1ASJ4

P1/mahoney poliovirus, at cryogenic temperature
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
b'GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1asj400
2PLV4 1D4M4 2RS14 1RVF4 1PO24 1VBA4 1RUC4 2R044 1HXS4 1R094 2R064 2RR14 2RS34 1MQTD 4Q4Y4 1HRV4 4Q4X4 1BEV4 1AR64 3JBG4 1HRI4 4RHV4 1VBB4 2RS54 1PVC4 4PDWD 1K5MD 1RUD4 1RMU4 1AR94 1NA1D 1ASJ4 1AR84 1AR74 1R084 1RUE4 1VBE4 1VBD4 1VRH4 1Z7S4 2X5ID 1OOPD 4Q4V4 1PIV4 1RUI4 4GB34 1POV0 1RUH4 3J8F4 1RUJ4 1NCQD 2RM24 3JD74 1H8TD 2RMU4 1PO14 2HWC4 1AL24 1RUF4 1VBC4 1EV14 1EAH4 2R074 2HWB4 1COV4 1RUG4 1RHI4 4Q4W4
chains in the Genus database with same CATH superfamily
3VR8A 1KF6A 1RVF4 4Q4X4 1ZOYA 2RS34 1BEV4 3AE3A 1XI1A 2B76A 3JBG4 1PVC4 1ZP0A 3AE9A 2WS3A 3ABVA 1NA1D 3AEDA 1KFYA 1VBE4 1VBD4 3AE5A 1XHZA 3SFDA 1OOPD 1RUI4 1RUH4 3AE6A 3AE7A 1RUJ4 3GQHA 1PO14 2WDQA 3AEGA 3AEAA 1VBC4 2WU5A 2R064 4YXDA 3AE8A 1PO24 1VBA4 1RUC4 2R044 1R094 4Q4Y4 2H89A 3VRAA 1MQTD 3P4QA 1HRI4 3CIRA 3AE1A 1RUD4 4YTPA 2PYLA 1NENA 1AR84 1R084 1RUE4 1Z7S4 4Q4V4 2EX3A 3AEEA 4GB34 3SUCA 2RMU4 3P4PA 1RUG4 2HWC4 1RUF4 1EAH4 2R074 2HWB4 2WDVA 1COV4 3AEFA 3VR9A 1YQ3A 3SFEA 3P4SA 1HXS4 4YTNA 3GQKA 2WDRA 1AR64 2PZSA 3AEBA 4KX6A 3P4RA 2PY5A 1AR74 2WP9A 2ACZA 5C3JA 4YSZA 2PW9A 1POV0 3FI7A 2RM24 1NCQD 3JD74 5C2TA 1AL24 1NEKA 1L0VA 1AR94 4YSYA 2WQYA 1RHI4 4Q4W4 2PLV4 1D4M4 2RS14 2RR14 1XHXA 4YSXA 1HRV4 1YQ4A 2R7FA 3AECA 4RHV4 1VBB4 2RS54 4PDWD 1K5MD 1RMU4 1ASJ4 3AE4A 3AE2A 3VRBA 2X5ID 1PIV4 3J8F4 2H88A 1H8TD 2WU2A 4YT0A 2FBWA 2PYJA 1EV14 4YTMA 1VRH4
chains in the Genus database with same CATH topology
2PLV4 1D4M4 2RS14 1RVF4 1PO24 1VBA4 1RUC4 2R044 1HXS4 1R094 2R064 2RR14 2RS34 1MQTD 4Q4Y4 1HRV4 4Q4X4 1BEV4 1AR64 3JBG4 1HRI4 4RHV4 1VBB4 2RS54 1PVC4 4PDWD 1K5MD 1RUD4 1RMU4 1AR94 1NA1D 1ASJ4 1AR84 1AR74 1R084 1RUE4 1VBE4 1VBD4 1VRH4 1Z7S4 2X5ID 1OOPD 4Q4V4 1PIV4 1RUI4 4GB34 1POV0 1RUH4 3J8F4 1RUJ4 1NCQD 2RM24 3JD74 1H8TD 2RMU4 1PO14 2HWC4 1AL24 1RUF4 1VBC4 1EV14 1EAH4 2R074 2HWB4 1COV4 1RUG4 1RHI4 4Q4W4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLV 4;  1D4M 4;  2RS1 4;  1RVF 4;  1PO2 4;  1VBA 4;  1RUC 4;  2R04 4;  1HXS 4;  1R09 4;  2R06 4;  2RR1 4;  2RS3 4;  1MQT D;  4Q4Y 4;  1HRV 4;  4Q4X 4;  1BEV 4;  1AR6 4;  3JBG 4;  1HRI 4;  4RHV 4;  1VBB 4;  2RS5 4;  1PVC 4;  4PDW D;  1K5M D;  1RUD 4;  1RMU 4;  1AR9 4;  1NA1 D;  1ASJ 4;  1AR8 4;  1AR7 4;  1R08 4;  1RUE 4;  1VBE 4;  1VBD 4;  1VRH 4;  1Z7S 4;  2X5I D;  1OOP D;  4Q4V 4;  1PIV 4;  1RUI 4;  4GB3 4;  1POV 0;  1RUH 4;  3J8F 4;  1RUJ 4;  1NCQ D;  2RM2 4;  3JD7 4;  1H8T D;  2RMU 4;  1PO1 4;  2HWC 4;  1AL2 4;  1RUF 4;  1VBC 4;  1EV1 4;  1EAH 4;  2R07 4;  2HWB 4;  1COV 4;  1RUG 4;  1RHI 4;  4Q4W 4; 
#chains in the Genus database with same CATH topology
 3VR8 A;  1KF6 A;  1RVF 4;  4Q4X 4;  1ZOY A;  2RS3 4;  1BEV 4;  3AE3 A;  1XI1 A;  2B76 A;  3JBG 4;  1PVC 4;  1ZP0 A;  3AE9 A;  2WS3 A;  3ABV A;  1NA1 D;  3AED A;  1KFY A;  1VBE 4;  1VBD 4;  3AE5 A;  1XHZ A;  3SFD A;  1OOP D;  1RUI 4;  1RUH 4;  3AE6 A;  3AE7 A;  1RUJ 4;  3GQH A;  1PO1 4;  2WDQ A;  3AEG A;  3AEA A;  1VBC 4;  2WU5 A;  2R06 4;  4YXD A;  3AE8 A;  1PO2 4;  1VBA 4;  1RUC 4;  2R04 4;  1R09 4;  4Q4Y 4;  2H89 A;  3VRA A;  1MQT D;  3P4Q A;  1HRI 4;  3CIR A;  3AE1 A;  1RUD 4;  4YTP A;  2PYL A;  1NEN A;  1AR8 4;  1R08 4;  1RUE 4;  1Z7S 4;  4Q4V 4;  2EX3 A;  3AEE A;  4GB3 4;  3SUC A;  2RMU 4;  3P4P A;  1RUG 4;  2HWC 4;  1RUF 4;  1EAH 4;  2R07 4;  2HWB 4;  2WDV A;  1COV 4;  3AEF A;  3VR9 A;  1YQ3 A;  3SFE A;  3P4S A;  1HXS 4;  4YTN A;  3GQK A;  2WDR A;  1AR6 4;  2PZS A;  3AEB A;  4KX6 A;  3P4R A;  2PY5 A;  1AR7 4;  2WP9 A;  2ACZ A;  5C3J A;  4YSZ A;  2PW9 A;  1POV 0;  3FI7 A;  2RM2 4;  1NCQ D;  3JD7 4;  5C2T A;  1AL2 4;  1NEK A;  1L0V A;  1AR9 4;  4YSY A;  2WQY A;  1RHI 4;  4Q4W 4;  2PLV 4;  1D4M 4;  2RS1 4;  2RR1 4;  1XHX A;  4YSX A;  1HRV 4;  1YQ4 A;  2R7F A;  3AEC A;  4RHV 4;  1VBB 4;  2RS5 4;  4PDW D;  1K5M D;  1RMU 4;  1ASJ 4;  3AE4 A;  3AE2 A;  3VRB A;  2X5I D;  1PIV 4;  3J8F 4;  2H88 A;  1H8T D;  2WU2 A;  4YT0 A;  2FBW A;  2PYJ A;  1EV1 4;  4YTM A;  1VRH 4; 
#chains in the Genus database with same CATH homology
 2PLV 4;  1D4M 4;  2RS1 4;  1RVF 4;  1PO2 4;  1VBA 4;  1RUC 4;  2R04 4;  1HXS 4;  1R09 4;  2R06 4;  2RR1 4;  2RS3 4;  1MQT D;  4Q4Y 4;  1HRV 4;  4Q4X 4;  1BEV 4;  1AR6 4;  3JBG 4;  1HRI 4;  4RHV 4;  1VBB 4;  2RS5 4;  1PVC 4;  4PDW D;  1K5M D;  1RUD 4;  1RMU 4;  1AR9 4;  1NA1 D;  1ASJ 4;  1AR8 4;  1AR7 4;  1R08 4;  1RUE 4;  1VBE 4;  1VBD 4;  1VRH 4;  1Z7S 4;  2X5I D;  1OOP D;  4Q4V 4;  1PIV 4;  1RUI 4;  4GB3 4;  1POV 0;  1RUH 4;  3J8F 4;  1RUJ 4;  1NCQ D;  2RM2 4;  3JD7 4;  1H8T D;  2RMU 4;  1PO1 4;  2HWC 4;  1AL2 4;  1RUF 4;  1VBC 4;  1EV1 4;  1EAH 4;  2R07 4;  2HWB 4;  1COV 4;  1RUG 4;  1RHI 4;  4Q4W 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...