1RUG4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rug400
1POV0 2RS34 2R044 1VBD4 1EV14 2HWC4 4Q4V4 1MQTD 1PVC4 1RUC4 2PLV4 4Q4X4 1VBA4 1ASJ4 1VBB4 1K5MD 1RUD4 1Z7S4 3JD74 1HRI4 1RUG4 1AR84 2RR14 3J8F4 1HRV4 1HXS4 1BEV4 4PDWD 4Q4W4 1NA1D 1COV4 2R074 1RUH4 2HWB4 1PO14 2RS54 1D4M4 1RHI4 3JBG4 1RMU4 1PO24 2RM24 1VBE4 1PIV4 1RUJ4 1R094 1RUF4 1AL24 1RVF4 1VBC4 1EAH4 1VRH4 2R064 4GB34 4Q4Y4 1AR94 1AR74 1RUE4 1NCQD 1RUI4 2X5ID 2RS14 2RMU4 1OOPD 1H8TD 4RHV4 1AR64 1R084
chains in the Genus database with same CATH superfamily
1POV0 1VBD4 1EV14 2HWC4 4Q4V4 3SFDA 2WDVA 4YTMA 3AE9A 3J8F4 1NENA 1NA1D 2PW9A 1RUH4 2HWB4 4KX6A 1H8TD 2EX3A 3FI7A 1RHI4 4YT0A 1RMU4 2FBWA 3P4RA 4YXDA 2RM24 1PIV4 3GQKA 4GB34 3AE8A 3VR8A 4YSZA 2X5ID 2RS14 2WP9A 2R044 1MQTD 2PLV4 3AE6A 2PY5A 1VBA4 1VBB4 1RUD4 3JD74 3AEBA 1RUG4 2RR14 3AE7A 3GQHA 1HRV4 2PYLA 1BEV4 4YSXA 1COV4 2R7FA 1D4M4 3JBG4 3AE1A 1RUF4 1XHZA 2R064 3P4QA 1NCQD 2PYJA 2WDQA 3SFEA 1AL24 2PZSA 2H88A 2RS34 1KFYA 2H89A 2WU2A 3VRBA 1PVC4 3AE2A 1XI1A 2B76A 5C3JA 1KF6A 1K5MD 2WU5A 3VR9A 3AEAA 1XHXA 3AEDA 4YTNA 2R074 3SUCA 1PO14 1NEKA 3VRAA 2RS54 1PO24 1RUJ4 1VBC4 1RVF4 4Q4Y4 2ACZA 1AR94 4YSYA 1AR74 1RUI4 1L0VA 2RMU4 1OOPD 4PDWD 2WS3A 3CIRA 3AE4A 1RUC4 5C2TA 4Q4X4 1ASJ4 1Z7S4 3AECA 1HRI4 1AR84 1HXS4 1ZOYA 3P4PA 3AE5A 1YQ4A 4Q4W4 1ZP0A 3P4SA 1VBE4 3ABVA 1R094 3AE3A 1VRH4 1EAH4 2WDRA 3AEFA 2WQYA 4YTPA 1RUE4 3AEGA 3AEEA 1YQ3A 4RHV4 1AR64 1R084
chains in the Genus database with same CATH topology
1POV0 2RS34 2R044 1VBD4 1EV14 2HWC4 4Q4V4 1MQTD 1PVC4 1RUC4 2PLV4 4Q4X4 1VBA4 1ASJ4 1VBB4 1K5MD 1RUD4 1Z7S4 3JD74 1HRI4 1RUG4 1AR84 2RR14 3J8F4 1HRV4 1HXS4 1BEV4 4PDWD 4Q4W4 1NA1D 1COV4 2R074 1RUH4 2HWB4 1PO14 2RS54 1D4M4 1RHI4 3JBG4 1RMU4 1PO24 2RM24 1VBE4 1PIV4 1RUJ4 1R094 1RUF4 1AL24 1RVF4 1VBC4 1EAH4 1VRH4 2R064 4GB34 4Q4Y4 1AR94 1AR74 1RUE4 1NCQD 1RUI4 2X5ID 2RS14 2RMU4 1OOPD 1H8TD 4RHV4 1AR64 1R084
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POV 0;  2RS3 4;  2R04 4;  1VBD 4;  1EV1 4;  2HWC 4;  4Q4V 4;  1MQT D;  1PVC 4;  1RUC 4;  2PLV 4;  4Q4X 4;  1VBA 4;  1ASJ 4;  1VBB 4;  1K5M D;  1RUD 4;  1Z7S 4;  3JD7 4;  1HRI 4;  1RUG 4;  1AR8 4;  2RR1 4;  3J8F 4;  1HRV 4;  1HXS 4;  1BEV 4;  4PDW D;  4Q4W 4;  1NA1 D;  1COV 4;  2R07 4;  1RUH 4;  2HWB 4;  1PO1 4;  2RS5 4;  1D4M 4;  1RHI 4;  3JBG 4;  1RMU 4;  1PO2 4;  2RM2 4;  1VBE 4;  1PIV 4;  1RUJ 4;  1R09 4;  1RUF 4;  1AL2 4;  1RVF 4;  1VBC 4;  1EAH 4;  1VRH 4;  2R06 4;  4GB3 4;  4Q4Y 4;  1AR9 4;  1AR7 4;  1RUE 4;  1NCQ D;  1RUI 4;  2X5I D;  2RS1 4;  2RMU 4;  1OOP D;  1H8T D;  4RHV 4;  1AR6 4;  1R08 4; 
#chains in the Genus database with same CATH topology
 1POV 0;  1VBD 4;  1EV1 4;  2HWC 4;  4Q4V 4;  3SFD A;  2WDV A;  4YTM A;  3AE9 A;  3J8F 4;  1NEN A;  1NA1 D;  2PW9 A;  1RUH 4;  2HWB 4;  4KX6 A;  1H8T D;  2EX3 A;  3FI7 A;  1RHI 4;  4YT0 A;  1RMU 4;  2FBW A;  3P4R A;  4YXD A;  2RM2 4;  1PIV 4;  3GQK A;  4GB3 4;  3AE8 A;  3VR8 A;  4YSZ A;  2X5I D;  2RS1 4;  2WP9 A;  2R04 4;  1MQT D;  2PLV 4;  3AE6 A;  2PY5 A;  1VBA 4;  1VBB 4;  1RUD 4;  3JD7 4;  3AEB A;  1RUG 4;  2RR1 4;  3AE7 A;  3GQH A;  1HRV 4;  2PYL A;  1BEV 4;  4YSX A;  1COV 4;  2R7F A;  1D4M 4;  3JBG 4;  3AE1 A;  1RUF 4;  1XHZ A;  2R06 4;  3P4Q A;  1NCQ D;  2PYJ A;  2WDQ A;  3SFE A;  1AL2 4;  2PZS A;  2H88 A;  2RS3 4;  1KFY A;  2H89 A;  2WU2 A;  3VRB A;  1PVC 4;  3AE2 A;  1XI1 A;  2B76 A;  5C3J A;  1KF6 A;  1K5M D;  2WU5 A;  3VR9 A;  3AEA A;  1XHX A;  3AED A;  4YTN A;  2R07 4;  3SUC A;  1PO1 4;  1NEK A;  3VRA A;  2RS5 4;  1PO2 4;  1RUJ 4;  1VBC 4;  1RVF 4;  4Q4Y 4;  2ACZ A;  1AR9 4;  4YSY A;  1AR7 4;  1RUI 4;  1L0V A;  2RMU 4;  1OOP D;  4PDW D;  2WS3 A;  3CIR A;  3AE4 A;  1RUC 4;  5C2T A;  4Q4X 4;  1ASJ 4;  1Z7S 4;  3AEC A;  1HRI 4;  1AR8 4;  1HXS 4;  1ZOY A;  3P4P A;  3AE5 A;  1YQ4 A;  4Q4W 4;  1ZP0 A;  3P4S A;  1VBE 4;  3ABV A;  1R09 4;  3AE3 A;  1VRH 4;  1EAH 4;  2WDR A;  3AEF A;  2WQY A;  4YTP A;  1RUE 4;  3AEG A;  3AEE A;  1YQ3 A;  4RHV 4;  1AR6 4;  1R08 4; 
#chains in the Genus database with same CATH homology
 1POV 0;  2RS3 4;  2R04 4;  1VBD 4;  1EV1 4;  2HWC 4;  4Q4V 4;  1MQT D;  1PVC 4;  1RUC 4;  2PLV 4;  4Q4X 4;  1VBA 4;  1ASJ 4;  1VBB 4;  1K5M D;  1RUD 4;  1Z7S 4;  3JD7 4;  1HRI 4;  1RUG 4;  1AR8 4;  2RR1 4;  3J8F 4;  1HRV 4;  1HXS 4;  1BEV 4;  4PDW D;  4Q4W 4;  1NA1 D;  1COV 4;  2R07 4;  1RUH 4;  2HWB 4;  1PO1 4;  2RS5 4;  1D4M 4;  1RHI 4;  3JBG 4;  1RMU 4;  1PO2 4;  2RM2 4;  1VBE 4;  1PIV 4;  1RUJ 4;  1R09 4;  1RUF 4;  1AL2 4;  1RVF 4;  1VBC 4;  1EAH 4;  1VRH 4;  2R06 4;  4GB3 4;  4Q4Y 4;  1AR9 4;  1AR7 4;  1RUE 4;  1NCQ D;  1RUI 4;  2X5I D;  2RS1 4;  2RMU 4;  1OOP D;  1H8T D;  4RHV 4;  1AR6 4;  1R08 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...