1RUG4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rug400
1EV14 1NA1D 1RUF4 2X5ID 1AR64 1VRH4 2R074 1PO14 1AR84 1Z7S4 4Q4V4 1RVF4 1RHI4 1H8TD 1VBB4 1ASJ4 1RUD4 1NCQD 2RS34 1VBC4 4Q4W4 4PDWD 2RS14 3J8F4 2HWC4 1RUH4 1RUI4 1VBE4 2RS54 1R084 1K5MD 4Q4X4 1AR94 3JD74 2RMU4 1HRI4 1EAH4 1HRV4 1VBA4 1BEV4 1RMU4 1OOPD 1PIV4 1POV0 1COV4 2R044 4Q4Y4 2R064 2RR14 4GB34 4RHV4 1RUJ4 1RUC4 1RUG4 1VBD4 1R094 1AR74 1PVC4 1RUE4 3JBG4 1AL24 2HWB4 2RM24 1D4M4 1MQTD 1HXS4 2PLV4 1PO24
chains in the Genus database with same CATH superfamily
1NA1D 1AR64 3FI7A 1YQ3A 1Z7S4 3AE4A 1YQ4A 2WU2A 3P4QA 2WQYA 3ABVA 1XI1A 1RUD4 3SFDA 4Q4X4 1K5MD 2H89A 1HRV4 1VBA4 2PY5A 3AEGA 4YTPA 1ZOYA 1D4M4 3P4PA 1RUF4 5C2TA 2R074 3AE8A 1PO14 4Q4V4 1RVF4 2WDVA 3AE1A 4YXDA 1ASJ4 2RS34 1VBC4 2FBWA 4PDWD 1RUH4 1RUI4 1EAH4 1BEV4 1OOPD 2WDRA 3SFEA 4Q4Y4 2R064 1RUJ4 3AEDA 1PVC4 1RUE4 3JBG4 1AL24 3VR9A 1NENA 3AEFA 2R7FA 2PLV4 1EV14 1AR84 4KX6A 1RHI4 1H8TD 1XHZA 1KF6A 1VBB4 3AEEA 1NCQD 1XHXA 4Q4W4 2WP9A 2WU5A 2RS14 3J8F4 2HWC4 2RS54 1VBE4 2ACZA 4YSXA 1AR94 3JD74 3AE3A 4YSYA 3AE5A 1POV0 2RR14 4RHV4 3AE7A 1RUC4 1RUG4 1VBD4 3VRBA 4YSZA 1ZP0A 3P4SA 2HWB4 1MQTD 1HXS4 2H88A 1PO24 2X5ID 1VRH4 2PW9A 3AEBA 4YTNA 3CIRA 2WS3A 3AE2A 3GQKA 1KFYA 1NEKA 3AE6A 3AE9A 2PZSA 2B76A 1R084 4YT0A 3AECA 2RMU4 1HRI4 3AEAA 3SUCA 1RMU4 1PIV4 2R044 1COV4 4GB34 2EX3A 3GQHA 3VR8A 5C3JA 1R094 1AR74 3P4RA 3VRAA 2RM24 1L0VA 2PYJA 4YTMA 2WDQA 2PYLA
chains in the Genus database with same CATH topology
1EV14 1NA1D 1RUF4 2X5ID 1AR64 1VRH4 2R074 1PO14 1AR84 1Z7S4 4Q4V4 1RVF4 1RHI4 1H8TD 1VBB4 1ASJ4 1RUD4 1NCQD 2RS34 1VBC4 4Q4W4 4PDWD 2RS14 3J8F4 2HWC4 1RUH4 1RUI4 1VBE4 2RS54 1R084 1K5MD 4Q4X4 1AR94 3JD74 2RMU4 1HRI4 1EAH4 1HRV4 1VBA4 1BEV4 1RMU4 1OOPD 1PIV4 1POV0 1COV4 2R044 4Q4Y4 2R064 2RR14 4GB34 4RHV4 1RUJ4 1RUC4 1RUG4 1VBD4 1R094 1AR74 1PVC4 1RUE4 3JBG4 1AL24 2HWB4 2RM24 1D4M4 1MQTD 1HXS4 2PLV4 1PO24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV1 4;  1NA1 D;  1RUF 4;  2X5I D;  1AR6 4;  1VRH 4;  2R07 4;  1PO1 4;  1AR8 4;  1Z7S 4;  4Q4V 4;  1RVF 4;  1RHI 4;  1H8T D;  1VBB 4;  1ASJ 4;  1RUD 4;  1NCQ D;  2RS3 4;  1VBC 4;  4Q4W 4;  4PDW D;  2RS1 4;  3J8F 4;  2HWC 4;  1RUH 4;  1RUI 4;  1VBE 4;  2RS5 4;  1R08 4;  1K5M D;  4Q4X 4;  1AR9 4;  3JD7 4;  2RMU 4;  1HRI 4;  1EAH 4;  1HRV 4;  1VBA 4;  1BEV 4;  1RMU 4;  1OOP D;  1PIV 4;  1POV 0;  1COV 4;  2R04 4;  4Q4Y 4;  2R06 4;  2RR1 4;  4GB3 4;  4RHV 4;  1RUJ 4;  1RUC 4;  1RUG 4;  1VBD 4;  1R09 4;  1AR7 4;  1PVC 4;  1RUE 4;  3JBG 4;  1AL2 4;  2HWB 4;  2RM2 4;  1D4M 4;  1MQT D;  1HXS 4;  2PLV 4;  1PO2 4; 
#chains in the Genus database with same CATH topology
 1NA1 D;  1AR6 4;  3FI7 A;  1YQ3 A;  1Z7S 4;  3AE4 A;  1YQ4 A;  2WU2 A;  3P4Q A;  2WQY A;  3ABV A;  1XI1 A;  1RUD 4;  3SFD A;  4Q4X 4;  1K5M D;  2H89 A;  1HRV 4;  1VBA 4;  2PY5 A;  3AEG A;  4YTP A;  1ZOY A;  1D4M 4;  3P4P A;  1RUF 4;  5C2T A;  2R07 4;  3AE8 A;  1PO1 4;  4Q4V 4;  1RVF 4;  2WDV A;  3AE1 A;  4YXD A;  1ASJ 4;  2RS3 4;  1VBC 4;  2FBW A;  4PDW D;  1RUH 4;  1RUI 4;  1EAH 4;  1BEV 4;  1OOP D;  2WDR A;  3SFE A;  4Q4Y 4;  2R06 4;  1RUJ 4;  3AED A;  1PVC 4;  1RUE 4;  3JBG 4;  1AL2 4;  3VR9 A;  1NEN A;  3AEF A;  2R7F A;  2PLV 4;  1EV1 4;  1AR8 4;  4KX6 A;  1RHI 4;  1H8T D;  1XHZ A;  1KF6 A;  1VBB 4;  3AEE A;  1NCQ D;  1XHX A;  4Q4W 4;  2WP9 A;  2WU5 A;  2RS1 4;  3J8F 4;  2HWC 4;  2RS5 4;  1VBE 4;  2ACZ A;  4YSX A;  1AR9 4;  3JD7 4;  3AE3 A;  4YSY A;  3AE5 A;  1POV 0;  2RR1 4;  4RHV 4;  3AE7 A;  1RUC 4;  1RUG 4;  1VBD 4;  3VRB A;  4YSZ A;  1ZP0 A;  3P4S A;  2HWB 4;  1MQT D;  1HXS 4;  2H88 A;  1PO2 4;  2X5I D;  1VRH 4;  2PW9 A;  3AEB A;  4YTN A;  3CIR A;  2WS3 A;  3AE2 A;  3GQK A;  1KFY A;  1NEK A;  3AE6 A;  3AE9 A;  2PZS A;  2B76 A;  1R08 4;  4YT0 A;  3AEC A;  2RMU 4;  1HRI 4;  3AEA A;  3SUC A;  1RMU 4;  1PIV 4;  2R04 4;  1COV 4;  4GB3 4;  2EX3 A;  3GQH A;  3VR8 A;  5C3J A;  1R09 4;  1AR7 4;  3P4R A;  3VRA A;  2RM2 4;  1L0V A;  2PYJ A;  4YTM A;  2WDQ A;  2PYL A; 
#chains in the Genus database with same CATH homology
 1EV1 4;  1NA1 D;  1RUF 4;  2X5I D;  1AR6 4;  1VRH 4;  2R07 4;  1PO1 4;  1AR8 4;  1Z7S 4;  4Q4V 4;  1RVF 4;  1RHI 4;  1H8T D;  1VBB 4;  1ASJ 4;  1RUD 4;  1NCQ D;  2RS3 4;  1VBC 4;  4Q4W 4;  4PDW D;  2RS1 4;  3J8F 4;  2HWC 4;  1RUH 4;  1RUI 4;  1VBE 4;  2RS5 4;  1R08 4;  1K5M D;  4Q4X 4;  1AR9 4;  3JD7 4;  2RMU 4;  1HRI 4;  1EAH 4;  1HRV 4;  1VBA 4;  1BEV 4;  1RMU 4;  1OOP D;  1PIV 4;  1POV 0;  1COV 4;  2R04 4;  4Q4Y 4;  2R06 4;  2RR1 4;  4GB3 4;  4RHV 4;  1RUJ 4;  1RUC 4;  1RUG 4;  1VBD 4;  1R09 4;  1AR7 4;  1PVC 4;  1RUE 4;  3JBG 4;  1AL2 4;  2HWB 4;  2RM2 4;  1D4M 4;  1MQT D;  1HXS 4;  2PLV 4;  1PO2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...