3FI7A

Crystal structure of the autolysin auto (lmo1076) from listeria monocytogenes, catalytic domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
177
structure length
177
Chain Sequence
b'EPVFSLEQNRDDAMAALASTPTFQQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGKAPNYNLFGIKGSYNGKSVTMKTWEYSDSKGWYQINANFAKYPSHKESLEDNAKKLRNGPSWDSSYYKGAWRENAKTYKDATAWLQGRYATDNTYASKLNTLISSYNLTQYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1076 protein
publication title Structural basis for autoinhibition and activation of Auto, a virulence-associated peptidoglycan hydrolase of Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Hydrolase
total genus 60
structure length 177
sequence length 177
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01832 Glucosaminidase Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3fi7A01
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 3fi7A02
1LSEA 4NSJA 4NFVA 5LA5A 3B0IA 4OWAA 1IWVA 3WH1A 3WL2A 4YF2A 3RT5X 1CJ8A 1I20A 2DQJY 2EIZC 3AGGG 2X0AA 1IC4Y 1TDYA 1TAYA 2DQFC 2DQIY 4HPIA 5LYMA 1GPQC 2W1LA 4G4CA 1XHXA 1JJ1A 4PHIA 2DQAA 3D9AC 2ZIKA 5F16A 4DWXA 1B5VA 1IR7A 1FLQA 3LHMA 2BQEA 3WPJA 4MR1A 3WPKA 4BAFA 1JIYA 3N9CA 193LA 1YIKA 1IR8A 1BGIA 1YAPA 4GLAA 3N9EA 1LMQA 154LA 3RNXA 4HJZA 2Z19A 2MEGA 1GHLA 4OW1A 1KIQC 4UWVA 1YAMA 4AGAA 1QIOA 1ZVHL 4NHQA 1IP4A 2MEBA 3FE0A 5KXMA 3J4GA 1GEVA 4WO6A 3QE8A 1FDLY 1JPOA 1UIAA 1UIBA 2ZQ3A 1G7HC 4FJRA 1SQ2L 1CKHA 1LZDA 2Y8PA 135LA 2ZQ4A 4DDAA 1RFPA 1WQOA 1EQEA 3IWRA 1GE2A 2D4IA 4PRQA 1C45A 5B1GA 2G4QA 1LJGA 4N9RA 3W3EA 2BQDA 1IOCA 1NKHA 5B05A 2PW9A 2YBMA 1DI4A 1OUGA 3WUNA 2CGIA 3A95A 2FYCA 5KY1A 1JTOL 1H6MA 1DPWA 1B5UA 1JKDA 4ETAA 2ZIJA 2HU3A 4WO9A 4DD0A 4H8YA 4DD1A 5I53A 1DZBX 1A2YC 1LYOA 3TXGA 1HSWA 4YOPA 4QY9A 3EMSA 5JENB 1FLWA 2BQGA 1D0MA 1FKVA 1HHLA 4LT0A 1JKAA 3W6EA 1KXYA 1LSGA 4N0JA 1GF8A 1GFGA 4BAPA 1WVUA 2MEDA 1GAYA 2BAAA 4H9IA 1JUGA 2WARA 2Z39A 5HMJA 4GCBA 5IDDA 2BQFA 1GDWA 2ZWBA 5FELA 5KXZA 4B49A 1HMKA 5C6LA 2HEFA 1C08C 4E3UA 5KJ9A 1BQLY 3OK0A 3TXKA 1JWRA 2HUBA 4ETDA 2BQOA 1F0WA 1HERA 4NHPA 2DQCY 3WU8A 1LHJA 1J1XY 2BQIA 2DQGY 3EO5A 2BQCA 4HJVA 3HBDA 1IOQA 2H9JA 3M3UA 3P66A 4CGEA 1XEIA 4NHIA 1HNLA 5FDJA 3SP3A 5F81A 4OWCA 1CJ9A 1BWIA 1QDRA 2BLXA 4H91A 1QUTA 133LA 4ZFPA 4ETBA 5K7OA 1LHKA 4TX7A 4NHTA 4WLXA 3TMWA 1QSWA 2MEFA 4MCKA 2C8OA 3CT5A 1LZRA 4OWEA 1VDTA 1KIPC 4G4BA 2CWIA 2PYLA 2YBIA 1HMLA 3A67Y 1HF4A 5B59A 2EX3A 1IR9A 3W6CA 5HNLA 1GB8A 3TXBA 3A6CY 1JSFA 1IC7Y 3P4ZA 1LZBA 4XENA 1AZFA 1LJKA 1DI5A 4QGZA 1BB4A 1VEDA 1UCOA 4H90A 5LAGA 2Z2EA 1LSNA 1WQRA 1BVXA 5ILFA 2D4KA 1WTNA 5LA8A 1LSDA 3P65A 2G4NA 1IIZA 1YROA 1XGTC 1LJNA 2PC2A 5DLAA 4YEMA 1GFRA 3AJNA 4PJ2C 6LYTA 3AGIA 3CSZA 3WXTA 1N4FA 1XGUC 4DD7A 2DBTA 1ZMYL 1B0DA 2F4AA 4DD9A 1LZAA 9LYZA 1B5XA 4G4HA 1LCNA 1FLYA 1OUJA 1GE1A 2MEEA 4OOOA 1GD6A 4AXTA 1BWHA 1G7MC 4GN4A 4BADA 1TCYA 5KXKA 1GXXA 1LKRA 3P64A 3P68A 5KXWA 1VATA 3MGWA 5LIOA 1UIDA 2HEBA 1LZ4A 1EQ5A 4PGJB 3A91A 2ZNWY 1IX0A 1LYSA 3QY4A 3TXJA 1LMOA 1GF5A 5APDA 2W1MA 3B6LA 2I6ZA 4OOTA 1XGRC 5L3HA 1LHLA 1NBYC 1B7QA 3AZ5A 4DD2A 1D6PA 1IP5A 3OJPA 2ZILA 4H9AA 5IELA 4M6DA 4WG1A 1REMA 1JITA 2BQBA 1VDSA 2DQEY 4G9SA 4H8ZA 2YBNA 1UIFA 4RDSA 4J1BA 2YSSC 1XFPL 4N5RA 5KXLA 1WQNA 3ATOA 4R0FA 1LKSA 5LXWA 5HLLA 1SLYA 3A94A 4ETEA 1OUAA 1PZYA 1NQIA 1B7PA 4NEBA 3CSQA 1OUEA 2GV0A 4WG7A 4KPMA 3GXKA 1ALCA 1LJ3A 1LJJA 4KXIA 1GF4A 4M4OA 4H92A 1BVKC 4UWUA 1XI1A 1LJHA 3A93A 4H9CA 1IOTA 1UUZC 1JEFA 1B7LA 2CJLA 5F14A 4U3XB 3GXRA 1WTMA 1NF5A 1LJ4A 2EPEA 153LA 2BQJA 1QQYA 1FLUA 3AB6A 1NWGA 3D3DA 4IATA 4WM4A 5DN5A 4XJDA 4NWEA 1B5WA 2C8PA 2ZYCA 4C5FA 4H8XA 3HFMY 1LOZA 3AGHA 5B1FA 2D4JA 5KXOA 1B7MA 1G7LC 1LHIA 1DKKA 1ZV5L 3E3DA 4FDYA 4NGIA 2YDGA 1CKGA 1H87A 4ZIXA 5LAFA 5I4WA 1IP2A 2LZ2A 4TUNA 4LT1A 4XADA 4NGYA 1QTEA 2B5ZA 1GF3A 3WU9A 4G49A 134LA 5AMYA 3AZ6A 4ML7A 1DQJC 1HEOA 1BB3A 4KL7A 4RW1A 1LSFA 1YAQA 5B07A 1DKJA 1GFKA 1LZNA 1REXA 2YVBA 2BQAA 2YBHA 2BPUA 1B5YA 3A92A 1LZSA 4B1AA 1GBSA 3M18B 3CQLA 5LVGA 2W1YA 5KXNA 1HENA 2LZTA 4EOFA 1GF6A 3WU7A 4W96A 1G7IC 1LTMA 2D91A 2HEEA 1IO5A 4B4EA 5J7CA 1J1PY 1CJ7A 3ZVQA 2F2NA 4NGWA 1GE3A 2N5ZA 5A3EA 3FI7A 5LINA 4I0CA 4ETCA 5APCA 3AZ4A 4H93A 1AT6A 3WW6A 4GCCA 1MLCE 1B7RA 1JISA 1V7TA 2G4PA 1YL1X 3ULRA 2BQKA 3RZ4A 4WM6A 5KXYA 2MEAA 1GBWA 1YKXX 4R6CA 4B4JA 1LPIA 3K3TA 4CFPA 1HEMA 1LMPA 1T3PA 3CT0A 1A4VA 4NIJA 1DPXA 4WOAA 1LJIA 2A7DA 4TSCA 5D5FA 3WULA 4BS7A 2AUBA 132LA 4GCEA 1IEEA 1NBZC 1LSBA 3W6FA 1LZ5A 1XGPC 208LA 3TXEA 1JTPL 4PPOA 3CB7A 4OWHA 4J7VA 4P2EA 1IP6A 1Z55A 3AZ7A 1LZ8A 3A90A 1RCMA 1D0LA 1HC0A 4OWBA 4XJIA 5IHGA 3TXDA 5C6JA 1GFJA 4B4IA 1YKYX 1I1ZA 1QDTA 1HEQA 1NDMC 1IWUA 4DDCA 1BB7A 4O34A 3ZVQB 1LZ9A 1WQQA 3B0KA 5LYZA 3LN2A 1LSYA 3T6UA 1UIHA 2FYDA 1QUSA 1GFVA 1EL1A 1LZCA 1UIEA 2PZSA 1JTTL 2EKSC 1UA6Y 3BKHA 5APFA 3LYZA 2F4GA 1GXV2 1JJ3A 2BQLA 3W6BA 3QNGA 2F30A 1UIGA 1GBOA 1RJCB 4WMGA 1GE4A 3TMXA 2ZNXY 4WM2A 5I4XA 5II3A 1IWZA 194LA 1OUCA 3EBAB 1F10A 2MECA 1GB9A 1GB0A 1NDGC 3J6KA 1FN5A 4HSFA 1HSXA 1HFXA 1QTKA 1LJFA 4LYBA 5T3FA 5KXRA 4HV1A 1JJ0A 4A7DA 5L3IA 5DM9A 5F9UA 1AKIA 1BWJA 1KXWA 1CJ6A 4LGKA 3WMKA 1AM7A 4H9BA 5LVIA 3LZ2A 1XSFA 1OUIA 4ZEEA 1VAUA 4CHXA 4N8ZA 1LZGA 4Z98A 5KXTA 2PYJA 1LMNA 2XJWA 1HFZA 1IORA 1GB6A 2EQLA 4NGVA 3WYHA 2PY5A 4NWHA 3B0OA 2Z37A 1DI3A 4NGOA 2DQHY 2D6BA 1C46A 1LSPA 3LZTA 4NY5A 5B06A 1YQVY 1LMTA 3G3BB 3TMVA 5HNCA 1UC0A 2XTHA 4YEOA 1LHMA 1XEJA 2YBJA 4GN5C 5FCPA 4RLMA 1IP3A 2BQHA 2Q0MX 4IJ4A 4CJ2A 4II8A 3EXDA 2MEIA 1FBIX 1PS5A 5DN4A 5APEA 4DT3A 4H9HA 1CNSA 1XHZA 1GFTA 1GBXA 1DXJA 1F6SA 5KXSA 1HFYA 3TXIA 4ANRA 2R7FA 5L9JA 2VB1A 4HV2A 4HTNA 4DD3A 1LZEA 3F6ZA 4LYZA 1EQ4A 3IJUA 4QEQA 4RW2A 4ET8A 4XJHA 4GCDA 1W08A 3A3RX 1BB6A 4C3WA 1IY4A 4H9FA 1BHZA 1GB5A 4MSTA 5I54A 5LVKA 4HJYA 4DYGA 1FKQA 1OUDA 1LSZA 3T36A 1GB2A 1REYA 1GBZA 4XJBA 4XN6A 1OP9B 2LYOA 3A34A 1B7OA 4TTDA 4ET9A 1V7SA 4LYCA 1CKCA 3WW5A 1P2CC 1LZYA 1YL0X 3A6BY 1B9OA 1IWWA 4H9EA 1IC5Y 4WLDA 2HECA 1KXXA 4KT3A 2RSCA 1IWTA 1IWYA 5I5QA 1LMAA 5HMVA 4WLTA 4WL7A 3WVXA 4LYOA 5C6IA 1GF7A 1I56A 1GFUA 2LYMA 4WM5A 2CDSA 2FBBA 1D0KA 4GCFA 4NG8A 4QDNA 1YAOA 5E4PA 1D6QA 1JKBA 1LZ6A 1REZA 3WPLA 2IFFY 4B0DA 1GEZA 5FHWA 3LYMA 4GN3A 4XYYA 4IASA 1LYZA 2HU1A 1CKDA 5EBHA 3IJVA 4NGJA 207LA 2A7FA 1WQMA 1YILA 3WXUA 5LVJA 1GFEA 1OUFA 2HEDA 4NGKA 2Z12A 5HQ1A 1E8LA 3RU5A 2W1XA 4H94A 4HTKA 4TSBA 4J0LA 5FSTA 5DL9A 4DC4A 4Z46A 4LT3A 2Z2FA 4NGLA 1RI8B 5I4YA 1LZTA 2DKVA 3AW7A 4HPEA 1LHHA 2YBLA 4HTQA 3A3QA 1B5ZA 3G3AB 5E9RA 1D9UA 4Z41A 1TEWA 1J1OY 1B7SA 2XBRA 1GFAA 2IHLA 1LSAA 1GDXA 1GAZA 1LMCA 1IP7A 1WVVA 4YENA 4D9ZA 1XEKA 1GF9A 3ATNA 4NSGA 4LYMA 1LSCA 1UACY 1IY3A 1JSEA 3AYQA 4XJFA 1WQPA 2HEAA 4NHSA 4WM3A 1QSAA 4NGZA 1C43A 1UICA 3W6AA 4WLYA 2NWDX 3LYTA 4WL6A 3WUMA 5A3ZA 6LYZA 2ZYPA 1W6ZA 1LYYA 3B72A 1OQMA 2DQDY 3CT1A 4XJGA 5KXPA 5LVHA 4I8SA 1GB3A 3HBEX 2BQMA 1GE0A 1NHEA 4PRUA 3LYOA 3KAMA 4X3BA 4DDBA 4N1CC 2XBSA 1JKCA 2HTXA 2I25L 1GFHA 2LHMA 1T6VL 4H1PA 4NG1A 2H5ZA 5KKIA 4WM1A 4L41A 3TMUA 2BLYA 2H9KA 2BQNA 4LT2A 4NSIA 1RE2A 3VWOA 1VFBC 1VDQA 5KXXA 1LJEA 1YKZX 3AW6A 4GLVA 4LZTA 2I26L 7LYZA 4HP0A 3A8ZA 3WVYA 1OUBA 2MEHA 5M1YA 1UBZA 1OUHA 3W6DA 3TXHA 1JHLA 1ZVYB 4NSHA 4W94A 3RW8A 4Z3MA 1IP1A 1B7NA 1XGQC 3A96A 3BKVA 4N1EI 1MELL 1INUA 1YANA 4CFOA 1O23A 1HEWA 1GB7A 3TXFA 1GWDA 1LSMA 1LAAA 1B2KA 4RLNA 1GF0A 5F9XA 5LYTA 1TBYA 4LFPA 5D5CA 1KIRC 1IOSA 4J1AA 1G7JC 1LZ1A 1IVMA 4EMNA 1F6RA 2Z38A 1VDPA 1IWXA 1C10A 8LYZA 5KKJA 1BB5A 1GBYA 1HEPA 2Z18A 1AT5A 3N9AA 3WUAA 4YM8A 3HBHA 5FEKA 1C7PA 1HELA 1NMMA 2LYZA 4TWSA 4UWNA 3ZEKA 5ILCA 4LYTA 2FBDA 4LFXA 3CSRA 1CKFA
chains in the Genus database with same CATH superfamily
1G0JA 3AGGG 2X0AA 147LA 2DQIY 4HPIA 1GPQC 2W1LA 1XHXA 1L03A 1JJ1A 3C80A 3D9AC 5F16A 1IR7A 1FLQA 3LHMA 2RH1A 1JIYA 3N9CA 193LA 1D3MA 1BGIA 1YAPA 1LMQA 4HJZA 2Z19A 3DKEX 4OW1A 1LW9A 1KNIA 3LZMA 1P46A 4WO6A 3QE8A 1UIBA 4DDAA 3QAKA 3IWRA 1L91A 1OVJA 118LA 1IOCA 3DN4A 1L46A 4WO9A 140LA 4DD1A 1RHI4 1L80A 4YTNA 3TXGA 1L97A 1HSWA 1VBA4 4YOPA 2BQGA 1D0MA 1FKVA 1HHLA 4LT0A 1L35A 1JKAA 1GFGA 2MEDA 112LA 1C6LA 4H9IA 5C6LA 2BQFA 1GDWA 162LA 4ETDA 1F0WA 2DQGY 1QS5A 4CGEA 1HNLA 1CVKA 3GUPA 3HTBA 1G1WA 3HTGA 2BLXA 4H91A 1QUTA 1PVC4 157LA 4WLXA 4MCKA 2C8OA 1LZRA 1L71A 2PYLA 3P4PA 1IR9A 238LA 1JSFA 1IC7Y 3P4ZA 1BB4A 1VEDA 1UCOA 178LA 1L01A 1WQRA 3HH6A 1LSDA 1QUOA 4YEMA 3AGIA 3CSZA 4DD7A 1L30A 2DBTA 4DD9A 1LZAA 4OOOA 4AXTA 1BWHA 2RB1X 4BADA 2NTGA 1GXXA 2F32A 5KXWA 1L14A 1EQ5A 225LA 4PGJB 2ZNWY 1AR94 1GF5A 5APDA 1C6BA 2W1MA 2I6ZA 1NBYC 3AZ5A 1R094 1L26A 1VRH4 1D3JA 1REMA 1JITA 2BQBA 2DQEY 4G9SA 2F2QA 3L2XA 240LA 1WQNA 4R0FA 5LXWA 4ETEA 1PZYA 1OUEA 2GV0A 4KPMA 2OE4X 4PJZA 1LJJA 4KXIA 3CDTA 254LA 1IOTA 1L36A 228LA 2CJLA 2H89A 1WTMA 1CU3A 1NF5A 1LJ4A 4WM4A 3DN0A 1B5WA 1LOZA 1G7LC 4FDYA 1H87A 137LA 1L83A 113LA 4KL7A 4RW1A 1RUC4 1LSFA 181LA 1YAQA 1DKJA 2RBSA 2YVBA 2BQAA 2BPUA 2HWB4 1LZSA 1XJTA 3M18B 3GUIA 1L33A 1HENA 1GF6A 1VBE4 1CJ7A 3ZVQA 2F2NA 241LA 3C7WA 3FI7A 259LA 5APCA 1SSWA 1C6EA 102LA 1B7RA 1YL1X 3ULRA 3RZ4A 1LYDA 4R6CA 4B4JA 1LPIA 3K3TA 4ARMB 1C61A 4CFPA 1HEMA 1L34A 3SBAA 4WOAA 4ARLA 2AUBA 1NBZC 3W6FA 1LSBA 4OWHA 4J7VA 1C6AA 1Z55A 3AZ7A 2OTZX 3A90A 1D0LA 1CV4A 4YSZA 1XEPA 4OWBA 5C6JA 131LA 1QDTA 1KFYA 1RUJ4 1L57A 4O34A 218LA 3ZVQB 1LZ9A 250LA 3ABVA 5LYZA 1LSYA 1UA6Y 2OE9X 4Q4Y4 3W6BA 1LI3A 2F30A 219LA 1SSYA 1SX2A 3JR6A 1SWZA 1NDGC 1L79A 3J6KA 1RUE4 4LYBA 1L74A 120LA 4A7DA 1CJ6A 1AM7A 1XSFA 2H88A 4CHXA 1LMNA 222LA 1L82A 1JQUA 2D6BA 1KW5A 5HNCA 2YBJA 4RLMA 4PDWD 1IP3A 2MEIA 1L59A 5DN4A 1CNSA 4ZPUA 4DAJA 5I14A 1DXJA 4ANRA 2VB1A 1C6QA 1KY1A 1L47A 4LYZA 4QEQA 3HDFA 239LA 1W08A 3A3RX 1BB6A 3HU8A 175LA 188LA 5LVKA 4HJYA 3AE6A 1OUDA 3T36A 107LA 4XJBA 4XN6A 2F47A 261LA 1B7OA 4TTDA 161LA 1B9OA 169LA 4LZMA 4GBRB 5I5QA 3WVXA 4LYOA 3HTDA 1GF7A 1GFUA 2LYMA 3SB9A 2CDSA 5ILCA 1D0KA 4NG8A 4QDNA 1LZ6A 1L51A 211LA 1C69A 4GN3A 4XYYA 4YTPA 229LA 1BEV4 3IJVA 249LA 231LA 1L53A 2B6XA 3WXUA 1E8LA 1OUFA 2HEDA 4H94A 1PQDA 5DL9A 166LA 2Z2FA 4NGLA 244LA 170LA 1NEKA 3AW7A 4HPEA 1LHHA 3G3AB 4Z41A 1TEWA 3G3VA 108LA 1GFAA 114LA 2A4TA 1LMCA 1IP7A 1XEKA 1GF9A 4NSGA 4LYMA 1L04A 3EMLA 1RUD4 3AYQA 4WM3A 4NGZA 1UICA 4WLYA 1CV0A 1QT5A 1L13A 1OQMA 3CT1A 5KXPA 5LVHA 4DQJA 3HBEX 3LYOA 2ANVA 3KAMA 4N1CC 2XBSA 1JKCA 1GFHA 1L92A 2LHMA 4NG1A 2B6ZA 5KKIA 1T8FA 2H9KA 4NSIA 1QSBA 1RE2A 1L20A 1LJEA 1L41A 247LA 2MEHA 3W6DA 1ZVYB 4W94A 3BKVA 4CFOA 1HEWA 115LA 1KIRC 1EAH4 1IVMA 1F6RA 1C68A 3HUQA 1CUPA 2Z18A 126LA 3WUAA 4YM8A 5FEKA 1KY0A 2LYZA 4EKRA 1H8TD 4LYTA 3B0IA 4OWAA 1IWVA 4YF2A 2DQJY 2EIZC 4EXMA 1IC4Y 1TDYA 2RBRA 1LI6A 1CTWA 154LA 4GLAA 3RNXA 142LA 1CV5A 2MEGA 151LA 1GHLA 4UWVA 4AGAA 159LA 2OU0X 1G06A 1IP4A 2MEBA 3J4GA 1FDLY 1UIAA 1G7HC 4FJRA 1SQ2L 2ZQ4A 4W56A 1L70A 1GE2A 226LA 1DYFA 3AEFA 2BQDA 1NKHA 2YBMA 1COV4 3HTFA 2FYCA 5KY1A 1H6MA 2RM24 4ETAA 2ZIJA 2HU3A 3DN8A 4H8YA 5I53A 1DZBX 216LA 2HWC4 1LPYA 3EMSA 3GUJA 1KXYA 143LA 1WVUA 109LA 130LA 1GAYA 2BAAA 5IDDA 5HMJA 5KXZA 191LA 1L95A 242LA 1AR64 2HUBA 1HERA 4NHPA 1LYJA 3EO5A 1L64A 1IOQA 1L88A 3P66A 3OE8A 3UONA 4OWCA 1QDRA 133LA 230LA 5K7OA 4TX7A 1LWGA 1QSWA 4OWEA 1KIPC 4G4BA 2CWIA 3A67Y 3TXBA 1LZBA 1AZFA 1LJKA 3CIRA 4H90A 5LAGA 158LA 182LA 5ILFA 1L84A 1WTNA 2D4KA 5LA8A 1IIZA 1LJNA 1L17A 2PC2A 3OE6A 3AJNA 1P37A 6LYTA 1YQ4A 4DKLA 1N4FA 3SBBC 1PO14 4YSXA 9LYZA 1OV5A 168LA 1L54A 4GN4A 4I7LA 3P64A 3P68A 4EKSA 3MGWA 5LIOA 4I7QA 149LA 3TXJA 1DYAA 1L90A 3B6LA 1C6CA 1XGRC 1B7QA 4DD2A 1D6PA 2OTYX 3OJPA 4H9AA 5IELA 1VDSA 2L78A 4RDSA 5KXLA 3ATOA 1LKSA 5HLLA 1SLYA 1RVF4 2OU8A 1B7PA 2B73A 1L22A 2PLV4 3AE3A 3SFDA 1GF4A 4M4OA 4UWUA 2RS54 4I7MA 3DMZA 160LA 2EPEA 1QTCA 3AB6A 2B6TA 198LA 1L85A 4NWEA 1DYGA 2ZYCA 4H8XA 1C66A 3HFMY 4YXAC 5B1FA 3HUAA 1DKKA 1VBC4 2YDGA 1CKGA 1L49A 1L66A 2B7XA 4NGYA 3HDEA 1LYFA 4W58A 1GF3A 3WU9A 4G49A 1G0QA 3AZ6A 4ML7A 1DQJC 1BB3A 1C6MA 1C6JA 2OEAX 1R084 1GFKA 3C8SA 221LA 4I7RA 1MQTD 233LA 2W1YA 3CDRA 2LZTA 1L77A 4EOFA 212LA 4W96A 201LA 1J1PY 217LA 1GE3A 3GUNA 4I0CA 5C2TA 1C6IA 1L72A 3AZ4A 4H93A 245LA 2RBQA 4GCCA 185LA 2G4PA 1ZP0A 2BQKA 4IAPA 4WM6A 1L24A 5KXYA 1A4VA 1QTDA 1L60A 1DPXA 2A7DA 1WTHA 127LA 132LA 4GCEA 1D2WA 1LZ5A 3TXEA 1JTPL 1L0VA 4P2EA 3V2YA 1C6GA 1IP6A 2RS34 2HUKA 1RCMA 1G1VA 3VRAA 4XJIA 1C67A 1NDMC 1BB7A 3B0KA 3LN2A 1UIHA 1QUSA 2O79A 1EL1A 1LZCA 1JTTL 1GXV2 1JJ3A 3QNGA 1GBOA 163LA 3TMXA 4W54A 5II3A 1T6HA 2MECA 3VR8A 1L05A 1HSXA 1HFXA 1QTKA 5T3FA 5KXRA 5L3IA 1BWJA 1KXWA 3HT6A 3LZ2A 4ZEEA 164LA 4Z98A 3SB7A 3WYHA 1L06A 4NWHA 3B0OA 1DI3A 1L68A 220LA 1C46A 2LC9A 4NY5A 5B06A 3TMVA 1YQVY 1LMTA 3G3BB 1LHMA 5FCPA 4GN5C 2Q0MX 4EPIA 3EXDA 1QUDA 2RB2X 1L40A 4DJHA 1OYUA 1L15A 4HTNA 1LZEA 184LA 1G0KA 1L86A 1L38A 2HUMA 4ARMA 1IY4A 4MSTA 4DYGA 3AEAA 1FKQA 125LA 1CKCA 1L25A 1IC5Y 3AE9A 4S0WA 2HECA 1C6KA 195LA 1LMAA 1I56A 1REZA 4B0DA 3HH5A 1GEZA 5FHWA 122LA 1LYZA 2HU1A 4NGJA 2A7FA 1CV3A 5LVJA 1GFEA 3HWLA 3FA0A 4TSBA 4Z46A 5I4YA 145LA 4LT3A 1RI8B 1L29A 3C83A 1C63A 4HTQA 3A3QA 2O7AA 3AEEA 1OOPD 1D9UA 1J1OY 3AE5A 3C7ZA 1L87A 1QT3A 1OWZA 2IHLA 110LA 1GDXA 4D9ZA 3ATNA 1AL24 1LSCA 1IY3A 1QSAA 1C43A 103LA 2NWDX 2QARC 1LYYA 3HT9A 4I8SA 1C60A 4X3BA 2I25L 1LGWA 1CX6A 171LA 4OO9A 3AW6A 7LYZA 4HP0A 1OUHA 197LA 1JHLA 156LA 4NSHA 4Z3MA 3AEDA 3SUCA 1XGQC 4N1EI 3VRBA 1MELL 1GB7A 3TXFA 1B2KA 4RLNA 5LYTA 236LA 129LA 1IOSA 2RAYX 1G7JC 1VDPA 1OV7A 1C10A 1BB5A 1QTBA 128LA 1AT5A 1NMMA 4TWSA 2QB0B 3CSRA 1CKFA 4NSJA 5LA5A 3WH1A 3RT5X 1CJ8A 1L50A 1I20A 1G07A 4LDOA 1TAYA 2DQFC 4G4CA 1LYGA 3DMVA 4PHIA 2DQAA 4DWXA 1B5VA 3WPKA 4BAFA 1C6HA 1LI2A 1KIQC 3GUOA 1KF6A 1QIOA 3FE0A 5KXMA 1GEVA 2WU2A 2ZQ3A 1CKHA 135LA 1RFPA 3P4SA 4PRQA 1C45A 1C65A 3W3EA 5B05A 2PW9A 1OUGA 3WUNA 3A95A 4YSYA 3NYAA 4DD0A 1AR84 2LZMA 1LYOA 1P2LA 5JENB 4QY9A 4RHV4 148LE 1FLWA 4W59A 3SB5A 3CDQA 2Q9EA 4N0JA 4BAPA 4DQ7A 256LA 2Z39A 2WARA 3DN2A 4GCBA 1L67A 4B49A 1L61A 3PBLA 1L93A 1HMKA 4E3UA 5KJ9A 1P56A 1LHJA 1J1XY 2BQIA 4HJVA 2H9JA 3M3UA 1XEIA 4NHIA 3GQHA 3C7YA 5F81A 1BWIA 123LA 2FBWA 4ZFPA 4ETBA 3CT5A 1VDTA 2RS14 210LA 2YBIA 1OVKA 2EX3A 1JTNA 4DQ5A 5HNLA 1GB8A 176LA 3HT7A 3A6CY 1PQOA 4XENA 1DI5A 192LA 1LSNA 1XJUA 1BVXA 3P65A 2G4NA 1YROA 1XGTC 5DLAA 1GFRA 3G3WA 1ZYTA 2F4AA 1ZMYL 1G7MC 2Q9DA 1L18A 5KXKA 1LKRA 3ODUA 1LZ4A 3A91A 200LA 1LYSA 1P3NA 1LHLA 1LLHA 1IP5A 2ZILA 4WG1A 1RUI4 1C6NA 4H8ZA 1UIFA 2YSSC 1SX7A 1HRI4 4N5RA 1HRV4 3CDOA 1D9WA 1PQJA 1L12A 1PQKA 1OUAA 1NQIA 1RUH4 4NEBA 3CSQA 4W53A 4WG7A 224LA 1ALCA 1POV0 1ZOYA 2RMU4 190LA 1BVKC 1XI1A 1LJHA 1G0PA 3A93A 4H9CA 4YXDA 1UUZC 1B7LA 4U3XB 3GXRA 1P64A 1NWGA 5APFA 3E3DA 2B76A 5LAFA 5I4WA 2LZ2A 4XADA 1K5MD 1NA1D 1QTEA 1AR74 134LA 1L56A 1C6PA 1LZNA 2LCBA 1B5YA 4B1AA 3GUKA 1GBSA 1DYBA 5LVGA 180LA 213LA 4ARQB 2D91A 4B4EA 5J7CA 1PO24 4NGWA 2R074 2N5ZA 1AT6A 1JISA 1V7TA 4LDLA 1QT8A 3AE8A 1L98A 3P4RA 2MEAA 1GBWA 186LA 3J8F4 1EPYA 1T3PA 4BS7A 1LJIA 4TSCA 5D5FA 3WULA 1EV14 1LYEA 1IEEA 1L16A 208LA 4PPOA 3CB7A 167LA 1LYHA 1NCQD 1CUQA 1I1ZA 1IWUA 4DDCA 119LA 3T6UA 2FYDA 3C8RA 1UIEA 2EKSC 3BKHA 196LA 2F4GA 4EJ4A 1I6SA 3SB6A 1P2RA 3G3XA 1GE4A 2CUUA 1IWZA 194LA 1OUCA 1FN5A 4HV1A 5DM9A 3WMKA 174LA 4H9BA 1L28A 1OUIA 150LA 1VAUA 1LZGA 1L55A 2XJWA 3AE4A 1HFZA 1IORA 2EQLA 4NGVA 2PY5A 1L65A 1L43A 4NGOA 144LA 3LZTA 1OVHA 2XTHA 1C6TA 2BQHA 4CJ2A 1ZURA 4I7JA 257LA 1FBIX 5APEA 1LWKA 1XHZA 4H9HA 243LA 214LA 1GBXA 1F6SA 4YTMA 1HFYA 3TXIA 4HV2A 3K2RA 3F6ZA 3IJUA 4RW2A 1L42A 4C3WA 1L99A 1PQIA 1BHZA 209LA 3FI5A 1LSZA 1GB2A 4I7SA 1LGUA 2LYOA 4ET9A 1V7SA 3WW5A 1P2CC 2B6WA 4WLDA 4KT3A 2X5ID 3VW7A 3SB8A 1IWTA 1QUGA 4WLTA 4WL7A 5C6IA 1G0GA 4WM5A 5E4PA 4GCFA 1YAOA 1JKBA 3OE0A 4IASA 1CKDA 235LA 207LA 1WQMA 1YILA 3HH3A 2Z12A 5HQ1A 260LA 1QSQA 141LA 3JBG4 2ACZA 4J0LA 4YXCA 1LZTA 1DYDA 138LA 3C81A 2YBLA 2WS3A 5E9RA 155LA 3AEBA 1L63A 4YENA 1NENA 1OWYA 1NHBA 1UACY 1L69A 4XJFA 1L89A 1WQPA 1L00A 262LA 3W6AA 3LYTA 6LYZA 4XJGA 3B72A 1L10A 1GB3A 1B6IA 4DDBA 1DYCA 1T6VL 1D3FA 4YX7C 1RMU4 4WM1A 1Z7S4 2BQNA 3VWOA 1YKZX 4GLVA 3SFEA 4LZTA 177LA 3A8ZA 3WVYA 5M1YA 3JD74 3RW8A 1IP1A 2O4WA 1C6FA 1INUA 1YANA 2RBOA 215LA 1GWDA 5F9XA 1GF0A 5D5CA 1RUG4 1P7SA 4EMNA 4GRVA 1L58A 1IWXA 8LYZA 3C8QA 1L09A 1L37A 1HEPA 253LA 3HBHA 1T97A 1L76A 1C7PA 1ASJ4 1HELA 3ZEKA 2FBDA 3DMXA 1LSEA 4NFVA 3WL2A 1L21A 2WQYA 5C3JA 173LA 5LYMA 3RZEA 2ZIKA 1P6YA 3WPJA 2BQEA 3AECA 4MR1A 1YIKA 1IR8A 1L0JA 3N9EA 1CU5A 1CU0A 4W57A 2WDRA 1YAMA 1ZVHL 4NHQA 2WP9A 172LA 1JPOA 2XQOA 2Y8PA 1LZDA 104LA 1WQOA 1EQEA 2D4IA 1VBB4 3HUKA 5B1GA 2G4QA 2OU9A 1LJGA 4N9RA 165LA 1DI4A 2CGIA 1JTOL 1DPWA 1B5UA 1JKDA 3FADA 1ZWNA 1A2YC 4K5YA 3W6EA 1LSGA 1GF8A 1L39A 1JUGA 4ET8A 252LA 2ZWBA 5FELA 2HEFA 1C08C 1BQLY 3OK0A 3TXKA 1JWRA 2BQOA 3WU8A 2DQCY 1L02A 1C62A 2BQCA 3HBDA 3NY8A 5FDJA 3SP3A 4Q4V4 1JTMA 1CJ9A 1G0LA 1LHKA 4NHTA 3TMWA 2MEFA 1QT7A 2HULA 4YT0A 3NY9A 1HMLA 1HF4A 5B59A 4EKQA 3W6CA 1CU6A 4QGZA 4E97A 2Z2EA 3VR9A 3HH4A 4I7NA 4PJ2C 3WXTA 187LA 1XGUC 3AEGA 1B0DA 1B5XA 1L19A 4G4HA 1YQ3A 1LCNA 1FLYA 1OUJA 1GE1A 2MEEA 1GD6A 1TCYA 1VATA 1D2YA 3F8VA 1UIDA 5LZMA 2HEBA 1IX0A 3QY4A 1LMOA 1L31A 5L3HA 4OOTA 2B72A 2NTHA 1L48A 4M6DA 251LA 1L23A 2B6YA 1T8GA 2YBNA 4J1BA 255LA 1XFPL 3C82A 1P36A 3A94A 3GXKA 1LJ3A 2R044 4H92A 3DNAA 1CV1A 3HT8A 4Q4X4 1JEFA 5F14A 153LA 2BQJA 1QQYA 1C6DA 246LA 1FLUA 223LA 3D3DA 4IATA 5DN5A 4XJDA 4EPFA 4C5FA 2C8PA 3AGHA 2D4JA 5KXOA 1B7MA 1LHIA 1ZV5L 4NGIA 4ZIXA 1CU2A 1IP2A 4TUNA 4LT1A 2B5ZA 1D3NA 5AMYA 1HEOA 5B07A 5LVIA 1L75A 1REXA 2YBHA 3A92A 3CQLA 5KXNA 3D4SA 232LA 3WU7A 1G7IC 1L44A 1LTMA 3L64A 152LA 2HEEA 1IO5A 4PK0A 4ARPA 1DYEA 2B70A 5A3EA 5LINA 4ETCA 2RR14 4W51A 2WU5A 2RAZX 3WW6A 1MLCE 2R064 146LA 1SWYA 1YKXX 1LMPA 3CT0A 4NIJA 4W55A 234LA 3OE9A 1XGPC 4I7TA 1L94A 1LZ8A 1L32A 3V2WA 1HC0A 5IHGA 3TXDA 1G0MA 1GFJA 4B4IA 3P4QA 1YKYX 1HEQA 111LA 1WQQA 6LZMA 1GFVA 2PZSA 3LYZA 2BQLA 1D4M4 1LYIA 1TLAA 1UIGA 1RJCB 1QT6A 4WMGA 2WDVA 205LA 2ZNXY 4WM2A 5I4XA 3EBAB 4Q4W4 1F10A 1GB9A 3GULA 1GB0A 2RBNA 183LA 4HSFA 1LJFA 3AE1A 1JJ0A 227LA 5F9UA 1AKIA 4LGKA 1PQMA 4N8ZA 5KXTA 2PYJA 4KX6A 1GB6A 2Z37A 1T8AA 1VBD4 2DQHY 1LSPA 4AQNA 1UC0A 4YEOA 1XEJA 4ARQA 4IJ4A 4II8A 1LGXA 1PS5A 1QTZA 4DT3A 4GB34 1GFTA 2RBPA 1L73A 5KXSA 199LA 2R7FA 5L9JA 258LA 2B74A 4DD3A 1EQ4A 4W52A 2RB0X 4XJHA 3DN1A 4GCDA 1CX7A 4H9FA 1GB5A 5I54A 1REYA 1GBZA 1OP9B 3A34A 3AE2A 1K28A 4LYCA 1LZYA 1YL0X 3A6BY 1IWWA 4H9EA 3HU9A 1L45A 2ANXA 1KXXA 2RSCA 1IWYA 5HMVA 2FBBA 1D6QA 3WPLA 2IFFY 3LYMA 1CV6A 4EKPA 1L81A 5EBHA 2B75A 2WDQA 189LA 4NGKA 139LA 3RU5A 2W1XA 4HTKA 3SN6R 5FSTA 4DC4A 4I7KA 1QT4A 2DKVA 2OE7X 1L96A 1B5ZA 1L11A 1B7SA 1L07A 4I7PA 2XBRA 2IGCA 1LSAA 1GAZA 1WVVA 248LA 1QTVA 1JSEA 3GQKA 1QUHA 2HEAA 7LZMA 4NHSA 3RUNA 1RUF4 1HXS4 3GUMA 4WL6A 3WUMA 5A3ZA 2ZYPA 1W6ZA 2DQDY 2BQMA 1GE0A 1PIV4 1NHEA 4PRUA 2Z6BA 2HTXA 4H1PA 1P5CA 2H5ZA 1L08A 3CDVA 4L41A 4LDEA 3TMUA 2BLYA 4LT2A 1VFBC 1VDQA 5KXXA 4ARJA 237LA 3DN6A 2I26L 3AE7A 1OUBA 1QTHA 1UBZA 3DN3A 3TXHA 1KW7A 1B7NA 3A96A 1O23A 3PDSA 4I7OA 1LSMA 1LAAA 1L52A 1TBYA 4LFPA 206LA 1L27A 4J1AA 1LZ1A 1KS3A 2Z38A 3F9LA 1L62A 5KKJA 1GBYA 3N9AA 1C64A 4UWNA 1QS9A 4LFXA 1L0KA
chains in the Genus database with same CATH topology
1G0JA 3AGGG 2X0AA 147LA 2DQIY 4HPIA 1GPQC 2W1LA 1XHXA 1L03A 1JJ1A 3C80A 3D9AC 5F16A 1IR7A 1FLQA 3LHMA 2RH1A 1JIYA 3N9CA 193LA 1D3MA 1BGIA 1YAPA 1LMQA 4HJZA 2Z19A 3DKEX 4OW1A 1LW9A 1KNIA 3LZMA 1P46A 4WO6A 3QE8A 1UIBA 4DDAA 3QAKA 3IWRA 1L91A 1OVJA 118LA 1IOCA 3DN4A 1L46A 4WO9A 140LA 4DD1A 1L80A 3TXGA 1L97A 1HSWA 4YOPA 2BQGA 1D0MA 1FKVA 1HHLA 4LT0A 1L35A 1JKAA 1GFGA 2MEDA 112LA 1C6LA 4H9IA 5C6LA 2BQFA 1GDWA 162LA 4ETDA 1F0WA 2DQGY 1QS5A 4CGEA 1HNLA 1CVKA 3GUPA 3HTBA 1G1WA 3HTGA 2BLXA 4H91A 1QUTA 157LA 4WLXA 4MCKA 2C8OA 1LZRA 1L71A 2PYLA 1IR9A 238LA 1JSFA 1IC7Y 3P4ZA 1BB4A 1VEDA 1UCOA 178LA 1L01A 1WQRA 3HH6A 1LSDA 1QUOA 4YEMA 3AGIA 3CSZA 4DD7A 1L30A 2DBTA 4DD9A 1LZAA 4OOOA 4AXTA 1BWHA 2RB1X 4BADA 2NTGA 1GXXA 2F32A 5KXWA 1L14A 1EQ5A 225LA 4PGJB 2ZNWY 1GF5A 5APDA 1C6BA 2W1MA 2I6ZA 1NBYC 3AZ5A 1L26A 1D3JA 1REMA 1JITA 2BQBA 2DQEY 4G9SA 2F2QA 3L2XA 240LA 1WQNA 4R0FA 5LXWA 4ETEA 1PZYA 1OUEA 2GV0A 4KPMA 2OE4X 4PJZA 1LJJA 4KXIA 3CDTA 254LA 1IOTA 1L36A 228LA 2CJLA 1WTMA 1CU3A 1NF5A 1LJ4A 4WM4A 3DN0A 1B5WA 1LOZA 1G7LC 4FDYA 1H87A 137LA 1L83A 113LA 4KL7A 4RW1A 1LSFA 181LA 1YAQA 1DKJA 2RBSA 2YVBA 2BQAA 2BPUA 1LZSA 1XJTA 3M18B 3GUIA 1L33A 1HENA 1GF6A 1CJ7A 3ZVQA 2F2NA 241LA 3C7WA 3FI7A 259LA 5APCA 1SSWA 1C6EA 102LA 1B7RA 1YL1X 3ULRA 3RZ4A 1LYDA 4R6CA 4B4JA 1LPIA 3K3TA 4ARMB 1C61A 4CFPA 1HEMA 1L34A 3SBAA 4WOAA 4ARLA 2AUBA 1NBZC 3W6FA 1LSBA 4OWHA 4J7VA 1C6AA 1Z55A 3AZ7A 2OTZX 3A90A 1D0LA 1CV4A 1XEPA 4OWBA 5C6JA 131LA 1QDTA 1L57A 4O34A 218LA 3ZVQB 1LZ9A 250LA 5LYZA 1LSYA 1UA6Y 2OE9X 3W6BA 1LI3A 2F30A 219LA 1SSYA 1SX2A 3JR6A 1SWZA 1NDGC 1L79A 3J6KA 4LYBA 1L74A 120LA 4A7DA 1CJ6A 1AM7A 1XSFA 4CHXA 1LMNA 222LA 1L82A 1JQUA 2D6BA 1KW5A 5HNCA 2YBJA 4RLMA 1IP3A 2MEIA 1L59A 5DN4A 1CNSA 4ZPUA 4DAJA 5I14A 1DXJA 4ANRA 2VB1A 1C6QA 1KY1A 1L47A 4LYZA 4QEQA 3HDFA 239LA 1W08A 3A3RX 1BB6A 3HU8A 175LA 188LA 5LVKA 4HJYA 1OUDA 3T36A 107LA 4XJBA 4XN6A 2F47A 261LA 1B7OA 4TTDA 161LA 1B9OA 169LA 4LZMA 4GBRB 5I5QA 3WVXA 4LYOA 3HTDA 1GF7A 1GFUA 2LYMA 3SB9A 2CDSA 5ILCA 1D0KA 4NG8A 4QDNA 1LZ6A 1L51A 211LA 1C69A 4GN3A 4XYYA 229LA 3IJVA 249LA 231LA 1L53A 2B6XA 3WXUA 1E8LA 1OUFA 2HEDA 4H94A 1PQDA 5DL9A 166LA 2Z2FA 4NGLA 244LA 170LA 3AW7A 4HPEA 1LHHA 3G3AB 4Z41A 1TEWA 3G3VA 108LA 1GFAA 114LA 2A4TA 1LMCA 1IP7A 1XEKA 1GF9A 4NSGA 4LYMA 1L04A 3EMLA 3AYQA 4WM3A 4NGZA 1UICA 4WLYA 1CV0A 1QT5A 1L13A 1OQMA 3CT1A 5KXPA 5LVHA 4DQJA 3HBEX 3LYOA 2ANVA 3KAMA 4N1CC 2XBSA 1JKCA 1GFHA 1L92A 2LHMA 4NG1A 2B6ZA 5KKIA 1T8FA 2H9KA 4NSIA 1QSBA 1RE2A 1L20A 1LJEA 1L41A 247LA 2MEHA 3W6DA 1ZVYB 4W94A 3BKVA 4CFOA 1HEWA 115LA 1KIRC 1IVMA 1F6RA 1C68A 3HUQA 1CUPA 2Z18A 126LA 3WUAA 4YM8A 5FEKA 1KY0A 2LYZA 4EKRA 4LYTA 3B0IA 4OWAA 1IWVA 4YF2A 2DQJY 2EIZC 4EXMA 1IC4Y 1TDYA 2RBRA 1LI6A 1CTWA 154LA 4GLAA 3RNXA 142LA 1CV5A 2MEGA 151LA 1GHLA 4UWVA 4AGAA 159LA 2OU0X 1G06A 1IP4A 2MEBA 3J4GA 1FDLY 1UIAA 1G7HC 4FJRA 1SQ2L 2ZQ4A 4W56A 1L70A 1GE2A 226LA 1DYFA 2BQDA 1NKHA 2YBMA 3HTFA 2FYCA 5KY1A 1H6MA 4ETAA 2ZIJA 2HU3A 3DN8A 4H8YA 5I53A 1DZBX 216LA 1LPYA 3EMSA 3GUJA 1KXYA 143LA 1WVUA 109LA 130LA 1GAYA 2BAAA 5IDDA 5HMJA 5KXZA 191LA 1L95A 242LA 2HUBA 1HERA 4NHPA 1LYJA 3EO5A 1L64A 1IOQA 1L88A 3P66A 3OE8A 3UONA 4OWCA 1QDRA 133LA 230LA 5K7OA 4TX7A 1LWGA 1QSWA 4OWEA 1KIPC 4G4BA 2CWIA 3A67Y 3TXBA 1LZBA 1AZFA 1LJKA 4H90A 5LAGA 158LA 182LA 5ILFA 1L84A 1WTNA 2D4KA 5LA8A 1IIZA 1LJNA 1L17A 2PC2A 3OE6A 3AJNA 1P37A 6LYTA 4DKLA 1N4FA 3SBBC 9LYZA 1OV5A 168LA 1L54A 4GN4A 4I7LA 3P64A 3P68A 4EKSA 3MGWA 5LIOA 4I7QA 149LA 3TXJA 1DYAA 1L90A 3B6LA 1C6CA 1XGRC 1B7QA 4DD2A 1D6PA 2OTYX 3OJPA 4H9AA 5IELA 1VDSA 2L78A 4RDSA 5KXLA 3ATOA 1LKSA 5HLLA 1SLYA 2OU8A 1B7PA 2B73A 1L22A 1GF4A 4M4OA 4UWUA 4I7MA 3DMZA 160LA 2EPEA 1QTCA 3AB6A 2B6TA 198LA 1L85A 4NWEA 1DYGA 2ZYCA 4H8XA 1C66A 3HFMY 4YXAC 5B1FA 3HUAA 1DKKA 2YDGA 1CKGA 1L49A 1L66A 2B7XA 4NGYA 3HDEA 1LYFA 4W58A 1GF3A 3WU9A 4G49A 1G0QA 3AZ6A 4ML7A 1DQJC 1BB3A 1C6MA 1C6JA 2OEAX 1GFKA 3C8SA 221LA 4I7RA 233LA 2W1YA 3CDRA 2LZTA 1L77A 4EOFA 212LA 4W96A 201LA 1J1PY 217LA 1GE3A 3GUNA 4I0CA 1C6IA 1L72A 3AZ4A 4H93A 245LA 2RBQA 4GCCA 185LA 2G4PA 2BQKA 4IAPA 4WM6A 1L24A 5KXYA 1A4VA 1QTDA 1L60A 1DPXA 2A7DA 1WTHA 127LA 132LA 4GCEA 1D2WA 1LZ5A 3TXEA 1JTPL 4P2EA 3V2YA 1C6GA 1IP6A 2HUKA 1RCMA 1G1VA 4XJIA 1C67A 1NDMC 1BB7A 3B0KA 3LN2A 1UIHA 1QUSA 2O79A 1EL1A 1LZCA 1JTTL 1GXV2 1JJ3A 3QNGA 1GBOA 163LA 3TMXA 4W54A 5II3A 1T6HA 2MECA 1L05A 1HSXA 1HFXA 1QTKA 5T3FA 5KXRA 5L3IA 1BWJA 1KXWA 3HT6A 3LZ2A 4ZEEA 164LA 4Z98A 3SB7A 3WYHA 1L06A 4NWHA 3B0OA 1DI3A 1L68A 220LA 1C46A 2LC9A 4NY5A 5B06A 3TMVA 1YQVY 1LMTA 3G3BB 1LHMA 5FCPA 4GN5C 2Q0MX 4EPIA 3EXDA 1QUDA 2RB2X 1L40A 4DJHA 1OYUA 1L15A 4HTNA 1LZEA 184LA 1G0KA 1L86A 1L38A 2HUMA 4ARMA 1IY4A 4MSTA 4DYGA 1FKQA 125LA 1CKCA 1L25A 1IC5Y 4S0WA 2HECA 1C6KA 195LA 1LMAA 1I56A 1REZA 4B0DA 3HH5A 1GEZA 5FHWA 122LA 1LYZA 2HU1A 4NGJA 2A7FA 1CV3A 5LVJA 1GFEA 3HWLA 3FA0A 4TSBA 4Z46A 5I4YA 145LA 4LT3A 1RI8B 1L29A 3C83A 1C63A 4HTQA 3A3QA 2O7AA 1D9UA 1J1OY 3C7ZA 1L87A 1QT3A 1OWZA 2IHLA 110LA 1GDXA 4D9ZA 3ATNA 1LSCA 1IY3A 1QSAA 1C43A 103LA 2NWDX 2QARC 1LYYA 3HT9A 4I8SA 1C60A 4X3BA 2I25L 1LGWA 1CX6A 171LA 4OO9A 3AW6A 7LYZA 4HP0A 1OUHA 197LA 1JHLA 156LA 4NSHA 4Z3MA 1XGQC 4N1EI 1MELL 1GB7A 3TXFA 1B2KA 4RLNA 5LYTA 236LA 129LA 1IOSA 2RAYX 1G7JC 1VDPA 1OV7A 1C10A 1BB5A 1QTBA 128LA 1AT5A 1NMMA 4TWSA 2QB0B 3CSRA 1CKFA 4NSJA 5LA5A 3WH1A 3RT5X 1CJ8A 1L50A 1I20A 1G07A 4LDOA 1TAYA 2DQFC 4G4CA 1LYGA 3DMVA 4PHIA 2DQAA 4DWXA 1B5VA 3WPKA 4BAFA 1C6HA 1LI2A 1KIQC 3GUOA 1QIOA 3FE0A 5KXMA 1GEVA 2ZQ3A 1CKHA 135LA 1RFPA 4PRQA 1C45A 1C65A 3W3EA 5B05A 2PW9A 1OUGA 3WUNA 3A95A 3NYAA 4DD0A 2LZMA 1LYOA 1P2LA 5JENB 4QY9A 148LE 1FLWA 4W59A 3SB5A 3CDQA 2Q9EA 4N0JA 4BAPA 4DQ7A 256LA 2Z39A 2WARA 3DN2A 4GCBA 1L67A 4B49A 1L61A 3PBLA 1L93A 1HMKA 4E3UA 5KJ9A 1P56A 1LHJA 1J1XY 2BQIA 4HJVA 2H9JA 3M3UA 1XEIA 4NHIA 3C7YA 5F81A 1BWIA 123LA 4ZFPA 4ETBA 3CT5A 1VDTA 210LA 2YBIA 1OVKA 2EX3A 1JTNA 4DQ5A 5HNLA 1GB8A 176LA 3HT7A 3A6CY 1PQOA 4XENA 1DI5A 192LA 1LSNA 1XJUA 1BVXA 3P65A 2G4NA 1YROA 1XGTC 5DLAA 1GFRA 3G3WA 1ZYTA 2F4AA 1ZMYL 1G7MC 2Q9DA 1L18A 5KXKA 1LKRA 3ODUA 1LZ4A 3A91A 200LA 1LYSA 1P3NA 1LHLA 1LLHA 1IP5A 2ZILA 4WG1A 1C6NA 4H8ZA 1UIFA 2YSSC 1SX7A 4N5RA 3CDOA 1D9WA 1PQJA 1L12A 1PQKA 1OUAA 1NQIA 4NEBA 3CSQA 4W53A 4WG7A 224LA 1ALCA 190LA 1BVKC 1XI1A 1LJHA 1G0PA 3A93A 4H9CA 1UUZC 1B7LA 4U3XB 3GXRA 1P64A 1NWGA 5APFA 3E3DA 5LAFA 5I4WA 2LZ2A 4XADA 1QTEA 134LA 1L56A 1C6PA 1LZNA 2LCBA 1B5YA 4B1AA 3GUKA 1GBSA 1DYBA 5LVGA 180LA 213LA 4ARQB 2D91A 4B4EA 5J7CA 4NGWA 2N5ZA 1AT6A 1JISA 1V7TA 4LDLA 1QT8A 1L98A 2MEAA 1GBWA 186LA 1EPYA 1T3PA 4BS7A 1LJIA 4TSCA 5D5FA 3WULA 1LYEA 1IEEA 1L16A 208LA 4PPOA 3CB7A 167LA 1LYHA 1CUQA 1I1ZA 1IWUA 4DDCA 119LA 3T6UA 2FYDA 3C8RA 1UIEA 2EKSC 3BKHA 196LA 2F4GA 4EJ4A 1I6SA 3SB6A 1P2RA 3G3XA 1GE4A 2CUUA 1IWZA 194LA 1OUCA 1FN5A 4HV1A 5DM9A 3WMKA 174LA 4H9BA 1L28A 1OUIA 150LA 1VAUA 1LZGA 1L55A 2XJWA 1HFZA 1IORA 2EQLA 4NGVA 2PY5A 1L65A 1L43A 4NGOA 144LA 3LZTA 1OVHA 2XTHA 1C6TA 2BQHA 4CJ2A 1ZURA 4I7JA 257LA 1FBIX 5APEA 1LWKA 1XHZA 4H9HA 243LA 214LA 1GBXA 1F6SA 1HFYA 3TXIA 4HV2A 3K2RA 3F6ZA 3IJUA 4RW2A 1L42A 4C3WA 1L99A 1PQIA 1BHZA 209LA 3FI5A 1LSZA 1GB2A 4I7SA 1LGUA 2LYOA 4ET9A 1V7SA 3WW5A 1P2CC 2B6WA 4WLDA 4KT3A 3VW7A 3SB8A 1IWTA 1QUGA 4WLTA 4WL7A 5C6IA 1G0GA 4WM5A 5E4PA 4GCFA 1YAOA 1JKBA 3OE0A 4IASA 1CKDA 235LA 207LA 1WQMA 1YILA 3HH3A 2Z12A 5HQ1A 260LA 1QSQA 141LA 4J0LA 4YXCA 1LZTA 1DYDA 138LA 3C81A 2YBLA 5E9RA 155LA 1L63A 4YENA 1OWYA 1NHBA 1UACY 1L69A 4XJFA 1L89A 1WQPA 1L00A 262LA 3W6AA 3LYTA 6LYZA 4XJGA 3B72A 1L10A 1GB3A 1B6IA 4DDBA 1DYCA 1T6VL 1D3FA 4YX7C 4WM1A 2BQNA 3VWOA 1YKZX 4GLVA 4LZTA 177LA 3A8ZA 3WVYA 5M1YA 3RW8A 1IP1A 2O4WA 1C6FA 1INUA 1YANA 2RBOA 215LA 1GWDA 5F9XA 1GF0A 5D5CA 1P7SA 4EMNA 4GRVA 1L58A 1IWXA 8LYZA 3C8QA 1L09A 1L37A 1HEPA 253LA 3HBHA 1T97A 1L76A 1C7PA 1HELA 3ZEKA 2FBDA 3DMXA 1LSEA 4NFVA 3WL2A 1L21A 173LA 5LYMA 3RZEA 2ZIKA 1P6YA 3WPJA 2BQEA 4MR1A 1YIKA 1IR8A 1L0JA 3N9EA 1CU5A 1CU0A 4W57A 1YAMA 1ZVHL 4NHQA 172LA 1JPOA 2XQOA 2Y8PA 1LZDA 104LA 1WQOA 1EQEA 2D4IA 3HUKA 5B1GA 2G4QA 2OU9A 1LJGA 4N9RA 165LA 1DI4A 2CGIA 1JTOL 1DPWA 1B5UA 1JKDA 3FADA 1ZWNA 1A2YC 4K5YA 3W6EA 1LSGA 1GF8A 1L39A 1JUGA 4ET8A 252LA 2ZWBA 5FELA 2HEFA 1C08C 1BQLY 3OK0A 3TXKA 1JWRA 2BQOA 3WU8A 2DQCY 1L02A 1C62A 2BQCA 3HBDA 3NY8A 5FDJA 3SP3A 1JTMA 1CJ9A 1G0LA 1LHKA 4NHTA 3TMWA 2MEFA 1QT7A 2HULA 3NY9A 1HMLA 1HF4A 5B59A 4EKQA 3W6CA 1CU6A 4QGZA 4E97A 2Z2EA 3HH4A 4I7NA 4PJ2C 3WXTA 187LA 1XGUC 1B0DA 1B5XA 1L19A 4G4HA 1LCNA 1FLYA 1OUJA 1GE1A 2MEEA 1GD6A 1TCYA 1VATA 1D2YA 3F8VA 1UIDA 5LZMA 2HEBA 1IX0A 3QY4A 1LMOA 1L31A 5L3HA 4OOTA 2B72A 2NTHA 1L48A 4M6DA 251LA 1L23A 2B6YA 1T8GA 2YBNA 4J1BA 255LA 1XFPL 3C82A 1P36A 3A94A 3GXKA 1LJ3A 4H92A 3DNAA 1CV1A 3HT8A 1JEFA 5F14A 153LA 2BQJA 1QQYA 1C6DA 246LA 1FLUA 223LA 3D3DA 4IATA 5DN5A 4XJDA 4EPFA 4C5FA 2C8PA 3AGHA 2D4JA 5KXOA 1B7MA 1LHIA 1ZV5L 4NGIA 4ZIXA 1CU2A 1IP2A 4TUNA 4LT1A 2B5ZA 1D3NA 5AMYA 1HEOA 5B07A 5LVIA 1L75A 1REXA 2YBHA 3A92A 3CQLA 5KXNA 3D4SA 232LA 3WU7A 1G7IC 1L44A 1LTMA 3L64A 152LA 2HEEA 1IO5A 4PK0A 4ARPA 1DYEA 2B70A 5A3EA 5LINA 4ETCA 4W51A 2RAZX 3WW6A 1MLCE 146LA 1SWYA 1YKXX 1LMPA 3CT0A 4NIJA 4W55A 234LA 3OE9A 1XGPC 4I7TA 1L94A 1LZ8A 1L32A 3V2WA 1HC0A 5IHGA 3TXDA 1G0MA 1GFJA 4B4IA 1YKYX 1HEQA 111LA 1WQQA 6LZMA 1GFVA 2PZSA 3LYZA 2BQLA 1LYIA 1TLAA 1UIGA 1RJCB 1QT6A 4WMGA 205LA 2ZNXY 4WM2A 5I4XA 3EBAB 1F10A 1GB9A 3GULA 1GB0A 2RBNA 183LA 4HSFA 1LJFA 1JJ0A 227LA 5F9UA 1AKIA 4LGKA 1PQMA 4N8ZA 5KXTA 2PYJA 1GB6A 2Z37A 1T8AA 2DQHY 1LSPA 4AQNA 1UC0A 4YEOA 1XEJA 4ARQA 4IJ4A 4II8A 1LGXA 1PS5A 1QTZA 4DT3A 1GFTA 2RBPA 1L73A 5KXSA 199LA 2R7FA 5L9JA 258LA 2B74A 4DD3A 1EQ4A 4W52A 2RB0X 4XJHA 3DN1A 4GCDA 1CX7A 4H9FA 1GB5A 5I54A 1REYA 1GBZA 1OP9B 3A34A 1K28A 4LYCA 1LZYA 1YL0X 3A6BY 1IWWA 4H9EA 3HU9A 1L45A 2ANXA 1KXXA 2RSCA 1IWYA 5HMVA 2FBBA 1D6QA 3WPLA 2IFFY 3LYMA 1CV6A 4EKPA 1L81A 5EBHA 2B75A 189LA 4NGKA 139LA 3RU5A 2W1XA 4HTKA 3SN6R 5FSTA 4DC4A 4I7KA 1QT4A 2DKVA 2OE7X 1L96A 1B5ZA 1L11A 1B7SA 1L07A 4I7PA 2XBRA 2IGCA 1LSAA 1GAZA 1WVVA 248LA 1QTVA 1JSEA 1QUHA 2HEAA 7LZMA 4NHSA 3RUNA 3GUMA 4WL6A 3WUMA 5A3ZA 2ZYPA 1W6ZA 2DQDY 2BQMA 1GE0A 1NHEA 4PRUA 2Z6BA 2HTXA 4H1PA 1P5CA 2H5ZA 1L08A 3CDVA 4L41A 4LDEA 3TMUA 2BLYA 4LT2A 1VFBC 1VDQA 5KXXA 4ARJA 237LA 3DN6A 2I26L 1OUBA 1QTHA 1UBZA 3DN3A 3TXHA 1KW7A 1B7NA 3A96A 1O23A 3PDSA 4I7OA 1LSMA 1LAAA 1L52A 1TBYA 4LFPA 206LA 1L27A 4J1AA 1LZ1A 1KS3A 2Z38A 3F9LA 1L62A 5KKJA 1GBYA 3N9AA 1C64A 4UWNA 1QS9A 4LFXA 1L0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSE A;  4NSJ A;  4NFV A;  5LA5 A;  3B0I A;  4OWA A;  1IWV A;  3WH1 A;  3WL2 A;  4YF2 A;  3RT5 X;  1CJ8 A;  1I20 A;  2DQJ Y;  2EIZ C;  3AGG G;  2X0A A;  1IC4 Y;  1TDY A;  1TAY A;  2DQF C;  2DQI Y;  4HPI A;  5LYM A;  1GPQ C;  2W1L A;  4G4C A;  1XHX A;  1JJ1 A;  4PHI A;  2DQA A;  3D9A C;  2ZIK A;  5F16 A;  4DWX A;  1B5V A;  1IR7 A;  1FLQ A;  3LHM A;  2BQE A;  3WPJ A;  4MR1 A;  3WPK A;  4BAF A;  1JIY A;  3N9C A;  193L A;  1YIK A;  1IR8 A;  1BGI A;  1YAP A;  4GLA A;  3N9E A;  1LMQ A;  154L A;  3RNX A;  4HJZ A;  2Z19 A;  2MEG A;  1GHL A;  4OW1 A;  1KIQ C;  4UWV A;  1YAM A;  4AGA A;  1QIO A;  1ZVH L;  4NHQ A;  1IP4 A;  2MEB A;  3FE0 A;  5KXM A;  3J4G A;  1GEV A;  4WO6 A;  3QE8 A;  1FDL Y;  1JPO A;  1UIA A;  1UIB A;  2ZQ3 A;  1G7H C;  4FJR A;  1SQ2 L;  1CKH A;  1LZD A;  2Y8P A;  135L A;  2ZQ4 A;  4DDA A;  1RFP A;  1WQO A;  1EQE A;  3IWR A;  1GE2 A;  2D4I A;  4PRQ A;  1C45 A;  5B1G A;  2G4Q A;  1LJG A;  4N9R A;  3W3E A;  2BQD A;  1IOC A;  1NKH A;  5B05 A;  2PW9 A;  2YBM A;  1DI4 A;  1OUG A;  3WUN A;  2CGI A;  3A95 A;  2FYC A;  5KY1 A;  1JTO L;  1H6M A;  1DPW A;  1B5U A;  1JKD A;  4ETA A;  2ZIJ A;  2HU3 A;  4WO9 A;  4DD0 A;  4H8Y A;  4DD1 A;  5I53 A;  1DZB X;  1A2Y C;  1LYO A;  3TXG A;  1HSW A;  4YOP A;  4QY9 A;  3EMS A;  5JEN B;  1FLW A;  2BQG A;  1D0M A;  1FKV A;  1HHL A;  4LT0 A;  1JKA A;  3W6E A;  1KXY A;  1LSG A;  4N0J A;  1GF8 A;  1GFG A;  4BAP A;  1WVU A;  2MED A;  1GAY A;  2BAA A;  4H9I A;  1JUG A;  2WAR A;  2Z39 A;  5HMJ A;  4GCB A;  5IDD A;  2BQF A;  1GDW A;  2ZWB A;  5FEL A;  5KXZ A;  4B49 A;  1HMK A;  5C6L A;  2HEF A;  1C08 C;  4E3U A;  5KJ9 A;  1BQL Y;  3OK0 A;  3TXK A;  1JWR A;  2HUB A;  4ETD A;  2BQO A;  1F0W A;  1HER A;  4NHP A;  2DQC Y;  3WU8 A;  1LHJ A;  1J1X Y;  2BQI A;  2DQG Y;  3EO5 A;  2BQC A;  4HJV A;  3HBD A;  1IOQ A;  2H9J A;  3M3U A;  3P66 A;  4CGE A;  1XEI A;  4NHI A;  1HNL A;  5FDJ A;  3SP3 A;  5F81 A;  4OWC A;  1CJ9 A;  1BWI A;  1QDR A;  2BLX A;  4H91 A;  1QUT A;  133L A;  4ZFP A;  4ETB A;  5K7O A;  1LHK A;  4TX7 A;  4NHT A;  4WLX A;  3TMW A;  1QSW A;  2MEF A;  4MCK A;  2C8O A;  3CT5 A;  1LZR A;  4OWE A;  1VDT A;  1KIP C;  4G4B A;  2CWI A;  2PYL A;  2YBI A;  1HML A;  3A67 Y;  1HF4 A;  5B59 A;  2EX3 A;  1IR9 A;  3W6C A;  5HNL A;  1GB8 A;  3TXB A;  3A6C Y;  1JSF A;  1IC7 Y;  3P4Z A;  1LZB A;  4XEN A;  1AZF A;  1LJK A;  1DI5 A;  4QGZ A;  1BB4 A;  1VED A;  1UCO A;  4H90 A;  5LAG A;  2Z2E A;  1LSN A;  1WQR A;  1BVX A;  5ILF A;  2D4K A;  1WTN A;  5LA8 A;  1LSD A;  3P65 A;  2G4N A;  1IIZ A;  1YRO A;  1XGT C;  1LJN A;  2PC2 A;  5DLA A;  4YEM A;  1GFR A;  3AJN A;  4PJ2 C;  6LYT A;  3AGI A;  3CSZ A;  3WXT A;  1N4F A;  1XGU C;  4DD7 A;  2DBT A;  1ZMY L;  1B0D A;  2F4A A;  4DD9 A;  1LZA A;  9LYZ A;  1B5X A;  4G4H A;  1LCN A;  1FLY A;  1OUJ A;  1GE1 A;  2MEE A;  4OOO A;  1GD6 A;  4AXT A;  1BWH A;  1G7M C;  4GN4 A;  4BAD A;  1TCY A;  5KXK A;  1GXX A;  1LKR A;  3P64 A;  3P68 A;  5KXW A;  1VAT A;  3MGW A;  5LIO A;  1UID A;  2HEB A;  1LZ4 A;  1EQ5 A;  4PGJ B;  3A91 A;  2ZNW Y;  1IX0 A;  1LYS A;  3QY4 A;  3TXJ A;  1LMO A;  1GF5 A;  5APD A;  2W1M A;  3B6L A;  2I6Z A;  4OOT A;  1XGR C;  5L3H A;  1LHL A;  1NBY C;  1B7Q A;  3AZ5 A;  4DD2 A;  1D6P A;  1IP5 A;  3OJP A;  2ZIL A;  4H9A A;  5IEL A;  4M6D A;  4WG1 A;  1REM A;  1JIT A;  2BQB A;  1VDS A;  2DQE Y;  4G9S A;  4H8Z A;  2YBN A;  1UIF A;  4RDS A;  4J1B A;  2YSS C;  1XFP L;  4N5R A;  5KXL A;  1WQN A;  3ATO A;  4R0F A;  1LKS A;  5LXW A;  5HLL A;  1SLY A;  3A94 A;  4ETE A;  1OUA A;  1PZY A;  1NQI A;  1B7P A;  4NEB A;  3CSQ A;  1OUE A;  2GV0 A;  4WG7 A;  4KPM A;  3GXK A;  1ALC A;  1LJ3 A;  1LJJ A;  4KXI A;  1GF4 A;  4M4O A;  4H92 A;  1BVK C;  4UWU A;  1XI1 A;  1LJH A;  3A93 A;  4H9C A;  1IOT A;  1UUZ C;  1JEF A;  1B7L A;  2CJL A;  5F14 A;  4U3X B;  3GXR A;  1WTM A;  1NF5 A;  1LJ4 A;  2EPE A;  153L A;  2BQJ A;  1QQY A;  1FLU A;  3AB6 A;  1NWG A;  3D3D A;  4IAT A;  4WM4 A;  5DN5 A;  4XJD A;  4NWE A;  1B5W A;  2C8P A;  2ZYC A;  4C5F A;  4H8X A;  3HFM Y;  1LOZ A;  3AGH A;  5B1F A;  2D4J A;  5KXO A;  1B7M A;  1G7L C;  1LHI A;  1DKK A;  1ZV5 L;  3E3D A;  4FDY A;  4NGI A;  2YDG A;  1CKG A;  1H87 A;  4ZIX A;  5LAF A;  5I4W A;  1IP2 A;  2LZ2 A;  4TUN A;  4LT1 A;  4XAD A;  4NGY A;  1QTE A;  2B5Z A;  1GF3 A;  3WU9 A;  4G49 A;  134L A;  5AMY A;  3AZ6 A;  4ML7 A;  1DQJ C;  1HEO A;  1BB3 A;  4KL7 A;  4RW1 A;  1LSF A;  1YAQ A;  5B07 A;  1DKJ A;  1GFK A;  1LZN A;  1REX A;  2YVB A;  2BQA A;  2YBH A;  2BPU A;  1B5Y A;  3A92 A;  1LZS A;  4B1A A;  1GBS A;  3M18 B;  3CQL A;  5LVG A;  2W1Y A;  5KXN A;  1HEN A;  2LZT A;  4EOF A;  1GF6 A;  3WU7 A;  4W96 A;  1G7I C;  1LTM A;  2D91 A;  2HEE A;  1IO5 A;  4B4E A;  5J7C A;  1J1P Y;  1CJ7 A;  3ZVQ A;  2F2N A;  4NGW A;  1GE3 A;  2N5Z A;  5A3E A;  3FI7 A;  5LIN A;  4I0C A;  4ETC A;  5APC A;  3AZ4 A;  4H93 A;  1AT6 A;  3WW6 A;  4GCC A;  1MLC E;  1B7R A;  1JIS A;  1V7T A;  2G4P A;  1YL1 X;  3ULR A;  2BQK A;  3RZ4 A;  4WM6 A;  5KXY A;  2MEA A;  1GBW A;  1YKX X;  4R6C A;  4B4J A;  1LPI A;  3K3T A;  4CFP A;  1HEM A;  1LMP A;  1T3P A;  3CT0 A;  1A4V A;  4NIJ A;  1DPX A;  4WOA A;  1LJI A;  2A7D A;  4TSC A;  5D5F A;  3WUL A;  4BS7 A;  2AUB A;  132L A;  4GCE A;  1IEE A;  1NBZ C;  1LSB A;  3W6F A;  1LZ5 A;  1XGP C;  208L A;  3TXE A;  1JTP L;  4PPO A;  3CB7 A;  4OWH A;  4J7V A;  4P2E A;  1IP6 A;  1Z55 A;  3AZ7 A;  1LZ8 A;  3A90 A;  1RCM A;  1D0L A;  1HC0 A;  4OWB A;  4XJI A;  5IHG A;  3TXD A;  5C6J A;  1GFJ A;  4B4I A;  1YKY X;  1I1Z A;  1QDT A;  1HEQ A;  1NDM C;  1IWU A;  4DDC A;  1BB7 A;  4O34 A;  3ZVQ B;  1LZ9 A;  1WQQ A;  3B0K A;  5LYZ A;  3LN2 A;  1LSY A;  3T6U A;  1UIH A;  2FYD A;  1QUS A;  1GFV A;  1EL1 A;  1LZC A;  1UIE A;  2PZS A;  1JTT L;  2EKS C;  1UA6 Y;  3BKH A;  5APF A;  3LYZ A;  2F4G A;  1GXV 2;  1JJ3 A;  2BQL A;  3W6B A;  3QNG A;  2F30 A;  1UIG A;  1GBO A;  1RJC B;  4WMG A;  1GE4 A;  3TMX A;  2ZNX Y;  4WM2 A;  5I4X A;  5II3 A;  1IWZ A;  194L A;  1OUC A;  3EBA B;  1F10 A;  2MEC A;  1GB9 A;  1GB0 A;  1NDG C;  3J6K A;  1FN5 A;  4HSF A;  1HSX A;  1HFX A;  1QTK A;  1LJF A;  4LYB A;  5T3F A;  5KXR A;  4HV1 A;  1JJ0 A;  4A7D A;  5L3I A;  5DM9 A;  5F9U A;  1AKI A;  1BWJ A;  1KXW A;  1CJ6 A;  4LGK A;  3WMK A;  1AM7 A;  4H9B A;  5LVI A;  3LZ2 A;  1XSF A;  1OUI A;  4ZEE A;  1VAU A;  4CHX A;  4N8Z A;  1LZG A;  4Z98 A;  5KXT A;  2PYJ A;  1LMN A;  2XJW A;  1HFZ A;  1IOR A;  1GB6 A;  2EQL A;  4NGV A;  3WYH A;  2PY5 A;  4NWH A;  3B0O A;  2Z37 A;  1DI3 A;  4NGO A;  2DQH Y;  2D6B A;  1C46 A;  1LSP A;  3LZT A;  4NY5 A;  5B06 A;  1YQV Y;  1LMT A;  3G3B B;  3TMV A;  5HNC A;  1UC0 A;  2XTH A;  4YEO A;  1LHM A;  1XEJ A;  2YBJ A;  4GN5 C;  5FCP A;  4RLM A;  1IP3 A;  2BQH A;  2Q0M X;  4IJ4 A;  4CJ2 A;  4II8 A;  3EXD A;  2MEI A;  1FBI X;  1PS5 A;  5DN4 A;  5APE A;  4DT3 A;  4H9H A;  1CNS A;  1XHZ A;  1GFT A;  1GBX A;  1DXJ A;  1F6S A;  5KXS A;  1HFY A;  3TXI A;  4ANR A;  2R7F A;  5L9J A;  2VB1 A;  4HV2 A;  4HTN A;  4DD3 A;  1LZE A;  3F6Z A;  4LYZ A;  1EQ4 A;  3IJU A;  4QEQ A;  4RW2 A;  4ET8 A;  4XJH A;  4GCD A;  1W08 A;  3A3R X;  1BB6 A;  4C3W A;  1IY4 A;  4H9F A;  1BHZ A;  1GB5 A;  4MST A;  5I54 A;  5LVK A;  4HJY A;  4DYG A;  1FKQ A;  1OUD A;  1LSZ A;  3T36 A;  1GB2 A;  1REY A;  1GBZ A;  4XJB A;  4XN6 A;  1OP9 B;  2LYO A;  3A34 A;  1B7O A;  4TTD A;  4ET9 A;  1V7S A;  4LYC A;  1CKC A;  3WW5 A;  1P2C C;  1LZY A;  1YL0 X;  3A6B Y;  1B9O A;  1IWW A;  4H9E A;  1IC5 Y;  4WLD A;  2HEC A;  1KXX A;  4KT3 A;  2RSC A;  1IWT A;  1IWY A;  5I5Q A;  1LMA A;  5HMV A;  4WLT A;  4WL7 A;  3WVX A;  4LYO A;  5C6I A;  1GF7 A;  1I56 A;  1GFU A;  2LYM A;  4WM5 A;  2CDS A;  2FBB A;  1D0K A;  4GCF A;  4NG8 A;  4QDN A;  1YAO A;  5E4P A;  1D6Q A;  1JKB A;  1LZ6 A;  1REZ A;  3WPL A;  2IFF Y;  4B0D A;  1GEZ A;  5FHW A;  3LYM A;  4GN3 A;  4XYY A;  4IAS A;  1LYZ A;  2HU1 A;  1CKD A;  5EBH A;  3IJV A;  4NGJ A;  207L A;  2A7F A;  1WQM A;  1YIL A;  3WXU A;  5LVJ A;  1GFE A;  1OUF A;  2HED A;  4NGK A;  2Z12 A;  5HQ1 A;  1E8L A;  3RU5 A;  2W1X A;  4H94 A;  4HTK A;  4TSB A;  4J0L A;  5FST A;  5DL9 A;  4DC4 A;  4Z46 A;  4LT3 A;  2Z2F A;  4NGL A;  1RI8 B;  5I4Y A;  1LZT A;  2DKV A;  3AW7 A;  4HPE A;  1LHH A;  2YBL A;  4HTQ A;  3A3Q A;  1B5Z A;  3G3A B;  5E9R A;  1D9U A;  4Z41 A;  1TEW A;  1J1O Y;  1B7S A;  2XBR A;  1GFA A;  2IHL A;  1LSA A;  1GDX A;  1GAZ A;  1LMC A;  1IP7 A;  1WVV A;  4YEN A;  4D9Z A;  1XEK A;  1GF9 A;  3ATN A;  4NSG A;  4LYM A;  1LSC A;  1UAC Y;  1IY3 A;  1JSE A;  3AYQ A;  4XJF A;  1WQP A;  2HEA A;  4NHS A;  4WM3 A;  1QSA A;  4NGZ A;  1C43 A;  1UIC A;  3W6A A;  4WLY A;  2NWD X;  3LYT A;  4WL6 A;  3WUM A;  5A3Z A;  6LYZ A;  2ZYP A;  1W6Z A;  1LYY A;  3B72 A;  1OQM A;  2DQD Y;  3CT1 A;  4XJG A;  5KXP A;  5LVH A;  4I8S A;  1GB3 A;  3HBE X;  2BQM A;  1GE0 A;  1NHE A;  4PRU A;  3LYO A;  3KAM A;  4X3B A;  4DDB A;  4N1C C;  2XBS A;  1JKC A;  2HTX A;  2I25 L;  1GFH A;  2LHM A;  1T6V L;  4H1P A;  4NG1 A;  2H5Z A;  5KKI A;  4WM1 A;  4L41 A;  3TMU A;  2BLY A;  2H9K A;  2BQN A;  4LT2 A;  4NSI A;  1RE2 A;  3VWO A;  1VFB C;  1VDQ A;  5KXX A;  1LJE A;  1YKZ X;  3AW6 A;  4GLV A;  4LZT A;  2I26 L;  7LYZ A;  4HP0 A;  3A8Z A;  3WVY A;  1OUB A;  2MEH A;  5M1Y A;  1UBZ A;  1OUH A;  3W6D A;  3TXH A;  1JHL A;  1ZVY B;  4NSH A;  4W94 A;  3RW8 A;  4Z3M A;  1IP1 A;  1B7N A;  1XGQ C;  3A96 A;  3BKV A;  4N1E I;  1MEL L;  1INU A;  1YAN A;  4CFO A;  1O23 A;  1HEW A;  1GB7 A;  3TXF A;  1GWD A;  1LSM A;  1LAA A;  1B2K A;  4RLN A;  1GF0 A;  5F9X A;  5LYT A;  1TBY A;  4LFP A;  5D5C A;  1KIR C;  1IOS A;  4J1A A;  1G7J C;  1LZ1 A;  1IVM A;  4EMN A;  1F6R A;  2Z38 A;  1VDP A;  1IWX A;  1C10 A;  8LYZ A;  5KKJ A;  1BB5 A;  1GBY A;  1HEP A;  2Z18 A;  1AT5 A;  3N9A A;  3WUA A;  4YM8 A;  3HBH A;  5FEK A;  1C7P A;  1HEL A;  1NMM A;  2LYZ A;  4TWS A;  4UWN A;  3ZEK A;  5ILC A;  4LYT A;  2FBD A;  4LFX A;  3CSR A;  1CKF A; 
#chains in the Genus database with same CATH topology
 1G0J A;  3AGG G;  2X0A A;  147L A;  2DQI Y;  4HPI A;  1GPQ C;  2W1L A;  1XHX A;  1L03 A;  1JJ1 A;  3C80 A;  3D9A C;  5F16 A;  1IR7 A;  1FLQ A;  3LHM A;  2RH1 A;  1JIY A;  3N9C A;  193L A;  1D3M A;  1BGI A;  1YAP A;  1LMQ A;  4HJZ A;  2Z19 A;  3DKE X;  4OW1 A;  1LW9 A;  1KNI A;  3LZM A;  1P46 A;  4WO6 A;  3QE8 A;  1UIB A;  4DDA A;  3QAK A;  3IWR A;  1L91 A;  1OVJ A;  118L A;  1IOC A;  3DN4 A;  1L46 A;  4WO9 A;  140L A;  4DD1 A;  1RHI 4;  1L80 A;  4YTN A;  3TXG A;  1L97 A;  1HSW A;  1VBA 4;  4YOP A;  2BQG A;  1D0M A;  1FKV A;  1HHL A;  4LT0 A;  1L35 A;  1JKA A;  1GFG A;  2MED A;  112L A;  1C6L A;  4H9I A;  5C6L A;  2BQF A;  1GDW A;  162L A;  4ETD A;  1F0W A;  2DQG Y;  1QS5 A;  4CGE A;  1HNL A;  1CVK A;  3GUP A;  3HTB A;  1G1W A;  3HTG A;  2BLX A;  4H91 A;  1QUT A;  1PVC 4;  157L A;  4WLX A;  4MCK A;  2C8O A;  1LZR A;  1L71 A;  2PYL A;  3P4P A;  1IR9 A;  238L A;  1JSF A;  1IC7 Y;  3P4Z A;  1BB4 A;  1VED A;  1UCO A;  178L A;  1L01 A;  1WQR A;  3HH6 A;  1LSD A;  1QUO A;  4YEM A;  3AGI A;  3CSZ A;  4DD7 A;  1L30 A;  2DBT A;  4DD9 A;  1LZA A;  4OOO A;  4AXT A;  1BWH A;  2RB1 X;  4BAD A;  2NTG A;  1GXX A;  2F32 A;  5KXW A;  1L14 A;  1EQ5 A;  225L A;  4PGJ B;  2ZNW Y;  1AR9 4;  1GF5 A;  5APD A;  1C6B A;  2W1M A;  2I6Z A;  1NBY C;  3AZ5 A;  1R09 4;  1L26 A;  1VRH 4;  1D3J A;  1REM A;  1JIT A;  2BQB A;  2DQE Y;  4G9S A;  2F2Q A;  3L2X A;  240L A;  1WQN A;  4R0F A;  5LXW A;  4ETE A;  1PZY A;  1OUE A;  2GV0 A;  4KPM A;  2OE4 X;  4PJZ A;  1LJJ A;  4KXI A;  3CDT A;  254L A;  1IOT A;  1L36 A;  228L A;  2CJL A;  2H89 A;  1WTM A;  1CU3 A;  1NF5 A;  1LJ4 A;  4WM4 A;  3DN0 A;  1B5W A;  1LOZ A;  1G7L C;  4FDY A;  1H87 A;  137L A;  1L83 A;  113L A;  4KL7 A;  4RW1 A;  1RUC 4;  1LSF A;  181L A;  1YAQ A;  1DKJ A;  2RBS A;  2YVB A;  2BQA A;  2BPU A;  2HWB 4;  1LZS A;  1XJT A;  3M18 B;  3GUI A;  1L33 A;  1HEN A;  1GF6 A;  1VBE 4;  1CJ7 A;  3ZVQ A;  2F2N A;  241L A;  3C7W A;  3FI7 A;  259L A;  5APC A;  1SSW A;  1C6E A;  102L A;  1B7R A;  1YL1 X;  3ULR A;  3RZ4 A;  1LYD A;  4R6C A;  4B4J A;  1LPI A;  3K3T A;  4ARM B;  1C61 A;  4CFP A;  1HEM A;  1L34 A;  3SBA A;  4WOA A;  4ARL A;  2AUB A;  1NBZ C;  3W6F A;  1LSB A;  4OWH A;  4J7V A;  1C6A A;  1Z55 A;  3AZ7 A;  2OTZ X;  3A90 A;  1D0L A;  1CV4 A;  4YSZ A;  1XEP A;  4OWB A;  5C6J A;  131L A;  1QDT A;  1KFY A;  1RUJ 4;  1L57 A;  4O34 A;  218L A;  3ZVQ B;  1LZ9 A;  250L A;  3ABV A;  5LYZ A;  1LSY A;  1UA6 Y;  2OE9 X;  4Q4Y 4;  3W6B A;  1LI3 A;  2F30 A;  219L A;  1SSY A;  1SX2 A;  3JR6 A;  1SWZ A;  1NDG C;  1L79 A;  3J6K A;  1RUE 4;  4LYB A;  1L74 A;  120L A;  4A7D A;  1CJ6 A;  1AM7 A;  1XSF A;  2H88 A;  4CHX A;  1LMN A;  222L A;  1L82 A;  1JQU A;  2D6B A;  1KW5 A;  5HNC A;  2YBJ A;  4RLM A;  4PDW D;  1IP3 A;  2MEI A;  1L59 A;  5DN4 A;  1CNS A;  4ZPU A;  4DAJ A;  5I14 A;  1DXJ A;  4ANR A;  2VB1 A;  1C6Q A;  1KY1 A;  1L47 A;  4LYZ A;  4QEQ A;  3HDF A;  239L A;  1W08 A;  3A3R X;  1BB6 A;  3HU8 A;  175L A;  188L A;  5LVK A;  4HJY A;  3AE6 A;  1OUD A;  3T36 A;  107L A;  4XJB A;  4XN6 A;  2F47 A;  261L A;  1B7O A;  4TTD A;  161L A;  1B9O A;  169L A;  4LZM A;  4GBR B;  5I5Q A;  3WVX A;  4LYO A;  3HTD A;  1GF7 A;  1GFU A;  2LYM A;  3SB9 A;  2CDS A;  5ILC A;  1D0K A;  4NG8 A;  4QDN A;  1LZ6 A;  1L51 A;  211L A;  1C69 A;  4GN3 A;  4XYY A;  4YTP A;  229L A;  1BEV 4;  3IJV A;  249L A;  231L A;  1L53 A;  2B6X A;  3WXU A;  1E8L A;  1OUF A;  2HED A;  4H94 A;  1PQD A;  5DL9 A;  166L A;  2Z2F A;  4NGL A;  244L A;  170L A;  1NEK A;  3AW7 A;  4HPE A;  1LHH A;  3G3A B;  4Z41 A;  1TEW A;  3G3V A;  108L A;  1GFA A;  114L A;  2A4T A;  1LMC A;  1IP7 A;  1XEK A;  1GF9 A;  4NSG A;  4LYM A;  1L04 A;  3EML A;  1RUD 4;  3AYQ A;  4WM3 A;  4NGZ A;  1UIC A;  4WLY A;  1CV0 A;  1QT5 A;  1L13 A;  1OQM A;  3CT1 A;  5KXP A;  5LVH A;  4DQJ A;  3HBE X;  3LYO A;  2ANV A;  3KAM A;  4N1C C;  2XBS A;  1JKC A;  1GFH A;  1L92 A;  2LHM A;  4NG1 A;  2B6Z A;  5KKI A;  1T8F A;  2H9K A;  4NSI A;  1QSB A;  1RE2 A;  1L20 A;  1LJE A;  1L41 A;  247L A;  2MEH A;  3W6D A;  1ZVY B;  4W94 A;  3BKV A;  4CFO A;  1HEW A;  115L A;  1KIR C;  1EAH 4;  1IVM A;  1F6R A;  1C68 A;  3HUQ A;  1CUP A;  2Z18 A;  126L A;  3WUA A;  4YM8 A;  5FEK A;  1KY0 A;  2LYZ A;  4EKR A;  1H8T D;  4LYT A;  3B0I A;  4OWA A;  1IWV A;  4YF2 A;  2DQJ Y;  2EIZ C;  4EXM A;  1IC4 Y;  1TDY A;  2RBR A;  1LI6 A;  1CTW A;  154L A;  4GLA A;  3RNX A;  142L A;  1CV5 A;  2MEG A;  151L A;  1GHL A;  4UWV A;  4AGA A;  159L A;  2OU0 X;  1G06 A;  1IP4 A;  2MEB A;  3J4G A;  1FDL Y;  1UIA A;  1G7H C;  4FJR A;  1SQ2 L;  2ZQ4 A;  4W56 A;  1L70 A;  1GE2 A;  226L A;  1DYF A;  3AEF A;  2BQD A;  1NKH A;  2YBM A;  1COV 4;  3HTF A;  2FYC A;  5KY1 A;  1H6M A;  2RM2 4;  4ETA A;  2ZIJ A;  2HU3 A;  3DN8 A;  4H8Y A;  5I53 A;  1DZB X;  216L A;  2HWC 4;  1LPY A;  3EMS A;  3GUJ A;  1KXY A;  143L A;  1WVU A;  109L A;  130L A;  1GAY A;  2BAA A;  5IDD A;  5HMJ A;  5KXZ A;  191L A;  1L95 A;  242L A;  1AR6 4;  2HUB A;  1HER A;  4NHP A;  1LYJ A;  3EO5 A;  1L64 A;  1IOQ A;  1L88 A;  3P66 A;  3OE8 A;  3UON A;  4OWC A;  1QDR A;  133L A;  230L A;  5K7O A;  4TX7 A;  1LWG A;  1QSW A;  4OWE A;  1KIP C;  4G4B A;  2CWI A;  3A67 Y;  3TXB A;  1LZB A;  1AZF A;  1LJK A;  3CIR A;  4H90 A;  5LAG A;  158L A;  182L A;  5ILF A;  1L84 A;  1WTN A;  2D4K A;  5LA8 A;  1IIZ A;  1LJN A;  1L17 A;  2PC2 A;  3OE6 A;  3AJN A;  1P37 A;  6LYT A;  1YQ4 A;  4DKL A;  1N4F A;  3SBB C;  1PO1 4;  4YSX A;  9LYZ A;  1OV5 A;  168L A;  1L54 A;  4GN4 A;  4I7L A;  3P64 A;  3P68 A;  4EKS A;  3MGW A;  5LIO A;  4I7Q A;  149L A;  3TXJ A;  1DYA A;  1L90 A;  3B6L A;  1C6C A;  1XGR C;  1B7Q A;  4DD2 A;  1D6P A;  2OTY X;  3OJP A;  4H9A A;  5IEL A;  1VDS A;  2L78 A;  4RDS A;  5KXL A;  3ATO A;  1LKS A;  5HLL A;  1SLY A;  1RVF 4;  2OU8 A;  1B7P A;  2B73 A;  1L22 A;  2PLV 4;  3AE3 A;  3SFD A;  1GF4 A;  4M4O A;  4UWU A;  2RS5 4;  4I7M A;  3DMZ A;  160L A;  2EPE A;  1QTC A;  3AB6 A;  2B6T A;  198L A;  1L85 A;  4NWE A;  1DYG A;  2ZYC A;  4H8X A;  1C66 A;  3HFM Y;  4YXA C;  5B1F A;  3HUA A;  1DKK A;  1VBC 4;  2YDG A;  1CKG A;  1L49 A;  1L66 A;  2B7X A;  4NGY A;  3HDE A;  1LYF A;  4W58 A;  1GF3 A;  3WU9 A;  4G49 A;  1G0Q A;  3AZ6 A;  4ML7 A;  1DQJ C;  1BB3 A;  1C6M A;  1C6J A;  2OEA X;  1R08 4;  1GFK A;  3C8S A;  221L A;  4I7R A;  1MQT D;  233L A;  2W1Y A;  3CDR A;  2LZT A;  1L77 A;  4EOF A;  212L A;  4W96 A;  201L A;  1J1P Y;  217L A;  1GE3 A;  3GUN A;  4I0C A;  5C2T A;  1C6I A;  1L72 A;  3AZ4 A;  4H93 A;  245L A;  2RBQ A;  4GCC A;  185L A;  2G4P A;  1ZP0 A;  2BQK A;  4IAP A;  4WM6 A;  1L24 A;  5KXY A;  1A4V A;  1QTD A;  1L60 A;  1DPX A;  2A7D A;  1WTH A;  127L A;  132L A;  4GCE A;  1D2W A;  1LZ5 A;  3TXE A;  1JTP L;  1L0V A;  4P2E A;  3V2Y A;  1C6G A;  1IP6 A;  2RS3 4;  2HUK A;  1RCM A;  1G1V A;  3VRA A;  4XJI A;  1C67 A;  1NDM C;  1BB7 A;  3B0K A;  3LN2 A;  1UIH A;  1QUS A;  2O79 A;  1EL1 A;  1LZC A;  1JTT L;  1GXV 2;  1JJ3 A;  3QNG A;  1GBO A;  163L A;  3TMX A;  4W54 A;  5II3 A;  1T6H A;  2MEC A;  3VR8 A;  1L05 A;  1HSX A;  1HFX A;  1QTK A;  5T3F A;  5KXR A;  5L3I A;  1BWJ A;  1KXW A;  3HT6 A;  3LZ2 A;  4ZEE A;  164L A;  4Z98 A;  3SB7 A;  3WYH A;  1L06 A;  4NWH A;  3B0O A;  1DI3 A;  1L68 A;  220L A;  1C46 A;  2LC9 A;  4NY5 A;  5B06 A;  3TMV A;  1YQV Y;  1LMT A;  3G3B B;  1LHM A;  5FCP A;  4GN5 C;  2Q0M X;  4EPI A;  3EXD A;  1QUD A;  2RB2 X;  1L40 A;  4DJH A;  1OYU A;  1L15 A;  4HTN A;  1LZE A;  184L A;  1G0K A;  1L86 A;  1L38 A;  2HUM A;  4ARM A;  1IY4 A;  4MST A;  4DYG A;  3AEA A;  1FKQ A;  125L A;  1CKC A;  1L25 A;  1IC5 Y;  3AE9 A;  4S0W A;  2HEC A;  1C6K A;  195L A;  1LMA A;  1I56 A;  1REZ A;  4B0D A;  3HH5 A;  1GEZ A;  5FHW A;  122L A;  1LYZ A;  2HU1 A;  4NGJ A;  2A7F A;  1CV3 A;  5LVJ A;  1GFE A;  3HWL A;  3FA0 A;  4TSB A;  4Z46 A;  5I4Y A;  145L A;  4LT3 A;  1RI8 B;  1L29 A;  3C83 A;  1C63 A;  4HTQ A;  3A3Q A;  2O7A A;  3AEE A;  1OOP D;  1D9U A;  1J1O Y;  3AE5 A;  3C7Z A;  1L87 A;  1QT3 A;  1OWZ A;  2IHL A;  110L A;  1GDX A;  4D9Z A;  3ATN A;  1AL2 4;  1LSC A;  1IY3 A;  1QSA A;  1C43 A;  103L A;  2NWD X;  2QAR C;  1LYY A;  3HT9 A;  4I8S A;  1C60 A;  4X3B A;  2I25 L;  1LGW A;  1CX6 A;  171L A;  4OO9 A;  3AW6 A;  7LYZ A;  4HP0 A;  1OUH A;  197L A;  1JHL A;  156L A;  4NSH A;  4Z3M A;  3AED A;  3SUC A;  1XGQ C;  4N1E I;  3VRB A;  1MEL L;  1GB7 A;  3TXF A;  1B2K A;  4RLN A;  5LYT A;  236L A;  129L A;  1IOS A;  2RAY X;  1G7J C;  1VDP A;  1OV7 A;  1C10 A;  1BB5 A;  1QTB A;  128L A;  1AT5 A;  1NMM A;  4TWS A;  2QB0 B;  3CSR A;  1CKF A;  4NSJ A;  5LA5 A;  3WH1 A;  3RT5 X;  1CJ8 A;  1L50 A;  1I20 A;  1G07 A;  4LDO A;  1TAY A;  2DQF C;  4G4C A;  1LYG A;  3DMV A;  4PHI A;  2DQA A;  4DWX A;  1B5V A;  3WPK A;  4BAF A;  1C6H A;  1LI2 A;  1KIQ C;  3GUO A;  1KF6 A;  1QIO A;  3FE0 A;  5KXM A;  1GEV A;  2WU2 A;  2ZQ3 A;  1CKH A;  135L A;  1RFP A;  3P4S A;  4PRQ A;  1C45 A;  1C65 A;  3W3E A;  5B05 A;  2PW9 A;  1OUG A;  3WUN A;  3A95 A;  4YSY A;  3NYA A;  4DD0 A;  1AR8 4;  2LZM A;  1LYO A;  1P2L A;  5JEN B;  4QY9 A;  4RHV 4;  148L E;  1FLW A;  4W59 A;  3SB5 A;  3CDQ A;  2Q9E A;  4N0J A;  4BAP A;  4DQ7 A;  256L A;  2Z39 A;  2WAR A;  3DN2 A;  4GCB A;  1L67 A;  4B49 A;  1L61 A;  3PBL A;  1L93 A;  1HMK A;  4E3U A;  5KJ9 A;  1P56 A;  1LHJ A;  1J1X Y;  2BQI A;  4HJV A;  2H9J A;  3M3U A;  1XEI A;  4NHI A;  3GQH A;  3C7Y A;  5F81 A;  1BWI A;  123L A;  2FBW A;  4ZFP A;  4ETB A;  3CT5 A;  1VDT A;  2RS1 4;  210L A;  2YBI A;  1OVK A;  2EX3 A;  1JTN A;  4DQ5 A;  5HNL A;  1GB8 A;  176L A;  3HT7 A;  3A6C Y;  1PQO A;  4XEN A;  1DI5 A;  192L A;  1LSN A;  1XJU A;  1BVX A;  3P65 A;  2G4N A;  1YRO A;  1XGT C;  5DLA A;  1GFR A;  3G3W A;  1ZYT A;  2F4A A;  1ZMY L;  1G7M C;  2Q9D A;  1L18 A;  5KXK A;  1LKR A;  3ODU A;  1LZ4 A;  3A91 A;  200L A;  1LYS A;  1P3N A;  1LHL A;  1LLH A;  1IP5 A;  2ZIL A;  4WG1 A;  1RUI 4;  1C6N A;  4H8Z A;  1UIF A;  2YSS C;  1SX7 A;  1HRI 4;  4N5R A;  1HRV 4;  3CDO A;  1D9W A;  1PQJ A;  1L12 A;  1PQK A;  1OUA A;  1NQI A;  1RUH 4;  4NEB A;  3CSQ A;  4W53 A;  4WG7 A;  224L A;  1ALC A;  1POV 0;  1ZOY A;  2RMU 4;  190L A;  1BVK C;  1XI1 A;  1LJH A;  1G0P A;  3A93 A;  4H9C A;  4YXD A;  1UUZ C;  1B7L A;  4U3X B;  3GXR A;  1P64 A;  1NWG A;  5APF A;  3E3D A;  2B76 A;  5LAF A;  5I4W A;  2LZ2 A;  4XAD A;  1K5M D;  1NA1 D;  1QTE A;  1AR7 4;  134L A;  1L56 A;  1C6P A;  1LZN A;  2LCB A;  1B5Y A;  4B1A A;  3GUK A;  1GBS A;  1DYB A;  5LVG A;  180L A;  213L A;  4ARQ B;  2D91 A;  4B4E A;  5J7C A;  1PO2 4;  4NGW A;  2R07 4;  2N5Z A;  1AT6 A;  1JIS A;  1V7T A;  4LDL A;  1QT8 A;  3AE8 A;  1L98 A;  3P4R A;  2MEA A;  1GBW A;  186L A;  3J8F 4;  1EPY A;  1T3P A;  4BS7 A;  1LJI A;  4TSC A;  5D5F A;  3WUL A;  1EV1 4;  1LYE A;  1IEE A;  1L16 A;  208L A;  4PPO A;  3CB7 A;  167L A;  1LYH A;  1NCQ D;  1CUQ A;  1I1Z A;  1IWU A;  4DDC A;  119L A;  3T6U A;  2FYD A;  3C8R A;  1UIE A;  2EKS C;  3BKH A;  196L A;  2F4G A;  4EJ4 A;  1I6S A;  3SB6 A;  1P2R A;  3G3X A;  1GE4 A;  2CUU A;  1IWZ A;  194L A;  1OUC A;  1FN5 A;  4HV1 A;  5DM9 A;  3WMK A;  174L A;  4H9B A;  1L28 A;  1OUI A;  150L A;  1VAU A;  1LZG A;  1L55 A;  2XJW A;  3AE4 A;  1HFZ A;  1IOR A;  2EQL A;  4NGV A;  2PY5 A;  1L65 A;  1L43 A;  4NGO A;  144L A;  3LZT A;  1OVH A;  2XTH A;  1C6T A;  2BQH A;  4CJ2 A;  1ZUR A;  4I7J A;  257L A;  1FBI X;  5APE A;  1LWK A;  1XHZ A;  4H9H A;  243L A;  214L A;  1GBX A;  1F6S A;  4YTM A;  1HFY A;  3TXI A;  4HV2 A;  3K2R A;  3F6Z A;  3IJU A;  4RW2 A;  1L42 A;  4C3W A;  1L99 A;  1PQI A;  1BHZ A;  209L A;  3FI5 A;  1LSZ A;  1GB2 A;  4I7S A;  1LGU A;  2LYO A;  4ET9 A;  1V7S A;  3WW5 A;  1P2C C;  2B6W A;  4WLD A;  4KT3 A;  2X5I D;  3VW7 A;  3SB8 A;  1IWT A;  1QUG A;  4WLT A;  4WL7 A;  5C6I A;  1G0G A;  4WM5 A;  5E4P A;  4GCF A;  1YAO A;  1JKB A;  3OE0 A;  4IAS A;  1CKD A;  235L A;  207L A;  1WQM A;  1YIL A;  3HH3 A;  2Z12 A;  5HQ1 A;  260L A;  1QSQ A;  141L A;  3JBG 4;  2ACZ A;  4J0L A;  4YXC A;  1LZT A;  1DYD A;  138L A;  3C81 A;  2YBL A;  2WS3 A;  5E9R A;  155L A;  3AEB A;  1L63 A;  4YEN A;  1NEN A;  1OWY A;  1NHB A;  1UAC Y;  1L69 A;  4XJF A;  1L89 A;  1WQP A;  1L00 A;  262L A;  3W6A A;  3LYT A;  6LYZ A;  4XJG A;  3B72 A;  1L10 A;  1GB3 A;  1B6I A;  4DDB A;  1DYC A;  1T6V L;  1D3F A;  4YX7 C;  1RMU 4;  4WM1 A;  1Z7S 4;  2BQN A;  3VWO A;  1YKZ X;  4GLV A;  3SFE A;  4LZT A;  177L A;  3A8Z A;  3WVY A;  5M1Y A;  3JD7 4;  3RW8 A;  1IP1 A;  2O4W A;  1C6F A;  1INU A;  1YAN A;  2RBO A;  215L A;  1GWD A;  5F9X A;  1GF0 A;  5D5C A;  1RUG 4;  1P7S A;  4EMN A;  4GRV A;  1L58 A;  1IWX A;  8LYZ A;  3C8Q A;  1L09 A;  1L37 A;  1HEP A;  253L A;  3HBH A;  1T97 A;  1L76 A;  1C7P A;  1ASJ 4;  1HEL A;  3ZEK A;  2FBD A;  3DMX A;  1LSE A;  4NFV A;  3WL2 A;  1L21 A;  2WQY A;  5C3J A;  173L A;  5LYM A;  3RZE A;  2ZIK A;  1P6Y A;  3WPJ A;  2BQE A;  3AEC A;  4MR1 A;  1YIK A;  1IR8 A;  1L0J A;  3N9E A;  1CU5 A;  1CU0 A;  4W57 A;  2WDR A;  1YAM A;  1ZVH L;  4NHQ A;  2WP9 A;  172L A;  1JPO A;  2XQO A;  2Y8P A;  1LZD A;  104L A;  1WQO A;  1EQE A;  2D4I A;  1VBB 4;  3HUK A;  5B1G A;  2G4Q A;  2OU9 A;  1LJG A;  4N9R A;  165L A;  1DI4 A;  2CGI A;  1JTO L;  1DPW A;  1B5U A;  1JKD A;  3FAD A;  1ZWN A;  1A2Y C;  4K5Y A;  3W6E A;  1LSG A;  1GF8 A;  1L39 A;  1JUG A;  4ET8 A;  252L A;  2ZWB A;  5FEL A;  2HEF A;  1C08 C;  1BQL Y;  3OK0 A;  3TXK A;  1JWR A;  2BQO A;  3WU8 A;  2DQC Y;  1L02 A;  1C62 A;  2BQC A;  3HBD A;  3NY8 A;  5FDJ A;  3SP3 A;  4Q4V 4;  1JTM A;  1CJ9 A;  1G0L A;  1LHK A;  4NHT A;  3TMW A;  2MEF A;  1QT7 A;  2HUL A;  4YT0 A;  3NY9 A;  1HML A;  1HF4 A;  5B59 A;  4EKQ A;  3W6C A;  1CU6 A;  4QGZ A;  4E97 A;  2Z2E A;  3VR9 A;  3HH4 A;  4I7N A;  4PJ2 C;  3WXT A;  187L A;  1XGU C;  3AEG A;  1B0D A;  1B5X A;  1L19 A;  4G4H A;  1YQ3 A;  1LCN A;  1FLY A;  1OUJ A;  1GE1 A;  2MEE A;  1GD6 A;  1TCY A;  1VAT A;  1D2Y A;  3F8V A;  1UID A;  5LZM A;  2HEB A;  1IX0 A;  3QY4 A;  1LMO A;  1L31 A;  5L3H A;  4OOT A;  2B72 A;  2NTH A;  1L48 A;  4M6D A;  251L A;  1L23 A;  2B6Y A;  1T8G A;  2YBN A;  4J1B A;  255L A;  1XFP L;  3C82 A;  1P36 A;  3A94 A;  3GXK A;  1LJ3 A;  2R04 4;  4H92 A;  3DNA A;  1CV1 A;  3HT8 A;  4Q4X 4;  1JEF A;  5F14 A;  153L A;  2BQJ A;  1QQY A;  1C6D A;  246L A;  1FLU A;  223L A;  3D3D A;  4IAT A;  5DN5 A;  4XJD A;  4EPF A;  4C5F A;  2C8P A;  3AGH A;  2D4J A;  5KXO A;  1B7M A;  1LHI A;  1ZV5 L;  4NGI A;  4ZIX A;  1CU2 A;  1IP2 A;  4TUN A;  4LT1 A;  2B5Z A;  1D3N A;  5AMY A;  1HEO A;  5B07 A;  5LVI A;  1L75 A;  1REX A;  2YBH A;  3A92 A;  3CQL A;  5KXN A;  3D4S A;  232L A;  3WU7 A;  1G7I C;  1L44 A;  1LTM A;  3L64 A;  152L A;  2HEE A;  1IO5 A;  4PK0 A;  4ARP A;  1DYE A;  2B70 A;  5A3E A;  5LIN A;  4ETC A;  2RR1 4;  4W51 A;  2WU5 A;  2RAZ X;  3WW6 A;  1MLC E;  2R06 4;  146L A;  1SWY A;  1YKX X;  1LMP A;  3CT0 A;  4NIJ A;  4W55 A;  234L A;  3OE9 A;  1XGP C;  4I7T A;  1L94 A;  1LZ8 A;  1L32 A;  3V2W A;  1HC0 A;  5IHG A;  3TXD A;  1G0M A;  1GFJ A;  4B4I A;  3P4Q A;  1YKY X;  1HEQ A;  111L A;  1WQQ A;  6LZM A;  1GFV A;  2PZS A;  3LYZ A;  2BQL A;  1D4M 4;  1LYI A;  1TLA A;  1UIG A;  1RJC B;  1QT6 A;  4WMG A;  2WDV A;  205L A;  2ZNX Y;  4WM2 A;  5I4X A;  3EBA B;  4Q4W 4;  1F10 A;  1GB9 A;  3GUL A;  1GB0 A;  2RBN A;  183L A;  4HSF A;  1LJF A;  3AE1 A;  1JJ0 A;  227L A;  5F9U A;  1AKI A;  4LGK A;  1PQM A;  4N8Z A;  5KXT A;  2PYJ A;  4KX6 A;  1GB6 A;  2Z37 A;  1T8A A;  1VBD 4;  2DQH Y;  1LSP A;  4AQN A;  1UC0 A;  4YEO A;  1XEJ A;  4ARQ A;  4IJ4 A;  4II8 A;  1LGX A;  1PS5 A;  1QTZ A;  4DT3 A;  4GB3 4;  1GFT A;  2RBP A;  1L73 A;  5KXS A;  199L A;  2R7F A;  5L9J A;  258L A;  2B74 A;  4DD3 A;  1EQ4 A;  4W52 A;  2RB0 X;  4XJH A;  3DN1 A;  4GCD A;  1CX7 A;  4H9F A;  1GB5 A;  5I54 A;  1REY A;  1GBZ A;  1OP9 B;  3A34 A;  3AE2 A;  1K28 A;  4LYC A;  1LZY A;  1YL0 X;  3A6B Y;  1IWW A;  4H9E A;  3HU9 A;  1L45 A;  2ANX A;  1KXX A;  2RSC A;  1IWY A;  5HMV A;  2FBB A;  1D6Q A;  3WPL A;  2IFF Y;  3LYM A;  1CV6 A;  4EKP A;  1L81 A;  5EBH A;  2B75 A;  2WDQ A;  189L A;  4NGK A;  139L A;  3RU5 A;  2W1X A;  4HTK A;  3SN6 R;  5FST A;  4DC4 A;  4I7K A;  1QT4 A;  2DKV A;  2OE7 X;  1L96 A;  1B5Z A;  1L11 A;  1B7S A;  1L07 A;  4I7P A;  2XBR A;  2IGC A;  1LSA A;  1GAZ A;  1WVV A;  248L A;  1QTV A;  1JSE A;  3GQK A;  1QUH A;  2HEA A;  7LZM A;  4NHS A;  3RUN A;  1RUF 4;  1HXS 4;  3GUM A;  4WL6 A;  3WUM A;  5A3Z A;  2ZYP A;  1W6Z A;  2DQD Y;  2BQM A;  1GE0 A;  1PIV 4;  1NHE A;  4PRU A;  2Z6B A;  2HTX A;  4H1P A;  1P5C A;  2H5Z A;  1L08 A;  3CDV A;  4L41 A;  4LDE A;  3TMU A;  2BLY A;  4LT2 A;  1VFB C;  1VDQ A;  5KXX A;  4ARJ A;  237L A;  3DN6 A;  2I26 L;  3AE7 A;  1OUB A;  1QTH A;  1UBZ A;  3DN3 A;  3TXH A;  1KW7 A;  1B7N A;  3A96 A;  1O23 A;  3PDS A;  4I7O A;  1LSM A;  1LAA A;  1L52 A;  1TBY A;  4LFP A;  206L A;  1L27 A;  4J1A A;  1LZ1 A;  1KS3 A;  2Z38 A;  3F9L A;  1L62 A;  5KKJ A;  1GBY A;  3N9A A;  1C64 A;  4UWN A;  1QS9 A;  4LFX A;  1L0K A; 
#chains in the Genus database with same CATH homology
 1G0J A;  3AGG G;  2X0A A;  147L A;  2DQI Y;  4HPI A;  1GPQ C;  2W1L A;  1XHX A;  1L03 A;  1JJ1 A;  3C80 A;  3D9A C;  5F16 A;  1IR7 A;  1FLQ A;  3LHM A;  2RH1 A;  1JIY A;  3N9C A;  193L A;  1D3M A;  1BGI A;  1YAP A;  1LMQ A;  4HJZ A;  2Z19 A;  3DKE X;  4OW1 A;  1LW9 A;  1KNI A;  3LZM A;  1P46 A;  4WO6 A;  3QE8 A;  1UIB A;  4DDA A;  3QAK A;  3IWR A;  1L91 A;  1OVJ A;  118L A;  1IOC A;  3DN4 A;  1L46 A;  4WO9 A;  140L A;  4DD1 A;  1L80 A;  3TXG A;  1L97 A;  1HSW A;  4YOP A;  2BQG A;  1D0M A;  1FKV A;  1HHL A;  4LT0 A;  1L35 A;  1JKA A;  1GFG A;  2MED A;  112L A;  1C6L A;  4H9I A;  5C6L A;  2BQF A;  1GDW A;  162L A;  4ETD A;  1F0W A;  2DQG Y;  1QS5 A;  4CGE A;  1HNL A;  1CVK A;  3GUP A;  3HTB A;  1G1W A;  3HTG A;  2BLX A;  4H91 A;  1QUT A;  157L A;  4WLX A;  4MCK A;  2C8O A;  1LZR A;  1L71 A;  2PYL A;  1IR9 A;  238L A;  1JSF A;  1IC7 Y;  3P4Z A;  1BB4 A;  1VED A;  1UCO A;  178L A;  1L01 A;  1WQR A;  3HH6 A;  1LSD A;  1QUO A;  4YEM A;  3AGI A;  3CSZ A;  4DD7 A;  1L30 A;  2DBT A;  4DD9 A;  1LZA A;  4OOO A;  4AXT A;  1BWH A;  2RB1 X;  4BAD A;  2NTG A;  1GXX A;  2F32 A;  5KXW A;  1L14 A;  1EQ5 A;  225L A;  4PGJ B;  2ZNW Y;  1GF5 A;  5APD A;  1C6B A;  2W1M A;  2I6Z A;  1NBY C;  3AZ5 A;  1L26 A;  1D3J A;  1REM A;  1JIT A;  2BQB A;  2DQE Y;  4G9S A;  2F2Q A;  3L2X A;  240L A;  1WQN A;  4R0F A;  5LXW A;  4ETE A;  1PZY A;  1OUE A;  2GV0 A;  4KPM A;  2OE4 X;  4PJZ A;  1LJJ A;  4KXI A;  3CDT A;  254L A;  1IOT A;  1L36 A;  228L A;  2CJL A;  1WTM A;  1CU3 A;  1NF5 A;  1LJ4 A;  4WM4 A;  3DN0 A;  1B5W A;  1LOZ A;  1G7L C;  4FDY A;  1H87 A;  137L A;  1L83 A;  113L A;  4KL7 A;  4RW1 A;  1LSF A;  181L A;  1YAQ A;  1DKJ A;  2RBS A;  2YVB A;  2BQA A;  2BPU A;  1LZS A;  1XJT A;  3M18 B;  3GUI A;  1L33 A;  1HEN A;  1GF6 A;  1CJ7 A;  3ZVQ A;  2F2N A;  241L A;  3C7W A;  3FI7 A;  259L A;  5APC A;  1SSW A;  1C6E A;  102L A;  1B7R A;  1YL1 X;  3ULR A;  3RZ4 A;  1LYD A;  4R6C A;  4B4J A;  1LPI A;  3K3T A;  4ARM B;  1C61 A;  4CFP A;  1HEM A;  1L34 A;  3SBA A;  4WOA A;  4ARL A;  2AUB A;  1NBZ C;  3W6F A;  1LSB A;  4OWH A;  4J7V A;  1C6A A;  1Z55 A;  3AZ7 A;  2OTZ X;  3A90 A;  1D0L A;  1CV4 A;  1XEP A;  4OWB A;  5C6J A;  131L A;  1QDT A;  1L57 A;  4O34 A;  218L A;  3ZVQ B;  1LZ9 A;  250L A;  5LYZ A;  1LSY A;  1UA6 Y;  2OE9 X;  3W6B A;  1LI3 A;  2F30 A;  219L A;  1SSY A;  1SX2 A;  3JR6 A;  1SWZ A;  1NDG C;  1L79 A;  3J6K A;  4LYB A;  1L74 A;  120L A;  4A7D A;  1CJ6 A;  1AM7 A;  1XSF A;  4CHX A;  1LMN A;  222L A;  1L82 A;  1JQU A;  2D6B A;  1KW5 A;  5HNC A;  2YBJ A;  4RLM A;  1IP3 A;  2MEI A;  1L59 A;  5DN4 A;  1CNS A;  4ZPU A;  4DAJ A;  5I14 A;  1DXJ A;  4ANR A;  2VB1 A;  1C6Q A;  1KY1 A;  1L47 A;  4LYZ A;  4QEQ A;  3HDF A;  239L A;  1W08 A;  3A3R X;  1BB6 A;  3HU8 A;  175L A;  188L A;  5LVK A;  4HJY A;  1OUD A;  3T36 A;  107L A;  4XJB A;  4XN6 A;  2F47 A;  261L A;  1B7O A;  4TTD A;  161L A;  1B9O A;  169L A;  4LZM A;  4GBR B;  5I5Q A;  3WVX A;  4LYO A;  3HTD A;  1GF7 A;  1GFU A;  2LYM A;  3SB9 A;  2CDS A;  5ILC A;  1D0K A;  4NG8 A;  4QDN A;  1LZ6 A;  1L51 A;  211L A;  1C69 A;  4GN3 A;  4XYY A;  229L A;  3IJV A;  249L A;  231L A;  1L53 A;  2B6X A;  3WXU A;  1E8L A;  1OUF A;  2HED A;  4H94 A;  1PQD A;  5DL9 A;  166L A;  2Z2F A;  4NGL A;  244L A;  170L A;  3AW7 A;  4HPE A;  1LHH A;  3G3A B;  4Z41 A;  1TEW A;  3G3V A;  108L A;  1GFA A;  114L A;  2A4T A;  1LMC A;  1IP7 A;  1XEK A;  1GF9 A;  4NSG A;  4LYM A;  1L04 A;  3EML A;  3AYQ A;  4WM3 A;  4NGZ A;  1UIC A;  4WLY A;  1CV0 A;  1QT5 A;  1L13 A;  1OQM A;  3CT1 A;  5KXP A;  5LVH A;  4DQJ A;  3HBE X;  3LYO A;  2ANV A;  3KAM A;  4N1C C;  2XBS A;  1JKC A;  1GFH A;  1L92 A;  2LHM A;  4NG1 A;  2B6Z A;  5KKI A;  1T8F A;  2H9K A;  4NSI A;  1QSB A;  1RE2 A;  1L20 A;  1LJE A;  1L41 A;  247L A;  2MEH A;  3W6D A;  1ZVY B;  4W94 A;  3BKV A;  4CFO A;  1HEW A;  115L A;  1KIR C;  1IVM A;  1F6R A;  1C68 A;  3HUQ A;  1CUP A;  2Z18 A;  126L A;  3WUA A;  4YM8 A;  5FEK A;  1KY0 A;  2LYZ A;  4EKR A;  4LYT A;  3B0I A;  4OWA A;  1IWV A;  4YF2 A;  2DQJ Y;  2EIZ C;  4EXM A;  1IC4 Y;  1TDY A;  2RBR A;  1LI6 A;  1CTW A;  154L A;  4GLA A;  3RNX A;  142L A;  1CV5 A;  2MEG A;  151L A;  1GHL A;  4UWV A;  4AGA A;  159L A;  2OU0 X;  1G06 A;  1IP4 A;  2MEB A;  3J4G A;  1FDL Y;  1UIA A;  1G7H C;  4FJR A;  1SQ2 L;  2ZQ4 A;  4W56 A;  1L70 A;  1GE2 A;  226L A;  1DYF A;  2BQD A;  1NKH A;  2YBM A;  3HTF A;  2FYC A;  5KY1 A;  1H6M A;  4ETA A;  2ZIJ A;  2HU3 A;  3DN8 A;  4H8Y A;  5I53 A;  1DZB X;  216L A;  1LPY A;  3EMS A;  3GUJ A;  1KXY A;  143L A;  1WVU A;  109L A;  130L A;  1GAY A;  2BAA A;  5IDD A;  5HMJ A;  5KXZ A;  191L A;  1L95 A;  242L A;  2HUB A;  1HER A;  4NHP A;  1LYJ A;  3EO5 A;  1L64 A;  1IOQ A;  1L88 A;  3P66 A;  3OE8 A;  3UON A;  4OWC A;  1QDR A;  133L A;  230L A;  5K7O A;  4TX7 A;  1LWG A;  1QSW A;  4OWE A;  1KIP C;  4G4B A;  2CWI A;  3A67 Y;  3TXB A;  1LZB A;  1AZF A;  1LJK A;  4H90 A;  5LAG A;  158L A;  182L A;  5ILF A;  1L84 A;  1WTN A;  2D4K A;  5LA8 A;  1IIZ A;  1LJN A;  1L17 A;  2PC2 A;  3OE6 A;  3AJN A;  1P37 A;  6LYT A;  4DKL A;  1N4F A;  3SBB C;  9LYZ A;  1OV5 A;  168L A;  1L54 A;  4GN4 A;  4I7L A;  3P64 A;  3P68 A;  4EKS A;  3MGW A;  5LIO A;  4I7Q A;  149L A;  3TXJ A;  1DYA A;  1L90 A;  3B6L A;  1C6C A;  1XGR C;  1B7Q A;  4DD2 A;  1D6P A;  2OTY X;  3OJP A;  4H9A A;  5IEL A;  1VDS A;  2L78 A;  4RDS A;  5KXL A;  3ATO A;  1LKS A;  5HLL A;  1SLY A;  2OU8 A;  1B7P A;  2B73 A;  1L22 A;  1GF4 A;  4M4O A;  4UWU A;  4I7M A;  3DMZ A;  160L A;  2EPE A;  1QTC A;  3AB6 A;  2B6T A;  198L A;  1L85 A;  4NWE A;  1DYG A;  2ZYC A;  4H8X A;  1C66 A;  3HFM Y;  4YXA C;  5B1F A;  3HUA A;  1DKK A;  2YDG A;  1CKG A;  1L49 A;  1L66 A;  2B7X A;  4NGY A;  3HDE A;  1LYF A;  4W58 A;  1GF3 A;  3WU9 A;  4G49 A;  1G0Q A;  3AZ6 A;  4ML7 A;  1DQJ C;  1BB3 A;  1C6M A;  1C6J A;  2OEA X;  1GFK A;  3C8S A;  221L A;  4I7R A;  233L A;  2W1Y A;  3CDR A;  2LZT A;  1L77 A;  4EOF A;  212L A;  4W96 A;  201L A;  1J1P Y;  217L A;  1GE3 A;  3GUN A;  4I0C A;  1C6I A;  1L72 A;  3AZ4 A;  4H93 A;  245L A;  2RBQ A;  4GCC A;  185L A;  2G4P A;  2BQK A;  4IAP A;  4WM6 A;  1L24 A;  5KXY A;  1A4V A;  1QTD A;  1L60 A;  1DPX A;  2A7D A;  1WTH A;  127L A;  132L A;  4GCE A;  1D2W A;  1LZ5 A;  3TXE A;  1JTP L;  4P2E A;  3V2Y A;  1C6G A;  1IP6 A;  2HUK A;  1RCM A;  1G1V A;  4XJI A;  1C67 A;  1NDM C;  1BB7 A;  3B0K A;  3LN2 A;  1UIH A;  1QUS A;  2O79 A;  1EL1 A;  1LZC A;  1JTT L;  1GXV 2;  1JJ3 A;  3QNG A;  1GBO A;  163L A;  3TMX A;  4W54 A;  5II3 A;  1T6H A;  2MEC A;  1L05 A;  1HSX A;  1HFX A;  1QTK A;  5T3F A;  5KXR A;  5L3I A;  1BWJ A;  1KXW A;  3HT6 A;  3LZ2 A;  4ZEE A;  164L A;  4Z98 A;  3SB7 A;  3WYH A;  1L06 A;  4NWH A;  3B0O A;  1DI3 A;  1L68 A;  220L A;  1C46 A;  2LC9 A;  4NY5 A;  5B06 A;  3TMV A;  1YQV Y;  1LMT A;  3G3B B;  1LHM A;  5FCP A;  4GN5 C;  2Q0M X;  4EPI A;  3EXD A;  1QUD A;  2RB2 X;  1L40 A;  4DJH A;  1OYU A;  1L15 A;  4HTN A;  1LZE A;  184L A;  1G0K A;  1L86 A;  1L38 A;  2HUM A;  4ARM A;  1IY4 A;  4MST A;  4DYG A;  1FKQ A;  125L A;  1CKC A;  1L25 A;  1IC5 Y;  4S0W A;  2HEC A;  1C6K A;  195L A;  1LMA A;  1I56 A;  1REZ A;  4B0D A;  3HH5 A;  1GEZ A;  5FHW A;  122L A;  1LYZ A;  2HU1 A;  4NGJ A;  2A7F A;  1CV3 A;  5LVJ A;  1GFE A;  3HWL A;  3FA0 A;  4TSB A;  4Z46 A;  5I4Y A;  145L A;  4LT3 A;  1RI8 B;  1L29 A;  3C83 A;  1C63 A;  4HTQ A;  3A3Q A;  2O7A A;  1D9U A;  1J1O Y;  3C7Z A;  1L87 A;  1QT3 A;  1OWZ A;  2IHL A;  110L A;  1GDX A;  4D9Z A;  3ATN A;  1LSC A;  1IY3 A;  1QSA A;  1C43 A;  103L A;  2NWD X;  2QAR C;  1LYY A;  3HT9 A;  4I8S A;  1C60 A;  4X3B A;  2I25 L;  1LGW A;  1CX6 A;  171L A;  4OO9 A;  3AW6 A;  7LYZ A;  4HP0 A;  1OUH A;  197L A;  1JHL A;  156L A;  4NSH A;  4Z3M A;  1XGQ C;  4N1E I;  1MEL L;  1GB7 A;  3TXF A;  1B2K A;  4RLN A;  5LYT A;  236L A;  129L A;  1IOS A;  2RAY X;  1G7J C;  1VDP A;  1OV7 A;  1C10 A;  1BB5 A;  1QTB A;  128L A;  1AT5 A;  1NMM A;  4TWS A;  2QB0 B;  3CSR A;  1CKF A;  4NSJ A;  5LA5 A;  3WH1 A;  3RT5 X;  1CJ8 A;  1L50 A;  1I20 A;  1G07 A;  4LDO A;  1TAY A;  2DQF C;  4G4C A;  1LYG A;  3DMV A;  4PHI A;  2DQA A;  4DWX A;  1B5V A;  3WPK A;  4BAF A;  1C6H A;  1LI2 A;  1KIQ C;  3GUO A;  1QIO A;  3FE0 A;  5KXM A;  1GEV A;  2ZQ3 A;  1CKH A;  135L A;  1RFP A;  4PRQ A;  1C45 A;  1C65 A;  3W3E A;  5B05 A;  2PW9 A;  1OUG A;  3WUN A;  3A95 A;  3NYA A;  4DD0 A;  2LZM A;  1LYO A;  1P2L A;  5JEN B;  4QY9 A;  148L E;  1FLW A;  4W59 A;  3SB5 A;  3CDQ A;  2Q9E A;  4N0J A;  4BAP A;  4DQ7 A;  256L A;  2Z39 A;  2WAR A;  3DN2 A;  4GCB A;  1L67 A;  4B49 A;  1L61 A;  3PBL A;  1L93 A;  1HMK A;  4E3U A;  5KJ9 A;  1P56 A;  1LHJ A;  1J1X Y;  2BQI A;  4HJV A;  2H9J A;  3M3U A;  1XEI A;  4NHI A;  3C7Y A;  5F81 A;  1BWI A;  123L A;  4ZFP A;  4ETB A;  3CT5 A;  1VDT A;  210L A;  2YBI A;  1OVK A;  2EX3 A;  1JTN A;  4DQ5 A;  5HNL A;  1GB8 A;  176L A;  3HT7 A;  3A6C Y;  1PQO A;  4XEN A;  1DI5 A;  192L A;  1LSN A;  1XJU A;  1BVX A;  3P65 A;  2G4N A;  1YRO A;  1XGT C;  5DLA A;  1GFR A;  3G3W A;  1ZYT A;  2F4A A;  1ZMY L;  1G7M C;  2Q9D A;  1L18 A;  5KXK A;  1LKR A;  3ODU A;  1LZ4 A;  3A91 A;  200L A;  1LYS A;  1P3N A;  1LHL A;  1LLH A;  1IP5 A;  2ZIL A;  4WG1 A;  1C6N A;  4H8Z A;  1UIF A;  2YSS C;  1SX7 A;  4N5R A;  3CDO A;  1D9W A;  1PQJ A;  1L12 A;  1PQK A;  1OUA A;  1NQI A;  4NEB A;  3CSQ A;  4W53 A;  4WG7 A;  224L A;  1ALC A;  190L A;  1BVK C;  1XI1 A;  1LJH A;  1G0P A;  3A93 A;  4H9C A;  1UUZ C;  1B7L A;  4U3X B;  3GXR A;  1P64 A;  1NWG A;  5APF A;  3E3D A;  5LAF A;  5I4W A;  2LZ2 A;  4XAD A;  1QTE A;  134L A;  1L56 A;  1C6P A;  1LZN A;  2LCB A;  1B5Y A;  4B1A A;  3GUK A;  1GBS A;  1DYB A;  5LVG A;  180L A;  213L A;  4ARQ B;  2D91 A;  4B4E A;  5J7C A;  4NGW A;  2N5Z A;  1AT6 A;  1JIS A;  1V7T A;  4LDL A;  1QT8 A;  1L98 A;  2MEA A;  1GBW A;  186L A;  1EPY A;  1T3P A;  4BS7 A;  1LJI A;  4TSC A;  5D5F A;  3WUL A;  1LYE A;  1IEE A;  1L16 A;  208L A;  4PPO A;  3CB7 A;  167L A;  1LYH A;  1CUQ A;  1I1Z A;  1IWU A;  4DDC A;  119L A;  3T6U A;  2FYD A;  3C8R A;  1UIE A;  2EKS C;  3BKH A;  196L A;  2F4G A;  4EJ4 A;  1I6S A;  3SB6 A;  1P2R A;  3G3X A;  1GE4 A;  2CUU A;  1IWZ A;  194L A;  1OUC A;  1FN5 A;  4HV1 A;  5DM9 A;  3WMK A;  174L A;  4H9B A;  1L28 A;  1OUI A;  150L A;  1VAU A;  1LZG A;  1L55 A;  2XJW A;  1HFZ A;  1IOR A;  2EQL A;  4NGV A;  2PY5 A;  1L65 A;  1L43 A;  4NGO A;  144L A;  3LZT A;  1OVH A;  2XTH A;  1C6T A;  2BQH A;  4CJ2 A;  1ZUR A;  4I7J A;  257L A;  1FBI X;  5APE A;  1LWK A;  1XHZ A;  4H9H A;  243L A;  214L A;  1GBX A;  1F6S A;  1HFY A;  3TXI A;  4HV2 A;  3K2R A;  3F6Z A;  3IJU A;  4RW2 A;  1L42 A;  4C3W A;  1L99 A;  1PQI A;  1BHZ A;  209L A;  3FI5 A;  1LSZ A;  1GB2 A;  4I7S A;  1LGU A;  2LYO A;  4ET9 A;  1V7S A;  3WW5 A;  1P2C C;  2B6W A;  4WLD A;  4KT3 A;  3VW7 A;  3SB8 A;  1IWT A;  1QUG A;  4WLT A;  4WL7 A;  5C6I A;  1G0G A;  4WM5 A;  5E4P A;  4GCF A;  1YAO A;  1JKB A;  3OE0 A;  4IAS A;  1CKD A;  235L A;  207L A;  1WQM A;  1YIL A;  3HH3 A;  2Z12 A;  5HQ1 A;  260L A;  1QSQ A;  141L A;  4J0L A;  4YXC A;  1LZT A;  1DYD A;  138L A;  3C81 A;  2YBL A;  5E9R A;  155L A;  1L63 A;  4YEN A;  1OWY A;  1NHB A;  1UAC Y;  1L69 A;  4XJF A;  1L89 A;  1WQP A;  1L00 A;  262L A;  3W6A A;  3LYT A;  6LYZ A;  4XJG A;  3B72 A;  1L10 A;  1GB3 A;  1B6I A;  4DDB A;  1DYC A;  1T6V L;  1D3F A;  4YX7 C;  4WM1 A;  2BQN A;  3VWO A;  1YKZ X;  4GLV A;  4LZT A;  177L A;  3A8Z A;  3WVY A;  5M1Y A;  3RW8 A;  1IP1 A;  2O4W A;  1C6F A;  1INU A;  1YAN A;  2RBO A;  215L A;  1GWD A;  5F9X A;  1GF0 A;  5D5C A;  1P7S A;  4EMN A;  4GRV A;  1L58 A;  1IWX A;  8LYZ A;  3C8Q A;  1L09 A;  1L37 A;  1HEP A;  253L A;  3HBH A;  1T97 A;  1L76 A;  1C7P A;  1HEL A;  3ZEK A;  2FBD A;  3DMX A;  1LSE A;  4NFV A;  3WL2 A;  1L21 A;  173L A;  5LYM A;  3RZE A;  2ZIK A;  1P6Y A;  3WPJ A;  2BQE A;  4MR1 A;  1YIK A;  1IR8 A;  1L0J A;  3N9E A;  1CU5 A;  1CU0 A;  4W57 A;  1YAM A;  1ZVH L;  4NHQ A;  172L A;  1JPO A;  2XQO A;  2Y8P A;  1LZD A;  104L A;  1WQO A;  1EQE A;  2D4I A;  3HUK A;  5B1G A;  2G4Q A;  2OU9 A;  1LJG A;  4N9R A;  165L A;  1DI4 A;  2CGI A;  1JTO L;  1DPW A;  1B5U A;  1JKD A;  3FAD A;  1ZWN A;  1A2Y C;  4K5Y A;  3W6E A;  1LSG A;  1GF8 A;  1L39 A;  1JUG A;  4ET8 A;  252L A;  2ZWB A;  5FEL A;  2HEF A;  1C08 C;  1BQL Y;  3OK0 A;  3TXK A;  1JWR A;  2BQO A;  3WU8 A;  2DQC Y;  1L02 A;  1C62 A;  2BQC A;  3HBD A;  3NY8 A;  5FDJ A;  3SP3 A;  1JTM A;  1CJ9 A;  1G0L A;  1LHK A;  4NHT A;  3TMW A;  2MEF A;  1QT7 A;  2HUL A;  3NY9 A;  1HML A;  1HF4 A;  5B59 A;  4EKQ A;  3W6C A;  1CU6 A;  4QGZ A;  4E97 A;  2Z2E A;  3HH4 A;  4I7N A;  4PJ2 C;  3WXT A;  187L A;  1XGU C;  1B0D A;  1B5X A;  1L19 A;  4G4H A;  1LCN A;  1FLY A;  1OUJ A;  1GE1 A;  2MEE A;  1GD6 A;  1TCY A;  1VAT A;  1D2Y A;  3F8V A;  1UID A;  5LZM A;  2HEB A;  1IX0 A;  3QY4 A;  1LMO A;  1L31 A;  5L3H A;  4OOT A;  2B72 A;  2NTH A;  1L48 A;  4M6D A;  251L A;  1L23 A;  2B6Y A;  1T8G A;  2YBN A;  4J1B A;  255L A;  1XFP L;  3C82 A;  1P36 A;  3A94 A;  3GXK A;  1LJ3 A;  4H92 A;  3DNA A;  1CV1 A;  3HT8 A;  1JEF A;  5F14 A;  153L A;  2BQJ A;  1QQY A;  1C6D A;  246L A;  1FLU A;  223L A;  3D3D A;  4IAT A;  5DN5 A;  4XJD A;  4EPF A;  4C5F A;  2C8P A;  3AGH A;  2D4J A;  5KXO A;  1B7M A;  1LHI A;  1ZV5 L;  4NGI A;  4ZIX A;  1CU2 A;  1IP2 A;  4TUN A;  4LT1 A;  2B5Z A;  1D3N A;  5AMY A;  1HEO A;  5B07 A;  5LVI A;  1L75 A;  1REX A;  2YBH A;  3A92 A;  3CQL A;  5KXN A;  3D4S A;  232L A;  3WU7 A;  1G7I C;  1L44 A;  1LTM A;  3L64 A;  152L A;  2HEE A;  1IO5 A;  4PK0 A;  4ARP A;  1DYE A;  2B70 A;  5A3E A;  5LIN A;  4ETC A;  4W51 A;  2RAZ X;  3WW6 A;  1MLC E;  146L A;  1SWY A;  1YKX X;  1LMP A;  3CT0 A;  4NIJ A;  4W55 A;  234L A;  3OE9 A;  1XGP C;  4I7T A;  1L94 A;  1LZ8 A;  1L32 A;  3V2W A;  1HC0 A;  5IHG A;  3TXD A;  1G0M A;  1GFJ A;  4B4I A;  1YKY X;  1HEQ A;  111L A;  1WQQ A;  6LZM A;  1GFV A;  2PZS A;  3LYZ A;  2BQL A;  1LYI A;  1TLA A;  1UIG A;  1RJC B;  1QT6 A;  4WMG A;  205L A;  2ZNX Y;  4WM2 A;  5I4X A;  3EBA B;  1F10 A;  1GB9 A;  3GUL A;  1GB0 A;  2RBN A;  183L A;  4HSF A;  1LJF A;  1JJ0 A;  227L A;  5F9U A;  1AKI A;  4LGK A;  1PQM A;  4N8Z A;  5KXT A;  2PYJ A;  1GB6 A;  2Z37 A;  1T8A A;  2DQH Y;  1LSP A;  4AQN A;  1UC0 A;  4YEO A;  1XEJ A;  4ARQ A;  4IJ4 A;  4II8 A;  1LGX A;  1PS5 A;  1QTZ A;  4DT3 A;  1GFT A;  2RBP A;  1L73 A;  5KXS A;  199L A;  2R7F A;  5L9J A;  258L A;  2B74 A;  4DD3 A;  1EQ4 A;  4W52 A;  2RB0 X;  4XJH A;  3DN1 A;  4GCD A;  1CX7 A;  4H9F A;  1GB5 A;  5I54 A;  1REY A;  1GBZ A;  1OP9 B;  3A34 A;  1K28 A;  4LYC A;  1LZY A;  1YL0 X;  3A6B Y;  1IWW A;  4H9E A;  3HU9 A;  1L45 A;  2ANX A;  1KXX A;  2RSC A;  1IWY A;  5HMV A;  2FBB A;  1D6Q A;  3WPL A;  2IFF Y;  3LYM A;  1CV6 A;  4EKP A;  1L81 A;  5EBH A;  2B75 A;  189L A;  4NGK A;  139L A;  3RU5 A;  2W1X A;  4HTK A;  3SN6 R;  5FST A;  4DC4 A;  4I7K A;  1QT4 A;  2DKV A;  2OE7 X;  1L96 A;  1B5Z A;  1L11 A;  1B7S A;  1L07 A;  4I7P A;  2XBR A;  2IGC A;  1LSA A;  1GAZ A;  1WVV A;  248L A;  1QTV A;  1JSE A;  1QUH A;  2HEA A;  7LZM A;  4NHS A;  3RUN A;  3GUM A;  4WL6 A;  3WUM A;  5A3Z A;  2ZYP A;  1W6Z A;  2DQD Y;  2BQM A;  1GE0 A;  1NHE A;  4PRU A;  2Z6B A;  2HTX A;  4H1P A;  1P5C A;  2H5Z A;  1L08 A;  3CDV A;  4L41 A;  4LDE A;  3TMU A;  2BLY A;  4LT2 A;  1VFB C;  1VDQ A;  5KXX A;  4ARJ A;  237L A;  3DN6 A;  2I26 L;  1OUB A;  1QTH A;  1UBZ A;  3DN3 A;  3TXH A;  1KW7 A;  1B7N A;  3A96 A;  1O23 A;  3PDS A;  4I7O A;  1LSM A;  1LAA A;  1L52 A;  1TBY A;  4LFP A;  206L A;  1L27 A;  4J1A A;  1LZ1 A;  1KS3 A;  2Z38 A;  3F9L A;  1L62 A;  5KKJ A;  1GBY A;  3N9A A;  1C64 A;  4UWN A;  1QS9 A;  4LFX A;  1L0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...