1ASJ4

P1/mahoney poliovirus, at cryogenic temperature
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
molecule tags Virus
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1asj400
1NCQD 1RUD4 1RUH4 1EV14 1OOPD 1VBB4 1AR74 1RUI4 1PIV4 4Q4W4 2RS14 2RS54 1RMU4 4GB34 1PVC4 1RUG4 1EAH4 1VBA4 1VBD4 1VRH4 1POV0 1MQTD 2RM24 2R064 4PDWD 1VBE4 1AR84 1NA1D 1RHI4 1RVF4 1PO24 4Q4X4 2PLV4 1RUE4 1VBC4 4RHV4 1AR94 1RUF4 3JD74 1BEV4 2RMU4 1R094 2R044 2RR14 3JBG4 1AL24 1COV4 1Z7S4 1RUC4 2R074 4Q4Y4 1ASJ4 1HXS4 1H8TD 1D4M4 1R084 1HRV4 4Q4V4 3J8F4 1RUJ4 2RS34 2X5ID 1K5MD 2HWB4 1HRI4 1PO14 2HWC4 1AR64
chains in the Genus database with same CATH superfamily
1NCQD 1RUH4 2EX3A 1EV14 1OOPD 4YXDA 1AR74 1ZP0A 1PIV4 4YT0A 4Q4W4 2RS14 2PZSA 3AE3A 2RM24 2PYLA 3AEBA 3FI7A 1AR84 1RHI4 3AE7A 1RUE4 1AR94 3AE8A 3SFEA 3JD74 2RMU4 2R044 2B76A 3VRAA 1RUC4 1HRV4 3J8F4 3P4RA 2PYJA 3SUCA 3AE9A 3ABVA 3VR9A 1RMU4 4GB34 1VBA4 1MQTD 4KX6A 1XI1A 1NA1D 1RVF4 1KFYA 1RUF4 1YQ3A 1AL24 1COV4 4YTMA 1Z7S4 1ASJ4 1D4M4 2ACZA 3AEDA 3VRBA 2RS34 3P4PA 3AEAA 2X5ID 1K5MD 2HWB4 1XHXA 1PO14 2HWC4 2WP9A 2H89A 2RS54 1PVC4 1KF6A 1EAH4 1VRH4 1VBE4 3SFDA 1PO24 4RHV4 1VBC4 1YQ4A 5C3JA 2WU2A 3AE4A 2PY5A 1BEV4 2WU5A 2RR14 3JBG4 4YSYA 4YTPA 1HXS4 1H8TD 3P4QA 1RUJ4 3AE2A 3P4SA 3AECA 3GQHA 1HRI4 1XHZA 1AR64 3AEFA 1RUD4 1VBB4 2WDVA 1RUI4 2FBWA 2PW9A 2H88A 1RUG4 1VBD4 3AE1A 1POV0 4PDWD 2R064 4YSXA 2WDRA 1NEKA 3AE6A 2WQYA 2WDQA 2WS3A 4Q4X4 2PLV4 3GQKA 1R094 4YTNA 1L0VA 2R074 4Q4Y4 3AE5A 1R084 3AEGA 4Q4V4 2R7FA 3VR8A 5C2TA 1NENA 1ZOYA 3CIRA 4YSZA 3AEEA
chains in the Genus database with same CATH topology
1NCQD 1RUD4 1RUH4 1EV14 1OOPD 1VBB4 1AR74 1RUI4 1PIV4 4Q4W4 2RS14 2RS54 1RMU4 4GB34 1PVC4 1RUG4 1EAH4 1VBA4 1VBD4 1VRH4 1POV0 1MQTD 2RM24 2R064 4PDWD 1VBE4 1AR84 1NA1D 1RHI4 1RVF4 1PO24 4Q4X4 2PLV4 1RUE4 1VBC4 4RHV4 1AR94 1RUF4 3JD74 1BEV4 2RMU4 1R094 2R044 2RR14 3JBG4 1AL24 1COV4 1Z7S4 1RUC4 2R074 4Q4Y4 1ASJ4 1HXS4 1H8TD 1D4M4 1R084 1HRV4 4Q4V4 3J8F4 1RUJ4 2RS34 2X5ID 1K5MD 2HWB4 1HRI4 1PO14 2HWC4 1AR64
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCQ D;  1RUD 4;  1RUH 4;  1EV1 4;  1OOP D;  1VBB 4;  1AR7 4;  1RUI 4;  1PIV 4;  4Q4W 4;  2RS1 4;  2RS5 4;  1RMU 4;  4GB3 4;  1PVC 4;  1RUG 4;  1EAH 4;  1VBA 4;  1VBD 4;  1VRH 4;  1POV 0;  1MQT D;  2RM2 4;  2R06 4;  4PDW D;  1VBE 4;  1AR8 4;  1NA1 D;  1RHI 4;  1RVF 4;  1PO2 4;  4Q4X 4;  2PLV 4;  1RUE 4;  1VBC 4;  4RHV 4;  1AR9 4;  1RUF 4;  3JD7 4;  1BEV 4;  2RMU 4;  1R09 4;  2R04 4;  2RR1 4;  3JBG 4;  1AL2 4;  1COV 4;  1Z7S 4;  1RUC 4;  2R07 4;  4Q4Y 4;  1ASJ 4;  1HXS 4;  1H8T D;  1D4M 4;  1R08 4;  1HRV 4;  4Q4V 4;  3J8F 4;  1RUJ 4;  2RS3 4;  2X5I D;  1K5M D;  2HWB 4;  1HRI 4;  1PO1 4;  2HWC 4;  1AR6 4; 
#chains in the Genus database with same CATH topology
 1NCQ D;  1RUH 4;  2EX3 A;  1EV1 4;  1OOP D;  4YXD A;  1AR7 4;  1ZP0 A;  1PIV 4;  4YT0 A;  4Q4W 4;  2RS1 4;  2PZS A;  3AE3 A;  2RM2 4;  2PYL A;  3AEB A;  3FI7 A;  1AR8 4;  1RHI 4;  3AE7 A;  1RUE 4;  1AR9 4;  3AE8 A;  3SFE A;  3JD7 4;  2RMU 4;  2R04 4;  2B76 A;  3VRA A;  1RUC 4;  1HRV 4;  3J8F 4;  3P4R A;  2PYJ A;  3SUC A;  3AE9 A;  3ABV A;  3VR9 A;  1RMU 4;  4GB3 4;  1VBA 4;  1MQT D;  4KX6 A;  1XI1 A;  1NA1 D;  1RVF 4;  1KFY A;  1RUF 4;  1YQ3 A;  1AL2 4;  1COV 4;  4YTM A;  1Z7S 4;  1ASJ 4;  1D4M 4;  2ACZ A;  3AED A;  3VRB A;  2RS3 4;  3P4P A;  3AEA A;  2X5I D;  1K5M D;  2HWB 4;  1XHX A;  1PO1 4;  2HWC 4;  2WP9 A;  2H89 A;  2RS5 4;  1PVC 4;  1KF6 A;  1EAH 4;  1VRH 4;  1VBE 4;  3SFD A;  1PO2 4;  4RHV 4;  1VBC 4;  1YQ4 A;  5C3J A;  2WU2 A;  3AE4 A;  2PY5 A;  1BEV 4;  2WU5 A;  2RR1 4;  3JBG 4;  4YSY A;  4YTP A;  1HXS 4;  1H8T D;  3P4Q A;  1RUJ 4;  3AE2 A;  3P4S A;  3AEC A;  3GQH A;  1HRI 4;  1XHZ A;  1AR6 4;  3AEF A;  1RUD 4;  1VBB 4;  2WDV A;  1RUI 4;  2FBW A;  2PW9 A;  2H88 A;  1RUG 4;  1VBD 4;  3AE1 A;  1POV 0;  4PDW D;  2R06 4;  4YSX A;  2WDR A;  1NEK A;  3AE6 A;  2WQY A;  2WDQ A;  2WS3 A;  4Q4X 4;  2PLV 4;  3GQK A;  1R09 4;  4YTN A;  1L0V A;  2R07 4;  4Q4Y 4;  3AE5 A;  1R08 4;  3AEG A;  4Q4V 4;  2R7F A;  3VR8 A;  5C2T A;  1NEN A;  1ZOY A;  3CIR A;  4YSZ A;  3AEE A; 
#chains in the Genus database with same CATH homology
 1NCQ D;  1RUD 4;  1RUH 4;  1EV1 4;  1OOP D;  1VBB 4;  1AR7 4;  1RUI 4;  1PIV 4;  4Q4W 4;  2RS1 4;  2RS5 4;  1RMU 4;  4GB3 4;  1PVC 4;  1RUG 4;  1EAH 4;  1VBA 4;  1VBD 4;  1VRH 4;  1POV 0;  1MQT D;  2RM2 4;  2R06 4;  4PDW D;  1VBE 4;  1AR8 4;  1NA1 D;  1RHI 4;  1RVF 4;  1PO2 4;  4Q4X 4;  2PLV 4;  1RUE 4;  1VBC 4;  4RHV 4;  1AR9 4;  1RUF 4;  3JD7 4;  1BEV 4;  2RMU 4;  1R09 4;  2R04 4;  2RR1 4;  3JBG 4;  1AL2 4;  1COV 4;  1Z7S 4;  1RUC 4;  2R07 4;  4Q4Y 4;  1ASJ 4;  1HXS 4;  1H8T D;  1D4M 4;  1R08 4;  1HRV 4;  4Q4V 4;  3J8F 4;  1RUJ 4;  2RS3 4;  2X5I D;  1K5M D;  2HWB 4;  1HRI 4;  1PO1 4;  2HWC 4;  1AR6 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...