2PY5A

Phi29 dna polymerase complexed with single-stranded dna
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
564
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GGACTTT)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 165
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2py5A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2py5A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2py5A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2py5A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2py5A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2py5A06
4CEDA 3DOKA 4OVLA 1KLMA 1WAFA 2BGGA 4LD0A 3LP2A 3QEXA 4Q0BA 3C95A 3OYNA 2X6NA 3OYBA 2RF2A 3PUFA 2DFFA 1L3SA 4F8RA 1C0UA 2O4IA 3KK2A 1BCOA 1JLQA 4DLGA 4DTOA 4IKFA 2DFHA 3L8BA 4MFBA 3ZT2A 5E41A 2FBXA 2HHQA 4RW8A 4KI4A 1WNSA 3O3FA 4O4GA 4FXDA 3A2FA 4FJXA 4NCAA 2HHWA 3HM9A 4ELVA 4AHUA 3ISNC 3AVHA 4CJ4A 4O0IA 2I5JA 2ZE2A 1G15A 4DFMA 5J2QA 1HYSA 1KRPA 1RTIA 3K5LA 3TAEA 4L8RB 3V1RA 4O44A 1IH7A 3U3YA 3AV9A 3SQ2A 1J53A 4CEZA 3U6FA 1LWCA 4FLVA 3K2PA 3V1OA 3TR8A 5SZTA 3TWHA 3ZT0A 2OZMA 2HNYA 3RTVA 3NHGA 2G8KA 1RBVA 4GVMA 1KLNA 3VQAA 4IFYA 1I39A 3HT3A 3EZ5A 4OPKA 1RILA 3NFAA 2PZSA 3JSMA 3VQQA 4Z4CA 4DS4A 3SNNA 1FXXA 4FZZA 1JKHA 3T3FA 1U49A 1S6QA 3OYAA 1LWEA 2XHBA 3CG7A 1VSJA 4HVJA 4Q5VA 4HUGA 4DU1A 1Q9YA 3AVFA 1L3VA 2OA8A 4IG0A 4NCBA 4CEFA 3KK3A 2YNGA 5FDLA 4KHNA 5DK5A 2G8VA 4O0JA 3QNOA 1HNIA 5JS1A 4C8LA 1WSIA 2FBYA 4PWDA 4CFCA 4C8KA 3DM2A 3QEWA 1UA1A 3HO1A 4JLHA 2PYJA 4FJ7A 1BCMA 1VSKA 1ZBFA 4B8CA 4UQGA 4PUOA 1RBTA 4CGFA 4FJHA 2Y1JA 4FJ9A 3PO5A 1QTMA 4I9LA 1X9SA 2OPSA 4OJRA 4DQPA 5HBMA 1BIZA 1TL1A 3AVIA 3QEVA 3OVNA 2Q3SA 4FYDA 3HVTA 3SUOA 3QIPA 1HJRA 1EP4A 4CJEA 3S9HA 5D3GA 2DTUA 3DOLA 2WOMA 4F2SA 2G8FA 4KB0A 1EX4A 1QE1A 4B9UA 1WAJA 3L2UA 3LZJA 4KHYA 2D0AA 2YV0X 4CGJA 4CK3A 1S1VA 1S1TA 2FBVA 3RMCA 4ZHRA 1LV5A 4FJNA 2EHGA 3L3UA 3MAQA 2X78A 2HHXA 3OYFA 3OYJA 4DQQA 4DSFA 2HHUA 2VG5A 3V1QA 3HL8A 3NGIA 1CLQA 4FM0A 5C42A 1VRUA 4E1MA 3NH1A 5KI6A 5I3UA 1N6QA 3AA3A 3MEGA 2IC3A 4M45A 4BDPA 4AILC 1D9DA 3S3MA 1RBRA 2ETJA 3EYZA 4CHNA 3NAEA 1RTHA 4DTSA 1VSMA 3THVA 1TKDA 1JLGA 2XY6A 4W5OA 1RNHA 2QKBA 1IKYA 5J1EA 2G8HA 4XIUA 3PX6A 2X6SA 4FJLA 2R7YA 3G0ZA 3KLIA 3O3HA 3CM6A 4H4OA 3CFPA 2FBTA 3LPUA 3DRPA 4B8AB 1A5XA 2A1SA 3P83D 3ZSZA 3LP0A 1XHZA 1NJXA 3UIQA 5CZ2A 1VSFA 4AHVA 4M3WA 2VWKA 1DLOA 2ZD1A 4E19A 3AVAA 4BDYA 4YFUA 4J2AA 1L3UA 2A1RA 4AH9A 3PO4A 2KZMA 1Z26A 3B6OA 4OLAA 4CHPA 4CF1A 4CEEA 4W5TA 4DFKA 2KFZA 4K8XA 4CGDA 3KKRA 1ASVA 1TVRA 1JL2A 4B3OA 4DTJA 3LPTA 3HPGA 3TABA 1N5YA 3VQ7A 3O4NA 3CFRA 2YNIA 2HNDA 3KD1E 4CHQA 3OYDA 4RW7A 3AO5A 5DMRA 3O4QA 3WNEA 4CERA 4EP5A 3JYTA 1ZBLA 4BWMA 1RTDA 4M42A 3VQ9A 4E7KA 3V9SA 3K5MA 4K8ZA 1BI4A 4IG3A 4FM1A 3MEEA 4CEOA 2YNFA 4LSNA 2YKMA 4O55A 4CJQA 3OYIA 4M3TA 2F8TA 2KTQA 1ZBHA 4CFDA 3OJUA 3SPYA 2KFNA 4LSLA 4BDZA 3KK1A 1TKTA 3AO2A 1CZBA 3HSTB 2IGIA 4KHQA 1C0TA 2NUBA 1FKOA 3ZSRA 4DTXA 1QSSA 1D9FA 4H4MA 3K59A 1RDDA 3ALYA 2G8WA 1WSJA 1YTUA 3ZSOA 4RW6A 4FK2A 2HHVA 1RT6A 1J54A 3WNFA 1SUQA 4GMJB 4JRQA 4FK4A 5HRSA 4FLZA 1QSLA 3SUQA 1S9EA 4I7FA 1UAXA 3AVCA 1HYZA 2GUIA 4CGHA 1D8YA 4LY7A 2E6LA 4JRPA 3KLGA 4HUEA 4CECA 4DF4A 5I42A 1C1BA 4CK1A 2X74A 4FJ8A 1JXBA 3I0RA 4EZ6A 3AA5X 1KSPA 4C8OA 3PX4A 3NDKA 1LAVA 1XWLA 1NOYA 4FJMA 4FVMA 4FJ5A 4N5SA 3ZT4A 4CF0A 3M8SA 3SQ1A 3SJJA 1JL1A 1W9HA 1W0HA 1RT2A 1YT3A 2IS3A 4YNQA 3F9KA 5CZ1A 4HTUA 4DS5A 4FW1A 1KTQA 4CHOA 3HK2A 4Y1CA 3QNNA 3OJSA 3U3GA 2G8UA 1S9GA 1IO2A 4N47A 4CJWA 1IG9A 1UWBA 4ZTFA 1U04A 3RMAA 4DFJA 3NH0A 1B92A 1RDAA 3OYEA 4M3YA 2QKKA 1RT5A 2BDPA 4PY5A 3QLHA 3L2RA 5CY4A 3HJFA 4CJ5A 3NF8A 3ASMA 4NYNA 4FK0A 3LDSA 1VSDA 2D0CA 2XY8A 3T1AA 3LANA 1X9MA 4Z4EA 1YVUA 4F2RA 4F3TA 1Y97A 1C1AA 5J2MA 4C8NA 4LH5A 4O5BA 1RT4A 4HUFA 1FKPA 1HQUA 1S1XA 4FJJA 1IKVA 1S1UA 2F96A 4CEQA 2E6MA 3NGZA 1HMVA 4KFBA 1WSEA 4KAZA 2EX3A 1KVCA 1L5UA 4C8MA 3MXMA 1JLAA 3VQ6A 3OS2A 3MECA 3V4IA 1WN7A 4CJKA 2F8SA 4DU3A 4PQUA 3AVJA 3LAMA 2GBZA 1NJWA 3ZT3A 4JS4A 1KCFA 3C6UA 2BE2A 1TK0A 3PY8A 1RCHA 3V9WA 4FW2A 3ZSXA 3QETA 3MEDA 5EU7A 5KGWA 3S3NA 3SV3A 4IFVA 3VN5A 5FROA 3EY1A 3VQPA 4CEAA 4CJFA 4E7IA 3TANA 3AVKA 5K14A 1NKBA 3VA0A 1LWFA 3ZSYA 2O4GA 4CJ3A 2E4LA 4QAGA 3IS9A 2OZSA 4G1QA 3S3OA 4N76A 4CHZA 3AVGA 1SKRA 3SZ2A 1QS4A 3I0SA 2IOCA 5C25A 1JLEA 3T19A 2IDOA 3K57A 3ZCMA 4CGIA 2P51A 3ULDA 4DSIA 2OPRA 4H8KA 4OGEA 3RR7A 2HW3A 2HVIA 4CJRA 3DLHA 2YKNA 2D5RA 4B9NA 4DSEA 3OYGA 4IBNA 4DQSA 3AVLA 3OYHA 1JLFA 3TI0A 1NK7A 1NK9A 4B9VA 2B5JA 2JLEA 4I2PA 4HCCA 3CM5A 1I3AA 1O1WA 4J2DA 2KW4A 1Z25A 4M3XA 4FLXA 1U48A 4W5RA 1X9WA 3NF9A 1Q8IA 1LW0A 4DTPA 1SL1A 2XY7A 2KZZA 4OGCA 4DSKA 4FJGA 1HRHA 2YHBA 3OYCA 3SQ4A 1NKEA 4KRFA 4DF8A 4CJLA 1Q9XA 2ITGA 3TAMA 3QERA 1NK6A 4EZ9A 4FZYA 2QXFA 1S5JA 2HHTA 1TAUA 1J5OA 3NF6A 1B9FA 1HQEA 2B4JA 5HLFA 4M3RA 1BIUA 4Y1DA 3VQDA 1FK9A 2ZQBA 5KGXA 5KRTA 1J9AA 1ITGA 3E01A 2P1JA 2RPIA 4NCGA 4CJVA 2Y1IA 3VQ4A 4CFAA 2P5GA 3NCIA 3KJVA 4I9QA 4BWJA 4Z4FA 2P5OA 3B6PA 1A5WA 3AO1A 4FJIA 3LALA 3HPHA 4BE1A 4KPYA 3SI6A 2Z1IA 1JLBA 4DTNA 4Z4IA 3F73A 3VA3A 2HVHA 3RWUA 4M3UA 4HHTA 1REVA 3H08A 4E1NA 1GOCA 4KB1A 3K58A 1WSHA 2GV9A 1EKEA 2BANA 5HRRA 5HRNA 3D45A 3OS1A 5SWMA 2VG6A 3SV4A 1NOZA 3TAPA 3V9XA 3KIOA 2AJQA 3IG1A 4N41A 1R0AA 4R5PA 4OLBA 2Z1HA 5FRNA 4BACA 2QK9A 1ZBUA 1IKWA 1JLCA 4DTRA 3BGRA 2JGUA 1DTTA 2YNHA 4RW4A 4DSJA 3I8DA 2D0BA 2OPPA 3D0PA 5C24A 3QEIA 4E3SA 3TARA 1RBUA 4E7JA 4N56A 4DLEA 4HCBA 1BL3A 2KQ2A 4M41A 1RT1A 4OKEA 5FRMA 1NJZA 1VSIA 1UOCA 2RKIA 1D5AA 1QQCA 2LSNA 4DU4A 3L2VA 3CFOA 4E0DA 4Z0UA 4CGGA 4CK2A 1ASUA 1WLJA 1HPZA 4KKOA 1GOBA 2HB5A 3FFIA 4IDKA 1XHXA 1RTJA 1VSHA 4CE9A 3NE6A 4CF9A 3NF7A 4AHCA 1RBSA 4ID1A 2XRIA 5CYMA 2IAJA 3ZSWA 3NH2A 4Z4GA 3K5NA 1GOAA 4KHUA 3LP3A 2YHAA 1VSLA 3NBPA 4GW6A 4CJUA 1VSEA 1VRTA 3AVBA 3SUPA 1U4BA 1ZBIA 4FLWA 4KTWA 3AO4A 3ZT1A 3ITHA 1BGXT 1LW2A 4CF2A 3KLFA 3QINA 3DLBA 1SL0A 4KHSA 2PYLA 3SPZA 1B9DA 1BQMA 1WSGA 3WNGA 1NK8A 3HYFA 2XO7A 4DFPA 4F3OA 3K5OA 2VWJA 4CESA 4BE2A 3DYAA 1C1CA 1C0MA 2Z1GA 4DTUA 3DRSA 3RMBA 4DTMA 3V81A 3IAYA 3PV8A 3LWMA 3MXIA 1KVAA 1TAQA 2VG7A 3KLHA 4AHSA 4ID5A 3RRGA 4B9LA 3VQ8A 1WSFA 1TGOA 2DFEA 3DMJA 3ZSQA 4CJTA 3V9UA 3KTQA 3LAKA 3QO9A 1TK5A 4PA1A 3VQ5A 1SKSA 3M8PA 4ELTA 2G8IA 4ELUA 3V6DA 3OYKA 1CZ9A 3HVRA 1KFSA 4EP4A 3LP1A 3AVNA 1XC9A 4CCHA 4F4KA 3DI6A 3BDPA 1EXQA 1SV5A 4CEBA 3AA4A 3CYMA 4CJPA 4ZTJA 4QOZB 1RDBA 1U47A 3OYMA 1HNVA 3QESA 4AHTA 3DLRA 3C94A 3CQ8A 3VQCA 1U45A 4JS5A 1ASWA 3M8QA 2OYQA 3V9ZA 3RMDA 4AHRA 1T8EA 1NJYA 4FLUA 4E7HA 3SUNA 3RR8A 1YTAA 1KVBA 1EETA 1T03A 1NKCA 1BISA 1RT3A 3DLEA 1F21A 1BHLA 1TK8A 1NK0A 4W5NA 3TAFA 2W42A 5J2NA 3VQEA 1X1PA 1BQNA 1K6YA 5KTQA 3LWLA 1T7PA 2DY4A 1QSYA 4B08A 1TKZA 4B9MA 3HPOA 3DLGA 4I2QA 4Z4HA 4KV8A 3HXMA 1RDCA 3L3VA 3IRXA 3L2WA 1UA0A 3O3GA 4FZXC 4J2BA 5KRSA 4OKJA 3P5JA 1HYVA 4KHWA 4E89A 4CIFA 4FJKA 5JS2A 4CF8A 4CIGA 2HMIA 1KFDA 2Z1JA 3ZSVA 3LZIA 4KTZA 1CXUA 1A5VA 1TKXA 4E7LA 3QEPA 4J2EA 1TL3A 3C6TA 4FLTA 3QIOA 4B9SA 2R7FA 4FM2A 4FCYA 4RW9A 3SCXA 4M3ZA 5HRPA 2ATQA 1CXQA 1NK5A 4DMNA 4DQRA 4DWIA 3P1GA 1ZYQA 4KTQA 5J2PA 2RN2A 3KD5E 1QHTA 2OPQA 5HROA 2HNZA 3DRRA 4QCLA 3KLEA 2HHSA 1S6PA 4CFBA 2WONA 3TAQA 4KI6A 3VQBA 1SKWA 4KO0A 5HP1A 4ICLA 2B6AA 1NK4A 1T05A 1SL2A 4WE1A 1DTQA 4CHYA 3FI7A 4B9TA 1LAWA 2FC0A 3SQ0A 1BI4B 4MQ3A 1VK0A 1L3TA 4DQIA 1S1WA 3OS0A 4NYFA 4OPJA 5CYQA 2PW9A 3AA2A 1JXEA 1XI1A 1C6VA 4FLYA 4CJSA 4OKKA 4CIEA 4TSXA 3M8RA 3L2QA 3AVMA 3NGYA 1MU2A 3MXJA 3WNHA 5T7BA 4BE0A 2XY5A 3RRHA 4LH4A 4KREA 3OYLA 3TAGA 1TV6A 3G10A 1IKXA 3KKSA 3HP9A 3PX0A 3AO3A 3OY9A 3SYZA 4DSLA 3DLKA 4DG1A 4W5QA 1RT7A 3HP6A 2PY5A 4RG8A
chains in the Genus database with same CATH superfamily
4CEDA 4RWUA 2HOEA 4KXRA 5EC1C 3ZBHA 1YHQV 3D2EA 3O1WA 4QS9A 3LP2A 2BGGA 1R094 4TOIA 3OYBA 4PA9A 2QM1A 4IEIA 4LNUA 3PUFA 3O6WA 4F8RA 4DR4K 1N36O 1JLQA 5B1NA 4IXCA 3B2EE 4DLGA 2P90A 3IFRA 1HR0K 4MFBA 2A06H 4YXDA 3W3DA 2IJIA 3LDLA 4YOTA 4RW8A 2HHQA 3THXA 1Y76B 4O4GA 3EKUA 5CA0B 1P84F 4WFBL 2QWNA 3RVCA 3HM9A 2P9LA 1GM8A 1NJIW 2IM9A 3ISNC 1OH8A 3AE5A 1B6QA 1ROPA 1G15A 2O8EB 3LDPA 3I8BA 3N2GB 5IE9A 4YOXA 1RFQA 3AEEA 5AQIA 3AG1C 3AV9A 1LWCA 2DYRB 1RUC4 4YXWG 3S3XA 2DWEC 3K2PA 2XAJA 4DV0B 3AARA 4CBXA 3WXMB 3ZT0A 3CPWM 3TWHA 3RTVA 3NHGA 1AI7A 1UJWB 2OWOA 3ZEUA 3E66A 1XDCA 2I7PA 3EZ5A 3NFAA 2PZSA 2KSDA 3AG1B 3SNNA 1FXXA 2P06A 3ZHTA 4MLEA 3OYAA 5IYZA 4WFGA 4HVJA 1VQ4V 4HUGA 3IMXA 1Q9YA 2OA8A 1NEKA 4IG0A 3AE8A 4JV5K 1FYJA 4LFCK 4EFBA 1TUBA 4HAMA 2XAFA 5KAFZ 3HSCA 4PL7A 1VF6C 4UQGA 4PUOA 2PBDA 4FJ9A 3PO5A 3THYB 2OPSA 1TL1A 3AVIA 3ABMC 2KKZA 1GH6A 2F66C 5AZJB 3QIPA 1HJRA 4DXWA 4CJEA 5D3GA 2DTUA 2NLXA 2Q97A 5IJ9B 1ZX3A 5KPTA 4YOYA 2DOSA 5D5QA 2G8FA 3P4SA 4TV9A 4DR3O 2GHYA 4F6RA 3I56V 3BZKA 5FNVA 3CCJN 4MVRA 1A32A 4KHYA 2QE7G 2D0AA 3FB6C 3VBBA 3LSSA 4GKJB 4CK3A 1QCEA 1S1VA 2OIGA 4BIUA 1S1TA 5DM6L 1ZBSA 3L3UA 2WPDG 2X78A 3ABMB 5IJ0B 3BEXA 1YJWV 4DQQA 4DHYA 5AR0A 4DV6K 1X3MA 3V1QA 1RPOA 2Q9LA 4HNAA 3W0LA 1XBLA 3L9DA 3Q4HA 1VRUA 4E1MA 3NH1A 1AROP 1HP8A 5BXZA 2UUBB 2ZJPL 5D5PA 4JI3B 2IC3A 3ATVA 3MEGA 4AILC 1D9DA 3R66A 4BDPA 2RS34 3IC7A 3K9AA 1RBRA 3W7TA 4LWSA 4PDVA 3M1FA 1VSMA 5AQQA 3HOSA 2CTPA 3SJHA 5C3JA 5E79Z 1JLGA 4O2AB 4YSYA 4EFEA 1IKYA 3RYFA 2FMLA 1K92A 3O8MA 4H4OA 5FPEA 4CZEA 3NVKA 4IOAL 4B1UB 4BRKA 1A5XA 1H2NA 2CUGA 3BHPA 5L3EA 1EWQA 4JYAO 3FZMA 1VSFA 1T5EA 2VWKA 2ZD1A 4HWIA 3L0QA 3AVAA 4E19A 2WAMA 3UKMA 1U2VB 1OKJA 3D36A 4YY3K 4YHHO 4DB3A 2A1RA 1YVNA 2KG7A 3VEZA 4RHV4 4CEEA 4WQ4C 4W5TA 4YSXA 3HZ6A 4CGDA 3CCLN 5IYDO 5LL6Y 1JL2A 4DTJA 4JI6O 1JPXA 2VQFK 3HPGA 1RMU4 1I5YA 1TUUA 2CK3G 3O9SA 2CGNA 4JI8K 3P30A 3IJ4A 3STZC 4JYAK 4EKWA 2KB1A 4ZI7A 3CFRA 1KFYA 4LF8B 4U3JA 4IFEA 4CHQA 1IBKK 1KYOF 4H37A 5JH7A 2CH6A 1X4TA 5IT9O 3O4QA 3EEQA 2WC9A 2QWQA 3HM8A 3VQ9A 1NS1A 5CA3A 1NGBA 4FM1A 1T44A 3H6EA 4LSNA 2YKMA 3OYIA 1NI8A 2KTQA 1GO3F 1VQ5V 4BR9A 3OW2M 2MK3A 1VQLV 3SPYA 2GX9A 2KFNA 5LBQA 2LJ2A 5FL7G 1YJ9V 1C0TA 4B1XB 1NH2B 2E5LK 4JK9A 3C7NA 4U7NA 3D3IA 4LF4O 5JWPA 1WSJA 1YTUA 4H0XB 3H3NO 5JLHA 4FK2A 1RT6A 1VHXA 1XUPO 4JK8A 1SUQA 2WBNA 5HRSA 4FLZA 3LSQA 3SUQA 4GV9A 1K34A 1JMKC 4I7FA 1P8ZA 1Z2GA 1NKDA 4FPAA 4EAHD 1NU1H 1QHAA 2E6LA 2EULA 4CECA 4DF4A 4CH4A 1C1BA 1P90A 4CK1A 5CR4A 5I42A 3RVZA 1JFFA 2GDSA 3JATA 1JOYA 4C8OA 2YIDA 1CZAN 1XWLA 1NOYA 4FVMA 4B7EA 3SJJA 1J95A 3FR0A 1KAXA 3RVYA 3JAMN 4KX6A 2FB5A 1AJPA 4YNQA 4HTUA 1PL4A 3EHBB 3FYIB 3F9KA 3WUHA 3QTCA 4Y1CA 1S9GA 2UUAK 3AECA 5C2TA 3L6QA 5IWAO 4JI5K 2DN9A 4KHPB 1Q6UA 5BN8A 4DQ8A 1AR74 2D4WA 3HBTA 2JWLA 3OYEA 4M3YA 4YJ2A 2YI1A 1VQ9V 4UVAA 2UXBB 4GV6A 1XREA 1VQ7V 2BDPA 2WFBA 5AQOA 2PLV4 3E8HA 3HJFA 4CJ5A 1K8AO 3NF8A 2F43G 1EM1A 2D0CA 2RHKA 3T1AA 3EVKA 2JEUA 3LANA 1K7DA 1Y97A 1JR9A 4CZZA 4JHDA 4TUYB 3N4QA 1XNQK 2E3CA 3RYHB 4CEQA 4JI1B 1QVGU 1HMVA 4KFBA 4BRGA 1WSEA 3DXKA 1HNXB 2EX3A 2Q7HA 1KVCA 2QW9A 3MDSA 1IBMK 3QNEA 2UYTA 3V4IA 3BF3A 1KP3A 3BA9A 1N33K 3U4LA 1WN7A 1H8TD 2F8SA 4B3SO 4BRQA 5H2FZ 4DU3A 3LAMA 2GBZA 1GM7A 4JS4A 3ZHQA 1RSOA 4V19S 4GY2B 2GELA 2E1YA 4H0TB 3QETA 5EU7A 1TYQB 2JGDB 4CC6A 5EYPA 4CEAA 1EAH4 1EZVH 4I4TB 4A2BA 4BRPA 3CCVN 3VA0A 1VQPN 1NKBA 4JI7K 2DYSC 2QR4A 3ETGA 2YHXA 1E79G 4LFAK 1DEJA 4QAGA 1DLBA 3ZX0A 1KD1W 1QS4A 3I0SA 3MWPA 4JKBA 3LDDA 4QPJA 1JLEA 3ZCMA 1FKAO 4DUZK 2P51A 3MHSC 3L4QA 1R1BA 3U10A 4MVQA 4LFBO 3ZRXA 3OYGA 2HWC4 2DYSB 3AVLA 1H8EG 1HUXA 5AQKA 5C2DA 1P7GA 4FWMA 4B9VA 3BCCH 4HCCA 3J7ZO 3ZX2A 1FJGO 1IVSA 1Z5VA 1BA1A 3CYOA 4YT0A 3ENHA 4BRCA 4M3XA 1U48A 3E89A 3OM3B 5DM7L 3CCEV 3BZCA 4DSKA 1AR5A 1Q81W 4WQ5C 5GADP 3HKBB 3ZN1A 1Q6HA 3OYCA 1VQKV 2ITGA 4DV5B 2FXUA 1NK6A 4FZYA 2CH7B 2JS5A 1KQSM 4CBCA 1J5OA 1COWG 1HQEA 1FS0G 5JCOC 1BIUA 5AJ3K 3UT5A 2UUCO 2OTJV 5JVGL 3JSNA 3CD6N 2RCVA 2ZQMA 4JTDB 4DV7K 1FJGK 1MWMA 2P5GA 3NCIA 3KJVA 3SJBC 2Y69C 2D0OA 5FPMA 3A0RA 2P5OA 3AEAA 3E8FA 2HHHK 1A5WA 1ESVA 4BE1A 4BRDA 4DUYB 3FZFA 5AQGA 1WP7A 3KCYA 5JMVA 1YCIA 4RUFA 5FPOA 2A40A 2QXLA 1VQ4N 3V9ZA 1EKEA 3OS1A 4GLXA 4O4JA 3HKEA 4PJ0Z 2AJQA 2JK5C 1HR0B 1R0AA 4R5PA 4DV0O 1MG1A 4FSVA 4WFEA 4GVEA 4OLBA 4PDMA 2GUZA 5C8YB 3SYPA 3CMEV 1ZBUA 2DQ0A 3SYAA 5AFUA 5EOYA 2WLLB 4OGQB 4BVPA 2YNHA 1X59A 1K8KA 2D0BA 5GIOA 2OPPA 5C24A 4BGAA 1QQOA 3CJHB 3TARA 4IJNA 4HCBA 3G80A 3ETDA 2KQ2A 1L0VA 2LGWA 1UOCA 2RKIA 4C23A 3OE7G 2R70A 1YDXA 4DU4A 3QFUA 5BN9A 1NTZH 4DV4K 3O5BA 3LM2A 1IZ3A 5CBFA 4CH3A 1WLJA 4H0PA 3MCPA 4KKOA 2HB5A 4JKGB 4BW9A 3I56N 4EB6A 4QNHB 3NF7A 2Q7GA 3JCZA 3ZEDA 1RBSA 3FZLA 5CYMA 3NH2A 4LF9K 3HKDA 1HKCA 4Z4GA 1Q86W 1YJWN 3NBPA 4KBOA 2ZDIA 4GW6A 2QTSA 5JJJB 5LGTA 1NLVA 1U4BA 4FLWA 3SBTA 3VEVA 1BDGA 2X6BA 4JV5B 3QFPA 4LFCB 3GBTA 1LW2A 4ZIBA 4CF2A 2ETNA 5H9CA 3SPZA 1WSGA 2VQEK 5GONA 1O9GA 1K5QA 3K5OA 4IT5A 1C0MA 4GKJO 2ZD9A 3PV8A 2Q5ZA 4KFMA 3IAYA 3JD2A 1GLCG 3LWMA 4I5SA 1JCGA 1SAZA 1FD9A 1SETA 3AE9A 3SLCA 2HR3A 2IJKA 4K41A 1TGOA 3CRMA 4X9QA 4F4LA 5M1OA 3KTQA 3QO9A 1TK5A 2G8IA 3ML0A 3OGCC 3KWGA 2UUBO 2FSKA 3C3TA 4JI3O 2WS3A 1U96A 3U0ZA 3H01A 1CZ9A 3HVRA 3AEBA 2GBOA 4B3TO 1BA0A 3R6MA 2O57A 3G6BA 2Q0RA 3QB0A 1JQ0A 1MA1A 1YQ3A 4CZHA 4KH6A 5C15A 3UM7A 4O4IA 3AG7A 3ZHSA 1JJOA 2ZIMA 1HNVA 3CRRA 4DV6B 5LY3A 1QR9A 1R084 3SPCA 4BROA 3SUNA 1NJYA 2F4VK 1KVBA 2HP8A 1Q43A 3IUCA 3K3WA 4JKFA 1BISA 1NKCA 4FWRA 3TPQA 1M93A 3VOUA 4B3TK 2W42A 1M1KO 1X1PA 5AQSA 1EWRA 4U7BA 5AQMA 2A79B 1BUPA 1QSYA 1SC5B 4B9MA 5EXWA 3AGRA 4KV8A 5M1KA 1RDCA 3L3VA 3R1XA 4K3AA 4EHTA 4ILJA 3L2WA 4XDKA 2O8FB 1HYVA 4CIFA 4BRLA 1VQ5N 1FAFA 2HMIA 5DN6G 1VQLN 1XL4A 3E83A 4WFFA 3PLAA 1A5VA 2KLAA 3P4RA 2YICA 2NZTA 5CB4A 3C6TA 1Y66A 4YDUA 1YJ9N 4B9SA 4FO0A 3SCXA 1SS6A 4LF8O 2EILC 2ATQA 1AR84 1FXVA 4DQRA 4YY3B 1AI5A 3CCJV 1ZXOA 2VCPA 3P1GA 2LFSA 1H2GA 3KD5E 5HROA 1MSWD 3DAWA 4Z94A 5J2TB 3ZMZA 1DT9A 2IIRA 5BZBA 2HHSA 3VQVA 1W7AA 3CC2N 4CFBA 3TAQA 2P7TC 3P32A 4J42A 2NRWA 4H0OA 4A57A 3ASNC 4G9ZA 2VQFB 2ZINA 2BTQB 1WOQA 4CHYA 3AY9A 1BOTO 2EILB 2M6YA 4JI8B 2WDRA 4JYAB 4DQIA 3VGKA 3SBGA 3OS0A 4X62K 5LL6Z 1S76D 4BGBA 5JVDB 1JXEA 1C6VA 4CJSA 5HLFA 2E76B 1NK0A 3ZCCA 5T7BA 3NGYA 3VERA 5ITZB 4B1YB 5BPNA 1VIBA 1OOPD 3ASNB 3LDCA 1IV0A 1DTOA 2H8PC 1BL8A 3G71N 3MN5A 1KKDA 1TV6A 3SAFA 3UKUB 1IKXA 2QDOA 3T1YK 3HP9A 3PX0A 1BCCH 1KXPA 4LF7K 1YXQA 1BSMA 1RT7A 2E88A 2WWWA 2A41A 1VQ9N 1XUQA 2E5LB 1VQNV 1V55C 3DOKA 2UXCK 3WFVA 3E9LA 1NGCA 5I9EB 3OMNB 3QEXA 4X88A 3VR8A 3DSQA 3F7VC 4FZ1A 1C0UA 4RTFD 4H0VB 2N05A 1SRYA 4X20B 4A5UB 1ZL8B 4DTOA 3H1QA 1NM1A 4IKFA 1SA0B 3CCLV 3L73H 1S77D 3GG4A 4UY8O 4LF5K 5E41A 5AQJA 3JD0A 2ZXWC 1R3LC 1WNSA 3O3FA 4KHPO 3OD4A 4TQFA 1V55B 3DJCA 1K5MD 5AZIA 4AHUA 2CGLA 2QM8A 5LMNO 2UXBO 3M6GA 2I5JA 4BVOA 1LR1A 4DFMA 1ILYA 1S5LZ 5KHHA 4BR6A 2N04A 1XMOK 2WU2A 4UV8A 3VEXA 1IH7A 3ZMTA 1J53A 4CEZA 4MLHA 3U6FA 4DYLA 4LR3A 2P9SA 4M7XA 1FFXB 2ZXWB 3OHRA 5SZTA 1JCEA 4NR1A 2UUAB 5A2QO 2PUSA 4UCSA 2G8KA 4GVMA 3O9OA 1IDSA 4JI5B 4IFYA 1M90O 1J6ZA 1MMMA 2P9UA 1RILA 1ZP0A 3VQQA 4CD3A 5BR9A 3DXRA 4DS4A 1Y67A 1JKHA 1U49A 4YTMA 2HJFC 1HXS4 5DECA 1VSJA 3F2KA 2AGAA 4RQEA 3AVFA 4DU1A 2W6JG 4X1YA 4TV8A 3EZWA 4CEFA 2ZM6K 5FDLA 4BR2A 4CS2A 2LP7A 3RYIA 1HNIA 5KMGB 3EXAA 4FFBA 4MTOA 1BQ0A 1V4TA 3DXMB 1AI6A 4JLHA 4J7ZA 4FJ7A 1VSKA 3WXKA 4B8CA 3SUCA 4MO5A 4DR5K 3OT7A 2NNWA 1QQNA 1PKXA 4CGFA 4PA3A 3J7AP 4PV1B 1X9SA 4OJRA 4DQPA 3FD9A 1IBMB 5HBMA 4GT1A 3FLCO 3QEVA 3BP8A 4IGGA 4BY9C 2ZIOA 3ABLB 1N33B 4Q4W4 3CCSN 1EP4A 1QVGM 4CS3A 4RCHA 4B3MK 4F2SA 1KBHA 1EX4A 3SMPA 3KZBA 2EZOA 5KAIZ 1VQKN 5EZYA 4X64K 4CGJA 5JQGA 1LV5A 2LW7A 4EEQA 5IY5C 2FBVA 3O9UA 4IHJB 4ZHRA 3ZRVA 2EHGA 3GQHA 4BWAA 4X1IB 3FZHA 4JI7B 4Z2WA 3OYJA 3WXLA 2OTJN 4J80A 3A5NC 1Y74B 4UUJC 3F5WC 4LFAB 1CLQA 5C42A 5K1PA 4QIWF 5KUMA 1CXZB 4ZBMA 4MDAA 3CJ7A 4DO2A 3EE8A 3WXIA 4H0YB 4BR7A 4YTNA 4LCUC 3S3MA 3VGLA 3ZN0A 4DUZB 2YHWA 3M5RA 3KCXA 4MO4A 4CHNA 3VF4A 1RTHA 4DTSA 4NVPA 1QNMA 2X6CA 3SPHA 4DV5O 5KPZA 1VEWA 2G8HA 1VBB4 4I0XA 3JALB 4DW1A 3G0ZA 3KLIA 3O3HA 4I6MB 3CM6A 1XL6A 2BOBC 2FBTA 3CFPA 3SAGA 1T6CA 4RWTA 4B8AB 1AR4A 3K9SA 1XHZA 3VGMA 3CWBH 1KMIZ 3WXJA 1NJXA 2VS0A 3O80A 4BRNA 4AHVA 4DK0A 4NXMO 3RYCB 1IXBA 1H2SB 2QGNA 4E2LA 4FWSA 4YFUA 2WLJA 4AH9A 4DUYO 2KZMA 1ZTEA 1K8AW 4K8XA 3KKRA 4IOCL 2D0PA 1TVRA 2Q68A 2YXLA 3ZIAG 1N4CA 1WB8A 3LPTA 4DV7B 4DR4O 1FJGB 2VYPA 1HR0O 3TSQA 1US6A 3O9TA 2O8DA 4P2ZA 4H33A 1NMDA 1C0GA 1N5YA 2BSKA 3VQ7A 5GAGP 3K06A 3VQWA 2HHHB 4PDRA 3O4WA 2YNIA 3QBXA 1JCHA 4JI4K 3AO5A 3K9JA 3JYTA 4YOVA 1RTDA 3H45C 3OUSA 3V9SA 2R9AA 2UU9K 3K5MA 1BI4A 4IG3A 5CE3A 4CJQA 3MEEA 2UUCB 3CSXA 4H5VA 1TVKA 3C90A 3TTDA 1ZBHA 3OJUA 4I50A 5KPRA 4BDZA 4DRXB 1CP9A 2JDIG 2F93B 3HSTB 1CZBA 1B3QA 4KHQA 1FKOA 3ZSRA 4DTXA 2DYRC 1VQMN 1YJNN 1LUVA 1SZXA 3THXB 1F4NA 5ADXH 3ZSOA 4RW6A 2HHVA 2P9KB 1J54A 3W7XA 2Q1NA 4GMJB 4JRQA 3WEEA 5K1XA 3FB7C 5H6QA 2HMPA 3AVCA 4JV5O 1HYZA 3CD6V 4LFCO 2GUIA 3DC5A 4GX1A 1HWYA 4CGHA 3SAHA 5C10A 1RUJ4 1NGFA 2H88A 2LW1A 4DV4B 1T3VA 4W4LA 3AA5X 1N0JA 2R9RB 3A5LC 4N23A 3NDKA 1LAVA 3SJAC 3A8YA 4MT8A 2DMXA 4LF9B 1GMGA 1Y76A 3HPLC 1JL1A 5CA0A 1W0HA 1YT3A 2AP1A 4GUNA 2BH1A 2F9TA 4JAUA 2QWMA 3OUFA 4CHOA 3P3PA 3F5TA 2P67A 3QNNA 5IYZB 3G25A 3D3QA 3N2GA 4O4HB 3TSPA 1UWBA 4ZTFA 4H13B 3RMAA 3EFFK 3T4DA 2VQEB 3K04A 1RDAA 2QKKA 3VEWA 2EIMC 1W59A 5DEDA 1SQVH 4DKWA 4A2AA 3LDSA 1NG9A 2X6AA 4FK0A 2XY8A 4R7CA 2BOCC 4DV6O 4F2RA 3AK1A 1Z6RA 3LM9A 3B77A 2FF6A 3OR6C 4WFHA 3GWOA 5EBWC 1HQUA 1KU9A 4JKDA 1M57C 3CE2A 3SPGA 4FJJA 4J7KA 2RMKB 5EBMC 1SQXH 1VF5B 2EIMB 4B3RO 1S5HC 2CGKA 4NTXA 4TV9B 1AR94 1Z5WA 3VRBA 4CZJA 3MXMA 1XC3A 3VQ6A 3KWIA 3MECA 4CJ7A 3LDOA 3K08A 3U9DA 1OH6A 2HFEC 4PQUA 2CH5A 4XH5A 3P38A 1NJWA 1RUG4 1M57B 3F9MA 2BE2A 3AE1A 1B04A 3V9WA 2F4VB 3AE7A 1RUE4 3MEDA 5KGWA 1JX9A 5AZJA 3R8EA 4IFVA 4I55B 5IJ9A 3D8CA 1AR1B 4CJFA 1URFA 3CJAA 4E7IA 4B3TB 5K14A 4B3RK 4YY3O 4LWSB 3AGKA 5EX5A 1VF6A 3ZSYA 1NA1D 1GTOA 4CD1A 2QKAA 2XUMA 3SYCA 1KP2A 2QI2A 4G1QA 3S3OA 4JTCB 3RYFB 3AVGA 4QS7A 4CHZA 1SKRA 1N34K 5C25A 4GYCB 3T19A 5IJ0A 4JYBA 2IDOA 2VQFO 2HVIA 1CPYA 4O4LB 1SQBH 3OEEG 3R3LA 2IVNA 3RR7A 1GLEG 2HW3A 2HBKA 3MN9A 2YIBA 1P49A 3B09A 4JI8O 1EQYA 3DLHA 3CMAN 4B9NA 5EY4A 4DSEA 4DQSA 4IBNA 1VQNN 1JLFA 3TI0A 3BEHA 3TSUA 1IBKO 2B5JA 2A3QA 3CXCU 1HLUA 1O1WA 4JZ2A 3OR7C 2KW4A 2P4VA 1JVMA 3CCRV 4FLXA 2UXNA 3CJ1A 5M1FA 4W5RA 1X9WA 2O8CB 4GCZA 1LW0A 2KZZA 4OGCA 2JS3A 1ATSA 4PA7A 3L75H 1QU7A 1XEQA 1HRHA 4IO8A 1UPGA 4CJLA 1Q9XA 1IXMA 2ASPA 5FLXO 2E5LO 2HHTA 2B4JA 5LGNA 4Y1DA 4M3RA 3I33A 2A6AA 4X62B 2EWSA 2P9PB 3LDQA 5KRTA 1K4CC 1H8HG 3EE9A 4H5WA 3E01A 5JH7B 2P9NB 1U2VA 1GN6A 4NCGA 2Y1IA 3SFEA 3VQ4A 1YITV 1Q90D 4A5BA 3PN1A 3SYQA 5E26A 4BWJA 3CC7N 1D2DA 3T1YB 3WQUA 3LALA 3HPHA 4KPYA 4DV1O 4Z4IA 2HVHA 1QLEC 1K9MO 2HVJC 4DV3K 2UXCB 1REVA 5L3GA 3P39A 1GOCA 2BANA 4JKAA 3SV4A 3DC6A 1NOZA 3HR0A 4WQ4A 4JNEA 4TT3G 3QDKA 2OT5A 1RFYA 2Z1HA 4O8UA 2UUAO 2FYUH 3CC2V 2ZE8A 1IKWA 3BGRA 5H6RA 4JI5O 3M8AA 1QLEB 2EBOA 1Q82O 3I8DA 5BRFA 5F0XA 3WB1A 4K43A 2V4DA 2ZCEA 1RBUA 4WBNB 3JATB 1M1KW 4E7JA 3TCUA 3GOIA 4DV1K 4M41A 5FRMA 4OKEA 1XMOB 1VSIA 3R9PA 4IOXA 2Q69A 3ULEB 1N8RO 2DQ3A 2DW4A 4DK1A 1SQQH 4I9WA 1GLBG 3L2VA 1M9NA 4E0DA 2WU5A 3BFRA 4CGGA 4CK2A 4X65K 1R73A 1ASUA 1KB9F 2HWB4 2YXYA 3W7UA 1MNGA 2CGOA 1GOBA 1XNQO 2Q0UA 3FFIA 3G71V 2Q8VA 1RTJA 1HPMA 2XASA 3DTUB 2W6LA 4AHCA 4JGSA 2F1MA 5M1PA 2HKOA 4RO2A 1GLFO 3B8MA 2XRIA 3RSEB 3K5NA 4O2BB 1GOAA 1LOTB 3HKCB 1AB3A 2EIKC 4HBNA 4NKGB 5LMNB 1IBMO 3AVBA 1N33O 4PHTX 3VF2A 2ZM6B 5GINA 2Z5UA 3OFNG 1OCOC 1BGXT 4FZ0A 3QINA 3KLFA 1SL0A 2PYLA 4NB4A 1BQMA 3T1HK 4F3OA 1PV0A 5IDJA 4BE2A 2XNDG 3OTFA 2Z1GA 3RMBA 2EIKB 4DTMA 2XAQA 3FKSG 1HKBA 3MXIA 3PJSK 4WF9V 4DR5B 5MLCQ 1YI2V 4UB8Z 3HO1A 2RS54 4JI7O 3MX2A 5EC2C 3VQ8A 4A5AA 3DMJA 4LFAO 4BR4A 3V9UA 1K4DC 1OCOB 4G28B 3JAKB 3L74H 3CETA 3CHWA 1SKSA 3VQ5A 1IBLK 4K0KK 2WSSG 4ELUA 4YSZA 3V6DA 2OCHA 3JD4A 3CJ9A 4EP4A 4DUZO 3D2FB 2W6IG 3PSFA 4BQZA 4C1NI 3ZMSA 1AJNA 1XOUA 1XC9A 4F4KA 4TUYA 3VRAA 4X64B 5LYJA 1EXQA 1SV5A 1YUWA 3ZX3A 4FFKA 4JYCA 5JICA 3CYMA 4UCTA 5LXTB 4CJPA 4ZTJA 3RYHA 1RDBA 4BQLA 3OYMA 3PSIA 4QOZB 3QESA 3C94A 1NTMH 4OPAA 4TQDA 2OYQA 2YIAA 5AQVA 4WCEV 2LO1A 1EETA 3E9OA 2OTLV 2NLJC 1NCQD 2J4RA 1BHLA 1OJHA 3N2KA 3ZMVA 1SESA 4UCRA 3TAFA 3FFKB 2Y0PA 1H2MA 3LWLA 1BQNA 1GN4A 3CS5A 1K6YA 1YAGA 2DY4A 4IYHA 4BREA 1ZOYA 1TYQA 2VGNA 3DLGA 1WPXA 2ADQB 4I2QA 1XQSC 3MDQA 4FZXC 3J80N 4DV7O 5BY1A 3FAVB 1W97L 3AEFA 1GN3A 2Z1JA 2QM7A 3CCSV 2WLKA 4KTZA 4JI0K 3RGBA 1TKXA 4AF1A 2PI5A 5H1SQ 4NB5A 3FX7A 4FLTA 4E7LA 1M90W 2HHHO 1PNLA 4FM2A 4FCYA 4RW9A 4M3ZA 3VQXA 5GAHP 3ABTA 4R79A 3DWLA 1BHBA 1PNMA 1HRV4 5J2PA 1I5XA 2HNZA 3F7YC 5CA1B 3DRRA 4FVUA 2F95B 4QCLA 1RVF4 3QICA 4KI6A 1SKWA 4KO0A 4WE1A 2Y4UA 1DTQA 3FI7A 4NXNK 2YCHA 4X8AA 3SQ0A 5LP6C 4UFZA 2OZMA 4NXMB 2QKCA 1SS3A 5CYQA 3HKBA 3OTOO 1MSDA 1XI1A 3L2QA 4BRMA 3SJQC 2XY5A 3AVMA 1MU2A 1BQZA 3MXJA 2CH7A 3JAWB 1ATNA 2UU9B 1I94O 2E1ZA 3RRHA 3WEEB 4KREA 3OYLA 2FSNA 3LDEA 5AQHA 3N4PA 1YVWA 4DV4O 3MWTA 5LP6B 1NGDA 4DR4B 5KQ8A 1W2BM 5EVZA 1AVMA 3DLKA 3HP6A 2NR5A 3CQXA 4WQ5A 5HL7L 4YJ3A 1R3KC 3QO5A 1WAFA 5CBHA 3QG5A 4CZKA 3THWB 4X66K 4LF9O 3C95A 3OYNA 2X6NA 2GTAA 2RF2A 4PI0A 1TUEB 2DFFA 3OTOK 1L3SA 1FPOA 3H1LH 1BCOA 4ILGB 3KK2A 5JCOA 4DV2K 1L8DA 3SFDA 3ENBA 3ZT2A 2ZJRL 1SQKA 1LNQA 2FBXA 1I94K 1KF6A 3TXQA 4KI4A 1RP3B 2QWRB 3A2FA 1ASJ4 4NCAA 2VQEO 2F9WA 1QR8A 4PELA 4GX5A 2XOKG 5IT9N 3AVHA 4CJ4A 2ZE2A 4O0IA 3U9ZA 2BTFA 2IVPA 3RW0A 1F4MA 1V4SA 1KRPA 3K5LA 5C8YA 2UXXA 3TAEA 2NRTA 3V1RA 4L8RB 4O44A 3SQ2A 2RQ6A 3CJHA 2A9HA 5JJNB 1IX9A 4J11A 2A5XA 3TR8A 4OX9O 2HNYA 3E22B 1DK1A 1RBVA 3ICXA 4H0LB 3VQAA 3S41A 3AG3C 3OGIB 1I39A 1FW6A 3P3NA 4OPKA 1N32K 4FWLA 1VQMV 1GLJO 3T3FA 4JD2B 3LSUA 1YJNV 5EBLC 1S6QA 1LWEA 2OANA 3CG7A 4JKGA 5F1XA 2IVOA 1L3VA 3AEDA 2VGMA 3KK3A 2Q0OC 4Q4X4 2YNGA 4KHNA 2G8VA 4O0JA 3TETA 1YF5L 5JS1A 4C8LA 2FBYA 4CFCA 5TKWA 4M7YA 1BHAA 4B9QA 2F4VO 3AG3B 1NWKA 1O9HA 3DM2A 4EFHA 3QEWA 1WBDA 4C8KA 2PYJA 4OX9K 3LNNA 1BCMA 1ZBFA 4PL8A 4XBFA 4FWNA 3UKRA 3RT3C 1VQON 4LH7A 4I9LA 2M7WA 4FYDA 3OVNA 2D2CB 2CE4A 1X9JA 3CCRN 3S9HA 4DR7K 3DOLA 1NGAA 4BR5A 2WLIB 5LJVA 1RGIA 1QE1A 3JASB 4B9UA 1WAJA 5J2UA 4XH1A 3LZJA 1MZFA 3H1KH 3APQA 2YV0X 4FJNA 2WLNA 3RMCA 4HZ3A 2RDCA 1PL0A 3J8F4 4JZGA 3OYFA 4B3RB 4YDUC 1XNRK 3IKMA 3WB2A 1M5IA 5AG2A 3FGUA 1YITN 5KI6A 5I3UA 2JIZG 4YOUA 1N34B 3AA3A 4LF6O 2ZGYA 3GWKC 3I5DA 2ETJA 2RJZA 2Q2RA 3EYZA 4JAXA 4YOWA 2YSUB 3THVA 1TKDA 1VBD4 2XY6A 5LGUA 1VQ6N 3KVGA 1NT2B 4W5OA 3AG4C 1SF9A 4BW5A 4X62O 2WA3A 3QMLA 3PX6A 3TJTA 4FJLA 3QBWA 1RDUA 1QBZA 3DRPA 3ZRWB 2QEXN 3ZSZA 1PM9A 4NTWA 1EZJA 4J9YB 3SR2C 2QWPB 2DE0X 3LDNA 5CZ2A 3UIQA 3CXCM 3T1YO 4LF6K 2Z3YA 2O8FA 4LF7O 1YSCA 2ZE5A 3AG4B 2VWBA 1Z26A 3TTCA 3L4IA 2A3ZA 2GTDA 4CHPA 4DFKA 2UXCO 5BMVB 1WLEA 1ASVA 3MHHC 4Q6GA 4CH6A 1IBKB 1HJOA 3D6RA 4JN4A 5AQNA 4FWPA 2HVKC 3CIRA 3BY5A 3VR9A 2Q0AA 1GLDG 3MMVA 4UV9A 4LF5O 3TABA 5J2TA 3O4NA 1HNZK 1XILA 2HNDA 3KD1E 2HF4A 1WA8B 5BPLA 4RW7A 3WNEA 1ZBLA 4B1ZA 4CERA 3CMAV 4EP5A 4YTPA 4BWMA 4DV3B 1XMOO 4OO1J 3ENOA 3CEIA 4K8ZA 4CEOA 3L71H 2F8TA 4M3TA 4O55A 3A0HZ 3N27A 3E9PA 1I7FA 4GNIA 5AQPA 3KK1A 3P4PA 3S3WA 2V51B 5ITZA 2IGIA 4X1KB 5L3CA 2P6JA 2QWOB 3ALYA 2G8WA 3AE3A 3AEGA 4FK5C 3UKUA 1YI2N 2ZNJA 3B8AX 3E35A 3C6AA 4GKKK 4DV1B 4UCOA 3JYCA 1E3MA 3RN4A 1RUI4 1Q18A 2IH1C 2ZM6O 1H38A 3QVNA 1D8YA 1PO24 2FTKA 4FWQA 3KLGA 2B1IA 4X65B 1V9PA 5AQFA 4FJ8A 2X74A 3I0RA 4O5FA 3UE5A 1KSPA 4EZ6A 1EN5A 3CC7V 3UQ8A 3PX4A 4CC5A 1SA0A 3UB5A 1M4UA 4FJMA 3J7YP 3ABKB 2YEVA 3G4SN 4DR5O 3ZT4A 5LOVB 1RT2A 3T7ZA 2ILMA 2OCEA 4FW1A 5M1NA 1KTQA 4WF9L 3HK2A 4MTFA 3U3GA 2ZT9B 4B3MO 1IO2A 2BE3A 2YX6A 4N47A 4X1YB 2HSTA 4CJWA 2UXDK 4ASUG 2BCCH 4MVUA 3NH0A 2OTLN 3ABLC 1MZEA 3RYIB 3T1HB 3FB8C 1FXKC 1YXBA 1TA8A 1XNQB 1GLLO 3B40A 4X64O 1I08A 3QLHA 2HG5C 1VAZA 2O8BA 4GB34 5CY4A 4CVNE 4R6ZA 1VSDA 4UCVA 3VF6A 3Q7CA 4AQYK 2O8CA 2D1KA 4BG8A 1BG3A 1RPRA 1OVQA 4BC4A 2XAHA 1IBLB 3H9VA 5B66Z 4K0KB 1FKPA 4HUFA 1FXKB 4DW0A 1IKVA 4MVMA 2F96A 4PHZA 2IU3A 1WPBA 1XMQK 2HF3A 4JKHA 4KAZA 4KUMA 4H5TA 5AQRA 4WCEL 1LUWA 1W0KG 5KMGA 4WYBA 1L5UA 2KHOA 1K9MW 1JLAA 3OS2A 5KX5B 3KZIZ 4LP8A 3DXMA 2F23A 2Y0IA 3EL2A 1RUF4 2E2PA 1YTFD 4GX0A 4ZKIA 1N0NA 4XH4A 2K1EA 3ZJZA 2H94A 2R9IA 3JARB 2YC0A 1KCFA 1NGHA 2P9IB 3C6UA 1RM1C 1J5EK 3ZETB 1HNXK 1TK0A 1RCHA 1AR64 3ZX6A 2AZ0A 1DF5A 5AQZA 3VN5A 1Q82W 5FROA 3EY1A 4U3FH 3VQPA 2WLHA 3OBWA 1BU6O 3AVKA 3TANA 4OPHA 3EKSA 3NMUA 2RNBA 1KC8W 2E8AA 4BRFA 3BRCA 4FIPC 4CJ3A 3IGAC 3CCUN 2ZKOA 3IS9A 4OXSA 2OZSA 1N8RW 1RDWX 1HNWK 1RM1B 3SDLA 3P4QA 3JXUA 3SZ2A 5AQXA 4MVOA 4IHJA 2IOCA 3APOA 4X1IA 4ZOLB 4DR2K 3ULDA 1BEV4 1Y74A 3E8BA 4H8KA 4JI0B 1DKGD 2GTSA 2YI9A 2YKNA 1NQTA 2D5RA 2W40A 2NRRA 3W7WA 3OYHA 1G6UA 2LQTA 2EIJC 5GTIZ 5BR8K 4I2PA 5LA6B 4JI4O 5B5EZ 5BREA 1VRH4 1XQ8A 1Z25A 5ELZA 4IIJB 2P4KA 2HLDG 2UU9O 1Q8IA 3NF9A 4DTPA 2XY7A 4MS2A 2QTOA 5L3BA 5B8HA 4FJGA 1Y4MA 3JALA 4I6MA 2YHBA 3SQ4A 4L87A 4DF8A 4QS8A 4NXNB 4EZ9A 3E86A 2EIJB 3A5OC 1SQPH 1S5JA 2B76A 5LJWA 2RN9A 3NF6A 4MW8A 2GSMB 2V7YA 4DR6K 3RYCA 1OZ0A 5KGXA 3CP1A 4ZHQA 2DJVA 1J9AA 1ITGA 4B1WB 2P1JA 2V52B 3A8TA 1L0LH 3AK2A 1W2BU 4CFAA 3LL3A 3MCAB 4YIPA 1SQFA 2Y48A 3TXSA 5GW7A 2H3OA 3UO2A 3D2EB 2ASOA 4JI2K 2JWKA 3B6PA 4H03B 3H1HH 3AO1A 4QGPA 4FJIA 4LNUB 5EIBD 3GE1A 1GAXA 3DGEA 4DTNA 3F73A 3VA3A 2CGJA 4M3UA 5LHHA 4BRIA 2CDYA 4E1NA 3H08A 1Q7YO 4X66B 1NR7A 4KB1A 2PI4A 3O65A 2GV9A 1WSHA 4N76A 3TAPA 3IC9A 2QWNB 2P9LB 3OTOB 3K9KA 3JAMO 1RHI4 1KECA 1EV14 3IG1A 3M99B 4DV2B 3NR7A 2HBJA 4BACA 2QK9A 1I94B 2ATKC 1JLCA 4DTRA 1W0JG 3AAPA 3CC4N 4KL1A 4RW4A 4DSJA 3CX5F 4TSFG 2EZPA 2MW2B 3ID8A 2NRHA 4DLEA 4DRXA 1BL3A 2RE2A 3NXSA 2BTOA 1RT1A 1NJZA 1D5NA 1SQGA 2OCCC 1IURA 1F51A 3ETEA 4EIAA 2LSNA 3ZEUB 4Z0UA 3J8AA 1F7YA 3BA8A 4ISGA 2ZE7A 4E1JA 4WFAV 1HX1A 2P9KA 1HPZA 4CBWA 2AHYA 4I7ZB 1ATRA 5JVHL 4DR1K 2B1GA 2O8EA 1VSHA 3NE6A 2R064 1HDJA 2P22C 3G6EN 1AL24 3ZHUA 2ZNIA 2IAJA 1PP9H 2OCCB 4HYOA 3LP3A 1N32B 1T6DA 1TUBB 1VSLA 4RAIA 4ILHA 1PIV4 1GRJA 4NTYA 1N36K 3SUPA 3GQKA 4AM6A 1QLNA 4KTWA 3ZT1A 3ITHA 3Q7BA 4PKGA 1U97A 1OH5A 4BIOA 4KHSA 1B9DA 1DGKN 3WNGA 3H1IH 2GEMA 3HYFA 4NLCA 4A59A 2W0FC 2XO7A 1NK8A 4FL9A 4OX9B 2VRZA 3DYAA 3C65A 3T1CA 2IJJA 4O4HA 1KVAA 2JJ2G 3KLHA 4AHSA 4ID5A 3HI0A 4PDLA 1VBE4 2DFEA 4F6RB 1KAYA 4CJTA 3VTHA 1RUH4 5FNVB 1VF7A 3MK6A 3I55V 1THZA 3LAKA 4FJCC 5A2QN 2B5UA 3J81N 4DR7B 1N34O 2AA4A 1IG8A 3CF5L 3THYA 4HNAB 3SPIA 1ZWIC 2YDEA 3AVNA 3U8XA 3Q4HB 3BDPA 2NRXA 4PKIA 3THOA 4CEBA 2L35A 3AA4A 1K73O 3VETA 1YEWA 5BRDA 3CHXA 1UFIA 3QF7A 2NNUA 4AHTA 1XNRB 3J80O 3CQ8A 3VQCA 1U45A 1NU0A 3M8QA 1QZ6A 1T8EA 2NRVA 3ID6A 4A62A 1LCUA 3M7MX 1YTAA 3D36C 3TGUH 4H5NA 1QVFM 4Y0WA 1P4RA 1RT3A 5L3DA 1ORQC 1NGJA 5LHGA 1YTFB 2YI8A 1TK8A 5HOOA 1JJ2U 5J2NA 1QZ5A 3VQEA 5KTQA 2XAGA 4CZMA 2ODMA 1AI4A 1H2LA 3HPOA 4Z4HA 3HXMA 4I55A 1VQOV 4J2BA 1UA0A 4MW3A 5HFMA 3O3GA 5KRSA 4OKJA 2E74B 4FJKA 4CF8A 2KG7B 4CIGA 1KFDA 4DR3K 2F7TA 3ZSVA 2PAVA 3LZIA 1CXUA 4O2AA 4K35A 1U6ZA 3QEPA 1NENA 4LF6B 4RUEA 5HRPA 2WP9A 1NK5A 4CZGA 4DWIA 3ATUA 4KTQA 4O4LA 2HJDA 1S0VA 2RN2A 2OPQA 2FF3B 4DV3O 5AQUA 2WDQA 2ZWHA 4E4EA 1NTKH 1D4M4 4DCHA 4D6TH 2ITDC 4ZI7B 3VQBA 4GV3A 5LMUO 2R72A 4U3JB 2EJRA 1PNKA 3CQYA 4NYKA 2E2OA 3O9RA 3HOTA 5HP1A 2B6AA 4CH5A 3SK3A 2PF4E 2QWQB 1OVYA 1LAWA 3O08A 2FC0A 1HW7A 1VK0A 2Q7EA 1HNZB 4JASA 4NYFA 4LF7B 2C2AA 1E1QG 4LH6A 1COV4 1VQ6V 4TSXA 4CIEA 3NGIA 3WNHA 2AHZA 4QJFB 1M56C 3C7NB 5AQTA 4LH4A 2JVDA 4CW7B 3TAGA 1HRI4 3K0GA 4X65O 3G10A 5EIBC 2P9PA 3KKSA 5LMUK 1L0NH 3CRCA 3AO3A 2QEXV 3RFRA 1MABG 1ZC6A 2P9NA 4DG1A 4YHHK 4IZ9A 2PY5A 4LBEC 4W5QA 4FWKA 4LF5B 1I0HA 4OVLA 1KLMA 5B1BC 3H1VX 4LD0A 4XDJA 3T4ZA 1BE3H 5FPDA 1DGSA 4Q0BA 3CI5A 1M56B 2O4IA 1BGYH 1JFFB 4GKKB 4JI6K 1KC8O 4JAAA 2DFHA 1MWKA 1R6TA 2DWDC 3L8BA 5J9PC 4B1VA 4J8FA 1R3JC 1YZBA 5CBGA 3HB3B 1AILA 4FXDA 2D3OW 1GKFA 4FJXA 2HHWA 3RBZA 5B1BB 3T1HO 1GK9A 5FPRA 4ELVA 1HKGA 5M1QA 5AQLA 5J2QA 4P9PA 1HYSA 3OMAB 1RTIA 1R59O 4IJAA 2BUPA 2I7NA 3SYZA 4PA4A 3U3YA 1E4FT 2QA4N 2CTQA 2QKSA 4YJ2B 4FWOA 4FLVA 4WBNA 3V1OA 3OEHG 4QE9A 1V54C 1IBLO 4K0KO 4UCUA 4CS4A 3C6HA 1WAZA 3CCMN 1F23A 2UXDB 1YIJV 1GN2A 3ULEA 1BT8A 1KLNA 2ITMA 3O1BA 4HTLA 3HT3A 4LF4K 2AZ2A 3ZMUA 4JHDB 3JSMA 5C0YA 4Z4CA 3FE1A 3K0SA 4FZZA 1OV9A 2WUSA 1Y6XA 4AI8A 4QE7A 5GTHZ 3BY6A 2XHBA 4AM7A 5CHIA 4Q5VA 1AJQA 3WB0A 1V54B 4AQYB 3DXKB 5DK5A 3QNOA 3RSEA 4O2BA 4KH4A 3HKCA 1WSIA 4PWDA 1UA1A 1ENVA 1S3XA 1Z05A 4B3MB 2RMU4 1TUYA 5AQWA 1RBTA 1XMQB 2WDVA 4KP4A 5BRHA 3SJCC 2Y1JA 3H46O 1RSOB 4FJHA 1QTMA 1BIZA 2Q73A 2Q3SA 2A42A 5LYJB 3G4SV 3CIPA 3HVTA 3SUOA 4FPPA 1IJJA 5EYPB 2WOMA 4L8JA 2ZF5O 5IWAK 1NR1A 1J5EB 2Q36A 4IWVA 4KB0A 4FOEA 4JI0O 3CCQN 3L2UA 4CZLA 3VEOA 3JAKA 3T2MA 2Z0AA 1CEZA 3MAQA 5GAEP 3L72H 2HHXA 3TTFA 3HTVA 3N2KB 3P4IA 4DSFA 2HHUA 1EN6A 3D2FA 3EN9A 2VG5A 1Z7S4 3HL8A 4FM0A 3MN6A 4CZFA 1YF2A 1HNWB 5C2FA 3AG2C 1S22A 2JGDA 4EHUA 4G2KA 1N6QA 4M45A 3ZYYX 3ZS8C 5LXTA 1NGIA 5F2VO 4DR2B 4I4TA 3BVOA 3ASOC 4UVCA 3SPJA 3NAEA 1NJIO 4NXNO 3SMSA 2ZR2A 2A7WA 2R074 1RNHA 2QKBA 5J1EA 3ETQA 4XIUA 4B3SK 2X6SA 2PFUA 2R7YA 4FMTA 5BR8B 3AG2B 1VQ8V 1D4XA 3LPUA 3PIOL 2A1SA 3P83D 3LP0A 3K03A 4ISEA 3O9QA 3ASOB 4M3WA 1DLOA 3UT5B 1YHQN 3DLLL 3A0IX 3L70H 4BDYA 1G4YB 4J2AA 1L3UA 3KG2A 3PO4A 3VESA 2RR14 3FAVA 3B6OA 4OLAA 2WLMA 1NVPD 3E2EA 2YUAA 4CF1A 2KFZA 2RS14 5KUKA 4X66O 4DR6B 4B3OA 5KQDA 5EK0A 4JI4B 5BPMA 3CCUV 4DV2O 4QPKA 1OCZC 2V7ZA 1AP5A 4H5RA 4LFBK 1K3EA 3QO8A 1WP8A 5CA1A 4JI2B 4JK7A 5C93A 4GX2A 5B1AC 3VMFB 4O4JB 3HKEB 5AQYA 3OYDA 3SYOA 5JLFA 2R7FA 5DMRA 1Q6IA 5JJEB 4M42A 3WU2Z 3QO7A 2GUZB 3K79A 4YJ3B 3CJBA 4E7KA 5HFLA 2FLOA 2YJEA 1OCZB 2Q4PA 4H44B 3FYEB 2HBLA 2YNFA 1K8KB 4BRAA 4CFDA 4LSLA 5GIPA 3SGIA 5B1AB 1TKTA 3AO2A 5FLXN 2NUBA 1QSSA 3JAWA 3NVMA 1D9FA 2ZDIC 3TK1A 3K59A 1ZAUA 2FL4A 1RDDA 4H4MA 4BRHA 4WFAL 1S72V 2UUCK 2H3GX 3BPZA 2Y69B 1N32O 5LP6A 1C0FA 5B1OA 4BAYA 3WNFA 3AAQA 4PA6A 5H5NA 4EB6B 1QSLA 4FK4A 1S9EA 2ITCC 1WBBA 4JKEA 3I55N 3THWA 1NNEA 1UAXA 4W4KA 4BG9A 4Z1MG 2WLLA 4LY7A 3CRAA 3HKDB 4JRPA 4HUEA 3MX5A 1JXBA 4ISFA 2ZR3A 3JS6A 2K9PA 4DR1B 5CMUA 3CPWU 1PO14 4FJ5A 5L3FA 4JEPA 4N5SA 4CF0A 3M8SA 3SQ1A 1OCRC 2QWRA 1S3JA 3GB7C 5GONB 1W9HA 4DS5A 2IS3A 5CZ1A 1EO1A 1N36B 1SKVA 4D7TA 4WFBV 4DV0K 5F2RA 3OJSA 2G8UA 4DR7O 4TWKA 1IG9A 1U04A 4DFJA 1B06A 2WQYA 1B92A 1RT5A 1SERA 4PY5A 1OCRB 3FZKA 3CC4V 3E22A 3L2RA 3KHYA 4MTXA 2IU0A 3ASMA 4NYNA 4FOIA 3UKRB 2DPNA 1X9MA 4Z4EA 4JTAB 1XNRO 1YVUA 2XT9A 4F3TA 1QQMA 1C1AA 3VOVA 4C8NA 4LH5A 4O5BA 1DF4A 5FPNA 1RT4A 3FFQA 4JAVA 4JD2A 2QTDA 3M3ZA 4O4IB 1S1XA 1S1UA 3D7EO 4KH5A 2E6MA 3NGZA 4CZIA 2W6KA 1SZTA 3ZLJA 2FKXA 4C8MA 5J2UB 4B7KA 3BABA 1Q7YW 3UO3A 3G6EV 1VBC4 4Z1VA 4CJKA 2E2NA 2IH3C 1QVFU 3AVJA 3ZT3A 3A0BZ 2GWKA 5AFUH 3P31A 3BF1A 4U67L 3PY8A 5E1AC 2ADPA 3X2QC 4FW2A 3ZSXA 2QM4A 4NLBA 3S3NA 4GKJK 4F9OA 5KA5A 3SV3A 3PIPL 1WB9A 1Y64A 4D7SA 2WLIA 1GM9A 2QSAA 1LWFA 4XEIA 2Q6AA 1P7BA 2O4GA 5IYCO 3JASA 4XDLA 2E4LA 2NRZA 4PDWD 5CB4B 3VQYA 2UUBK 1G1XB 4JF3A 4JI3K 5KLVH 3OBYA 4Q4V4 2JEXA 3X2QB 5DM6V 3K57A 1NGEA 1JJ2M 3H3OB 4CGIA 3VENA 4DSIA 2OPRA 1BS3A 4DR3B 4OGEA 2H89A 4CI6A 2A0LA 2CAZC 4CJRA 4X89A 1L1FA 1HNZO 3G67A 1NK9A 1NK7A 2R044 2JRIA 2KQXA 3B4SA 2JLEA 1TAEA 5KHIA 1MDUB 1I3AA 3CM5A 3CPEA 4J2DA 1RUD4 2WTUA 4YIOA 1BWFO 2N74A 3STLC 5KHKA 1SL1A 4MSWC 5KHGA 2IW5A 1O13A 3CJCA 1NKEA 4KRFA 3KK7A 4WFNL 3AE4A 3TAMA 3QERA 3ZRWA 1PPJH 1VP7A 2ZE6A 2QXFA 4P9OA 1TAUA 5TISZ 1B9FA 4A61A 2QWPA 3OMIB 3VQDA 1NGGA 1FK9A 2ZQBA 4JPRA 4F6EA 2E75B 4GKKO 3T69A 1ZUQA 1R6KA 4LC1A 2BTQA 2RPIA 4CJVA 4P30A 3GL1A 2Q31A 4I9QA 3JD3A 5TKYA 4UVBA 5BMVA 2ASMA 1MOFA 4Z4FA 4N21A 1YIJN 1NVPB 4J10A 5LMUB 2W41A 3GDQA 3AEIA 4BC3A 4LF8K 3SI6A 3C3SA 1R6NA 5JVDA 2Z1IA 4YHHB 3U11A 1JLBA 3OW2U 3HRGA 2YHYA 3LNMB 3RWUA 1K73W 4HHTA 3VEYA 1NMNA 2CTRA 3K58A 5HRRA 2CTWA 2JJ1G 4M63C 3D45A 5HRNA 5SWMA 2VG6A 1R3IC 4MVZA 1EFRG 4K25A 5AZIB 3JD1A 3ABKC 1WA8A 4PI2A 3E8GA 4J7JA 4JI6B 1WUAA 3KIOA 1VMGA 4UB6Z 2AXTZ 1SZ2A 3IFXA 5FRNA 2ACZA 2UXDO 4C1NK 1VQ7N 2HEPA 3J7AU 4R50A 4IYIA 2JGUA 2PGGA 5KA6A 1DTTA 3TU5A 3MN7A 4BC2A 4UXNA 3D0PA 5A9GA 3QEIA 2P9SB 4E3SA 3K0DA 3IDHA 4N56A 4X20A 1ZL8A 1VBA4 4MVSA 4BC5A 1VARA 5LHIA 4X1KA 1D5AA 2V1DA 2YEVB 1QQCA 3B8NA 2QWOA 4PD4F 1KD1O 3CFOA 4AQYO 2G38A 2HBMA 2P9UB 2LGQA 3CRQA 3DXRB 3V9XA 4IDKA 4MTGA 1OHHG 1XHXA 5C12A 4CE9A 4IL6Z 1KAZA 4IEEA 4CF9A 4TV8B 3UCSC 3GVMA 5KHJA 4FPBA 3A5MC 1XMQO 1FXHA 1NZ6A 2Q67A 4ID1A 4LF4B 3ZSWA 4N41A 4NO7A 4KHUA 4LC9B 3R65A 2YHAA 4CJUA 5E84A 1VSEA 1MQTD 1FFXA 3WG7C 4FFBB 1VRTA 1ZBIA 1BO5O 2KKWA 2O8BB 2IBZH 1GLAG 3AO4A 3J81O 3H1JH 3DLBA 1YQ4A 4JI1O 2EINC 1JCFA 2Y4TA 5LOVA 1E4GT 1Q81O 1J5EO 4RQFA 1HNXO 1WB7A 4K42A 4G27B 4KHPK 4DFPA 2VWJA 1BMFG 4CESA 5LMNK 2UXBK 1X3NA 1C1CA 4DTUA 3LUTB 3C0BA 3DRSA 2FBWA 1G8MA 2EJ7A 4ICGA 3V81A 3JBG4 3WG7B 1WJZA 1TAQA 2RM24 4IDHA 2VG7A 3BUZB 1OH7A 3RRGA 3CXHF 4B9LA 1Q5OA 4GZRB 1WSFA 2E20A 3ZSQA 3AK3A 1VQ8N 4ABMA 1HNWO 2EINB 5EZYB 4ELTA 4PA1A 5JQGB 3M8PA 2QA4V 2YXHA 3OYKA 5IWAB 2YIBD 4DR2O 4JI1K 1KFSA 2ARHA 3LP1A 2GUPA 1K33A 3CCMV 4R8CA 2AW9A 4CBUA 1NBMG 3DI6A 4CCHA 3ZRSA 3JCUZ 2ZGZA 2E2QA 2FSJA 3KKYA 3W7SA 1PD3A 1FXKA 1G99A 1E1RG 4U7OA 3E1YA 3CCEN 1U47A 5BR8O 4JYYA 3DLRA 5ADXA 4L3QA 4Q20A 1ASWA 1H1VA 4JS5A 3RMDA 4AHRA 4MDBA 4FLUA 4E7HA 3RR8A 5KX5A 3WT0A 3VTIA 4BR0A 2NN4A 1T03A 4I0XB 3DLEA 1F21A 1EBOA 3EO3A 4YORA 3JD74 3JARA 3VPZA 4W5NA 2P9IA 4C7UA 3ZETA 1EN4A 1T7PA 1AP6A 4B08A 1TKZA 2XTAA 4DR6O 4B3SB 3WQTA 3ABUA 3IRXA 3CB2A 1BZKA 5IYBO 3P5JA 1NBWA 4KHWA 4E89A 2WA4A 5IY5B 5JS2A 1POV0 1Q3EA 3OAAG 1KKCA 4J41A 4Q4Y4 2YS8A 1JA8A 4J2EA 1TL3A 4JI2O 3QIOA 1PVC4 2X0LA 3AE2A 2W0XA 2X7RB 2V7QG 1CXQA 4ZOLA 4DMNA 4J9ZB 1ZSPA 3CCQV 1S72N 1Q86O 1OCCC 1ZYQA 2O8DB 3RWRD 1QHTA 3ABVA 2QWLA 2BSKB 2PTMA 1FFTB 2ZJQL 3KLEA 2YJFA 3FB5C 1KQSU 1S6PA 2WONA 3BAAA 3MD0A 3CMEN 3JSLA 4ZHQB 2X5ID 1K5SA 4ICLA 5LA6A 1NK4A 1T05A 5CN0A 1SL2A 2L6LA 2LFRA 5B3SC 4B9TA 4DV5K 1ZLZA 1MA9B 2QJ1A 4LFBB 4IO9L 4IIJA 1BI4B 4MQ3A 2IJHA 1L3TA 1OCCB 1S1WA 1VQPV 3ZHRA 3CCVV 3CERA 1TVKB 4OPJA 2PW9A 3AA2A 4I50B 5J2MA 1NH2D 4FLYA 4JKCA 4OKKA 3M8RA 3ZHVA 4BE0A 3OA9A 1KUQA 3AE6A 5B3SB 4NXMK 4O8KA 1H2KA 2GWJA 3OY9A 2OIEA 4PKHA 4DSLA 4BIZA 4DUYK 4NCBA 2B9ZA 4RG8A 4DR1O 1K97A
chains in the Genus database with same CATH topology
4CEDA 2BGGA 3LP2A 4TOIA 3OYBA 4LNUA 3PUFA 4F8RA 1JLQA 4DLGA 3B2EE 4MFBA 2HHQA 4RW8A 4O4GA 5CA0B 3HM9A 2IM9A 3ISNC 1G15A 3N2GB 3AV9A 1LWCA 3K2PA 4DV0B 3TWHA 3ZT0A 3RTVA 3NHGA 2OWOA 3EZ5A 3NFAA 2PZSA 3SNNA 1FXXA 3OYAA 5IYZA 4HVJA 4HUGA 1Q9YA 2OA8A 4IG0A 4EFBA 1TUBA 4UQGA 4PUOA 4FJ9A 3PO5A 2OPSA 1TL1A 3AVIA 2F66C 3QIPA 1HJRA 4CJEA 5D3GA 2DTUA 5IJ9B 5D5QA 2G8FA 4TV9A 4F6RA 5FNVA 4KHYA 2D0AA 4GKJB 4CK3A 1S1VA 1S1TA 3L3UA 2X78A 5IJ0B 4DQQA 3V1QA 4HNAA 1VRUA 4E1MA 3NH1A 2UUBB 5D5PA 4JI3B 2IC3A 3MEGA 4BDPA 4AILC 1D9DA 1RBRA 1VSMA 1JLGA 4O2AB 4EFEA 1IKYA 3RYFA 4H4OA 1A5XA 3BHPA 1VSFA 2VWKA 1T5EA 2ZD1A 4E19A 3AVAA 2A1RA 4CEEA 4W5TA 4CGDA 1JL2A 4DTJA 3HPGA 4ZI7A 3CFRA 4LF8B 4U3JA 4CHQA 5JH7A 1X4TA 3O4QA 3VQ9A 4FM1A 2KTQA 4LSNA 2YKMA 3OYIA 2KFNA 3SPYA 1C0TA 1WSJA 1YTUA 4FK2A 1RT6A 1SUQA 5HRSA 4FLZA 3SUQA 1JMKC 4I7FA 2E6LA 4CECA 4DF4A 5I42A 4CH4A 1C1BA 4CK1A 1JFFA 3JATA 4C8OA 1XWLA 1NOYA 4FVMA 3SJJA 4YNQA 4HTUA 3F9KA 3QTCA 4Y1CA 1S9GA 4KHPB 4M3YA 3OYEA 4YJ2A 2UXBB 2BDPA 3HJFA 4CJ5A 3NF8A 2D0CA 3T1AA 3LANA 1Y97A 4TUYB 2E3CA 3RYHB 4CEQA 4JI1B 1HMVA 4KFBA 1WSEA 1HNXB 2EX3A 2Q7HA 1KVCA 3V4IA 3BA9A 1WN7A 2F8SA 4DU3A 3LAMA 2GBZA 4JS4A 1RSOA 3QETA 5EU7A 4CC6A 5EYPA 4CEAA 4I4TB 1NKBA 3VA0A 4QAGA 1QS4A 3I0SA 1JLEA 3ZCMA 2P51A 3U10A 3OYGA 3AVLA 4B9VA 4HCCA 1Z5VA 4M3XA 1U48A 4DSKA 3HKBB 3OYCA 2ITGA 4DV5B 1NK6A 4FZYA 2JS5A 1J5OA 1HQEA 5JCOC 1BIUA 3UT5A 3JSNA 2P5GA 3NCIA 3KJVA 3SJBC 2P5OA 1A5WA 4BE1A 4DUYB 5FPOA 3V9ZA 1EKEA 3OS1A 4GLXA 4O4JA 3HKEA 2AJQA 1HR0B 1R0AA 4R5PA 4OLBA 5C8YB 1ZBUA 2YNHA 2D0BA 2OPPA 5C24A 3TARA 4HCBA 2KQ2A 1UOCA 2RKIA 2R70A 4DU4A 4CH3A 1WLJA 4KKOA 2HB5A 4BW9A 4EB6A 3NF7A 2Q7GA 3ZEDA 1RBSA 3NH2A 5CYMA 4Z4GA 3HKDA 3NBPA 4GW6A 5JJJB 1U4BA 4FLWA 4JV5B 4LFCB 1LW2A 4ZIBA 4CF2A 3SPZA 1WSGA 5GONA 1O9GA 3K5OA 1C0MA 3PV8A 3IAYA 3LWMA 1TGOA 3KTQA 3QO9A 1TK5A 2G8IA 3U0ZA 1CZ9A 3HVRA 4O4IA 1JJOA 2ZIMA 1HNVA 4DV6B 1NJYA 3SUNA 1KVBA 1Q43A 1NKCA 1BISA 1M93A 2W42A 1X1PA 1QSYA 4B9MA 4KV8A 1RDCA 3L3VA 3L2WA 1HYVA 4CIFA 2HMIA 1A5VA 3C6TA 5CB4A 4B9SA 3SCXA 2ATQA 4DQRA 4YY3B 3P1GA 3KD5E 5HROA 5J2TB 2HHSA 3VQVA 4CFBA 3TAQA 2VQFB 2ZINA 2BTQB 4CHYA 4JI8B 4JYAB 4DQIA 3OS0A 5JVDB 1JXEA 1C6VA 4CJSA 5HLFA 1NK0A 5T7BA 3NGYA 5ITZB 1TV6A 1IKXA 3HP9A 3PX0A 1RT7A 3DOKA 2E5LB 3QEXA 3DSQA 1C0UA 4DTOA 4IKFA 4X20B 1SA0B 5E41A 1WNSA 3O3FA 4TQFA 4AHUA 2I5JA 4DFMA 5KHHA 1IH7A 1J53A 4CEZA 3U6FA 4LR3A 1FFXB 5SZTA 2UUAB 2G8KA 2PUSA 4UCSA 4GVMA 4JI5B 4IFYA 1RILA 3VQQA 4DS4A 1JKHA 1U49A 1VSJA 4DU1A 3AVFA 4X1YA 4TV8A 4CEFA 5FDLA 4CS2A 3RYIA 1HNIA 5KMGB 4FFBA 4JLHA 4FJ7A 1VSKA 4B8CA 4CGFA 1X9SA 4OJRA 4DQPA 1IBMB 5HBMA 3QEVA 2ZIOA 1N33B 1EP4A 4CS3A 4F2SA 1EX4A 5EZYA 4CGJA 5JQGA 1LV5A 4EEQA 2FBVA 4ZHRA 4IHJB 2EHGA 4BWAA 4X1IB 4JI7B 3OYJA 4LFAB 1CLQA 5C42A 5K1PA 3S3MA 4DUZB 4CHNA 1RTHA 4DTSA 4NVPA 2G8HA 3JALB 3G0ZA 3KLIA 3O3HA 3CM6A 3CFPA 2FBTA 4B8AB 1XHZA 1NJXA 1KMIZ 4AHVA 4DK0A 3RYCB 1H2SB 4YFUA 4AH9A 2KZMA 4K8XA 3KKRA 1TVRA 2YXLA 3LPTA 4DV7B 1FJGB 1N5YA 3VQ7A 3VQWA 2HHHB 2YNIA 3AO5A 3JYTA 1RTDA 3V9SA 2R9AA 3K5MA 1BI4A 4IG3A 4CJQA 3MEEA 2UUCB 3CSXA 1TVKA 1ZBHA 3OJUA 4I50A 4BDZA 4DRXB 2F93B 3HSTB 1CZBA 4KHQA 1FKOA 3ZSRA 4DTXA 3ZSOA 4RW6A 2HHVA 1J54A 4GMJB 4JRQA 5K1XA 3AVCA 1HYZA 2GUIA 4CGHA 4DV4B 3AA5X 3NDKA 1LAVA 3SJAC 4LF9B 1JL1A 5CA0A 1W0HA 1YT3A 4CHOA 3QNNA 5IYZB 3N2GA 4O4HB 1UWBA 4ZTFA 3RMAA 2VQEB 1RDAA 2QKKA 4FK0A 3LDSA 2XY8A 4F2RA 1HQUA 1KU9A 4FJJA 4TV9B 1Z5WA 3MXMA 3VQ6A 3MECA 4PQUA 1NJWA 2BE2A 1B04A 3V9WA 2F4VB 3MEDA 5KGWA 4IFVA 4I55B 5IJ9A 4CJFA 4E7IA 4B3TB 5K14A 3ZSYA 4G1QA 3S3OA 3RYFB 4CHZA 3AVGA 1SKRA 5C25A 4GYCB 3T19A 5IJ0A 2IDOA 2HVIA 4O4LB 3RR7A 2HW3A 3DLHA 2YIBA 1P49A 4B9NA 4DSEA 4DQSA 4IBNA 1JLFA 3TI0A 2B5JA 1O1WA 2KW4A 4FLXA 1X9WA 4W5RA 1LW0A 2KZZA 4OGCA 1HRHA 4CJLA 1Q9XA 2HHTA 2B4JA 4M3RA 4Y1DA 4X62B 5KRTA 3E01A 5JH7B 4NCGA 2Y1IA 3VQ4A 3PN1A 4BWJA 3T1YB 3LALA 3HPHA 4KPYA 4Z4IA 2HVHA 2UXCB 1REVA 1GOCA 2BANA 3SV4A 1NOZA 2Z1HA 1IKWA 3BGRA 3I8DA 3WB1A 2V4DA 2ZCEA 1RBUA 4WBNB 3JATB 4E7JA 4M41A 5FRMA 4OKEA 1XMOB 1VSIA 4DK1A 4E0DA 3L2VA 4CGGA 4CK2A 1ASUA 1GOBA 3FFIA 1RTJA 4AHCA 2F1MA 2XRIA 3K5NA 4O2BB 1GOAA 3HKCB 4HBNA 5LMNB 3AVBA 2ZM6B 1BGXT 3KLFA 3QINA 1SL0A 2PYLA 1BQMA 4F3OA 4BE2A 3OTFA 2Z1GA 3RMBA 4DTMA 3MXIA 4DR5B 3VQ8A 3DMJA 3V9UA 3JAKB 1SKSA 3VQ5A 4ELUA 3V6DA 4EP4A 1XC9A 4F4KA 4TUYA 4X64B 5LYJA 1EXQA 1SV5A 3CYMA 4UCTA 5LXTB 4CJPA 4ZTJA 3RYHA 1RDBA 4QOZB 3OYMA 3QESA 3C94A 4TQDA 2OYQA 2YIAA 1EETA 1BHLA 3N2KA 4UCRA 3TAFA 3LWLA 1BQNA 1K6YA 2DY4A 3DLGA 4I2QA 4FZXC 2Z1JA 4KTZA 3RGBA 1TKXA 4E7LA 4FLTA 4FM2A 4FCYA 4RW9A 4M3ZA 3VQXA 5J2PA 2HNZA 5CA1B 3DRRA 2F95B 4QCLA 4KI6A 1SKWA 4KO0A 4WE1A 1DTQA 3FI7A 3SQ0A 5LP6C 4UFZA 4NXMB 5CYQA 3HKBA 1XI1A 3L2QA 2XY5A 3AVMA 1MU2A 3MXJA 3JAWB 2UU9B 3RRHA 4KREA 3OYLA 5LP6B 4DR4B 3DLKA 3HP6A 4YJ3A 1WAFA 3QG5A 3C95A 3OYNA 2X6NA 2RF2A 4PI0A 2DFFA 1L3SA 3KK2A 1BCOA 5JCOA 1L8DA 3ZT2A 2FBXA 4KI4A 3A2FA 4NCAA 3AVHA 4CJ4A 4O0IA 2ZE2A 1KRPA 3K5LA 5C8YA 3TAEA 4L8RB 3V1RA 4O44A 3SQ2A 2RQ6A 5JJNB 3TR8A 2HNYA 3E22B 1RBVA 3ICXA 3VQAA 1I39A 4OPKA 3T3FA 1S6QA 1LWEA 3CG7A 1L3VA 3KK3A 2YNGA 4KHNA 2G8VA 4O0JA 5JS1A 4C8LA 2FBYA 4CFCA 4C8KA 3DM2A 1O9HA 3QEWA 3HO1A 2PYJA 3LNNA 1BCMA 1ZBFA 4LH7A 4I9LA 4FYDA 3OVNA 3S9HA 3DOLA 1QE1A 3JASB 4B9UA 1WAJA 5J2UA 3LZJA 2YV0X 4FJNA 3RMCA 3OYFA 4B3RB 3WB2A 1M5IA 5KI6A 5I3UA 1N34B 3AA3A 2ETJA 2RJZA 3EYZA 3THVA 1TKDA 2XY6A 1NT2B 4W5OA 3PX6A 4FJLA 3DRPA 3ZSZA 3SR2C 3UIQA 5CZ2A 1Z26A 4CHPA 4DFKA 5BMVB 1ASVA 4Q6GA 4CH6A 1IBKB 2Q0AA 3TABA 5J2TA 3O4NA 2HNDA 3KD1E 4RW7A 3WNEA 1ZBLA 4CERA 4EP5A 4BWMA 4DV3B 4K8ZA 4CEOA 2F8TA 4M3TA 4O55A 1I7FA 3KK1A 5ITZA 2IGIA 4X1KB 3ALYA 2G8WA 2ZNJA 4DV1B 4UCOA 1D8YA 3KLGA 4X65B 1V9PA 4FJ8A 2X74A 3I0RA 4EZ6A 1KSPA 3UQ8A 3PX4A 4CC5A 1SA0A 1M4UA 4FJMA 3ZT4A 5LOVB 1RT2A 4FW1A 1KTQA 3HK2A 3U3GA 1IO2A 4N47A 4X1YB 4CJWA 3NH0A 3RYIB 3T1HB 1XNQB 1TA8A 3QLHA 5CY4A 1VSDA 4UCVA 1IBLB 4HUFA 4K0KB 1FKPA 1IKVA 2F96A 4PHZA 1WPBA 4KAZA 1L5UA 5KMGA 1JLAA 3OS2A 5KX5B 3JARB 1KCFA 3C6UA 1TK0A 1RCHA 3VN5A 5FROA 3EY1A 3VQPA 3TANA 3AVKA 3BRCA 4CJ3A 3IS9A 2OZSA 3SZ2A 4IHJA 2IOCA 4X1IA 4ZOLB 3ULDA 4H8KA 4JI0B 2YI9A 2YKNA 2D5RA 3OYHA 1G6UA 4I2PA 5LA6B 1XQ8A 1Z25A 4IIJB 3NF9A 1Q8IA 4DTPA 2XY7A 4FJGA 3JALA 2YHBA 3SQ4A 4DF8A 4NXNB 4EZ9A 1S5JA 3NF6A 3RYCA 5KGXA 4ZHQA 1J9AA 1ITGA 2P1JA 4CFAA 1SQFA 3B6PA 3AO1A 4FJIA 4LNUB 5EIBD 4DTNA 3F73A 3VA3A 4M3UA 4E1NA 3H08A 4X66B 4KB1A 1WSHA 2GV9A 4N76A 3TAPA 3OTOB 3IG1A 4DV2B 4BACA 2QK9A 1I94B 1JLCA 4DTRA 4KL1A 4RW4A 4DSJA 4DLEA 4DRXA 1BL3A 1RT1A 2BTOA 1NJZA 1SQGA 2LSNA 4Z0UA 3BA8A 1HPZA 1VSHA 3NE6A 2P22C 2ZNIA 2IAJA 3LP3A 1N32B 1TUBB 1VSLA 3SUPA 4KTWA 3ZT1A 3ITHA 4KHSA 1B9DA 3WNGA 1NK8A 3HYFA 2XO7A 4OX9B 3DYAA