2PY5A

Phi29 dna polymerase complexed with single-stranded dna
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
564
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GGACTTT)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 165
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2py5A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2py5A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2py5A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2py5A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2py5A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2py5A06
4CEDA 1VSKA 1JL2A 4CHQA 1RDDA 4E7HA 4FJIA 1ZBIA 1W9HA 1QE1A 4G1QA 1NK9A 1VSHA 4PY5A 3VQ6A 4CIEA 4N47A 4E1MA 4JRQA 5FRNA 3THVA 4DS4A 4EZ6A 3B6OA 1S9GA 3MXIA 1ZBUA 3ZSZA 3SV3A 4CHOA 4B9VA 1NOZA 2BANA 4BACA 4FLXA 1GOAA 3H08A 2KFZA 5FROA 1VSJA 2PY5A 4J2AA 5HLFA 3NGZA 4KFBA 1LV5A 1QSLA 2XO7A 4FJ5A 3DMJA 3U6FA 3K2PA 1YT3A 1KFSA 1RTDA 3QETA 2GUIA 3OJUA 2OA8A 2Z1JA 3MXJA 3OYMA 1SKWA 1S1VA 1VSFA 3SJJA 3TR8A 4E19A 3CM5A 4ID5A 4Z4HA 1N5YA 3AVIA 4BDZA 1C0MA 1FK9A 1Q8IA 2B5JA 4ZHRA 1T05A 4C8LA 4I9LA 5D3GA 4Q0BA 2Z1IA 1HRHA 1LAWA 3RMDA 1C1BA 3SV4A 5CYMA 3SCXA 4FM1A 1RT3A 1NK7A 2AJQA 1T7PA 2P1JA 2PYJA 1X9MA 4F2RA 4ELTA 1NJWA 4CGHA 3DLRA 1TK5A 4Y1CA 4B8AB 1X9WA 1XHXA 5SZTA 5DMRA 4I2PA 3MEDA 3TI0A 4W5RA 4I7FA 2E6LA 4KAZA 5HRSA 3RR7A 3TAPA 2VWKA 4CFDA 1BIZA 3K58A 4LY7A 4YFUA 3M8PA 5KRTA 1ZYQA 4OGEA 3OJSA 3ZSXA 4O0IA 1JL1A 4DFJA 1EKEA 2KZMA 4PQUA 1IO2A 4KO0A 3JSMA 1EETA 3WNHA 4M41A 1G15A 4MFBA 2G8VA 4CFCA 4BWJA 4FK4A 3JYTA 4CESA 3BGRA 3OYGA 3ZSVA 4N41A 3AA5X 4DQSA 4DTNA 4CEEA 3LZIA 4CHNA 1T8EA 4FZYA 4PUOA 3SPZA 4DF8A 1ITGA 2XRIA 4LSNA 3VQ7A 3OS2A 4FM0A 1Z25A 4FLWA 1J5OA 1SL0A 1B9DA 1C1CA 5JS1A 2GBZA 1HNIA 2IC3A 1KVBA 1NJYA 5K14A 1S5JA 1TAQA 3QEVA 4CFAA 4CJQA 4B9NA 4M3XA 1L3UA 2G8HA 3RR8A 1CLQA 3PV8A 3DRSA 3KLGA 1DTTA 5J2NA 3PX4A 4HCBA 1JLFA 3BDPA 3CFOA 2PYLA 2E4LA 3VQAA 3ZT1A 1JXBA 4DSLA 4KREA 4LH5A 3LWMA 1IKVA 2G8FA 3PY8A 3S3OA 3DLKA 1TKZA 3HXMA 3LP1A 1VSLA 2X6SA 2D0AA 1L3TA 4HCCA 4CF8A 1NJZA 4DFMA 4KB1A 3LP2A 4AHRA 1WSHA 4E0DA 2RF2A 1BHLA 3ULDA 4CHZA 1HNVA 2JGUA 2B4JA 3SQ0A 3MAQA 1R0AA 4F3OA 5J2PA 3NGYA 4DQRA 3NBPA 4B9SA 3DI6A 4FYDA 4IG3A 3AVCA 3K5OA 4NCAA 3MEEA 1NK6A 4DWIA 4FM2A 4Z0UA 3MEGA 1YTAA 2DFHA 2HHUA 2VWJA 1C0TA 2KW4A 2XY5A 4LD0A 3K5NA 4CJWA 1NKCA 3AA4A 4KI6A 3KLFA 5C42A 2HHVA 4M3UA 3LPUA 4CJUA 3L2RA 4DTOA 1LWFA 2OYQA 1MU2A 2HB5A 2OPPA 1U48A 4FJKA 1Y97A 2PW9A 1ASUA 1TKXA 4C8MA 4BDPA 4KKOA 1I3AA 5E41A 3V4IA 4M3TA 1KCFA 4AILC 1JLEA 2XY8A 3C95A 3ZSRA 4BE1A 3NF6A 5KI6A 4Z4CA 4OPKA 2KQ2A 2VG7A 3RMAA 3HJFA 1TKTA 3VQ5A 3IG1A 3TABA 4DU1A 1N6QA 3KLIA 3P1GA 1Q9YA 1HJRA 3ZSQA 3O3FA 4NCGA 3ZT0A 3OS1A 3KIOA 4KHWA 3AVKA 3B6PA 1VSDA 4DG1A 1RBTA 2LSNA 5C25A 2I5JA 4LSLA 1J53A 1HQEA 3LAKA 4GMJB 4RW7A 4CJTA 1RT2A 4IDKA 2O4GA 1S1XA 1SV5A 3V1OA 3EZ5A 3V6DA 1KLNA 4L8RB 4FJNA 3ZSWA 5I42A 3C94A 4QAGA 5DK5A 3VQ4A 1W0HA 3PX0A 1NK4A 1KLMA 4FLVA 2OPQA 3RMBA 1KVCA 3I0RA 4E7LA 1EX4A 3V9XA 3KJVA 2YHAA 2YHBA 4CEFA 2F96A 4Y1DA 3V81A 3QEIA 4ELVA 3ZT2A 3L2WA 5KTQA 2D0CA 1UWBA 4XIUA 2DFEA 3AVGA 1K6YA 4IG0A 1IKYA 4CJKA 3LWLA 4CJVA 3NAEA 3TWHA 3V9WA 3SQ1A 2QKKA 1RT1A 4FZXC 3K57A 3DM2A 4CECA 4DTMA 1HYVA 3LPTA 3HSTB 4CJFA 5HRNA 3RMCA 2KFNA 3SUPA 2XHBA 1REVA 5CYQA 4DTJA 1KSPA 1VSIA 2YNFA 1IKWA 1C6VA 2HHWA 3ZT4A 1NKBA 3VN5A 4M3WA 2P5OA 2DFFA 4BDYA 4CEQA 4N5SA 1U4BA 4I9QA 3LP3A 3AVJA 3ISNC 2O4IA 1XC9A 4OLBA 2NUBA 2Q3SA 3QEWA 4CCHA 3KK3A 3HO1A 4DQQA 5EU7A 3QERA 1BISA 4KPYA 2HVIA 1WAJA 3VQEA 4I2QA 4AHUA 3HM9A 1NJXA 4DSJA 4F8RA 3CFRA 1QSSA 4H4OA 3C6UA 4OKEA 3OYAA 1ZBLA 1RTHA 3AO5A 4CERA 2IOCA 3PUFA 3HK2A 3NF9A 1SL2A 3OVNA 4QCLA 1CXQA 4HTUA 3OYBA 4ELUA 1C0UA 5J2QA 2ZQBA 4HUFA 3P83D 3KTQA 3FFIA 2HHQA 1UA0A 4BE0A 2F8SA 3L2VA 2HHTA 5CY4A 1RNHA 3PX6A 4F2SA 1GOCA 1S9EA 3CG7A 1NOYA 3AA3A 3T1AA 4DS5A 3FI7A 3LANA 4CHYA 4FJMA 3VA3A 5T7BA 1TKDA 3SNNA 3HVTA 1ASWA 1U04A 3O4QA 4CJ3A 4CK1A 4YNQA 4ICLA 5JS2A 4KV8A 3TANA 1KRPA 4JS5A 3VQPA 2BGGA 4GVMA 4WE1A 3NHGA 2D0BA 2G8IA 4O4GA 4CFBA 2FBVA 4HVJA 3HPHA 3CFPA 1CZBA 1DTQA 3HL8A 4J2EA 4RW4A 3NGIA 3KKSA 2W42A 1L5UA 3TAEA 4M3RA 2IS3A 4AH9A 3O3HA 3U3YA 3KD5E 4FVMA 1XHZA 3HYFA 1TL3A 2ITGA 4RW8A 3L3VA 3LDSA 4W5TA 4DU4A 1TL1A 3G0ZA 4B9MA 1L3SA 4KHNA 2A1SA 4OVLA 3O3GA 3AO3A 3K5MA 3OYHA 2KZZA 4F4KA 4CHPA 1LW0A 4GW6A 3L8BA 1WSIA 4MQ3A 4BE2A 3DYAA 4OKKA 4OGCA 3VQQA 4HHTA 4KI4A 4B9TA 3T3FA 1TK8A 4CEZA 3NH0A 4FJ7A 4AHSA 3SPYA 2FBYA 4BWMA 4EZ9A 4OLAA 2X78A 2JLEA 1JXEA 1GOBA 1RT5A 1Z26A 3OY9A 4KHQA 1X9SA 4RW9A 1BI4A 3D45A 4K8ZA 1WSFA 1RT6A 3L3UA 5HP1A 1RCHA 1RT7A 3C6TA 1IG9A 3ZSOA 4KHSA 2RPIA 5SWMA 3EYZA 2R7FA 1S6PA 3ASMA 1L3VA 1EP4A 5KRSA 3PO5A 1ASVA 3AVBA 1HPZA 4IFVA 4R5PA 4O5BA 3RRGA 3SQ4A 4DTUA 4DLGA 4J2DA 4M45A 1A5VA 3OYFA 3V9UA 1BCOA 4KTZA 4JRPA 2XY7A 4N56A 3DLBA 3QINA 4KTQA 1IH7A 1S1UA 3T19A 4FJ9A 4QOZB 2G8UA 1DLOA 4CIGA 4DU3A 4DTPA 1I39A 3OYKA 1T03A 2IDOA 2YNIA 4CJLA 3D0PA 3S3MA 3OYCA 5J1EA 1WSEA 1FXXA 1JKHA 3AVMA 2R7YA 2IGIA 3IRXA 2HHXA 1BGXT 4DSKA 2G8KA 4E1NA 3V1QA 3QNOA 3QLHA 1QS4A 4CJEA 3QESA 2YV0X 3RTVA 3O4NA 4DSEA 4NCBA 3SZ2A 3OYLA 3QO9A 3HP6A 3F9KA 3F73A 1RDCA 4DF4A 3NF8A 3AO2A 4TSXA 4CF1A 4FJXA 2BE2A 3L2UA 4W5QA 2OPSA 4F3TA 4C8KA 3OYDA 3EY1A 1RDAA 5HRPA 1KTQA 3QNNA 4IBNA 3AO4A 4CJRA 2KTQA 1RBUA 1RT4A 4FW1A 4C8NA 4E3SA 3DLEA 2HMIA 4B08A 4PWDA 4CF2A 4DFKA 3HPOA 3WNFA 1YVUA 4DTRA 3TAQA 4K8XA 5KGWA 3MECA 3HVRA 1JLGA 4EP4A 3CQ8A 5C24A 4NYFA 1XI1A 3OYJA 2FBXA 2P51A 4H4MA 4Q5VA 3QIPA 3SUQA 3QEPA 5HRRA 4FK2A 4FJHA 4Z4EA 1XWLA 2X74A 3SI6A 1HYZA 2WONA 2HNZA 1YTUA 1JLQA 3PO4A 2QK9A 4DFPA 4E89A 3HP9A 1UA1A 2HNYA 2YNHA 1CZ9A 1RTJA 3IS9A 1Q9XA 4FW2A 4CF0A 4OJRA 4AHVA 2VG5A 5FDLA 4DTSA 1SUQA 2YKNA 1JLAA 4O44A 3NF7A 1WLJA 4CGIA 3KLHA 3DLGA 3KD1E 3NFAA 4CIFA 1TV6A 4Z4IA 3DOLA 4J2BA 3AO1A 1S1TA 3G10A 1HQUA 3VQCA 4W5NA 1X1PA 1VRUA 3P5JA 4AHTA 1BIUA 1JLCA 3KLEA 4CE9A 3TARA 1RBRA 2WOMA 2HNDA 4CGDA 1WSJA 1HMVA 3OS0A 3ZT3A 4E7JA 1QTMA 4CEOA 2OZSA 4FLTA 4ID1A 4LH4A 3UIQA 1ZBHA 4KRFA 1JLBA 3V1RA 1VSMA 1NK0A 4Z4GA 2E6MA 3IAYA 1CXUA 1EXQA 3KK2A 4B9UA 3QIOA 3QEXA 3ZSYA 4FJLA 1U47A 3HPGA 1TAUA 2YKMA 2XY6A 4CJPA 1SKSA 4HUEA 3CYMA 1BCMA 4CEAA 1BQMA 2EHGA 1RBVA 3OYNA 1KVAA 3LAMA 3ALYA 2ZD1A 1BQNA 3AVHA 1WN7A 3NE6A 4RW6A 3VQBA 3LZJA 4CF9A 1QSYA 2OPRA 2Y1JA 2DTUA 1FKPA 3TAMA 4JS4A 3K59A 2Y1IA 3E01A 3ZCMA 1B92A 3AA2A 1VSEA 4KHUA 4M3ZA 3CM6A 5FRMA 1F21A 4O0JA 4KB0A 1UOCA 4DQIA 3M8SA 4W5OA 1U45A 3VQ8A 1LWCA 4E7KA 1A5WA 1QQCA 4E7IA 3MXMA 2YNGA 4FJJA 1WAFA 4Z4FA 3DOKA 4IFYA 4DSFA 3OYEA 4N76A 3L2QA 2D5RA 2ZE2A 1KFDA 1J9AA 2A1RA 3NH1A 4ZTJA 2Z1HA 1D5AA 1O1WA 1BI4B 3TAGA 1D9DA 4B8CA 5HBMA 4IKFA 1TGOA 3LP0A 1LWEA 3HT3A 4DSIA 1UAXA 4JLHA 1SL1A 4B3OA 2X6NA 4HUGA 1S6QA 2P5GA 3SYZA 3NCIA 4M3YA 1A5XA 5I3UA 2OZMA 3NH2A 2HVHA 4OKJA 3VQ9A 4CJSA 1NKEA 4RG8A 1D9FA 4B9LA 1RDBA 3VQDA 3ITHA 1LW2A 2EX3A 3K5LA 1VRTA 3WNEA 3RRHA 4ZTFA 4CGJA 1ZBFA 4FJGA 2F8TA 5CZ1A 2GV9A 4FLUA 1WSGA 3NDKA 3KK1A 2QKBA 4M42A 3DRPA 4OPJA 5HROA 2RN2A 3M8QA 1RBSA 4CJ4A 4DMNA 3S9HA 2BDPA 1J54A 1NK8A 1TVRA 4CK2A 2FC0A 4AHCA 2ATQA 4UQGA 5KGXA 4EP5A 4DQPA 4FXDA 2VG6A 3M8RA 2RKIA 1C1AA 4FCYA 3LALA 4DLEA 4KHYA 2HW3A 3AVFA 2HHSA 4NYNA 1LAVA 1S1WA 3AVNA 4H8KA 3I0SA 3TAFA 3S3NA 3AV9A 3SQ2A 3A2FA 3DRRA 4CGFA 1HYSA 1VK0A 2FBTA 1BL3A 3KKRA 3V9SA 4FJ8A 2DY4A 1SKRA 1RILA 1B9FA 1RTIA 5J2MA 3DLHA 4FLYA 5CZ2A 1FKOA 2IAJA 4PA1A 3U3GA 2PZSA 3SUNA 4C8OA 3AVLA 4DTXA 4FZZA 1QHTA 3I8DA 4CJ5A 4O55A 2G8WA 1IKXA 1WNSA 3RWUA 3SUOA 4CK3A 1TK0A 4FK0A 3WNGA 4CGGA 3AVAA 2B6AA 4FLZA 1U49A 1D8YA 3OYIA 2ETJA 4CEBA 1NK5A 2QXFA 4KTWA 3VA0A 3V9ZA 2Z1GA
chains in the Genus database with same CATH superfamily
1Q86O 1JL2A 4E2LA 1RDDA 4FWPA 4LWSB 2LFSA 1QE1A 2FF6A 4P9PA 3VQ6A 5FRNA 2Z3YA 1S9GA 3MXIA 1ZBUA 1YEWA 4XDKA 3ZMSA 2X7RB 3EXAA 4LNUA 4FLXA 1NOZA 4R79A 5CBGA 2AHYA 3E8BA 1XEQA 4JI3B 3WG7C 3CC4V 2E2QA 3UT5A 4BC2A 2A41A 3VETA 5HLFA 5M1NA 1LV5A 1QSLA 1L0NH 1PNKA 2XO7A 4FJ5A 5JJEB 2P6JA 2W0XA 3JS6A 4MT8A 3O80A 3JD4A 4H0VB 2GUIA 3CD6V 3ABLC 1NGIA 1V54C 1Y74B 2LGWA 2ZXWC 3A5LC 2OA8A 2UXBK 3O9QA 3O8MA 3D2FB 2P22C 1VMGA 2JEUA 4E19A 3AEEA 4ID5A 5LA6A 1FXKB 4O4JA 2HP8A 1YF2A 4BDZA 3DTUB 4R50A 5J2TB 4ZHRA 4C8LA 4Q0BA 3W7UA 3FZFA 2UUCB 3K03A 1R59O 5BN8A 5CYMA 5C8YB 2CDYA 3FB5C 4BAYA 4JD2B 3OMAB 2P4KA 4MVZA 1N0JA 1M1KW 1BS3A 4CGHA 5LGUA 1NR7A 5LYJA 4DV0B 5TISZ 1V9PA 3BFRA 3A0BZ 1XHXA 4DR1O 2QEXV 4I2PA 5AQLA 1EBOA 5M1FA 4DV4K 3VOUA 1Q82O 4I7FA 3EEQA 2X0LA 5IYZB 2W41A 3B8AX 2E74B 4GB34 1BIZA 3K58A 3ATUA 1ZYQA 3JASA 5KRTA 5IY5B 4OGEA 3SJQC 1WP8A 2YDEA 4FO0A 3OA9A 4PQUA 1LR1A 2UUAO 1AI4A 2E88A 1G15A 3ZETB 4WFBL 1NH2D 4MFBA 4CFCA 4BWJA 2CAZC 3K9KA 4J7ZA 3MCAB 3VEOA 3BGRA 3OYGA 4RTFD 4DQSA 5LHGA 1UPGA 1RUF4 4B3MO 4X65B 3FFKB 4FZYA 4PHTX 3VMFB 1ITGA 4JV5K 4LSNA 3G4SN 2WC9A 3RN4A 1NU1H 2P9KA 1J5OA 3LDPA 1QZ6A 4MTXA 1VQPV 3T7ZA 1DF5A 1JA8A 1HNIA 4FWKA 4B9NA 4CJQA 4BR6A 1VBE4 4PKIA 2D2CB 2ASOA 3ULEA 3PV8A 1NJIW 4JN4A 3OM3B 5KPZA 1N0NA 4H5WA 3PX4A 4DV2B 2NRHA 4EB6A 1JXBA 5DECA 3LWMA 4JI2O 3GG4A 3SAHA 3PY8A 4YOTA 4H5TA 3OTOO 1TKZA 3LP1A 3DAWA 4LFAO 4LC9B 4HCCA 4K3AA 4CF8A 2P9LB 2YHWA 1BUPA 3SMSA 4IFEA 4W4LA 4DFMA 1NJZA 1I08A 3LP2A 2YHYA 4AHRA 1WSHA 1ZX3A 2KKZA 1G8MA 1NGDA 2R72A 5FL7G 1BWFO 4CHZA 3J7AP 2WU5A 1XNRO 5BREA 2A42A 4F3OA 1N32K 3QDKA 3AK3A 3ZMVA 4IG3A 3K5OA 1SS6A 1OJHA 1NK6A 5CHIA 3VBBA 2VQEK 3CHWA 3MEGA 1Z7S4 1YTAA 2DFHA 3BA9A 4H0XB 2HHUA 2VWJA 4GX2A 1ZAUA 2QWQA 3I56N 2HVKC 2QGNA 3ASNC 3DJCA 4LBEC 5C42A 3LPUA 3F7VC 1ESVA 4CJUA 3L2RA 4IL6Z 2OYQA 1MU2A 2OPPA 1U48A 4FJKA 3CJ1A 2YI1A 3CCMV 2PW9A 4C8MA 3T1YK 1QVFU 1RSOB 1PNMA 2FL4A 2YSUB 3HOTA 4DV5K 4OPKA 4Z4CA 1NGEA 2VG7A 1TKTA 4EIAA 1RDWX 2E1ZA 4M7YA 1M1KO 3JARA 3F7YC 3KLIA 3P1GA 3VEWA 4YORA 4TV8B 3ZSQA 4JKBA 5KPTA 4GKKK 3KIOA 1FXVA 3CCJV 3T4ZA 1COV4 1RBTA 1AB3A 1RM1B 2I5JA 3ASOC 5KHKA 4GMJB 1JCFA 1S1XA 1SV5A 2GELA 2Q1NA 2QR4A 4J8FA 3V6DA 3J7YP 3CXHF 1HR0O 5I42A 3O4WA 4QAGA 3J80N 1GN4A 3RGBA 3RYCA 1OOPD 3K04A 4DK0A 2ZQMA 4ISGA 3TCUA 4JPRA 3KJVA 4R6ZA 2YHBA 1IV0A 4OPHA 1WB7A 5AZJA 4YY3O 4WQ4C 2RCVA 3EHBB 3JYCA 4FOEA 5AZIA 3ZT2A 3GL1A 5KTQA 5ITZB 1TAEA 5LY3A 4B3SK 5CMUA 1VQ8V 4BQZA 1UWBA 4XIUA 1Z6RA 3LDEA 1IKYA 4IG0A 3SBGA 4CJKA 3AG3C 2UUBO 3TWHA 4BW9A 4WFAL 4QE9A 3BVOA 1VIBA 5JVHL 4FZXC 3K57A 3DM2A 2A06H 3KK7A 4LFBK 1L1FA 4HBNA 4DV7B 3S3WA 5JJJB 2YNFA 1VQKN 3JD2A 4KH5A 1MZFA 3D6RA 2FYUH 4CEQA 4BRQA 2IU3A 3O9RA 3ISNC 3SDLA 4RHV4 4OLBA 3HO1A 3ABVA 5EU7A 1BISA 1N34O 4GKJB 1KD1W 1NJXA 4JI1O 2KKWA 3VENA 1NENA 2A6AA 1HRI4 3IGAC 5HL7L 4H4OA 4OKEA 1ZBSA 2ZNJA 1NM1A 4CERA 2IOCA 4ZI7B 3ETEA 2ZCEA 4UUJC 4MTFA 4UCUA 4JI4B 3PUFA 3NF9A 4H13B 4H03B 2FF3B 4UB6Z 4O4HB 5CE3A 4DR4K 4X1YB 2HMPA 1VQ6V 4ELUA 1SQXH 3H1KH 3P83D 1KC8W 3KTQA 1Z05A 3QG5A 4BE0A 4DR7B 3L2VA 1PV0A 1KQSU 4FVUA 1YJNV 1RP3B 2NNUA 4F2SA 1GOCA 3LDOA 3ETQA 4X64O 5JCOA 1SERA 4WQ5C 1ATNA 3FI7A 3QBWA 4FOIA 1F51A 4FJMA 4O4IB 2HF3A 1ASJ4 4U3JA 5GW7A 3ZX6A 2ZGYA 5T7BA 5C0YA 3SNNA 4BRCA 3RRGA 3TANA 2P9UA 4LF4B 5JS2A 3KCYA 2UXDB 3VQPA 5LMUB 3VR8A 3JALB 2XAHA 3CCQV 2G8IA 3LDLA 3N4QA 3SFEA 2VCPA 3HL8A 1JX9A 4RW4A 3NGIA 2W42A 3AG1B 1DLBA 4FVMA 1XHZA 3AE2A 3HYFA 1GM9A 4OO1J 3EE9A 2D0PA 1XMOB 5F2RA 2YXYA 3KKYA 4MVOA 4JKEA 3TAFA 1AROP 4O2BA 4MVSA 3SPJA 3B8NA 3K5MA 3AARA 3CJ9A 3D2EB 5EOYA 4CHPA 1AR4A 4F4KA 1O9GA 5IJ0B 4MQ3A 1SA0B 2QA4V 4KI4A 2IH3C 3R66A 4MVMA 1YXQA 4F9OA 1TK8A 2E8AA 4CEZA 1MWKA 2E2NA 4GV9A 1I5XA 5JH7B 3SPYA 4EZ9A 2X78A 1JXEA 1GOBA 5AQHA 4DR2B 4KHQA 4RW9A 5KA5A 2UXXA 1R3IC 3ID8A 3PJSK 3L3UA 5HP1A 4IOAL 1H1VA 3CIPA 2RPIA 3EYZA 5GIOA 1S6PA 1EP4A 2VYPA 1OVYA 1T6DA 1ASVA 1Q7YW 3ZBHA 4LCUC 2ZE7A 4R5PA 3SQ4A 3CX5F 4X62O 4IWVA 3V9UA 1I94O 1Y64A 1IBLB 3FLCO 1NCQD 1NGFA 4KL1A 1DK1A 1OCRC 2VGMA 3U9DA 2W0FC 4BGAA 1PM9A 1UFIA 3HB3B 2P9IB 4LF7K 1ZUQA 5LGTA 4H0LB 3UT5B 3OYKA 1BL8A 3THYA 4DB3A 4CD3A 1T03A 2YNIA 2N04A 1NVPB 2OWOA 4CZMA 1DTOA 3S3MA 4PDWD 3OYCA 5J1EA 3CC7N 1FXXA 5A2QO 3P4QA 4PKHA 2R7YA 1BGXT 2QWOA 2G8KA 1KF6A 3QNOA 1QS4A 2ZDIC 4CJEA 5GINA 2YV0X 2ODMA 2P7TC 3OYLA 3OGIB 4CZGA 4DR3B 3KZBA 3T1HK 4J2BA 2JEXA 4LF9B 4W5QA 3EY1A 1RFYA 4B3MK 1ILYA 3QNNA 4IBNA 1QNMA 2KTQA 1HNXO 3L6QA 3C90A 4X1KB 4JK9A 4E3SA 2HMIA 1XQSC 4TUYB 4CF2A 1SQKA 5H1SQ 2PGGA 3AE6A 1Q6UA 2XAFA 3QNEA 3TAQA 2XAJA 4K8XA 4F4LA 5M1OA 3QO7A 1JLGA 4YSYA 3CQ8A 1DT9A 1XL6A 2WLMA 1XI1A 1Y66A 4NYFA 2D3OW 3OYJA 5JQGB 3E9PA 1OCZB 3QEPA 3OT7A 4FJHA 5EYPB 1YTUA 1UA1A 4E89A 3HP9A 4DO2A 5IYDO 4B1UB 2OIEA 3SYAA 4FW2A 4CF0A 4FFBB 5AQJA 3BY5A 4D7SA 4AHVA 4DTSA 1GLEG 3RSEB 3KLHA 1WLJA 1NT2B 1SKVA 2NRVA 2ARHA 3VEYA 4CIFA 1K8AW 4YOYA 2EINC 4DR6B 1HQUA 1S1TA 2P4VA 4Z1VA 4MDAA 3VQCA 1XNRK 1X1PA 1VRUA 3P5JA 4AHTA 1BIUA 3KLEA 4B3RK 3TARA 3CJHB 1RBRA 3VQYA 1WSJA 5B3SB 1HMVA 4E7JA 2OZSA 5FLXO 2EJ7A 4PJ0Z 1Y6XA 1YXBA 4LH4A 3UIQA 3AG7A 2ZR3A 1ZBHA 2GEMA 4KRFA 1VSMA 3AY9A 1CXUA 1Y74A 5AG2A 3BZCA 3O08A 1IBKK 3OMIB 3CCLV 3W0LA 3CMAV 5J2UB 3D2FA 3FB6C 1U47A 1YTFB 1VQOV 2D1KA 4FJLA 5AQRA 4CJPA 1WJZA 3ZHSA 4ICGA 4HUEA 1Q7YO 3CCRN 3FX7A 2XNDG 2W6LA 1BCMA 3HPLC 5J2TA 4XDLA 3ZMUA 2EHGA 1EQYA 1RBVA 3KCXA 3LAMA 3J81N 2V1DA 5IT9N 3ALYA 3FR0A 5C8YA 2EIKC 4JD2A 4K0KB 4YHHO 5AQKA 4FPPA 4CF9A 5AQMA 3UO3A 2OPRA 4J11A 3WU2Z 3CF5L 3ABMC 3TAMA 1MWMA 4IGGA 1QR9A 2QM7A 2EIJB 2DW4A 3N2GB 1VSEA 3WXIA 4M3ZA 3CM6A 1RUJ4 3FYIB 1UOCA 5IYZA 1RUE4 1RHI4 1NVPD 3VEVA 4B1YB 3E8GA 1VQ4V 1AI5A 1EN6A 1WAFA 4Z4FA 4DKWA 1RUG4 4N76A 5AQPA 2D5RA 1YITV 2Y69B 1D5AA 4NXNO 5AQGA 1RPOA 3QBXA 2O8CA 3CCUV 3D8CA 4X20B 3ZETA 1EN5A 2X5ID 5LHIA 2HEPA 2FSJA 3CRMA 5CN0A 1LWEA 4JLHA 2Y4UA 1SL1A 5EC1C 2X6NA 4JI0K 3KHYA 4M3YA 2BOBC 1KAYA 1A5XA 3ZCCA 1VQ5N 2OZMA 2KSDA 4YDUA 2GBOA 2BTQB 1NKEA 4IO9L 3C65A 1N8RW 3HKCB 4RG8A 4PI0A 3ZRVA 1P4RA 2F4VB 3VQDA 2VQFO 3JATB 4JI8O 4CGJA 3CC2N 3STLC 4FLUA 1R3KC 1N36B 4DV3O 4H5VA 1B04A 3JCZA 3BA8A 4K35A 1S76D 4DV6K 1AR5A 2HBMA 2PBDA 4BIZA 4TQDA 2QEXN 5KHJA 5KGXA 1Y4MA 4HWIA 1S5HC 1GLLO 3E9OA 2AW9A 3M8RA 3LALA 1PL4A 2QJ1A 4YXDA 1LAVA 4B3TB 3S3NA 2Y0PA 3W3DA 2ZE5A 2OCCB 2PI5A 3ZMZA 2P9LA 1VK0A 5LL6Y 1HYSA 3JD74 4QNHB 4JI1K 4G28B 4GV3A 1EV14 3KKRA 4FJ8A 3CS5A 4UCSA 5JJNB 1O13A 5L3CA 3OHRA 4C23A 4EHUA 1B9FA 4Q20A 2BTFA 3E9LA 1K8AO 1PIV4 1WB8A 2Q7HA 4CZZA 4FLYA 2E5LO 4PA1A 3RYHB 1V4TA 3GQKA 4DTXA 1QHTA 4BGBA 4CJ5A 4O55A 3QF7A 3OE7G 1KXPA 4OPAA 3RVCA 3AG2B 3SUOA 4CK3A 4FK0A 2A0LA 3AAPA 3AVAA 3CRRA 4FLZA 1U49A 1D8YA 5JVDB 4DV1B 3EVKA 1KB9F 2JIZG 1NK5A 2Q6AA 2QXFA 4X64K 3V9ZA 1QLNA 2OTJN 4CEDA 4CHQA 4E7HA 4Q4V4 1RSOA 5A9GA 1J5EB 2VWBA 2PAVA 2BUPA 4DS4A 1ENVA 1QU7A 2A3QA 1YHQV 1VQNN 3RFRA 1PO14 3ZRSA 2QM1A 4O5FA 3ZSZA 4CHOA 1JR9A 3SV3A 1J6ZA 3DXMB 1WPBA 1H8HG 3N27A 1NS1A 3VEZA 3CETA 1VQ7N 1YQ3A 3CHXA 3DMJA 2N74A 1RUC4 3THOA 4NXMO 1KFSA 4WFNL 4ZBMA 1KBHA 3QETA 1I0HA 4CJ7A 3LDCA 5F1XA 1S3XA 3OJUA 3AEBA 1R6TA 1SKWA 4IO8A 1S1VA 1VSFA 3B09A 2BOCC 4IIJB 2N05A 4BR5A 3EL2A 3GOIA 2PFUA 4CZJA 1M93A 1FK9A 3P4PA 2Q73A 1XREA 4I9LA 5ITZA 3WXMB 4N23A 4YJ2B 2Z1IA 1YJWN 2QKSA 2XAQA 2UXBB 1C1BA 1LAWA 3SV4A 3RMDA 4FM1A 5F0XA 1JMKC 3VF2A 5FPOA 2PYJA 3EN9A 3WG7B 1NJWA 4LF5O 2V52B 1K5MD 2PLV4 5LHHA 3AECA 2OIGA 3AK1A 3I5DA 4W5RA 4QIWF 1FFTB 4WCEV 2E6LA 5HRSA 3RR7A 3TTFA 4TQFA 3EKUA 1Q86W 4PV1B 4LY7A 3Q4HB 2WDRA 3CCJN 3ABLB 1V54B 3ZSXA 3OJSA 1I94K 4JI7O 2DOSA 4DFJA 2F43G 5B1BC 1HX1A 1OH8A 4LFCB 4M41A 1IBMK 1AVMA 3FD9A 3JXUA 1XC3A 1NMDA 3ENOA 1R73A 4QS9A 4AM7A 3OUSA 3WXKA 3JYTA 3AA5X 4RCHA 4DTNA 4CEEA 1W0KG 3OGCC 1FD9A 3LZIA 1T8EA 3PSFA 3G6EV 3FZKA 3SPZA 4DUZK 2IVPA 4ZI7A 1Z25A 2D0OA 4O4HA 4EFHA 4X1YA 5CA1B 3A0HZ 4CVNE 4FJ7A 2JK5C 1KVBA 4G9ZA 1S5JA 1IVSA 4OX9O 3E2EA 1TAQA 4BIUA 3QEVA 4M3XA 4J7JA 2G8HA 5TKWA 3RR8A 2H89A 2R064 3DRSA 1E79G 4JV5B 4HCBA 2GTSA 2ZKOA 2HBLA 1ROPA 3CFOA 3VQAA 4DSLA 2GUZB 3BHPA 4KREA 2RS34 1VARA 1IKVA 2G8FA 4O4IA 3S3OA 4D6TH 1KECA 4MVQA 4UCRA 3DLKA 3JAMO 4LF6K 4Z1MG 2X6SA 2D0AA 5IWAK 2ZM6B 3JALA 4UY8O 3RVYA 4B7EA 3ENHA 3CRAA 4E0DA 4PD4F 1BHLA 2CGLA 3GWOA 3ULDA 1WA8B 1JCHA 3BAAA 3E22B 2JGUA 1GLAG 1K73O 1P7BA 1JPXA 5J2PA 3NGYA 2QM8A 4B9SA 3DI6A 3O9OA 4UV8A 4NCAA 3AEAA 3MEEA 3GE1A 4Z0UA 5KA6A 1NH2B 4X88A 2KW4A 2K9PA 4LD0A 3K5NA 4CJWA 1NKCA 1DGSA 5K1PA 1BGYH 3KLFA 4KI6A 3D2EA 2HHVA 4BVPA 3ZN0A 1NBMG 1LWFA 2HB5A 5IJ0A 5KHGA 2RS14 1SA0A 3JD3A 2VQEB 1JCEA 1D2DA 3AEGA 4BRMA 4H5RA 4BREA 3CMEV 3C95A 4BE1A 1KKCA 3JD0A 5JH7A 4NKGB 3NVMA 3HJFA 1GLBG 1ZWIC 1MABG 1VBD4 3VQ5A 1NGGA 3IG1A 1AP6A 4DU1A 1Q9YA 4X65O 2D4WA 2Q7GA 3T1YB 2X6AA 3B6PA 1H2LA 1GLFO 2KHOA 1HKCA 4DV5B 3L9DA 4LSLA 1HQEA 4CW7B 3CIRA 4BR7A 5BR9A 2NRWA 5GTHZ 5LP6C 3T1CA 3V1OA 4GKKB 2G38A 4JYBA 2YX6A 4QS7A 3ZSWA 2WA3A 1ZSPA 4JGSA 3ASNB 4YHHK 3CB2A 2AZ0A 2EWSA 4DV2O 2UXCO 4FLVA 2OPQA 1KVCA 1XMQK 1X4TA 4MW3A 1ZP0A 2P9IA 4WF9L 2YHAA 4X66O 4WFGA 2E2PA 3HSCA 1T6CA 3DWLA 4JI6K 4CEFA 4JASA 4W4KA 5KAIZ 4XH1A 4I50B 4Y1DA 3QEIA 4ELVA 1H2KA 3SJBC 3BZKA 2YIDA 2IIRA 1GN3A 4O2AB 2D0CA 1L0VA 1K6YA 1U97A 4FMTA 4RQFA 2QTDA 1MOFA 3SQ1A 4NXNK 3TGUH 3S3XA 4CJFA 3RMCA 3ASOB 3QMLA 2KFNA 5BR8K 1OH5A 5C2DA 4DTJA 1AR94 1EZJA 1IKWA 4LF8O 2XASA 5TKYA 4JKFA 3ZT4A 4DUYK 1NKBA 2Q8VA 4HTLA 3TXSA 4BDYA 1U4BA 3JBG4 4X1KA 3VQWA 4LFBB 1RDUA 1KFYA 3SJHA 4TUYA 2ETNA 2NUBA 4CCHA 4DK1A 3R9PA 4PL7A 4KXRA 1HW7A 2OT5A 3VPZA 2HVIA 2HSTA 3I8BA 3VQEA 5JMVA 4IJNA 3J8AA 1SS3A 3HM9A 2ZJPL 1OH7A 3APOA 1POV0 5JQGA 3CQYA 3AG3B 1BZKA 5EYPA 1QLEC 3OYAA 2JVDA 1RTHA 1SZ2A 3B8MA 1S72V 3HKBA 1VQ9N 1HNWK 4JF3A 3OVNA 3R1XA 4QCLA 3A0RA 1GAXA 1CXQA 2O8CB 4J9ZB 1BSMA 3HKDA 4FFBA 1C0UA 4Y0WA 3CCSV 3RSEA 4FL9A 2HHQA 1NGAA 4X89A 3RT3C 2O8FB 4A5BA 4B3SB 1OV9A 3A5MC 1K5QA 3D36A 1VQMV 4X9QA 3PX6A 3SUCA 1NOYA 4EFEA 1R6KA 4DR4B 2GDSA 3AA3A 3AEDA 1GN6A 1M57C 2DYRB 3CJHA 3VA3A 2QM4A 4I7ZB 3AE9A 3O4QA 4CJ3A 4YNQA 4MTGA 2RDCA 1EWRA 4GV6A 4O8UA 2CGKA 1SQGA 4RQEA 5EVZA 1JQ0A 5LOVB 4O4GA 3CCVV 3R3LA 2FBVA 1GRJA 3E86A 5J2UA 3D7EO 3HPHA 4HVJA 5H9CA 2HWC4 3T4DA 4FWNA 1KKDA 3SPHA 3KKSA 2UU9K 3MX2A 1M9NA 5LMNK 4RW8A 2ITGA 4DU4A 3L3VA 3LDSA 1CXZB 2NLXA 3G0ZA 2XTAA 2Q67A 3RYFB 1H2MA 1DKGD 5L3DA 3WQUA 4GX5A 4KHNA 2HHHO 3VEXA 1GLDG 4OVLA 1W7AA 4ZHQA 3AO3A 3EKSA 2P67A 2V7ZA 3CQXA 1OCOB 1PPJH 3N2GA 3ID6A 3L8BA 3A5NC 3UB5A 4Q6GA 5EZYB 2QWNB 4UCOA 1YCIA 1PVC4 4GKJO 1XBLA 4NXMK 2X6BA 2QWPB 1BHBA 1S3JA 1XQ8A 2JLEA 1HKGA 1Z26A 1QVFM 3ZYYX 2H88A 1NR1A 2DMXA 4H33A 4KP4A 1WSFA 3D45A 3TTCA 4X20A 3ZS8C 1RCHA 1OCCC 1RT7A 3MN5A 4ILHA 3H1VX 4CBUA 2ZF5O 4J9YB 1IURA 4AQYK 2R7FA 5L3BA 2WSSG 4C1NK 5M1PA 3PO5A 2WP9A 3AVBA 5E84A 3CCLN 3CMAN 4ZOLA 5CB4B 1VQON 1EO1A 1KUQA 3OYFA 3X2QC 2BTQA 4JRPA 3HKCA 1S1UA 4I4TB 4QOZB 1IJJA 4ASUG 3JATA 2G8UA 2R9AA 3D3QA 4K42A 2L6LA 4EHTA 2M6YA 1XNQK 5C12A 1WLEA 1RUI4 1CP9A 1GTOA 2YC0A 2GSMB 4LF4O 3D0PA 3K08A 1P90A 4PA9A 1HNZK 1WPXA 3AVMA 1K34A 3LSQA 3QFPA 2FTKA 3IRXA 2HHXA 2HWB4 2Q0AA 4BRFA 2GTDA 4LF7B 1VQ4N 5DN6G 2KLAA 2YEVB 4DSEA 4H0TB 3NF8A 3LDDA 1YITN 2WLLA 4TSXA 4CF1A 5HFMA 3SK3A 4C8KA 4FWOA 1XMOO 4JYAK 5HRPA 1XL4A 1KTQA 4IHJB 2IJIA 3RYHA 3AO4A 1OCRB 4FW1A 1B3QA 2QKAA 3G80A 4C8NA 4B08A 2GTAA 4V19S 4DFKA 4PWDA 3SPGA 1FXKC 3VESA 3T1HB 1MA1A 3E89A 3WNFA 4NTYA 4R8CA 2Q7EA 4MO5A 2IU0A 2GHYA 4JI5K 4OX9K 1BCCH 1EM1A 3M3ZA 1N4CA 5JVDA 4H4MA 3L0QA 2WLKA 3CI5A 5GADP 2WLIB 4DR2O 1TUYA 2I7NA 1LUVA 2RHKA 2WONA 1D4XA 2HNZA 3FZHA 3PO4A 1WP7A 2VRZA 2HNYA 3C6AA 1CZ9A 2ZE6A 1YJ9N 4C7UA 3LNMB 4I6MB 2NLJC 1JLAA 4IDHA 3NF7A 3AAQA 2LP7A 2LO1A 3DXMA 3NFAA 1AJPA 1TV6A 4Z4IA 1VF6C 3G10A 4W5NA 1R094 4M3TA 2EILC 1KQSM 4XDJA 4YT0A 2ZNIA 4QPKA 3TK1A 4CEOA 2M7WA 4ID1A 4RUFA 1HXS4 1JLBA 2WLHA 3R8EA 1NK0A 4Z4GA 3SFDA 1H8EG 3UM7A 4CBCA 3IAYA 1XNRB 3VF4A 3KK2A 4KHPK 3WQTA 2QW9A 4B3RB 3ZSYA 5HOOA 4DXWA 3N4PA 1FJGK 1I5YA 4IIJA 4JKDA 4JYYA 3UKRA 1Q90D 4WCEL 3WXJA 4CEAA 5BRDA 1BQMA 2ZJRL 3E8HA 4MO4A 4YJ2A 4DR3O 3P39A 1IBKB 3AVHA 2ZD1A 3LZJA 4LF9O 2KG7B 1KU9A 4CS2A 4FZ1A 5AQYA 2DTUA 2EINB 3JAWA 3N2KB 4JS4A 3PN1A 3P3NA 3ZCMA 2RQ6A 5H6QA 3APQA 4KB0A 3P4IA 5KX5B 1U45A 4W5OA 3VQ8A 1LWCA 2EIMC 4UVAA 3MXMA 1BT8A 4PELA 3Q4HA 3ZX3A 2XT9A 1SC5B 5F2VO 3W7XA 4R7CA 2ZE2A 2QKCA 1AR84 2DE0X 2UXCK 2Z1HA 3U10A 2ILMA 1NTZH 2WLNA 4B8CA 5HBMA 4X66K 4MLHA 3QTCA 4CD1A 1D4M4 2P5GA 2EIKB 5I3UA 1KAXA 3NH2A 4LH7A 3UKMA 2Q9LA 3ABMB 4OKJA 3VQ9A 4Q4X4 3RYIB 3BF3A 4B9LA 4DR6O 3ITHA 5CA1A 1NTKH 1QQOA 4FPBA 5B8HA 4FJGA 2F8TA 1KYOF 4JI0B 1FPOA 2GV9A 3IC9A 2OTLN 4KFMA 1FYJA 4OPJA 4LF8K 4CJ4A 1BG3A 4YTMA 2QE7G 4DMNA 5KLVH 3WEEB 3S9HA 1J54A 2CTRA 1NK8A 2BDPA 4CK2A 2FC0A 4AHCA 2ATQA 1XILA 2GUZA 5AJ3K 4XBFA 4DQPA 3QO5A 1G4YB 4HZ3A 2VG6A 3CE2A 1C1AA 2RKIA 2LGQA 2Q5ZA 5IJ9B 5L3FA 4DV6B 3C3TA 1S1WA 3AVNA 4H8KA 1M56C 3H01A 5DEDA 4DR1K 1X9JA 1K3EA 4WFFA 2NNWA 4XH5A 2FBTA 1YI2V 5KQDA 3MN9A 4Z2WA 4K0KO 5J2MA 1WA8A 3E22A 1CEZA 5AQQA 3DLHA 3U3GA 2PZSA 3WB1A 3SUNA 4UB8Z 1QR8A 2B1GA 3I55N 2UUAK 2LW1A 1WNSA 1GMGA 3RBZA 4A5UB 3G6EN 2JS5A 5B1OA 3WB0A 1TK0A 1URFA 2B6AA 1JOYA 4PA4A 3CWBH 4ZIBA 2A3ZA 2JWLA 3FFQA 2NRXA 4KTWA 3VA0A 4U7OA 2DYSC 1N6QA 2ASPA 3THXB 1VSKA 4I55B 4FJIA 1ZBIA 1W9HA 4DCHA 3L74H 3L75H 3MDSA 3O9UA 4PY5A 4CIEA 4JRQA 4N47A 4E1MA 1H2NA 3THVA 4X64B 3FKSG 1GK9A 2WA4A 2X6CA 2BANA 4X1IB 5EK0A 2YXHA 3CSXA 1GOAA 4B1ZA 2KFZA 1VF7A 2PY5A 1VSJA 4GUNA 1LNQA 2YI9A 3NGZA 2F4VO 1RPRA 4JI2K 3G4SV 1CPYA 3HKBB 3SYQA 3DLLL 1PKXA 1TUUA 1BDGA 1N36O 2GWJA 2HG5C 2QWMA 5LJVA 2O57A 3OEHG 3OTOK 3U6FA 1CZAN 1YT3A 3K2PA 1XOUA 4LFAK 2FLOA 2YCHA 3HKDB 3LL3A 3W7WA 2HHHK 3R65A 3ZRXA 5KUKA 4IOXA 2Z1JA 5CBFA 3MXJA 1YIJN 3SJJA 2F9TA 1N5YA 4Z4HA 2R074 4B3TO 1C0MA 4I50A 4PKGA 1X59A 1JCGA 2B5JA 1DEJA 4G2KA 4O2AA 3L4IA 1QZ5A 1NK7A 1RT3A 2AJQA 3IKMA 2P1JA 1EWQA 4MSWC 2EJRA 1BQ0A 4K25A 5BN9A 3THWB 3DLRA 1O9HA 1K9MW 3LUTB 2WFBA 1TK5A 4BG8A 4Y1CA 1Q6IA 5E79Z 1Q5OA 5SZTA 3MEDA 1IX9A 2DWEC 4X8AA 4KAZA 3TAPA 5IYCO 3G67A 3K3WA 3RVZA 4CFDA 2E2OA 3HI0A 4KH6A 5EXWA 3M8PA 4BC4A 3SYOA 5AQFA 3BP8A 4CZFA 4Q4Y4 5IT9O 4DR5O 2IM9A 3OEEG 4FJNA 4DV1O 1AP5A 1EKEA 1VRH4 2NR5A 4ZHQB 5FLXN 4BRPA 4LH6A 4WQ4A 4A2AA 1H2SB 4FK4A 1JJOA 3H45C 4CESA 1EFRG 1J5EO 3BABA 5EBWC 4CHNA 3CC4N 4PUOA 4DYLA 4DHYA 1HR0K 1IBMB 3VQ7A 1MNGA 2FMLA 3CJCA 3OS2A 3AE7A 3IC7A 1SL0A 1B9DA 1RFQA 3K79A 5JS1A 2GBZA 3U4LA 4BRKA 1NJYA 3M1FA 1PP9H 3K9JA 3M8AA 4JTCB 3O9SA 4CFAA 4YY3K 1L3UA 3BRCA 5BPNA 3CD6N 4DUZB 1KP3A 2O8FA 5J2NA 1DTTA 3LNNA 1XMOK 5EIBC 2GX9A 1TVKB 2E4LA 5B1AC 4ZOLB 3CP1A 4YOXA 4LH5A 2NZTA 2UUBK 3BPZA 4YIPA 2CTQA 5GONB 3HXMA 2UYTA 2CE4A 3GDQA 4BG9A 3L4QA 5LGNA 5ELZA 3PIOL 1L3TA 4RO2A 3OAAG 1HLUA 3I33A 2CH7B 4JAVA 5LOVA 2HLDG 1Z5WA 2UXBO 1U2VA 3RW0A 1AR74 1F4NA 4JTDB 1QQNA 4JKAA 3ZX0A 5CR4A 1HNVA 2B4JA 1LUWA 4LF6B 1K5SA 3MAQA 3SQ0A 3ATVA 5IWAB 4DQRA 3NBPA 4CI6A 4CZIA 4RWUA 3AVCA 5BMVB 3P30A 1BA0A 3RYFA 1W2BU 1BMFG 2FSNA 1BQZA 5EC2C 3IFXA 1N34K 4J80A 5LJWA 1Z5VA 2WLLB 3AA4A 4Q4W4 1VQKV 4WQ5A 3TSQA 4M3UA 2Y0IA 1NKDA 3GB7C 5EBMC 3CCSN 3FYEB 5EZYA 4LFCO 2J4RA 2QWNA 4BDPA 2A7WA 5E41A 3V4IA 2ZIMA 3QFUA 1VQMN 1KCFA 4AILC 1JLEA 1T44A 3H46O 3IMXA 1WOQA 2QWPA 3NF6A 4WFEA 2BH1A 2KQ2A 3VR9A 5ADXH 1K9MO 4H0OA 5EY4A 1YZBA 1HJRA 3O3FA 3ZLJA 4NCGA 3ABKB 3AVKA 5AFUH 1VQPN 4DG1A 2WDQA 5C25A 5L3GA 3MWPA 1XUQA 3JAKB 1X3MA 3LAKA 5KPRA 2A9HA 2NRTA 1SRYA 4RW7A 4IDKA 4CJTA 2O4GA 2HJFC 5ADXA 1KLNA 5CB4A 3CYOA 5AFUA 2DQ0A 3VTIA 4CZHA 5DK5A 1RVF4 1W0HA 3PX0A 1NK4A 1Y67A 2BE3A 2IBZH 4I4TA 1ZL8B 3AEIA 4CS3A 1JJ2U 1KLMA 2W6KA 4E7LA 3KWGA 1Y76B 5D5PA 1SQFA 1K73W 3V81A 3O5BA 2ZM6O 5DM6V 1MA9B 4UV9A 1XMQB 3C0BA 3P38A 5KMGB 4YOVA 3LWLA 2Q0UA 1ZLZA 3H3OB 4NR1A 4CJVA 3NAEA 3V9WA 2YEVA 2RNBA 4JI6B 1RT1A 4CECA 4DTMA 1HYVA 3HSTB 5HRNA 4ABMA 1TUBB 3AG4C 3TETA 3SUPA 5CYQA 1REVA 5AQVA 3ABTA 5LP6B 3UKRB 1AL24 3CPWU 4DW1A 1C6VA 4PI2A 1THZA 3SPIA 2YHXA 4K41A 5E1AC 4NXNB 4IHJA 5C2FA 4N5SA 5AQZA 3CCMN 4H37A 2O4IA 1XC9A 5K1XA 5BR8B 3K9SA 4MLEA 3QEWA 3AEFA 3KK3A 3OMNB 2WDVA 3E83A 3JAWB 3QO8A 2BTOA 1MG1A 4U3FH 3SPCA 2VQEO 1KP2A 3M5RA 4DUYB 1VAZA 3QERA 4KPYA 3PIPL 4I2QA 3H1QA 4F8RA 5BY1A 4B9QA 3ICXA 4FPAA 4MVUA 2WLIA 1N33O 4X62K 2ZDIA 2ZXWB 4K43A 2CUGA 2EIJC 3AO5A 3KG2A 2WS3A 3TTDA 3T1YO 1BOTO 3B4SA 4DV4B 1NTMH 1HDJA 3HK2A 4JHDB 4HNAA 4NLCA 4HTUA 3OYBA 1P49A 3TSUA 5J2QA 3DGEA 2ZQBA 4I6MA 5C10A 5JLHA 3GVMA 3U9ZA 1JFFB 1LOTB 4GKKO 2YIBD 3W7TA 5CY4A 1T5EA 1ORQC 2Y69C 1RNHA 1HNWB 5KAFZ 1S9EA 2ATKC 4GYCB 4CC6A 1U96A 4H44B 5AQWA 1R6NA 3UKUB 4CHYA 1PL0A 4JI3O 5BXZA 4IEIA 4XEIA 3HVTA 1U04A 2O8BB 1VQ8N 4KV8A 2V4DA 2E20A 3VTHA 4GVMA 2IJJA 3DXRB 2ZWHA 1QLEB 2E3CA 2LW7A 4MW8A 3CC7V 4CFBA 2RMKB 2WPDG 2CGNA 1CZBA 1T3VA 1BEV4 5LBQA 4J2EA 1L5UA 1P7GA 3MN7A 4M3RA 4U7BA 3U3YA 1HNXK 1V4SA 1QBZA 1OKJA 1TL3A 4HAMA 3ZHTA 1FKAO 2ZE8A 4B9MA 1B06A 5FPRA 3E1YA 2KG7A 3S41A 3O3GA 2UU9B 2UUCO 3WUHA 3FAVB 3VRAA 3N2KA 3RWRD 4B7KA 4BRLA 2KZZA 4J41A 5LMNB 4LFBO 1LW0A 4GW6A 4FSVA 1M57B 3T69A 5KX5A 2JWKA 3BEHA 4HHTA 4OGCA 3VQQA 3VERA 4DV0O 1VHXA 3T3FA 4NLBA 3LM2A 3L73H 3P3PA 2FBYA 4BWMA 4B1WB 4RWTA 1YVWA 2XOKG 4CH3A 1RT5A 2Q68A 1HKBA 4I0XB 1X9SA 1N32B 2Q2RA 5H6RA 5H5NA 4K8ZA 3AE4A 4DRXB 4JAXA 2P90A 4PDMA 1IG9A 1VQ6N 5SWMA 5C2TA 3UE5A 1OH6A 3ASMA 4NXMB 2O8DB 5KRSA 2ZT9B 3AG2C 4IEEA 3PLAA 4BR4A 1HPZA 4E1JA 3P4RA 1YJNN 3IFRA 3H1JH 4DTUA 3CXCU 1A5VA 2IJHA 4B3SO 2XY7A 3RYIA 3LDQA 2ZR2A 3DLBA 4AQYB 2KB1A 2QWRB 2AHZA 1IH7A 5LXTB 3T19A 1C0GA 4FJ9A 2ADPA 4CH6A 4CIGA 4OXSA 1I39A 4JZGA 1L0LH 4MTOA 3SYPA 2IDOA 2IW5A 3CCQN 2P9NB 1WSEA 1GH6A 3WEEA 3H1LH 1TYQB 5BRHA 3AE1A 5M1KA 1E4FT 4DR5K 5CA3A 2IGIA 3Q7BA 3L70H 4DSKA 4DV1K 5IJ9A 1OCCB 3OBWA 4BR0A 3QLHA 1J95A 1XNQB 4QGPA 2F9WA 3O4NA 3SYCA 3SZ2A 5IDJA 3QO9A 4NCBA 3HP6A 3F73A 1RDCA 1HNZB 3FZLA 3ZEUB 4DF4A 1QVGU 1H8TD 3L2UA 4JKGA 3X2QB 3OYDA 2VS0A 2AA4A 4CJRA 2FXUA 1RBUA 4FZ0A 4IT5A 4TOIA 3K06A 2E1YA 5HFLA 2W40A 4UCTA 3CJBA 3DLEA 2EZPA 5JCOC 2WUSA 3AGRA 4DTRA 2ZD9A 4JYAB 3CERA 4MDBA 5KGWA 1GLCG 4EP4A 4ILJA 2FBXA 3Q7CA 1VBB4 4FK2A 1E4GT 1HYZA 3THXA 4YTNA 1JLQA 3DC5A 4I55A 4DFPA 4JI5B 4OX9B 2OANA 2YNHA 3HZ6A 1RTJA 3IS9A 2VQFK 4JI8K 3OTFA 4GVEA 3ETDA 2VG5A 5FDLA 4DV3K 1SUQA 1OHHG 3A0IX 1SETA 4CGIA 3DLGA 4F6RB 3KD1E 2YIAA 4X1IA 5JVGL 1WBBA 5D5QA 1VQ5V 1TA8A 1NQTA 1JLCA 1YI2N 4CE9A 1SZXA 3DXKB 2WOMA 5AQUA 3JSNA 3SMPA 1PO24 3ZT3A 3CC2V 4JYCA 2F95B 4N21A 5BPLA 3V1RA 2E6MA 4TT3G 1Q81W 3QIOA 3QEXA 1KAZA 1IG8A 3HPGA 1TAUA 2E5LK 4LF7O 1SKSA 2UXNA 1S5LZ 4LFCK 2F66C 3CYMA 3IUCA 3MN6A 4JK7A 4KHPB 3M99B 4GT1A 2P9SB 4ISEA 1QSYA 4RW6A 3AE5A 1M5IA 3G6BA 1FJGB 4FWRA 5BRFA 3THWA 4L8JA 1WAZA 1FW6A 4FWLA 1U2VB 2EILB 3K59A 4FJCC 1H2GA 3E01A 2HBJA 2Y1IA 3AA2A 4KHUA 1JVMA 3VQXA 1F21A 3H1IH 3T1HO 3M8SA 4DQIA 2QTSA 1W59A 1TUEB 1A5WA 1QQCA 1ZXOA 4BRDA 2YNGA 4E7KA 4FJJA 2LFRA 1V55C 3DOKA 4IFYA 3EFFK 4DV7O 5AQTA 1HUXA 1SQPH 1J9AA 1S77D 3FGUA 1HP8A 4C1NI 3NH1A 1AR64 1K8KA 1O1WA 4Z94A 1BI4B 4ILGB 1G99A 3TAGA 4P9OA 3OW2M 3LP0A 2F1MA 1D5NA 2OTJV 2IVOA 4B3OA 5AQOA 4CZLA 3SYZA 1XUPO 2ZM6K 3LM9A 2UXCB 4L87A 5B66Z 3FZMA 2RS54 2HVHA 4BY9C 3ZRWA 4X66B 4OGQB 1VQNV 3CCEV 4ISFA 1MMMA 1G6UA 4ZTFA 1LW2A 2EX3A 3U11A 1VRTA 3WNEA 3ABUA 1ZBFA 2JJ2G 3C3SA 5AQIA 2EIMB 5CZ1A 1SQQH 1WSGA 4JI4O 3NDKA 3KK1A 4JNEA 4FK5C 1VQ7V 2P06A 3DRPA 2ADQB 2RN2A 3M8QA 2GWKA 1TVKA 4BR2A 3OR7C 3H1HH 2PI4A 3NVKA 4EP5A 4YJ3B 4FXDA 2HVJC 4DR7O 3UO2A 3M6GA 4DLEA 1EN4A 4B3RO 4FCYA 3WB2A 4KHYA 2HW3A 3AVFA 3HRGA 5GONA 3EE8A 4LF5K 4LF8B 5C3JA 3AV9A 3VGLA 2PTMA 2Y4TA 3A2FA 3ZHQA 3DRRA 1AI7A 1EAH4 2CH7A 4P30A 4F6EA 4H0PA 1IBKO 5GIPA 2AP1A 1RILA 4BRNA 4TV9B 2CGOA 2BSKB 1F23A 1YJWV 5LMUO 2UXDO 5FPDA 2NN4A 1N33K 1FKOA 1E1QG 3SJAC 1H38A 2IAJA 4UVCA 3A8YA 5FPMA 4JI7K 4D7TA 4DR1B 3AVLA 3I8DA 5CA0B 3J80O 5BMVA 1IKXA 5FPEA 4AI8A 3MWTA 3CJAA 1GKFA 4O4LB 1Q81O 4CGGA 3LSSA 3ZX2A 1SF9A 2YIBA 3O6WA 1NWKA 3BF1A 5JICA 5H2FZ 2FKXA 2ETJA 1FFXB 4PA7A 3CCUN 2YJFA 2F93B 2DN9A 2UUAB 1VP7A 2Z1GA 3FB8C 1SQBH 1M56B 4JI3K 2HF4A 4G1QA 1NK9A 1VSHA 1HRV4 1MDUB 4EZ6A 4B3MB 3B6OA 1BHAA 1ATSA 1Q3EA 5GTIZ 4B9VA 4BACA 3T2MA 3H08A 1AILA 3P4SA 2RE2A 1ATRA 2HBKA 5FROA 4J2AA 4KFBA 3TJTA 3VF6A 3JAKA 1VBC4 4FWSA 2YI8A 3P32A 4JI0O 4HNAB 2O8EB 5DM6L 3J7AU 3PSIA 5IY5C 2UUCK 1AI6A 3BY6A 1ZL8A 2VGNA 3OYMA 2DYSB 3G71V 4JI2B 4JKHA 2ITMA 3QICA 3CRQA 1Y76A 3TR8A 1IBLO 3OTOB 2LQTA 2E76B 3CM5A 1GLJO 4DV6O 4EAHD 3AVIA 4LFAB 1NJIO 2HHHB 4DV0K 3STZC 5D3GA 1Q8IA 1T05A 4LP8A 3MCPA 1I7FA 2CK3G 3CJ7A 5KUMA 1HRHA 3SCXA 5KMGA 3MD0A 1T7PA 1YDXA 1X9MA 2WBNA 4F2RA 3ENBA 4ELTA 4YDUC 1NU0A 2B76A 2XAGA 3U8XA 1GM7A 2DYRC 3O1WA 4B8AB 4BW5A 1X9WA 1TUBA 4JK8A 5DMRA 3JCUZ 4LC1A 1K33A 3TI0A 5LP6A 3LDNA 3P31A 4FWQA 5CBHA 1VQLV 4NTWA 4BQLA 2VWKA 4PDVA 4TWKA 1SESA 4YFUA 3ZJZA 1A32A 1RMU4 1NGHA 1BO5O 4O0IA 1NA1D 1YQ4A 1JL1A 2KZMA 4NVPA 3VGKA 4X65K 1IO2A 4CH5A 4KO0A 2HFEC 2Q36A 1EETA 3WNHA 3JSMA 5IYBO 3HTVA 3SLCA 4JAAA 2G8VA 4PDLA 3D3IA 4YOUA 1YHQN 4N41A 3C7NA 2ITDC 3ZSVA 3R6MA 4QJFB 3E66A 3O65A 4A2BA 4DF8A 1NGBA 1OCOC 2XRIA 3C6HA 2WU2A 4WYBA 4FM0A 4DV2K 2HJDA 4HYOA 4FLWA 4JHDA 1E3MA 1K4CC 3HKEB 4JAUA 1C1CA 5I9EB 3E8FA 1YF5L 2IC3A 3HBTA 5K14A 3BCCH 1BU6O 5AQXA 2I7PA 1JFFA 4AF1A 1CLQA 1HR0B 2DJVA 3KLGA 3A5OC 1JLFA 3BDPA 3ZT1A 2PYLA 3JSLA 3K0DA 5C15A 2HR3A 1F4MA 2R70A 3UKUA 4CBXA 5EBLC 4YY3B 2O8BA 4IYIA 4WBNB 1VSLA 1GM8A 1VBA4 3CPEA 1ZOYA 2Z5UA 4KB1A 3DXRA 4IOCL 2LJ2A 2YUAA 2A5XA 3KVGA 2UUBB 1NGCA 2RF2A 3CRCA 5IE9A 3AK2A 4WFHA 1R0AA 1F7YA 2K1EA 4KBOA 4FYDA 2P9PB 1DF4A 4M63C 4PA3A 1RM1C 2JS3A 2B1IA 2B9ZA 3VGMA 4FM2A 3OW2U 1WBDA 4DWIA 3SBTA 4PHZA 2RMU4 1C0TA 2JGDB 2XY5A 2Q69A 1GO3F 3FAVA 3J7ZO 5B1AB 1HPMA 1YVNA 5AQNA 1U6ZA 3AGKA 4JKGB 4DTOA 3W7SA 2ZIOA 2CGJA 3KZIZ 1Y97A 4ZKIA 1ASUA 1TKXA 1NLVA 3QB0A 1X3NA 4KKOA 1N34B 1I3AA 4EFBA 1Q18A 1RUD4 4JI1B 1AR1B 4JZ2A 1FXHA 2XY8A 3ZSRA 4H5NA 2EULA 3RMAA 5KI6A 1RTDA 2A40A 1HWYA 3TABA 2H8PC 2WWWA 4I0XA 2JRIA 1NEKA 1IZ3A 1S0VA 5FPNA 3OS1A 4LNUB 4DRXA 3ZT0A 4KHWA 1KD1O 1IBMO 1YUWA 1VSDA 2O8DA 2LSNA 4JKCA 1VQ9V 1SQVH 1J53A 4KH4A 5A2QN 1RT2A 3KWIA 3F9MA 3EZ5A 4L8RB 2CTPA 4DUZO 3C94A 3OBYA 4QPJA 2V51B 3VQ4A 3ML0A 2QWRA 3MDQA 3RMBA 5LXTA 3IDHA 3I0RA 1LCUA 2MW2B 3B40A 1EX4A 4WF9V 3V9XA 5MLCQ 1KC8O 1NNEA 4FFKA 2IH1C 2Q31A 3TSPA 2QXLA 5LA6B 4O4JB 2F96A 4U67L 2PF4E 3B2EE 2P9NA 2QI2A 3L2WA 3FB7C 2C2AA 1TYQA 4DV7K 1NMNA 2DFEA 3AVGA 4PA6A 4A5AA 1S22A 3ZMTA 5KQ8A 2QKKA 4LF6O 5M1QA 5LYJB 4IYHA 5IWAO 3LPTA 4MVRA 3ZEUA 2XHBA 2DPNA 1KSPA 1VSIA 5FNVA 3QVNA 3OR6C 3MMVA 2HHWA 3VN5A 4M3WA 4GKJK 3JASB 2P5OA 2DFFA 2HKOA 2GUPA 3GBTA 4I9QA 5KHIA 3LP3A 4GZRB 3AVJA 3EZWA 4LWSA 2Q3SA 5E26A 3CMEN 4BIOA 3NXSA 2L35A 4DQQA 4KX6A 5GAHP 4JI4K 1WAJA 4AHUA 4DSJA 3CFRA 1QSSA 2RR14 2Q4PA 1SAZA 2Q97A 3CEIA 3C6UA 4B1VA 4YSZA 3J81O 1ZBLA 4O8KA 4DR7K 4J42A 3MK6A 3I56V 2WLJA 1K8KB 3AG1C 4MS2A 3AG4B 2P9KB 1SL2A 2V7QG 4YOWA 4WFBV 1AJQA 2JDIG 1DGKN 1NBWA 4UCVA 4HUFA 3JD1A 5EIBD 3FFIA 4X62B 3TPQA 4G27B 4F6RA 3MHHC 1I94B 2R9RB 3ULEB 5JLFA 5B1NA 1UA0A 4LF4K 2QWLA 2F8SA 3VOVA 2HHTA 2NRRA 5LMUK 2UXDK 3F5WC 3CG7A 4EB6B 3T1AA 2W6JG 1FXKA 4DS5A 3LANA 2XUMA 1P84F 4PL8A 1AJNA 3DXKA 3ZRWB 1TKDA 2R9IA 1IXBA 3MX5A 2E75B 4CK1A 3A8TA 1PD3A 1R1BA 1YSCA 4RAIA 5L3EA 1ASWA 4ICLA 4BRAA 1KRPA 2R044 4JS5A 2KQXA 3J8F4 2BGGA 4WE1A 5EX5A 3NHGA 2D0BA 3CFPA 1R3LC 1XMQO 4NB5A 2AZ2A 1DTQA 3OUFA 5B1BB 3SJCC 1QQMA 2QA4N 3KD5E 3GQHA 3TAEA 3ZHVA 2IS3A 4JI6O 1K4DC 4AH9A 3O3HA 2YXLA 3OD4A 3NR7A 3NMUA 4W5TA 1TL1A 3L71H 1L3SA 3HOSA 2P9SA 2A1SA 1GN2A 4EEQA 4IZ9A 3SGIA 2QWQB 1VF6A 1HNXB 4UFZA 4DQ8A 3ETGA 3BEXA 3OYHA 1W2BM 2H94A 2EBOA 3HM8A 2EZOA 1WSIA 1NI8A 5BR8O 1M4UA 1XDCA 3SAGA 3O1BA 4DR2K 4BE2A 3DYAA 1VF5B 4OKKA 4B9TA 2FBWA 4DUYO 4KUMA 2H3GX 3NH0A 4EKWA 1WUAA 1NG9A 4AHSA 1K97A 4OLAA 5GAGP 3OY9A 5BZBA 4CH4A 2ZJQL 3JARB 1S72N 1BI4A 1Z2GA 4J10A 4NTXA 1RT6A 3MHSC 3C6TA 3ZSOA 4KHSA 1IBLK 4DV4O 1COWG 2RJZA 1L3VA 2V7YA 2FB5A 4IFVA 2YICA 5KHHA 4O5BA 2QDOA 3WXLA 1YJ9V 4DLGA 4M45A 4GNIA 3LSUA 1BCOA 4KTZA 5AQSA 4A57A 4BC3A 4N56A 4KTQA 3RYCB 1HNWO 2QSAA 3QINA 1IXMA 1Q43A 1FAFA 1DLOA 4A59A 4B1XB 4DU3A 4DTPA 2MK3A 4QS8A 3K0SA 5AZJB 3E35A 4AM6A 2YJEA 2WTUA 1JJ2M 1BE3H 4CJLA 3CCVN 5AZIB 1JKHA 4DR3K 3B77A 1ZTEA 3M7MX 4YJ3A 4LF9K 1OCZC 1M90W 4JV5O 1SZTA 2OCHA 3V1QA 4BRIA 4E1NA 3QESA 3RTVA 2AXTZ 4J7KA 2NRZA 3F9KA 1RGIA 5GAEP 3AO2A 1EZVH 4DR5B 1HJOA 2BE2A 3ZHUA 4NO7A 4FJXA 2OPSA 3OFNG 4YHHB 4F3TA 4TV9A 3L72H 2BSKA 1RDAA 1YTFD 2UU9O 2WAMA 1RT4A 3D36C 2Q0RA 4WFAV 5LMNO 3CPWM 5CA0A 3HPOA 2B5UA 2ZINA 3ZEDA 1YVUA 3EO3A 1MQTD 3MECA 4O4LA 5B3SC 4A61A 4CZEA 3HVRA 5C24A 3CCEN 4TV8A 1QHAA 1MZEA 2RN9A 1FFXA 3DC6A 2P51A 3QIPA 4Q5VA 3SUQA 5HRRA 3VRBA 1KMIZ 4Z4EA 1XWLA 2X74A 2AGAA 5C93A 1N32O 1W97L 2FSKA 3SI6A 2QK9A 2H3OA 2IJKA 4I9WA 3TXQA 4BWAA 1Q9XA 4DR6K 4BR9A 3UQ8A 4OJRA 2ASMA 2DWDC 4UXNA 4O44A 2YKNA 1K7DA 3C7NB 3F2KA 4GX1A 3DOLA 3FE1A 4GY2B 1E1RG 3AO1A 2VQFB 4AQYO 4JI8B 4PDRA 4CBWA 4DV3B 2HNDA 4U3JB 4CGDA 3OS0A 1QTMA 2O8EA 4GCZA 4DV5O 4FLTA 2PUSA 3U0ZA 3SR2C 2P9UB 1N8RO 2OTLV 4JEPA 1P8ZA 4BROA 4TSFG 1EXQA 4B9UA 4K0KK 3H6EA 3BUZB 2YKMA 2XY6A 4LR3A 3GWKC 1XNQO 4CC5A 4NYKA 3OYNA 3K0GA 2DQ3A 1HNZO 3WFVA 1KVAA 2OCEA 1UJWB 2RM24 3NE6A 4GLXA 1BQNA 1Q6HA 1WN7A 3VQBA 1PNLA 2A79B 2WQYA 2E5LB 4FWMA 2Y1JA 1FKPA 4O2BB 1R084 4M7XA 4BC5A 2W6IG 1B92A 3H9VA 5FRMA 4O0JA 3IJ4A 4JTAB 4RUEA 4I5SA 1US6A 4E7IA 3I55V 4JYAO 4YIOA 2CH5A 4DSFA 3OYEA 3DSQA 4QE7A 1OZ0A 4E4EA 3L2QA 1M90O 1KFDA 2A1RA 4BRGA 1BA1A 4ZTJA 1K92A 2Z0AA 2HOEA 5LL6Z 2JJ1G 1B6QA 2CH6A 1D9DA 3ZHRA 5DM7L 2Y48A 5AR0A 1TGOA 4JI5O 3HT3A 4IKFA 4P2ZA 1UAXA 4DSIA 3AE3A 2F4VK 2Q0OC 4GX0A 4DW0A 1WB9A 1VEWA 2OCCC 4HUGA 1S6QA 3G71N 1L8DA 3NCIA 1N36K 3H3NO 3UCSC 1QCEA 3AE8A 1W0JG 4CJSA 1C0FA 2ITCC 3JAMN 1RDBA 1D9FA 3HKEA 3K5LA 3CXCM 3RRHA 4BVOA 4YSXA 3G25A 3THYB 2QKBA 1Q82W 1V55B 4IJAA 4B3TK 2BCCH 4BRHA 5HROA 4M42A 1RBSA 5JWPA 4YTPA 4IXCA 1MSDA 4U7NA 3HR0A 1TVRA 3ZIAG 4UQGA 4H0YB 3ABKC 1VQLN 2QWOB 5B5EZ 4UVBA 2HHSA 4NYNA 1R3JC 4NB4A 4DR4O 1NGJA 1YIJV 1MSWD 4WBNA 3I0SA 3SAFA 1G1XB 4CZKA 3SQ2A 4CS4A 2F7TA 3WT0A 2ZGZA 4CGFA 3ZN1A 1BL3A 3V9SA 2DY4A 4KHPO 1SKRA 1RTIA 1FJGO 4LF5B 3F5TA 5CZ2A 1QVGM 1OVQA 2IVNA 1FS0G 2F23A 4YXWG 4C8OA 2QTOA 4FZZA 3VQVA 2P9PA 3TU5A 5BPMA 2G8WA 4XH4A 2CTWA 1ZC6A 3RWUA 2YS8A 4FIPC 2JGDA 1YAGA 3K9AA 1N33B 1NZ6A 3WNGA 2ACZA 3CCRV 5FNVB 4L3QA 4JI7B 1J5EK 3OYIA 1IDSA 3O9TA 4CEBA 4A62A 5J9PC 1RUH4 4J2DA
chains in the Genus database with same CATH topology
1JL2A 1RDDA 1QE1A 3VQ6A 5FRNA 1S9GA 3MXIA 1ZBUA 1YEWA 1NOZA 4LNUA 4FLXA 4JI3B 3UT5A 5HLFA 1LV5A 1QSLA 2XO7A 4FJ5A 5JJEB 2GUIA 2OA8A 2P22C 4E19A 4ID5A 5LA6A 4O4JA 4BDZA 5J2TB 4ZHRA 4C8LA 4Q0BA 2UUCB 5CYMA 5C8YB 4CGHA 5LYJA 4DV0B 1V9PA 1XHXA 4I2PA 4I7FA 5IYZB 1BIZA 3K58A 1ZYQA 3JASA 5KRTA 4OGEA 4PQUA 1G15A 4MFBA 4CFCA 4BWJA 2CAZC 3OYGA 3BGRA 4DQSA 4X65B 4FZYA 1ITGA 4LSNA 1J5OA 1HNIA 4B9NA 4CJQA 3PV8A 3PX4A 4DV2B 4EB6A 1JXBA 3LWMA 3PY8A 1TKZA 3LP1A 4HCCA 4CF8A 1NJZA 4DFMA 3LP2A 4AHRA 1WSHA 2R72A 4CHZA 4F3OA 4IG3A 3K5OA 1NK6A 3MEGA 1YTAA 2DFHA 3BA9A 2HHUA 2VWJA 1ZAUA 5C42A 3LPUA 4CJUA 3L2RA 2OYQA 1MU2A 2OPPA 1U48A 4FJKA 2PW9A 4C8MA 4OPKA 4Z4CA 2VG7A 1TKTA 3JARA 3KLIA 3P1GA 4TV8B 3ZSQA 3KIOA 1RBTA 2I5JA 5KHKA 4GMJB 4FJNA 1S1XA 1SV5A 3V6DA 5I42A 4QAGA 3RGBA 3RYCA 4DK0A 3KJVA 2YHBA 3ZT2A 5KTQA 5ITZB 1TAEA 1UWBA 4XIUA 4IG0A 1IKYA 4CJKA 3TWHA 4BW9A 4FZXC 3K57A 3DM2A 4HBNA 4DV7B 5JJJB 2YNFA 4CEQA 3ISNC 4OLBA 3HO1A 5EU7A 1BISA 4GKJB 1NJXA 2KKWA 4H4OA 4OKEA 2ZNJA 4CERA 2IOCA 4ZI7B 3PUFA 2ZCEA 4UCUA 4JI4B 3NF9A 4O4HB 4X1YB 4ELUA 3P83D 3KTQA 3QG5A 4BE0A 4DR7B 3L2VA 4F2SA 1GOCA 3ETQA 5JCOA 3FI7A 4FJMA 4O4IB 4U3JA 5T7BA 3SNNA 3RRGA 3TANA 4LF4B 5JS2A 2UXDB 3VQPA 5LMUB 3JALB 2G8IA 3HL8A 4RW4A 3NGIA 2W42A 4FVMA 1XHZA 3HYFA 1XMOB 4O2BA 3K5MA 4F4KA 4CHPA 1O9GA 5IJ0B 4MQ3A 1SA0B 4KI4A 1TK8A 4CEZA 5JH7B 3SPYA 4EZ9A 2X78A 1JXEA 1GOBA 4DR2B 4KHQA 4RW9A 3L3UA 5HP1A 2RPIA 3EYZA 1S6PA 1EP4A 1ASVA 4R5PA 3SQ4A 3V9UA 1IBLB 4KL1A 3UT5B 3OYKA 1T03A 2YNIA 2OWOA 3S3MA 3OYCA 5J1EA 1FXXA 2R7YA 1BGXT 2G8KA 3QNOA 1QS4A 4CJEA 2YV0X 3OYLA 4DR3B 4LF9B 4W5QA 3EY1A 3QNNA 4IBNA 2KTQA 4X1KB 4E3SA 2HMIA 4TUYB 4CF2A 2PGGA 3TAQA 4K8XA 1JLGA 3CQ8A 4NYFA 1XI1A 3OYJA 5JQGB 3QEPA 4FJHA 5EYPB 1YTUA 1UA1A 4E89A 3HP9A 4FW2A 4CF0A 4FFBB 4D7SA 4AHVA 4DTSA 3KLHA 1WLJA 1NT2B 1SKVA 4CIFA 4J2BA 1S1TA 4DR6B 1HQUA 3VQCA 1X1PA 1VRUA 3P5JA 4AHTA 1BIUA 3KLEA 3TARA 1RBRA 3VQYA 1WSJA 1HMVA 4E7JA 2OZSA 4LH4A 3UIQA 1ZBHA 4KRFA 1VSMA 1CXUA 5J2UB 4FJLA 1U47A 4CJPA 4HUEA 1BCMA 5J2TA 2EHGA 1RBVA 3LAMA 3ALYA 5C8YA 4K0KB 4CF9A 2OPRA 3TAMA 3N2GB 1VSEA 4M3ZA 3CM6A 1UOCA 5IYZA 1WAFA 4Z4FA 4N76A 2D5RA 1D5AA 4X20B 2HEPA 1LWEA 4JLHA 1SL1A 2X6NA 4M3YA 1A5XA 2OZMA 2BTQB 1NKEA 3HKCB 4RG8A 4PI0A 3VQDA 2F4VB 3JATB 4CGJA 4FLUA 1N36B 1B04A 3BA8A 4TQDA 5KHJA 5KGXA 3M8RA 3LALA 2QJ1A 1LAVA 4B3TB 3S3NA 1HYSA 1VK0A 3KKRA 4FJ8A 4UCSA 5JJNB 1B9FA 2Q7HA 4FLYA 4PA1A 3RYHB 4DTXA 1QHTA 4CJ5A 4O55A 3QF7A 3SUOA 4CK3A 4FK0A 3AVAA 4FLZA 1U49A 1D8YA 5JVDB 4DV1B 1NK5A 2QXFA 3V9ZA 4CEDA 4CHQA 4E7HA 1RSOA 1J5EB 4DS4A 3RFRA 3ZSZA 3SV3A 4CHOA 1WPBA 3CHXA 3DMJA 3THOA 1KFSA 3QETA 3OJUA 1SKWA 1S1VA 1VSFA 4IIJB 1M93A 1FK9A 4I9LA 5ITZA 2Z1IA 4YJ2B 1LAWA 3RMDA 2UXBB 1C1BA 3SV4A 4FM1A 1JMKC 5FPOA 2PYJA 1NJWA 4W5RA 2E6LA 5HRSA 3RR7A 4TQFA 4LY7A 3OJSA 3ZSXA 4DFJA 4LFCB 4M41A 3JYTA 3AA5X 4DTNA 4CEEA 3LZIA 1T8EA 3SPZA 4ZI7A 1Z25A 4O4HA 4X1YA 5CA1B 4FJ7A 1KVBA 1S5JA 1TAQA 3QEVA 4M3XA 2G8HA 3RR8A 3DRSA 4JV5B 4HCBA 3CFOA 3VQAA 4DSLA 3BHPA 4KREA 1IKVA 2G8FA 4O4IA 3S3OA 4UCRA 3DLKA 2X6SA 2D0AA 2ZM6B 3JALA 4E0DA 1BHLA 3ULDA 3BAAA 3E22B 2JGUA 5J2PA 3NGYA 4B9SA 3DI6A 4NCAA 3MEEA 4Z0UA 2KW4A 4LD0A 3K5NA 4CJWA 1NKCA 1DGSA 5K1PA 4KI6A 3KLFA 2HHVA 1LWFA 2HB5A 5IJ0A 5KHGA 1SA0A 2VQEB 3C95A 4BE1A 5JH7A 3HJFA 3VQ5A 3IG1A 4DU1A 1Q9YA 2Q7GA 3T1YB 3B6PA 4DV5B 4LSLA 1HQEA 5LP6C 3V1OA 4GKKB 3ZSWA 3CB2A 4FLVA 2OPQA 1KVCA 1X4TA 2YHAA 4CEFA 4Y1DA 4I50B 3QEIA 4ELVA 3SJBC 4O2AB 2D0CA 1K6YA 3SQ1A 4CJFA 3RMCA 2KFNA 4DTJA 1IKWA 3ZT4A 1NKBA 4BDYA 1U4BA 4X1KA 3VQWA 4LFBB 4TUYA 2NUBA 4CCHA 4DK1A 1HW7A 2HVIA 3VQEA 3HM9A 5JQGA 5EYPA 3OYAA 2JVDA 1RTHA 3HKBA 3OVNA 4QCLA 1CXQA 3HKDA 4FFBA 1C0UA 2HHQA 4B3SB 3PX6A 1NOYA 4EFEA 3AA3A 4DR4B 3VA3A 2QM4A 3O4QA 4CJ3A 4YNQA 1SQGA 5LOVB 4O4GA 2FBVA 4HVJA 3HPHA 5J2UA 3KKSA 4RW8A 2ITGA 4DU4A 3L3VA 3LDSA 3G0ZA 3RYFB 4KHNA 4OVLA 4ZHQA 3AO3A 3N2GA 3L8BA 4Q6GA 5EZYB 4UCOA 1XQ8A 2JLEA 1Z26A 3D45A 1WSFA 4X20A 3ZS8C 1RCHA 1RT7A 2R7FA 3PO5A 3AVBA 4ZOLA 5CB4B 3OYFA 2BTQA 4JRPA 3HKCA 1S1UA 4I4TB 4QOZB 2G8UA 3JATA 2R9AA 3D0PA 3AVMA 3IRXA 2HHXA 2Q0AA 4LF7B 4DSEA 3NF8A 4TSXA 4CF1A 4C8KA 5HRPA 1KTQA 4IHJB 3AO4A 3RYHA 4FW1A 4C8NA 4B08A 4PWDA 4DFKA 3T1HB 3WNFA 2Q7EA 5JVDA 4H4MA 2WONA 2HNZA 3PO4A 2HNYA 1CZ9A 1JLAA 3NF7A 3NFAA 1TV6A 4Z4IA 3G10A 4W5NA 2ZNIA 4CEOA 4ID1A 1JLBA 1NK0A 4Z4GA 3IAYA 1XNRB 3KK2A 4B3RB 3ZSYA 4IIJA 4CEAA 1BQMA 4YJ2A 1IBKB 3AVHA 2ZD1A 3LZJA 1KU9A 4CS2A 2DTUA 3JAWA 3N2KB 4JS4A 3PN1A 3ZCMA 2RQ6A 4KB0A 5KX5B 1U45A 4W5OA 3VQ8A 1LWCA 3MXMA 2ZE2A 2Z1HA 3U10A 4B8CA 5HBMA 3QTCA 2P5GA 5I3UA 3NH2A 4LH7A 4OKJA 3VQ9A 3RYIB 4B9LA 3ITHA 5CA1A 4FJGA 2F8TA 4JI0B 2GV9A 4OPJA 4CJ4A 4DMNA 3S9HA 2BDPA 1J54A 1NK8A 4CK2A 2FC0A 4AHCA 2ATQA 4DQPA 2VG6A 2RKIA 1C1AA 5IJ9B 4DV6B 1S1WA 3AVNA 4H8KA 2FBTA 5J2MA 3DLHA 3E22A 3U3GA 2PZSA 3WB1A 3SUNA 1WNSA 2JS5A 1TK0A 3WB0A 2B6AA 4ZIBA 3FFQA 4KTWA 3VA0A 1N6QA 1VSKA 4I55B 4FJIA 1ZBIA 1W9HA 4PY5A 4CIEA 4JRQA 4N47A 4E1MA 3THVA 4X64B 2BANA 4X1IB 3CSXA 1GOAA 2KFZA 1VF7A 2PY5A 1VSJA 2YI9A 3NGZA 3HKBB 3U6FA 3K2PA 1YT3A 3HKDB 2Z1JA 3MXJA 3SJJA 1N5YA 4Z4HA 1C0MA 4I50A 2B5JA 4O2AA 1NK7A 1RT3A 2AJQA 2P1JA 3DLRA 1O9HA 1TK5A 4Y1CA 1Q5OA 5SZTA 3MEDA 4KAZA 3TAPA 4CFDA 3M8PA 2IM9A 1EKEA 4ZHQB 4LH6A 1H2SB 4FK4A 1JJOA 4CESA 3BABA 4CHNA 4PUOA 1IBMB 3VQ7A 3OS2A 1SL0A 1B9DA 5JS1A 2GBZA 1NJYA 4CFAA 1L3UA 3BRCA 4DUZB 5J2NA 1DTTA 3LNNA 5EIBC 1TVKB 2E4LA 4ZOLB 4LH5A 3BPZA 5GONB 3HXMA 1L3TA 5LOVA 1Z5WA 1HNVA 2B4JA 4LF6B 3SQ0A 3MAQA 5IWAB 4DQRA 3NBPA 3AVCA 5BMVB 3RYFA 1Z5VA 3AA4A 4M3UA 5EZYA 4BDPA 5E41A 3V4IA 2ZIMA 4M3TA 1KCFA 4AILC 1JLEA 3NF6A 2KQ2A 1HJRA 3O3FA 4NCGA 3AVKA 4DG1A 5C25A 3JAKB 3LAKA 4RW7A 4CJTA 4IDKA 2O4GA 1KLNA 5CB4A 5DK5A 1W0HA 3PX0A 1NK4A 4I4TA 1KLMA 4CS3A 4E7LA 5D5PA 1SQFA 3V81A 1XMQB 5KMGB 3LWLA 3NAEA 4CJVA 3V9WA 1RT1A 4JI6B 4CECA 4DTMA 1HYVA 3HSTB 5HRNA 1TUBB 3SUPA 5CYQA 1REVA 5LP6B 1C6VA 4PI2A 4NXNB 4IHJA 4N5SA 2O4IA 1XC9A 5K1XA 5BR8B 3QEWA 3KK3A 3JAWB 2BTOA 3QERA 4DUYB 4KPYA 4I2QA 4F8RA 3ICXA 3AO5A 3HK2A 4DV4B 4HNAA 4HTUA 3OYBA 1P49A 5J2QA 2ZQBA 1JFFB 2YIBD 5CY4A 1T5EA 1RNHA 1HNWB 1S9EA 4GYCB 4CC6A 4CHYA 3HVTA 1U04A 4KV8A 2V4DA 4GVMA 2E3CA 4CFBA 1CZBA 4J2EA 1L5UA 4M3RA 3U3YA 1TL3A 4B9MA 5FPRA 3O3GA 2UU9B 3N2KA 3RWRD 2KZZA 5LMNB 1LW0A 4GW6A 5KX5A 4HHTA 4OGCA 3VQQA 3T3FA 2FBYA 4BWMA 4CH3A 1RT5A 1X9SA 1N32B 4K8ZA 4DRXB 1IG9A 5SWMA 3ASMA 4NXMB 5KRSA 1HPZA 4DTUA 1A5VA 2XY7A 3RYIA 3DLBA 4AQYB 1IH7A 3T19A 5LXTB 4FJ9A 4CH6A 4CIGA 1I39A 2IDOA 1WSEA 2IGIA 4DSKA 5IJ9A 3QLHA 1XNQB 3O4NA 4NCBA 3SZ2A 3QO9A 3HP6A 3F73A 1RDCA 1HNZB 4DF4A 3L2UA 3OYDA 4CJRA 1RBUA 4TOIA 3DLEA 4UCTA 5JCOC 4DTRA 4JYAB 5KGWA 4EP4A 2FBXA 4FK2A 1HYZA 1JLQA 4I55A 4DFPA 4JI5B 4OX9B 2YNHA 1RTJA 3IS9A