1ASJ4

P1/mahoney poliovirus, at cryogenic temperature
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1asj400
1RVF4 1AR84 1POV0 1VBA4 1RUH4 2RM24 1RUG4 4GB34 1VBB4 2RS14 4Q4Y4 1RUI4 1VRH4 1K5MD 1AR94 3JBG4 1RHI4 1COV4 1OOPD 1D4M4 2R074 4Q4W4 4Q4V4 1AR74 1RUD4 1EV14 1AL24 1RMU4 1VBC4 1PO24 1MQTD 1VBE4 1R084 1PVC4 1EAH4 2RS54 1HRI4 3J8F4 1ASJ4 4PDWD 2RR14 1Z7S4 2RMU4 3JD74 2HWC4 1HRV4 1PO14 1BEV4 2X5ID 1NCQD 1H8TD 4Q4X4 1VBD4 1HXS4 2HWB4 1RUJ4 2PLV4 1R094 1AR64 1NA1D 1RUC4 1RUE4 2R044 2RS34 1PIV4 1RUF4 4RHV4 2R064
chains in the Genus database with same CATH superfamily
3GQHA 1AR84 1VBB4 2RS14 3CIRA 3AE7A 1VRH4 1K5MD 1AR94 1COV4 1D4M4 4Q4W4 4YSXA 1RMU4 2H88A 3AE6A 3VR8A 1PVC4 3J8F4 4PDWD 3VR9A 4YSZA 1KF6A 1KFYA 4Q4X4 1YQ3A 1AR64 3AEFA 2R044 2PZSA 1RUF4 4YTMA 1RUH4 3P4RA 1ZP0A 4GB34 3AEAA 3GQKA 4YTNA 3FI7A 1RUD4 1EV14 1AL24 5C3JA 2WDRA 1MQTD 1VBE4 2PYJA 1EAH4 3AE9A 3AEGA 1ASJ4 2ACZA 2RR14 3AEBA 1HRV4 2WU5A 1NCQD 1L0VA 1H8TD 3AECA 3AEEA 3P4SA 2WU2A 1HXS4 4YSYA 2B76A 2WQYA 2RS34 1PIV4 4KX6A 3P4PA 1RVF4 2RM24 1RUG4 4YTPA 4Q4Y4 1RUI4 3SUCA 2PYLA 3SFDA 3VRBA 4Q4V4 1YQ4A 1AR74 1XHXA 1PO24 1R084 5C2TA 3AE5A 2RS54 3VRAA 1HRI4 3AE3A 1Z7S4 2X5ID 3ABVA 1R094 1XI1A 3AE2A 3AEDA 3SFEA 1NA1D 3AE4A 1NENA 2R064 2R7FA 3P4QA 1POV0 1VBA4 2EX3A 4YXDA 2PY5A 2WDQA 1RHI4 2R074 1OOPD 2WP9A 2WDVA 1VBC4 1NEKA 3AE8A 2PW9A 2H89A 2WS3A 3AE1A 1ZOYA 3JD74 2RMU4 4YT0A 2HWC4 1PO14 1BEV4 2FBWA 1VBD4 2HWB4 1RUJ4 2PLV4 1XHZA 1RUE4 1RUC4 3JBG4 4RHV4
chains in the Genus database with same CATH topology
1RVF4 1AR84 1POV0 1VBA4 1RUH4 2RM24 1RUG4 4GB34 1VBB4 2RS14 4Q4Y4 1RUI4 1VRH4 1K5MD 1AR94 3JBG4 1RHI4 1COV4 1OOPD 1D4M4 2R074 4Q4W4 4Q4V4 1AR74 1RUD4 1EV14 1AL24 1RMU4 1VBC4 1PO24 1MQTD 1VBE4 1R084 1PVC4 1EAH4 2RS54 1HRI4 3J8F4 1ASJ4 4PDWD 2RR14 1Z7S4 2RMU4 3JD74 2HWC4 1HRV4 1PO14 1BEV4 2X5ID 1NCQD 1H8TD 4Q4X4 1VBD4 1HXS4 2HWB4 1RUJ4 2PLV4 1R094 1AR64 1NA1D 1RUC4 1RUE4 2R044 2RS34 1PIV4 1RUF4 4RHV4 2R064
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RVF 4;  1AR8 4;  1POV 0;  1VBA 4;  1RUH 4;  2RM2 4;  1RUG 4;  4GB3 4;  1VBB 4;  2RS1 4;  4Q4Y 4;  1RUI 4;  1VRH 4;  1K5M D;  1AR9 4;  3JBG 4;  1RHI 4;  1COV 4;  1OOP D;  1D4M 4;  2R07 4;  4Q4W 4;  4Q4V 4;  1AR7 4;  1RUD 4;  1EV1 4;  1AL2 4;  1RMU 4;  1VBC 4;  1PO2 4;  1MQT D;  1VBE 4;  1R08 4;  1PVC 4;  1EAH 4;  2RS5 4;  1HRI 4;  3J8F 4;  1ASJ 4;  4PDW D;  2RR1 4;  1Z7S 4;  2RMU 4;  3JD7 4;  2HWC 4;  1HRV 4;  1PO1 4;  1BEV 4;  2X5I D;  1NCQ D;  1H8T D;  4Q4X 4;  1VBD 4;  1HXS 4;  2HWB 4;  1RUJ 4;  2PLV 4;  1R09 4;  1AR6 4;  1NA1 D;  1RUC 4;  1RUE 4;  2R04 4;  2RS3 4;  1PIV 4;  1RUF 4;  4RHV 4;  2R06 4; 
#chains in the Genus database with same CATH topology
 3GQH A;  1AR8 4;  1VBB 4;  2RS1 4;  3CIR A;  3AE7 A;  1VRH 4;  1K5M D;  1AR9 4;  1COV 4;  1D4M 4;  4Q4W 4;  4YSX A;  1RMU 4;  2H88 A;  3AE6 A;  3VR8 A;  1PVC 4;  3J8F 4;  4PDW D;  3VR9 A;  4YSZ A;  1KF6 A;  1KFY A;  4Q4X 4;  1YQ3 A;  1AR6 4;  3AEF A;  2R04 4;  2PZS A;  1RUF 4;  4YTM A;  1RUH 4;  3P4R A;  1ZP0 A;  4GB3 4;  3AEA A;  3GQK A;  4YTN A;  3FI7 A;  1RUD 4;  1EV1 4;  1AL2 4;  5C3J A;  2WDR A;  1MQT D;  1VBE 4;  2PYJ A;  1EAH 4;  3AE9 A;  3AEG A;  1ASJ 4;  2ACZ A;  2RR1 4;  3AEB A;  1HRV 4;  2WU5 A;  1NCQ D;  1L0V A;  1H8T D;  3AEC A;  3AEE A;  3P4S A;  2WU2 A;  1HXS 4;  4YSY A;  2B76 A;  2WQY A;  2RS3 4;  1PIV 4;  4KX6 A;  3P4P A;  1RVF 4;  2RM2 4;  1RUG 4;  4YTP A;  4Q4Y 4;  1RUI 4;  3SUC A;  2PYL A;  3SFD A;  3VRB A;  4Q4V 4;  1YQ4 A;  1AR7 4;  1XHX A;  1PO2 4;  1R08 4;  5C2T A;  3AE5 A;  2RS5 4;  3VRA A;  1HRI 4;  3AE3 A;  1Z7S 4;  2X5I D;  3ABV A;  1R09 4;  1XI1 A;  3AE2 A;  3AED A;  3SFE A;  1NA1 D;  3AE4 A;  1NEN A;  2R06 4;  2R7F A;  3P4Q A;  1POV 0;  1VBA 4;  2EX3 A;  4YXD A;  2PY5 A;  2WDQ A;  1RHI 4;  2R07 4;  1OOP D;  2WP9 A;  2WDV A;  1VBC 4;  1NEK A;  3AE8 A;  2PW9 A;  2H89 A;  2WS3 A;  3AE1 A;  1ZOY A;  3JD7 4;  2RMU 4;  4YT0 A;  2HWC 4;  1PO1 4;  1BEV 4;  2FBW A;  1VBD 4;  2HWB 4;  1RUJ 4;  2PLV 4;  1XHZ A;  1RUE 4;  1RUC 4;  3JBG 4;  4RHV 4; 
#chains in the Genus database with same CATH homology
 1RVF 4;  1AR8 4;  1POV 0;  1VBA 4;  1RUH 4;  2RM2 4;  1RUG 4;  4GB3 4;  1VBB 4;  2RS1 4;  4Q4Y 4;  1RUI 4;  1VRH 4;  1K5M D;  1AR9 4;  3JBG 4;  1RHI 4;  1COV 4;  1OOP D;  1D4M 4;  2R07 4;  4Q4W 4;  4Q4V 4;  1AR7 4;  1RUD 4;  1EV1 4;  1AL2 4;  1RMU 4;  1VBC 4;  1PO2 4;  1MQT D;  1VBE 4;  1R08 4;  1PVC 4;  1EAH 4;  2RS5 4;  1HRI 4;  3J8F 4;  1ASJ 4;  4PDW D;  2RR1 4;  1Z7S 4;  2RMU 4;  3JD7 4;  2HWC 4;  1HRV 4;  1PO1 4;  1BEV 4;  2X5I D;  1NCQ D;  1H8T D;  4Q4X 4;  1VBD 4;  1HXS 4;  2HWB 4;  1RUJ 4;  2PLV 4;  1R09 4;  1AR6 4;  1NA1 D;  1RUC 4;  1RUE 4;  2R04 4;  2RS3 4;  1PIV 4;  1RUF 4;  4RHV 4;  2R06 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...