECA 4Q4W4 3TXJA 153LA 228LA 1XEKA 4N1EI 2YBNA 2FBDA 1L41A 1GFRA 161LA 2OU0X 1GE3A 3GUPA 3P66A 2YBLA 134LA 4XJDA 2BQDA 1FLUA 126LA 4I7LA 5K7OA 2PLV4 3T36A 1AT6A 1JKAA 1LJNA 3TMVA 2WP9A 1NQIA 1L34A 2C8OA 1QTKA 4NSJA 4ARPA 1XGUC 1PVC4 5APDA 1QUSA 2YBJA 3A8ZA 2MECA 193LA 1LHLA 1LHMA 2X5ID 5ILCA 5KKIA 2RS14 4XJHA 3AE9A 4IJ4A 1HXS4 1IX0A 2ZIKA 4XJFA 4NWEA 181LA 1LJEA 2X0AA 1L51A 4HJVA 4I7MA 3SB5A 5KXLA 3FI5A 4EMNA 5C6LA 1L10A 154LA 5DN4A 3EO5A 4UWVA 1EQ4A 4W53A 3RNXA 2RBPA 4H93A 1VBC4 3A95A 2BQCA 1OYUA 3GQHA 4YEOA 1B5YA 2DQJY 4GRVA 2NWDX 3AEGA 207LA 2A4TA 5LYTA 1GF8A 1OVKA 4LZTA 2B5ZA 103LA 213LA 1FLWA 1CUPA 3AE6A 2BQIA 3DNAA 174LA 1GF9A 3ZVQA 1HHLA 172LA 219LA 2B74A 216LA 1LSGA 5B59A 3HBHA 1L19A 2RBSA 240LA 5FHWA 2RBRA 2OU9A 1COV4 1DYGA 1QTBA 3DN1A 3HUQA 4QY9A 1QSQA 5LYZA 188LA 1GAYA 1GFKA 1OVHA 4HTQA 3WXTA 1LYEA 3A6CY 1L46A 1GBSA 4CJ2A 4TTDA 1WQMA 1F6SA 2W1MA 1RVF4 3RUNA 1UIHA 1LYSA 1REXA 4WO6A 4DJHA 2RR14 1L25A 1MLCE 256LA 2MEAA 1PQIA 1XJTA 3LYZA 1EPYA 1NDMC 5LA8A 2RS34 3M18B 2D6BA 4M4OA 4LFPA 4DD7A 4DT3A 3HTFA 2HU1A 1LJGA 1K5MD 1GPQC 4RLNA 5ILFA 1R094 165LA 148LE 1CV0A 1QT5A 1YKXX 3A93A 4CHXA 3B72A 1HEMA 189LA 5KJ9A 1OQMA 1DI4A 4RW1A 4CGEA 1IWWA 1L39A 1KF6A 5F81A 118LA 1T3PA 4GB34 1NENA 1UBZA 2LZTA 2OE4X 1GE4A 1LGXA 4ARMB 2VB1A 178LA 1WTNA 3AZ4A 4DD0A 3TXBA 1GBOA 1ZOYA 1PIV4 5A3EA 5KXXA 5I54A 1VATA 1TEWA 1QUTA 1C6PA 137LA 233LA 1T6HA 122LA 3G3VA 4ETAA 4LT3A 1LZTA 1LYYA 5B1GA 3C82A 3V2WA 245LA 5LA5A 4HJYA 2HEBA 4I7KA 4Q4X4 1YQ4A 1C43A 1CV3A 2Q0MX 196LA 2CUUA 1HRV4 3HDEA 1C64A 159LA 2F4GA 1LYDA 4Q4Y4 1XJUA 2RBOA 4IATA 2W1YA 4NGWA 1GB9A 1P36A 4NGIA 4I0CA 2OTYX 1T8GA 4W56A 1T8AA 4PHIA 4NGKA 1LTMA 3RZ4A 2MEFA 3ATNA 1B7MA 1QSAA 185LA 1KIQC 4YSXA 1L73A 5FSTA 3AE5A 1D4M4 143LA 2QARC 2B73A 1TAYA 1CNSA 1IY4A 1L44A 1NBYC 2L78A 144LA 1W08A 1XHZA 2ANVA 2HEAA 4YXCA 1L22A 2H5ZA 1T8FA 1LZ8A 1LSFA 1UIAA 5KXTA 1H8TD 2B76A 3AEDA 1P64A 2BQNA 1ZYTA 5F14A 4N5RA 2BLXA 1CVKA 4LYBA 1Z7S4 1D0MA 1UICA 1HSWA 3LYMA 3RW8A 4NGVA 255LA 3B6LA 3PBLA 1DYAA 1B5ZA 1I1ZA 1LSAA 2ZILA 248LA 1PQJA 4B49A 1IWVA 3P65A 3HTBA 1C60A 1IP7A 1C6DA 2Z39A 171LA 2O4WA 5KY1A 4H9IA 5LZMA 221LA 1GB2A 1C7PA 1BVXA 1D2YA 1L42A 260LA 1AL24 1JKDA 262LA 1IIZA 182LA 2CDSA 2HEDA 4EJ4A 3LHMA 1FBIX 2G4PA 4W59A 1NDGC 1L70A 1BB4A 3GUOA 4YSYA 1L63A 5KXKA 4NFVA 1BVKC 2I25L 4OO9A 1CKHA 1C6BA 1RUJ4 1G0JA 4HTNA 1NA1D 1GF3A 3ODUA 7LZMA 3WW6A 3P68A 3AE3A 1LGUA 2G4QA 2ZNXY 1IWYA 3G3WA 3NY9A 1IY3A 168LA 1IOTA 1YILA 4QDNA 3A91A 1C6IA 1YROA 226LA 5KXZA 1UIFA 4KPMA 4TWSA 1UACY 1B7QA 4DYGA 1I6SA 1LZBA 4ZIXA 1FN5A 5C6JA 1QQYA 1C67A 1F6RA 1XGTC 1L76A 3WVXA 3P4SA 1QTDA 1GB6A 1L75A 195LA 4M6DA 4MR1A 3J4GA 2DQCY 5M1YA 2H89A 2B7XA 3SB7A 3VW7A 5KXOA 1SWZA 1L47A 1QDTA 1Z55A 2F30A 4WMGA 5LAGA 4ZFPA 5E4PA 2F32A 1QDRA 4QGZA 1RI8B 4EKRA 3CIRA 1KW5A 4NGOA 4ETDA 4CFOA 3SB6A 3W6CA 1VBA4 1CV4A 4H94A 3A90A 4U3XB 1C65A 1ZURA 220LA 3OE0A 1PQOA 4P2EA 4R0FA 1GFGA 4B1AA 4LT1A 4DDCA 1BB7A 1JITA 3EXDA 4WLTA 3A67Y 5LYMA 2MEEA 214LA 2D91A 4OWBA 1L01A 3WXUA 1LYHA 1L72A 4ZEEA 4DKLA 1P6YA 1LPYA 5HLLA 1LYJA 1YL1X 1C68A 1L0VA 4WM4A 1CV1A 111LA 2BQEA 1B7LA 1LZAA 4Q4V4 1L16A 1DKKA 1LMNA 4PJZA 1QT8A 104LA 2Q9EA 2HUKA 1G7MC 2B70A 1C6QA 1LSBA 1HEOA 1OV5A 4LZMA 3WPLA 1H6MA 1L94A 2OE7X 1LWKA 1L06A 3UONA 4XJIA 1L36A 4J0LA 3EBAB 112LA 2FBWA 1XEIA 4WL6A 2YVBA 1KW7A 3F8VA 4FDYA 4GN4A 1QT3A 5FCPA 140LA 1LYOA 1CKGA 1B7PA 1L32A 218LA 1LHJA 4IASA 2F2QA 4TX7A 1TBYA 1B7SA 3QY4A 1T97A 1ZP0A 1L49A 113LA 1PQDA 2Z37A 1FLQA 1UA6Y 1LW9A 1KXXA 4LDLA 4I7QA 4H9HA 1L97A 1WTMA 2LHMA 1AR74 1G06A 1C61A 3G3AB 192LA 2YBIA 3TXKA 4HTKA 1PQKA 1YKYX 1WVUA 3SBBC 1HFYA 2EPEA 2B6YA 1L31A 1YQVY 4W51A 1CV5A 2D4IA 1LZ4A 1IOSA 5L3HA 1SX7A 1C66A 4H9CA 2ANXA 3WYHA 3TXDA 1UCOA 4LYZA 3JD74 4GCFA 1HC0A 2LZMA 2PYJA 131LA 1D6QA 186LA 1OUGA 1DPWA 1JJ0A 1E8LA 3CDQA 4ML7A 5F16A 1LOZA 1GFEA 227LA 5IELA 1GEZA 1L83A 1L71A 1LHIA 4MCKA 3GUMA 5EBHA 4RHV4 3AE1A 4EPFA 3CDRA 3F6ZA 3OJPA 1VBE4 2FYDA 4MSTA 4L41A 4NHSA 4TUNA 187LA 3AZ6A 1GDXA 2WU5A 4YTPA 4LT0A 1L96A 3CQLA 4PRUA 3G3XA 1HEQA 1L85A 4C5FA 1P7SA 3GXRA 120LA 5KXYA 1H87A 1D6PA 3GXKA 1OVJA 1JKBA 3CB7A 1C6CA 1RUE4 1EQ5A 1L38A 2BQGA 2XTHA 2O7AA 3BKHA 1L11A 1GD6A 230LA 1L87A 2RAYX 4G9SA 4W52A 4LDEA 2RAZX 236LA 5DN5A 1LWGA 1NMMA 1LZ9A 1G0PA 6LYZA 1DYBA 1JEFA 4E97A 2H9KA 1G1WA 149LA 2HWC4 3J8F4 197LA 3CDVA 4PJ2C 1L20A 1C6KA 3TXEA 1OWYA 5FDJA 1BWHA 1L67A 1L79A 261LA 2Z2EA 4ETEA 114LA 1G7IC 2WARA 1L80A 3E3DA 4A7DA 3HTDA 4NGJA 1G7JC 3FA0A 156LA 4ARQA 1L86A 1QUHA 1AR84 191LA 1L00A 1SSYA 5KXSA 4H1PA 5B06A 1OWZA 1G0MA 145LA 4NGLA 2BQAA 1IC7Y 1SWYA 4NSIA 4WLYA 2RS54 3DN3A 4NHIA 4LDOA 4GCDA 1DI3A 1L93A 2N5ZA 2R064 1L03A 4W55A 4YENA 5IHGA 238LA 1L07A 3HT7A 1KY1A 1QUOA 4W96A 4DWXA 3A6BY 1UIDA 4BS7A 5IDDA 4HP0A 1GB7A 1L08A 3C80A 1LJJA 3HWLA 1B2KA 1GF6A 1RFPA 177LA 1L91A 5I4WA 1REZA 1IP3A 1F0WA 155LA 1OUCA 4GLVA 1XGRC 1AM7A 2WS3A 2EIZC 1D0KA 4I7JA 4WL7A 2Z19A 2BQLA 1C10A 3A3QA 3A3RX 2BPUA 1IC5Y 4HSFA 1CU0A 3WUMA 250LA 4Z41A 4YT0A 4DD9A 3HU8A 3SBAA 4EPIA 1OUIA 1CJ8A 1G7HC 3TXGA 1LMOA 1IORA 1L81A 1LCNA 1L53A 1JTPL 1L09A 2H9JA 138LA 1L84A 3P4ZA 3VR8A 1CX7A 1GB8A 184LA 3DMVA 4XYYA 1KXWA 1NBZC 5LVGA 4H8XA 1IEEA 1GB3A 1JISA 4WLXA 3AW6A 1HRI4 1B7OA 3P4RA 1QT4A 223LA 1L15A 1FKVA 4B4IA 1LGWA 4XN6A 4Z46A 2MEDA 1GAZA 2MEIA 1JWRA 1L74A 3K2RA 3T6UA 4B4EA 4GBRB 2MEBA 1C6AA 2MEGA 1BQLY 1L35A 4I7NA 1I56A 3DMXA 5I14A 4W54A 239LA 1GE0A 1YAPA 5HMJA 2Z6BA 3GULA 3AW7A 2EX3A 243LA 254LA 4I7RA 2RBNA 3OE8A 3CSZA 1JTTL 1C46A 1PZYA 1GHLA 2WQYA 160LA 157LA 4YXAC 4YSZA 102LA 3DN6A 4GLAA 2BAAA 3N9EA 3TMWA 5FELA 2HUMA 4NHQA 2F2NA 2R044 3DN2A 1D2WA 1DYCA 2Q9DA 5I53A 4LFXA 1NF5A 1DPXA 2XJWA 249LA 4I7OA 3AE4A 1LYGA 1T6VL 4H90A 247LA 3HH3A 3J6KA 1KIPC 1NCQD 1EV14 1IWTA 1G0QA 208LA 4EOFA 1VAUA 1LMAA 1A2YC 3C7WA 3HTGA 175LA 1L58A 1L69A 1LZNA 206LA 1D9WA 5B05A 4HV1A 6LZMA 1CX6A 1SQ2L 3W6BA 5C6IA 5HNCA 1L14A 2ZYPA 115LA 1GFVA 4N1CC 4HPEA 2WDVA 4I7SA 4PRQA 2RB1X 1RMU4 3AZ7A 1WQPA 1HSXA 3HFMY 2WDQA 5APFA 4G49A 1LYFA 2EKSC 2ZQ4A 4XENA 3CSRA 1P3NA 3V2YA 1L68A 1D3FA 107LA 1QTCA 1FLYA 4H9FA 2DQDY 4QEQA 1L28A 1IWXA 1P2LA 258LA 147LA 1C6NA 3AGHA 3W6DA 127LA 1KXYA 4IAPA 1CU5A 4H9EA 4H9AA 5B1FA 4DDBA 3B0IA 3ZVQB 1L89A 4WM3A 3C8RA 3C7ZA 4YTNA 1L92A 1GBWA 1UIGA 3P4PA 1LHHA 1W6ZA 1JTOL 4DD2A 3C8QA 1GXV2 2RB0X 1JUGA 3CT1A 5DLAA 1LJHA 4NG1A 4C3WA 194LA 1L64A 139LA 3F9LA 1L0KA 2OEAX 3AEFA 2YBMA 5II3A 1OUEA 1WVVA 1XGQC 2DKVA 2RMU4 5L9JA 4J7VA 4XJBA 1LJFA 1L48A 4WM2A 1YKZX 1VRH4 212LA 4K5YA 1UC0A 1GE1A 1BB6A 2BQBA 5F9XA 4OWHA 1G0LA 2LYZA 3N9AA 2F4AA 4ET8A 2YSSC 4H8YA 1D9UA 3G3BB 1CU2A 1OUFA 1IR8A 1IC4Y 1DYFA 1FKQA 1RUG4 4ANRA 1LSMA 1J1XY 1OUJA 1L66A 1RUH4 3D3DA 3WVYA 3HDFA 2H88A 1YQ3A 2OTZX 1OP9B 229LA 4WM6A 5JENB 1QT7A 1IP2A 201LA 1TCYA 1EQEA 4N0JA 2XBSA 5KXPA 5HQ1A 1C62A 4YM8A 1LJ3A 3EMSA 4LGKA 1B5UA 1IR7A 2OE9X 3AGGG 1LZ6A 1L29A 2HU3A 2PYLA 1HMLA 3RZEA 3HH5A 5LVIA 4X3BA 5C2TA 132LA 211LA 1CV6A 4W58A 1PO14 2WDRA 1RUD4 2W1XA 1CKCA 1CU6A 4BAPA 5LXWA 3FI7A 1JJ1A 2DQIY 1L77A 4PGJB 5J7CA 2BQJA 5LVKA 2R074 2YDGA 3LZMA 1LSZA 2Y8PA 129LA 2EQLA 1C6FA 1DYEA 3IWRA 1L88A 1LSYA 2I26L 1REYA 1L33A 2LZ2A 2BQHA 1IWUA 1GWDA 5T3FA 1VEDA 4YOPA 1KNIA 5HNLA 1C6LA 1HEPA 1D3JA 3WU7A 4DQJA 2HTXA 4OOTA 4UWUA 1L45A 4W57A 232LA 1D3MA 4RLMA 2PZSA 164LA 3AZ5A 2IHLA 1LZ5A 2Z12A 1V7SA 4EKQA 1L27A 4NGZA 1ZMYL 1LSNA 2QB0B 3P4QA 4EXMA 1MQTD 1YIKA 1GFJA 4WM5A 4YX7C
chains in the Genus database with same CATH topology
1WQRA 257LA 1IP6A 3QNGA 1FDLY 217LA 234LA 4NG8A 1GFTA 3B0OA 3BKVA 2B72A 1LI2A 4BAFA 209LA 1IO5A 2HEEA 224LA 1BWIA 2ZWBA 2NTGA 3W6FA 1KS3A 1KIRC 170LA 1JSEA 1SX2A 4OWAA 2RBQA 1G07A 1WQQA 1GFAA 173LA 2HULA 1GBYA 4EKPA 1YAQA 1GF7A 1NWGA 4NY5A 2BLYA 3CDTA 2AUBA 5D5FA 4ETBA 1DZBX 1IOQA 3L2XA 1C6GA 1L0JA 253LA 5LINA 215LA 4N9RA 3HBDA 2CGIA 4HJZA 1CKFA 4NSHA 1HEWA 2G4NA 1QTVA 3CDOA 4G4HA 1XEPA 4W94A 4HV2A 4H91A 3HT6A 1LMPA 4OWCA 2NTHA 1LJ4A 1UUZC 1C08C 1JIYA 2HECA 4Z3MA 3GUIA 2BQOA 2IGCA 4DC4A 1LZEA 2RH1A 2IFFY 252LA 3D4SA 1L60A 3GUKA 1LZCA 1CKDA 3WPJA 1QTHA 1C6MA 2DQFC 1GDWA 3CSQA 1IWZA 1G0GA 1L54A 4DQ5A 5E9RA 2Z18A 1YANA 1XI1A 6LYTA 2BQKA 1L23A 1KY0A 4HPIA 1RCMA 1C6HA 142LA 2B6ZA 3A96A 2F47A 2MEHA 3ZEKA 2XQOA 4ARJA 3AGIA 1WQOA 3RT5X 1JTMA 3NY8A 2ZNWY 1WTHA 2B6WA 3LYOA 1C45A 1VDQA 205LA 4I7PA 4Z98A 1B9OA 1C69A 222LA 1L18A 3C7YA 1LZ1A 3HT9A 4XADA 123LA 3SN6R 5APEA 3TMUA 2DBTA 3W3EA 1AKIA 3QE8A 3SB8A 4AGAA 5LVJA 3WH1A 1LHKA 1VDPA 198LA 141LA 3TMXA 4ETCA 3OE9A 4ET9A 1LKSA 4NIJA 3A94A 3WU9A 4ARLA 1P37A 3HUAA 1RJCB 1DI5A 3OE6A 3M3UA 4LYCA 4LYMA 1DKJA 183LA 4GCEA 4BADA 3JR6A 2LCBA 4GCCA 1LLHA 1VFBC 1BGIA 2A7DA 2B75A 5KXMA 1DYDA 4S0WA 210LA 4G4CA 4NWHA 2W1LA 2D4KA 9LYZA 152LA 1LYIA 3EMLA 3GUNA 1V7TA 1HNLA 3DKEX 3DN0A 3SP3A 4WLDA 3TXFA 1LSDA 4WOAA 3WUAA 1LJKA 3DMZA 2CJLA 5I5QA 4LYTA 1HMKA 1C6JA 1D0LA 1IR9A 4I8SA 3HH4A 1LPIA 1QS9A 4NSGA 1RE2A 3HUKA 1L17A 4KXIA 1L12A 3CT0A 3W6AA 2ZYCA 3A92A 4UWNA 151LA 176LA 128LA 1LZRA 1B5XA 1F10A 1LSCA 1INUA 2LYOA 1JKCA 1ZVYB 1QIOA 1EL1A 1AZFA 199LA 1L37A 4FJRA 1IP5A 1L57A 4H92A 3K3TA 1L90A 1GB0A 242LA 1L95A 1P2RA 1L26A 3LN2A 1ZV5L 2RB2X 1L21A 4D9ZA 1QUGA 2ZIJA 1CUQA 1SLYA 1G7LC 2DQGY 4WO9A 1P5CA 1DXJA 5LVHA 133LA 4DD1A 119LA 2ZQ3A 3D9AC 1IP1A 3AB6A 3FE0A 3WUNA 3QAKA 2B6XA 2O79A 3WW5A 1N4FA 1CJ7A 1IVMA 2RSCA 1B6IA 1VDSA 1J1PY 5APCA 3WU8A 4J1BA 1LZSA 1I20A 1JTNA 1B5WA 1GFHA 2DQEY 1LSPA 3HH6A 3SB9A 5DL9A 1GB5A 146LA 1L55A 4AXTA 4GCBA 2BQFA 4OWEA 3HT8A 4RDSA 1GE2A 5KKJA 1ALCA 1LMTA 1OUAA 1GFUA 3C81A 4AQNA 1CJ6A 5D5CA 4R6CA 3OK0A 5FEKA 4YEMA 1MELL 3WPKA 1HERA 4LT2A 1C6EA 2C8PA 180LA 4OOOA 2Z2FA 2CWIA 1C6TA 4NHPA 3C8SA 1B7RA 3C83A 1JPOA 5KXNA 3FADA 5DM9A 1K28A 4I7TA 4PK0A 167LA 1O23A 1GXXA 1LAAA 5F9UA 3IJVA 1JSFA 3DN8A 3A34A 1AT5A 1QSBA 1OUHA 109LA 1BWJA 1LMQA 4H9BA 4CFPA 2PY5A 3B0KA 1L02A 163LA 3DN4A 1B7NA 1ZWNA 1YAOA 3LYTA 1LZDA 1YL0X 1L65A 1QS5A 1ZVHL 1NHBA 5KXWA 4DD3A 3LZ2A 1TDYA 3WMKA 2R7FA 251LA 1HFZA 1P2CC 1BB5A 4B4JA 4GN3A 1REMA 4ARQB 1QTEA 5HMVA 5L3IA 2OU8A 4KT3A 1HENA 1SSWA 1XFPL 7LYZA 1JJ3A 5A3ZA 1G1VA 169LA 4TSCA 1LJIA 4NEBA 4II8A 1OV7A 1XHXA 2D4JA 4B0DA 5I4XA 1LZGA 4WM1A 1HF4A 1LMCA 4DDAA 2I6ZA 1NHEA 130LA 1VDTA 2FYCA 135LA 1IP4A 200LA 3RU5A 4PPOA 5KXRA 1C63A 4TSBA 3AJNA 1QUDA 3TXIA 4LYOA 3L64A 1B5VA 2HUBA 1L59A 2LC9A 2DQHY 1QSWA 4RW2A 5LIOA 3IJUA 4XJGA 1L82A 1LZYA 3WULA 2BQMA 125LA 1XEJA 4KL7A 1XGPC 231LA 1L05A 4DAJA 1GF4A 3P64A 1L13A 259LA 1QTZA 1GBXA 3NYAA 4YF2A 1L98A 190LA 2Z38A 3WL2A 1UIEA 4N8ZA 1NKHA 1G0KA 1LI6A 1CJ9A 5B07A 3W6EA 2DQAA 1A4VA 244LA 1HFXA 158LA 3LZTA 2GV0A 1B0DA 4G4BA 1OUBA 1GF0A 1LYZA 1UIBA 1CTWA 1L62A 3MGWA 1CU3A 1L50A 1L99A 1BHZA 3KAMA 3N9CA 4ARMA 1P56A 3ULRA 1YAMA 166LA 1OUDA 162LA 3AYQA 4EKSA 1BB3A 3CT5A 1L04A 110LA 4ZPUA 5AMYA 3HBEX 246LA 2PC2A 4O34A 1PQMA 4GN5C 235LA 237LA 108LA 2FBBA 2XBRA 1PS5A 241LA 2B6TA 3PDSA 5LAFA 3TXHA 3VWOA 4H8ZA 2YBHA 1GBZA 1JHLA 3ATOA 8LYZA 4NHTA 3GUJA 150LA 4J1AA 225LA 1XSFA 1TLAA 1L61A 1J1OY 2A7FA 1L43A 1L30A 1P46A 1LSEA 4OW1A 2HEFA 2PW9A 1LI3A 1QT6A 5I4YA 4NGYA 4E3UA 1GF5A 1DQJC 1L40A 3HU9A 1JQUA 1D3NA 1LKRA 1IOCA 1WQNA 1L24A 1L56A 1GEVA 1L52A 2LYMA 4WG1A 1HELA 4DQ7A 4WG7A 3TXJA 153LA 228LA 1XEKA 4N1EI 2YBNA 2FBDA 1L41A 1GFRA 161LA 2OU0X 1GE3A 3GUPA 3P66A 2YBLA 134LA 4XJDA 2BQDA 1FLUA 126LA 4I7LA 5K7OA 3T36A 1AT6A 1JKAA 1LJNA 3TMVA 1NQIA 1L34A 2C8OA 1QTKA 4NSJA 4ARPA 1XGUC 5APDA 1QUSA 2YBJA 3A8ZA 2MECA 193LA 1LHLA 1LHMA 5ILCA 5KKIA 4XJHA 4IJ4A 1IX0A 2ZIKA 4XJFA 4NWEA 181LA 1LJEA 2X0AA 1L51A 4HJVA 4I7MA 3SB5A 5KXLA 3FI5A 4EMNA 5C6LA 1L10A 154LA 5DN4A 3EO5A 4UWVA 1EQ4A 4W53A 3RNXA 2RBPA 4H93A 3A95A 2BQCA 1OYUA 4YEOA 1B5YA 2DQJY 4GRVA 2NWDX 207LA 2A4TA 5LYTA 1GF8A 1OVKA 4LZTA 2B5ZA 103LA 213LA 1FLWA 1CUPA 2BQIA 3DNAA 174LA 1GF9A 3ZVQA 1HHLA 172LA 219LA 2B74A 216LA 1LSGA 5B59A 3HBHA 1L19A 2RBSA 240LA 5FHWA 2RBRA 2OU9A 1DYGA 1QTBA 3DN1A 3HUQA 4QY9A 1QSQA 5LYZA 188LA 1GAYA 1GFKA 1OVHA 4HTQA 3WXTA 1LYEA 3A6CY 1L46A 1GBSA 4CJ2A 4TTDA 1WQMA 1F6SA 2W1MA 3RUNA 1UIHA 1LYSA 1REXA 4WO6A 4DJHA 1L25A 1MLCE 256LA 2MEAA 1PQIA 1XJTA 3LYZA 1EPYA 1NDMC 5LA8A 3M18B 2D6BA 4M4OA 4LFPA 4DD7A 4DT3A 3HTFA 2HU1A 1LJGA 1GPQC 4RLNA 5ILFA 165LA 148LE 1CV0A 1QT5A 1YKXX 3A93A 4CHXA 3B72A 1HEMA 189LA 5KJ9A 1OQMA 1DI4A 4RW1A 4CGEA 1IWWA 1L39A 5F81A 118LA 1T3PA 1UBZA 2LZTA 2OE4X 1GE4A 1LGXA 4ARMB 2VB1A 178LA 1WTNA 3AZ4A 4DD0A 3TXBA 1GBOA 5A3EA 5KXXA 5I54A 1VATA 1TEWA 1QUTA 1C6PA 137LA 233LA 1T6HA 122LA 3G3VA 4ETAA 4LT3A 1LZTA 1LYYA 5B1GA 3C82A 3V2WA 245LA 5LA5A 4HJYA 2HEBA 4I7KA 1C43A 1CV3A 2Q0MX 196LA 2CUUA 3HDEA 1C64A 159LA 2F4GA 1LYDA 1XJUA 2RBOA 4IATA 2W1YA 4NGWA 1GB9A 1P36A 4NGIA 4I0CA 2OTYX 1T8GA 4W56A 1T8AA 4PHIA 4NGKA 1LTMA 3RZ4A 2MEFA 3ATNA 1B7MA 1QSAA 185LA 1KIQC 1L73A 5FSTA 143LA 2QARC 2B73A 1TAYA 1CNSA 1IY4A 1L44A 1NBYC 2L78A 144LA 1W08A 1XHZA 2ANVA 2HEAA 4YXCA 1L22A 2H5ZA 1T8FA 1LZ8A 1LSFA 1UIAA 5KXTA 1P64A 2BQNA 1ZYTA 5F14A 4N5RA 2BLXA 1CVKA 4LYBA 1D0MA 1UICA 1HSWA 3LYMA 3RW8A 4NGVA 255LA 3B6LA 3PBLA 1DYAA 1B5ZA 1I1ZA 1LSAA 2ZILA 248LA 1PQJA 4B49A 1IWVA 3P65A 3HTBA 1C60A 1IP7A 1C6DA 2Z39A 171LA 2O4WA 5KY1A 4H9IA 5LZMA 221LA 1GB2A 1C7PA 1BVXA 1D2YA 1L42A 260LA 1JKDA 262LA 1IIZA 182LA 2CDSA 2HEDA 4EJ4A 3LHMA 1FBIX 2G4PA 4W59A 1NDGC 1L70A 1BB4A 3GUOA 1L63A 5KXKA 4NFVA 1BVKC 2I25L 4OO9A 1CKHA 1C6BA 1G0JA 4HTNA 1GF3A 3ODUA 7LZMA 3WW6A 3P68A 1LGUA 2G4QA 2ZNXY 1IWYA 3G3WA 3NY9A 1IY3A 168LA 1IOTA 1YILA 4QDNA 3A91A 1C6IA 1YROA 226LA 5KXZA 1UIFA 4KPMA 4TWSA 1UACY 1B7QA 4DYGA 1I6SA 1LZBA 4ZIXA 1FN5A 5C6JA 1QQYA 1C67A 1F6RA 1XGTC 1L76A 3WVXA 1QTDA 1GB6A 1L75A 195LA 4M6DA 4MR1A 3J4GA 2DQCY 5M1YA 2B7XA 3SB7A 3VW7A 5KXOA 1SWZA 1L47A 1QDTA 1Z55A 2F30A 4WMGA 5LAGA 4ZFPA 5E4PA 2F32A 1QDRA 4QGZA 1RI8B 4EKRA 1KW5A 4NGOA 4ETDA 4CFOA 3SB6A 3W6CA 1CV4A 4H94A 3A90A 4U3XB 1C65A 1ZURA 220LA 3OE0A 1PQOA 4P2EA 4R0FA 1GFGA 4B1AA 4LT1A 4DDCA 1BB7A 1JITA 3EXDA 4WLTA 3A67Y 5LYMA 2MEEA 214LA 2D91A 4OWBA 1L01A 3WXUA 1LYHA 1L72A 4ZEEA 4DKLA 1P6YA 1LPYA 5HLLA 1LYJA 1YL1X 1C68A 4WM4A 1CV1A 111LA 2BQEA 1B7LA 1LZAA 1L16A 1DKKA 1LMNA 4PJZA 1QT8A 104LA 2Q9EA 2HUKA 1G7MC 2B70A 1C6QA 1LSBA 1HEOA 1OV5A 4LZMA 3WPLA 1H6MA 1L94A 2OE7X 1LWKA 1L06A 3UONA 4XJIA 1L36A 4J0LA 3EBAB 112LA 1XEIA 4WL6A 2YVBA 1KW7A 3F8VA 4FDYA 4GN4A 1QT3A 5FCPA 140LA 1LYOA 1CKGA 1B7PA 1L32A 218LA 1LHJA 4IASA 2F2QA 4TX7A 1TBYA 1B7SA 3QY4A 1T97A 1L49A 113LA 1PQDA 2Z37A 1FLQA 1UA6Y 1LW9A 1KXXA 4LDLA 4I7QA 4H9HA 1L97A 1WTMA 2LHMA 1G06A 1C61A 3G3AB 192LA 2YBIA 3TXKA 4HTKA 1PQKA 1YKYX 1WVUA 3SBBC 1HFYA 2EPEA 2B6YA 1L31A 1YQVY 4W51A 1CV5A 2D4IA 1LZ4A 1IOSA 5L3HA 1SX7A 1C66A 4H9CA 2ANXA 3WYHA 3TXDA 1UCOA 4LYZA 4GCFA 1HC0A 2LZMA 2PYJA 131LA 1D6QA 186LA 1OUGA 1DPWA 1JJ0A 1E8LA 3CDQA 4ML7A 5F16A 1LOZA 1GFEA 227LA 5IELA 1GEZA 1L83A 1L71A 1LHIA 4MCKA 3GUMA 5EBHA 4EPFA 3CDRA 3F6ZA 3OJPA 2FYDA 4MSTA 4L41A 4NHSA 4TUNA 187LA 3AZ6A 1GDXA 4LT0A 1L96A 3CQLA 4PRUA 3G3XA 1HEQA 1L85A 4C5FA 1P7SA 3GXRA 120LA 5KXYA 1H87A 1D6PA 3GXKA 1OVJA 1JKBA 3CB7A 1C6CA 1EQ5A 1L38A 2BQGA 2XTHA 2O7AA 3BKHA 1L11A 1GD6A 230LA 1L87A 2RAYX 4G9SA 4W52A 4LDEA 2RAZX 236LA 5DN5A 1LWGA 1NMMA 1LZ9A 1G0PA 6LYZA 1DYBA 1JEFA 4E97A 2H9KA 1G1WA 149LA 197LA 3CDVA 4PJ2C 1L20A 1C6KA 3TXEA 1OWYA 5FDJA 1BWHA 1L67A 1L79A 261LA 2Z2EA 4ETEA 114LA 1G7IC 2WARA 1L80A 3E3DA 4A7DA 3HTDA 4NGJA 1G7JC 3FA0A 156LA 4ARQA 1L86A 1QUHA 191LA 1L00A 1SSYA 5KXSA 4H1PA 5B06A 1OWZA 1G0MA 145LA 4NGLA 2BQAA 1IC7Y 1SWYA 4NSIA 4WLYA 3DN3A 4NHIA 4LDOA 4GCDA 1DI3A 1L93A 2N5ZA 1L03A 4W55A 4YENA 5IHGA 238LA 1L07A 3HT7A 1KY1A 1QUOA 4W96A 4DWXA 3A6BY 1UIDA 4BS7A 5IDDA 4HP0A 1GB7A 1L08A 3C80A 1LJJA 3HWLA 1B2KA 1GF6A 1RFPA 177LA 1L91A 5I4WA 1REZA 1IP3A 1F0WA 155LA 1OUCA 4GLVA 1XGRC 1AM7A 2EIZC 1D0KA 4I7JA 4WL7A 2Z19A 2BQLA 1C10A 3A3QA 3A3RX 2BPUA 1IC5Y 4HSFA 1CU0A 3WUMA 250LA 4Z41A 4DD9A 3HU8A 3SBAA 4EPIA 1OUIA 1CJ8A 1G7HC 3TXGA 1LMOA 1IORA 1L81A 1LCNA 1L53A 1JTPL 1L09A 2H9JA 138LA 1L84A 3P4ZA 1CX7A 1GB8A 184LA 3DMVA 4XYYA 1KXWA 1NBZC 5LVGA 4H8XA 1IEEA 1GB3A 1JISA 4WLXA 3AW6A 1B7OA 1QT4A 223LA 1L15A 1FKVA 4B4IA 1LGWA 4XN6A 4Z46A 2MEDA 1GAZA 2MEIA 1JWRA 1L74A 3K2RA 3T6UA 4B4EA 4GBRB 2MEBA 1C6AA 2MEGA 1BQLY 1L35A 4I7NA 1I56A 3DMXA 5I14A 4W54A 239LA 1GE0A 1YAPA 5HMJA 2Z6BA 3GULA 3AW7A 2EX3A 243LA 254LA 4I7RA 2RBNA 3OE8A 3CSZA 1JTTL 1C46A 1PZYA 1GHLA 160LA 157LA 4YXAC 102LA 3DN6A 4GLAA 2BAAA 3N9EA 3TMWA 5FELA 2HUMA 4NHQA 2F2NA 3DN2A 1D2WA 1DYCA 2Q9DA 5I53A 4LFXA 1NF5A 1DPXA 2XJWA 249LA 4I7OA 1LYGA 1T6VL 4H90A 247LA 3HH3A 3J6KA 1KIPC 1IWTA 1G0QA 208LA 4EOFA 1VAUA 1LMAA 1A2YC 3C7WA 3HTGA 175LA 1L58A 1L69A 1LZNA 206LA 1D9WA 5B05A 4HV1A 6LZMA 1CX6A 1SQ2L 3W6BA 5C6IA 5HNCA 1L14A 2ZYPA 115LA 1GFVA 4N1CC 4HPEA 4I7SA 4PRQA 2RB1X 3AZ7A 1WQPA 1HSXA 3HFMY 5APFA 4G49A 1LYFA 2EKSC 2ZQ4A 4XENA 3CSRA 1P3NA 3V2YA 1L68A 1D3FA 107LA 1QTCA 1FLYA 4H9FA 2DQDY 4QEQA 1L28A 1IWXA 1P2LA 258LA 147LA 1C6NA 3AGHA 3W6DA 127LA 1KXYA 4IAPA 1CU5A 4H9EA 4H9AA 5B1FA 4DDBA 3B0IA 3ZVQB 1L89A 4WM3A 3C8RA 3C7ZA 1L92A 1GBWA 1UIGA 1LHHA 1W6ZA 1JTOL 4DD2A 3C8QA 1GXV2 2RB0X 1JUGA 3CT1A 5DLAA 1LJHA 4NG1A 4C3WA 194LA 1L64A 139LA 3F9LA 1L0KA 2OEAX 2YBMA 5II3A 1OUEA 1WVVA 1XGQC 2DKVA 5L9JA 4J7VA 4XJBA 1LJFA 1L48A 4WM2A 1YKZX 212LA 4K5YA 1UC0A 1GE1A 1BB6A 2BQBA 5F9XA 4OWHA 1G0LA 2LYZA 3N9AA 2F4AA 4ET8A 2YSSC 4H8YA 1D9UA 3G3BB 1CU2A 1OUFA 1IR8A 1IC4Y 1DYFA 1FKQA 4ANRA 1LSMA 1J1XY 1OUJA 1L66A 3D3DA 3WVYA 3HDFA 2OTZX 1OP9B 229LA 4WM6A 5JENB 1QT7A 1IP2A 201LA 1TCYA 1EQEA 4N0JA 2XBSA 5KXPA 5HQ1A 1C62A 4YM8A 1LJ3A 3EMSA 4LGKA 1B5UA 1IR7A 2OE9X 3AGGG 1LZ6A 1L29A 2HU3A 2PYLA 1HMLA 3RZEA 3HH5A 5LVIA 4X3BA 132LA 211LA 1CV6A 4W58A 2W1XA 1CKCA 1CU6A 4BAPA 5LXWA 3FI7A 1JJ1A 2DQIY 1L77A 4PGJB 5J7CA 2BQJA 5LVKA 2YDGA 3LZMA 1LSZA 2Y8PA 129LA 2EQLA 1C6FA 1DYEA 3IWRA 1L88A 1LSYA 2I26L 1REYA 1L33A 2LZ2A 2BQHA 1IWUA 1GWDA 5T3FA 1VEDA 4YOPA 1KNIA 5HNLA 1C6LA 1HEPA 1D3JA 3WU7A 4DQJA 2HTXA 4OOTA 4UWUA 1L45A 4W57A 232LA 1D3MA 4RLMA 2PZSA 164LA 3AZ5A 2IHLA 1LZ5A 2Z12A 1V7SA 4EKQA 1L27A 4NGZA 1ZMYL 1LSNA 2QB0B 4EXMA 1YIKA 1GFJA 4WM5A 4YX7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G7J C;  1WQR A;  1KIQ C;  1IP6 A;  4TSC A;  1LJI A;  4NEB A;  4II8 A;  3QNG A;  1FDL Y;  4NG8 A;  5FST A;  1XHX A;  2D4J A;  1GFT A;  4B0D A;  1LZG A;  3B0O A;  4H1P A;  3BKV A;  4WM1 A;  5KXS A;  1HF4 A;  1LMC A;  5I4X A;  4DDA A;  1TAY A;  5B06 A;  1CNS A;  4BAF A;  2I6Z A;  1IY4 A;  1IO5 A;  1NHE A;  1VDT A;  1NBY C;  2HEE A;  4NGL A;  2FYC A;  135L A;  2BQA A;  1IC7 Y;  4NSI A;  1W08 A;  1IP4 A;  4WLY A;  1XHZ A;  2HEA A;  4NHI A;  3RU5 A;  4PPO A;  1BWI A;  2H5Z A;  4TSB A;  3AJN A;  2ZWB A;  5KXR A;  3TXI A;  4LYO A;  1B5V A;  2HUB A;  4GCD A;  1DI3 A;  3W6F A;  1LZ8 A;  1LSF A;  2N5Z A;  4YEN A;  1KIR C;  2DQH Y;  1QSW A;  1UIA A;  5IHG A;  5KXT A;  4RW2 A;  1JSE A;  5LIO A;  3IJU A;  4XJG A;  2BQN A;  1LZY A;  4OWA A;  4W96 A;  3A6B Y;  3WUL A;  4DWX A;  1UID A;  2BQM A;  4BS7 A;  1XEJ A;  4HP0 A;  5IDD A;  5F14 A;  1GB7 A;  1WQQ A;  4KL7 A;  1XGP C;  4N5R A;  2BLX A;  1GFA A;  1LJJ A;  1B2K A;  1GF4 A;  3P64 A;  1GF6 A;  1RFP A;  4LYB A;  1GBY A;  5I4W A;  1YAQ A;  1GBX A;  1D0M A;  1REZ A;  1UIC A;  1HSW A;  3LYM A;  3RW8 A;  1IP3 A;  1F0W A;  1GF7 A;  4NGV A;  1NWG A;  3B6L A;  4NY5 A;  1OUC A;  4GLV A;  1XGR C;  4YF2 A;  1AM7 A;  2Z38 A;  3WL2 A;  1UIE A;  1B5Z A;  4N8Z A;  2EIZ C;  1NKH A;  1D0K A;  2BLY A;  4WL7 A;  1I1Z A;  2Z19 A;  1LSA A;  2AUB A;  2ZIL A;  5D5F A;  1CJ9 A;  2BQL A;  5B07 A;  3W6E A;  4B49 A;  1C10 A;  2DQA A;  3A3Q A;  1A4V A;  1IWV A;  4ETB A;  1HFX A;  3P65 A;  3A3R X;  2BPU A;  1DZB X;  1IC5 Y;  1IOQ A;  1IP7 A;  2Z39 A;  3LZT A;  4HSF A;  3WUM A;  4H9I A;  5KY1 A;  2GV0 A;  1B0D A;  4G4B A;  4N9R A;  1OUB A;  3HBD A;  4Z41 A;  5LIN A;  4DD9 A;  1GF0 A;  1LYZ A;  1UIB A;  1GB2 A;  2CGI A;  4HJZ A;  1CKF A;  1OUI A;  1C7P A;  1BVX A;  4NSH A;  1HEW A;  1CJ8 A;  1G7H C;  2G4N A;  3MGW A;  3TXG A;  1LMO A;  1IOR A;  4G4H A;  1LCN A;  1JKD A;  1JTP L;  2H9J A;  1IIZ A;  3P4Z A;  4W94 A;  1BHZ A;  2CDS A;  3KAM A;  4HV2 A;  4H91 A;  1GB8 A;  1LMP A;  2HED A;  3N9C A;  4OWC A;  1LJ4 A;  4XYY A;  1UUZ C;  3LHM A;  1NBZ C;  1KXW A;  1FBI X;  5LVG A;  1C08 C;  1JIY A;  2HEC A;  4Z3M A;  4H8X A;  1IEE A;  2G4P A;  1NDG C;  1GB3 A;  2BQO A;  3ULR A;  1YAM A;  4DC4 A;  1LZE A;  1JIS A;  4WLX A;  1BB4 A;  3AW6 A;  1OUD A;  1B7O A;  2IFF Y;  3AYQ A;  1BB3 A;  1FKV A;  4B4I A;  3CT5 A;  5KXK A;  1LZC A;  4NFV A;  1CKD A;  3WPJ A;  5AMY A;  1BVK C;  3HBE X;  4XN6 A;  2DQF C;  1GDW A;  2PC2 A;  4Z46 A;  4O34 A;  3CSQ A;  1IWZ A;  4GN5 C;  2I25 L;  2MED A;  1CKH A;  1GAZ A;  4HTN A;  2FBB A;  2MEI A;  1JWR A;  2XBR A;  1PS5 A;  1GF3 A;  3TXH A;  5LAF A;  3VWO A;  4H8Z A;  2YBH A;  5E9R A;  3T6U A;  1GBZ A;  2Z18 A;  3WW6 A;  2MEB A;  4B4E A;  1JHL A;  1YAN A;  3ATO A;  1XI1 A;  6LYT A;  8LYZ A;  4NHT A;  2BQK A;  2MEG A;  4J1A A;  1BQL Y;  3P68 A;  2G4Q A;  1I56 A;  2ZNX Y;  4HPI A;  1RCM A;  1GE0 A;  1IWY A;  1YAP A;  3A96 A;  2MEH A;  1IY3 A;  3ZEK A;  1IOT A;  5HMJ A;  1XSF A;  1YIL A;  3AGI A;  4QDN A;  3A91 A;  1WQO A;  3RT5 X;  3AW7 A;  2EX3 A;  1YRO A;  2ZNW Y;  3LYO A;  1C45 A;  1J1O Y;  1UIF A;  5KXZ A;  1VDQ A;  2A7F A;  4KPM A;  4TWS A;  1UAC Y;  4Z98 A;  3CSZ A;  1JTT L;  1B7Q A;  1LSE A;  1C46 A;  4OW1 A;  4DD0 A;  4DYG A;  1B9O A;  1PZY A;  2HEF A;  1LZB A;  1GHL A;  4ZIX A;  1FN5 A;  5C6J A;  5I4Y A;  1QQY A;  2PW9 A;  4NGY A;  1F6R A;  1LZ1 A;  1XGT C;  3WVX A;  4E3U A;  1GF5 A;  1DQJ C;  4XAD A;  1GB6 A;  1LKR A;  5APE A;  1IOC A;  4M6D A;  1WQN A;  4MR1 A;  3TMU A;  2DBT A;  4GLA A;  3J4G A;  2BAA A;  3N9E A;  3W3E A;  1AKI A;  3QE8 A;  5FEL A;  3TMW A;  4NHQ A;  1GEV A;  2DQC Y;  2F2N A;  4AGA A;  5LVJ A;  3WH1 A;  5M1Y A;  1LHK A;  1VDP A;  2LYM A;  4WG1 A;  1HEL A;  4WG7 A;  5KXO A;  3TMX A;  4ETC A;  4ET9 A;  1QDT A;  1LKS A;  5I53 A;  4LFX A;  4NIJ A;  1NF5 A;  1Z55 A;  3A94 A;  3TXJ A;  1DPX A;  153L A;  2XJW A;  2F30 A;  4WMG A;  3WU9 A;  5LAG A;  1XEK A;  4N1E I;  5E4P A;  2YBN A;  4ZFP A;  1QDR A;  2FBD A;  4QGZ A;  1RI8 B;  1RJC B;  1DI5 A;  1GFR A;  1T6V L;  4H90 A;  3J6K A;  4NGO A;  1KIP C;  3M3U A;  4LYC A;  4ETD A;  4LYM A;  1DKJ A;  1GE3 A;  4CFO A;  4GCE A;  4BAD A;  5ILC A;  3P66 A;  3W6C A;  1IWT A;  208L A;  4EOF A;  2YBL A;  4GCC A;  1VFB C;  1VAU A;  1BGI A;  4H94 A;  1LMA A;  1A2Y C;  2A7D A;  3A90 A;  4U3X B;  134L A;  1LZN A;  4XJD A;  5KXM A;  2BQD A;  4P2E A;  1FLU A;  4R0F A;  5B05 A;  1GFG A;  4G4C A;  5K7O A;  4HV1 A;  3T36 A;  1AT6 A;  1JKA A;  1LJN A;  4NWH A;  3TMV A;  2W1L A;  2D4K A;  4B1A A;  9LYZ A;  1SQ2 L;  4LT1 A;  3W6B A;  1NQI A;  4DDC A;  1BB7 A;  1JIT A;  3EXD A;  4WLT A;  5C6I A;  3A67 Y;  5HNC A;  1V7T A;  2ZYP A;  2C8O A;  1QTK A;  4NSJ A;  1HNL A;  2MEE A;  5LYM A;  2D91 A;  4OWB A;  1XGU C;  1GFV A;  4N1C C;  3WXU A;  4HPE A;  5APD A;  1QUS A;  2YBJ A;  3A8Z A;  2MEC A;  4PRQ A;  3SP3 A;  193L A;  3AZ7 A;  1WQP A;  1LHL A;  1LHM A;  1HSX A;  4WLD A;  3TXF A;  4ZEE A;  1LSD A;  4WOA A;  3HFM Y;  4XJH A;  3WUA A;  5KKI A;  4IJ4 A;  5APF A;  1IX0 A;  2ZIK A;  4G49 A;  5HLL A;  1YL1 X;  1LJK A;  5I5Q A;  2CJL A;  4XJF A;  4LYT A;  2ZQ4 A;  1HMK A;  2EKS C;  4NWE A;  4XEN A;  1D0L A;  1IR9 A;  4I8S A;  3CSR A;  4WM4 A;  1LJE A;  2X0A A;  2BQE A;  1B7L A;  1LZA A;  4HJV A;  1DKK A;  1LMN A;  1LPI A;  4NSG A;  1RE2 A;  1G7M C;  5KXL A;  1LSB A;  4KXI A;  1FLY A;  4H9F A;  4EMN A;  2DQD Y;  1HEO A;  3CT0 A;  4QEQ A;  3W6A A;  1IWX A;  3WPL A;  5C6L A;  1H6M A;  2ZYC A;  3A92 A;  4UWN A;  5DN4 A;  154L A;  3EO5 A;  4UWV A;  3AGH A;  1EQ4 A;  3W6D A;  1KXY A;  4XJI A;  4J0L A;  1LZR A;  3RNX A;  3EBA B;  1B5X A;  4H93 A;  1XEI A;  3A95 A;  4H9E A;  1F10 A;  4H9A A;  1LSC A;  4WL6 A;  2BQC A;  2YVB A;  5B1F A;  4DDB A;  4FDY A;  1INU A;  2LYO A;  3B0I A;  4GN4 A;  1JKC A;  4YEO A;  5FCP A;  1ZVY B;  1LYO A;  3ZVQ B;  1QIO A;  4WM3 A;  1CKG A;  1B7P A;  1EL1 A;  1AZF A;  1B5Y A;  2DQJ Y;  4FJR A;  2NWD X;  207L A;  1GBW A;  1IP5 A;  1LHJ A;  1UIG A;  5LYT A;  1GF8 A;  4H92 A;  4IAS A;  1LHH A;  1W6Z A;  4LZT A;  1JTO L;  3K3T A;  2B5Z A;  1TBY A;  4TX7 A;  1B7S A;  4DD2 A;  3QY4 A;  1FLW A;  1GB0 A;  2BQI A;  1GXV 2;  2Z37 A;  1FLQ A;  1GF9 A;  3ZVQ A;  1UA6 Y;  1HHL A;  1JUG A;  3CT1 A;  3LN2 A;  1KXX A;  1LJH A;  1ZV5 L;  194L A;  4NG1 A;  5DLA A;  4C3W A;  1LSG A;  4H9H A;  5B59 A;  4D9Z A;  3HBH A;  2YBM A;  5II3 A;  2ZIJ A;  5FHW A;  1OUE A;  1WVV A;  1XGQ C;  1SLY A;  1G7L C;  2DKV A;  2DQG Y;  4WO9 A;  5L9J A;  1DXJ A;  4J7V A;  5LVH A;  4XJB A;  1LJF A;  133L A;  1WTM A;  4DD1 A;  2LHM A;  4WM2 A;  4QY9 A;  1YKZ X;  2ZQ3 A;  3G3A B;  5LYZ A;  3D9A C;  2YBI A;  1GAY A;  1UC0 A;  4HTK A;  3TXK A;  1GFK A;  1YKY X;  1IP1 A;  1GE1 A;  3AB6 A;  4HTQ A;  3WXT A;  1WVU A;  3FE0 A;  1BB6 A;  2BQB A;  3A6C Y;  3WUN A;  5F9X A;  4OWH A;  1GBS A;  1HFY A;  2LYZ A;  4CJ2 A;  3N9A A;  4TTD A;  2F4A A;  4ET8 A;  1WQM A;  2EPE A;  1F6S A;  2W1M A;  2YSS C;  4H8Y A;  1D9U A;  3G3B B;  1YQV Y;  1OUF A;  3WW5 A;  1N4F A;  1CJ7 A;  1IR8 A;  1IVM A;  2RSC A;  1UIH A;  2D4I A;  1IC4 Y;  1LZ4 A;  1IOS A;  1LYS A;  1REX A;  1J1P Y;  1VDS A;  4WO6 A;  5APC A;  5L3H A;  1FKQ A;  3WU8 A;  4ANR A;  1LSM A;  4J1B A;  1J1X Y;  1LZS A;  1I20 A;  1OUJ A;  4H9C A;  3WYH A;  1B5W A;  3TXD A;  1MLC E;  1UCO A;  1GFH A;  3D3D A;  2DQE Y;  3WVY A;  2MEA A;  4LYZ A;  1LSP A;  5DL9 A;  4GCF A;  1OP9 B;  1HC0 A;  3LYZ A;  1NDM C;  1GB5 A;  4WM6 A;  5LA8 A;  5JEN B;  2PYJ A;  1IP2 A;  4AXT A;  1D6Q A;  3M18 B;  1OUG A;  2D6B A;  4M4O A;  1DPW A;  1TCY A;  4LFP A;  1EQE A;  1JJ0 A;  4N0J A;  1E8L A;  2XBS A;  5KXP A;  4ML7 A;  4DD7 A;  5F16 A;  1LOZ A;  1GFE A;  2BQF A;  4GCB A;  5HQ1 A;  4OWE A;  4YM8 A;  1LJ3 A;  3EMS A;  4RDS A;  4DT3 A;  5IEL A;  1GE2 A;  2HU1 A;  1LJG A;  4LGK A;  1GPQ C;  1GEZ A;  4RLN A;  5ILF A;  5KKJ A;  1ALC A;  1LHI A;  4MCK A;  1B5U A;  1LMT A;  5EBH A;  1IR7 A;  1OUA A;  1GFU A;  3F6Z A;  3AGG G;  1YKX X;  1LZ6 A;  3A93 A;  4CHX A;  2HU3 A;  1CJ6 A;  5D5C A;  3OJP A;  4R6C A;  3OK0 A;  3B72 A;  5FEK A;  2FYD A;  4MST A;  4YEM A;  2PYL A;  4L41 A;  4NHS A;  1HEM A;  4TUN A;  1MEL L;  1HML A;  5KJ9 A;  3AZ6 A;  1GDX A;  3WPK A;  1OQM A;  1DI4 A;  1HER A;  5LVI A;  4X3B A;  132L A;  4RW1 A;  4CGE A;  1IWW A;  4LT0 A;  4LT2 A;  4PRU A;  3CQL A;  2C8P A;  1HEQ A;  4C5F A;  4OOO A;  3GXR A;  5F81 A;  2Z2F A;  5KXY A;  1T3P A;  2W1X A;  2CWI A;  1CKC A;  1H87 A;  1D6P A;  1UBZ A;  2LZT A;  3GXK A;  4BAP A;  5LXW A;  1GE4 A;  3FI7 A;  4NHP A;  2VB1 A;  1JJ1 A;  1B7R A;  2DQI Y;  4PGJ B;  5J7C A;  2BQJ A;  1WTN A;  1JPO A;  3AZ4 A;  5KXN A;  5LVK A;  3TXB A;  1JKB A;  5DM9 A;  2YDG A;  3CB7 A;  1LSZ A;  1GBO A;  2Y8P A;  5A3E A;  5KXX A;  5I54 A;  1EQ5 A;  2BQG A;  2EQL A;  1O23 A;  1TEW A;  1GXX A;  1VAT A;  1QUT A;  2XTH A;  3BKH A;  1LAA A;  5F9U A;  1GD6 A;  3IJV A;  1JSF A;  3IWR A;  1LSY A;  2I26 L;  3A34 A;  1REY A;  1AT5 A;  4ETA A;  2LZ2 A;  4LT3 A;  2BQH A;  1IWU A;  1GWD A;  4G9S A;  5T3F A;  1OUH A;  1VED A;  1BWJ A;  1LMQ A;  1LZT A;  1LYY A;  4H9B A;  4CFP A;  4YOP A;  2PY5 A;  5DN5 A;  3B0K A;  5B1G A;  5HNL A;  1B7N A;  1NMM A;  1YAO A;  1LZ9 A;  3LYT A;  1HEP A;  1LZD A;  1YL0 X;  6LYZ A;  1JEF A;  5LA5 A;  4HJY A;  2H9K A;  2HEB A;  3WU7 A;  2HTX A;  4OOT A;  4UWU A;  1C43 A;  1ZVH L;  5KXW A;  2Q0M X;  4PJ2 C;  4DD3 A;  4RLM A;  3LZ2 A;  2PZS A;  1TDY A;  3WMK A;  3AZ5 A;  3TXE A;  2R7F A;  1LZ5 A;  2IHL A;  2F4G A;  1HFZ A;  1P2C C;  2Z12 A;  5FDJ A;  1V7S A;  1BB5 A;  4IAT A;  2W1Y A;  4GN3 A;  1REM A;  4NGW A;  1BWH A;  4B4J A;  1GB9 A;  1QTE A;  1ZMY L;  4NGZ A;  1LSN A;  5HMV A;  5L3I A;  4NGI A;  2Z2E A;  4KT3 A;  1HEN A;  4I0C A;  4ETE A;  1G7I C;  1XFP L;  2WAR A;  4PHI A;  4NGK A;  1YIK A;  7LYZ A;  1GFJ A;  3E3D A;  1LTM A;  4A7D A;  3RZ4 A;  1JJ3 A;  5A3Z A;  2MEF A;  3ATN A;  4WM5 A;  1B7M A;  4NGJ A;  1QSA A; 
#chains in the Genus database with same CATH topology
 1WQR A;  257L A;  1IP6 A;  1RUF 4;  4YTM A;  3QNG A;  1FDL Y;  217L A;  234L A;  4NG8 A;  1GFT A;  3B0O A;  3BKV A;  2B72 A;  1LI2 A;  4BAF A;  209L A;  1IO5 A;  2HEE A;  224L A;  1BWI A;  2ZWB A;  2NTG A;  3W6F A;  1KS3 A;  1KIR C;  170L A;  1JSE A;  1SX2 A;  4OWA A;  2RBQ A;  1G07 A;  1WQQ A;  1GFA A;  173L A;  2HUL A;  1GBY A;  4EKP A;  1YAQ A;  3VRB A;  1GF7 A;  1NWG A;  4NY5 A;  2BLY A;  3CDT A;  2AUB A;  5D5F A;  4ETB A;  1DZB X;  1IOQ A;  3L2X A;  1C6G A;  1L0J A;  253L A;  5LIN A;  215L A;  4N9R A;  3HBD A;  2CGI A;  4HJZ A;  1CKF A;  4NSH A;  1HEW A;  2G4N A;  1QTV A;  1RUC 4;  3CDO A;  4G4H A;  1XEP A;  4YXD A;  4W94 A;  4HV2 A;  4H91 A;  3HT6 A;  1LMP A;  4OWC A;  2NTH A;  1LJ4 A;  1UUZ C;  1C08 C;  1JIY A;  1BEV 4;  2HEC A;  4Z3M A;  3GUI A;  2BQO A;  2IGC A;  4DC4 A;  1LZE A;  2RH1 A;  2IFF Y;  252L A;  3D4S A;  1L60 A;  3GUK A;  1LZC A;  1CKD A;  3WPJ A;  1QTH A;  1C6M A;  2DQF C;  1GDW A;  5C3J A;  3CSQ A;  1IWZ A;  1G0G A;  1L54 A;  4DQ5 A;  5E9R A;  2Z18 A;  1YAN A;  1XI1 A;  6LYT A;  2BQK A;  1L23 A;  1KY0 A;  4HPI A;  1RCM A;  1C6H A;  142L A;  2B6Z A;  3A96 A;  2F47 A;  2MEH A;  3ZEK A;  2XQO A;  4ARJ A;  3AGI A;  1WQO A;  3RT5 X;  1JTM A;  3NY8 A;  2ZNW Y;  1WTH A;  2B6W A;  3LYO A;  1C45 A;  1VDQ A;  205L A;  4I7P A;  3AE2 A;  4Z98 A;  3JBG 4;  1B9O A;  1C69 A;  222L A;  1EAH 4;  1L18 A;  3C7Y A;  1LZ1 A;  3HT9 A;  4XAD A;  123L A;  3SN6 R;  1RUI 4;  5APE A;  3TMU A;  2DBT A;  3W3E A;  1AKI A;  3QE8 A;  3SB8 A;  4AGA A;  5LVJ A;  3WH1 A;  1LHK A;  1VDP A;  3SUC A;  198L A;  141L A;  4KX6 A;  3TMX A;  4ETC A;  3OE9 A;  4ET9 A;  1LKS A;  4NIJ A;  3A94 A;  3WU9 A;  4ARL A;  1P37 A;  3HUA A;  1RJC B;  1DI5 A;  3OE6 A;  3M3U A;  4LYC A;  4LYM A;  1DKJ A;  183L A;  4GCE A;  4BAD A;  3JR6 A;  2LCB A;  4GCC A;  1LLH A;  1OOP D;  1VFB C;  1BGI A;  2A7D A;  2B75 A;  5KXM A;  1DYD A;  4S0W A;  210L A;  4G4C A;  4NWH A;  2W1L A;  2D4K A;  9LYZ A;  152L A;  1LYI A;  3EML A;  3GUN A;  1V7T A;  1HNL A;  3AEA A;  3DKE X;  3DN0 A;  3SP3 A;  4WLD A;  3TXF A;  1LSD A;  4WOA A;  3WUA A;  1LJK A;  3DMZ A;  2CJL A;  5I5Q A;  4LYT A;  1POV 0;  1HMK A;  1C6J A;  1D0L A;  1IR9 A;  4I8S A;  3HH4 A;  1LPI A;  1QS9 A;  4NSG A;  1RE2 A;  3HUK A;  1L17 A;  4KXI A;  1RHI 4;  1L12 A;  3CT0 A;  3W6A A;  2ZYC A;  3A92 A;  4UWN A;  151L A;  176L A;  128L A;  1LZR A;  1B5X A;  1F10 A;  1LSC A;  1INU A;  2LYO A;  1JKC A;  1ZVY B;  1QIO A;  1EL1 A;  1AZF A;  199L A;  1L37 A;  4FJR A;  1IP5 A;  1L57 A;  4H92 A;  3K3T A;  1L90 A;  1GB0 A;  242L A;  1L95 A;  1P2R A;  1L26 A;  3LN2 A;  1ZV5 L;  2RB2 X;  1L21 A;  4D9Z A;  4PDW D;  1QUG A;  2ZIJ A;  1CUQ A;  1SLY A;  1G7L C;  2DQG Y;  4WO9 A;  1P5C A;  1DXJ A;  5LVH A;  133L A;  4DD1 A;  3AE8 A;  119L A;  2ZQ3 A;  3D9A C;  1IP1 A;  3AB6 A;  3FE0 A;  3WUN A;  3QAK A;  2B6X A;  2O79 A;  3WW5 A;  1N4F A;  3AEB A;  1CJ7 A;  1IVM A;  2RSC A;  1B6I A;  1VDS A;  1J1P Y;  5APC A;  3WU8 A;  4J1B A;  1LZS A;  1I20 A;  1JTN A;  3SFE A;  1B5W A;  1GFH A;  2DQE Y;  1LSP A;  3HH6 A;  3SB9 A;  5DL9 A;  1GB5 A;  146L A;  1L55 A;  4AXT A;  4GCB A;  2BQF A;  4OWE A;  3HT8 A;  4RDS A;  1GE2 A;  5KKJ A;  1ALC A;  1LMT A;  1OUA A;  1GFU A;  3C81 A;  4AQN A;  1CJ6 A;  5D5C A;  4R6C A;  3OK0 A;  5FEK A;  4YEM A;  1MEL L;  3WPK A;  1HER A;  4LT2 A;  1C6E A;  2C8P A;  180L A;  3AEE A;  4OOO A;  2Z2F A;  2CWI A;  1C6T A;  4NHP A;  3C8S A;  1B7R A;  3C83 A;  1JPO A;  5KXN A;  3FAD A;  5DM9 A;  1K28 A;  4I7T A;  4PK0 A;  167L A;  1O23 A;  1GXX A;  1LAA A;  5F9U A;  3IJV A;  1JSF A;  3DN8 A;  3A34 A;  1AT5 A;  1QSB A;  1OUH A;  109L A;  1BWJ A;  1LMQ A;  4H9B A;  4CFP A;  2PY5 A;  3B0K A;  1L02 A;  163L A;  3DN4 A;  1B7N A;  1ZWN A;  1YAO A;  3LYT A;  1LZD A;  1YL0 X;  1ASJ 4;  1L65 A;  1QS5 A;  1ZVH L;  1NHB A;  5KXW A;  4DD3 A;  3LZ2 A;  1TDY A;  3WMK A;  2R7F A;  251L A;  1HFZ A;  1P2C C;  1BB5 A;  4B4J A;  4GN3 A;  1REM A;  4ARQ B;  1QTE A;  5HMV A;  5L3I A;  2OU8 A;  4KT3 A;  1HEN A;  1VBD 4;  1SSW A;  1XFP L;  7LYZ A;  1JJ3 A;  5A3Z A;  1G1V A;  169L A;  4TSC A;  1LJI A;  4NEB A;  4II8 A;  1OV7 A;  1XHX A;  2D4J A;  4B0D A;  5I4X A;  1LZG A;  4WM1 A;  1HF4 A;  1LMC A;  4DDA A;  2I6Z A;  1NHE A;  130L A;  1VDT A;  2FYC A;  135L A;  3ABV A;  1IP4 A;  200L A;  3RU5 A;  4PPO A;  5KXR A;  1C63 A;  4TSB A;  3AJN A;  1QUD A;  3TXI A;  4LYO A;  3L64 A;  1B5V A;  2HUB A;  1L59 A;  3AE7 A;  2LC9 A;  2DQH Y;  1QSW A;  4RW2 A;  5LIO A;  3IJU A;  4XJG A;  1L82 A;  1LZY A;  3WUL A;  2BQM A;  125L A;  3SFD A;  1XEJ A;  4KL7 A;  1XGP C;  231L A;  1L05 A;  2RM2 4;  1AR9 4;  4DAJ A;  1GF4 A;  3P64 A;  1L13 A;  259L A;  1PO2 4;  1R08 4;  1QTZ A;  1GBX A;  3NYA A;  4YF2 A;  1L98 A;  190L A;  2Z38 A;  3WL2 A;  1UIE A;  4N8Z A;  1NKH A;  1G0K A;  1LI6 A;  1CJ9 A;  3GQK A;  1VBB 4;  5B07 A;  3W6E A;  2DQA A;  1A4V A;  244L A;  1HFX A;  158L A;  2ACZ A;  3LZT A;  2GV0 A;  1B0D A;  4G4B A;  1OUB A;  1GF0 A;  1LYZ A;  1UIB A;  1CTW A;  1L62 A;  3MGW A;  1CU3 A;  1L50 A;  1L99 A;  3VRA A;  1BHZ A;  3KAM A;  3N9C A;  4ARM A;  1P56 A;  3ULR A;  2HWB 4;  1YAM A;  166L A;  1OUD A;  162L A;  3AYQ A;  4EKS A;  1BB3 A;  3CT5 A;  1L04 A;  110L A;  4ZPU A;  5AMY A;  3HBE X;  246L A;  2PC2 A;  4O34 A;  2WU2 A;  1PQM A;  4GN5 C;  235L A;  237L A;  108L A;  2FBB A;  2XBR A;  1PS5 A;  241L A;  2B6T A;  3PDS A;  5LAF A;  3TXH A;  3VWO A;  4H8Z A;  2YBH A;  1GBZ A;  1JHL A;  1KFY A;  3ATO A;  8LYZ A;  4NHT A;  3GUJ A;  150L A;  4J1A A;  225L A;  1XSF A;  1TLA A;  1L61 A;  1AR6 4;  1J1O Y;  2A7F A;  1L43 A;  1L30 A;  1P46 A;  1LSE A;  4OW1 A;  2HEF A;  2PW9 A;  1LI3 A;  1QT6 A;  5I4Y A;  4NGY A;  4E3U A;  1GF5 A;  1DQJ C;  1L40 A;  1NEK A;  3HU9 A;  1JQU A;  1D3N A;  1LKR A;  1IOC A;  3VR9 A;  1WQN A;  1L24 A;  1L56 A;  1GEV A;  1L52 A;  2LYM A;  4WG1 A;  1HEL A;  4DQ7 A;  4WG7 A;  3AEC A;  4Q4W 4;  3TXJ A;  153L A;  228L A;  1XEK A;  4N1E I;  2YBN A;  2FBD A;  1L41 A;  1GFR A;  161L A;  2OU0 X;  1GE3 A;  3GUP A;  3P66 A;  2YBL A;  134L A;  4XJD A;  2BQD A;  1FLU A;  126L A;  4I7L A;  5K7O A;  2PLV 4;  3T36 A;  1AT6 A;  1JKA A;  1LJN A;  3TMV A;  2WP9 A;  1NQI A;  1L34 A;  2C8O A;  1QTK A;  4NSJ A;  4ARP A;  1XGU C;  1PVC 4;  5APD A;  1QUS A;  2YBJ A;  3A8Z A;  2MEC A;  193L A;  1LHL A;  1LHM A;  2X5I D;  5ILC A;  5KKI A;  2RS1 4;  4XJH A;  3AE9 A;  4IJ4 A;  1HXS 4;  1IX0 A;  2ZIK A;  4XJF A;  4NWE A;  181L A;  1LJE A;  2X0A A;  1L51 A;  4HJV A;  4I7M A;  3SB5 A;  5KXL A;  3FI5 A;  4EMN A;  5C6L A;  1L10 A;  154L A;  5DN4 A;  3EO5 A;  4UWV A;  1EQ4 A;  4W53 A;  3RNX A;  2RBP A;  4H93 A;  1VBC 4;  3A95 A;  2BQC A;  1OYU A;  3GQH A;  4YEO A;  1B5Y A;  2DQJ Y;  4GRV A;  2NWD X;  3AEG A;  207L A;  2A4T A;  5LYT A;  1GF8 A;  1OVK A;  4LZT A;  2B5Z A;  103L A;  213L A;  1FLW A;  1CUP A;  3AE6 A;  2BQI A;  3DNA A;  174L A;  1GF9 A;  3ZVQ A;  1HHL A;  172L A;  219L A;  2B74 A;  216L A;  1LSG A;  5B59 A;  3HBH A;  1L19 A;  2RBS A;  240L A;  5FHW A;  2RBR A;  2OU9 A;  1COV 4;  1DYG A;  1QTB A;  3DN1 A;  3HUQ A;  4QY9 A;  1QSQ A;  5LYZ A;  188L A;  1GAY A;  1GFK A;  1OVH A;  4HTQ A;  3WXT A;  1LYE A;  3A6C Y;  1L46 A;  1GBS A;  4CJ2 A;  4TTD A;  1WQM A;  1F6S A;  2W1M A;  1RVF 4;  3RUN A;  1UIH A;  1LYS A;  1REX A;  4WO6 A;  4DJH A;  2RR1 4;  1L25 A;  1MLC E;  256L A;  2MEA A;  1PQI A;  1XJT A;  3LYZ A;  1EPY A;  1NDM C;  5LA8 A;  2RS3 4;  3M18 B;  2D6B A;  4M4O A;  4LFP A;  4DD7 A;  4DT3 A;  3HTF A;  2HU1 A;  1LJG A;  1K5M D;  1GPQ C;  4RLN A;  5ILF A;  1R09 4;  165L A;  148L E;  1CV0 A;  1QT5 A;  1YKX X;  3A93 A;  4CHX A;  3B72 A;  1HEM A;  189L A;  5KJ9 A;  1OQM A;  1DI4 A;  4RW1 A;  4CGE A;  1IWW A;  1L39 A;  1KF6 A;  5F81 A;  118L A;  1T3P A;  4GB3 4;  1NEN A;  1UBZ A;  2LZT A;  2OE4 X;  1GE4 A;  1LGX A;  4ARM B;  2VB1 A;  178L A;  1WTN A;  3AZ4 A;  4DD0 A;  3TXB A;  1GBO A;  1ZOY A;  1PIV 4;  5A3E A;  5KXX A;  5I54 A;  1VAT A;  1TEW A;  1QUT A;  1C6P A;  137L A;  233L A;  1T6H A;  122L A;  3G3V A;  4ETA A;  4LT3 A;  1LZT A;  1LYY A;  5B1G A;  3C82 A;  3V2W A;  245L A;  5LA5 A;  4HJY A;  2HEB A;  4I7K A;  4Q4X 4;  1YQ4 A;  1C43 A;  1CV3 A;  2Q0M X;  196L A;  2CUU A;  1HRV 4;  3HDE A;  1C64 A;  159L A;  2F4G A;  1LYD A;  4Q4Y 4;  1XJU A;  2RBO A;  4IAT A;  2W1Y A;  4NGW A;  1GB9 A;  1P36 A;  4NGI A;  4I0C A;  2OTY X;  1T8G A;  4W56 A;  1T8A A;  4PHI A;  4NGK A;  1LTM A;  3RZ4 A;  2MEF A;  3ATN A;  1B7M A;  1QSA A;  185L A;  1KIQ C;  4YSX A;  1L73 A;  5FST A;  3AE5 A;  1D4M 4;  143L A;  2QAR C;  2B73 A;  1TAY A;  1CNS A;  1IY4 A;  1L44 A;  1NBY C;  2L78 A;  144L A;  1W08 A;  1XHZ A;  2ANV A;  2HEA A;  4YXC A;  1L22 A;  2H5Z A;  1T8F A;  1LZ8 A;  1LSF A;  1UIA A;  5KXT A;  1H8T D;  2B76 A;  3AED A;  1P64 A;  2BQN A;  1ZYT A;  5F14 A;  4N5R A;  2BLX A;  1CVK A;  4LYB A;  1Z7S 4;  1D0M A;  1UIC A;  1HSW A;  3LYM A;  3RW8 A;  4NGV A;  255L A;  3B6L A;  3PBL A;  1DYA A;  1B5Z A;  1I1Z A;  1LSA A;  2ZIL A;  248L A;  1PQJ A;  4B49 A;  1IWV A;  3P65 A;  3HTB A;  1C60 A;  1IP7 A;  1C6D A;  2Z39 A;  171L A;  2O4W A;  5KY1 A;  4H9I A;  5LZM A;  221L A;  1GB2 A;  1C7P A;  1BVX A;  1D2Y A;  1L42 A;  260L A;  1AL2 4;  1JKD A;  262L A;  1IIZ A;  182L A;  2CDS A;  2HED A;  4EJ4 A;  3LHM A;  1FBI X;  2G4P A;  4W59 A;  1NDG C;  1L70 A;  1BB4 A;  3GUO A;  4YSY A;  1L63 A;  5KXK A;  4NFV A;  1BVK C;  2I25 L;  4OO9 A;  1CKH A;  1C6B A;  1RUJ 4;  1G0J A;  4HTN A;  1NA1 D;  1GF3 A;  3ODU A;  7LZM A;  3WW6 A;  3P68 A;  3AE3 A;  1LGU A;  2G4Q A;  2ZNX Y;  1IWY A;  3G3W A;  3NY9 A;  1IY3 A;  168L A;  1IOT A;  1YIL A;  4QDN A;  3A91 A;  1C6I A;  1YRO A;  226L A;  5KXZ A;  1UIF A;  4KPM A;  4TWS A;  1UAC Y;  1B7Q A;  4DYG A;  1I6S A;  1LZB A;  4ZIX A;  1FN5 A;  5C6J A;  1QQY A;  1C67 A;  1F6R A;  1XGT C;  1L76 A;  3WVX A;  3P4S A;  1QTD A;  1GB6 A;  1L75 A;  195L A;  4M6D A;  4MR1 A;  3J4G A;  2DQC Y;  5M1Y A;  2H89 A;  2B7X A;  3SB7 A;  3VW7 A;  5KXO A;  1SWZ A;  1L47 A;  1QDT A;  1Z55 A;  2F30 A;  4WMG A;  5LAG A;  4ZFP A;  5E4P A;  2F32 A;  1QDR A;  4QGZ A;  1RI8 B;  4EKR A;  3CIR A;  1KW5 A;  4NGO A;  4ETD A;  4CFO A;  3SB6 A;  3W6C A;  1VBA 4;  1CV4 A;  4H94 A;  3A90 A;  4U3X B;  1C65 A;  1ZUR A;  220L A;  3OE0 A;  1PQO A;  4P2E A;  4R0F A;  1GFG A;  4B1A A;  4LT1 A;  4DDC A;  1BB7 A;  1JIT A;  3EXD A;  4WLT A;  3A67 Y;  5LYM A;  2MEE A;  214L A;  2D91 A;  4OWB A;  1L01 A;  3WXU A;  1LYH A;  1L72 A;  4ZEE A;  4DKL A;  1P6Y A;  1LPY A;  5HLL A;  1LYJ A;  1YL1 X;  1C68 A;  1L0V A;  4WM4 A;  1CV1 A;  111L A;  2BQE A;  1B7L A;  1LZA A;  4Q4V 4;  1L16 A;  1DKK A;  1LMN A;  4PJZ A;  1QT8 A;  104L A;  2Q9E A;  2HUK A;  1G7M C;  2B70 A;  1C6Q A;  1LSB A;  1HEO A;  1OV5 A;  4LZM A;  3WPL A;  1H6M A;  1L94 A;  2OE7 X;  1LWK A;  1L06 A;  3UON A;  4XJI A;  1L36 A;  4J0L A;  3EBA B;  112L A;  2FBW A;  1XEI A;  4WL6 A;  2YVB A;  1KW7 A;  3F8V A;  4FDY A;  4GN4 A;  1QT3 A;  5FCP A;  140L A;  1LYO A;  1CKG A;  1B7P A;  1L32 A;  218L A;  1LHJ A;  4IAS A;  2F2Q A;  4TX7 A;  1TBY A;  1B7S A;  3QY4 A;  1T97 A;  1ZP0 A;  1L49 A;  113L A;  1PQD A;  2Z37 A;  1FLQ A;  1UA6 Y;  1LW9 A;  1KXX A;  4LDL A;  4I7Q A;  4H9H A;  1L97 A;  1WTM A;  2LHM A;  1AR7 4;  1G06 A;  1C61 A;  3G3A B;  192L A;  2YBI A;  3TXK A;  4HTK A;  1PQK A;  1YKY X;  1WVU A;  3SBB C;  1HFY A;  2EPE A;  2B6Y A;  1L31 A;  1YQV Y;  4W51 A;  1CV5 A;  2D4I A;  1LZ4 A;  1IOS A;  5L3H A;  1SX7 A;  1C66 A;  4H9C A;  2ANX A;  3WYH A;  3TXD A;  1UCO A;  4LYZ A;  3JD7 4;  4GCF A;  1HC0 A;  2LZM A;  2PYJ A;  131L A;  1D6Q A;  186L A;  1OUG A;  1DPW A;  1JJ0 A;  1E8L A;  3CDQ A;  4ML7 A;  5F16 A;  1LOZ A;  1GFE A;  227L A;  5IEL A;  1GEZ A;  1L83 A;  1L71 A;  1LHI A;  4MCK A;  3GUM A;  5EBH A;  4RHV 4;  3AE1 A;  4EPF A;  3CDR A;  3F6Z A;  3OJP A;  1VBE 4;  2FYD A;  4MST A;  4L41 A;  4NHS A;  4TUN A;  187L A;  3AZ6 A;  1GDX A;  2WU5 A;  4YTP A;  4LT0 A;  1L96 A;  3CQL A;  4PRU A;  3G3X A;  1HEQ A;  1L85 A;  4C5F A;  1P7S A;  3GXR A;  120L A;  5KXY A;  1H87 A;  1D6P A;  3GXK A;  1OVJ A;  1JKB A;  3CB7 A;  1C6C A;  1RUE 4;  1EQ5 A;  1L38 A;  2BQG A;  2XTH A;  2O7A A;  3BKH A;  1L11 A;  1GD6 A;  230L A;  1L87 A;  2RAY X;  4G9S A;  4W52 A;  4LDE A;  2RAZ X;  236L A;  5DN5 A;  1LWG A;  1NMM A;  1LZ9 A;  1G0P A;  6LYZ A;  1DYB A;  1JEF A;  4E97 A;  2H9K A;  1G1W A;  149L A;  2HWC 4;  3J8F 4;  197L A;  3CDV A;  4PJ2 C;  1L20 A;  1C6K A;  3TXE A;  1OWY A;  5FDJ A;  1BWH A;  1L67 A;  1L79 A;  261L A;  2Z2E A;  4ETE A;  114L A;  1G7I C;  2WAR A;  1L80 A;  3E3D A;  4A7D A;  3HTD A;  4NGJ A;  1G7J C;  3FA0 A;  156L A;  4ARQ A;  1L86 A;  1QUH A;  1AR8 4;  191L A;  1L00 A;  1SSY A;  5KXS A;  4H1P A;  5B06 A;  1OWZ A;  1G0M A;  145L A;  4NGL A;  2BQA A;  1IC7 Y;  1SWY A;  4NSI A;  4WLY A;  2RS5 4;  3DN3 A;  4NHI A;  4LDO A;  4GCD A;  1DI3 A;  1L93 A;  2N5Z A;  2R06 4;  1L03 A;  4W55 A;  4YEN A;  5IHG A;  238L A;  1L07 A;  3HT7 A;  1KY1 A;  1QUO A;  4W96 A;  4DWX A;  3A6B Y;  1UID A;  4BS7 A;  5IDD A;  4HP0 A;  1GB7 A;  1L08 A;  3C80 A;  1LJJ A;  3HWL A;  1B2K A;  1GF6 A;  1RFP A;  177L A;  1L91 A;  5I4W A;  1REZ A;  1IP3 A;  1F0W A;  155L A;  1OUC A;  4GLV A;  1XGR C;  1AM7 A;  2WS3 A;  2EIZ C;  1D0K A;  4I7J A;  4WL7 A;  2Z19 A;  2BQL A;  1C10 A;  3A3Q A;  3A3R X;  2BPU A;  1IC5 Y;  4HSF A;  1CU0 A;  3WUM A;  250L A;  4Z41 A;  4YT0 A;  4DD9 A;  3HU8 A;  3SBA A;  4EPI A;  1OUI A;  1CJ8 A;  1G7H C;  3TXG A;  1LMO A;  1IOR A;  1L81 A;  1LCN A;  1L53 A;  1JTP L;  1L09 A;  2H9J A;  138L A;  1L84 A;  3P4Z A;  3VR8 A;  1CX7 A;  1GB8 A;  184L A;  3DMV A;  4XYY A;  1KXW A;  1NBZ C;  5LVG A;  4H8X A;  1IEE A;  1GB3 A;  1JIS A;  4WLX A;  3AW6 A;  1HRI 4;  1B7O A;  3P4R A;  1QT4 A;  223L A;  1L15 A;  1FKV A;  4B4I A;  1LGW A;  4XN6 A;  4Z46 A;  2MED A;  1GAZ A;  2MEI A;  1JWR A;  1L74 A;  3K2R A;  3T6U A;  4B4E A;  4GBR B;  2MEB A;  1C6A A;  2MEG A;  1BQL Y;  1L35 A;  4I7N A;  1I56 A;  3DMX A;  5I14 A;  4W54 A;  239L A;  1GE0 A;  1YAP A;  5HMJ A;  2Z6B A;  3GUL A;  3AW7 A;  2EX3 A;  243L A;  254L A;  4I7R A;  2RBN A;  3OE8 A;  3CSZ A;  1JTT L;  1C46 A;  1PZY A;  1GHL A;  2WQY A;  160L A;  157L A;  4YXA C;  4YSZ A;  102L A;  3DN6 A;  4GLA A;  2BAA A;  3N9E A;  3TMW A;  5FEL A;  2HUM A;  4NHQ A;  2F2N A;  2R04 4;  3DN2 A;  1D2W A;  1DYC A;  2Q9D A;  5I53 A;  4LFX A;  1NF5 A;  1DPX A;  2XJW A;  249L A;  4I7O A;  3AE4 A;  1LYG A;  1T6V L;  4H90 A;  247L A;  3HH3 A;  3J6K A;  1KIP C;  1NCQ D;  1EV1 4;  1IWT A;  1G0Q A;  208L A;  4EOF A;  1VAU A;  1LMA A;  1A2Y C;  3C7W A;  3HTG A;  175L A;  1L58 A;  1L69 A;  1LZN A;  206L A;  1D9W A;  5B05 A;  4HV1 A;  6LZM A;  1CX6 A;  1SQ2 L;  3W6B A;  5C6I A;  5HNC A;  1L14 A;  2ZYP A;  115L A;  1GFV A;  4N1C C;  4HPE A;  2WDV A;  4I7S A;  4PRQ A;  2RB1 X;  1RMU 4;  3AZ7 A;  1WQP A;  1HSX A;  3HFM Y;  2WDQ A;  5APF A;  4G49 A;  1LYF A;  2EKS C;  2ZQ4 A;  4XEN A;  3CSR A;  1P3N A;  3V2Y A;  1L68 A;  1D3F A;  107L A;  1QTC A;  1FLY A;  4H9F A;  2DQD Y;  4QEQ A;  1L28 A;  1IWX A;  1P2L A;  258L A;  147L A;  1C6N A;  3AGH A;  3W6D A;  127L A;  1KXY A;  4IAP A;  1CU5 A;  4H9E A;  4H9A A;  5B1F A;  4DDB A;  3B0I A;  3ZVQ B;  1L89 A;  4WM3 A;  3C8R A;  3C7Z A;  4YTN A;  1L92 A;  1GBW A;  1UIG A;  3P4P A;  1LHH A;  1W6Z A;  1JTO L;  4DD2 A;  3C8Q A;  1GXV 2;  2RB0 X;  1JUG A;  3CT1 A;  5DLA A;  1LJH A;  4NG1 A;  4C3W A;  194L A;  1L64 A;  139L A;  3F9L A;  1L0K A;  2OEA X;  3AEF A;  2YBM A;  5II3 A;  1OUE A;  1WVV A;  1XGQ C;  2DKV A;  2RMU 4;  5L9J A;  4J7V A;  4XJB A;  1LJF A;  1L48 A;  4WM2 A;  1YKZ X;  1VRH 4;  212L A;  4K5Y A;  1UC0 A;  1GE1 A;  1BB6 A;  2BQB A;  5F9X A;  4OWH A;  1G0L A;  2LYZ A;  3N9A A;  2F4A A;  4ET8 A;  2YSS C;  4H8Y A;  1D9U A;  3G3B B;  1CU2 A;  1OUF A;  1IR8 A;  1IC4 Y;  1DYF A;  1FKQ A;  1RUG 4;  4ANR A;  1LSM A;  1J1X Y;  1OUJ A;  1L66 A;  1RUH 4;  3D3D A;  3WVY A;  3HDF A;  2H88 A;  1YQ3 A;  2OTZ X;  1OP9 B;  229L A;  4WM6 A;  5JEN B;  1QT7 A;  1IP2 A;  201L A;  1TCY A;  1EQE A;  4N0J A;  2XBS A;  5KXP A;  5HQ1 A;  1C62 A;  4YM8 A;  1LJ3 A;  3EMS A;  4LGK A;  1B5U A;  1IR7 A;  2OE9 X;  3AGG G;  1LZ6 A;  1L29 A;  2HU3 A;  2PYL A;  1HML A;  3RZE A;  3HH5 A;  5LVI A;  4X3B A;  5C2T A;  132L A;  211L A;  1CV6 A;  4W58 A;  1PO1 4;  2WDR A;  1RUD 4;  2W1X A;  1CKC A;  1CU6 A;  4BAP A;  5LXW A;  3FI7 A;  1JJ1 A;  2DQI Y;  1L77 A;  4PGJ B;  5J7C A;  2BQJ A;  5LVK A;  2R07 4;  2YDG A;  3LZM A;  1LSZ A;  2Y8P A;  129L A;  2EQL A;  1C6F A;  1DYE A;  3IWR A;  1L88 A;  1LSY A;  2I26 L;  1REY A;  1L33 A;  2LZ2 A;  2BQH A;  1IWU A;  1GWD A;  5T3F A;  1VED A;  4YOP A;  1KNI A;  5HNL A;  1C6L A;  1HEP A;  1D3J A;  3WU7 A;  4DQJ A;  2HTX A;  4OOT A;  4UWU A;  1L45 A;  4W57 A;  232L A;  1D3M A;  4RLM A;  2PZS A;  164L A;  3AZ5 A;  2IHL A;  1LZ5 A;  2Z12 A;  1V7S A;  4EKQ A;  1L27 A;  4NGZ A;  1ZMY L;  1LSN A;  2QB0 B;  3P4Q A;  4EXM A;  1MQT D;  1YIK A;  1GFJ A;  4WM5 A;  4YX7 C; 
#chains in the Genus database with same CATH homology
 1WQR A;  257L A;  1IP6 A;  3QNG A;  1FDL Y;  217L A;  234L A;  4NG8 A;  1GFT A;  3B0O A;  3BKV A;  2B72 A;  1LI2 A;  4BAF A;  209L A;  1IO5 A;  2HEE A;  224L A;  1BWI A;  2ZWB A;  2NTG A;  3W6F A;  1KS3 A;  1KIR C;  170L A;  1JSE A;  1SX2 A;  4OWA A;  2RBQ A;  1G07 A;  1WQQ A;  1GFA A;  173L A;  2HUL A;  1GBY A;  4EKP A;  1YAQ A;  1GF7 A;  1NWG A;  4NY5 A;  2BLY A;  3CDT A;  2AUB A;  5D5F A;  4ETB A;  1DZB X;  1IOQ A;  3L2X A;  1C6G A;  1L0J A;  253L A;  5LIN A;  215L A;  4N9R A;  3HBD A;  2CGI A;  4HJZ A;  1CKF A;  4NSH A;  1HEW A;  2G4N A;  1QTV A;  3CDO A;  4G4H A;  1XEP A;  4W94 A;  4HV2 A;  4H91 A;  3HT6 A;  1LMP A;  4OWC A;  2NTH A;  1LJ4 A;  1UUZ C;  1C08 C;  1JIY A;  2HEC A;  4Z3M A;  3GUI A;  2BQO A;  2IGC A;  4DC4 A;  1LZE A;  2RH1 A;  2IFF Y;  252L A;  3D4S A;  1L60 A;  3GUK A;  1LZC A;  1CKD A;  3WPJ A;  1QTH A;  1C6M A;  2DQF C;  1GDW A;  3CSQ A;  1IWZ A;  1G0G A;  1L54 A;  4DQ5 A;  5E9R A;  2Z18 A;  1YAN A;  1XI1 A;  6LYT A;  2BQK A;  1L23 A;  1KY0 A;  4HPI A;  1RCM A;  1C6H A;  142L A;  2B6Z A;  3A96 A;  2F47 A;  2MEH A;  3ZEK A;  2XQO A;  4ARJ A;  3AGI A;  1WQO A;  3RT5 X;  1JTM A;  3NY8 A;  2ZNW Y;  1WTH A;  2B6W A;  3LYO A;  1C45 A;  1VDQ A;  205L A;  4I7P A;  4Z98 A;  1B9O A;  1C69 A;  222L A;  1L18 A;  3C7Y A;  1LZ1 A;  3HT9 A;  4XAD A;  123L A;  3SN6 R;  5APE A;  3TMU A;  2DBT A;  3W3E A;  1AKI A;  3QE8 A;  3SB8 A;  4AGA A;  5LVJ A;  3WH1 A;  1LHK A;  1VDP A;  198L A;  141L A;  3TMX A;  4ETC A;  3OE9 A;  4ET9 A;  1LKS A;  4NIJ A;  3A94 A;  3WU9 A;  4ARL A;  1P37 A;  3HUA A;  1RJC B;  1DI5 A;  3OE6 A;  3M3U A;  4LYC A;  4LYM A;  1DKJ A;  183L A;  4GCE A;  4BAD A;  3JR6 A;  2LCB A;  4GCC A;  1LLH A;  1VFB C;  1BGI A;  2A7D A;  2B75 A;  5KXM A;  1DYD A;  4S0W A;  210L A;  4G4C A;  4NWH A;  2W1L A;  2D4K A;  9LYZ A;  152L A;  1LYI A;  3EML A;  3GUN A;  1V7T A;  1HNL A;  3DKE X;  3DN0 A;  3SP3 A;  4WLD A;  3TXF A;  1LSD A;  4WOA A;  3WUA A;  1LJK A;  3DMZ A;  2CJL A;  5I5Q A;  4LYT A;  1HMK A;  1C6J A;  1D0L A;  1IR9 A;  4I8S A;  3HH4 A;  1LPI A;  1QS9 A;  4NSG A;  1RE2 A;  3HUK A;  1L17 A;  4KXI A;  1L12 A;  3CT0 A;  3W6A A;  2ZYC A;  3A92 A;  4UWN A;  151L A;  176L A;  128L A;  1LZR A;  1B5X A;  1F10 A;  1LSC A;  1INU A;  2LYO A;  1JKC A;  1ZVY B;  1QIO A;  1EL1 A;  1AZF A;  199L A;  1L37 A;  4FJR A;  1IP5 A;  1L57 A;  4H92 A;  3K3T A;  1L90 A;  1GB0 A;  242L A;  1L95 A;  1P2R A;  1L26 A;  3LN2 A;  1ZV5 L;  2RB2 X;  1L21 A;  4D9Z A;  1QUG A;  2ZIJ A;  1CUQ A;  1SLY A;  1G7L C;  2DQG Y;  4WO9 A;  1P5C A;  1DXJ A;  5LVH A;  133L A;  4DD1 A;  119L A;  2ZQ3 A;  3D9A C;  1IP1 A;  3AB6 A;  3FE0 A;  3WUN A;  3QAK A;  2B6X A;  2O79 A;  3WW5 A;  1N4F A;  1CJ7 A;  1IVM A;  2RSC A;  1B6I A;  1VDS A;  1J1P Y;  5APC A;  3WU8 A;  4J1B A;  1LZS A;  1I20 A;  1JTN A;  1B5W A;  1GFH A;  2DQE Y;  1LSP A;  3HH6 A;  3SB9 A;  5DL9 A;  1GB5 A;  146L A;  1L55 A;  4AXT A;  4GCB A;  2BQF A;  4OWE A;  3HT8 A;  4RDS A;  1GE2 A;  5KKJ A;  1ALC A;  1LMT A;  1OUA A;  1GFU A;  3C81 A;  4AQN A;  1CJ6 A;  5D5C A;  4R6C A;  3OK0 A;  5FEK A;  4YEM A;  1MEL L;  3WPK A;  1HER A;  4LT2 A;  1C6E A;  2C8P A;  180L A;  4OOO A;  2Z2F A;  2CWI A;  1C6T A;  4NHP A;  3C8S A;  1B7R A;  3C83 A;  1JPO A;  5KXN A;  3FAD A;  5DM9 A;  1K28 A;  4I7T A;  4PK0 A;  167L A;  1O23 A;  1GXX A;  1LAA A;  5F9U A;  3IJV A;  1JSF A;  3DN8 A;  3A34 A;  1AT5 A;  1QSB A;  1OUH A;  109L A;  1BWJ A;  1LMQ A;  4H9B A;  4CFP A;  2PY5 A;  3B0K A;  1L02 A;  163L A;  3DN4 A;  1B7N A;  1ZWN A;  1YAO A;  3LYT A;  1LZD A;  1YL0 X;  1L65 A;  1QS5 A;  1ZVH L;  1NHB A;  5KXW A;  4DD3 A;  3LZ2 A;  1TDY A;  3WMK A;  2R7F A;  251L A;  1HFZ A;  1P2C C;  1BB5 A;  4B4J A;  4GN3 A;  1REM A;  4ARQ B;  1QTE A;  5HMV A;  5L3I A;  2OU8 A;  4KT3 A;  1HEN A;  1SSW A;  1XFP L;  7LYZ A;  1JJ3 A;  5A3Z A;  1G1V A;  169L A;  4TSC A;  1LJI A;  4NEB A;  4II8 A;  1OV7 A;  1XHX A;  2D4J A;  4B0D A;  5I4X A;  1LZG A;  4WM1 A;  1HF4 A;  1LMC A;  4DDA A;  2I6Z A;  1NHE A;  130L A;  1VDT A;  2FYC A;  135L A;  1IP4 A;  200L A;  3RU5 A;  4PPO A;  5KXR A;  1C63 A;  4TSB A;  3AJN A;  1QUD A;  3TXI A;  4LYO A;  3L64 A;  1B5V A;  2HUB A;  1L59 A;  2LC9 A;  2DQH Y;  1QSW A;  4RW2 A;  5LIO A;  3IJU A;  4XJG A;  1L82 A;  1LZY A;  3WUL A;  2BQM A;  125L A;  1XEJ A;  4KL7 A;  1XGP C;  231L A;  1L05 A;  4DAJ A;  1GF4 A;  3P64 A;  1L13 A;  259L A;  1QTZ A;  1GBX A;  3NYA A;  4YF2 A;  1L98 A;  190L A;  2Z38 A;  3WL2 A;  1UIE A;  4N8Z A;  1NKH A;  1G0K A;  1LI6 A;  1CJ9 A;  5B07 A;  3W6E A;  2DQA A;  1A4V A;  244L A;  1HFX A;  158L A;  3LZT A;  2GV0 A;  1B0D A;  4G4B A;  1OUB A;  1GF0 A;  1LYZ A;  1UIB A;  1CTW A;  1L62 A;  3MGW A;  1CU3 A;  1L50 A;  1L99 A;  1BHZ A;  3KAM A;  3N9C A;  4ARM A;  1P56 A;  3ULR A;  1YAM A;  166L A;  1OUD A;  162L A;  3AYQ A;  4EKS A;  1BB3 A;  3CT5 A;  1L04 A;  110L A;  4ZPU A;  5AMY A;  3HBE X;  246L A;  2PC2 A;  4O34 A;  1PQM A;  4GN5 C;  235L A;  237L A;  108L A;  2FBB A;  2XBR A;  1PS5 A;  241L A;  2B6T A;  3PDS A;  5LAF A;  3TXH A;  3VWO A;  4H8Z A;  2YBH A;  1GBZ A;  1JHL A;  3ATO A;  8LYZ A;  4NHT A;  3GUJ A;  150L A;  4J1A A;  225L A;  1XSF A;  1TLA A;  1L61 A;  1J1O Y;  2A7F A;  1L43 A;  1L30 A;  1P46 A;  1LSE A;  4OW1 A;  2HEF A;  2PW9 A;  1LI3 A;  1QT6 A;  5I4Y A;  4NGY A;  4E3U A;  1GF5 A;  1DQJ C;  1L40 A;  3HU9 A;  1JQU A;  1D3N A;  1LKR A;  1IOC A;  1WQN A;  1L24 A;  1L56 A;  1GEV A;  1L52 A;  2LYM A;  4WG1 A;  1HEL A;  4DQ7 A;  4WG7 A;  3TXJ A;  153L A;  228L A;  1XEK A;  4N1E I;  2YBN A;  2FBD A;  1L41 A;  1GFR A;  161L A;  2OU0 X;  1GE3 A;  3GUP A;  3P66 A;  2YBL A;  134L A;  4XJD A;  2BQD A;  1FLU A;  126L A;  4I7L A;  5K7O A;  3T36 A;  1AT6 A;  1JKA A;  1LJN A;  3TMV A;  1NQI A;  1L34 A;  2C8O A;  1QTK A;  4NSJ A;  4ARP A;  1XGU C;  5APD A;  1QUS A;  2YBJ A;  3A8Z A;  2MEC A;  193L A;  1LHL A;  1LHM A;  5ILC A;  5KKI A;  4XJH A;  4IJ4 A;  1IX0 A;  2ZIK A;  4XJF A;  4NWE A;  181L A;  1LJE A;  2X0A A;  1L51 A;  4HJV A;  4I7M A;  3SB5 A;  5KXL A;  3FI5 A;  4EMN A;  5C6L A;  1L10 A;  154L A;  5DN4 A;  3EO5 A;  4UWV A;  1EQ4 A;  4W53 A;  3RNX A;  2RBP A;  4H93 A;  3A95 A;  2BQC A;  1OYU A;  4YEO A;  1B5Y A;  2DQJ Y;  4GRV A;  2NWD X;  207L A;  2A4T A;  5LYT A;  1GF8 A;  1OVK A;  4LZT A;  2B5Z A;  103L A;  213L A;  1FLW A;  1CUP A;  2BQI A;  3DNA A;  174L A;  1GF9 A;  3ZVQ A;  1HHL A;  172L A;  219L A;  2B74 A;  216L A;  1LSG A;  5B59 A;  3HBH A;  1L19 A;  2RBS A;  240L A;  5FHW A;  2RBR A;  2OU9 A;  1DYG A;  1QTB A;  3DN1 A;  3HUQ A;  4QY9 A;  1QSQ A;  5LYZ A;  188L A;  1GAY A;  1GFK A;  1OVH A;  4HTQ A;  3WXT A;  1LYE A;  3A6C Y;  1L46 A;  1GBS A;  4CJ2 A;  4TTD A;  1WQM A;  1F6S A;  2W1M A;  3RUN A;  1UIH A;  1LYS A;  1REX A;  4WO6 A;  4DJH A;  1L25 A;  1MLC E;  256L A;  2MEA A;  1PQI A;  1XJT A;  3LYZ A;  1EPY A;  1NDM C;  5LA8 A;  3M18 B;  2D6B A;  4M4O A;  4LFP A;  4DD7 A;  4DT3 A;  3HTF A;  2HU1 A;  1LJG A;  1GPQ C;  4RLN A;  5ILF A;  165L A;  148L E;  1CV0 A;  1QT5 A;  1YKX X;  3A93 A;  4CHX A;  3B72 A;  1HEM A;  189L A;  5KJ9 A;  1OQM A;  1DI4 A;  4RW1 A;  4CGE A;  1IWW A;  1L39 A;  5F81 A;  118L A;  1T3P A;  1UBZ A;  2LZT A;  2OE4 X;  1GE4 A;  1LGX A;  4ARM B;  2VB1 A;  178L A;  1WTN A;  3AZ4 A;  4DD0 A;  3TXB A;  1GBO A;  5A3E A;  5KXX A;  5I54 A;  1VAT A;  1TEW A;  1QUT A;  1C6P A;  137L A;  233L A;  1T6H A;  122L A;  3G3V A;  4ETA A;  4LT3 A;  1LZT A;  1LYY A;  5B1G A;  3C82 A;  3V2W A;  245L A;  5LA5 A;  4HJY A;  2HEB A;  4I7K A;  1C43 A;  1CV3 A;  2Q0M X;  196L A;  2CUU A;  3HDE A;  1C64 A;  159L A;  2F4G A;  1LYD A;  1XJU A;  2RBO A;  4IAT A;  2W1Y A;  4NGW A;  1GB9 A;  1P36 A;  4NGI A;  4I0C A;  2OTY X;  1T8G A;  4W56 A;  1T8A A;  4PHI A;  4NGK A;  1LTM A;  3RZ4 A;  2MEF A;  3ATN A;  1B7M A;  1QSA A;  185L A;  1KIQ C;  1L73 A;  5FST A;  143L A;  2QAR C;  2B73 A;  1TAY A;  1CNS A;  1IY4 A;  1L44 A;  1NBY C;  2L78 A;  144L A;  1W08 A;  1XHZ A;  2ANV A;  2HEA A;  4YXC A;  1L22 A;  2H5Z A;  1T8F A;  1LZ8 A;  1LSF A;  1UIA A;  5KXT A;  1P64 A;  2BQN A;  1ZYT A;  5F14 A;  4N5R A;  2BLX A;  1CVK A;  4LYB A;  1D0M A;  1UIC A;  1HSW A;  3LYM A;  3RW8 A;  4NGV A;  255L A;  3B6L A;  3PBL A;  1DYA A;  1B5Z A;  1I1Z A;  1LSA A;  2ZIL A;  248L A;  1PQJ A;  4B49 A;  1IWV A;  3P65 A;  3HTB A;  1C60 A;  1IP7 A;  1C6D A;  2Z39 A;  171L A;  2O4W A;  5KY1 A;  4H9I A;  5LZM A;  221L A;  1GB2 A;  1C7P A;  1BVX A;  1D2Y A;  1L42 A;  260L A;  1JKD A;  262L A;  1IIZ A;  182L A;  2CDS A;  2HED A;  4EJ4 A;  3LHM A;  1FBI X;  2G4P A;  4W59 A;  1NDG C;  1L70 A;  1BB4 A;  3GUO A;  1L63 A;  5KXK A;  4NFV A;  1BVK C;  2I25 L;  4OO9 A;  1CKH A;  1C6B A;  1G0J A;  4HTN A;  1GF3 A;  3ODU A;  7LZM A;  3WW6 A;  3P68 A;  1LGU A;  2G4Q A;  2ZNX Y;  1IWY A;  3G3W A;  3NY9 A;  1IY3 A;  168L A;  1IOT A;  1YIL A;  4QDN A;  3A91 A;  1C6I A;  1YRO A;  226L A;  5KXZ A;  1UIF A;  4KPM A;  4TWS A;  1UAC Y;  1B7Q A;  4DYG A;  1I6S A;  1LZB A;  4ZIX A;  1FN5 A;  5C6J A;  1QQY A;  1C67 A;  1F6R A;  1XGT C;  1L76 A;  3WVX A;  1QTD A;  1GB6 A;  1L75 A;  195L A;  4M6D A;  4MR1 A;  3J4G A;  2DQC Y;  5M1Y A;  2B7X A;  3SB7 A;  3VW7 A;  5KXO A;  1SWZ A;  1L47 A;  1QDT A;  1Z55 A;  2F30 A;  4WMG A;  5LAG A;  4ZFP A;  5E4P A;  2F32 A;  1QDR A;  4QGZ A;  1RI8 B;  4EKR A;  1KW5 A;  4NGO A;  4ETD A;  4CFO A;  3SB6 A;  3W6C A;  1CV4 A;  4H94 A;  3A90 A;  4U3X B;  1C65 A;  1ZUR A;  220L A;  3OE0 A;  1PQO A;  4P2E A;  4R0F A;  1GFG A;  4B1A A;  4LT1 A;  4DDC A;  1BB7 A;  1JIT A;  3EXD A;  4WLT A;  3A67 Y;  5LYM A;  2MEE A;  214L A;  2D91 A;  4OWB A;  1L01 A;  3WXU A;  1LYH A;  1L72 A;  4ZEE A;  4DKL A;  1P6Y A;  1LPY A;  5HLL A;  1LYJ A;  1YL1 X;  1C68 A;  4WM4 A;  1CV1 A;  111L A;  2BQE A;  1B7L A;  1LZA A;  1L16 A;  1DKK A;  1LMN A;  4PJZ A;  1QT8 A;  104L A;  2Q9E A;  2HUK A;  1G7M C;  2B70 A;  1C6Q A;  1LSB A;  1HEO A;  1OV5 A;  4LZM A;  3WPL A;  1H6M A;  1L94 A;  2OE7 X;  1LWK A;  1L06 A;  3UON A;  4XJI A;  1L36 A;  4J0L A;  3EBA B;  112L A;  1XEI A;  4WL6 A;  2YVB A;  1KW7 A;  3F8V A;  4FDY A;  4GN4 A;  1QT3 A;  5FCP A;  140L A;  1LYO A;  1CKG A;  1B7P A;  1L32 A;  218L A;  1LHJ A;  4IAS A;  2F2Q A;  4TX7 A;  1TBY A;  1B7S A;  3QY4 A;  1T97 A;  1L49 A;  113L A;  1PQD A;  2Z37 A;  1FLQ A;  1UA6 Y;  1LW9 A;  1KXX A;  4LDL A;  4I7Q A;  4H9H A;  1L97 A;  1WTM A;  2LHM A;  1G06 A;  1C61 A;  3G3A B;  192L A;  2YBI A;  3TXK A;  4HTK A;  1PQK A;  1YKY X;  1WVU A;  3SBB C;  1HFY A;  2EPE A;  2B6Y A;  1L31 A;  1YQV Y;  4W51 A;  1CV5 A;  2D4I A;  1LZ4 A;  1IOS A;  5L3H A;  1SX7 A;  1C66 A;  4H9C A;  2ANX A;  3WYH A;  3TXD A;  1UCO A;  4LYZ A;  4GCF A;  1HC0 A;  2LZM A;  2PYJ A;  131L A;  1D6Q A;  186L A;  1OUG A;  1DPW A;  1JJ0 A;  1E8L A;  3CDQ A;  4ML7 A;  5F16 A;  1LOZ A;  1GFE A;  227L A;  5IEL A;  1GEZ A;  1L83 A;  1L71 A;  1LHI A;  4MCK A;  3GUM A;  5EBH A;  4EPF A;  3CDR A;  3F6Z A;  3OJP A;  2FYD A;  4MST A;  4L41 A;  4NHS A;  4TUN A;  187L A;  3AZ6 A;  1GDX A;  4LT0 A;  1L96 A;  3CQL A;  4PRU A;  3G3X A;  1HEQ A;  1L85 A;  4C5F A;  1P7S A;  3GXR A;  120L A;  5KXY A;  1H87 A;  1D6P A;  3GXK A;  1OVJ A;  1JKB A;  3CB7 A;  1C6C A;  1EQ5 A;  1L38 A;  2BQG A;  2XTH A;  2O7A A;  3BKH A;  1L11 A;  1GD6 A;  230L A;  1L87 A;  2RAY X;  4G9S A;  4W52 A;  4LDE A;  2RAZ X;  236L A;  5DN5 A;  1LWG A;  1NMM A;  1LZ9 A;  1G0P A;  6LYZ A;  1DYB A;  1JEF A;  4E97 A;  2H9K A;  1G1W A;  149L A;  197L A;  3CDV A;  4PJ2 C;  1L20 A;  1C6K A;  3TXE A;  1OWY A;  5FDJ A;  1BWH A;  1L67 A;  1L79 A;  261L A;  2Z2E A;  4ETE A;  114L A;  1G7I C;  2WAR A;  1L80 A;  3E3D A;  4A7D A;  3HTD A;  4NGJ A;  1G7J C;  3FA0 A;  156L A;  4ARQ A;  1L86 A;  1QUH A;  191L A;  1L00 A;  1SSY A;  5KXS A;  4H1P A;  5B06 A;  1OWZ A;  1G0M A;  145L A;  4NGL A;  2BQA A;  1IC7 Y;  1SWY A;  4NSI A;  4WLY A;  3DN3 A;  4NHI A;  4LDO A;  4GCD A;  1DI3 A;  1L93 A;  2N5Z A;  1L03 A;  4W55 A;  4YEN A;  5IHG A;  238L A;  1L07 A;  3HT7 A;  1KY1 A;  1QUO A;  4W96 A;  4DWX A;  3A6B Y;  1UID A;  4BS7 A;  5IDD A;  4HP0 A;  1GB7 A;  1L08 A;  3C80 A;  1LJJ A;  3HWL A;  1B2K A;  1GF6 A;  1RFP A;  177L A;  1L91 A;  5I4W A;  1REZ A;  1IP3 A;  1F0W A;  155L A;  1OUC A;  4GLV A;  1XGR C;  1AM7 A;  2EIZ C;  1D0K A;  4I7J A;  4WL7 A;  2Z19 A;  2BQL A;  1C10 A;  3A3Q A;  3A3R X;  2BPU A;  1IC5 Y;  4HSF A;  1CU0 A;  3WUM A;  250L A;  4Z41 A;  4DD9 A;  3HU8 A;  3SBA A;  4EPI A;  1OUI A;  1CJ8 A;  1G7H C;  3TXG A;  1LMO A;  1IOR A;  1L81 A;  1LCN A;  1L53 A;  1JTP L;  1L09 A;  2H9J A;  138L A;  1L84 A;  3P4Z A;  1CX7 A;  1GB8 A;  184L A;  3DMV A;  4XYY A;  1KXW A;  1NBZ C;  5LVG A;  4H8X A;  1IEE A;  1GB3 A;  1JIS A;  4WLX A;  3AW6 A;  1B7O A;  1QT4 A;  223L A;  1L15 A;  1FKV A;  4B4I A;  1LGW A;  4XN6 A;  4Z46 A;  2MED A;  1GAZ A;  2MEI A;  1JWR A;  1L74 A;  3K2R A;  3T6U A;  4B4E A;  4GBR B;  2MEB A;  1C6A A;  2MEG A;  1BQL Y;  1L35 A;  4I7N A;  1I56 A;  3DMX A;  5I14 A;  4W54 A;  239L A;  1GE0 A;  1YAP A;  5HMJ A;  2Z6B A;  3GUL A;  3AW7 A;  2EX3 A;  243L A;  254L A;  4I7R A;  2RBN A;  3OE8 A;  3CSZ A;  1JTT L;  1C46 A;  1PZY A;  1GHL A;  160L A;  157L A;  4YXA C;  102L A;  3DN6 A;  4GLA A;  2BAA A;  3N9E A;  3TMW A;  5FEL A;  2HUM A;  4NHQ A;  2F2N A;  3DN2 A;  1D2W A;  1DYC A;  2Q9D A;  5I53 A;  4LFX A;  1NF5 A;  1DPX A;  2XJW A;  249L A;  4I7O A;  1LYG A;  1T6V L;  4H90 A;  247L A;  3HH3 A;  3J6K A;  1KIP C;  1IWT A;  1G0Q A;  208L A;  4EOF A;  1VAU A;  1LMA A;  1A2Y C;  3C7W A;  3HTG A;  175L A;  1L58 A;  1L69 A;  1LZN A;  206L A;  1D9W A;  5B05 A;  4HV1 A;  6LZM A;  1CX6 A;  1SQ2 L;  3W6B A;  5C6I A;  5HNC A;  1L14 A;  2ZYP A;  115L A;  1GFV A;  4N1C C;  4HPE A;  4I7S A;  4PRQ A;  2RB1 X;  3AZ7 A;  1WQP A;  1HSX A;  3HFM Y;  5APF A;  4G49 A;  1LYF A;  2EKS C;  2ZQ4 A;  4XEN A;  3CSR A;  1P3N A;  3V2Y A;  1L68 A;  1D3F A;  107L A;  1QTC A;  1FLY A;  4H9F A;  2DQD Y;  4QEQ A;  1L28 A;  1IWX A;  1P2L A;  258L A;  147L A;  1C6N A;  3AGH A;  3W6D A;  127L A;  1KXY A;  4IAP A;  1CU5 A;  4H9E A;  4H9A A;  5B1F A;  4DDB A;  3B0I A;  3ZVQ B;  1L89 A;  4WM3 A;  3C8R A;  3C7Z A;  1L92 A;  1GBW A;  1UIG A;  1LHH A;  1W6Z A;  1JTO L;  4DD2 A;  3C8Q A;  1GXV 2;  2RB0 X;  1JUG A;  3CT1 A;  5DLA A;  1LJH A;  4NG1 A;  4C3W A;  194L A;  1L64 A;  139L A;  3F9L A;  1L0K A;  2OEA X;  2YBM A;  5II3 A;  1OUE A;  1WVV A;  1XGQ C;  2DKV A;  5L9J A;  4J7V A;  4XJB A;  1LJF A;  1L48 A;  4WM2 A;  1YKZ X;  212L A;  4K5Y A;  1UC0 A;  1GE1 A;  1BB6 A;  2BQB A;  5F9X A;  4OWH A;  1G0L A;  2LYZ A;  3N9A A;  2F4A A;  4ET8 A;  2YSS C;  4H8Y A;  1D9U A;  3G3B B;  1CU2 A;  1OUF A;  1IR8 A;  1IC4 Y;  1DYF A;  1FKQ A;  4ANR A;  1LSM A;  1J1X Y;  1OUJ A;  1L66 A;  3D3D A;  3WVY A;  3HDF A;  2OTZ X;  1OP9 B;  229L A;  4WM6 A;  5JEN B;  1QT7 A;  1IP2 A;  201L A;  1TCY A;  1EQE A;  4N0J A;  2XBS A;  5KXP A;  5HQ1 A;  1C62 A;  4YM8 A;  1LJ3 A;  3EMS A;  4LGK A;  1B5U A;  1IR7 A;  2OE9 X;  3AGG G;  1LZ6 A;  1L29 A;  2HU3 A;  2PYL A;  1HML A;  3RZE A;  3HH5 A;  5LVI A;  4X3B A;  132L A;  211L A;  1CV6 A;  4W58 A;  2W1X A;  1CKC A;  1CU6 A;  4BAP A;  5LXW A;  3FI7 A;  1JJ1 A;  2DQI Y;  1L77 A;  4PGJ B;  5J7C A;  2BQJ A;  5LVK A;  2YDG A;  3LZM A;  1LSZ A;  2Y8P A;  129L A;  2EQL A;  1C6F A;  1DYE A;  3IWR A;  1L88 A;  1LSY A;  2I26 L;  1REY A;  1L33 A;  2LZ2 A;  2BQH A;  1IWU A;  1GWD A;  5T3F A;  1VED A;  4YOP A;  1KNI A;  5HNL A;  1C6L A;  1HEP A;  1D3J A;  3WU7 A;  4DQJ A;  2HTX A;  4OOT A;  4UWU A;  1L45 A;  4W57 A;  232L A;  1D3M A;  4RLM A;  2PZS A;  164L A;  3AZ5 A;  2IHL A;  1LZ5 A;  2Z12 A;  1V7S A;  4EKQ A;  1L27 A;  4NGZ A;  1ZMY L;  1LSN A;  2QB0 B;  4EXM A;  1YIK A;  1GFJ A;  4WM5 A;  4YX7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...