2PY5A

Phi29 dna polymerase complexed with single-stranded dna
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
564
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GGACTTT)-3'
total genus 165
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2py5A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2py5A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2py5A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2py5A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2py5A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2py5A06
3V81A 3PX6A 3RMBA 2HHTA 3K2PA 1RTIA 4MQ3A 2D0CA 3OJUA 1L3TA 1TV6A 3SYZA 1KFDA 5KGXA 2B6AA 2X74A 3V9UA 4DF4A 2PY5A 3G0ZA 4CHNA 3OYLA 4Q5VA 4CJ5A 1T8EA 1JLEA 3QO9A 4E1MA 3LZIA 1C1BA 1JKHA 3DRSA 4KHQA 3AA3A 1JLAA 5HRSA 5J2MA 3OYKA 1KLMA 4CEDA 4M3XA 4RW4A 2X78A 4IKFA 1S9EA 3LWLA 3CQ8A 1ZBFA 3VN5A 4ZHRA 4CJRA 3O3FA 4CJKA 4CJVA 4ELVA 2HNZA 4Z0UA 3T19A 1UAXA 4CGDA 3NH1A 4CEZA 4I9LA 4KPYA 3AA2A 3U3GA 3DM2A 3ZSZA 1WSEA 4BE0A 3OJSA 4NCAA 3QERA 1WSIA 1IG9A 1RT7A 3NF6A 4KTWA 3OYMA 4B9TA 3VQEA 4CECA 2RPIA 3RR7A 1LWFA 4ZTJA 4M42A 2VWKA 3SPYA 1R0AA 1N5YA 1HYVA 1TKZA 3LALA 3AVLA 1CXQA 4W5OA 3KK3A 3S3MA 3SV3A 1LAWA 5C42A 4DTMA 1D5AA 4HHTA 3FFIA 2IGIA 3AVBA 1NKEA 5JS2A 4FLYA 1NK9A 4LD0A 4F3TA 4W5NA 4OPKA 1C0TA 2F96A 3AO4A 1HQUA 3TAEA 1XWLA 4I9QA 3ZSOA 4JS4A 2HHUA 4E7HA 1TAQA 4DTXA 5C24A 1JXBA 4B9UA 3VQDA 3RRHA 4IBNA 4PA1A 4DQSA 1CLQA 3OS0A 2B5JA 3WNEA 2DTUA 1VRUA 2FBXA 3LPUA 2Z1IA 4E89A 4EZ6A 2HMIA 4JS5A 4OJRA 3DLBA 1ZBIA 3OYNA 4CJWA 1B9FA 1XC9A 4DSJA 4J2EA 2PZSA 3VQ8A 3ZSXA 4CEAA 3L2QA 3QEIA 2Y1JA 4DSEA 2R7FA 4OGCA 1IO2A 3CM5A 4DTSA 2OZMA 2PYJA 1NJXA 1Q8IA 4CJ4A 3VQPA 4M3ZA 2IAJA 1RDCA 4LH5A 3NCIA 4XIUA 2DFHA 4N5SA 1C1AA 4CHZA 4M3WA 1XHXA 4KRFA 1VSDA 3ZSQA 3KJVA 3RMAA 4F8RA 4IFVA 3F9KA 3OYFA 1QQCA 4CF2A 1ZBLA 3RRGA 4CEEA 3V1RA 4C8OA 4BDYA 1NK4A 5CYMA 1EKEA 4FM0A 1DTTA 3V4IA 4CK3A 2HHQA 1RT1A 5HROA 2RKIA 4DLEA 4Z4CA 4ID1A 3TAPA 2PW9A 3SV4A 1BCOA 3E01A 4FJ9A 4FLWA 4W5RA 2P51A 4GMJB 3IAYA 3NGIA 1QE1A 3B6OA 3PX0A 3THVA 1EX4A 4RW8A 3RR8A 1EP4A 3KTQA 1BQNA 4DS5A 1VK0A 3QESA 4E19A 3QNNA 1UWBA 3AO3A 1S6QA 1BIUA 4C8NA 3ZSRA 1IKYA 2HVIA 4DSFA 1NK5A 1C0MA 2GBZA 3KIOA 3KK2A 3OYDA 2KZMA 2I5JA 4Z4HA 1TK0A 4C8MA 4DTOA 1J54A 3LDSA 4M3TA 1NOZA 3KKRA 2X6NA 3KLIA 4O5BA 4BWJA 4FLTA 3RWUA 3AA4A 3ZSWA 4OLAA 1ZBHA 3AO2A 1QHTA 5T7BA 2KW4A 3TAQA 1BI4A 2OA8A 4BE1A 4CJLA 1YT3A 1JLFA 4J2AA 2HHWA 4FM2A 1ASWA 1IKWA 2FBTA 3QEXA 4FYDA 4CF1A 3QEVA 2XY8A 2YNFA 4DSLA 1QS4A 2OPQA 4AHTA 4PUOA 3V9SA 3OYAA 4E1NA 2ZQBA 4CK2A 3S3OA 1EXQA 3O4NA 1ASUA 2ATQA 1BQMA 4M41A 4M3RA 4KHWA 1KVAA 3HVRA 1RCHA 2O4GA 1YTUA 4RW7A 3LP0A 1QSSA 3LWMA 3MXJA 1U4BA 3QIOA 3DLRA 2YNIA 4CJTA 3F73A 3IG1A 4G1QA 4FK0A 2BANA 1U04A 4KTZA 1SKSA 2RN2A 3PY8A 4F3OA 2A1SA 4Y1CA 4O55A 1HMVA 4BDPA 1HJRA 3ZSVA 3U6FA 4FZXC 1TL1A 3L2VA 2YHBA 4IFYA 2HHXA 4CEOA 4E0DA 4ICLA 3TAMA 5HLFA 4Z4EA 3NBPA 3T3FA 3SCXA 2JGUA 2NUBA 1JLQA 1RT6A 1VSFA 4W5QA 3U3YA 3K57A 1S5JA 2IC3A 5KRTA 4CK1A 1LV5A 1A5XA 4CGJA 2G8IA 4I7FA 4KI4A 3DOKA 3HJFA 4KREA 5FROA 4OVLA 4CHQA 3OYCA 1BL3A 4RG8A 3ASMA 4DQPA 1RBVA 2Z1GA 3PO5A 2X6SA 3AVCA 3SI6A 4DSIA 4DFPA 4R5PA 4FCYA 1UA1A 1W9HA 3EYZA 4C8LA 4DQRA 4DMNA 3L2WA 1CZ9A 3UIQA 3HPHA 2WONA 4H8KA 1WNSA 2IS3A 4DTNA 4K8XA 4B9SA 3QINA 4OKEA 1SV5A 1Q9YA 1TL3A 1J5OA 4DFMA 1HRHA 1RTHA 3MXMA 3ZT2A 1NJZA 1RT4A 5CZ2A 2P5GA 4ZTFA 4LH4A 3TAGA 1QSLA 3V9WA 1LAVA 1CZBA 3DLGA 3DLKA 3ULDA 3KLEA 1C6VA 3M8PA 4KFBA 4CEQA 3HO1A 5HRPA 1ZBUA 4RW9A 5KRSA 4DTUA 1NJYA 1SL0A 4ELTA 4Z4GA 2E6MA 3HSTB 2B4JA 3PO4A 1RDBA 3V6DA 3JYTA 2KFZA 1W0HA 3C95A 1L3VA 3LPTA 4IDKA 3V1OA 4B8CA 1QTMA 1S1WA 1VSIA 4O4GA 1J53A 3P1GA 4DS4A 4FM1A 1FK9A 3LP3A 3SQ0A 3SNNA 1RDDA 1JXEA 4NYNA 4DFKA 1U47A 2G8VA 3H08A 4DF8A 5C25A 1X9MA 4AHUA 2VG7A 1KRPA 2KFNA 3SJJA 3HK2A 3SUOA 3AVJA 4EZ9A 3OYIA 4DG1A 3A2FA 1NOYA 1L3SA 3SUQA 3QEWA 4CHPA 2A1RA 2G8FA 1JL2A 3IS9A 1LW2A 1T03A 1RT5A 2WOMA 4KAZA 3SQ2A 3L2RA 3HL8A 3P83D 1FKOA 3VQAA 2QXFA 2HNYA 4E7LA 2LSNA 4ID5A 1TKXA 4OKKA 1KLNA 1A5WA 4MFBA 2XY6A 3MECA 1RNHA 4BWMA 3WNGA 2R7YA 5FDLA 1SUQA 2GV9A 2OPRA 1GOCA 3D45A 5HRRA 3SUPA 3QETA 1BHLA 2OPSA 1RBSA 5K14A 4CF9A 1KFSA 1Z25A 4HUFA 3K5NA 4EP4A 1RBRA 2ETJA 4KI6A 3DLEA 3P5JA 2YNHA 2XY5A 4FJ5A 1UOCA 1B9DA 3V9ZA 5SWMA 2D0BA 4CF8A 2Q3SA 3AVMA 1NK7A 4FJIA 3M8SA 4CFAA 4FJHA 3ZCMA 3LANA 4HTUA 2YV0X 4FJKA 1LW0A 1VSEA 4FW2A 3VA0A 4CCHA 4AHRA 3TARA 1GOBA 1YTAA 3AVFA 1D8YA 2HHVA 4RW6A 3EY1A 1TGOA 1RBUA 2G8KA 4FJJA 5D3GA 4CGIA 3NE6A 5J2QA 3OYGA 4Z4FA 3SUNA 2HNDA 1HNIA 5FRMA 3AVNA 3CM6A 4FJMA 4OPJA 1WSHA 3K58A 1LWEA 4BE2A 4LY7A 4AHVA 1KCFA 2ITGA 1RDAA 4H4OA 2E4LA 4DTRA 1L3UA 3O4QA 3K59A 4IG3A 1NK0A 3NH2A 4KTQA 3MEDA 4DU4A 4CJSA 4CE9A 1NKBA 1K6YA 4QAGA 1RTJA 1JLCA 3DRRA 4CJUA 3NGZA 3O3GA 1FXXA 4B3OA 4FLVA 4PQUA 4CFCA 4AHSA 4HCBA 3HP6A 4FJ8A 4OLBA 3HPGA 1BGXT 2FC0A 3I8DA 1TK8A 1GOAA 3I0RA 4FXDA 4NCBA 5KI6A 4E7JA 1CXUA 1IKXA 3L3UA 1SKRA 4KHYA 4YFUA 4CERA 3TWHA 1WAJA 4E3SA 5I3UA 3VQ9A 3LAMA 1N6QA 2DFEA 4Z4IA 3RMDA 3QLHA 1S1UA 2ZD1A 1X1PA 2VG5A 4BDZA 2HW3A 4FLXA 2G8UA 4EP5A 1VSKA 3VQBA 1D9DA 4O0JA 3SZ2A 3PX4A 3AA5X 1G15A 4GVMA 2F8SA 2P1JA 2E6LA 4NCGA 1TKTA 3ZT3A 1T05A 4W5TA 1X9WA 1HQEA 1WAFA 4J2DA 5DMRA 3AV9A 3NFAA 3QEPA 3C6UA 2XY7A 2F8TA 2Z1JA 4PY5A 3OS1A 4JLHA 4CEBA 1WSFA 4KV8A 3AVKA 4KB1A 3HXMA 4UQGA 1WSGA 1FKPA 4KHUA 2RF2A 4OGEA 4JRPA 1S1XA 3NF7A 1KTQA 1RILA 1RT3A 3HYFA 3WNFA 1RT2A 1HYSA 5J2NA 4DFJA 4GW6A 4I2QA 3OYHA 4DTPA 1ASVA 3ITHA 3MEGA 4I2PA 2YHAA 4FJ7A 4ELUA 2JLEA 1ZYQA 3WNHA 4CGHA 4QCLA 1S1TA 1TVRA 4B8AB 1VRTA 4TSXA 3S9HA 3C6TA 3QIPA 1QSYA 4CGFA 4DWIA 4DTJA 4N47A 1Z26A 3LP2A 2HHSA 3FI7A 2IOCA 1Y97A 3AVAA 1DLOA 1EETA 1JL1A 4B9VA 4FW1A 4F4KA 4CJEA 5CZ1A 2HVHA 1DTQA 3MEEA 3TI0A 2EX3A 4AH9A 4KKOA 1L5UA 3CFOA 1JLBA 1I39A 1WLJA 4CEFA 3OYEA 4E7IA 4Y1DA 5J1EA 3DOLA 3DYAA 4F2RA 3NF9A 1WN7A 5CYQA 3ALYA 3L3VA 4FLUA 1RBTA 4PWDA 3AVHA 5JS1A 2XHBA 3AVIA 5EU7A 3LAKA 2EHGA 1U49A 1LWCA 3HVTA 3PV8A 3TANA 3OYJA 3G10A 4CFBA 5DK5A 3ZT1A 3KLHA 1TKDA 1TAUA 4F2SA 4B9NA 3T1AA 4DU3A 3TABA 4KO0A 1IH7A 5E41A 4FJLA 1I3AA 3KLGA 3CFRA 3KK1A 3B6PA 3TAFA 1UA0A 2KQ2A 2P5OA 2GUIA 3DI6A 3L2UA 2OZSA 4FZYA 4FJGA 4FLZA 1REVA 4CHYA 3MXIA 4CIFA 2D5RA 1JLGA 1VSHA 4CHOA 2W42A 5HBMA 3D0PA 4CF0A 3M8QA 3NDKA 2FBYA 3I0SA 3S3NA 4HCCA 3CG7A 3JSMA 4FK4A 3AO5A 3OYBA 1NKCA 4WE1A 1MU2A 1S6PA 3C94A 3ISNC 3CFPA 3IRXA 1XHZA 4B9LA 3HP9A 3HT3A 4FZZA 3CYMA 3NHGA 2QK9A 4E7KA 4FK2A 4CGGA 3ZT4A 1IKVA 1HYZA 3KKSA 3PUFA 3LP1A 4LSNA 4CESA 3NH0A 3OY9A 3VA3A 3DLHA 1BCMA 2Z1HA 1SL1A 2BGGA 2BE2A 2Y1IA 2HB5A 4DQQA 2YKMA 4BACA 2DFFA 2IDOA 5KTQA 1X9SA 3NGYA 4K8ZA 3VQ4A 3SQ4A 1KVBA 4CJ3A 1U45A 1Q9XA 2PYLA 2G8WA 4M3YA 1VSLA 1WSJA 3ZSYA 3KD5E 5SZTA 1HPZA 1A5VA 5HRNA 1XI1A 3V9XA 4QOZB 3KD1E 2YKNA 2VWJA 4DLGA 2G8HA 2O4IA 2OYQA 2KZZA 3L8BA 2QKBA 4CJFA 4O0IA 4M3UA 2QKKA 4AILC 3K5MA 4HVJA 2VG6A 1VSMA 1TK5A 4N56A 4B9MA 4L8RB 4FJXA 1F21A 3RMCA 4LSLA 4NYFA 2XRIA 5KGWA 4OKJA 4B08A 1VSJA 1J9AA 3VQ6A 3BDPA 3AVGA 5J2PA 1BISA 1BIZA 1HNVA 2YNGA 3RTVA 3SQ1A 2XO7A 1SL2A 4KHNA 1KSPA 4KHSA 1S9GA 3O3HA 2AJQA 3M8RA 4CJQA 4HUGA 4DU1A 3DMJA 1ITGA 2OPPA 4FJNA 1BI4B 3VQCA 3SPZA 2KTQA 1O1WA 3HM9A 3NF8A 1YVUA 4M45A 3DRPA 3OVNA 1KVCA 3TR8A 3VQQA 4Q0BA 4N41A 4IG0A 3QNOA 1S1VA 3NAEA 3VQ5A 1NJWA 3KLFA 5HP1A 3HPOA 3LZJA 3AO1A 1B92A 4DSKA 4DQIA 4AHCA 3K5OA 4CJPA 4FVMA 3ZT0A 1U48A 4C8KA 2BDPA 4N76A 1RTDA 1C0UA 3VQ7A 3EZ5A 1NK8A 2ZE2A 5CY4A 5I42A 1SKWA 4YNQA 1NK6A 2DY4A 4CFDA 3V1QA 4O44A 3MAQA 3K5LA 1C1CA 4J2BA 4JRQA 2FBVA 4CIGA 3OS2A 5FRNA 1D9FA 1T7PA 3BGRA 2D0AA 4CIEA 4HUEA 4H4MA 4KB0A
chains in the Genus database with same CATH superfamily
3PX6A 3RMBA 2HHTA 4H0XB 1VQPV 3SJBC 1L3TA 1TV6A 1KFDA 3OW2M 1RUG4 3ZMVA 5AQPA 2WLIA 2KSDA 3PSFA 4DQ8A 2OIEA 2BTQA 1MZEA 2ATKC 3OMIB 4JI2B 3ENOA 3QO9A 4E1MA 2XNDG 1C1BA 1RGIA 3K9KA 4NO7A 3LZIA 2H89A 2QDOA 3PJSK 4KHQA 1JLAA 5J2MA 3CX5F 4O5FA 2UXNA 1BE3H 1HNXO 1YCIA 1BG3A 2EWSA 3AE8A 2GWJA 3H1QA 4IKFA 1HWYA 2GUZA 2WLJA 1YI2V 2OIGA 4BREA 1AL24 4ZHQB 2OTJV 3OTOB 2HR3A 3HRGA 1UAXA 4CGDA 1T44A 1Q86W 1H1VA 3AA2A 4ISFA 2O8BA 1WSEA 1IJJA 1Y74B 3HM8A 1WSIA 1VBB4 1RT7A 2WS3A 2YCHA 3RR7A 4ZTJA 1J95A 1UPGA 2PFUA 4O4JB 1VQ8V 2A41A 2DN9A 2DE0X 1D4M4 2I7NA 1RMU4 1LAWA 3QMLA 1GK9A 1PL0A 5FPDA 2B1IA 5AQVA 3ABUA 3M99B 4B3SB 4DV5O 4FLYA 2I7PA 2NZTA 4LD0A 3A5MC 4LF5B 1OV9A 2HF3A 1C0TA 3FD9A 3SJAC 1IBLO 4YXWG 3ZSOA 3TAEA 1FYJA 4HAMA 5FNVB 1KECA 3BAAA 1HR0B 5C24A 1ZXOA 4BVPA 1KP2A 3ZJZA 4A5BA 5GIOA 4PA1A 1XMOB 2HF4A 4DUZK 3OS0A 1MQTD 3LPUA 2Z1IA 4EZ6A 2FF6A 4CJWA 3TK1A 3K9AA 2PZSA 3FE1A 4KH4A 4CEAA 2CDYA 4DHYA 3L2QA 5B1AB 2Y1JA 2V1DA 4BQLA 1D5NA 4F6EA 1NJXA 3SPGA 4PA9A 4IYHA 3N4PA 3EL2A 2IAJA 1OVYA 2O8CB 4DV5B 2DFHA 4N5SA 1C1AA 1XHXA 1M4UA 1VSDA 3ZSQA 4JKCA 1ZBLA 1QQCA 4B3RB 1BMFG 2ZXWB 5L3CA 4DV6B 2A42A 5BR8O 1YJWN 3OAAG 4C8OA 1TVKA 1RM1C 2P9UA 4DR7K 2X7RB 1DTTA 3PSIA 1JJ2M 1RT1A 5HROA 4HZ3A 5AQTA 1BT8A 3KK7A 4Z4CA 2OCCB 5AQSA 3VTIA 4JYYA 3ABTA 4CJ7A 2PW9A 4RTFD 2Q31A 4AQYK 3HKBA 5BZBA 3RYFA 1TUEB 3U4LA 1BCOA 3E01A 3ID8A 3CD6N 2P51A 3RR8A 3IAYA 3PX0A 1I5XA 1WB7A 2Q4PA 1BO5O 1D4XA 4RW8A 3CXHF 4E19A 4IL6Z 4E1JA 3HKCA 4FOIA 4C8NA 1FXKB 1MDUB 1NK5A 3OR6C 5FPOA 1OKJA 5LHHA 4B3TB 5BY1A 3EE8A 2QWQB 2KZMA 3EZWA 1IBKB 4NKGB 4JZ2A 3LDSA 1PP9H 3WEEA 3KLIA 2P22C 4HWIA 3T1YB 3X2QB 4FLTA 4LF6K 4I0XA 3ZSWA 4OLAA 3TAQA 2X5ID 1VQLN 4CJLA 3JD74 1K7DA 1MOFA 4DCHA 1Y74A 3BABA 4X66K 4ABMA 3QEXA 4FYDA 5KMGA 1IBKO 1F7YA 4CF1A 4FWKA 5DM6V 4LFBK 4PUOA 4O2BA 3C90A 3V9SA 1G1XB 1NGHA 3QO8A 2ZQBA 5GAHP 4NB5A 1EXQA 3S3OA 1HLUA 2R70A 1ASUA 4EHTA 5ADXH 1P49A 2F1MA 2XUMA 1EZVH 3GWKC 3IC9A 3WU2Z 1I5YA 4AQYB 3BF1A 4M41A 4M3RA 3VEWA 1L0VA 3OBYA 1YTUA 4PI2A 2EBOA 3O9UA 5FPNA 2GUPA 1GM7A 1Z5VA 2CH7B 4LH7A 1RSOA 3E9LA 5BRHA 2FKXA 3CCSN 3AEIA 3G4SV 4DV6K 1IDSA 4G1QA 3STLC 4DV0K 4LFCO 1SKSA 3PY8A 2YEVA 4Y1CA 3CC4N 3CCLN 4FZXC 3CSXA 1OH8A 3ABKB 2IVOA 3TAMA 2LP7A 1AJNA 1VIBA 3RT3C 5KPZA 1B3QA 3SCXA 2JGUA 1VSFA 4DRXB 3K57A 2IC3A 3SPCA 2JVDA 4CZJA 2YI9A 5CHIA 5LGTA 1A5XA 1R094 2X6BA 3HJFA 4KREA 4Z2WA 4J41A 4OVLA 1FAFA 4BAYA 1BL3A 4IT5A 4FWLA 4DQPA 3AG3C 1RBVA 2X6SA 2Q67A 1PM9A 2WLNA 3SI6A 2WAMA 4Q4Y4 2YEVB 4R5PA 1UA1A 1WBDA 1PD3A 2N04A 4M63C 3SPHA 1YEWA 3CRCA 1RFQA 2WONA 2YJEA 4H8KA 1POV0 4OKEA 4GKKK 1K73O 1J5OA 4DFMA 4M7YA 4RQFA 1HRHA 3CJHA 1KYOF 4WCEV 4TV8B 3ZT2A 2Q0UA 1RT4A 3KHYA 2UU9B 3B8AX 5JWPA 5IYDO 1WOQA 1ZWIC 4ZTFA 1GN2A 4X1IA 3ABLB 3IFRA 1XL4A 5IYZA 1B04A 4FIPC 2HHHB 2YDEA 2QJ1A 4FFBA 1NMNA 5AQIA 4RW9A 4DTUA 3EKSA 1AR5A 4ELTA 3VF2A 4JV5K 1RDBA 5FPMA 1Q3EA 1NGIA 4IHJA 4B1XB 1PO14 2QTOA 2ASPA 4LF9O 2FSJA 5GTIZ 2PLV4 1NKDA 3J7ZO 2UU9K 4O4LA 4FZ0A 2F9WA 2ZT9B 5ITZB 2ZM6B 2UXDB 1AI6A 2NRWA 3JS6A 3SQ0A 1EFRG 1WLEA 3SNNA 2QWPB 2UUBB 3ASOB 4DFKA 2GTDA 1U47A 1XEQA 1H2MA 5C25A 2ZDIA 4IO8A 3SJJA 3SUOA 3SDLA 1NOYA 3AG4C 4O2AA 4QPJA 4CHPA 2A1RA 4GCZA 1L3SA 2G8FA 1GLDG 2IVNA 3K9JA 1T03A 1NR7A 3SQ2A 1ZL8B 4PJ0Z 1YJNV 1FKOA 1BDGA 1AI5A 4WFHA 2QXFA 1RDWX 4JYAK 3MHSC 3WFVA 1A5WA 3CI5A 4GNIA 3THOA 3WNGA 2XY6A 1KLNA 3CC7N 5FDLA 1SUQA 2OPRA 3VGLA 1FXHA 2PI5A 2E5LB 1N33O 2ASOA 1DKGD 5K14A 2WLMA 3AEAA 3LM2A 3JSNA 3ZS8C 2F66C 1Z25A 3K5NA 3VESA 1K4DC 5AZIA 3O9RA 4UCVA 1UFIA 2YNHA 4FJ5A 5LMNO 1B9DA 4WFNL 2DOSA 5B5EZ 2UXDO 2PTMA 3OFNG 2QKCA 1YJWV 2FF3B 5AQNA 2O8CA 3AEFA 5C2TA 5GAGP 2HOEA 2NRXA 2WLHA 3B8NA 4FW2A 2QWRA 3TARA 1S72V 1GOBA 3AVFA 3VEOA 1HKGA 3HPLC 2HJDA 1SQKA 2B9ZA 4BRGA 5C2DA 2IJHA 4YTPA 5LBQA 3WXKA 2HNDA 4MDAA 2EULA 5FRMA 3AVNA 4OPJA 3SBGA 4BE2A 4LFBB 1N32K 4JHDA 3ZRWA 1NGAA 1GN3A 1L3UA 3O4QA 2CE4A 1NI8A 4BC5A 4TWKA 1EN5A 5LMUO 3RN4A 4CE9A 1NKBA 4ISGA 2AW9A 3H1JH 3UKRB 4MDBA 3DRRA 1JLCA 4CJUA 3NGZA 3JD4A 3J7AP 4D6TH 2ODMA 1I94O 5BN8A 1GKFA 2F23A 5AQLA 3VENA 1EM1A 3K06A 1Y66A 3BEHA 1Z05A 1CZAN 3L3UA 3R9PA 3CCMN 2UUBO 4CZFA 4IO9L 2KKWA 2F43G 4ILHA 4GZRB 1Q82O 1YSCA 4Z4IA 1S1UA 2ZKOA 1X1PA 4BDZA 4FLXA 2Z0AA 4EP5A 1VSKA 2FL4A 4JI0O 1Q18A 1HDJA 2LW1A 4JAXA 1VBC4 4KP4A 5CA1A 5LMUB 1HJOA 3RGBA 2VQEO 3FAVA 1TKTA 2E76B 2E6LA 4NCGA 1HQEA 5DMRA 1T5EA 4JPRA 1M1KW 4U7OA 3GOIA 4L8JA 1K92A 3TXQA 1P4RA 4PY5A 4DR7B 4LR3A 4CEBA 3RFRA 4TV9A 3F5WC 3AVKA 3HXMA 3C0BA 5H1SQ 3BCCH 4C23A 4OGEA 4KHUA 4OO1J 3ETDA 3NXSA 3L72H 3OT7A 1HYSA 4UCUA 4DFJA 1SQFA 4KHPK 1ASVA 2QGNA 3ITHA 2X6AA 5JJEB 1XNRO 4DR6B 3ZEUA 4ELUA 5JS1A 2Q7HA 5KHHA 4QCLA 1LUWA 3AE7A 5LMNB 1X9JA 1TAEA 2N74A 5C12A 2IJJA 1X4TA 5IJ0B 1ESVA 2ITMA 4B1UB 4CGFA 2ZDIC 1X59A 4DWIA 1Z26A 3LP2A 4PI0A 4XH4A 2IOCA 3AVAA 4H0YB 1JL1A 3STZC 5KPRA 2A3QA 3UQ8A 3CMAN 5CZ1A 2AZ2A 1DTQA 1YIJV 1L5UA 1BA0A 2H94A 3SJCC 3CQXA 1I0HA 2M6YA 5C15A 3P32A 2BCCH 2RHKA 3CXCM 4I5SA 2E2NA 5BN9A 5J1EA 3B8MA 2IH3C 1ZUQA 3OEEG 2L35A 3L3VA 4LF5K 4PWDA 3AVHA 2RS14 3AVIA 4DV7B 3VOUA 2QTSA 4PDMA 2EHGA 4JYBA 1U49A 4H5RA 1Y64A 3EXAA 2A3ZA 3TANA 3KLHA 2WU2A 3ZT1A 1TKDA 3P39A 2OCEA 1NMDA 5IY5C 3TABA 3LSQA 1IH7A 4KO0A 1I3AA 2R044 4DR3B 3KLGA 2ZM6O 3B6PA 5JICA 3O9SA 3TAFA 4K25A 4LC1A 2O8EB 5LL6Y 1AR1B 4FLZA 5DM6L 1N0JA 4CIFA 1ILYA 4QNHB 4DSIA 5EVZA 3EHBB 4YHHB 2CK3G 3T4DA 5HBMA 4FK5C 3M8QA 2M7WA 4FK4A 1AR4A 3J7YP 1WB8A 3LL3A 3ZETB 4KUMA 4EFHA 2HHHO 3AEBA 3IRXA 1SA0B 2F4VO 3HP9A 2IBZH 1COV4 3ABKC 4CH3A 3NHGA 1JFFB 4CS4A 3AG1B 1CEZA 2YICA 2UXCO 3HKDA 4FWRA 4GVEA 4QGPA 4BR6A 1YVNA 3BUZB 3THWA 2KQXA 5LXTA 2IDOA 1X9SA 2D2CB 3QO5A 4BRKA 3L75H 3GB7C 4R50A 1KVBA 1U45A 2NR5A 1HNWB 4YTNA 2G8WA 3ZSYA 2Q0RA 2PF4E 2ZGYA 1A5VA 1YQ4A 4BIOA 1K5QA 4C1NI 3LDEA 4MTFA 3J8AA 1R73A 1EN6A 4O0IA 3U8XA 4CW7B 3NMUA 5CA1B 3GQHA 4HVJA 4B9MA 1F21A 4NYFA 3QNEA 5KGWA 2H8PC 1P7BA 2YXLA 5H9CA 4B08A 4K42A 1J9AA 1BISA 3ZEDA 3RTVA 1SL2A 3SQ1A 1L8DA 1WP7A 1E4GT 1KSPA 4PDRA 5AQGA 1K8KB 4NXNB 4A59A 4PHTX 2P9SA 5D5PA 1AR94 4QS8A 1BI4B 4I7ZB 3ZHSA 4YHHO 3JAMO 1IVSA 4H13B 3ZMSA 4QE9A 3NVKA 4H37A 3NF8A 3HM9A 1YVUA 4WQ5C 3BVOA 3F2KA 4KBOA 2JGDB 1LUVA 4N41A 4JKGA 5KHGA 1S1VA 3RYHA 1XMQO 1K34A 3NAEA 1XQSC 3ZHTA 5IDJA 2GX9A 1RFYA 5HP1A 1Z7S4 1CPYA 2EJ7A 3FB7C 4I50B 3AO1A 5ELZA 3AE1A 3RYHB 3I55V 2HMPA 1VQNN 1MSWD 1QQOA 3ULEA 3VQ7A 2W0XA 5BMVB 1XMOO 1MWKA 4JKBA 2A0LA 4YNQA 5I42A 2DY4A 1NA1D 4O44A 3MAQA 4EFEA 1C1CA 1VBD4 4O4HB 2E2QA 4DW0A 4I4TB 1HX1A 4A61A 4A5UB 2D0AA 4RAIA 2Y4TA 4TQDA 1KMIZ 4CIEA 4H4MA 4DV7K 4HUEA 4CBXA 4H0VB 3THWB 4D7TA 2ADPA 3SYAA 5KGXA 4J8FA 4C7UA 3OYLA 4HTLA 2OT5A 1R59O 3CJ1A 3ENBA 5HRSA 3C7NA 4EB6A 3E22A 1C0FA 3N2KB 1WBBA 1FD9A 4E2LA 2GTSA 3C65A 3Q7BA 4I55A 1S9EA 1IV0A 3E89A 1XMQB 3J81O 4CJRA 4CJKA 4CJVA 4Z0UA 5LMNK 1M90O 4KPYA 3RWRD 3AG2B 3DM2A 1AP5A 4W4KA 4JI7K 4BY9C 5LP6A 4NCAA 4PKGA 3AE6A 3E2EA 3NF6A 3OYMA 4CECA 4LBEC 4MW3A 3SYQA 4B3MK 4XBFA 2VWKA 1PPJH 1R0AA 1HXS4 3G6EV 3ETGA 4B3RO 1TKZA 2E75B 3AVLA 3KK3A 3DXKB 1BSMA 3S3MA 5C42A 4UFZA 3CJ9A 1NKEA 2IGIA 3AVBA 4PD4F 4F3TA 3IC7A 4W5NA 4OPKA 4WBNB 1HQUA 2RS54 3SBTA 4E7HA 1Y6XA 4GX5A 2ZD9A 1JXBA 3VQDA 3RRHA 3CCEN 3LNNA 4DQSA 2ETNA 1BOTO 3EO3A 2FBXA 1I94K 4YOYA 1WAZA 1QBZA 5LP6B 5KHJA 1B9FA 4Z1VA 1IBMK 1XC9A 4DSJA 3VQ8A 3UKMA 1U96A 3RVYA 4DSEA 3WXMB 4J11A 2LGQA 4IIJA 4F6RA 1XNRB 4OGCA 1FJGK 3FFKB 4DTSA 2HWB4 3CQYA 1Q8IA 2RNBA 1RDCA 4NXNK 3MDSA 5GW7A 4M3WA 1COWG 4DR2B 4F8RA 1XBLA 1NCQD 4LF4O 3CRAA 1R6TA 4CEEA 3V1RA 1ZSPA 2MW2B 5CYMA 2V52B 1EKEA 3OHRA 2VQEB 3QF7A 5AZJA 4BVOA 2OCCC 3UT5A 5I9EB 3D7EO 2P9KA 4O8KA 5IWAK 2P06A 2WPDG 5AQUA 1E1QG 4FLWA 4DRXA 3GE1A 1EAH4 4X64K 1EX4A 3H01A 3FZLA 4TT3G 2CTWA 1EP4A 1V4SA 4DS5A 3CCUN 4JTCB 3AO3A 3ULEB 5JMVA 1O13A 3SAHA 3ZSRA 3J7AU 3O1BA 3O1WA 4X20A 1XL6A 3AY9A 3LDCA 4I50A 2GBZA 4H5WA 3KK2A 3EVKA 3VGKA 1S72N 1EO1A 1I94B 1N34O 2I5JA 4DTOA 3H3OB 2QKSA 1BUPA 3KKRA 1VEWA 3H1HH 2LQTA 3TXSA 2P9LA 4O5BA 4R7CA 1E4FT 4TV9B 3RWUA 1I7FA 3AA4A 1QR9A 4ILJA 2KW4A 1BI4A 3JAMN 3QO7A 3CCJN 1JLFA 4J2AA 2O57A 2HEPA 2HHWA 2KKZA 3CHXA 1ASWA 1IKWA 3J80O 3W3DA 4IJAA 3TPQA 3QEVA 2QI2A 1QS4A 4AHTA 1R1BA 1VQ7N 1MABG 2UUCB 4O8UA 5AQYA 4E1NA 1JCFA 1NBWA 1E3MA 3JARB 1KVAA 2UYTA 1RCHA 4JKGB 3VTHA 2NNUA 4UCSA 4JK7A 3FYIB 4DR4B 3NVMA 1SQGA 3H46O 4UVCA 3UE5A 3C6HA 2F9TA 1VQ4V 3N2GA 2Q69A 3ZN1A 3K79A 3F73A 1HNZO 2QWRB 5F0XA 3IG1A 3OUFA 5EZYA 3BEXA 4JKFA 1VF7A 1S76D 2QM7A 5FPEA 4F3OA 1FXKA 1HMVA 3U6FA 2HHXA 2L6LA 1OCOC 2UXBO 1TL1A 1WJZA 1YAGA 1RUJ4 5H6RA 4CEOA 4D7SA 1M5IA 4LP8A 3CC7V 5M1FA 4Z4EA 3AGRA 3NBPA 3ZRWB 4CS2A 2HHHK 1JLQA 3QG5A 1NGFA 1S5JA 1VF5B 3TCUA 4DW1A 3AG1C 4WFFA 1W2BU 4CGJA 2G8IA 5FROA 3ENHA 4DV1O 3KWIA 1IBLK 3OYCA 3CRRA 1BHAA 4PDVA 4B9QA 1SQQH 3JD1A 5GTHZ 3AVCA 5JVGL 5F2VO 4NXMB 4FSVA 4C8LA 3DAWA 4DQRA 3OW2U 4DR6K 3UIQA 4BRFA 3HPHA 4B9SA 1W0JG 4DV2B 2IS3A 4DTNA 3CCJV 3QINA 1Y67A 1SV5A 2BUPA 1Q9YA 3JAWB 1IURA 3OMNB 1ZLZA 1NGCA 4HYOA 3WUHA 1F4MA 5CZ2A 2P5GA 3VQXA 2YXHA 4CBUA 2YIBD 4N23A 2IJKA 1DGSA 3DLGA 3UB5A 1XQ8A 2C2AA 3THXB 4J7ZA 2GSMB 4JYCA 1RHI4 2G38A 3CMEV 5TISZ 3Q4HB 2ZE8A 5HRPA 3SFDA 1XNQO 1R084 3MN7A 2EINC 3CCUV 3TSPA 3HSTB 4JKEA 1K73W 1AR84 1YQ3A 1ASJ4 4NTXA 2DWDC 3ZHUA 2KFZA 1UJWB 1Q6IA 5FNVA 3M8AA 3C95A 1L3VA 3LPTA 3G71N 1BS3A 4IDKA 3V1OA 5A2QN 1KXPA 2V7QG 1S1WA 4B8CA 3JCUZ 5C10A 1J53A 4U67L 2NRVA 2QWPA 2VGMA 1NTKH 2HVKC 3CCLV 2CUGA 3ASOC 1CXZB 1RDDA 2GELA 3ZMUA 2G8VA 2HWC4 5KUMA 4BQZA 3E9OA 4X62B 3I33A 3K08A 3CCEV 2VG7A 4BGAA 1KC8O 4EZ9A 3CCSV 3A2FA 1OVQA 3JAKA 3VETA 3JARA 3IS9A 1AR64 1AILA 2VS0A 2KG7B 1RT5A 2D1KA 2WOMA 4KAZA 3L2RA 3D3QA 2LSNA 1SETA 5L3EA 1TKXA 4ID5A 4M7XA 4MFBA 1EWQA 4YXDA 3D2FB 3MECA 3GG4A 2GV9A 2QSAA 2XOKG 3KKYA 3D45A 1XREA 3SUPA 3QETA 4CF9A 1RBSA 1SC5B 4BRDA 1AI7A 3C6AA 4B1VA 4JI3O 3HR0A 5IJ0A 5EYPB 2QWNA 4EP4A 4PDLA 2AHZA 3E22B 5L3BA 3LDLA 2WP9A 4YOTA 5SWMA 1NM1A 2D0BA 2XAJA 1NK7A 1DK1A 4CBWA 1V9PA 3P4RA 3QICA 4FJHA 4Z1MG 4CC5A 3LANA 1VARA 4FJKA 4UV9A 4JI1O 3UM7A 2HHVA 5KHKA 3CYOA 5LYJB 1TGOA 2E5LK 4X1KA 3QB0A 3O8MA 2G8KA 4FJJA 4CGIA 5J2QA 5DN6G 4Z4FA 5BR8B 3SUNA 4DV6O 1M57B 4LCUC 3CE2A 5BREA 4LF4B 3K58A 4JKAA 4DR1B 1KAXA 3SPIA 2W6KA 3UT5B 4H4OA 4CZHA 4DV3K 4UB8Z 1QVGU 4DTRA 1NWKA 1NK0A 2ZIOA 3NH2A 3MEDA 4BC2A 4BR9A 1QVGM 2P9PA 4I6MA 3T1YO 3ABLC 4P30A 4QAGA 4DV2K 2KG7A 1SQPH 3O3GA 3TTDA 4B3OA 4DV5K 4AHSA 3ML0A 2EJRA 4YY3K 4OLBA 1GTOA 1BGXT 4RCHA 4I9WA 1OCCB 4JGSA 3SLCA 1TK8A 4NCBA 1T6CA 4FOEA 3EKUA 1CXUA 1V55C 1SKRA 4DXWA 2Z5UA 4JKDA 3FFQA 4KHYA 4YSXA 1T6DA 1Z2GA 4CERA 1H2LA 2X6CA 4YIPA 5AR0A 5I3UA 4F6RB 4JI6K 3VQ9A 2DFEA 2QXLA 3CJCA 2HW3A 2A7WA 2ASMA 4QPKA 2Q5ZA 3VQBA 1D9DA 1IXBA 3JCZA 3SZ2A 3KWGA 3MWTA 1KUQA 3PX4A 2GBOA 3HKCB 4OX9O 2F8SA 5IYBO 2P1JA 4MTOA 4H5VA 3SK3A 4FWOA 4JEPA 1WAFA 1YHQN 1O9HA 1R3LC 3VRAA 3AV9A 3NFAA 5AQRA 2XY7A 2E3CA 1OZ0A 2F8TA 2Z1JA 2BE3A 4Q20A 3OS1A 2IVPA 3G25A 4JLHA 5BPLA 1S3JA 1VQMN 3RW0A 1VQPN 4XEIA 1PVC4 3LDPA 2VWBA 1QZ5A 3U10A 5GINA 1MZFA 5CMUA 3C3SA 1S1XA 1KB9F 1KTQA 1RT3A 3HYFA 4UXNA 3MCAB 4DR4K 1RT2A 3OYHA 2CGNA 4I2QA 2P90A 3MEGA 4I2PA 2YHAA 4H0LB 3AE9A 4CGHA 1S1TA 2A6AA 4K43A 4DK0A 5IWAO 4JI8O 4TSXA 1BQZA 2DJVA 2X0LA 5AZIB 2DMXA 5EIBC 1HNXB 2RMKB 3DLLL 4DTJA 2HHSA 3P30A 1Y97A 1V4TA 1LOTB 3L71H 5HFLA 1QQMA 4NLBA 3KG2A 4B9VA 4EEQA 3WB2A 1TUBA 2ZJRL 2RN9A 3B09A 2KHOA 4NTYA 3TETA 3L9DA 1I39A 1TUBB 1WLJA 3S3XA 1GRJA 2ZWHA 4PKIA 1ZL8A 1VAZA 2CTQA 1YVWA 3C3TA 1NU1H 3L74H 1U6ZA 4WQ4A 4CZIA 2P6JA 1AJPA 2LJ2A 4B3SO 4F2RA 5CYQA 4WFBV 1MWMA 4FLUA 1RBTA 1YF5L 4QS7A 4DR1O 5CR4A 2XHBA 2NRTA 3T7ZA 3LAKA 2NRHA 2YHWA 2ITCC 1LWCA 3HVTA 5EY4A 1N32B 3AEGA 3J8F4 1V54B 1QLEC 3G10A 4MLHA 4CFBA 4YJ2B 1HKCA 4BROA 3VEYA 2BSKA 4FJLA 3LM9A 4WFEA 2Y0PA 1XILA 4TV8A 5IWAB 1KKDA 3E8GA 3AAQA 1UA0A 3QVNA 2GUIA 3DI6A 4AF1A 5BRFA 2OZSA 4LF7K 3MXIA 4MVUA 4NB4A 2WC9A 1VSHA 1BEV4 5HFMA 4WCEL 2W42A 3I0SA 3S3NA 3A5NC 2O8BB 4X65B 3OYBA 2A5XA 5KQ8A 1NKCA 4WE1A 1HNZK 2HP8A 5EIBD 3C94A 4JTAB 3ISNC 2P67A 3IDHA 3MN6A 3AEDA 3THYB 3VERA 3AAPA 3CEIA 2V4DA 4FZZA 2JS3A 2YHXA 3P4PA 4E7KA 4CGGA 3KKSA 1HYZA 3LP1A 2MK3A 1J5EB 3WXIA 3CJHB 1K97A 1RUF4 4IXCA 3ETEA 1IBMB 2Z1HA 4BGBA 2BGGA 2EIJB 3AEEA 3ETQA 4UV8A 3JD2A 1JA8A 3CMAV 2YKMA 4BACA 4UCRA 4CZMA 5GADP 4X62O 5HL7L 2AXTZ 3CIPA 3NGYA 3VQ4A 2BH1A 3SQ4A 1Q9XA 1P7GA 4X20B 3D2EB 3B77A 3A0BZ 3KD5E 3RSEB 2FYUH 2JEUA 1HPZA 2E8AA 5HRNA 1T3VA 3W0LA 4NXMK 3T4ZA 3KD1E 2YIDA 3D36C 4DLGA 2G8HA 2UUBK 1HR0O 2QKBA 5J2UB 4H5TA 1K8AW 3KZIZ 1IBLB 5J2UA 1TK5A 4L8RB 4N56A 4GKKO 2O8DA 4LSLA 2XRIA 2P9LB 1VSJA 5LXTB 3VQ6A 5J2PA 3ZRVA 4B3MB 1BIZA 5DEDA 1NTZH 1HNVA 2WU5A 5L3DA 3BPZA 4WFAV 1DGKN 2YHYA 1NG9A 4B7EA 4JV5B 4Q4W4 2R9RB 4HUGA 3WXLA 3JAKB 2GTAA 2N05A 2HG5C 1ITGA 2D0OA 1H2KA 2JWLA 2OPPA 1VQKN 3MD0A 1TUUA 1SA0A 4MSWC 1EQYA 2CH7A 1YUWA 4IGGA 3DRPA 5JQGA 3OVNA 3TR8A 4Q0BA 2HBJA 3QBXA 1OH5A 1HRV4 1U97A 3B4SA 2NLXA 5CBGA 4DR3O 2OTLV 2Q9LA 2YIAA 3GQKA 2K9PA 2ZNIA 1B92A 4DQIA 2ZJQL 3JASB 3UO3A 3K5OA 4FVMA 5AQMA 4YY3B 3ZT0A 1SZTA 4X8AA 3EZ5A 1BWFO 1QVFU 1NK8A 2FB5A 2HBKA 2UUCK 1SERA 2HBMA 3K5LA 2WSSG 1F23A 4OPAA 4JRQA 2FBVA 4CIGA 2RCVA 4DV3B 1T7PA 3ABMB 4FPAA 1H2NA 3G80A 3K2PA 2CGOA 4MQ3A 4YJ3A 2D0CA 2R064 4UVAA 3EN9A 2B6AA 2HSTA 4KH6A 3V9UA 5JH7A 5LJVA 4YJ2A 1ZTEA 3CC2V 5AQJA 4Q4V4 1JLEA 4E4EA 3W7XA 1JKHA 3OUSA 4RQEA 1LR1A 3SGIA 3KCXA 3OYKA 1KLMA 4CEDA 4M3XA 3RVZA 4ZKIA 4RW4A 1G4YB 4JI1B 4IOXA 2DYRB 3R65A 1KBHA 3LWLA 4JI3K 4FVUA 4ZHRA 2ZINA 3O3FA 3MX2A 3APQA 3T19A 3NH1A 4CEZA 4U3JA 4I9LA 3ZSZA 1TA8A 3THXA 3LDQA 4BE0A 3DXRB 1FW6A 4JI2K 3OJSA 3QERA 5IJ9A 2F7TA 1IG9A 2OTJN 1WB9A 4K0KB 3CCVN 4JI4B 2RPIA 1LWFA 4M42A 1VQ9N 2DPNA 1N33B 4YDUC 1HYVA 4YIOA 3LALA 4W5OA 1CXQA 4LF8O 1QCEA 5JCOC 1M56B 3VGMA 2Y4UA 3CCQN 3SV3A 4DTMA 1D5AA 3FFIA 5FL7G 3DWLA 4A5AA 1YTFD 4QIWF 1NVPD 3H45C 2F4VK 3ZRXA 4DV3O 2F96A 3AO4A 1OCZC 2WA4A 4JS4A 2HHUA 3J81N 1TAQA 2DQ3A 1NQTA 2DWEC 2W0FC 3N2GB 1NJIO 5JJNB 3T1YK 4JI5K 4LFAK 4CC6A 2WLLA 1FJGB 1CLQA 5KHIA 1SZXA 2B5JA 3WNEA 2VQFO 2DTUA 4YY3O 5B3SB 1VQLV 1P8ZA 4IHJB 2HMIA 4JS5A 3BF3A 4OJRA 5EBMC 1GLAG 1VQOV 4GB34 3CPEA 1WPXA 2Y0IA 3ZSXA 3MCPA 4B1YB 5DM7L 3AE5A 2ZNJA 1IO2A 3CM5A 1JX9A 4ZHQA 2OZMA 1NENA 4CJ4A 1QQNA 5JJJB 5C93A 5JLFA 3NCIA 4LH5A 4M3ZA 1KAYA 3WB1A 5CB4A 3H6EA 3BY5A 4CHZA 2P9IB 5C3JA 1QZ6A 2RE2A 2AZ0A 4OX9K 4KRFA 1N36B 5M1PA 1XNQB 4JV5O 3F9KA 4IFVA 3TTFA 4CF2A 3DXMA 3OYFA 3RRGA 4ASUG 5M1NA 5E79Z 4J7KA 1N36O 3E66A 1NK4A 3AE2A 2YIBA 1BU6O 3VEVA 1H2SB 5H5NA 4CK3A 4BR2A 2AP1A 4DLEA 4JHDB 3VQWA 1H8EG 2F95B 3GBTA 4ID1A 3SV4A 5BXZA 3TAPA 3HBTA 4OXSA 1K5SA 3TSQA 3H1KH 4FJ9A 4DR4O 4DO2A 2GUZB 4GMJB 3NGIA 1QE1A 3B6OA 5F2RA 5ADXA 3THVA 2PBDA 4MTXA 2VCPA 1BQNA 1YTFB 4AM7A 3QESA 1O9GA 3E8FA 1GLJO 3T1HO 2PI4A 1IKYA 4YDUA 4BRCA 2VQFB 1GLBG 2VGNA 5EK0A 5JVDA 1K8KA 5LYJA 3OMAB 3KIOA 4MO4A 4Y0WA 5AZJB 3OYDA 1JVMA 3L73H 4TSFG 5KA6A 4BRAA 1TK0A 4C8MA 1K5MD 4KH5A 1J54A 4PDWD 1XMOK 2X6NA 1EN4A 4PHZA 2R72A 2JRIA 4BW5A 4BWJA 5M1KA 3AE3A 1Q81W 3ASNC 3OEHG 1ZBHA 2JWKA 1JFFA 3J80N 1YT3A 2YJFA 1A32A 1RSOB 4LF8B 4A62A 3BA8A 4FM2A 2FBTA 3APOA 3DXRA 4TUYA 4B3SK 3UKUB 2D3OW 5EC2C 2OPQA 3MX5A 5B8HA 1YF2A 3M3ZA 5BRDA 1KKCA 3CWBH 4IFEA 3SJHA 1BQMA 2QWMA 1JMKC 3O80A 2O4GA 2XAHA 5B1BB 4PA3A 1VHXA 4UB6Z 3S41A 5CA3A 3GL1A 3MXJA 3LSUA 1NGJA 5IYCO 5JH7B 2YNIA 4MW8A 1R3JC 1ZBSA 4J7JA 4PELA 4FK0A 3PIOL 2K1EA 1THZA 1N32O 2RN2A 4BDPA 2Q36A 1OCOB 1HJRA 2Q1NA 3L2VA 2YHBA 4IYIA 2QWQA 5LMUK 4B1WB 4ICLA 4HBNA 1N4CA 2AA4A 3U3YA 3SUCA 5EBWC 2YS8A 3PLAA 3PN1A 1E1RG 4CK1A 4BIZA 2WDRA 4EKWA 3G6BA 4ILGB 1SS3A 3CXCU 4X88A 3ASMA 3H3NO 3L6QA 3Q4HA 4WFGA 2NLJC 3F5TA 4TQFA 4X64B 1YHQV 4JI5B 2DYSC 3UKUA 4FCYA 4DFPA 4PA4A 1SQXH 1IZ3A 1HPMA 1W9HA 4H03B 4DMNA 4JAAA 3L2WA 1YXQA 3B2EE 1JOYA 4JI0K 1WNSA 2UUAO 4PA7A 1JCHA 3B40A 2XT9A 2JEXA 4EB6B 1S22A 2QWLA 1GLLO 3A0IX 5J9PC 1D2DA 3R3LA 2VQEK 3IJ4A 4CZKA 3JAWA 4MVSA 1NJZA 3MHHC 4DR5K 1DLBA 4LH4A 3TAGA 1QSLA 1LAVA 1CZBA 2FSKA 3VEXA 3KLEA 2J4RA 4DR2K 4NXNO 4JI4K 3VRBA 1C6VA 3M8PA 2E2OA 4CEQA 2F93B 1GM9A 1ZBUA 5KRSA 3CIRA 1SL0A 4Z4GA 3FB6C 2E6MA 4K0KO 4L87A 3PO4A 4KHPO 3V6DA 1HKBA 1XNRK 1RUD4 1BCCH 4FWNA 3C7NB 1R6KA 2A40A 1ZX3A 2W6IG 3ZMZA 2QM1A 2CH6A 4BG8A 2RMU4 3ZEUB 1VSIA 3PIPL 1ZAUA 4O4GA 3P1GA 2DW4A 4FM1A 4AQYO 1FK9A 1Q6UA 4J9YB 4NYNA 5L3FA 1HNWO 2ZE7A 4DR3K 1PNKA 5KLVH 3DXMB 4MVQA 1X9MA 4AHUA 1DF4A 2KFNA 4JYAB 3DGEA 4I4TA 3R66A 1I08A 4O4HA 3UO2A 3OM3B 3SUQA 3QEWA 4J10A 1JL2A 3TTCA 5J2TA 1LW2A 4GUNA 3QDKA 3OGCC 3THYA 3CC2N 1N34K 4NLCA 3HL8A 3EFFK 3VQAA 2GEMA 2HNYA 5AQXA 4CI6A 2A9HA 3U11A 3ZN0A 4BWMA 4DK1A 1QNMA 3HI0A 1GOCA 2JGDA 1SAZA 5HRRA 1Y4MA 2IW5A 4JASA 1Z6RA 3QTCA 2E2PA 1IG8A 2ZM6K 1KC8W 3WEEB 4OPHA 1UOCA 3P31A 3V9ZA 2ADQB 2BSKB 4CF8A 3AVMA 3BY6A 1N8RO 2WA3A 4FJIA 3DSQA 3JYCA 1OHHG 4P2ZA 3BA9A 1GO3F 3MN5A 3UKRA 4HTUA 2HKOA 2R9AA 4X1YB 1VSEA 3VF4A 3VA0A 4CCHA 2XAGA 5LY3A 3K0GA 1G8MA 1URFA 4WFAL 2ZIMA 4BR5A 4KHPB 5D3GA 4G27B 2FXUA 3NE6A 3VQVA 2ITDC 3OYGA 4GV6A 3WG7B 4G28B 1PKXA 1WSHA 1LWEA 1KCFA 3FX7A 2FSNA 4B3MO 2ITGA 2QW9A 4LFCK 2E4LA 1RUI4 4U7NA 1NVPB 1K3EA 3K59A 3QBWA 4IG3A 3T2MA 1K8AO 2PAVA 3CF5L 3P4QA 2EZOA 4PA6A 1K6YA 4AM6A 1RTJA 2LFRA 3FR0A 1FXXA 3CCMV 3M6GA 3OA9A 4HCBA 2Q7GA 3I8DA 1W0KG 1R3KC 2WQYA 1GOAA 5CBHA 5KI6A 2QA4V 4DV4O 1GLEG 4FZ1A 4DV1K 4JI5O 4ZI7A 4P9OA 1W59A 3OBWA 1WAJA 3TWHA 4E3SA 2VQFK 1N6QA 3WQUA 1PNLA 3H1IH 3QLHA 1J5EK 3FZHA 2QA4N 2G8UA 4DR6O 1IBMO 4PL7A 5B66Z 4O0JA 3AA5X 4FFKA 4UVBA 3FZFA 5AQWA 2EIKB 4CZGA 1NT2B 3F7YC 3H9VA 3ZT3A 4W5TA 1K9MW 1R6NA 4IZ9A 2CTPA 4WYBA 4BRLA 3QEPA 2R074 2D0PA 3O9TA 1AP6A 2RJZA 5H6QA 1P90A 3GDQA 2Z3YA 1F51A 1YJNN 1WSFA 1IX9A 4KB1A 4X65O 4U3FH 3AARA 1B6QA 4DUYO 4UQGA 2WTUA 4QJFB 1XNQK 1Y76A 1SQVH 4LF7B 2RF2A 3NF7A 3L0QA 3O4WA 3WNFA 1KD1O 5JQGB 5J2NA 1HRI4 2IIRA 4O4IB 1ZYQA 3EEQA 3WNHA 4WFBL 1TVRA 3L4IA 1F4NA 1VRTA 3S9HA 3CJ7A 1M93A 4X9QA 5LHIA 3A5OC 3GVMA 1K33A 1QSYA 4NR1A 1US6A 2A79B 3BRCA 5M1OA 1KQSM 1KF6A 4DKWA 4FW1A 2P7TC 3K0SA 1PV0A 4CJEA 2HVHA 3CRMA 3MEEA 3T1HK 4AH9A 4DV7O 2EINB 4MVZA 5B1OA 4BC3A 3W7UA 4CEFA 4X66O 2EILC 5L3GA 2ARHA 4TUYB 1WUAA 2WUSA 1IBKK 3ALYA 2QM8A 3FAVB 4TOIA 1JQ0A 2WLIB 3G67A 4LFBO 3R8EA 5EU7A 3ZRSA 2VRZA 3ZIAG 4JYAO 1ORQC 3JATB 1QLEB 1HNXK 2Q7EA 1NS1A 4MVOA 1TAUA 2OANA 1DEJA 1N33K 2CGJA 3OD4A 1Q7YW 4KL1A 1M9NA 4MLEA 5E41A 2IU3A 1Q5OA 4JAVA 4IEIA 3K3WA 3KK1A 2QWNB 3G6EN 3CFRA 2GDSA 2O8DB 2ZJPL 1VF6C 3HB3B 5B1BC 2P5OA 4JI7O 3L2UA 4FZYA 5EC1C 1DTOA 4CHYA 3E9PA 1JJ2U 1OCCC 4BR7A 2UXDK 5E84A 3CPWU 4EFBA 4DV0O 4GX0A 2QEXN 1WA8A 4JI3B 4CF0A 1Q43A 3NDKA 5JVHL 2FBYA 1FFTB 4JI1K 3CG7A 3JSMA 4B3RK 3ID6A 5KX5A 4JK8A 2RM24 3SFEA 1KD1W 1MU2A 3D2EA 4O2BB 3T69A 3D3IA 1VQ6N 2NNWA 2ACZA 5KMGB 5EX5A 1GLCG 4B9LA 1BHBA 3CYMA 2QK9A 4FK2A 3ZT4A 5JCOA 1IKVA 5CBFA 4CESA 3OY9A 1FPOA 3NH0A 4PL8A 3DLHA 4I0XB 1M1KO 2B5UA 2EIJC 4JI6B 4DUZO 5AQKA 1K9MO 3E86A 2RDCA 1GH6A 1G99A 3RBZA 2DFFA 4R79A 1EZJA 4K8ZA 1RP3B 2WDQA 2PYLA 2JK5C 2DYSB 5SZTA 2WFBA 3BHPA 1XI1A 4H5NA 3K03A 5CA0A 1M57C 2VWJA 3TSUA 1B06A 2OYQA 3FYEB 3VOVA 4YTMA 3CERA 4CJFA 3D36A 3RYIB 4B1ZA 2QKKA 4AILC 3HKBB 1SRYA 4GX1A 2YUAA 5LOVA 2VG6A 4GV9A 5LA6B 2Y69C 3LDDA 3SYOA 4B7KA 1WP8A 4NVPA 3D8CA 4OKJA 4BRHA 1BQ0A 4LF4K 1R3IC 4NTWA 2ZE6A 3AVGA 5BR8K 4KHNA 2P9NA 1P84F 2YNGA 2DQ0A 1SZ2A 3JD3A 2XO7A 4DR7O 3U9DA 4DB3A 3U9ZA 2EZPA 3O3HA 2AJQA 2JDIG 1OH7A 4CJQA 1PO24 1V55B 3M5RA 4WF9V 2LO1A 4FJNA 3SPZA 2KTQA 3OTOK 4DV0B 3MK6A 1W7AA 1O1WA 1EV14 4KFMA 3LNMB 1NR1A 3TJTA 1FXVA 3I56V 3VQQA 1ZP0A 3QNOA 4BIUA 3HZ6A 5AQOA 1NJWA 1ZC6A 3T1CA 5ITZA 4YOVA 3HPOA 1M90W 4YORA 5LL6Z 4AHCA 2E74B 5LA6A 1YJ9N 4CJPA 4JI8K 5H2FZ 1N8RW 2BDPA 1RPOA 1RTDA 2EIMB 1NGEA 2ZE2A 5CY4A 5AQFA 5A2QO 1SKWA 4CFDA 1G6UA 3V1QA 2W40A 2GHYA 4LF6O 5CA0B 2WBNA 4J2BA 5CN0A 1RM1B 2XAFA 5FRNA 4A2AA 3BGRA 2O8EA 5KPTA 3IGAC 4ZOLB 4X66B 3ATUA 2QR4A 4KB0A 3V81A 1RUH4 2H3OA 5C8YA 1RTIA 4PV1B 4CD1A 3OJUA 3SYZA 3ZX3A 2X74A 4DF4A 2PY5A 4LF6B 3G0ZA 4CHNA 4XDLA 4CJ5A 1T8EA 4O4LB 3DRSA 1YZBA 1HP8A 3W7WA 3AA3A 4BRIA 5FPRA 3CB2A 2DYRC 2X78A 5GONA 4W4LA 3CQ8A 1ZBFA 3VN5A 1VQMV 1E79G 2W41A 2ZCEA 2P9PB 1AVMA 4I6MB 1Q7YO 4ELVA 3UCSC 2HNZA 1SKVA 3X2QC 4K35A 3U3GA 4MO5A 1QLNA 5J2TB 2B76A 1OCRB 3H1VX 3O5BA 4CH6A 2BTFA 1ENVA 3CCQV 3JALA 4KTWA 2YC0A 4B9TA 3VQEA 1SQBH 3JSLA 2IH1C 3WG7C 2ZR2A 2E5LO 1BZKA 3SPYA 1N5YA 5D5QA 4L3QA 4Q4X4 1V54C 4Q5VA 4XDJA 3A5LC 1KQSU 5F1XA 4HHTA 5JS2A 3CP1A 3SYPA 1NK9A 1VQ5V 4CZEA 1ATSA 1OCZB 2Q68A 1PIV4 1VMGA 2HVJC 3HKEA 4I9QA 1XWLA 1TYQB 3FB5C 4AI8A 4JD2A 2Q8VA 4DTXA 4B9UA 1K4CC 4JNEA 4LNUA 3NR7A 4IBNA 1KAZA 2YI1A 2YXYA 1VQ6V 1VRUA 4E89A 4HNAA 2HBLA 3U0ZA 2E88A 3DLBA 1ZBIA 2P9KB 4DYLA 3OYNA 4DV4K 1NNEA 4X1KB 2OTLN 4J2EA 1NH2B 2Y48A 5FLXO 1MMMA 4MS2A 3RSEA 4IWVA 4QS9A 4JK9A 1XOUA 3F7VC 1YJ9V 3QEIA 2R7FA 1GN4A 4DUZB 4JI6O 5AQHA 2PYJA 4CH5A 1J5EO 3VQPA 1HR0K 1QHAA 4XIUA 2EIKC 3F9MA 4CZZA 4FWSA 2V7YA 4DUYB 5GAEP 3I56N 3AGKA 3RMAA 3KJVA 3ZCCA 3FZMA 3O65A 4JF3A 3JD0A 3CPWM 3AG3B 4BDYA 1Z5WA 2CH5A 2KLAA 4FM0A 3V4IA 4LF9K 3ICXA 3ABMC 5C8YB 2HHQA 3Q7CA 2UU9O 2RKIA 4GKKB 3AG7A 4BR0A 2FMLA 4DUYK 3H1LH 4H0PA 3N4QA 4W5RA 2FBWA 1GN6A 3TU5A 4BWAA 4IOAL 3MWPA 3KTQA 1AI4A 1VK0A 4J42A 3QNNA 1UWBA 1NJIW 1S6QA 1BIUA 2Q2RA 3EE9A 2WWWA 2HVIA 4GYCB 4DV4B 4DSFA 1NEKA 1C0MA 3AK3A 2GWKA 4XDKA 4Z4HA 5CE3A 3JBG4 2JIZG 1Y76B 4M3TA 4XH1A 1NOZA 3ATVA 4V19S 2O8FB 4MVMA 3IKMA 2JJ2G 1BGYH 1QHTA 3AO2A 4RWTA 5T7BA 4YOWA 5IE9A 2BTOA 2OWOA 4X89A 5LJWA 4BE1A 2OA8A 3P4SA 3FB8C 3HTVA 1Q81O 2HFEC 2XY8A 2YNFA 1ATNA 4DSLA 5AG2A 4DR1K 1Q86O 3K9SA 3FKSG 1AB3A 5LHGA 3OYAA 4F9OA 1RVF4 4YSYA 4CK2A 3O4NA 3VEZA 4I55B 4LWSA 2ATQA 2IJIA 4UCTA 1VQ9V 4GLXA 3AK1A 2ZGZA 2XTAA 3HVRA 2ZR3A 3ZHVA 3N2KA 5LOVB 4WF9L 3G4SN 4IOCL 4RHV4 3WQTA 4RW7A 3AG4B 2UXXA 3KCYA 3LP0A 4BRQA 1L1FA 1QSSA 4RO2A 3LWMA 1U4BA 4O2AB 2BOCC 3QIOA 3LSSA 3FGUA 4GKJO 3DC6A 1JCEA 3DLRA 4CJTA 4LF7O 4X1YA 2CGLA 2NN4A 4RUEA 1U04A 2BANA 4KTZA 2CAZC 4EAHD 4H33A 4JI2O 3BFRA 2A1SA 2O8FA 4O55A 5AJ3K 2YSUB 5EZYB 1NGGA 1SS6A 3ZSVA 2P9NB 4IFYA 3VPZA 5DECA 3SR2C 4E0DA 5HLFA 4O4JA 4MT8A 4WQ5A 3T3FA 3FLCO 2NUBA 3LDNA 1RT6A 4W5QA 4YT0A 1DT9A 5KRTA 3RYIA 3SMSA 4B3TK 1LV5A 4MTGA 5M1QA 1GM8A 3ZX6A 4I7FA 3DOKA 4KI4A 4CHQA 2UUAB 3ABVA 5B1NA 1EBOA 2A06H 4RG8A 4BG9A 2Z1GA 3PO5A 4FFBB 5KX5B 1RPRA 1NBMG 3EYZA 4X62K 1WA8B 3A8TA 3RYCB 1Q82W 1CZ9A 3IUCA 4JI8B 2QWOA 1ZOYA 1FS0G 4MVRA 4K8XA 4KXRA 2QWOB 1TL3A 2ILMA 4R8CA 1M56C 1RTHA 3MXMA 2QKAA 2ZF5O 2E1ZA 1KFYA 1YIJN 1FKAO 4UUJC 4K41A 1AR74 1MA9B 3V9WA 4FPBA 3DLKA 3ULDA 3I5DA 4KFBA 3HO1A 3DJCA 1NJYA 3A0HZ 5B3SC 3ZHRA 3QFUA 2B4JA 2WLLB 1N0NA 3HOTA 1YXBA 4J9ZB 3ASNB 2RQ6A 4GKJB 3JXUA 3JYTA 1W0HA 3OTFA 3CRQA 1XMQK 1VQ7V 2V51B 3OTOO 1QTMA 3VF6A 1BL8A 4DS4A 1ATRA 4JD2B 5BPNA 3LP3A 1JXEA 3VMFB 2VYPA 4X64O 1H2GA 5HOOA 3CS5A 3H08A 5BR9A 3JATA 4DF8A 1OOPD 1KRPA 3HK2A 3AVJA 3OYIA 4DG1A 2JS5A 5EYPA 3L4QA 1VQNV 3I55N 4LWSB 4LF5O 4BRNA 1VQON 1YITV 4IIJB 3P83D 4E7LA 3D2FA 4WQ4C 4JAUA 1JR9A 1GMGA 4OKKA 1RNHA 1W97L 2R7YA 1DF5A 2OCHA 1XUPO 1S5HC 4K3AA 1YITN 4KX6A 1PL4A 2ZE5A 1BHLA 2OPSA 1KFSA 5K1PA 1HUXA 4HUFA 4YOUA 4BC4A 3SMPA 1RBRA 2ETJA 2W6JG 3BZKA 3SJQC 3DLEA 4NYKA 3P5JA 4U7BA 2XY5A 4KI6A 1OJHA 3BP8A 3ZBHA 2Q3SA 1NU0A 3M8SA 4A2BA 4CFAA 5AQQA 3E35A 1X3MA 4PKHA 1MNGA 3ZCMA 5JLHA 2YV0X 2WDVA 1LW0A 2RS34 3VR9A 1U2VB 1GAXA 4AHRA 1YTAA 1FFXB 1D8YA 1XC3A 1OCRC 2CTRA 2IM9A 1H38A 1RBUA 2Q97A 4RW6A 4ZOLA 1Q6HA 3EY1A 4KHWA 5BPMA 4RUFA 4JTDB 3SAGA 3CETA 1HNIA 3CM6A 1XDCA 4FJMA 2BOBC 5TKYA 2ZQMA 4LY7A 4AHVA 2QM4A 1RDAA 2PGGA 3RVCA 1WPBA 2XASA 2UXCK 4ZBMA 3RYFB 3IMXA 2P4VA 3W7TA 2UXBK 1IXMA 4DU4A 2LGWA 4OX9B 4CJSA 4QE7A 3VR8A 2R9IA 4H0TB 1L0LH 4FLVA 4PQUA 3S3WA 4CFCA 3HP6A 4FJ8A 3CCRV 3HPGA 2FC0A 1TVKB 2P9UB 2LW7A 1SF9A 2QE7G 1KU9A 3VQYA 4ZI7B 3I0RA 4BR4A 4GX2A 2PUSA 4FXDA 4E7JA 3O9QA 4RWUA 4NXMO 3T1HB 3O9OA 1IKXA 2FLOA 3MMVA 1ROPA 3O6WA 4YFUA 5IT9O 2CGKA 4H0OA 2H3GX 1FJGO 1VQ4N 3LAMA 1EWRA 2NRRA 5B1AC 3RMDA 1H8HG 1XUQA 2ZD1A 3SPJA 1RDUA 2VG5A 5KA5A 3LUTB 4LFAB 3DC5A 1VBA4 1G15A 3P3PA 4GVMA 3K0DA 1LCUA 3M1FA 1T05A 4J2DA 1X9WA 1L0NH 3AE4A 5A9GA 2RR14 4DR5O 4LNUB 2F4VB 3C6UA 2AHYA 2UXBB 2ZXWC 4IJNA 3VBBA 1JPXA 4BW9A 1TYQA 3CHWA 2QEXV 4YHHK 4JI4O 4DR5B 4KV8A 4EIAA 3SYCA 3FZKA 3P38A 1WSGA 2YI8A 1FKPA 5K1XA 4JRPA 3AECA 4P9PA 1RILA 4K0KK 4CBCA 4GW6A 4JI0B 4DTPA 4H44B 1Q90D 2JLEA 4FJ7A 1VRH4 2FTKA 3M7MX 5EXWA 4ISEA 4B8AB 4FWMA 1KP3A 2P9IA 3JALB 3C6TA 5CB4B 3QIPA 4JN4A 3RYCA 4N47A 4Z94A 3FI7A 4LH6A 1YDXA 1FXKC 5BMVA 2UUCO 3R6MA 1DLOA 1S77D 1EETA 1W2BM 2HJFC 5E1AC 4F4KA 1MG1A 4JZGA 4FMTA 4DV1B 2EX3A 2P4KA 4FWQA 4KKOA 3TI0A 1QVFM 3CFOA 5GONB 1JLBA 1LNQA 1GLFO 3P4IA 5C2FA 3OYEA 5FLXN 1PNMA 3OR7C 3I8BA 3AG2C 4E7IA 4Y1DA 5KAFZ 3DOLA 3DYAA 3LDOA 3N27A 3NF9A 3BZCA 1WN7A 4CVNE 1NGBA 3HOSA 4FL9A 1MSDA 3O08A 3WB0A 2P9SB 1CP9A 4YOXA 1X3NA 4GT1A 4LFCB 1AROP 2BTQB 2IU0A 3OYJA 3PV8A 5DK5A 1VBE4 5AFUA 2Q0AA 4F2SA 4B9NA 3CCRN 5IY5B 3T1AA 4OGQB 2NRZA 4DU3A 2KB1A 3CMEN 1VQ8N 3E83A 3QFPA 4JI7B 2QTDA 2KQ2A 2V7ZA 3SAFA 1VP7A 4EHUA 1VQKV 4FJGA 4LF9B 1REVA 5KUKA 3MN9A 1VF6A 2D5RA 2Q73A 3A0RA 4Q6GA 3ZMTA 3CC4V 1C0GA 1SESA 1JLGA 2D4WA 3R1XA 4CHOA 3D0PA 4C1NK 3A8YA 1S0VA 3ZETA 4HCCA 3AO5A 5LP6C 3KVGA 4GKJK 4LF8K 1S3XA 1S6PA 1JCGA 1AJQA 3E8BA 3CFPA 2HLDG 3OGIB 1NLVA 2Q0OC 1YI2N 1XHZA 1RUE4 1HW7A 1QU7A 3HT3A 4BRPA 4G9ZA 3L70H 4CS3A 3VA3A 4KTQA 3PUFA 3HKDB 4G2KA 5IT9N 4LSNA 4N21A 1BCMA 5GIPA 4LFAO 3WT0A 1SL1A 1J6ZA 1RUC4 3P3NA 2BE2A 4UY8O 1N34B 2Y1IA 5IJ9B 2HB5A 4DQQA 2E1YA 5LGUA 4DV2O 4YJ3B 2B1GA 2JJ1G 4O4IA 4B3TO 3K04A 1NZ6A 3GWOA 4IEEA 5AQZA 1NH2D 5KTQA 2YX6A 4IDHA 4U3JB 4CJ3A 3ZHQA 4M3YA 1VSLA 1WSJA 3AK2A 3MDQA 4ZIBA 3V9XA 4QOZB 2YKNA 3D6RA 1QR8A 2O4IA 2KZZA 3L8BA 4GY2B 3CJBA 3IFXA 5LGNA 1NGDA 4M3UA 4XH5A 3ZYYX 3K5MA 4FPPA 2Y69B 2UUAK 1VSMA 4FJXA 3RMCA 4R6ZA 5IYZB 3DTUB 4GV3A 4ICGA 1TUYA 2W6LA 3E1YA 1H8TD 1S5LZ 1FFXA 3BDPA 4X1IB 1NTMH 1U2VA 4CZLA 5EOYA 5TKWA 1N36K 4A57A 4WBNA 4CH4A 3ZLJA 4F4LA 4BRMA 1VQ5N 1S9GA 4CD3A 4KHSA 3ZX0A 4DR2O 3M8RA 5KQDA 3HSCA 4DU1A 1JJOA 3WXJA 3DMJA 5AFUH 3CCVV 3DXKA 1OH6A 1HNZB 5E26A 3VQCA 4YSZA 2EILB 4X65K 2XAQA 2Q6AA 4M45A 1KVCA 2AGAA 3OE7G 4J80A 4IG0A 3JASA 1MA1A 3VQ5A 3KLFA 2WLKA 5EBLC 5JVDB 3LZJA 4DSKA 5KAIZ 3G71V 1U48A 4FWPA 4C8KA 4FJCC 2EIMC 4N76A 4HNAB 1C0UA 4FO0A 4JKHA 1NK6A 2LFSA 3W7SA 1HNWK 4LC9B 3TGUH 4UCOA 3KZBA 3CD6V 2H88A 3OS2A 3E8HA 2UXCB 5C0YA 3HKEB 2E20A 1D9FA 3ZX2A 1BA1A 3CJAA 5MLCQ
chains in the Genus database with same CATH topology
3PX6A 3RMBA 2HHTA 3SJBC 1L3TA 1TV6A 1KFDA 4Q5VA 2BTQA 4JI2B 3QO9A 4E1MA 3LZIA 1C1BA 4KHQA 1JLAA 5J2MA 4IKFA 4ZHQB 3OTOB 1UAXA 4CGDA 3AA2A 1WSEA 1WSIA 1RT7A 3RR7A 4ZTJA 4O4JB 1LAWA 4B3SB 4FLYA 4LD0A 4LF5B 1C0TA 3SJAC 3TAEA 3ZSOA 5FNVB 3BAAA 1HR0B 5C24A 4PA1A 1XMOB 3OS0A 3LPUA 2Z1IA 4EZ6A 4CJWA 2PZSA 4CEAA 3L2QA 2Y1JA 1NJXA 2IAJA 4DV5B 2DFHA 4N5SA 1C1AA 1XHXA 1M4UA 1VSDA 3ZSQA 1ZBLA 1QQCA 4B3RB 4DV6B 4C8OA 1TVKA 1DTTA 1RT1A 5HROA 4Z4CA 2PW9A 3HKBA 3RYFA 1BCOA 3E01A 2P51A 3RR8A 3IAYA 3PX0A 4RW8A 4E19A 3HKCA 4C8NA 1NK5A 5FPOA 4B3TB 2KZMA 1IBKB 3LDSA 3KLIA 2P22C 3T1YB 4FLTA 3ZSWA 4OLAA 3TAQA 4CJLA 3BABA 3QEXA 4FYDA 5KMGA 4CF1A 4PUOA 4O2BA 3V9SA 2ZQBA 3S3OA 1EXQA 2R70A 1ASUA 1P49A 2F1MA 4M3RA 4M41A 4AQYB 4KHWA 1YTUA 4PI2A 1Z5VA 4LH7A 1RSOA 4G1QA 1SKSA 3PY8A 4Y1CA 4FZXC 3CSXA 3TAMA 3SCXA 2JGUA 1VSFA 4DRXB 3K57A 2IC3A 2JVDA 2YI9A 1A5XA 3HJFA 4KREA 4OVLA 1BL3A 4DQPA 1RBVA 2X6SA 3SI6A 4R5PA 1UA1A 1YEWA 2WONA 4H8KA 4OKEA 1J5OA 4DFMA 1HRHA 4TV8B 3ZT2A 1RT4A 2UU9B 4ZTFA 4X1IA 5IYZA 1B04A 2HHHB 4FFBA 2QJ1A 4RW9A 4DTUA 4ELTA 1RDBA 1Q3EA 4IHJA 4O4LA 5ITZB 2ZM6B 2UXDB 3SQ0A 3SNNA 2UUBB 4DFKA 1U47A 5C25A 3SJJA 3SUOA 1NOYA 4O2AA 1L3SA 4CHPA 2A1RA 2G8FA 1T03A 3SQ2A 1FKOA 2QXFA 1KLNA 1A5WA 2XY6A 3THOA 3WNGA 5FDLA 1SUQA 2OPRA 2E5LB 5K14A 3JSNA 3ZS8C 2F66C 1Z25A 3K5NA 4UCVA 2YNHA 4FJ5A 1B9DA 2PTMA 4FW2A 3TARA 1GOBA 3AVFA 2HNDA 5FRMA 3AVNA 4OPJA 4BE2A 4LFBB 1L3UA 3O4QA 4CE9A 1NKBA 3DRRA 1JLCA 4CJUA 3NGZA 3L3UA 2KKWA 4Z4IA 1S1UA 1X1PA 4BDZA 4FLXA 4EP5A 1VSKA 5CA1A 5LMUB 3RGBA 2E6LA 4NCGA 1TKTA 1HQEA 5DMRA 1T5EA 4L8JA 4PY5A 4DR7B 4LR3A 4CEBA 3RFRA 4TV9A 3AVKA 3HXMA 4KHUA 4OGEA 1HYSA 4DFJA 4UCUA 1SQFA 1ASVA 3ITHA 5JS1A 5JJEB 4DR6B 4ELUA 2Q7HA 5KHHA 4QCLA 5LMNB 1TAEA 1X4TA 5IJ0B 4CGFA 4DWIA 1Z26A 3LP2A 4PI0A 2IOCA 3AVAA 1JL1A 3UQ8A 5CZ1A 1L5UA 1DTQA 3SJCC 5J1EA 3L3VA 4PWDA 3AVHA 3AVIA 4DV7B 2EHGA 1U49A 3TANA 3KLHA 3ZT1A 1TKDA 3TABA 4KO0A 1IH7A 1I3AA 4DR3B 3KLGA 3B6PA 3TAFA 4FLZA 4CIFA 4YHHB 5HBMA 3M8QA 4FK4A 3IRXA 1SA0B 3HP9A 4CH3A 3NHGA 1JFFB 4CS4A 3HKDA 2IDOA 5LXTA 1X9SA 1U45A 1KVBA 1HNWB 2G8WA 3ZSYA 1A5VA 4O0IA 5CA1B 4HVJA 4B9MA 1F21A 4NYFA 5KGWA 2YXLA 4B08A 1J9AA 1BISA 1SL2A 3ZEDA 3RTVA 3SQ1A 1L8DA 1KSPA 4NXNB 5D5PA 1BI4B 3HM9A 3NF8A 1YVUA 4N41A 5KHGA 1S1VA 3RYHA 3NAEA 5HP1A 4I50B 3AO1A 3RYHB 3VQ7A 5BMVB 5I42A 2DY4A 4YNQA 4O44A 3MAQA 4EFEA 1C1CA 4O4HB 4I4TB 2D0AA 4CIEA 4HUEA 1KMIZ 4TQDA 4H4MA 4D7TA 5KGXA 3OYLA 5HRSA 4EB6A 3E22A 3N2KB 4I55A 1S9EA 1XMQB 4CJRA 4CJKA 4CJVA 4Z0UA 4KPYA 3RWRD 3DM2A 5LP6A 4NCAA 3NF6A 3OYMA 4CECA 2VWKA 1R0AA 1TKZA 3AVLA 3KK3A 3S3MA 5C42A 4UFZA 1NKEA 2IGIA 3AVBA 4F3TA 4W5NA 4OPKA 4WBNB 1HQUA 4E7HA 1JXBA 3VQDA 3RRHA 3LNNA 4DQSA 2FBXA 5LP6B 5KHJA 1B9FA 1XC9A 4DSJA 3VQ8A 4DSEA 1XNRB 4IIJA 4F6RA 4OGCA 4DTSA 1Q8IA 1RDCA 4M3WA 4DR2B 4F8RA 4CEEA 3V1RA 5CYMA 1EKEA 2VQEB 3QF7A 3UT5A 4FLWA 4DRXA 1EX4A 1EP4A 4DS5A 3AO3A 3ZSRA 4X20A 4I50A 2GBZA 3KK2A 1I94B 2I5JA 4DTOA 3KKRA 4O5BA 4TV9B 3RWUA 1I7FA 3AA4A 2KW4A 1BI4A 1JLFA 4J2AA 2HEPA 2HHWA 3CHXA 1ASWA 1IKWA 3QEVA 1QS4A 4AHTA 2UUCB 4E1NA 3JARB 1KVAA 1RCHA 4UCSA 4DR4B 1SQGA 3N2GA 3F73A 3IG1A 5EZYA 1VF7A 4F3OA 1HMVA 3U6FA 2HHXA 1TL1A 4CEOA 4D7SA 1M5IA 4Z4EA 3NBPA 4CS2A 1JLQA 3QG5A 1S5JA 4CGJA 2G8IA 5FROA 3OYCA 3AVCA 4NXMB 4C8LA 4DQRA 3UIQA 3HPHA 4B9SA 4DV2B 2IS3A 4DTNA 3QINA 1SV5A 1Q9YA 3JAWB 5CZ2A 2P5GA 3VQXA 2YIBD 1DGSA 3DLGA 1XQ8A 5HRPA 3HSTB 2KFZA 5FNVA 3C95A 1L3VA 3LPTA 4IDKA 3V1OA 4B8CA 1S1WA 1J53A 1RDDA 2G8VA 4X62B 2VG7A 4EZ9A 3A2FA 3JAKA 3JARA 3IS9A 1RT5A 2WOMA 4KAZA 3L2RA 2LSNA 4ID5A 1TKXA 4MFBA 3MECA 2GV9A 3D45A 3SUPA 3QETA 4CF9A 1RBSA 5IJ0A 5EYPB 4EP4A 3E22B 5SWMA 2D0BA 1NK7A 1V9PA 4FJHA 3LANA 4CC5A 4FJKA 2HHVA 5KHKA 2G8KA 5LYJB 1TGOA 4FJJA 4X1KA 4CGIA 5J2QA 4Z4FA 5BR8B 3SUNA 4LF4B 3K58A 4DR1B 4H4OA 3UT5B 4DTRA 1NK0A 2ZIOA 3NH2A 3MEDA 4QAGA 4B3OA 3O3GA 4AHSA 4OLBA 1BGXT 1TK8A 4NCBA 1CXUA 1SKRA 4KHYA 3FFQA 4CERA 5I3UA 4F6RB 3VQ9A 2DFEA 2HW3A 3VQBA 1D9DA 3SZ2A 3PX4A 3HKCB 2F8SA 2P1JA 1WAFA 1O9HA 3AV9A 3NFAA 2XY7A 2E3CA 2F8TA 2Z1JA 3OS1A 4JLHA 3U10A 1S1XA 1KTQA 1RT3A 3HYFA 1RT2A 3OYHA 4I2QA 3MEGA 4I2PA 2YHAA 4CGHA 1S1TA 4DK0A 4TSXA 5EIBC 1HNXB 4DTJA 2HHSA 1Y97A 4B9VA 4EEQA 1TUBA 3WB2A 1I39A 1TUBB 1WLJA 4F2RA 5CYQA 4FLUA 1RBTA 2XHBA 3LAKA 1LWCA 3HVTA 1N32B 3G10A 4CFBA 4YJ2B 4FJLA 4TV8A 5IWAB 1UA0A 3DI6A 2GUIA 2OZSA 3MXIA 1VSHA 2W42A 3I0SA 3S3NA 4X65B 3OYBA 1NKCA 4WE1A 3C94A 5EIBD 3ISNC 2V4DA 4FZZA 4E7KA 4CGGA 3KKSA 1HYZA 3LP1A 1J5EB 2Z1HA 1IBMB 2BGGA 3ETQA 2YKMA 4BACA 4UCRA 1Q9XA 3NGYA 3VQ4A 3SQ4A 4X20B 3KD5E 1HPZA 5HRNA 3KD1E 4DLGA 2G8HA 2QKBA 5J2UB 1IBLB 5J2UA 1TK5A 4L8RB 4N56A 4LSLA 2XRIA 1VSJA 5LXTB 3VQ6A 5J2PA 4B3MB 1BIZA 1HNVA 3BPZA 4JV5B 4HUGA 3JAKB 1ITGA 2OPPA 1SA0A 3DRPA 5JQGA 3OVNA 3TR8A 4Q0BA 2YIAA 1B92A 2ZNIA 4DQIA 3JASB 3K5OA 4FVMA 3ZT0A 4YY3B 3EZ5A 1NK8A 3K5LA 4JRQA 2FBVA 4CIGA 1T7PA 4DV3B 3K2PA 4MQ3A 4YJ3A 2D0CA 2B6AA 3V9UA 5JH7A 4YJ2A 1JLEA 1JKHA 3SGIA 3OYKA 1KLMA 4CEDA 4M3XA 4RW4A 4JI1B 3LWLA 4ZHRA 2ZINA 3O3FA 3T19A 3NH1A 4CEZA 4U3JA 4I9LA 3ZSZA 1TA8A 4BE0A 3OJSA 3QERA 5IJ9A 1IG9A 4K0KB 4JI4B 2RPIA 1LWFA 4M42A 1N33B 1HYVA 3LALA 4W5OA 1CXQA 3SV3A 5JCOC 4DTMA 1D5AA 3FFIA 2F96A 3AO4A 4JS4A 2HHUA 1TAQA 3N2GB 5JJNB 4CC6A 1FJGB 1CLQA 5KHIA 2B5JA 3WNEA 2DTUA 4IHJB 2HMIA 4JS5A 4OJRA 3ZSXA 2ZNJA 1IO2A 3CM5A 4ZHQA 2OZMA 4CJ4A 5JJJB 4M3ZA 3NCIA 4LH5A 3WB1A 5CB4A 4CHZA 4KRFA 1N36B 1XNQB 3F9KA 4IFVA 3OYFA 4CF2A 3RRGA 1NK4A 2YIBA 1H2SB 4CK3A 4DLEA 3VQWA 2F95B 4ID1A 3TAPA 3SV4A 4FJ9A 4GMJB 3NGIA 3THVA 1QE1A 3B6OA 1BQNA 3QESA 1O9GA 1IKYA 2VQFB 5JVDA 5LYJA 3KIOA 3OYDA 1TK0A 4C8MA 1J54A 2X6NA 4PHZA 2R72A 4BWJA 1ZBHA 1JFFA 1YT3A 4LF8B 3BA8A 4FM2A 2FBTA 4TUYA 2OPQA 1BQMA 1JMKC 2O4GA 3MXJA 5JH7B 2YNIA 4FK0A 2RN2A 4BDPA 1HJRA 3L2VA 2YHBA 4ICLA 4HBNA 3U3YA 3PN1A 4CK1A 3ASMA 4TQFA 4DSIA 4X64B 4DFPA 4JI5B 4FCYA 1W9HA 4DMNA 3L2WA 3B2EE 1WNSA 4EB6B 3JAWA 1NJZA 4LH4A 3TAGA 1QSLA 1LAVA 1CZBA 3KLEA 1C6VA 3M8PA 4CEQA 2F93B 1ZBUA 5KRSA 1SL0A 4Z4GA 2E6MA 3PO4A 3V6DA 1VSIA 1ZAUA 4O4GA 3P1GA 4FM1A 1FK9A 4NYNA 1X9MA 4AHUA 2KFNA 4JYAB 4I4TA 4O4HA 3SUQA 3QEWA 1JL2A 5J2TA 1LW2A 3HL8A 3VQAA 2HNYA 3U11A 4BWMA 4DK1A 1GOCA 5HRRA 3QTCA 1UOCA 3V9ZA 4CF8A 3AVMA 4FJIA 3DSQA 3BA9A 4HTUA 4X1YB 2R9AA 1VSEA 3VA0A 4CCHA 2ZIMA 4KHPB 5D3GA 3NE6A 3VQVA 3OYGA 1WSHA 1LWEA 1KCFA 2ITGA 2E4LA 3K59A 4IG3A 1K6YA 1RTJA 1FXXA 4HCBA 2Q7GA 3I8DA 1GOAA 5KI6A 4ZI7A 3TWHA 1WAJA 4E3SA 1N6QA 3QLHA 2G8UA 4O0JA 3AA5X 1NT2B 3ZT3A 4W5TA 3QEPA 2RJZA 1WSFA 4KB1A 4UQGA 2RF2A 4LF7B 3NF7A 3WNFA 5JQGB 5J2NA 4O4IB 1ZYQA 3WNHA 1TVRA 1VRTA 3S9HA 1M93A 1QSYA 3BRCA 4FW1A 4CJEA 2HVHA 3MEEA 4AH9A 4CEFA 4TUYB 3ALYA 4TOIA 5EU7A 3JATB 2Q7EA 1TAUA 4KL1A 5E41A 1Q5OA 3CFRA 3KK1A 2P5OA 3L2UA