1RUG4

Rhinovirus 14 mutant n1219s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
molecule keywords RHINOVIRUS 14
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rug400
1EV14 1POV0 1RUG4 1D4M4 2R044 4RHV4 2RR14 1H8TD 1PIV4 1PVC4 1HRV4 4Q4X4 1EAH4 1RHI4 1K5MD 2RS34 1RMU4 2R074 1MQTD 1AL24 1HRI4 1R084 1RUC4 1RUJ4 1PO24 1RUF4 1RVF4 2HWC4 1RUE4 3J8F4 2PLV4 1BEV4 1OOPD 1RUH4 1VBB4 1NA1D 2RMU4 1VBC4 1AR84 1PO14 4GB34 2RM24 2HWB4 4Q4V4 1Z7S4 1HXS4 1AR74 2RS54 4Q4W4 4PDWD 1VBA4 1RUD4 1AR94 4Q4Y4 3JBG4 2R064 1AR64 2X5ID 1ASJ4 2RS14 3JD74 1VRH4 1COV4 1RUI4 1VBE4 1NCQD 1R094 1VBD4
chains in the Genus database with same CATH superfamily
4RHV4 2RR14 1H8TD 1PVC4 1K5MD 2RS34 1RMU4 3AE1A 4PDWD 1RUJ4 3AE8A 4YSXA 4KX6A 1BEV4 1OOPD 1VBB4 1NA1D 1ZOYA 5C2TA 3SUCA 4GB34 2RM24 2PW9A 1HXS4 3AEGA 2H88A 3AE7A 2WS3A 3VRAA 1RUD4 1AR94 4Q4Y4 3JBG4 2R064 3P4RA 1ASJ4 4YSYA 1COV4 2ACZA 1VBE4 2WU2A 4YTMA 4YT0A 1RUG4 1D4M4 4YSZA 4Q4X4 2PZSA 1RHI4 2R074 1MQTD 1HRI4 2FBWA 1RUC4 2PYLA 3AE2A 5C3JA 1RUE4 2PYJA 1XHZA 4YXDA 2RMU4 3AE5A 1YQ4A 3AE4A 3AEEA 3P4PA 1AR74 3ABVA 1KFYA 4Q4W4 1NEKA 1AR64 1XHXA 4YTNA 1XI1A 1VRH4 2B76A 1PO24 3AEFA 2PY5A 1POV0 2R044 3SFDA 2WDQA 3AEDA 1EAH4 3VR9A 1AL24 2HWC4 2WDVA 3SFEA 1RUH4 1AR84 3AE9A 3AEAA 4Q4V4 3AE6A 1ZP0A 1VBA4 4YTPA 2X5ID 1NENA 2EX3A 1R094 3VR8A 1VBD4 1EV14 3AECA 1YQ3A 3AEBA 3CIRA 1HRV4 1PIV4 2R7FA 1R084 1RUF4 3AE3A 3J8F4 1RVF4 3P4QA 2WDRA 2PLV4 1L0VA 1VBC4 1PO14 2HWB4 3GQHA 1Z7S4 2WQYA 2RS54 3P4SA 3FI7A 3VRBA 1KF6A 3JD74 2WU5A 1RUI4 3GQKA 2H89A 1NCQD 2RS14 2WP9A
chains in the Genus database with same CATH topology
1EV14 1POV0 1RUG4 1D4M4 2R044 4RHV4 2RR14 1H8TD 1PIV4 1PVC4 1HRV4 4Q4X4 1EAH4 1RHI4 1K5MD 2RS34 1RMU4 2R074 1MQTD 1AL24 1HRI4 1R084 1RUC4 1RUJ4 1PO24 1RUF4 1RVF4 2HWC4 1RUE4 3J8F4 2PLV4 1BEV4 1OOPD 1RUH4 1VBB4 1NA1D 2RMU4 1VBC4 1AR84 1PO14 4GB34 2RM24 2HWB4 4Q4V4 1Z7S4 1HXS4 1AR74 2RS54 4Q4W4 4PDWD 1VBA4 1RUD4 1AR94 4Q4Y4 3JBG4 2R064 1AR64 2X5ID 1ASJ4 2RS14 3JD74 1VRH4 1COV4 1RUI4 1VBE4 1NCQD 1R094 1VBD4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV1 4;  1POV 0;  1RUG 4;  1D4M 4;  2R04 4;  4RHV 4;  2RR1 4;  1H8T D;  1PIV 4;  1PVC 4;  1HRV 4;  4Q4X 4;  1EAH 4;  1RHI 4;  1K5M D;  2RS3 4;  1RMU 4;  2R07 4;  1MQT D;  1AL2 4;  1HRI 4;  1R08 4;  1RUC 4;  1RUJ 4;  1PO2 4;  1RUF 4;  1RVF 4;  2HWC 4;  1RUE 4;  3J8F 4;  2PLV 4;  1BEV 4;  1OOP D;  1RUH 4;  1VBB 4;  1NA1 D;  2RMU 4;  1VBC 4;  1AR8 4;  1PO1 4;  4GB3 4;  2RM2 4;  2HWB 4;  4Q4V 4;  1Z7S 4;  1HXS 4;  1AR7 4;  2RS5 4;  4Q4W 4;  4PDW D;  1VBA 4;  1RUD 4;  1AR9 4;  4Q4Y 4;  3JBG 4;  2R06 4;  1AR6 4;  2X5I D;  1ASJ 4;  2RS1 4;  3JD7 4;  1VRH 4;  1COV 4;  1RUI 4;  1VBE 4;  1NCQ D;  1R09 4;  1VBD 4; 
#chains in the Genus database with same CATH topology
 4RHV 4;  2RR1 4;  1H8T D;  1PVC 4;  1K5M D;  2RS3 4;  1RMU 4;  3AE1 A;  4PDW D;  1RUJ 4;  3AE8 A;  4YSX A;  4KX6 A;  1BEV 4;  1OOP D;  1VBB 4;  1NA1 D;  1ZOY A;  5C2T A;  3SUC A;  4GB3 4;  2RM2 4;  2PW9 A;  1HXS 4;  3AEG A;  2H88 A;  3AE7 A;  2WS3 A;  3VRA A;  1RUD 4;  1AR9 4;  4Q4Y 4;  3JBG 4;  2R06 4;  3P4R A;  1ASJ 4;  4YSY A;  1COV 4;  2ACZ A;  1VBE 4;  2WU2 A;  4YTM A;  4YT0 A;  1RUG 4;  1D4M 4;  4YSZ A;  4Q4X 4;  2PZS A;  1RHI 4;  2R07 4;  1MQT D;  1HRI 4;  2FBW A;  1RUC 4;  2PYL A;  3AE2 A;  5C3J A;  1RUE 4;  2PYJ A;  1XHZ A;  4YXD A;  2RMU 4;  3AE5 A;  1YQ4 A;  3AE4 A;  3AEE A;  3P4P A;  1AR7 4;  3ABV A;  1KFY A;  4Q4W 4;  1NEK A;  1AR6 4;  1XHX A;  4YTN A;  1XI1 A;  1VRH 4;  2B76 A;  1PO2 4;  3AEF A;  2PY5 A;  1POV 0;  2R04 4;  3SFD A;  2WDQ A;  3AED A;  1EAH 4;  3VR9 A;  1AL2 4;  2HWC 4;  2WDV A;  3SFE A;  1RUH 4;  1AR8 4;  3AE9 A;  3AEA A;  4Q4V 4;  3AE6 A;  1ZP0 A;  1VBA 4;  4YTP A;  2X5I D;  1NEN A;  2EX3 A;  1R09 4;  3VR8 A;  1VBD 4;  1EV1 4;  3AEC A;  1YQ3 A;  3AEB A;  3CIR A;  1HRV 4;  1PIV 4;  2R7F A;  1R08 4;  1RUF 4;  3AE3 A;  3J8F 4;  1RVF 4;  3P4Q A;  2WDR A;  2PLV 4;  1L0V A;  1VBC 4;  1PO1 4;  2HWB 4;  3GQH A;  1Z7S 4;  2WQY A;  2RS5 4;  3P4S A;  3FI7 A;  3VRB A;  1KF6 A;  3JD7 4;  2WU5 A;  1RUI 4;  3GQK A;  2H89 A;  1NCQ D;  2RS1 4;  2WP9 A; 
#chains in the Genus database with same CATH homology
 1EV1 4;  1POV 0;  1RUG 4;  1D4M 4;  2R04 4;  4RHV 4;  2RR1 4;  1H8T D;  1PIV 4;  1PVC 4;  1HRV 4;  4Q4X 4;  1EAH 4;  1RHI 4;  1K5M D;  2RS3 4;  1RMU 4;  2R07 4;  1MQT D;  1AL2 4;  1HRI 4;  1R08 4;  1RUC 4;  1RUJ 4;  1PO2 4;  1RUF 4;  1RVF 4;  2HWC 4;  1RUE 4;  3J8F 4;  2PLV 4;  1BEV 4;  1OOP D;  1RUH 4;  1VBB 4;  1NA1 D;  2RMU 4;  1VBC 4;  1AR8 4;  1PO1 4;  4GB3 4;  2RM2 4;  2HWB 4;  4Q4V 4;  1Z7S 4;  1HXS 4;  1AR7 4;  2RS5 4;  4Q4W 4;  4PDW D;  1VBA 4;  1RUD 4;  1AR9 4;  4Q4Y 4;  3JBG 4;  2R06 4;  1AR6 4;  2X5I D;  1ASJ 4;  2RS1 4;  3JD7 4;  1VRH 4;  1COV 4;  1RUI 4;  1VBE 4;  1NCQ D;  1R09 4;  1VBD 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...