2PY5A

Phi29 dna polymerase complexed with single-stranded dna
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
564
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GGACTTT)-3'
total genus 165
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2py5A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2py5A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2py5A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2py5A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2py5A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2py5A06
1S1XA 3OJUA 3AV9A 1XHZA 1T03A 2OZSA 4FJIA 1WAFA 4CFDA 3DLBA 3DI6A 4OVLA 3QEWA 3ASMA 2PY5A 3HVTA 1TKDA 1D5AA 2F8SA 2FBYA 5HBMA 3T1AA 4QCLA 1U45A 3DLGA 2OYQA 3ZT1A 1TK5A 1NK4A 4FK2A 4DQRA 1X9SA 4CEEA 1BQMA 4QAGA 4Z4IA 4FYDA 3DRSA 4CEZA 1FKOA 4CHOA 3RMBA 4KHNA 4OGCA 2DFFA 4IFVA 4ICLA 4CJFA 4Z0UA 1Z26A 4KREA 3KLFA 4OPJA 5J2NA 1SL0A 1RBTA 4FLXA 3C6UA 3M8SA 1TKTA 2KZMA 1RDAA 3C6TA 1ITGA 3SJJA 1RT4A 3AVCA 1U49A 1Q9YA 4FJXA 3OYEA 3QETA 4MFBA 4Q5VA 2Z1JA 3AVGA 1ZBIA 2P51A 2A1RA 3M8QA 2HB5A 3MXIA 4ELVA 3AVJA 4KHYA 4YFUA 1IKWA 3AO4A 4QOZB 3RMCA 4PA1A 3AVHA 4CFBA 3TAEA 2G8VA 3SYZA 1B9FA 3O3HA 4K8ZA 4E7IA 5KRTA 3K57A 3S9HA 3SI6A 2G8IA 1S1TA 2IAJA 3KLEA 4DMNA 4RW8A 4KTWA 5C42A 4KHUA 5J1EA 4B3OA 2QXFA 4FJJA 4JRQA 2F96A 1QS4A 3AVKA 3AO3A 2YKMA 1KLMA 3ZSVA 4DFKA 4F8RA 4W5TA 2HHUA 1VSDA 1YVUA 5HRRA 2PW9A 3V9ZA 3DLHA 4E1MA 5D3GA 3VQDA 2VG7A 3OYJA 3NF8A 3HP6A 1J5OA 4DFMA 2VG6A 4L8RB 4CE9A 1CLQA 3RTVA 3NDKA 4LD0A 4E7JA 3ZT0A 1X9MA 1RNHA 2DFEA 4CK2A 4B9NA 1SUQA 2DFHA 3ZT4A 3IRXA 2YNIA 1ASWA 1LWFA 1TVRA 2A1SA 3QIPA 3U3YA 3QEXA 3VQ6A 1NK5A 4DSIA 3VQ5A 2G8HA 2ZE2A 5DK5A 4HUFA 1VSEA 1TKXA 1VSKA 2KQ2A 3KKRA 1HNVA 1EKEA 3NAEA 4M3UA 1FKPA 3C94A 3A2FA 4AHRA 2FBTA 3SQ4A 3L2UA 5KRSA 4Z4GA 1DLOA 3AVAA 1Z25A 3LWLA 4J2DA 3TANA 3OVNA 3CFOA 1B92A 1GOBA 1S9EA 1RBUA 1LV5A 2YHBA 1JKHA 4KB0A 1KFSA 1LAWA 3MECA 1VSIA 1WAJA 1Q9XA 1BIZA 1B9DA 2WOMA 5SZTA 3KK2A 3CFRA 1HYSA 1ASVA 4DLEA 3AA2A 4IG3A 3VQPA 4GMJB 1I39A 4BACA 2Q3SA 4N5SA 1T7PA 4C8MA 4NYNA 4DLGA 1YT3A 4F4KA 4I9LA 4DFPA 1RTJA 3O3FA 4DFJA 4KI6A 1HJRA 3OYDA 5HLFA 3KJVA 3V9SA 2OPPA 4DTNA 4HCCA 4KHQA 4FJ7A 4DTPA 5J2QA 4WE1A 2HMIA 1W9HA 4OKJA 4NYFA 3OYCA 3TABA 3T19A 5KGXA 1GOAA 4CJVA 1KRPA 3E01A 3WNGA 4DSLA 4FW1A 4H4OA 2Z1IA 3S3OA 1WNSA 2XY6A 2NUBA 2X78A 4EZ9A 3KIOA 4CJLA 1RBRA 1IO2A 3ITHA 3WNFA 1S6QA 4N56A 4J2EA 4DQSA 1NJYA 2ZQBA 4CJEA 4PQUA 4H4MA 3ZSZA 1U4BA 1RBSA 2BDPA 1T05A 1TL3A 4FW2A 4CEFA 2GBZA 3VQ4A 5FRNA 1HQUA 3OYBA 1RDCA 2G8KA 1O1WA 4AHVA 3NF7A 3EZ5A 3QNNA 5JS1A 1JLAA 3JSMA 4HTUA 3PX6A 4H8KA 3HL8A 1CZ9A 4FJNA 3DMJA 3FI7A 2RF2A 3SCXA 4LSNA 3VQ7A 3LP1A 2EX3A 3OS2A 3V4IA 4Q0BA 1S6PA 4ZHRA 3PY8A 4DSKA 2HVHA 2B5JA 4O55A 4KI4A 3KKSA 4BE0A 4FVMA 1U04A 3NF6A 4NCGA 4DTSA 2HHWA 4FZZA 2XY8A 3JYTA 4BE2A 5CZ2A 1NK7A 3M8PA 4KHWA 4B9VA 4PY5A 3TARA 3ZSXA 4FLYA 1CXQA 2IC3A 3L2WA 1KLNA 1JLEA 4CJKA 4XIUA 2B4JA 1QSLA 3HP9A 4FJ9A 1KVBA 1NK8A 3LP3A 4LH4A 5KTQA 1BISA 1T8EA 3L8BA 2HNYA 3VQEA 4FLTA 2OPQA 1BIUA 4E3SA 1EETA 4TSXA 2OZMA 1RT5A 2VG5A 4LY7A 3UIQA 2BGGA 1TAUA 3P83D 1YTAA 3BGRA 3D45A 2IDOA 1ZBFA 3LANA 4DQIA 4O4GA 1J9AA 4OJRA 4C8NA 3QEVA 4F2RA 4N76A 4F2SA 5CZ1A 3AVFA 4B9MA 5JS2A 2QK9A 1BI4B 3F9KA 5I3UA 3TAGA 1I3AA 1REVA 3AO1A 4CFCA 3TAFA 3LZIA 4CCHA 2HHVA 2HHSA 2KFNA 3I8DA 2Y1JA 4CK3A 4RG8A 4FK0A 3VN5A 3ZSRA 3NCIA 2R7YA 5C25A 4E89A 4CJRA 3HPHA 1L3SA 3KLGA 4EP5A 3K5NA 4M41A 3KD5E 2D0AA 4FXDA 4CIGA 3OYAA 1CZBA 3SV4A 3T3FA 3PX0A 1BGXT 4LSLA 4HUEA 3OS1A 5I42A 3U6FA 3DLRA 3OY9A 4R5PA 1QE1A 3SZ2A 3S3MA 3KLHA 5FDLA 2G8WA 4CEOA 4E19A 4DSJA 1X1PA 3KK1A 4ELTA 3V6DA 4F3OA 1NK9A 3WNHA 4B9UA 2HNZA 2G8FA 4I7FA 4W5RA 1VSJA 2P5OA 1NKEA 4KV8A 4BWJA 3ULDA 3V9WA 1JLFA 2IGIA 4CGDA 4CIEA 1NKBA 1WSEA 1U47A 2B6AA 4DQPA 2ATQA 1C0MA 2O4IA 2YNHA 4PUOA 4AHTA 3NGYA 1VRTA 1JLCA 1K6YA 1VSLA 2GUIA 4CGFA 2ETJA 3DRRA 4DSEA 3MEDA 2E4LA 3PUFA 1SL1A 3HJFA 4CF1A 3IS9A 3L3VA 1WSGA 4G1QA 3VQQA 3SPZA 2XY5A 3HO1A 4OPKA 1RT6A 3ZT2A 2YKNA 1ZYQA 3CM6A 1HYVA 1WSFA 3HSTB 4LH5A 1BCMA 1NJWA 4FM2A 3QESA 2QKBA 3OYFA 4BDZA 2P1JA 3AA5X 1QHTA 1L3UA 2HHQA 4N47A 1L3TA 2YNFA 4O0JA 4I2QA 4DS4A 3VQ8A 2BANA 3V1RA 1FXXA 4RW7A 3V9XA 4DU1A 4E1NA 1NKCA 3AO5A 3OYGA 4FZYA 1KSPA 3ALYA 2FC0A 3G10A 3QEPA 4FJLA 1JLQA 3WNEA 5KGWA 3U3GA 2JGUA 3QO9A 4CJQA 1NK6A 1RCHA 3NE6A 3MEEA 4JLHA 2E6LA 4CF0A 1TK0A 4Z4EA 3QIOA 3ZT3A 3HXMA 1QSSA 4FLZA 3DYAA 3S3NA 4KTQA 1W0HA 4ID1A 3SQ0A 3NHGA 3DM2A 4DTMA 3SV3A 1TAQA 1UAXA 4UQGA 1RT2A 4W5QA 1QSYA 3LZJA 3LAKA 1BCOA 4RW9A 3KTQA 1TGOA 1LAVA 2Z1GA 3L2RA 2R7FA 4CERA 1NJZA 3KD1E 4OLBA 4AHSA 3OYLA 4DF8A 4M45A 1C0TA 4CEDA 3DRPA 4CF8A 3M8RA 3NFAA 5J2MA 4J2BA 3CG7A 4CGHA 2BE2A 4FJMA 2X6NA 4OKKA 3DLKA 2GV9A 2X74A 2HVIA 4M3WA 2XRIA 2P5GA 1SV5A 2PYJA 4Y1CA 3ZCMA 3B6PA 5C24A 1ZBUA 3K5OA 4RW4A 4CESA 3QERA 4M42A 1L3VA 2DY4A 5CYMA 2Y1IA 1UWBA 3H08A 4RW6A 2HHXA 4CJSA 4B9LA 1A5WA 5HRPA 1HNIA 3P1GA 2XHBA 1LWCA 4IFYA 3NGZA 1VSFA 3AA4A 4FCYA 2KZZA 1WN7A 2HNDA 3LP2A 3THVA 3TAPA 3OYIA 1BQNA 3HM9A 3V81A 4FJHA 3PO5A 3VA0A 2EHGA 4Z4FA 4CF2A 4K8XA 1NOYA 1J54A 2OPSA 1J53A 3MXMA 1ZBLA 3LWMA 1RILA 4B9SA 4C8OA 2YV0X 1XWLA 4Z4CA 4JS5A 4E0DA 4FJ5A 4O5BA 4KFBA 3EYZA 3VQCA 4I9QA 3TAQA 3CQ8A 1EP4A 1RT7A 3AVIA 4KB1A 4CJUA 3NH1A 2DTUA 5HP1A 3P5JA 4HUGA 3F73A 3K5MA 1A5VA 4HVJA 4CHYA 2O4GA 1N6QA 3PX4A 3K59A 1QQCA 5J2PA 4YNQA 2KFZA 1JLBA 4DTJA 4OKEA 4EZ6A 3VQ9A 3HT3A 3RRGA 4KO0A 4CECA 4KHSA 2W42A 4FJ8A 1DTQA 3OYHA 1S1WA 4CJ3A 3DOLA 1SL2A 3SNNA 4CGIA 1L5UA 1RDDA 1BI4A 1KVCA 1NOZA 2IS3A 2IOCA 3KLIA 4CIFA 4BDYA 1TK8A 2E6MA 1VSMA 1U48A 5CY4A 1NJXA 1D9FA 5FRMA 3VQBA 3NBPA 3RR8A 5K14A 4O44A 4FJKA 1EXQA 4IG0A 4J2AA 2KTQA 5CYQA 4CFAA 2AJQA 3KK3A 3K58A 1JL2A 4CHNA 3HK2A 4DTRA 1HRHA 3TR8A 4ZTJA 1C1BA 3LPTA 4B8AB 4EP4A 1UOCA 3ZSYA 4CHQA 1JXEA 4F3TA 2WONA 3SUNA 4FLUA 5E41A 3V1QA 3HPGA 3OYKA 4CJTA 4I2PA 1KCFA 4ZTFA 4Y1DA 4FK4A 4M3ZA 2OPRA 4AILC 2OA8A 4BDPA 4FLVA 1JXBA 1S9GA 5HRNA 3VA3A 3SQ2A 4HHTA 1HPZA 1KTQA 3QNOA 4BE1A 3RMDA 3ZSQA 1R0AA 1QTMA 2QKKA 1VSHA 1S1UA 4DTXA 4DF4A 3RR7A 2VWJA 3BDPA 3AVLA 4CGJA 1RTDA 2PZSA 3VQAA 1DTTA 1HMVA 3CFPA 4CHPA 1WLJA 3I0RA 1D9DA 3AVNA 4HCBA 4FM0A 5DMRA 3D0PA 4DTOA 1GOCA 3O4QA 5HRSA 4CEQA 1RDBA 3B6OA 1S5JA 4OLAA 1XI1A 1IKXA 2YNGA 1SKSA 1RT1A 2X6SA 4CJ4A 4E7HA 4DSFA 1S1VA 2D0CA 4FLWA 1RTIA 4KPYA 3LP0A 1KFDA 1WSHA 4OGEA 5FROA 2RN2A 1IG9A 5T7BA 4CEAA 4IBNA 4DWIA 1RTHA 2ZD1A 3CYMA 3LAMA 3RRHA 3MEGA 3ZSOA 2VWKA 1IH7A 2D5RA 4CEBA 1LW0A 4FM1A 1C6VA 1HYZA 3AVBA 3L3UA 1HQEA 1KVAA 3ZSWA 3OYNA 1UA0A 2HW3A 2FBVA 1UA1A 2PYLA 1RBVA 3SUQA 4AHUA 2G8UA 3O3GA 3FFIA 4AHCA 4CF9A 3V9UA 3HVRA 3RMAA 1IKVA 5HROA 3C95A 4KTZA 2XO7A 1D8YA 2HHTA 4GVMA 3OJSA 1IKYA 4CK1A 4PWDA 1XHXA 4FJGA 3MXJA 2LSNA 1C0UA 3DLEA 1SKRA 1TKZA 2FBXA 4M3RA 3PV8A 4KRFA 4DG1A 3TAMA 4ELUA 4CJPA 4AH9A 3NH0A 1XC9A 3OYMA 3O4NA 1LW2A 2I5JA 3AVMA 4DU3A 1X9WA 3PO4A 3NGIA 4KAZA 1BL3A 3QLHA 4DQQA 4IDKA 3QEIA 4CHZA 3IAYA 4KKOA 1F21A 3IG1A 3LPUA 4E7LA 4DS5A 4O0IA 3AA3A 5EU7A 4M3XA 1C1CA 2KW4A 3AO2A 3SUOA 4CJ5A 4Z4HA 3OS0A 3NF9A 3CM5A 3V1OA 1WSIA 4W5OA 5KI6A 4BWMA 4C8KA 1JL1A 3HPOA 4JS4A 3SUPA 2D0BA 3TI0A 1VRUA 1A5XA 3TWHA 1C1AA 1ZBHA 4GW6A 1EX4A 1FK9A 2Z1HA 5SWMA 1NK0A 3EY1A 1Y97A 3I0SA 1ASUA 4MQ3A 4JRPA 4IKFA 3MAQA 4B9TA 1RT3A 2RKIA 3DOKA 1VK0A 3HYFA 3RWUA 1TL1A 2RPIA 1BHLA 3K2PA 4B8CA 4DTUA 3L2VA 1JLGA 4CGGA 4CJWA 1WSJA 1SKWA 3SPYA 3SQ1A 1G15A 2YHAA 1MU2A 4NCAA 4M3TA 1TV6A 1Q8IA 4ID5A 4B08A 1YTUA 1LWEA 2ITGA 3L2QA 1N5YA 3G0ZA 3QINA 4E7KA 4W5NA 4DU4A 4N41A 1CXUA 4NCBA 3ISNC 3NH2A 3LDSA 2JLEA 2XY7A 4C8LA 4M3YA 3LALA 3K5LA 2F8TA 4FZXC
chains in the Genus database with same CATH superfamily
3ML0A 4JI3O 4GX1A 4DV2O 1T03A 3AE5A 4YXDA 4BR9A 3ASMA 5JLHA 1ZL8A 1DGKN 2WLLA 3T1AA 1WB8A 4MTGA 3T7ZA 3CC7N 5GIPA 3CSXA 1JJ2U 4Z4IA 3H1IH 2OANA 4KHNA 4OGCA 4DW0A 4E2LA 2DFFA 4CJFA 3JAMN 1R3IC 1YEWA 3A5LC 4CD1A 5H1SQ 4OPJA 2YJFA 4DR7O 4OGQB 3SJJA 5EZYA 2EILC 1ITGA 3HOTA 3VESA 4Y0WA 1Q9YA 2UU9K 2EIMB 3JASB 3QETA 4N23A 2XUMA 5FLXO 2Q2RA 4X66B 3CCSV 4CZMA 1AI5A 3AG1C 3LDNA 4DUZK 4KHYA 3AO4A 4B7KA 1VQMV 3DAWA 5BMVB 4UFZA 4XEIA 1B9FA 3O3HA 2QA4V 2FB5A 3K57A 1N36B 1NQTA 3DC5A 4I7ZB 4KHUA 1ZLZA 3ENBA 3AVKA 2ASOA 2YKMA 4XDJA 1FXKA 2ZDIA 1PVC4 3UQ8A 4PKIA 3R65A 3AE8A 1QBZA 2HHUA 2G38A 1VSDA 1KKCA 3BY5A 3WFVA 2PW9A 1MA1A 3V9ZA 4CC5A 1NJWA 1Q43A 1CLQA 1GLBG 5GAEP 2GHYA 2LJ2A 4X66K 2DFEA 3E1YA 4FJCC 4BRHA 1S72V 4FZZA 1YJNV 4MTOA 1KFYA 3VQ6A 1NK5A 2DYRB 3SJCC 1TKXA 1VSEA 4JTAB 2KQ2A 5JJEB 1EKEA 1HNVA 4JHDB 3C94A 1OH8A 3G80A 4RQFA 5KAIZ 1G6UA 4JI6O 3D3QA 4IJNA 2QTSA 2ZM6K 5LHGA 1M56C 4O2BA 2OTLN 3AG3C 3AVAA 3EXAA 4YTPA 2Q5ZA 4PA3A 2CGOA 1KKDA 3BVOA 4CH4A 1GOBA 4BR4A 1S9EA 1RBUA 4FVUA 2YHBA 4EIAA 1PL4A 3MECA 1VSIA 1BIZA 5SZTA 4JYYA 3KK2A 1IBKO 2XAFA 3SJAC 1YF5L 1GO3F 3CMAV 4DLEA 3Q7BA 3AA2A 5C8YA 1YUWA 2HFEC 3VQPA 4F6RB 1RUC4 3PSFA 1Q86O 4JI8K 4JN4A 4UVBA 1EO1A 5C93A 2D2CB 5KPTA 3D36A 4ISFA 3Q7CA 4M7YA 4C8MA 4F4KA 4I9LA 4DFJA 4BY9C 3EKUA 4KI6A 5LMUO 2ZXWB 3KJVA 2OPPA 2YHYA 4BRNA 4I6MA 5JJJB 4DR1K 3E9OA 4YOWA 3WB1A 1WB9A 1U97A 3OYCA 5HFMA 3L72H 3T19A 5KGXA 2JK5C 5KMGB 3WNGA 3JD4A 1VQ5N 4DSLA 1OCRC 1OOPD 1AR4A 4X9QA 1WNSA 2DMXA 2QKSA 2NUBA 1SRYA 1TVKA 3ZEUA 4CJLA 3WNFA 1IO2A 1SQXH 4N56A 3CJBA 5M1PA 4J2EA 1NJYA 4OO1J 2E88A 4PQUA 4FFKA 1RDWX 3SMPA 1H8HG 3ZRWA 2NRRA 4FIPC 4ZOLB 1WPXA 4O8UA 1TL3A 5EBWC 1S0VA 1OZ0A 3CCEV 1KAZA 1B04A 1J5EO 4CS2A 3OYBA 1Q7YO 4AHVA 3LNMB 4DR5B 3NF7A 3QNNA 4JKGA 2WSSG 5M1OA 2IJJA 4HTUA 2WDQA 1K9MW 3GVMA 2HG5C 4R50A 1CZ9A 3E66A 4FJNA 3ZHQA 4MVSA 1MSWD 3OHRA 3ASNB 4DR7B 4ZI7B 5JVDB 4LSNA 1NBWA 4Q0BA 2P4VA 1KC8O 1S6PA 4DSKA 1AR84 4O4IA 2B5JA 4O55A 1ZL8B 1LUWA 4EFEA 4LF6O 4RAIA 4FVMA 1U04A 3HTVA 4TV9B 3OR7C 3UCSC 2QWPA 3NF6A 1M57C 2WC9A 4NCGA 3NMUA 5EXWA 4PY5A 1S77D 3FKSG 4IOCL 4GVEA 1VBB4 3MD0A 1CXQA 1NCQD 1DT9A 1JLEA 4EB6B 2E20A 3HP9A 4CZKA 4GV3A 1NK8A 1Y64A 3L8BA 3WEEA 4X89A 2B1GA 4JZ2A 4FLTA 5EVZA 1BMFG 3VQEA 1KF6A 1DTOA 1EETA 4TSXA 2A06H 4JI0K 3BHPA 4DR4O 1RT5A 3F5TA 4LY7A 1R59O 1TAUA 3P83D 1COWG 1YQ3A 5JVHL 3IJ4A 1GTOA 3DJCA 1MOFA 2PGGA 2ZKOA 3AAQA 4OJRA 3ATVA 3CYOA 5BMVA 2P06A 4F2SA 3MHHC 4JI0B 1YZBA 3H46O 3M99B 1GN3A 2D1KA 3AO1A 3TAFA 3LZIA 4B1XB 3WXLA 3AGKA 4EEQA 2UXNA 3K08A 4FK0A 3VN5A 3GB7C 1NGAA 4CVNE 2Y0PA 3BAAA 2UUCO 4P9OA 1NGIA 4DXWA 3KLGA 4EP5A 2KG7A 3K5NA 2KHOA 4M41A 1L8DA 3KD5E 3HKCA 4H03B 4FK4A 4BC2A 2GTAA 1CZBA 3CCQN 3PX0A 1LOTB 3OMAB 4JGSA 3VTHA 5BPNA 2DQ0A 4CS3A 1BHAA 1CEZA 3N2KB 1J6ZA 4HUEA 3OS1A 5I42A 3VQYA 3TTFA 1NGJA 4DQ8A 1WJZA 1YDXA 1T6CA 3RVCA 3S3MA 4RO2A 2WBNA 3BF3A 3KLHA 5FDLA 1RP3B 2ZQMA 4CEOA 4DSJA 1X1PA 4DR5O 3FLCO 4F3OA 2EBOA 3H3OB 3WNHA 4FOIA 5L3BA 2HNZA 3ZYYX 4IYIA 2HBLA 3LNNA 3Q4HB 5H9CA 1Y67A 4O2BB 2JWKA 4GKJB 4CGDA 1YJWN 4GV6A 4JASA 3BRCA 1PNKA 5B3SB 5AZIA 1CP9A 3GQKA 4BWAA 4PUOA 3IC7A 5AQTA 1VRTA 1K6YA 1T5EA 1R094 4DSEA 2GUIA 4WFNL 1EN5A 3I55N 4CF1A 2ZDIC 3JARB 1WSGA 1VQLV 5IYBO 2ZWHA 2YKNA 3SBGA 4LH5A 2GUPA 1BCMA 3NXSA 2IJHA 3OYFA 2P1JA 1L3UA 4X88A 5E79Z 3LDOA 4N47A 2YXYA 1D2DA 2VS0A 4Q4Y4 4DU1A 3VQ8A 1FXXA 4RW7A 3V9XA 2P22C 4E1NA 4QGPA 1NKCA 3AO5A 3OYGA 4A5BA 1KSPA 2FC0A 4FJLA 4JYAK 1SERA 2B9ZA 2JGUA 4I6MB 4CJQA 1RCHA 2VQFO 4O4JB 1Q6IA 1R3KC 1K73W 2VRZA 4WFHA 1K8AW 5J2TB 1W97L 3ZT3A 4FLZA 3DYAA 4GUNA 3OW2U 3O9RA 4OX9B 1XBLA 1Z7S4 5JQGA 4UQGA 4W5QA 2NRXA 2AZ0A 3LZJA 5AQXA 1TA8A 3VBBA 3THWB 1K34A 4H44B 1TGOA 2P6JA 2RQ6A 2Z1GA 4CERA 2K9PA 2Q69A 3ABLC 1NJZA 1BDGA 1NBMG 3ICXA 4OLBA 2O8EB 4BRCA 5GTHZ 4DF8A 1N33O 3HKBA 1C0TA 4CF8A 3A8YA 4J2BA 3C6AA 2WA3A 2UUCB 3DLKA 2ITCC 5B1AC 3D6RA 2X74A 5B1OA 3B09A 2QWRA 2XRIA 2P5GA 3FZLA 2PYJA 1AL24 3ABTA 3MDSA 5C24A 4M42A 2DY4A 4J42A 1ATRA 2HHXA 1Y66A 4CJSA 1R1BA 1HNIA 4IFYA 4GV9A 4DR2B 3QVNA 1U2VB 3T1YO 3LP2A 2HBJA 3ZEUB 5FPDA 5GINA 4DW1A 2HMPA 3PO5A 4M3UA 2F7TA 3PN1A 1KBHA 4K8XA 4CF2A 4Z4FA 1J54A 1J53A 1ZBLA 4H0TB 2OTLV 5DM6L 4Z4CA 3QTCA 4KFBA 4O5BA 3VQCA 3TAQA 3CQ8A 3B8MA 3AVIA 5KAFZ 4W4LA 3N4QA 4HNAA 4HUGA 3F73A 3EFFK 3THXA 4CC6A 3WXMB 3CMEN 3CERA 3A0RA 3ZHRA 3SPIA 2YXLA 1OCRB 4YNQA 4DTJA 2NN4A 2F93B 2L6LA 2OCCC 1C0FA 2W42A 4UXNA 4Q4V4 2M6YA 2H3OA 2K1EA 2YIBD 1VBA4 4CGIA 1YIJV 1D4XA 1L5UA 2RS54 2QTOA 3KLIA 3K03A 4BIUA 1GAXA 4J7KA 3H1HH 4PKGA 2E6MA 3P39A 5JVGL 3VQBA 3NBPA 3P3NA 3FE1A 1RM1B 1N32O 1SAZA 3VTIA 4ILGB 1IJJA 5CYQA 4JYAB 2KG7B 3F7VC 4YDUA 1VQNV 5KQ8A 1N34O 5KX5B 1K5SA 2NZTA 3IFRA 3TR8A 4ZTJA 3I56N 1UOCA 4BGAA 4CHQA 5FPEA 4FLUA 4YSZA 3OYKA 3LDCA 3T1HB 1KCFA 1QHAA 3L70H 1TYQA 5BY1A 1IBLO 4M3ZA 2ARHA 4AILC 3G6EN 3SYCA 2GTSA 2IIRA 2BUPA 4IO8A 1M1KW 1IBMO 1PKXA 4QE7A 1JXBA 5HRNA 1PP9H 3KKYA 3SQ2A 3KVGA 1AR94 4HHTA 1ZUQA 4UV8A 4JAXA 4BE1A 4HWIA 4B3MO 2V7YA 2JEUA 1DLBA 3B77A 4GKJK 1NWKA 2O57A 1S1UA 4YTMA 4DTXA 3BA8A 2QWMA 4HZ3A 5EY4A 1YF2A 1HMVA 3CFPA 4H13B 3X2QB 1IG8A 3CJHB 5LBQA 2WLIB 1CXZB 4LWSB 2E8AA 3SPJA 3CPWU 3AVNA 3D0PA 5DMRA 4A59A 1VQKN 4OX9O 3ABVA 4U3FH 2FYUH 4OLAA 3VEYA 1ZX3A 1XI1A 1SKSA 3D7EO 4YIPA 3MWPA 1WBDA 1X3NA 3L71H 2VWBA 4CJ4A 1S1VA 3CJ9A 2XAHA 3RYIA 4FLWA 4DUZO 1RTIA 4H0OA 2IU0A 5B1NA 1KFDA 1WSHA 3LP0A 4EHTA 4IOAL 5CMUA 3CQXA 4J9ZB 3E35A 3AG2C 5LMNO 2FF3B 3ZRXA 1LNQA 2HWC4 1ORQC 3SK3A 2WTUA 3TGUH 1F23A 4FFBB 1LW0A 1YXQA 4JHDA 1C6VA 4DV5O 3KWGA 4CBXA 3ZSWA 1KB9F 1VQ4N 4O4LA 5JQGB 3CCJN 5C15A 1Q7YW 2HW3A 1YXBA 3CCLN 3CCMV 4AHUA 4CF9A 1W59A 1IKVA 4DR1B 3X2QC 2OT5A 2ZCEA 3U0ZA 2O8EA 2Q4PA 4WQ4A 3D2EA 4JI1O 3CCVV 1HNXK 3SYPA 1ZTEA 3DLEA 1RPOA 2WLJA 5BRFA 2JEXA 2Y69B 5J9PC 2DQ3A 5C2FA 3CXHF 1P8ZA 5EZYB 2PLV4 2I5JA 1YAGA 1X9WA 2E1ZA 4KAZA 1FD9A 1HNXO 3QEIA 2HHHB 3IAYA 4JI6K 2DE0X 3OFNG 3LUTB 3TXQA 3G25A 3AO2A 2R9IA 4MTXA 1NGDA 4GNIA 1QQNA 3CCSN 1KAXA 3AG7A 4DV0O 3ZMTA 1JL1A 4IL6Z 3SUPA 1I5XA 3JAMO 5CBGA 2YICA 3CE2A 3TWHA 4NYKA 3SMSA 5SWMA 1NK0A 2FBWA 3I0SA 4JRPA 4MQ3A 3MAQA 4B9TA 3DXKB 3E89A 4Z2WA 4DCHA 4JI4B 3SAFA 1Q82O 2CH7B 1JLGA 3A5NC 3FGUA 5IJ9B 1SKWA 2W41A 1E79G 1R73A 2ZD9A 3FB5C 1L0NH 4DV7B 1G15A 2PI5A 3KWIA 4M3TA 1GK9A 1VQLN 1TV6A 4NCAA 5FPNA 1WB7A 5IJ0A 2ITGA 2NRHA 5GONA 2HVKC 1N5YA 1MG1A 3ASNC 4N41A 4M63C 3TSUA 2YCHA 2XY7A 5B5EZ 2B1IA 4QPJA 4JI8B 5JVDA 2F8TA 1AR74 3HI0A 2WLHA 1XHZA 3MMVA 2NNUA 2YI8A 4IJAA 4FJIA 3DI6A 4OVLA 3AK3A 3HVTA 1XUPO 1JCEA 3TU5A 1NJIO 1FFXB 3DLGA 4QCLA 1TK5A 1NK4A 1L0LH 4FZ1A 1RMU4 1ZWIC 4K25A 2N05A 2PI4A 1QVFU 4CEEA 4FYDA 1BG3A 3K06A 3A0HZ 1LCUA 4CHOA 4K43A 4U3JA 4LFBB 3EVKA 4LF5K 4ICLA 4JEPA 4TQDA 3ABKB 4E4EA 4LF8O 1Z26A 2JJ2G 4O5FA 3ZCCA 4Z0UA 1SL0A 2P9LA 5J2NA 1RBTA 4C1NI 4FLXA 2P9PA 3C6UA 1COV4 3M8SA 3K0SA 2KZMA 1R6TA 2JS3A 5IDJA 3QO8A 1TYQB 4H0YB 5B1BB 4DR6B 4P30A 4MFBA 3AVGA 4GB34 1SESA 4DV4K 2CE4A 3M8QA 2A1RA 2HB5A 4DV6B 2Q0UA 4IWVA 4ICGA 3B40A 3AVJA 3QICA 1IKWA 2WP9A 2CTWA 4YOXA 4K3AA 4XDKA 4U67L 2WDRA 2ATKC 4X1YB 3G71N 2WA4A 4DUZB 4DR3O 4CFBA 3TAEA 3T2MA 3VQVA 2IAJA 3UM7A 1OH5A 4KTWA 1HNXB 5J1EA 2QXFA 4FJJA 2E2NA 5HFLA 1MABG 3AO3A 1XDCA 3E2EA 1RDUA 1ENVA 3OGCC 5GAGP 4LF7B 4DFKA 1GLDG 2Z5UA 4UCRA 3RYFA 5L3EA 2CGNA 4W5TA 3J80N 2GTDA 4ZBMA 3DLHA 3AG4B 3OYJA 2VG7A 2Q8VA 2YC0A 4JKDA 4DFMA 3N2KA 4CE9A 1AJQA 3UKMA 1S76D 1G1XB 1ZSPA 3ZT0A 1X9MA 4R79A 2DFHA 3ZT4A 4A2AA 2YNIA 1QCEA 1TVRA 1H8EG 1V4TA 3QIPA 4PKHA 4WBNB 2ZE2A 4ZHQA 2E2PA 4CBCA 5DK5A 1I94B 4ZI7A 3O65A 4KP4A 2OIEA 3NAEA 3A2FA 4O4LB 3J80O 5KRSA 3L2UA 3JATB 1DLOA 1NLVA 3NVMA 4Z4GA 1Z25A 2Y4UA 1EM1A 3LWLA 3OMIB 1R084 1QLNA 4DRXB 3BP8A 1YIJN 1LV5A 3W3DA 3CF5L 1NTKH 4FZ0A 4KFMA 1KFSA 1WAJA 4MSWC 4MDAA 1B9DA 2WOMA 4F9OA 3D2EB 1NJIW 2ZIMA 2P9NB 4JI4K 4GMJB 1NZ6A 2EIJC 2BTFA 1RSOA 2P9UB 3OM3B 4BACA 5H5NA 2PTMA 1SETA 4AQYO 2CGLA 3VF4A 5EYPB 4ABMA 3WQTA 3CD6N 3JXUA 2H3GX 4NYNA 4DLGA 2A0LA 3TTCA 1X9JA 1Q81O 1KMIZ 4X8AA 4DFPA 4X65K 3O3FA 2YDEA 5AQNA 2AHYA 4TUYA 3SYAA 2IM9A 3VGKA 1HJOA 3L9DA 4KHQA 3QF7A 2KKWA 4AM6A 4LCUC 1W9HA 2F4VO 4QJFB 2QM8A 2EINC 3E01A 4MLEA 4FW1A 4WFBV 4JKAA 4YTNA 2A40A 2YI9A 4IIJB 2X78A 3ZN1A 1OKJA 1GM9A 1RBRA 3ITHA 1SQPH 3A0BZ 3QFPA 5AFUH 3THWA 1BSMA 2ZQBA 3VEVA 1E1RG 4CH3A 5IJ9A 1U4BA 5ADXA 1QU7A 2XAJA 3OUFA 3DXMB 1ZOYA 1T05A 4FW2A 4CEFA 2GBZA 5A2QO 4YHHK 2YIBA 5DEDA 4CBWA 1F4NA 5BR8O 3CCQV 2DJVA 4JYAO 4H5TA 5JS1A 1KP3A 5IJ0B 1CZAN 2ZM6O 1N32B 4Z1VA 3HL8A 2FSKA 4CW7B 5EBMC 3DMJA 2RF2A 2Q68A 3A5MC 5D5QA 2V1DA 1YI2V 3VEXA 2EX3A 3V4IA 2FL4A 2X7RB 2W6KA 1GLJO 1N8RW 2QWOA 2HHWA 1X4TA 2LGWA 2UXDB 5AZIB 4GX5A 3JYTA 3S3WA 3O08A 4BE2A 2UXCK 1RM1C 4XH1A 5CZ2A 1NK7A 3ZSXA 1FJGO 1KLNA 4R7CA 3HPLC 4DV2B 1B3QA 4NVPA 5KTQA 4OXSA 1BISA 2EULA 5LMUK 2YHWA 4HNAB 1BIUA 4E3SA 2OZMA 1SZXA 1QZ6A 1RGIA 2W0FC 2VG5A 3UIQA 4X64K 2CGKA 4G9ZA 3TETA 1YTAA 2VQEK 4F4LA 3LANA 3VRBA 4MW3A 5KHJA 4F2RA 4ASUG 1VF5B 1KUQA 4B9MA 5JS2A 2QK9A 3JAWA 3F9KA 1U96A 1SZ2A 1YHQV 3CQYA 3QDKA 1FW6A 4CCHA 4DV1O 2HHSA 2AGAA 1WA8B 1EN6A 3I8DA 2PBDA 1X59A 2Y1JA 1N4CA 2R7YA 5F2RA 5C25A 2H8PC 4LFBO 4E89A 3HPHA 1PNMA 1TUBA 4LF8B 1K7DA 1Q18A 2Q0AA 4CIGA 3OYAA 3CXCU 5KX5A 4YHHB 2UXDK 2QM4A 1XNRK 1PNLA 3W7XA 4LSLA 3D2FA 5BN9A 1GKFA 4DV0B 3AK2A 4IGGA 1HR0B 3H6EA 2E5LO 3VPZA 1URFA 4WFAV 4J8FA 1F4MA 1BL8A 1Z5VA 4E19A 4ELTA 2WWWA 3VOUA 3K04A 4WBNA 4A62A 2ZE6A 2XASA 1KP2A 2G8FA 1VSJA 1I5YA 2P9KA 4KV8A 4BWJA 3ULDA 2D4WA 2LW1A 1XL4A 1JLFA 4CIEA 4DV7O 3W7SA 5JMVA 3VEOA 1FKAO 1WSEA 1NKBA 4LF9K 5LGTA 1NMNA 2ATQA 1C0MA 4I0XA 4BRQA 2JVDA 2HOEA 3C6HA 2GWKA 4KX6A 2MW2B 4L87A 4CGFA 1SL1A 1AP6A 1NT2B 2ETJA 3MEDA 2E4LA 1DKGD 3HJFA 3K9JA 1GM8A 3VQQA 4G1QA 4DR4K 2WLIA 4LWSA 1VF6C 1ZXOA 4OPKA 3HO1A 1ZYQA 1NI8A 2Q7HA 3T1HK 1GLFO 3VENA 1NGFA 1HYVA 2BCCH 4TT3G 1WSFA 2P4KA 5C3JA 1QHTA 3THXB 1L3TA 4O0JA 3JD74 2CDYA 2QE7G 4DS4A 1N36K 4MVQA 2BANA 4ILHA 4LF4K 3TSQA 4JV5O 4X20B 2BH1A 3H01A 4B3SB 1JLQA 3WNEA 2ZE7A 3U3GA 1K97A 1NK6A 3WU2Z 3NE6A 4MW8A 5FPOA 4B3RB 4FWOA 4CF0A 4JI7K 5JCOC 4I50A 1QSSA 3S3NA 3N2GB 4NXMK 1IBKK 1GM7A 3SV3A 2JGDB 1QSYA 1BA0A 2V4DA 4JI5O 3ZHVA 1OHHG 3KTQA 2OCHA 1LAVA 3L2RA 1D4M4 3AE3A 1VARA 3MDQA 3BY6A 1M9NA 4KXRA 1M93A 4CEDA 1BOTO 1L1FA 1W2BU 5J2MA 3WG7C 1M56B 5IWAO 3EHBB 2BE2A 4FJMA 5AQLA 3SAHA 2GV9A 4BC3A 3APQA 5B3SC 4M3WA 1Q6HA 1SV5A 4DK0A 2UU9B 4CESA 1CPYA 3AEGA 4LFAO 2ZR2A 3SR2C 1L3VA 1H2GA 2HBMA 4DV5K 2DOSA 5ITZA 3SYQA 1H2KA 5CYMA 3C3TA 3THOA 2Y1IA 4RW6A 4B9LA 5AQGA 3RT3C 3ABMB 4XH4A 3THVA 2HNDA 5LOVA 2AP1A 2P9IA 3OYIA 3G4SN 4EAHD 4DV6K 3V81A 2O8FA 3SJQC 1NOYA 3AAPA 3SGIA 2OPSA 1RILA 4B1WB 3CJHA 1XWLA 4JS5A 4NTYA 3SPCA 3EYZA 2QEXN 2CAZC 2WFBA 5CA0A 1NNEA 4CJUA 1EWRA 4A2BA 3UB5A 3K5MA 3E9LA 1BU6O 4FPBA 2O4GA 1E4FT 4Z94A 3K59A 5BRDA 1N6QA 4JKEA 4B3SK 2DWDC 1JLBA 3R6MA 5M1FA 1NENA 4EZ6A 2Q0RA 4LFCB 4KO0A 2E2QA 4KHSA 5BPMA 1DTQA 4YJ2B 1S1WA 3O4WA 2P7TC 2ACZA 3OGIB 3R66A 4CIFA 2JRIA 4G28B 4MVZA 3B8AX 2HSTA 4FSVA 2ETNA 2F43G 1WA8A 2X0LA 4FFBA 1VSMA 5CY4A 1U48A 3FFKB 4O44A 2FLOA 4FWKA 4K0KB 5KPZA 1VQMN 1HNZB 1FXKC 1J5EB 3HBTA 4DTRA 4YSXA 1HRHA 4BAYA 3LDEA 3LSSA 2Q7EA 1C0GA 1C1BA 3QMLA 4B8AB 1XNRB 1Y74B 1HWYA 4JKBA 2LGQA 2WONA 4NXNK 4RTFD 3CJCA 3OEEG 2UUBO 2GX9A 1M1KO 3L75H 4CD3A 3FZHA 2ZT9B 3KZBA 2Y4TA 5LMUB 4P2ZA 1YTFB 2OPRA 3EN9A 4YOYA 2OA8A 1AR5A 3W7UA 1M90W 2XT9A 3CRQA 1W7AA 1RUI4 5LGNA 3AGRA 1VSHA 4DF4A 3O5BA 4PI2A 5L3DA 3I8BA 2ZR3A 3CS5A 2J4RA 3AVLA 4LF5O 1RTDA 4ISEA 3VQAA 3NVKA 4JKFA 4UCSA 4B9QA 1E4GT 3QFUA 2A6AA 1EFRG 3I0RA 3DXKA 4FM0A 4DTOA 3HRGA 4CEQA 2B5UA 3JSNA 1RDBA 3B6OA 1KYOF 1GN2A 1IKXA 5B66Z 2YNGA 5AQUA 2O8BA 4JI2O 1RT1A 2KLAA 3R3LA 4DR5K 4IZ9A 3SYOA 1XOUA 5JCOA 2D0CA 2HEPA 3OTOB 1YITV 2F4VB 1T6DA 3JS6A 4KPYA 3CMAN 1IG9A 4ZKIA 3BZKA 1WPBA 4JV5B 1FS0G 5GONB 5AQKA 2ZD1A 4PDMA 3LAMA 4LFCO 3VF2A 1BCCH 4CH5A 4FWRA 1IH7A 1O9GA 4CEBA 2HBKA 4I50B 1HYZA 2IW5A 1BT8A 2QKCA 3AG4C 2ZF5O 1QNMA 2X5ID 1UA1A 2G8UA 3FFIA 4AHCA 4LR3A 1FFXA 3MCPA 1K4CC 4DRXA 3HVRA 3EE9A 4FWNA 2XTAA 3DXRA 4FK5C 3C95A 4KTZA 3OT7A 3JYCA 4Q6GA 4LC1A 1IZ3A 1IKYA 2KSDA 1VQ5V 2LSNA 1OVQA 1SKRA 1IBMK 2H89A 4M3RA 4CZFA 3K79A 4DG1A 1OCOB 2P9LB 3M3ZA 4K0KK 2P9PB 3NH0A 2HWB4 3RYHA 2IH3C 4WCEV 3WQUA 5EYPA 4DU3A 5AQSA 4JTDB 4GKJO 2X6BA 1BL3A 4BR2A 4C23A 5CA3A 3IFXA 4K35A 3IG1A 4JKCA 4O0IA 1XILA 4TUYB 3CCEN 3U9ZA 4M3XA 4UCOA 5DM6V 4QS9A 4CJ5A 2CUGA 4F6EA 4FL9A 3IGAC 1P84F 1VMGA 2WU2A 1V54C 1K9MO 3HPOA 4TSFG 4EFBA 2YEVA 3G71V 1VRUA 1A5XA 1ZBHA 2Q9LA 1EX4A 4H0PA 1N33K 1GLCG 4BROA 5M1KA 1ASUA 3A8TA 3JALB 4IIJA 2RKIA 4CZIA 5CA0B 1TL1A 3JD0A 3K2PA 4B8CA 2QWNB 3RYFB 2EZPA 4CJWA 1DEJA 1KD1W 1NTZH 1VQPN 2YS8A 1VQ6N 3SPYA 3L6QA 1SQQH 2FMLA 3SQ1A 3AE4A 1XNQO 2YHAA 1MU2A 3P31A 5AQFA 3JCZA 3H1JH 2ZGZA 4YJ2A 1UPGA 1AB3A 2V52B 1SQVH 4YOUA 1CXUA 1HRI4 3ISNC 3JCUZ 4C8LA 1I94K 3SQ0A 1VEWA 1S1XA 3UKUB 3AEFA 3AV9A 3F5WC 1K5QA 4CFDA 3CC7V 4JI1B 3S3XA 5C0YA 2FBYA 3ZT1A 3U10A 1HR0O 2OYQA 1AVMA 4DQRA 1X9SA 1J5EK 3H1LH 1DF5A 1NKDA 3DRSA 1Y74A 4L8JA 4YIOA 3ABUA 4MVMA 3CI5A 4H5WA 4IFVA 3GL1A 5AQHA 2P9NA 2Y48A 5BZBA 4KREA 1NG9A 2RM24 1VQ9V 5C8YB 4DKWA 4LF7K 1VBD4 4F6RA 3QB0A 2UXBO 1RDAA 4FJXA 3OA9A 3AVCA 3BFRA 4PDWD 4JI5B 3OYEA 4B1VA 2Z1JA 3FZFA 3LDDA 2KB1A 4JI7B 2P51A 4B3RK 1B06A 4BQZA 2F66C 4KUMA 1UFIA 4ELVA 5EC1C 1UJWB 4PA6A 2YSUB 3CCUV 5HL7L 4QOZB 3RMCA 4PA1A 1K4DC 3AVHA 3CPEA 3OTOO 2UYTA 2Y69C 2GUZA 3SYZA 4K8ZA 3VMFB 5KRTA 2ZNJA 3S9HA 2G8IA 1S1TA 3J81O 4DMNA 4RW8A 1N34K 1FXVA 1WBBA 4B3OA 1Q90D 3GWOA 3D3IA 3HKDA 1MNGA 2E3CA 2F96A 3BZCA 2QA4N 1IURA 3M6GA 1NEKA 3O1WA 1RUE4 4GT1A 1KLMA 3FD9A 1BEV4 4O2AB 1AJNA 5AQMA 3FX7A 1YJWV 1TUBB 4F8RA 3RBZA 5HRRA 2XAGA 5BN8A 2XNDG 4E1MA 1XQ8A 3FB6C 3NF8A 3HP6A 5AQZA 1Z05A 1S72N 2RE2A 4B1YB 2IU3A 3ENOA 4DO2A 3VQWA 3NDKA 2VGNA 4CK2A 3P4QA 3E83A 2YUAA 1AR1B 4LBEC 1ASWA 1LWFA 3LDLA 4B3MK 3QEXA 1XC3A 1AP5A 2IVPA 4DSIA 1S22A 3SPHA 2G8HA 3P4IA 4JAVA 5JH7A 1VSKA 1IV0A 2HHHO 3ZMUA 2P9KB 1F51A 2DW4A 4O4IB 2W6LA 1KQSM 2NNWA 4LFBK 1YI2N 1R6KA 2QWOB 3K0GA 3RYCB 4TV9A 3GE1A 4AQYB 3OVNA 4BRAA 1B92A 1P7GA 3TANA 2UUAB 2JS5A 3DXRB 3FYIB 4KB0A 1LAWA 1Q9XA 3LM2A 3FR0A 4BR5A 1HYSA 4JPRA 1IBKB 3UT5A 4IG3A 3D8CA 1I39A 4JNEA 4R6ZA 2QWLA 3R1XA 5AQOA 4I55A 4YJ3A 2ZJRL 2Q3SA 3EO3A 5L3CA 3U8XA 5JICA 4N5SA 4YY3B 2KKZA 5LMNK 1NGGA 1FYJA 3WB2A 4KL1A 5CB4B 1YT3A 4PA4A 3CJAA 2Q67A 4PV1B 3SAGA 1SQFA 4IDHA 3JAKB 4H37A 1NVPB 1HJRA 3HM8A 5TKWA 3V9SA 4LF9B 4KHPK 3E8GA 1THZA 2IH1C 4DTPA 2UUBB 4CBUA 2QW9A 4OKJA 3TJTA 1Q6UA 3TABA 1KRPA 1GOAA 4CJVA 4BRMA 1VQON 3CCRV 3WUHA 2AHZA 2YIAA 3ETEA 2Z1IA 4H4OA 4CZEA 1OCCC 1SF9A 2XY6A 2F23A 3JALA 1HNWB 4G27B 4WFGA 2A42A 4BVOA 3KIOA 4ILJA 4EZ9A 1ASJ4 1H8TD 3C7NA 1S6QA 4JI3K 2R9RB 2MK3A 5AQJA 4DV2K 2QWNA 1MZEA 2ZE8A 2RMKB 2IJKA 3ZSZA 4IT5A 4FO0A 2QTDA 1N36O 3LDPA 2GBOA 3VQ4A 3KHYA 2PF4E 5B8HA 1H1VA 2OIGA 1HQUA 4CS4A 4JI6B 1RDCA 2QWQB 4RWUA 1OV9A 1HKBA 3JSMA 3PX6A 1US6A 1IVSA 2GELA 4H0VB 3TTDA 1SQGA 3E8HA 4DR7K 5ITZB 5LYJB 3PY8A 2HVHA 1BWFO 2W0XA 3SBTA 3QBWA 1PIV4 2EIMC 3KKSA 1SA0B 4DTSA 1NGCA 2VCPA 2C2AA 2XY8A 3J7ZO 1JA8A 4A61A 1RUF4 4D7TA 4KHWA 3IC9A 2O8FB 3TARA 3ABLB 4FLYA 4O4HB 3L2WA 4XBFA 1ILYA 4BR6A 2B4JA 4XIUA 3LP3A 2ZXWC 1GLEG 4WQ5A 1T8EA 2Z0AA 5EC2C 1H2MA 3STLC 3FFQA 4LFAK 1PO14 4E1JA 3VR9A 2PUSA 1NGBA 3P30A 5KHIA 3BGRA 4JZGA 1W2BM 2IDOA 1VQ8N 3C65A 1EAH4 4R8CA 4O4GA 4X64B 4M7XA 1HXS4 4N76A 3QEVA 4FWQA 5I9EB 3CC2V 3PJSK 4LFAB 5J2UA 1AI4A 3AVFA 1BI4B 4O4JA 4YT0A 4CFCA 4D7SA 4PA7A 5J2TA 4LH6A 1S3XA 2JIZG 3N2GA 1WUAA 4RG8A 1XMQK 2A5XA 3ZSRA 3NCIA 2O8DB 5AZJB 4J41A 3SFDA 3HKEA 2FSJA 4NXNB 4FXDA 4CI6A 3T3FA 4MLHA 4IHJB 1BGXT 2NR5A 1VQ7V 1H2NA 2P67A 4WFEA 5LXTB 3LL3A 2QI2A 1Z6RA 4JK7A 3H9VA 2RNBA 3ABMC 3U6FA 3DLRA 3MN7A 1MZFA 3BEXA 3T1YB 4R5PA 1XMOO 4UVCA 1MWKA 2JDIG 1QE1A 1S3JA 3SZ2A 1AI6A 2QWRB 3ZRVA 1QLEC 4BRFA 4I9WA 3S41A 3V6DA 3VEWA 4EHUA 5JH7B 4B9UA 3AEEA 2WLKA 1BQZA 3VR8A 4I7FA 4W5RA 3C90A 1NKEA 4BRIA 4DR6O 3KK7A 3V9WA 4UUJC 1JQ0A 5IY5B 2IGIA 2Q0OC 1U47A 2B6AA 2O4IA 1SZTA 3K9KA 2ASMA 1JLCA 4KH5A 4CZJA 1VSLA 4DK1A 4X62K 2FXUA 3PUFA 5CA1B 1SS3A 3IS9A 3L3VA 4BREA 3E22A 1RT6A 3B4SA 3ZT2A 2IVOA 3CM6A 3HSTB 3CCMN 4MVOA 3I55V 1V54B 3J7YP 1FFTB 5BXZA 2HHQA 1R3JC 3CETA 4I2QA 4B3TO 3MK6A 4J10A 4FZYA 2XOKG 3G10A 4XDLA 4FWLA 2VQFB 1N0JA 5KGWA 4DV3O 1DGSA 4NO7A 1SC5B 2F95B 4YSYA 2ZM6B 4U7BA 3R8EA 1XNQB 4RWTA 1YJ9N 2BTOA 4TOIA 2IBZH 1W0HA 4ID1A 4OX9K 5LL6Y 2LQTA 3DM2A 3NHGA 3STZC 5LP6A 3AEBA 3CCUN 1JCFA 4JI4O 4RW9A 1YCIA 3C7NB 4JK9A 4BRDA 2BTQB 1ZC6A 2E1YA 4CZHA 1Q81W 3UE5A 4AQYK 3IUCA 5DECA 4U7NA 2Q6AA 4M45A 5KHKA 1Q5OA 1N8RO 4Z1MG 3DSQA 1Z5WA 3O8MA 4NB4A 4CGHA 2WDVA 2ZINA 4QE9A 3B8NA 4DB3A 2HVIA 1MQTD 3OE7G 4GYCB 3ZCMA 2OCCB 4J9YB 4LF9O 3B6PA 3K5OA 4RW4A 3UKRA 3ID6A 1K33A 5LYJA 3QNEA 1UWBA 3ABKC 3PSIA 1A5WA 5HRPA 4B1UB 3P1GA 4IO9L 5KUMA 4UB8Z 2XHBA 4DR2K 2E74B 1HLUA 1WN7A 4IFEA 5B1BC 3TAPA 1HNZO 1BQNA 5E84A 3VA0A 2EHGA 4C1NK 4AF1A 5D5PA 3MXMA 3LWMA 3U11A 4E0DA 3JD3A 4LNUB 4I9QA 2IVNA 4I5SA 4TWKA 4GZRB 1N34B 1RT7A 4KB1A 4X1KA 3W0LA 3NH1A 2KQXA 3P5JA 1M4UA 1A5VA 1RUJ4 4CHYA 4TV8B 1KU9A 1PL0A 3D36C 1R6NA 1YTFD 1QQCA 2JJ1G 5BRHA 5J2PA 2OTJN 3RYIB 2RN9A 4WF9V 3HSCA 3HT3A 4DV0K 3RRGA 3BEHA 3CMEV 4CECA 4FJ8A 4NXMO 2HVJC 3ULEB 1FPOA 1YITN 1NU1H 1PV0A 1BQ0A 1BI4A 1NOZA 1RDDA 3OBWA 2IOCA 2ZJPL 3ZMSA 2Q97A 5E26A 5A9GA 4JI5K 5TISZ 3JD2A 3SJBC 1J95A 5FRMA 1MMMA 4PDVA 4UCTA 1KC8W 3UKUA 1N33B 3AEDA 5K14A 3FB7C 3CIPA 4FJKA 1EXQA 1FAFA 2KTQA 1RHI4 3MN9A 4WYBA 5AR0A 5AZJA 4GX0A 5KHGA 2A9HA 3O9OA 3KK3A 3BABA 3K58A 5BR8B 5IWAK 3MHSC 4CHNA 3HK2A 2GDSA 1JCHA 1ZBSA 4IHJA 3LPTA 4EKWA 2Q73A 4EP4A 3ZSYA 4F3TA 1JXEA 3CCRN 3SUNA 5LGUA 5AQQA 3CJ1A 3G6EV 3O9UA 4WFFA 1VHXA 3V1QA 2VQEO 3OBYA 3AY9A 4CJTA 1QVGM 3T69A 1K8KA 1JR9A 5HOOA 1M90O 3ETDA 3RN4A 4Y1DA 1AJPA 3RYHB 4BC5A 4ZTFA 1KXPA 3CEIA 4BDPA 3O9TA 2BSKB 3CRMA 4FLVA 2ZJQL 4J80A 3ZMVA 1IBMB 3VA3A 4GX2A 4A5AA 4NLBA 1KTQA 1P4RA 4OPAA 3RMDA 4CH6A 1K92A 1U2VA 5ELZA 1QTMA 2QKKA 2W40A 1GN4A 4LF8K 3BDPA 5IYDO 1ATNA 2LFSA 3OR6C 3E86A 5CBHA 1VQKV 2PZSA 2W6JG 3HKDB 1SS6A 3O1BA 4Q20A 4CHPA 4IEIA 3E22B 5H2FZ 4Q4W4 1D9DA 3K9SA 5LHHA 1EWQA 3O4QA 1ATSA 5HRSA 4BQLA 2ASPA 2CH7A 3E8FA 3ZX0A 3J8F4 1O13A 4NR1A 2X6SA 3ZHUA 3W7WA 4DSFA 4NKGB 3NR7A 4DYLA 3JD1A 5FROA 2RN2A 1GN6A 5T7BA 2EJ7A 4X1IA 3AEAA 2ADPA 4BVPA 1RTHA 1P49A 3CYMA 1NH2D 3O6WA 1F7YA 1VQ4V 3MEGA 3DWLA 2M7WA 3CRCA 1PPJH 3MX2A 4DUYO 3OYNA 1HX1A 2FBVA 3J8AA 4YY3O 2PYLA 4DR1O 3LDQA 3RMAA 4JAUA 3CC2N 4NB5A 3T1HO 4RUFA 3CCVN 5HROA 4FOEA 1RFYA 2UUBK 1ZP0A 1OCCB 1S5HC 1D8YA 2HHTA 4GVMA 2EIKB 3OJSA 3RWRD 5AJ3K 1XHXA 4U3JB 1Z2GA 1C0UA 4X65B 3J81N 1TKZA 3PV8A 4KRFA 3TAMA 4ELUA 4A57A 1HW7A 1RFQA 2GEMA 4KBOA 1XC9A 3O4NA 4FWMA 1LW2A 3AVMA 4HYOA 4DQQA 1QQOA 3CP1A 4DV3B 4IDKA 3UKRB 5CB4A 4H5RA 4KKOA 4JI7O 1F21A 3EE8A 3LPUA 5M1NA 4E7LA 2O8CA 1V55C 2AXTZ 5EU7A 5AQWA 1OCZB 1VIBA 2UU9O 1C1CA 3OMNB 2KW4A 3MX5A 3AK1A 4WQ5C 3CM5A 3ZMZA 3V1OA 5BREA 4KH6A 1QVFM 3P3PA 5KI6A 3DC6A 3THYA 1P7BA 4O8KA 3DGEA 4C7UA 3OUSA 4JS4A 2NRTA 5JLFA 3OD4A 2D0BA 4I4TA 3T4ZA 3TI0A 5LP6C 2Z1HA 3ZBHA 1FK9A 3WXIA 3EY1A 4LF6K 1Y97A 2N74A 1RT3A 3CX5F 4PL8A 1VK0A 4JAAA 4LH7A 4PJ0Z 4O2AA 3RWUA 1AR64 1GH6A 1BHLA 4DTUA 2ZNIA 4X1KB 4B3MB 4BRGA 3BCCH 4CGGA 1WSJA 1H38A 1P90A 2HLDG 5GADP 1U6ZA 4LFCK 3FZKA 3CRAA 1I0HA 4NTXA 2QXLA 3CB2A 1Q8IA 1OJHA 4ID5A 2WU5A 1LWEA 1Y6XA 3BPZA 4E7KA 5L3GA 3QINA 4W5NA 3K0DA 1DK1A 4JD2B 3ZHTA 5TKYA 4DU4A 4NCBA 4FPAA 3NH2A 1R3LC 2CTRA 3LDSA 1AROP 1W0KG 4DV6O 4CEAA 3K5LA 5IYZB 2Q1NA 1K3EA 4X66O 4J11A 2LO1A 1IBLK 3OJUA 4FZXC 2OZSA 1WAFA 3DLBA 3WG7B 3QEWA 1HPMA 2PY5A 4WCEL 1TKDA 1D5AA 2F8SA 4BIOA 1OCOC 4AI8A 5HBMA 5IT9O 1U45A 4QIWF 2UXBB 3U9DA 2E75B 3M8AA 3RYCA 4YHHO 2FF6A 3I33A 4FK2A 4Q4X4 1QVGU 3ZHSA 5IWAB 1BZKA 3ZETB 4GKKB 1W0JG 5BR8K 4N21A 1BQMA 4QAGA 3OW2M 2YI1A 4CEZA 1FKOA 4O4HA 3RMBA 4V19S 1XEQA 2NRVA 4RUEA 1JX9A 4DV5B 3KLFA 3UT5B 4H0LB 1IX9A 2BOCC 1TKTA 4QS8A 4I55B 4YJ3B 3C6TA 3FAVB 5CN0A 1RT4A 3U4LA 3ZX2A 1U49A 1TAEA 2EZOA 2YHXA 3N27A 5C10A 4Q5VA 1ZBIA 4RHV4 3AE2A 3ZJZA 4ZIBA 4OPHA 3MXIA 4JI8O 2UUAK 1H2LA 4YFUA 4YXWG 2CTPA 3JAKA 4BRPA 4BRKA 3I5DA 4JKHA 3WT0A 4L3QA 1OH6A 2G8VA 3VERA 1QR9A 4E7IA 2A3QA 3SI6A 2P9SA 3KLEA 1LR1A 3I56V 4B3TB 5C42A 1XL6A 5K1XA 4BGBA 1BUPA 3TPQA 1HNWO 1QZ5A 4JRQA 2D3OW 2D0PA 1QS4A 3H45C 2CH5A 3SJHA 1K5MD 1VQOV 4LC9B 3ZSVA 1XNQK 1VF6A 4J7JA 2QSAA 4BG9A 2A3ZA 2FSNA 3CC4N 1YVUA 2EIKC 2DWEC 5D3GA 4X62B 5FPRA 3DXMA 3VQDA 1J5OA 4GKKK 4L8RB 2VG6A 3PIOL 3RTVA 4LD0A 3P32A 1XQSC 4E7JA 1JVMA 1RNHA 2ZIOA 4PD4F 4DV4B 1SUQA 2QWQA 4B9NA 3IRXA 4JK8A 2RDCA 4JI1K 3PIPL 2A1SA 3A0IX 3U3YA 3ETGA 3RSEA 3VQ5A 1IBLB 4HAMA 3SFEA 4HUFA 1HKGA 1V55B 3CPWM 1PD3A 2FKXA 1TUUA 3KKRA 5IYCO 1FKPA 4AHRA 5LJWA 2FBTA 1XMQO 2DYSC 3SQ4A 3HB3B 2WLLB 1XNRO 2VQFK 2HF4A 1SA0A 4J2DA 3IDHA 1NS1A 3CFOA 1JKHA 2UXBK 4YDUC 4JYBA 4JI2K 3QO5A 3CFRA 5CA1A 1ASVA 3CD6V 4B3RO 1VBE4 5CHIA 2BE3A 2R70A 5AQYA 3BF1A 2LFRA 5DM7L 1QQMA 4XH5A 1M57B 2PAVA 4A5UB 4MO5A 3SDLA 4MVRA 3CJ7A 1T7PA 3AE1A 1B6QA 1IDSA 4PA9A 4UCUA 5FL7G 2NRZA 5AQIA 1JOYA 4YOVA 1RTJA 2X6AA 3OYDA 3JBG4 5HLFA 3CCLV 5EIBD 1LUVA 4X1YA 1Q82W 4DTNA 2RJZA 4HCCA 4PHTX 3TCUA 5J2QA 1HDJA 4FJ7A 2ADQB 5J2UB 1VQ8V 4WE1A 3THYB 2HMIA 4UV9A 4NYFA 4U7OA 4DHYA 3ZIAG 3G6BA 3KZIZ 1WP7A 1RUH4 2QM7A 1X3MA 3S3OA 4LP8A 5LP6B 2YJEA 3ASOB 3VF6A 2O8DA 3H1VX 3HZ6A 3T1YK 1JCGA 4IYHA 4DQSA 3GOIA 4CJEA 3HKEB 5KLVH 2BTQA 4H4MA 3ZS8C 1I08A 1RBSA 4PDLA 4JV5K 1V4SA 2BDPA 2GWJA 3EZWA 3AE7A 1RVF4 3D2FB 1RUD4 5FRNA 5LXTA 1YJNN 5EIBC 1Y76B 1NU0A 2G8KA 2DYSB 1O1WA 3EZ5A 3ZX6A 4UY8O 1VQ7N 2HHHK 1AILA 1JLAA 4DV3K 4FWSA 4H8KA 3LM9A 1XMOB 2L35A 4FMTA 4JD2A 2ILMA 3R9PA 3FI7A 3SCXA 4ZHQB 5EX5A 3E8BA 3L0QA 1AI7A 3P4SA 2QGNA 5IYZA 3VQ7A 3LP1A 3OS2A 1M5IA 4ZHRA 1NM1A 2WAMA 4MS2A 3ZN0A 3F9MA 1PO24 3JATA 1MA9B 3O9SA 4TQFA 1SQBH 4DV4O 4KI4A 4BR0A 4BE0A 1EN4A 3AEIA 1NR1A 1SQKA 4I0XB 2UXCB 2VQEB 3M8PA 4B9VA 3AE9A 4GCZA 3QO7A 2IC3A 5IE9A 4DR3K 4CJKA 2EJRA 1G99A 4WQ4C 1H2SB 1QSLA 4FJ9A 1KVBA 4LH4A 1RSOB 2P9UA 3O9QA 3RVZA 2V7QG 2HNYA 3FAVA 2OPQA 4DR3B 5F1XA 1BO5O 3KCYA 4TV8A 5CBFA 4KH4A 2BGGA 1Q86W 1WP8A 1EQYA 3N4PA 3QG5A 3D45A 1ZBFA 1QLEB 4X20A 2RCVA 4DQIA 4DR2O 1J9AA 2R72A 4C8NA 2BOBC 3M5RA 5CZ1A 3ULEA 2HKOA 3MWTA 1L0VA 5CE3A 1HNZK 5I3UA 1NGHA 4GY2B 3TAGA 4RQEA 1I3AA 1REVA 2HHVA 2KFNA 3O80A 5KMGA 4G2KA 5BPLA 3RFRA 5LL6Z 2E2OA 4CK3A 1YHQN 3ZX3A 1XUQA 2AZ2A 3VRAA 1YJ9V 1BS3A 2WQYA 1FXKB 4CJRA 1L3SA 4UB6Z 2RS34 2YXHA 2D0AA 2RMU4 3T1CA 4IOXA 3ZRWB 3F2KA 2YIDA 5KA6A 3SV4A 4ZOLA 3DTUB 1NR7A 1JFFB 3VGLA 4J7ZA 1RPRA 3OY9A 3H1KH 4JI3B 3KCXA 4JKGB 1NMDA 3CRRA 4GLXA 1OVYA 3CIRA 1K8KB 2R9AA 5EBLC 1GMGA 2CGJA 2G8WA 3RSEB 5C12A 3KK1A 1VBC4 4BR7A 1NK9A 2BSKA 4PDRA 3DLLL 2DN9A 3QBXA 1YVWA 5LY3A 2P5OA 4W4KA 3ZLJA 5KA5A 2R044 4JI2B 5CR4A 3CHWA 3OEHG 5F2VO 5EK0A 3BA9A 4X65O 4DQPA 2WLNA 2EILB 2YNHA 4PHZA 3P4PA 5LOVB 4NXNO 2P9IB 3IMXA 3NGYA 2I7PA 2YX6A 4AHTA 1GLAG 3DRRA 2VGMA 2QKAA 4K41A 3ASOC 3SPZA 3TK1A 2Q36A 4CZGA 2XY5A 2N04A 2F9WA 2QJ1A 4LNUA 1HUXA 4MVUA 2HJDA 3WEEB 3AE6A 3ZRSA 4FM2A 4JYCA 5H6QA 3APOA 3QESA 2EINB 4MTFA 5JWPA 4ISGA 3AA5X 4BDZA 2QKBA 4BW9A 2VYPA 1NVPD 2YNFA 1T44A 5GIOA 3V1RA 1Q3EA 4JTCB 3UO2A 3VETA 5FLXN 3SPGA 1BE3H 5GW7A 3ALYA 2X6CA 4JF3A 2DYRC 4B1ZA 1NGEA 3QEPA 3H3NO 1GRJA 3QO9A 4H5VA 2OTJV 3JAWB 3OTFA 3MEEA 4JLHA 3ENHA 1G8MA 3E9PA 2E6LA 1TK0A 1HP8A 1TUEB 1IXMA 3QIOA 4Z4EA 3HXMA 4P9PA 3MN5A 4KTQA 4PI0A 4H33A 5ADXH 4DTMA 5KPRA 1TAQA 1UAXA 1RT2A 3LAKA 1BCOA 4KHPO 2WLMA 1JPXA 2R7FA 3GDQA 3KD1E 2CK3G 4AHSA 2NRWA 3OYLA 2UXCO 4NTWA 5C2TA 3DRPA 3H1QA 3M8RA 3NFAA 1Y76A 4YORA 3CG7A 2Y0IA 5FNVA 2X6NA 2ITDC 4OKKA 4DR6K 3JSLA 1VF7A 1D5NA 3RVYA 3AG2B 4NXMB 3AECA 4Y1CA 4BRLA 2P90A 1ZBUA 4JI0O 1KQSU 3QERA 1KECA 3VGMA 4BC4A 1KD1O 2O8CB 1NA1D 3ATUA 3H08A 4X62O 1MWMA 2EWSA 4IEEA 5GAHP 3PLAA 3FZMA 3J7AP 1EV14 3SUCA 1T3VA 3NGZA 1LWCA 4X64O 1EZJA 1HKCA 1VSFA 2RHKA 3AA4A 3F7YC 2QWPB 4FCYA 2KZZA 1BGYH 2OCEA 3HM9A 2QDOA 4FJHA 3K9AA 2Z3YA 4I4TB 4EFHA 4K0KO 2QM1A 2H88A 1FXHA 4EB6A 2R074 4B9SA 4C8OA 2YV0X 2HF3A 4FJ5A 4DV1K 1E3MA 2UUCK 1EP4A 4B3TK 5IT9N 1WLEA 3L73H 2WUSA 2DTUA 5HP1A 3K3WA 3B2EE 4LF5B 2QEXV 4HVJA 4WFBL 2O8BB 4CJ7A 3VEZA 4CZZA 3PX4A 1YQ4A 5LA6A 2KFZA 4OKEA 3VQ9A 2UXDO 3KG2A 4LF4B 5GTIZ 3OYHA 1OCZC 4CJ3A 4X1IB 1WAZA 3RGBA 3DOLA 1SL2A 1VQ9N 1POV0 3SNNA 1JMKC 1KVCA 3WXJA 2IS3A 4BDYA 2V51B 3GBTA 5MLCQ 2E5LK 4PELA 2CH6A 1TK8A 3RW0A 1D9FA 5AG2A 1NJXA 5A2QN 1BA1A 4AM7A 4PL7A 3RR8A 1QR8A 4DR4B 1OH7A 4MO4A 2JGDA 3M7MX 1PM9A 4IG0A 1O9HA 3VQXA 4J2AA 2PFUA 1IXBA 2W6IG 2AJQA 4CFAA 3HKCB 1JL2A 3ZETA 3HR0A 4DV7K 4FWPA 2R064 3FB8C 3AARA 1WOQA 3ID8A 1A32A 5IY5C 4NLCA 5AFUA 1JFFA 1FJGB 2F9TA 3LSQA 5E41A 1NH2B 3HPGA 1RUG4 3UO3A 1I94O 1GLLO 3EL2A 4I2PA 2ZE5A 1XMQB 1KAYA 4LF6B 3JASA 1N0NA 3T4DA 3MCAB 3EEQA 5BR9A 2A79B 2H94A 4DUYB 5H6RA 5LHIA 3HOSA 1S9GA 2RS14 5EOYA 4K42A 1HR0K 3Q4HA 1HPZA 3W7TA 3QNOA 4LF4O 3ZSQA 1R0AA 4H5NA 3RR7A 5B1AB 3G67A 2VWJA 3OAAG 3M1FA 1TUYA 2YEVB 2AW9A 1V9PA 1Y4MA 4BIZA 4LF7O 4CGJA 4WFAL 3J7AU 2XAQA 3GWKC 1DTTA 1G4YB 3JARA 2NLJC 5LJVA 5DN6G 1WLJA 2A41A 5FPMA 5AQPA 1XREA 4HCBA 5F0XA 2D0OA 1GOCA 3P4RA 3GQHA 1XMOK 2GSMB 1S5JA 2B76A 5KHHA 1ZAUA 5KQDA 4B7EA 3L74H 2LW7A 3CWBH 2IJIA 2NLXA 4E7HA 2UUAO 3OTOK 4HBNA 5C2DA 1ROPA 4UVAA 5K1PA 3A5OC 4OGEA 1EBOA 3AG1B 1S5LZ 4IBNA 4DWIA 1ESVA 4BG8A 3RRHA 3ZSOA 2VWKA 2D5RA 5L3FA 4FM1A 1HNWK 1I7FA 1YVNA 3AVBA 3L3UA 1HQEA 1KVAA 1UA0A 1VQNN 4H0XB 2FTKA 2I7NA 1RBVA 4HTLA 3SUQA 2HP8A 2F1MA 4RCHA 3O3GA 3V9UA 2HJFC 2A7WA 2F4VK 2XO7A 2V7ZA 4KHPB 4GKKO 3TXSA 4CK1A 4PWDA 3HKBB 2Q31A 4FJGA 3MXJA 2RR14 3WXKA 1HRV4 2FBXA 4MDBA 5FNVB 4CJPA 2E76B 4AH9A 3OYMA 1EZVH 3AG3B 3PO4A 4D6TH 3NGIA 1VP7A 1YSCA 3QLHA 3SLCA 3WB0A 2E5LB 1VAZA 1NTMH 4CHZA 5KUKA 3FYEB 3IKMA 4DS5A 2AA4A 3L4IA 3AA3A 3MN6A 3SUOA 2JWLA 3TSPA 1MSDA 4B3SO 4Z4HA 2OWOA 3NF9A 4W5OA 3OS0A 1WSIA 3L4QA 5AQVA 1JJ2M 2EIJB 4BWMA 4C8KA 1DF4A 4UCVA 2GUZB 2UXXA 4CZLA 2ODMA 2P9SB 4WF9L 2DPNA 3C3SA 1C1AA 4GW6A 4YOTA 5E1AC 2WPDG 4FPPA 4IKFA 1N32K 1JJOA 1SKVA 4BW5A 1TVKB 2HR3A 4DV1B 3LSUA 2QR4A 3DOKA 1VQ6V 3HYFA 2RPIA 3P38A 5M1QA 5AQRA 2ITMA 1K73O 3L2VA 4QPKA 2ZGYA 3EKSA 5JJNB 1FJGK 1K8AO 1E1QG 3ZEDA 1MDUB 2CTQA 5LA6B 3CXCM 2WS3A 3CC4V 1YTUA 4B08A 4QNHB 1VQPV 3VOVA 1BHBA 3L2QA 2LP7A 2Q7GA 3ETQA 4DUYK 3G0ZA 3BUZB 3CHXA 3G4SV 5LMNB 4IXCA 4QS7A 4YY3K 3C0BA 1VRH4 2JLEA 4M3YA 3GG4A 3CCJV 3LALA 4MT8A
chains in the Genus database with same CATH topology
1T03A 3ASMA 3T1AA 3CSXA 4Z4IA 4KHNA 4OGCA 2DFFA 4CJFA 1YEWA 4OPJA 3SJJA 5EZYA 1ITGA 1Q9YA 3JASB 3QETA 4X66B 4KHYA 3AO4A 5BMVB 4UFZA 1B9FA 3O3HA 3K57A 1N36B 4KHUA 3AVKA 2YKMA 3UQ8A 2HHUA 1VSDA 2PW9A 3V9ZA 4CC5A 1Q43A 1CLQA 2DFEA 4FZZA 3VQ6A 1NK5A 3SJCC 1VSEA 1TKXA 2KQ2A 4M3UA 5JJEB 1EKEA 1HNVA 3C94A 1G6UA 4O2BA 3AVAA 4CH4A 1GOBA 1S9EA 1RBUA 2YHBA 3MECA 1VSIA 1BIZA 5SZTA 3KK2A 3SJAC 4DLEA 3AA2A 5C8YA 3VQPA 4F6RB 4C8MA 4F4KA 4I9LA 4DFJA 4KI6A 3KJVA 2OPPA 5JJJB 3WB1A 3OYCA 3T19A 5KGXA 5KMGB 3WNGA 4DSLA 1WNSA 2NUBA 1TVKA 4CJLA 3WNFA 1IO2A 4N56A 4J2EA 1NJYA 4PQUA 4ZOLB 1TL3A 1B04A 3OYBA 4CS2A 4AHVA 4DR5B 3NF7A 3QNNA 4HTUA 1CZ9A 4FJNA 4DR7B 4ZI7B 5JVDB 4LSNA 4Q0BA 1S6PA 4DSKA 4O4IA 2B5JA 4O55A 4EFEA 4FVMA 1U04A 3NF6A 4TV9B 4NCGA 4PY5A 1CXQA 1JLEA 4EB6B 3HP9A 1NK8A 3L8BA 3VQEA 4FLTA 1EETA 4TSXA 3BHPA 1RT5A 4LY7A 1TAUA 3P83D 2PGGA 4OJRA 4F2SA 5BMVA 4JI0B 3AO1A 3TAFA 3LZIA 4EEQA 4FK0A 3VN5A 3BAAA 3KLGA 4EP5A 3K5NA 4M41A 3KD5E 1L8DA 3HKCA 1CZBA 3PX0A 4CS3A 3N2KB 4HUEA 3OS1A 5I42A 3VQYA 3S3MA 3KLHA 5FDLA 4CEOA 4DSJA 1X1PA 4F3OA 3WNHA 2HNZA 3LNNA 4O2BB 4CGDA 4GKJB 3BRCA 4BWAA 4PUOA 1VRTA 1K6YA 1T5EA 4DSEA 2GUIA 4CF1A 3JARB 1WSGA 2YKNA 4LH5A 1BCMA 3OYFA 2P1JA 1L3UA 4N47A 4DU1A 3VQ8A 1FXXA 4RW7A 3V9XA 2P22C 4E1NA 1NKCA 3AO5A 3OYGA 1KSPA 4FJLA 2FC0A 2JGUA 4CJQA 1RCHA 4O4JB 5J2TB 3ZT3A 4FLZA 3DYAA 4OX9B 5JQGA 4UQGA 4W5QA 3LZJA 1TA8A 1TGOA 2Z1GA 2RQ6A 4CERA 1NJZA 4OLBA 3ICXA 4DF8A 3HKBA 1C0TA 4CF8A 4J2BA 2UUCB 3DLKA 2X74A 2XRIA 2P5GA 2PYJA 5C24A 4M42A 2DY4A 2HHXA 4CJSA 1HNIA 4IFYA 4DR2B 3LP2A 3PO5A 4Z4FA 3PN1A 4CF2A 4K8XA 1J54A 1J53A 1ZBLA 4Z4CA 3QTCA 4KFBA 4O5BA 3VQCA 3TAQA 3CQ8A 3AVIA 4HNAA 4HUGA 3F73A 4CC6A 2YXLA 4YNQA 4DTJA 2F93B 2W42A 2YIBD 4CGIA 1L5UA 3KLIA 2E6MA 3VQBA 3NBPA 5CYQA 4JYAB 5KX5B 3TR8A 4ZTJA 1UOCA 4CHQA 4FLUA 3OYKA 3T1HB 1KCFA 4M3ZA 4AILC 1JXBA 5HRNA 3SQ2A 4HHTA 4BE1A 1S1UA 4DTXA 3BA8A 1HMVA 3CFPA 3AVNA 3D0PA 5DMRA 4OLAA 1XI1A 1SKSA 4CJ4A 1S1VA 4FLWA 3RYIA 1RTIA 3LP0A 1KFDA 1WSHA 4FFBB 1LW0A 1C6VA 3ZSWA 2HW3A 4O4LA 5JQGB 4AHUA 4CF9A 1IKVA 4DR1B 2ZCEA 3U0ZA 3DLEA 5EZYB 2I5JA 1X9WA 4KAZA 3QEIA 2HHHB 3IAYA 3AO2A 1JL1A 3SUPA 3TWHA 5SWMA 1NK0A 3I0SA 4JRPA 4MQ3A 3MAQA 4B9TA 4JI4B 1JLGA 1SKWA 5IJ9B 4DV7B 1G15A 4M3TA 4NCAA 1TV6A 5IJ0A 2ITGA 5GONA 1N5YA 4N41A 2XY7A 4JI8B 5JVDA 2F8TA 1XHZA 2YI8A 4FJIA 3DI6A 4OVLA 3HVTA 4QCLA 1FFXB 3DLGA 1TK5A 1NK4A 4CEEA 4FYDA 4CHOA 4U3JA 4LFBB 4ICLA 4TQDA 4Z0UA 1Z26A 1SL0A 5J2NA 1RBTA 4FLXA 3C6UA 3M8SA 2KZMA 4DR6B 4MFBA 3AVGA 2A1RA 3M8QA 2HB5A 4DV6B 3AVJA 1IKWA 4X1YB 4DUZB 4CFBA 3TAEA 3VQVA 2IAJA 4KTWA 1HNXB 5J1EA 2QXFA 4FJJA 3AO3A 4LF7B 4DFKA 4UCRA 3RYFA 4W5TA 3DLHA 3OYJA 2VG7A 4DFMA 3N2KA 4CE9A 3ZT0A 1X9MA 2DFHA 3ZT4A 2YNIA 3QIPA 1TVRA 4WBNB 2ZE2A 4ZHQA 5DK5A 1I94B 4ZI7A 3NAEA 3A2FA 4O4LB 3L2UA 5KRSA 4Z4GA 3JATB 1DLOA 1Z25A 3LWLA 4DRXB 1LV5A 1KFSA 1WAJA 1B9DA 2WOMA 2ZIMA 4GMJB 1RSOA 4BACA 2PTMA 5EYPB 4NYNA 4DLGA 1KMIZ 4DFPA 3O3FA 4TUYA 2IM9A 4KHQA 3QF7A 2KKWA 1W9HA 3E01A 4FW1A 2YI9A 4IIJB 2X78A 1RBRA 3ITHA 2ZQBA 4CH3A 5IJ9A 1U4BA 1T05A 4FW2A 4CEFA 2GBZA 2YIBA 5JS1A 5IJ0B 1N32B 3HL8A 3DMJA 2RF2A 5D5QA 3V4IA 2EX3A 2HHWA 1X4TA 2UXDB 3JYTA 4BE2A 5CZ2A 1NK7A 3ZSXA 1KLNA 4DV2B 4NVPA 5KTQA 1BISA 4HNAB 1BIUA 4E3SA 2OZMA 2VG5A 3UIQA 1YTAA 3LANA 5KHJA 4F2RA 4B9MA 5JS2A 2QK9A 3JAWA 3F9KA 4CCHA 2HHSA 3I8DA 2Y1JA 2R7YA 5C25A 4E89A 3HPHA 1TUBA 4LF8B 2Q0AA 4CIGA 3OYAA 5KX5A 4YHHB 2QM4A 4LSLA 4DV0B 1HR0B 1Z5VA 4E19A 4ELTA 4WBNA 2G8FA 1VSJA 4KV8A 4BWJA 3ULDA 1JLFA 4CIEA 1NKBA 1WSEA 2ATQA 1C0MA 2JVDA 4CGFA 3HJFA 1SL1A 1NT2B 2ETJA 3MEDA 2E4LA 3VQQA 4G1QA 3HO1A 4OPKA 1ZYQA 2Q7HA 1HYVA 1WSFA 1QHTA 1L3TA 4O0JA 4DS4A 2BANA 4X20B 4B3SB 1JLQA 3WNEA 3U3GA 1NK6A 3NE6A 5FPOA 4B3RB 4CF0A 5JCOC 4I50A 1QSSA 3S3NA 3N2GB 3SV3A 1QSYA 2V4DA 3KTQA 1LAVA 3L2RA 1M93A 4CEDA 5J2MA 2BE2A 4FJMA 2GV9A 4M3WA 1SV5A 4DK0A 2UU9B 4CESA 3SR2C 1L3VA 5ITZA 5CYMA 2Y1IA 3THOA 4RW6A 4B9LA 3THVA 2HNDA 5LOVA 3OYIA 3V81A 1NOYA 3SGIA 2OPSA 1RILA 1XWLA 4JS5A 3EYZA 2CAZC 5CA0A 4CJUA 3K5MA 2O4GA 1N6QA 3K59A 1JLBA 4EZ6A 4LFCB 4KO0A 4KHSA 1DTQA 4YJ2B 1S1WA 4CIFA 1VSMA 4FFBA 5CY4A 1U48A 4O44A 4K0KB 1HNZB 1J5EB 4DTRA 1HRHA 2Q7EA 1C1BA 4B8AB 1XNRB 2WONA 4FK4A 5LMUB 2OPRA 2OA8A 1VSHA 4DF4A 4PI2A 3AVLA 1RTDA 3VQAA 4UCSA 3I0RA 4FM0A 4DTOA 4CEQA 3JSNA 1RDBA 3B6OA 1IKXA 2YNGA 1RT1A 5JCOA 2D0CA 2HEPA 3OTOB 2F4VB 4KPYA 1IG9A 1WPBA 4JV5B 5GONB 2ZD1A 3LAMA 4CH5A 1IH7A 1O9GA 4CEBA 4I50B 1HYZA 1UA1A 2G8UA 3FFIA 4AHCA 4LR3A 1FFXA 3HVRA 4DRXA 3C95A 4KTZA 4Q6GA 1IKYA 2LSNA 1SKRA 4M3RA 4DG1A 3NH0A 3RYHA 5EYPA 4DU3A 1BL3A 3IG1A 4O0IA 4TUYB 4M3XA 4UCOA 4CJ5A 3HPOA 4EFBA 1VRUA 1A5XA 1ZBHA 1EX4A 1ASUA 3JALB 4IIJA 2RKIA 5CA0B 1TL1A 3K2PA 4B8CA 3RYFB 4CJWA 3SPYA 3SQ1A 2YHAA 1MU2A 4YJ2A 1CXUA 3ISNC 4C8LA 3SQ0A 1S1XA 3AV9A 4CFDA 4JI1B 2FBYA 3ZT1A 3U10A 2OYQA 4DQRA 1X9SA 3DRSA 4L8JA 4IFVA 4KREA 5C8YB 4F6RA 1RDAA 4FJXA 3AVCA 4JI5B 3OYEA 2Z1JA 4JI7B 2P51A 2F66C 4ELVA 4QOZB 3RMCA 4PA1A 3AVHA 3SYZA 3S9HA 4K8ZA 2G8IA 5KRTA 2ZNJA 1S1TA 4DMNA 4RW8A 4B3OA 3HKDA 2E3CA 2F96A 1KLMA 4O2AB 1TUBB 4F8RA 5HRRA 4E1MA 1XQ8A 3NF8A 3HP6A 3VQWA 3NDKA 4CK2A 1ASWA 1LWFA 3QEXA 4DSIA 2G8HA 5JH7A 1VSKA 4O4IB 3RYCB 4TV9A 4AQYB 3OVNA 3TANA 1B92A 2UUAB 2JS5A 4KB0A 1LAWA 1Q9XA 1HYSA 1IBKB 3UT5A 4IG3A 1I39A 4I55A 4YJ3A 2Q3SA 4N5SA 4YY3B 3WB2A 4KL1A 5CB4B 1YT3A 1SQFA 3JAKB 1HJRA 3V9SA 4LF9B 4DTPA 2UUBB 4OKJA 3TABA 1KRPA 1GOAA 4CJVA 2YIAA 4H4OA 2Z1IA 2XY6A 1HNWB 3JALA 4EZ9A 3KIOA 1S6QA 3ZSZA 3VQ4A 1HQUA 4CS4A 4JI6B 1RDCA 3JSMA 3PX6A 1SQGA 5ITZB 5LYJB 3PY8A 2HVHA 3KKSA 1SA0B 4DTSA 2XY8A 4D7TA 4KHWA 3TARA 4FLYA 4O4HB 3L2WA 4XIUA 2B4JA 3LP3A 1T8EA 3FFQA 2PUSA 5KHIA 3BGRA 2IDOA 4O4GA 4X64B 4N76A 3QEVA 4LFAB 5J2UA 3AVFA 1BI4B 4O4JA 4CFCA 4D7SA 5J2TA 4LH6A 3N2GA 4RG8A 3ZSRA 3NCIA 3HKEA 4NXNB 4FXDA 3T3FA 4IHJB 1BGXT 5LXTB 3U6FA 3DLRA 3T1YB 4R5PA 1QE1A 3SZ2A 3V6DA 5JH7B 4B9UA 4I7FA 4W5RA 1NKEA 3V9WA 2IGIA 1U47A 2B6AA 2O4IA 1JLCA 1VSLA 4DK1A 3PUFA 5CA1B 3IS9A 3L3VA 3E22A 1RT6A 3ZT2A 3CM6A 3HSTB 2HHQA 4I2QA 4FZYA 3G10A 2VQFB 5KGWA 1DGSA 2F95B 2ZM6B 1XNQB 2BTOA 4TOIA 1W0HA 4ID1A 3NHGA 3DM2A 5LP6A 4RW9A 2BTQB 4M45A 5KHKA 1Q5OA 3DSQA 1Z5WA 4CGHA 2ZINA 2HVIA 4GYCB 3ZCMA 3B6PA 3K5OA 4RW4A 5LYJA 1UWBA 1A5WA 5HRPA 3P1GA 2XHBA 1WN7A 3TAPA 1BQNA 3VA0A 2EHGA 5D5PA 3MXMA 3LWMA 3U11A 4E0DA 4LNUB 4I9QA 4KB1A 1N34B 1RT7A 4X1KA 3NH1A 3P5JA 1M4UA 1A5VA 4CHYA 1KU9A 4TV8B 1QQCA 5J2PA 3RYIB 3HT3A 3RRGA 4CECA 4FJ8A 1RDDA 1BI4A 1NOZA 2IOCA 3SJBC 5FRMA 4UCTA 1N33B 5K14A 4FJKA 1EXQA 2KTQA 5KHGA 3KK3A 3BABA 3K58A 5BR8B 4CHNA 3HK2A 4IHJA 3LPTA 4EP4A 3ZSYA 4F3TA 1JXEA 3SUNA 3V1QA 4CJTA 4ZTFA 4Y1DA 3RYHB 4BDPA 4FLVA 1IBMB 3VA3A 1KTQA 3RMDA 4CH6A 1QTMA 2QKKA 3BDPA 2PZSA 3HKDB 4CHPA 3E22B