1RUG4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rug400
1PIV4 1OOPD 1RUG4 1RUH4 1VBB4 4Q4X4 1H8TD 1VBA4 2HWB4 1BEV4 3JBG4 1R094 1RUI4 2R064 1AL24 1VBE4 2RMU4 1ASJ4 2RS54 1Z7S4 1EV14 1RUJ4 1AR64 1NCQD 2HWC4 4PDWD 2R074 1AR94 1PVC4 1RUF4 4RHV4 2RS34 1VBC4 4Q4V4 2X5ID 1AR74 1D4M4 2R044 1POV0 2RS14 3JD74 1AR84 1PO14 1NA1D 1VRH4 1COV4 3J8F4 2RM24 2RR14 2PLV4 1VBD4 1HRV4 1RHI4 1RUD4 1EAH4 1RVF4 4Q4W4 1RMU4 1PO24 1R084 4GB34 1MQTD 1HRI4 1K5MD 1RUE4 4Q4Y4 1RUC4 1HXS4
chains in the Genus database with same CATH superfamily
3VR9A 2ACZA 1VBB4 1VBA4 3AEEA 1XI1A 1AL24 1ASJ4 3CIRA 2RS54 3ABVA 3AEGA 4YTMA 1KF6A 3VRAA 2PY5A 1PVC4 2WP9A 2RS34 1AR74 2WU2A 1KFYA 1POV0 3AE3A 2B76A 2WDRA 1NA1D 2WQYA 3AE8A 2EX3A 3J8F4 2RM24 2PLV4 1RUD4 1EAH4 4YXDA 2PZSA 1HXS4 1RUG4 3AECA 4Q4X4 1H8TD 3FI7A 3GQKA 5C3JA 1Z7S4 2H89A 1AR64 4PDWD 2R074 3AE7A 1RUF4 4Q4V4 3AEAA 3P4RA 3P4QA 2R044 3AE4A 1VRH4 3SFEA 1VBD4 1XHZA 4Q4W4 1XHXA 1K5MD 3AEDA 3SUCA 2X5ID 1ZOYA 1NEKA 3JBG4 1R094 1RUI4 2R064 3P4PA 3VR8A 3AE1A 2FBWA 2HWC4 2PW9A 1AR94 3VRBA 4YSXA 3AE6A 3P4SA 4RHV4 1ZP0A 1VBC4 3AE5A 1D4M4 2RS14 1AR84 2R7FA 2WS3A 2PYLA 1COV4 2RR14 2WU5A 1HRV4 1RVF4 2PYJA 4YT0A 4YSZA 1NENA 1YQ4A 1MQTD 4GB34 3GQHA 4YTPA 1PIV4 1OOPD 1RUH4 4KX6A 2HWB4 1BEV4 1VBE4 2RMU4 4YTNA 1YQ3A 3AEFA 1EV14 1RUJ4 3SFDA 1NCQD 2WDQA 3AEBA 3AE9A 1L0VA 3JD74 1PO14 3AE2A 2H88A 5C2TA 4YSYA 2WDVA 1RHI4 1RMU4 1PO24 1R084 1HRI4 1RUE4 4Q4Y4 1RUC4
chains in the Genus database with same CATH topology
1PIV4 1OOPD 1RUG4 1RUH4 1VBB4 4Q4X4 1H8TD 1VBA4 2HWB4 1BEV4 3JBG4 1R094 1RUI4 2R064 1AL24 1VBE4 2RMU4 1ASJ4 2RS54 1Z7S4 1EV14 1RUJ4 1AR64 1NCQD 2HWC4 4PDWD 2R074 1AR94 1PVC4 1RUF4 4RHV4 2RS34 1VBC4 4Q4V4 2X5ID 1AR74 1D4M4 2R044 1POV0 2RS14 3JD74 1AR84 1PO14 1NA1D 1VRH4 1COV4 3J8F4 2RM24 2RR14 2PLV4 1VBD4 1HRV4 1RHI4 1RUD4 1EAH4 1RVF4 4Q4W4 1RMU4 1PO24 1R084 4GB34 1MQTD 1HRI4 1K5MD 1RUE4 4Q4Y4 1RUC4 1HXS4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIV 4;  1OOP D;  1RUG 4;  1RUH 4;  1VBB 4;  4Q4X 4;  1H8T D;  1VBA 4;  2HWB 4;  1BEV 4;  3JBG 4;  1R09 4;  1RUI 4;  2R06 4;  1AL2 4;  1VBE 4;  2RMU 4;  1ASJ 4;  2RS5 4;  1Z7S 4;  1EV1 4;  1RUJ 4;  1AR6 4;  1NCQ D;  2HWC 4;  4PDW D;  2R07 4;  1AR9 4;  1PVC 4;  1RUF 4;  4RHV 4;  2RS3 4;  1VBC 4;  4Q4V 4;  2X5I D;  1AR7 4;  1D4M 4;  2R04 4;  1POV 0;  2RS1 4;  3JD7 4;  1AR8 4;  1PO1 4;  1NA1 D;  1VRH 4;  1COV 4;  3J8F 4;  2RM2 4;  2RR1 4;  2PLV 4;  1VBD 4;  1HRV 4;  1RHI 4;  1RUD 4;  1EAH 4;  1RVF 4;  4Q4W 4;  1RMU 4;  1PO2 4;  1R08 4;  4GB3 4;  1MQT D;  1HRI 4;  1K5M D;  1RUE 4;  4Q4Y 4;  1RUC 4;  1HXS 4; 
#chains in the Genus database with same CATH topology
 3VR9 A;  2ACZ A;  1VBB 4;  1VBA 4;  3AEE A;  1XI1 A;  1AL2 4;  1ASJ 4;  3CIR A;  2RS5 4;  3ABV A;  3AEG A;  4YTM A;  1KF6 A;  3VRA A;  2PY5 A;  1PVC 4;  2WP9 A;  2RS3 4;  1AR7 4;  2WU2 A;  1KFY A;  1POV 0;  3AE3 A;  2B76 A;  2WDR A;  1NA1 D;  2WQY A;  3AE8 A;  2EX3 A;  3J8F 4;  2RM2 4;  2PLV 4;  1RUD 4;  1EAH 4;  4YXD A;  2PZS A;  1HXS 4;  1RUG 4;  3AEC A;  4Q4X 4;  1H8T D;  3FI7 A;  3GQK A;  5C3J A;  1Z7S 4;  2H89 A;  1AR6 4;  4PDW D;  2R07 4;  3AE7 A;  1RUF 4;  4Q4V 4;  3AEA A;  3P4R A;  3P4Q A;  2R04 4;  3AE4 A;  1VRH 4;  3SFE A;  1VBD 4;  1XHZ A;  4Q4W 4;  1XHX A;  1K5M D;  3AED A;  3SUC A;  2X5I D;  1ZOY A;  1NEK A;  3JBG 4;  1R09 4;  1RUI 4;  2R06 4;  3P4P A;  3VR8 A;  3AE1 A;  2FBW A;  2HWC 4;  2PW9 A;  1AR9 4;  3VRB A;  4YSX A;  3AE6 A;  3P4S A;  4RHV 4;  1ZP0 A;  1VBC 4;  3AE5 A;  1D4M 4;  2RS1 4;  1AR8 4;  2R7F A;  2WS3 A;  2PYL A;  1COV 4;  2RR1 4;  2WU5 A;  1HRV 4;  1RVF 4;  2PYJ A;  4YT0 A;  4YSZ A;  1NEN A;  1YQ4 A;  1MQT D;  4GB3 4;  3GQH A;  4YTP A;  1PIV 4;  1OOP D;  1RUH 4;  4KX6 A;  2HWB 4;  1BEV 4;  1VBE 4;  2RMU 4;  4YTN A;  1YQ3 A;  3AEF A;  1EV1 4;  1RUJ 4;  3SFD A;  1NCQ D;  2WDQ A;  3AEB A;  3AE9 A;  1L0V A;  3JD7 4;  1PO1 4;  3AE2 A;  2H88 A;  5C2T A;  4YSY A;  2WDV A;  1RHI 4;  1RMU 4;  1PO2 4;  1R08 4;  1HRI 4;  1RUE 4;  4Q4Y 4;  1RUC 4; 
#chains in the Genus database with same CATH homology
 1PIV 4;  1OOP D;  1RUG 4;  1RUH 4;  1VBB 4;  4Q4X 4;  1H8T D;  1VBA 4;  2HWB 4;  1BEV 4;  3JBG 4;  1R09 4;  1RUI 4;  2R06 4;  1AL2 4;  1VBE 4;  2RMU 4;  1ASJ 4;  2RS5 4;  1Z7S 4;  1EV1 4;  1RUJ 4;  1AR6 4;  1NCQ D;  2HWC 4;  4PDW D;  2R07 4;  1AR9 4;  1PVC 4;  1RUF 4;  4RHV 4;  2RS3 4;  1VBC 4;  4Q4V 4;  2X5I D;  1AR7 4;  1D4M 4;  2R04 4;  1POV 0;  2RS1 4;  3JD7 4;  1AR8 4;  1PO1 4;  1NA1 D;  1VRH 4;  1COV 4;  3J8F 4;  2RM2 4;  2RR1 4;  2PLV 4;  1VBD 4;  1HRV 4;  1RHI 4;  1RUD 4;  1EAH 4;  1RVF 4;  4Q4W 4;  1RMU 4;  1PO2 4;  1R08 4;  4GB3 4;  1MQT D;  1HRI 4;  1K5M D;  1RUE 4;  4Q4Y 4;  1RUC 4;  1HXS 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...