2PY5A

Phi29 dna polymerase complexed with single-stranded dna
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
564
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication, transferase/dna
molecule keywords 5'-d(GGACTTT)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 165
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2py5A04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2py5A01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2py5A03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2py5A02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2py5A05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2py5A06
4B8AB 4FCYA 1LV5A 4CFAA 2XY7A 1O1WA 4CJSA 3OYCA 1BGXT 4CE9A 2BGGA 4Z4GA 4E1MA 1S1TA 1BI4A 4JLHA 2FBVA 3SQ2A 1HJRA 4RW6A 1JKHA 3G10A 1A5XA 4CJ5A 5D3GA 2YHAA 3HPOA 3OYFA 3PX4A 2OPRA 3P1GA 4KRFA 5HRNA 3WNGA 3MEEA 4FJIA 1RBUA 3LAMA 3AO2A 2O4IA 5CZ1A 1VSKA 2IS3A 3ZSRA 3T19A 4I2QA 3PV8A 1NK0A 3MEGA 2KFZA 1ASWA 4FVMA 1ITGA 3NF7A 3DRSA 4PY5A 3RRGA 4L8RB 3NDKA 4PA1A 2BDPA 5CYQA 4HVJA 2G8WA 1D5AA 1QS4A 3M8RA 4AILC 4DTOA 4KHQA 1VSHA 4DTPA 1YTUA 1HYSA 4IFVA 4FLWA 4KV8A 3VQ5A 5J2NA 4I9QA 4WE1A 4KI4A 1VSEA 2FBYA 3LPUA 4FJ9A 4RW8A 3AA3A 3AVFA 4F4KA 2KZMA 4W5NA 1NK8A 4CEBA 4Y1CA 2YNGA 5FROA 4F2RA 3HSTB 3AA4A 1VK0A 2XY5A 4B9SA 1BL3A 3IRXA 1ZYQA 1A5VA 3KLIA 1SL2A 1IG9A 3OYJA 2R7YA 1ZBFA 5JS2A 3ZCMA 3HVRA 3NF8A 1NK4A 3A2FA 3LP2A 1NK6A 4OLAA 4FYDA 2GUIA 1TAUA 3V9UA 2RPIA 2BE2A 3KKRA 4ID5A 4CF8A 4CJUA 4GMJB 3F73A 4FLUA 1TV6A 3VQ8A 3NGIA 4DWIA 3LWMA 3DM2A 4DFMA 4KHNA 1KTQA 1VSJA 4B9LA 4JS5A 4HCBA 4FJKA 4FLXA 1RT5A 4IKFA 1T05A 3S3MA 4Z4HA 4AHRA 4KHWA 5HLFA 1RTIA 3AVCA 2ZQBA 3QIPA 2HHVA 1DLOA 4O5BA 4Q5VA 4M45A 4CJQA 4FM0A 4FK2A 1TK0A 2OPPA 2XY8A 3OYKA 1RDCA 1NJYA 2A1SA 3LWLA 4M3XA 4DSFA 4DSIA 3SPYA 3C6UA 3VQEA 1NK7A 1VSDA 3K2PA 3SQ4A 4E7HA 3VQ4A 1ZBIA 5HROA 3KK2A 1EETA 4Z4FA 1JLBA 4MQ3A 3VQ6A 4IBNA 4CJVA 4FJMA 2RKIA 4XIUA 1LWEA 1EKEA 4DMNA 4CJEA 4DQSA 3PO4A 2XY6A 4DTNA 5C24A 4C8KA 3ZT0A 4OKEA 4E19A 5C25A 4ELTA 4ELVA 1EX4A 1C1CA 4O4GA 2KZZA 2X6NA 2QKBA 3FI7A 1D9FA 3NH1A 4AHCA 1J9AA 4KKOA 3OYDA 4DFPA 3K57A 1ZBUA 5KGWA 2VWJA 1VSIA 3SCXA 1JLQA 3L2QA 3ZSVA 3KK3A 1BQNA 3OYHA 3QEWA 1YTAA 4H4OA 3TWHA 1L3TA 1YT3A 1WSHA 4W5OA 4CGFA 3MXMA 3HP6A 3TANA 4DF8A 3S3NA 2EHGA 4FZZA 4E7KA 4PQUA 3ZSOA 4FJXA 1LAVA 4CJFA 2XO7A 3AVAA 1HPZA 2QKKA 3SQ1A 3K59A 4FK0A 1KVBA 3HYFA 3EYZA 2YHBA 3VQBA 3M8SA 1B9FA 2OZMA 3ZSWA 4Z4IA 2F8TA 1KFDA 5HRSA 4B3OA 1TGOA 3VA0A 4BE2A 2YKNA 4FJ5A 3TR8A 1HYZA 5E41A 2HHQA 1BISA 1BIUA 3TAFA 4YNQA 4FJGA 1TKTA 3IG1A 3CQ8A 1QE1A 5DK5A 4KTZA 4M41A 1LW2A 3MXIA 4OKKA 4CCHA 4KPYA 3WNEA 4EP5A 2PZSA 4FLTA 4CF0A 2BANA 4J2EA 4CIFA 4K8ZA 3AV9A 4CJ3A 3SNNA 4EZ9A 2KTQA 2XRIA 4B9TA 3LZJA 2GV9A 1WSEA 2HNZA 4C8NA 4E0DA 3M8PA 2OZSA 2PY5A 1I3AA 3HK2A 4DSLA 2EX3A 3OS0A 3ZT3A 1J53A 1REVA 1KFSA 1JXBA 1KLMA 3PX6A 4ZHRA 4OGCA 1I39A 3RR8A 2VG6A 3VQ9A 4O0IA 3TAQA 1W9HA 1LWFA 3F9KA 1VSLA 4N56A 3VQCA 3AO1A 4CGHA 4R5PA 3OJSA 4DLEA 5J2PA 4GW6A 4M42A 2G8UA 4QOZB 3QNNA 1JL1A 2IC3A 2VG7A 4NCAA 4KI6A 1C0MA 1RBRA 1HYVA 3V9ZA 3SUQA 1QSLA 1FKPA 5K14A 4UQGA 3MXJA 4J2AA 3AVHA 3D0PA 4KHSA 1JLGA 1GOCA 4ZTFA 4FJLA 1JLFA 4YFUA 2OYQA 2YNHA 2OPSA 3AVJA 4DFKA 1NKCA 4JS4A 2HVIA 2HNYA 3KTQA 1XI1A 4BDZA 1HNIA 3OS1A 2FBXA 2YV0X 1WN7A 1WAFA 2E6LA 3DMJA 3L3VA 4I9LA 4OKJA 3K58A 1RT1A 1TKXA 3IS9A 3S3OA 4AHUA 5FRNA 1FKOA 3U3GA 1RBSA 1S1WA 1UWBA 2Z1IA 4B8CA 1SKRA 3ZSXA 1HRHA 1Z26A 4CHZA 1NOYA 1WSIA 1ASVA 3RWUA 1U4BA 5I42A 3NH2A 1JXEA 3NFAA 3HXMA 3ISNC 3SPZA 4CK1A 4CEOA 5C42A 3K5MA 5KRSA 4N76A 2RN2A 4CJ4A 3HM9A 3B6PA 1LW0A 3ASMA 3V9SA 4FW2A 2KFNA 3NH0A 3K5NA 1U04A 3QLHA 2PYLA 1RT3A 3DLRA 5KTQA 1NK5A 4E7JA 4DQIA 1HQUA 4LSLA 4Z0UA 2HHWA 3SUNA 1KRPA 3V4IA 4LY7A 4BWJA 3QETA 2P51A 3TARA 1GOBA 1DTQA 4Z4CA 3OYEA 3TAEA 1CLQA 3AA2A 1XC9A 1R0AA 1T8EA 3NE6A 2YKMA 3VA3A 4FM1A 3V1QA 4KAZA 1LWCA 2Z1JA 4E1NA 4W5TA 3QEIA 3NGYA 4O0JA 4M3TA 4CHYA 3QINA 3K5OA 1HNVA 4DU3A 1KLNA 1JLAA 4C8MA 4TSXA 4J2BA 3HP9A 1F21A 4IFYA 1S6QA 4NYFA 1RT4A 4EZ6A 4FLVA 4LH4A 3DOLA 4FK4A 4OGEA 4CESA 4HHTA 1XHZA 4DFJA 4KB0A 4CF9A 3QNOA 3DYAA 3V9WA 4FLZA 1FK9A 4OPKA 3C6TA 4CJKA 1QTMA 5CY4A 4W5RA 3QEPA 1ASUA 3LDSA 2P5GA 4KFBA 3VQQA 4IDKA 3O4NA 4E7LA 1U45A 2P1JA 1UA1A 4FJJA 4FXDA 2HVHA 4CEQA 4E3SA 3DLEA 3L8BA 4M3ZA 4BDYA 4NCBA 3DLKA 1RCHA 4IG0A 3SYZA 2X74A 1IKYA 1NJZA 4CEDA 2QXFA 1TKZA 4CHOA 3SI6A 3O4QA 5KI6A 1C0TA 2DFHA 1N6QA 4FJHA 2YNIA 3G0ZA 1RDAA 3DLGA 3CM5A 4B08A 4CEEA 3LALA 1WSJA 1QQCA 4BWMA 3V1RA 1EXQA 4N5SA 4DS4A 4DTSA 4JRQA 1TL3A 3AVNA 1RTDA 1CZ9A 1DTTA 4FW1A 4CGDA 1U48A 1NJWA 4KTQA 2IDOA 1NKBA 5HBMA 5J2QA 3O3HA 4FJ7A 3HVTA 4FJ8A 3CFOA 1SKSA 1CZBA 3RR7A 3EY1A 3OYAA 2OA8A 2WOMA 3OS2A 1WNSA 3VQPA 1SKWA 4CJLA 3ULDA 3SJJA 3L3UA 4G1QA 4DTXA 1SL1A 1X9MA 5KGXA 2HHTA 4K8XA 2HW3A 1IKVA 1BQMA 3TAGA 1IKWA 3CFPA 3B6OA 3OVNA 3PUFA 4CF1A 3ZSZA 1RBTA 4CEZA 4CFBA 3EZ5A 4BDPA 4DQPA 4F2SA 3AO5A 4CECA 4KHUA 1NJXA 3DLBA 2HHSA 2PYJA 1XHXA 4FJNA 1TAQA 3OYGA 1VRTA 3C95A 3LP3A 3KLHA 3LZIA 4KHYA 2VG5A 1Q9YA 1SL0A 3KD5E 1W0HA 3HJFA 1S9EA 3ZSYA 1KSPA 2E4LA 4FLYA 1WLJA 4CIGA 1MU2A 2ETJA 2R7FA 3AO4A 5J1EA 3ALYA 1QHTA 1GOAA 3WNHA 4OVLA 3ZSQA 3TAMA 3NF9A 1IH7A 4CIEA 3NHGA 3P83D 5I3UA 1TKDA 4PUOA 3THVA 1IKXA 4N47A 3U6FA 2Y1IA 3RMCA 1G15A 1VRUA 2HNDA 1D9DA 2G8KA 4B9UA 2DFEA 5HRPA 4QAGA 3TABA 2F96A 2JLEA 1RDBA 4CK2A 3HT3A 3BDPA 4FZYA 2D5RA 1SV5A 2AJQA 4HTUA 2DTUA 4KO0A 3AO3A 1S5JA 3H08A 2XHBA 2NUBA 1J5OA 3V6DA 1C6VA 3MECA 4CJPA 3RMDA 4CHPA 1NK9A 3PY8A 5JS1A 2LSNA 5SWMA 4BE0A 4I7FA 4MFBA 1L3SA 1JL2A 2G8VA 4C8OA 1S9GA 3DLHA 2JGUA 2GBZA 3KK1A 4GVMA 2WONA 3FFIA 3L2RA 1KVCA 4CJWA 1RDDA 1C1BA 1BHLA 3O3GA 4JRPA 1KCFA 4DTRA 1VSMA 4DSEA 4E7IA 1RT2A 1L3VA 2G8IA 1HMVA 2HHXA 4CGJA 3I0RA 2E6MA 2IAJA 3I0SA 1CXUA 4DSJA 4CF2A 4O55A 3MEDA 1TK5A 4RG8A 3SQ0A 3CG7A 2RF2A 2A1RA 4KREA 4DG1A 3VQ7A 2G8HA 4N41A 2W42A 3QEXA 3KJVA 1S6PA 2I5JA 2Z1HA 1Y97A 1WSGA 3NCIA 2QK9A 1YVUA 1N5YA 1RT7A 1C0UA 2KW4A 1Z25A 4DQRA 3O3FA 2DFFA 4W5QA 1K6YA 1Q9XA 4J2DA 2Y1JA 3IAYA 1JLCA 3OYIA 2IGIA 5CZ2A 5DMRA 3L2VA 4Y1DA 1TK8A 3QEVA 4B9VA 4AHSA 1Q8IA 2B5JA 4DSKA 3LP1A 2B6AA 4CJTA 3RRHA 1ZBHA 3P5JA 3T1AA 2KQ2A 2FBTA 1B92A 3AVIA 1RILA 4O44A 5EU7A 2G8FA 2OPQA 5SZTA 4HCCA 4IG3A 3OY9A 4CEAA 2DY4A 4M3YA 1X9SA 3S9HA 4B9NA 4DLGA 3DRRA 2ZD1A 2ATQA 3HPHA 1U47A 3TAPA 3U3YA 1B9DA 4AHVA 4DU1A 3CYMA 3MAQA 4RW7A 3SV4A 1D8YA 3SUPA 3KKSA 4CK3A 1S1XA 1QSSA 5FRMA 2VWKA 4LH5A 4DTJA 4CHNA 4DF4A 4ID1A 3ITHA 3RTVA 3SV3A 1RNHA 3KD1E 4M3WA 3BGRA 3HL8A 4H4MA 4FM2A 3LPTA 3QIOA 3NGZA 4NYNA 4DTMA 1X9WA 3HO1A 1WSFA 4KB1A 4QCLA 1BCOA 1VSFA 5HRRA 1RT6A 4DTUA 4RW4A 4B9MA 2YNFA 2FC0A 5CYMA 3OJUA 4F3OA 1BIZA 3KLFA 1KVAA 2B4JA 1S1VA 3PO5A 1CXQA 1NOZA 1T03A 3V9XA 3DOKA 2D0CA 4OPJA 4HUFA 2HMIA 3D45A 4HUGA 1TL1A 1IO2A 3AVLA 2HHUA 4M3RA 3RMBA 4DS5A 1TVRA 4FZXC 2F8SA 1SUQA 3OYNA 3PX0A 1C1AA 3AA5X 1HQEA 4Z4EA 4BE1A 1X1PA 2ZE2A 3QERA 2P5OA 3I8DA 3VQDA 3DRPA 2ITGA 1RTJA 4OJRA 3V81A 4CERA 3RMAA 1BCMA 3OYMA 1FXXA 4LD0A 5T7BA 3AVKA 4CGIA 3L2UA 3AVGA 3UIQA 1WAJA 4E89A 2X78A 3ZT4A 1T7PA 5FDLA 4DQQA 1ZBLA 1U49A 4H8KA 3JYTA 4PWDA 3LP0A 3KLEA 4ELUA 4F8RA 3NAEA 1BI4B 3CFRA 4CFCA 5KRTA 1UOCA 3CM6A 3VQAA 2PW9A 1UA0A 1L5UA 4LSNA 3HPGA 2Z1GA 1UAXA 3VN5A 3DI6A 4Q0BA 1XWLA 3NBPA 2X6SA 4CGGA 3KIOA 3NF6A 3C94A 3M8QA 4CHQA 3L2WA 4HUEA 3V1OA 3KLGA 3AVBA 4ZTJA 1RTHA 2D0BA 2IOCA 4KTWA 2O4GA 4AH9A 3K5LA 3E01A 4CEFA 1QSYA 2HB5A 4EP4A 4DU4A 4M3UA 4BACA 1LAWA 4AHTA 1L3UA 3OYLA 3JSMA 4F3TA 1JLEA 3TI0A 4OLBA 3AVMA 3WNFA 4ICLA 4CJRA 3LAKA 1NKEA 1A5WA 3SZ2A 3LANA 3QO9A 3T3FA 1RBVA 1EP4A 4NCGA 3SUOA 4CFDA 3OYBA 5J2MA 3QESA 2Q3SA 5HP1A 4C8LA 1J54A 1S1UA 4I2PA 2D0AA 3ZT2A 4RW9A 3ZT1A
chains in the Genus database with same CATH superfamily
3P32A 1GLCG 4DR5O 5EY4A 5CA3A 3D2FA 4CFAA 1IURA 1YHQN 1H8TD 1N0JA 1BGXT 1WAZA 4CJ7A 1IBKO 5JJEB 1S1TA 1Q6IA 3QG5A 4JLHA 3F5TA 2ARHA 4DK1A 4DV6O 2FBVA 4RW6A 3G10A 3LDLA 2HP8A 2EZPA 1YVWA 1HKGA 5EIBC 4H03B 3AE8A 3PX4A 1H8HG 2X5ID 1YSCA 3WNGA 3ZX2A 3MEEA 4NTYA 4GCZA 3LAMA 3AO2A 2O4IA 3T19A 4I2QA 3PV8A 2KFZA 3FX7A 2JWLA 3DRSA 4DR3O 3RRGA 3UKUA 4L8RB 3NDKA 1HNWK 1DKGD 2BDPA 5CYQA 5BRHA 1QS4A 4MLHA 4DTOA 3MN5A 5GW7A 1VSHA 3G25A 1XUQA 3C6AA 3BFRA 2A40A 1YJ9N 4FLWA 4ZI7B 4I9QA 4JI6K 2DPNA 4BR5A 4R79A 2CTPA 3AVFA 4F4KA 2KZMA 5CHIA 1NK8A 1DLBA 2DYRC 2P06A 1ZBSA 3HSTB 4NXNK 2AGAA 1VK0A 2UUAK 1YXQA 2EINB 1Q7YW 1A5VA 4JNEA 1SL2A 5JS2A 3R3LA 4DR4B 3MHHC 3GQHA 4FYDA 3NMUA 2FLOA 2RPIA 4EHUA 1EN6A 4G27B 3J7AU 4YOVA 3L9DA 1BZKA 3NGIA 3D36A 4WFBV 3KCXA 3LWMA 3DM2A 4KHNA 1KTQA 5M1QA 4CD3A 3T4DA 4B9LA 4U7OA 4FJKA 4F6RB 1AROP 2WBNA 1VQLV 1RTIA 5IWAB 2QWOB 3J81O 1SS3A 3ABTA 3DGEA 3KG2A 5CA1A 1JA8A 1F7YA 4B7EA 3OUSA 4M45A 4CJQA 4Q5VA 4FK2A 1RDCA 5CB4B 3CCLV 3QMLA 5KA5A 4DSIA 3ABMB 3C6UA 1Y74A 5AQOA 5HFMA 4B3RB 4O2BA 1C0GA 3K2PA 3SQ4A 3SGIA 4IHJB 5HROA 3KK2A 4J9YB 1XQ8A 1SQVH 1ZC6A 3F7YC 3ATVA 3UT5A 3F9MA 3J81N 4XIUA 2VWBA 4JAAA 3BA8A 4C8KA 4DTNA 5C24A 5AQXA 4OKEA 4JKAA 3H1LH 4UUJC 4O4GA 2X6NA 2QKBA 5BN9A 3CP1A 1RM1B 2H89A 4OXSA 1XMOO 4AHCA 3BPZA 1J9AA 2QWLA 3P4IA 2YXHA 4QPKA 5KGWA 3B2EE 4YOYA 3OA9A 3VF2A 3ZLJA 1KECA 3PIPL 3KK3A 2E3CA 2QWNB 4DYLA 4X62O 3CIPA 3TWHA 5B1BB 4TQFA 1TUYA 2F9TA 5KMGA 3JAWA 3ZSOA 3ABUA 4GX1A 3AEBA 1LAVA 2XO7A 2UXBO 2ATKC 1Q5OA 1V54B 3FB6C 1FKAO 4OX9B 3A8TA 2IVNA 4EAHD 3M1FA 4B3OA 2F8TA 5HRSA 4DB3A 3VA0A 1H38A 2ITMA 3P4QA 5FPMA 4FJ5A 2WDRA 4X9QA 1I94O 2Q5ZA 5TKYA 1BIUA 4JN4A 3UKUB 4J11A 1E4GT 4IYIA 4FJGA 1Y67A 1NTMH 5LBQA 5FNVA 3JS6A 5AQRA 1NH2B 1QE1A 4CZKA 4FWQA 1GMGA 3SMSA 3MXIA 4LF5O 2IJKA 1VQ8N 4EKWA 2KTQA 1WP8A 4CJ3A 4CIFA 2ZM6K 4H0TB 4PL7A 3ETDA 2VYPA 3BP8A 3BEHA 1YITV 2PY5A 4K41A 2OZSA 3CRMA 2EX3A 2CH6A 3KCYA 4CC5A 1REVA 1G4YB 3H45C 4L87A 1W2BU 1I5YA 1KFSA 4ZHRA 4OGCA 1BS3A 1I39A 4BIUA 2VG6A 3VQ9A 3TAQA 1V9PA 2H3GX 3MDQA 4N56A 3CCQV 1J95A 1QLEC 5KUMA 1BA0A 4GW6A 1MZFA 4IT5A 1MABG 4QOZB 1HNWB 3OD4A 3RYIA 1KD1W 2UU9O 4ZIBA 4GLXA 2L6LA 1HYVA 1FKPA 1MDUB 4WFEA 3AVHA 3SJHA 3F5WC 1YTFB 4ZTFA 3CXCM 1JLFA 4FJLA 2YNHA 4JI6B 3SFEA 3AE4A 1W97L 3KTQA 5BRDA 4JK9A 3HKCA 2FBXA 1WN7A 1Y6XA 2E6LA 1NU1H 2DYRB 3LDEA 1HX1A 3K58A 4NXNB 1E4FT 5BRFA 3AK2A 2UUAB 3S3OA 2W40A 3U3GA 5FRNA 2O8FB 2AW9A 2Z1IA 4B8CA 3OFNG 1HRHA 4O4IB 4A2AA 5M1KA 4FJCC 1NOYA 4QS8A 3P4PA 3UT5B 5I42A 3NFAA 5EVZA 3QO7A 2UXCK 2RS54 2R9RB 3K5MA 5KRSA 1NJIW 2RN2A 1EZJA 1M1KO 1YZBA 3AG3C 2DOSA 3JALA 4JI2O 3ZN1A 3CCEV 1N32O 5KX5A 1U04A 3QLHA 5LGUA 5LOVA 1RT3A 1Z7S4 3MN7A 4QE7A 5KTQA 1C0FA 4G28B 3HKEA 2ZJQL 4CZIA 3G4SN 1T44A 1U2VA 3JARB 5KAFZ 3R66A 3CMAN 1KXPA 3OYEA 3CCVV 4UV9A 3RW0A 3T1HO 1HR0O 3DWLA 5JVDA 1RUC4 2XAGA 2WC9A 5DM6L 1XC9A 1S3JA 2Q0AA 4CZJA 1NA1D 3D3QA 2ILMA 1NGCA 4KBOA 3J7AP 2GUZB 2YKMA 4FM1A 3DXRA 3U0ZA 1OCZC 3CCUV 3OR7C 3CRQA 4DKWA 4CHYA 4LF7K 4BC5A 4TSXA 3HP9A 1W59A 4WQ5C 3AEFA 1S5LZ 3SJAC 4X1YA 2NZTA 3DOLA 4LH4A 3AAQA 1SQXH 4MSWC 2YIBA 4DFJA 3NR7A 5FNVB 3DYAA 1ZP0A 2W0FC 5JH7A 4HAMA 1QTMA 1YF2A 1ENVA 4MTOA 3LDSA 2ZD9A 3THYB 4DV2O 1YI2V 3VQQA 1N34O 2X0LA 3JD4A 2YHWA 4E7LA 1U45A 3WXKA 4BREA 1QR8A 1SQGA 1V55C 1GM9A 4BDYA 4NCBA 3KWGA 1QQNA 4IG0A 3O5BA 3SYZA 2V1DA 4CEDA 4LR3A 4CHOA 4FPPA 3SI6A 2E5LO 5LGTA 4Q4W4 3RN4A 5EZYB 2GEMA 4FJHA 2LW7A 3G0ZA 4H5VA 2YSUB 4YIPA 3V1RA 4BWMA 4G9ZA 4GX0A 4N5SA 2ZE8A 4DTSA 3E2EA 3AVNA 5L3BA 2E2OA 4FW1A 3LSSA 1HRI4 1NJWA 5E26A 4OPHA 1F51A 3RYIB 5J2QA 2E76B 5LGNA 1R6KA 4FJ8A 2QM7A 3RR7A 2P4KA 2JDIG 1DEJA 3CC2N 2WOMA 3OS2A 1YIJV 3VQPA 4CJLA 3THXB 5C2TA 3A5OC 1EQYA 3D8CA 4I50B 3AG4C 4A61A 5KGXA 1BQMA 3CJCA 3HKCB 1IKWA 1POV0 2ZM6B 3OVNA 3PUFA 4CEZA 1RVF4 4U7BA 3VRBA 1TYQB 2P9LB 3WXIA 4CECA 5K1PA 3C7NB 3D2EA 2HHSA 2PYJA 1NBWA 2ZR2A 1AL24 2GTDA 1Z5WA 4PI2A 3LZIA 3KHYA 2ZDIC 2HF4A 5EK0A 2VG5A 2WTUA 1W0HA 1SL0A 4KHYA 1OH6A 2CGJA 4TSFG 2E4LA 3LNMB 3MWPA 1WLJA 4K25A 4CIGA 1YVNA 1Q86O 3IFRA 1QLEB 3CB2A 3HM8A 5KPZA 3JALB 4I55B 4WQ4A 4IOAL 1WJZA 4UCTA 3A5NC 1H2GA 2HFEC 3L4QA 4M42A 2ACZA 1T5EA 3M3ZA 2X6CA 3HKEB 3CCMV 1R59O 5I3UA 4PUOA 3UCSC 1IKXA 3ZMVA 4N47A 1G15A 5LMNK 3EZWA 2LFRA 1U2VB 1QBZA 2JGDA 5JJNB 3JATA 2F96A 4H0YB 2NLXA 1R084 4O4JB 1SV5A 2AJQA 3L4IA 5JVDB 3AO3A 3CHWA 1S5JA 1YUWA 4WFFA 1XMQO 3RVCA 1GKFA 3LDQA 4ISGA 4BRHA 1J5OA 4CJPA 4X20A 3H1JH 2LSNA 5SWMA 2ZDIA 3DXRB 4MFBA 2QEXV 3DLHA 4GVMA 3EHBB 2UXCB 1R3IC 4JEPA 3VR8A 3L2RA 1KVCA 2IH1C 2QM8A 1RDDA 1BHLA 1Q82O 3AG3B 1VBA4 4DTRA 1VSMA 1E3MA 4DSEA 2F93B 4E7IA 4LC1A 1RT2A 3H6EA 4KH6A 4X1YB 2HHXA 1DGKN 2IAJA 1FJGK 2QA4N 4O55A 1K73O 1RSOA 5JH7B 2A7WA 3FZFA 3VF4A 1EFRG 2RMU4 4X64O 4FK5C 5KHGA 3N2KA 2HF3A 5FPNA 3VQ7A 4DG1A 3O9UA 2A1RA 2W42A 4N41A 4LFBK 1RMU4 2Z1HA 3ABVA 1MZEA 1JMKC 1FPOA 2UXXA 2QK9A 3CX5F 5A9GA 1C0UA 5BY1A 5B1AB 1K8KA 3GWKC 4Q20A 2DFFA 3BRCA 1NGDA 1OCZB 4P30A 2P9KA 2Y1JA 4I7ZB 2V51B 4LF7B 3VQXA 3E89A 2IGIA 5CZ2A 3SLCA 4BVPA 1QR9A 4JKGA 4AHSA 2QWPB 1VQNN 1OHHG 1PKXA 3A0BZ 3WU2Z 3LP1A 2R064 1N33K 1IBLO 4B3SK 2FBTA 1B92A 4DO2A 3K3WA 2JEUA 1RILA 2G8FA 3GBTA 2OPQA 5SZTA 2WPDG 3WXLA 2E74B 4MVUA 4DLGA 1NQTA 3DTUB 1YDXA 1V55B 1B9DA 4DU1A 3MAQA 1D8YA 1QSSA 4BY9C 2QM1A 1PNLA 1T3VA 1RNHA 2YI1A 5H5NA 4JI1O 3CHXA 4H13B 3FZHA 1VBE4 1Y4MA 5AFUA 2EWSA 4GY2B 4DV4K 2UXDK 4X1IA 2VRZA 1KKDA 3ZRVA 2FF3B 4B9MA 4QGPA 3P38A 1AI6A 1I08A 2VGNA 2OANA 3MCAB 4HNAA 1HNXO 3WXJA 4B9QA 5AZJA 2B4JA 3KLFA 2RS14 5CN0A 3JCUZ 3H01A 3D45A 3W7UA 4A57A 5M1PA 2HHUA 4M3RA 4YY3K 3RMBA 3P31A 4CS4A 3AG4B 1EM1A 1O9HA 4LF8O 3LDCA 5LJWA 3OYNA 3PX0A 3JSLA 4BG8A 1ZSPA 2OT5A 1K5QA 4N21A 1AP6A 1N4CA 3PN1A 2ADQB 3ZBHA 4I0XB 4CC6A 1VQ4V 3DRPA 1S72N 3OGCC 3E9LA 4OJRA 2MW2B 2XTAA 3CJ7A 4CERA 4Y0WA 5A2QO 3ETGA 2BCCH 1K9MW 3K9JA 3RMAA 3VRAA 3ZETA 3TSPA 3E35A 4BRMA 1KBHA 3D3IA 3AVGA 1WP7A 3UIQA 3HRGA 4E89A 1T7PA 3LNNA 5FDLA 3BF3A 3G6EN 1QNMA 3JXUA 2OIGA 1FYJA 5AQQA 4ELUA 3A8YA 3B8NA 1HP8A 3EE9A 4TOIA 1BI4B 3CFRA 4CFCA 4X66O 4BGAA 2CGOA 5KRTA 2DW4A 1UOCA 3CM6A 4F4LA 1GLEG 3N4PA 1P4RA 3O08A 4LSNA 3SJBC 1U6ZA 3HPGA 5A2QN 4BRGA 4Q0BA 2O8EB 4CGGA 1F4MA 2XNDG 5LMNB 4FL9A 3L2WA 2R074 4NXMK 3TSQA 5C10A 3AVBA 2QKSA 2D0BA 4KTWA 4M7XA 1ATRA 4BRLA 5JMVA 3ZEUA 4XBFA 4FOEA 3HR0A 1HRV4 1LAWA 1K34A 3L72H 3OYLA 3GG4A 3O6WA 3CD6N 3IJ4A 2BTQA 3TI0A 1THZA 3OW2U 2OTLV 3O9TA 1VMGA 4DW1A 1K8KB 3EN9A 3HKBA 4W4KA 2X6BA 2WQYA 3OAAG 3QO9A 3AK1A 1I5XA 4GNIA 1QZ5A 1VQPV 1RBVA 4JKGB 3T3FA 3ETEA 4YSXA 3QESA 4JAVA 4DUYK 5KHKA 1D5NA 4U3JA 4EIAA 2WS3A 4X65K 2XY7A 2F7TA 4I4TA 3LM9A 4JD2B 1FJGB 1IXMA 3ZHRA 2LP7A 5J2UA 1KC8W 2GWJA 1NNEA 4UVAA 1RPOA 3D7EO 4WCEL 1WPXA 2AZ0A 2OCCC 3K03A 3QF7A 4JKHA 3ID6A 3C3SA 3M8AA 1HJRA 2HSTA 4LFBB 3WQTA 1Q7YO 1FW6A 4QE9A 4KHPK 2P9PA 1K97A 3OYFA 1MMMA 3P1GA 3VEOA 1XREA 5DECA 4KRFA 3CC7N 4XH4A 1FS0G 4IIJA 2IS3A 2EIKC 5CMUA 4GV9A 2PGGA 1SERA 1JVMA 2O8CB 3CC4V 4FO0A 3M6GA 2VS0A 4PA1A 4HVJA 5ELZA 4AILC 5LL6Z 2Q68A 3B09A 1MA1A 1JJOA 1HYSA 1PNMA 1N33B 4LFAK 4HNAB 4B3SB 3U9ZA 3ASOB 4FJ9A 4EEQA 1GO3F 1R6NA 4J7KA 1WUAA 4RW8A 1SQPH 5AZIB 1NGAA 2VQEK 2FBWA 1JX9A 4ABMA 2YNGA 4Y1CA 5FROA 4B3TK 3AA4A 2E2PA 3THWA 4PHZA 2XY5A 4JKFA 3IRXA 1AR74 1ZTEA 5BZBA 3P39A 3H1IH 4FZ1A 4FWSA 1ZBFA 1Y76A 2UUBK 1S5HC 3HVRA 4DV0K 4OLAA 3A2FA 3ATUA 1RDWX 4ID5A 4CF8A 3ETQA 3F73A 3K0DA 3VQ8A 1MWKA 3FLCO 4DWIA 2XAHA 3ZETB 5IJ0A 4JS5A 4DV4B 2UXDB 4FLXA 1ZOYA 3FB5C 4CS2A 4AHRA 3CPWM 2FB5A 3EO3A 1NMNA 2CGKA 4GKKO 5HLFA 4KHWA 3AEDA 2ZQBA 2GSMB 1ZL8B 4O5BA 5AQFA 4FM0A 4PKGA 3AG2C 3OYKA 3VTHA 2ZT9B 4M3XA 2D0PA 5H1SQ 2FSNA 4ISFA 3VGKA 3L71H 4EFBA 3W0LA 1KQSM 4JI5K 4YY3B 3VQ4A 1ZBIA 3B4SA 1EETA 4MQ3A 5KHIA 5JS1A 4IOCL 3T7ZA 2RKIA 1LWEA 1MWMA 4LH7A 4B3MK 2XY6A 2WLHA 1GRJA 3UQ8A 2Q7GA 3ZT0A 4P2ZA 4CZFA 4E19A 5C25A 1L0LH 4ELVA 1C1CA 2BTQB 2JVDA 5KUKA 2AA4A 1GLLO 4JI7K 2N04A 1HPMA 3HKBB 1PD3A 3VTIA 2WSSG 1RP3B 5JWPA 4AQYK 4GX2A 4KKOA 3FB8C 1ZBUA 2ASMA 2D1KA 1IBMK 2VWJA 2IBZH 1VSIA 1JLQA 3L2QA 2FMLA 5CA0A 5IYZA 1SQKA 4NB5A 4PKIA 2KG7A 4F6RA 2V7QG 1PL4A 2IU0A 4H4OA 1YT3A 2AXTZ 4CGFA 4DF8A 2B1GA 3S3XA 1JOYA 1EO1A 1Q6HA 4NXMB 4E7KA 2OTJN 5BR8O 3STLC 1VARA 5CB4A 4FPBA 2LJ2A 1HPZA 2QKKA 1BT8A 1Q81W 4AI8A 3K59A 2CTWA 3HYFA 4MTFA 2OZMA 1B9FA 1TGOA 4IIJB 1VQKN 1VQ9N 4C1NI 5E41A 1AVMA 1G8MA 4B1UB 4D7SA 1GLFO 3SBTA 1RPRA 1PP9H 1BISA 4MO4A 1URFA 1OH8A 1V54C 4PDRA 1TKTA 2P6JA 1KD1O 3G71V 5JLFA 1I7FA 4DUYB 4CCHA 4X65B 5H6RA 3WNEA 2PZSA 3SUCA 4K8ZA 2DYSC 3SNNA 3SPJA 2HHHO 4LNUB 2P9NB 1VP7A 3P30A 1M4UA 2GV9A 1WSEA 2HNZA 2OCCB 4C8NA 3THWB 2NRWA 4DSLA 4KHPB 1ZX3A 1AR1B 1S76D 1Y76B 2A06H 1KLMA 2YCHA 1WB8A 4PELA 2GHYA 4MLEA 1W9HA 2EIKB 1IV0A 5B5EZ 3A0IX 3AO1A 4CGHA 4DLEA 3EL2A 1NJIO 3Q4HA 5IJ0B 2CTQA 1VF6C 4NCAA 1C0MA 1RBRA 3V9ZA 1QSLA 5K14A 4MO5A 1CPYA 3RFRA 4MTGA 4PA6A 1GOCA 4I6MB 4C23A 3ZRSA 3W7XA 4LFAB 2HVIA 3ENOA 1NTZH 4LF6K 2VQEB 4GVEA 2IW5A 1SAZA 1VBB4 1SQQH 3BY6A 3DMJA 4OKJA 4B3TB 4RQFA 1VQMV 1TKXA 4PDWD 2B9ZA 4WF9L 4AHUA 3OGIB 5AQTA 1RBSA 4CBUA 4WFHA 2YXYA 1SKRA 2XAJA 2WU5A 4CHZA 3I55N 4K0KK 1U4BA 2UUBB 4DV0B 1JXEA 4DR7O 3WG7C 1MOFA 3ISNC 1GLAG 5KQ8A 4CBXA 1QQOA 4JI0K 1XDCA 3QNEA 4IEEA 3T4ZA 3O8MA 1LW0A 3ASMA 5AQVA 1VF6A 1RDUA 4CJ4A 1BHAA 3V9SA 4UFZA 4TV9A 4U67L 1HJOA 1AR84 4E7JA 2Z3YA 3APOA 4LSLA 2HHWA 4DR1O 1KRPA 1Y66A 1R1BA 3AG2B 4K35A 1NI8A 4LY7A 4BWJA 2WDVA 5CA0B 5IYZB 1E79G 1DTQA 3QO5A 2KG7B 3TAEA 2YHYA 2CAZC 4JI5B 2HWC4 3E9PA 3ABKC 3E8BA 2Q7EA 2ZINA 4QS9A 3VGLA 1T8EA 4FWLA 2X6AA 2GX9A 4QIWF 3RYHA 3STZC 5LMUO 3VA3A 4KAZA 4E1NA 2WLJA 3E8GA 4B3MB 3W7TA 4O0JA 2O8FA 2QW9A 3K5OA 1KLNA 1JLAA 5C2DA 4O4IA 1UFIA 4B1XB 4JF3A 4JI7B 1RT4A 4DV7O 4PV1B 4AQYB 4ILJA 4GV6A 2IM9A 2DQ3A 1IBMB 4KB0A 2VGMA 3UKMA 4CF9A 3QNOA 1FK9A 4PDVA 2HKOA 5KHHA 5CY4A 1ASUA 5CE3A 4KFBA 4IDKA 4YHHK 2NR5A 4M3ZA 3DLEA 4KL1A 1QVFU 3TXQA 3DLKA 5C0YA 4IO8A 1NJZA 2QXFA 1AI7A 3JARA 4MW8A 3O4QA 5TISZ 3HB3B 3N2GB 2Z0AA 3SPIA 4X1KB 3O9OA 1RUJ4 3CM5A 1N8RO 2QKCA 4YSZA 4H5WA 2MK3A 1PM9A 2GUZA 1DTTA 2Q0OC 2QWQB 3Q4HB 3KKYA 1IG8A 1U48A 2QJ1A 4KTQA 3OTOK 1NK0A 4FJ7A 2YXLA 1H2MA 5EOYA 1SKSA 1NLVA 3OT7A 1KAZA 2OA8A 1SKWA 2Y48A 4MTXA 3ULDA 3SJJA 3ZCCA 3L3UA 4G1QA 4CZEA 4DTXA 3MMVA 1NT2B 5GAHP 1LR1A 3TAGA 2DYSB 1SZTA 4CZMA 4IZ9A 4CF1A 3MX5A 1RBTA 4DR4O 3ZSZA 4C7UA 3IFXA 4IOXA 4CFBA 4BDPA 4DQPA 2LGQA 1F4NA 1ATNA 3AO5A 5DM7L 4R50A 2ASPA 1TAEA 5CR4A 2J4RA 1TAQA 2OIEA 2CH5A 2YJFA 3THYA 3SAFA 4LF4K 3T1YK 1Q9YA 3CCSV 3KD5E 1RUH4 4LFCK 3ZSYA 5AQLA 5AQPA 4PL8A 4FLYA 5IWAO 2YJEA 2BSKB 3R9PA 2ETJA 2R7FA 3QDKA 5EZYA 4TV9B 1NTKH 1ZLZA 2N05A 5J1EA 3AE6A 1GOAA 3WNHA 4OVLA 4CIEA 5JLHA 5C15A 4O5FA 1W2BM 1TKDA 4B3RO 4NYKA 1KB9F 2Y1IA 3RMCA 1VRUA 4H37A 4QPJA 2HNDA 1AR4A 4LF6B 4YSYA 3AE5A 3TABA 1X3NA 3HT3A 1P49A 3BDPA 2XAQA 1X3MA 1VQLN 4HTUA 3ICXA 4KO0A 3H08A 2XHBA 3ZRWB 1C6VA 3CQYA 5AFUH 4MDBA 4UB8Z 4CHPA 3THXA 1NK9A 3CCLN 4K0KB 4I50A 1VF7A 3S3WA 3CJ9A 2R70A 3RYHB 2XASA 4BE0A 1JL2A 3WG7B 1S9GA 4JI8K 3N27A 5IYCO 5EYPA 1TYQA 3BAAA 3CJHA 4JI0B 2P9LA 1AJPA 4HWIA 4CJWA 1PVC4 3C7NA 4FMTA 1KCFA 1ZWIC 1QU7A 3M7MX 1L3VA 4BAYA 5C8YB 2A9HA 4CGJA 3I0RA 2E6MA 2RNBA 1K8AO 1CXUA 4DSJA 3JCZA 3O1BA 5LY3A 3U8XA 1VQOV 2ZCEA 3F2KA 2ZJRL 2PI4A 2FXUA 4RWTA 3CG7A 3DSQA 1Q18A 4H5TA 2RF2A 4I55A 3WEEA 1VQ5V 3ABKB 4OX9O 3K9AA 4NTXA 3JD74 2I5JA 2BTFA 2PF4E 1BA1A 1BU6O 3B77A 3NCIA 1H2NA 4JI4K 4FZ0A 3VEXA 1XQSC 4ASUG 3O3FA 4O4JA 2YUAA 4QJFB 4O2AB 1K6YA 1Q9XA 4J2DA 1HWYA 1Z05A 4DQ8A 3IAYA 3HOTA 1M9NA 5DMRA 4Y1DA 1TK8A 5LP6B 3CF5L 2ZGYA 4BQZA 4GB34 3BZCA 2B5JA 4CJTA 3DLLL 4DV5K 1YJWV 3RRHA 3SPCA 1ZBHA 1OVQA 3P5JA 5B1AC 4O44A 1R6TA 5MLCQ 4BQLA 5E1AC 4IG3A 5H6QA 3VGMA 3NVMA 4XDLA 1LNQA 3GQKA 3S9HA 5KQDA 3C3TA 1NU0A 4IJNA 3DRRA 2EZOA 1J5EK 4YHHB 2W6LA 3TAPA 1PO14 3CYMA 3UB5A 3ZHTA 3KKSA 2RMKB 5FRMA 4GKJK 4CZLA 4LH5A 4CHNA 2IJHA 4ID1A 4TUYB 3ITHA 5GIPA 4X89A 3RTVA 3SV3A 3KD1E 1VQ7V 2M6YA 3CRCA 2H94A 3B8MA 1HNWO 3QB0A 1JCEA 4BR4A 3LPTA 3NGZA 3FE1A 1X9WA 1YITN 1BCOA 1VSFA 3OBWA 5HRRA 1RT6A 2YNFA 2FC0A 4YDUC 2HWB4 1EWRA 2Y69B 1KVAA 4JI6O 3OTOB 3UO3A 1CXQA 3AK3A 2P9UB 3VESA 2D0CA 1PO24 3FAVB 3J7ZO 4HUGA 1TL1A 1IO2A 1N36K 1U97A 3CCQN 3ABLC 1MQTD 4NXNO 1OZ0A 2UUCK 2UUAO 2V4DA 2QWPA 4WQ5A 3AA5X 4LF9K 5FLXO 4Z4EA 3LL3A 2ITCC 1X1PA 1WOQA 2ZE2A 3I8DA 2F4VK 1X4TA 1VIBA 3VQDA 4GT1A 2ITGA 4JKCA 4A5UB 1RTJA 4JK7A 3V81A 3RYFB 1BCMA 5JQGA 4LF4B 2KHOA 1WB7A 3T1YB 2Q6AA 3L2UA 3VENA 4LFCB 2QTDA 4O4LA 3THOA 1SC5B 2XAFA 5EYPB 3WQUA 3CJHB 5FLXN 1ASJ4 4YDUA 4ZBMA 3LP0A 4HTLA 3KLEA 1XL4A 1IZ3A 4A5BA 1LUWA 3CJ1A 3CCJV 1HDJA 1XNQK 2EJ7A 2E88A 4JV5K 1L5UA 2ZNIA 5HL7L 4DV1K 4I5SA 1QQMA 2Z1GA 1UAXA 1XWLA 3I56V 2YI9A 1KAYA 3KIOA 4NLCA 2WFBA 3O4WA 3C94A 3QBWA 3CCEN 4IYHA 2GTAA 1TVKB 4NO7A 2Z5UA 1YAGA 3WEEB 2V7YA 3U4LA 1RTHA 2IOCA 4TT3G 3E01A 1QSYA 2GELA 2HB5A 4DU4A 4YT0A 3FGUA 2JS3A 4JKEA 4RQEA 2JIZG 4PA9A 2Q97A 1YXBA 3CCVN 1DT9A 1YF5L 1R3JC 2RQ6A 4JI8B 1D4M4 2WA3A 1KMIZ 4I0XA 2XOKG 3J7YP 3OMIB 3LANA 2WLNA 4EFHA 3EEQA 3LDOA 4FWRA 1W0JG 4C8LA 3C90A 3BUZB 3HOSA 4H0LB 5HP1A 1WBDA 4I2PA 2D0AA 3GL1A 4IO9L 3ZEDA 1NVPB 1GN6A 4J42A 1VF5B 2DN9A 3CCUN 4FCYA 1LV5A 4WFAL 1KU9A 2FSKA 3PSIA 4CJSA 2DQ0A 1XC3A 4E1MA 3VQWA 5KPRA 4R8CA 1BI4A 2HVJC 3SBGA 3SQ2A 5D3GA 4CBWA 5IYBO 4JYBA 4CJ5A 5IT9O 1PNKA 4UB6Z 2Q31A 5KAIZ 4RWUA 2YHAA 3MX2A 2V7ZA 2RHKA 2O8EA 5HRNA 4E1JA 1RBUA 2A0LA 3JSNA 3OM3B 1VSKA 4JI4B 3ZX6A 1YI2N 1QVGM 2P4VA 3MEGA 4AM7A 5JVHL 5EXWA 3OMNB 2G8WA 1D5AA 1G99A 3MWTA 4AF1A 2A79B 1YTUA 4IFVA 3JASB 4DV5B 3VQ5A 5J2NA 4KI4A 2FL4A 2FBYA 3OUFA 3CYOA 1QLNA 2ZM6O 1XNRK 4CEBA 4IGGA 5JJJB 3OHRA 5AQNA 3ZMZA 1ZYQA 1KYOF 1M56C 3QO8A 5JCOC 1IG9A 1J5EB 2HVKC 2R7YA 4JI3K 1EV14 1YJNV 3GDQA 3O9QA 1XBLA 3ASOC 2JRIA 3NF8A 2F23A 5D5PA 2NRHA 1NK4A 5LYJA 4GKJB 4JD2A 1NK6A 1YIJN 3V9UA 5AQKA 2BE2A 1OCOC 4DV3K 4KFMA 3KKRA 3SR2C 2Y4TA 4CJUA 4GMJB 4BROA 1TV6A 4A2BA 5JQGB 1M90O 4DFMA 1BL8A 4GX5A 4MVOA 4UXNA 4IKFA 4DR6K 4EFEA 4O4LB 4Q6GA 4CVNE 3AVCA 3AEIA 3CXHF 3QIPA 1DLOA 4M63C 3CRRA 1TK0A 2OPPA 2YICA 1NJYA 4XEIA 2O8CA 3LWLA 3IGAC 1GM8A 3P3NA 4PDMA 3ABLB 3E9OA 5JVGL 1NK7A 2UUCB 1VSDA 4KX6A 3W7WA 3TETA 3AGKA 3E83A 5L3GA 3CCRV 1JJ2U 4LF9B 3MN9A 1JLBA 3VQ6A 4IBNA 5AQGA 2O8BB 4DR2K 1SKVA 5AZIA 2P90A 5J9PC 2CDYA 4FJMA 2F4VB 3CCMN 4Z2WA 4DQSA 4MVRA 4LWSB 1Q81O 1OH5A 3PO4A 5L3CA 2UXCO 4ELTA 3ASNB 1SA0B 2PAVA 1EX4A 4FWKA 2KZZA 4G2KA 1MNGA 2X7RB 1NENA 2F9WA 3FZMA 5M1FA 2GDSA 2ZIMA 3OYDA 4YORA 4DFPA 1S22A 5AQHA 3CERA 3WB1A 4BR2A 5BMVA 2VQFK 5CBHA 1NH2D 3ZSVA 2QEXN 1XNQB 1BQNA 4JV5B 3OYHA 4DR5K 2O57A 4DV1B 1L3TA 4J80A 3P4RA 5E84A 4UCRA 1ZL8A 2KSDA 1IBKK 4FZZA 3TXSA 2HJFC 4FJXA 4Q4Y4 4DV6K 4CJFA 1JR9A 1NM1A 2CGNA 3X2QC 4RUFA 1KVBA 3H3OB 1R73A 3VQVA 4HYOA 4B1YB 3M8SA 4LF7O 1KFDA 4L3QA 2RCVA 1SQFA 2G38A 5J2TA 4BE2A 3K04A 2YKNA 3TR8A 1HYZA 1SZXA 2HHQA 3AE3A 4DR3K 1PL0A 3H9VA 2A5XA 3TAFA 2LQTA 5LHHA 4MT8A 3KZBA 5I9EB 3IG1A 1NGHA 3CQ8A 2R044 1SETA 1BQ0A 1CZAN 1RUG4 4KTZA 1YTFD 3MHSC 1LW2A 3SMPA 4D7TA 4KPYA 3AG7A 3SFDA 1JFFB 1BMFG 2BANA 5FPRA 4J2EA 3AV9A 3OW2M 4EZ9A 3PY8A 2XRIA 3CMEV 2HBMA 3EKUA 3ZS8C 2QM4A 2KKWA 3HKDB 3LM2A 3HK2A 2EBOA 3OS0A 3JD1A 1J53A 3DXMB 3ZYYX 3JAMO 4JPRA 3PX6A 4PJ0Z 2UYTA 5LYJB 2LFSA 4O0IA 4BW9A 1LWFA 3HSCA 1EN5A 3VQCA 4R5PA 3PSFA 5J2PA 1VEWA 2G8UA 4KI6A 1JL1A 2VG7A 3WT0A 1RUE4 4YXDA 3SUQA 4BWAA 2ZE5A 5H9CA 3JD3A 1NKCA 3JAMN 5D5QA 2OPSA 3HBTA 4JS4A 2CE4A 2HNYA 3ML0A 4RO2A 1XI1A 1AJQA 1HNIA 4BDZA 4FSVA 2YV0X 5ITZA 1WAFA 2AHZA 1XNRB 1YEWA 3OEEG 2HBJA 1RT1A 1Q86W 5IE9A 1FKOA 2KKZA 4O4HB 1M56B 1KP3A 5GAGP 3VEVA 4JI3B 1RFQA 1ASVA 5LJVA 3RWUA 4RUEA 4O8UA 3TTFA 4JYAK 4LNUA 2P9NA 2YX6A 1OCOB 2ZNJA 4DV3B 3QFUA 5L3EA 5C42A 1L0NH 2ZGZA 5BR9A 4N76A 2HOEA 4KXRA 3HM9A 5C3JA 2KFNA 2NN4A 3NH0A 3K5NA 1VQ4N 4BC4A 2PYLA 3DLRA 4DR6B 1X9JA 1XMOK 2WLLB 2Q7HA 1VQ6V 4IEIA 2A42A 5BMVB 1HQUA 4OO1J 2OWOA 1YJ9V 5LMNO 1GLDG 3R8EA 2P51A 3JBG4 3DC5A 4Z4CA 4X62K 1WLEA 4MW3A 4C1NK 1CLQA 2WWWA 1NWKA 3IUCA 4I6MA 2ETNA 5IDJA 1R0AA 4TQDA 3BEXA 4DR2B 3UKRB 1AILA 3CI5A 3LDNA 3R1XA 2IVOA 3V1QA 2UXBK 2Z1JA 3CSXA 4WFBL 4GZRB 2ZJPL 4M3TA 1YCIA 1OOPD 1YHQV 1H2SB 5J2TB 1D2DA 1HNVA 3K0SA 2JJ2G 2ZXWC 4ISEA 4DU3A 4WBNA 1I94K 1F21A 4IFYA 1S6QA 4EZ6A 1NZ6A 2Q73A 2RJZA 4FLVA 3FFKB 2QTSA 4UVBA 4OGEA 2A3ZA 1IX9A 2ZWHA 4CESA 4XH1A 1XHZA 1WA8A 2VQFB 3EE8A 5IY5C 1FJGO 3V9WA 3RWRD 4OPKA 2OTLN 2EIMC 4CJKA 3CQXA 3IDHA 4W5RA 3QEPA 4LF5K 2H88A 4DR5B 4LH6A 1T6CA 4PA4A 2P5GA 1EAH4 3O4NA 4LFBO 4YTPA 4JTDB 5B1NA 3SYAA 3CMEN 4FJJA 4FXDA 2HVHA 4CEQA 1VQPN 4YJ2A 1GK9A 2DMXA 2HR3A 1IBKB 1RCHA 4PKHA 4R6ZA 4H5NA 4DV6B 1S77D 3AE2A 2PFUA 4WYBA 3GWOA 1C0TA 2AP1A 4RTFD 2NLJC 1N6QA 3SYPA 3X2QB 4KP4A 1BO5O 1RDAA 2YEVB 3SYOA 3DLGA 3FD9A 4UCVA 4B08A 3OEHG 2QXLA 3L6QA 1TL3A 1RTDA 1CXZB 3FZLA 4DR3B 1N33O 4DXWA 4B3SO 4UCOA 2IDOA 1NKBA 2QWRA 2UU9K 1Y64A 2ZQMA 3HVTA 4BRNA 3KVGA 3CFOA 5KLVH 1CZBA 3K9KA 2GBOA 3EY1A 4DV3O 3OYAA 1WNSA 4TV8B 4DHYA 5LA6B 1G6UA 1SL1A 3CC4N 2HHTA 4H44B 2HW3A 5BPNA 1S0VA 3JAKA 3P3PA 5ITZB 3J8AA 3RBZA 1Q90D 4KHUA 1H8EG 1O13A 3KWIA 1NJXA 3DLBA 1XHXA 1BOTO 4FJNA 3J80O 3ENBA 3P4SA 1VRTA 4BC2A 3KLHA 4JTAB 1VRH4 4DV4O 2UXDO 2HBKA 3HJFA 5ADXA 1KSPA 2PTMA 4NB4A 2F1MA 5GTHZ 4YOXA 3CRAA 4JI2K 3N2GA 3AO4A 1N32K 4YTNA 4X1KA 4RHV4 2DWDC 3AARA 3NHGA 3J80N 2YIBD 4H33A 4YY3O 5IYDO 3U9DA 3U6FA 2FYUH 1NGEA 2DJVA 4FWOA 2G8KA 4QNHB 2QWQA 2K9PA 4QAGA 5F2VO 4MDAA 2JLEA 2HJDA 1BGYH 3T1HK 1HR0K 1SS6A 3A5MC 5FPDA 2I7PA 2NUBA 3V6DA 3E66A 3IC9A 5E79Z 1KF6A 3VERA 4I9WA 4I7FA 1V4SA 4JYAB 4IWVA 2G8VA 2QDOA 3O9RA 4P9OA 3KK1A 3H1QA 2CH7A 5EBWC 2A6AA 4FFBB 1C1BA 3GE1A 5GINA 4WBNB 3QVNA 2YI8A 1PV0A 1BUPA 1XMOB 2EILC 2BOCC 2JS5A 2JEXA 4EHTA 3ZIAG 1WA8B 4WFGA 4CF2A 4FWMA 3EVKA 3NXSA 2IIRA 5AQUA 2BSKA 1BCCH 1FXKC 4LC9B 4NXMO 4RG8A 3FYEB 2CUGA 1AP5A 3D36C 4X62B 1GN2A 2I7NA 4DV2K 1N34K 3H1HH 3AECA 4ZKIA 3I33A 3KJVA 4YJ2B 2Y0IA 1S6PA 5CBFA 5GAEP 1WSGA 2ADPA 2HBLA 1YVUA 1N5YA 1RT7A 2E5LK 1CEZA 1TUUA 2UXBB 4DQRA 1AI4A 4W5QA 3K08A 2FKXA 4PA3A 1VQ8V 1NGBA 3I5DA 2CTRA 4UV8A 3MN6A 4MVZA 2IJIA 4JHDB 3L2VA 3ZRWA 5AQWA 4DUZK 4B9VA 5EC1C 2ZXWB 1NGGA 4J7ZA 4DSKA 1HW7A 1I94B 4DUYO 1LUVA 2B6AA 4CH5A 3E86A 2QTOA 2ZKOA 2DE0X 4X65O 3MK6A 1JCFA 5KPTA 5EU7A 1JPXA 2QWRB 2ZE7A 3VQYA 1H2LA 5IY5B 5M1OA 5GADP 3OY9A 1FXKA 2EIMB 3BCCH 4CEAA 5LP6C 3BF1A 2IU3A 4L8JA 1X9SA 4LF5B 4M3YA 2ZD1A 1DF5A 1K7DA 4KHPO 5C8YA 2ATQA 3HPHA 3K06A 3U3YA 1U47A 1NR1A 3JAKB 3NVKA 3G71N 3GB7C 3FZKA 2GUPA 4CK3A 2Y0PA 3L73H 1S1XA 4BRKA 2E8AA 3C0BA 4H0OA 4DTJA 4ZOLB 3JD0A 2BE3A 4BRFA 1BG3A 2PUSA 5IJ9B 5BPMA 4W4LA 3BGRA 3VBBA 4K42A 5HFLA 4HBNA 1E1QG 1K4DC 2LGWA 1NR7A 4H4MA 4FM2A 1RUF4 2VCPA 5BPLA 4NYNA 1WSFA 5LL6Y 1H1VA 1IXBA 4CZZA 1GLJO 4RW4A 2EJRA 2LW1A 5BXZA 5CYMA 1GTOA 4F3OA 4LFAO 1BIZA 1QVFM 1P8ZA 2GWKA 3HI0A 1T03A 2VQEO 2UU9B 4O2AA 3DOKA 4OPJA 4JYAO 4HUFA 1R3LC 2HMIA 3IMXA 3AVLA 4B3TO 5LP6A 4RW9A 4MVSA 4DS5A 2F8SA 4CZGA 1TUBA 1B04A 1XILA 4J10A 2Y69C 3T69A 2WA4A 4PA7A 4BE1A 1K5SA 2UUBO 4BIOA 1NGIA 2R9IA 4DV0O 3ZN0A 5FPOA 1AJNA 1AR5A 1VHXA 1XMQK 1YQ3A 2QSAA 2E75B 4FPAA 2NRTA 3OYMA 2W6JG 3SK3A 5T7BA 2WAMA 4CGIA 1OKJA 3G4SV 3UE5A 4CS3A 2C2AA 1M57C 1VQMN 5H2FZ 3CMAV 3D2FB 1WAJA 3ZT4A 2KLAA 1U49A 3JYTA 5C2FA 2CH7B 3APQA 4TUYA 4F8RA 2B1IA 4JI2B 3NAEA 3RSEA 1N32B 1K5MD 2FSJA 2PW9A 1UA0A 3ZHVA 1AI5A 1A32A 3SPHA 2HMPA 1KAXA 4JI5O 1EBOA 3DI6A 2YC0A 3NBPA 3KK7A 4ZHQA 3VR9A 4U7NA 3M8QA 3DC6A 2Q67A 3KLGA 2P9UA 4X64K 4ZTJA 4EB6A 1NG9A 2D0OA 4TWKA 3K5LA 3T1HB 2XUMA 1HR0B 3FAVA 3PLAA 2RDCA 4B3MO 4EP4A 2E1YA 1NS1A 5EC2C 2WLKA 4IDHA 4KH5A 4BACA 1UPGA 3JSMA 2Q0UA 4P9PA 2ZR3A 1JLEA 5C12A 4F3TA 5EBMC 3AVMA 4OLBA 3WNFA 4ICLA 4JI7O 3CE2A 1RGIA 4KH4A 4DW0A 4AQYO 1A5WA 4PHTX 3SZ2A 4XDKA 5AQJA 1IBMO 1Q43A 1ZBLA 1X59A 4NTWA 3K9SA 3OYBA 3RYFA 2Q3SA 4JAXA 1LCUA 4JASA 3R6MA 2EILB 3ZT1A 3ZT2A 4B8AB 1IBLK 4BRQA 1O1WA 3O9SA 1IDSA 4JKDA 2ZF5O 1GAXA 3OYCA 2YHXA 4CE9A 5AJ3K 2BGGA 5JICA 4Z4GA 1FXKB 3WB0A 1TUEB 1ILYA 2QWMA 3IKMA 1NMDA 3TSUA 4DV2B 1JKHA 4WF9V 1N34B 1A5XA 2QI2A 1DF4A 3HPOA 3CXCU 2OPRA 1GLBG 5GONA 1DTOA 4FJIA 3CS5A 2CK3G 5CZ1A 3WUHA 3ZSRA 2E5LB 1TVKA 5CA1B 3CC2V 4BW5A 1K33A 2L35A 3OR6C 5B3SC 4FVMA 1ASWA 1ITGA 2P9SA 3GOIA 3NF7A 4JI1K 4PY5A 2RR14 1MSWD 3CJAA 4BIZA 4NVPA 5CBGA 2QE7G 1S3XA 4KHQA 3M8RA 1Y74B 4DUZB 4DTPA 5DN6G 4O2BB 4FWNA 4MS2A 4KV8A 4AM6A 4JYYA 1AB3A 4WE1A 2H3OA 3K79A 1HNXK 1VSEA 3T1CA 1BDGA 1COWG 3LPUA 3VEWA 5F0XA 1K3EA 3AA3A 4CI6A 4NR1A 2EIJC 4W5NA 4F2RA 4B7KA 1T6DA 3AE1A 4B9SA 1BL3A 1TUBB 4IXCA 5KA6A 3KLIA 3LDPA 4LF8K 3O65A 3SJCC 3OYJA 3EXAA 4PD4F 1GN3A 1UJWB 3ZCMA 4IFEA 5GIOA 3LP2A 4Q4X4 2YIDA 2GUIA 3G6BA 4K43A 1TAUA 3VETA 5B8HA 2BTOA 2KB1A 3IC7A 2D2CB 4FLUA 3N4QA 3LDDA 1VSJA 4HCBA 2BOBC 4J41A 4BR6A 1RT5A 1T05A 3JYCA 4Z4HA 3S3MA 4BR7A 1R3KC 2HHVA 5KMGB 3JAWB 3RGBA 3RSEB 4X66K 4GYCB 2XY8A 4LF6O 1K9MO 3CCSN 2A1SA 4DSFA 4FOIA 4UVCA 3SPYA 3A5LC 3VQEA 1SRYA 4QS7A 3ZHQA 4E7HA 4ZHQB 3JASA 5AR0A 4Z4FA 4K0KO 3BZKA 4CJVA 4V19S 4BRCA 3LUTB 4EB6B 3QICA 5L3DA 1EN4A 3AEGA 1EKEA 5LHIA 4DMNA 4CJEA 1XMQB 1RUI4 3M5RA 3ZSQA 1RHI4 2D3OW 4JI0O 3SJQC 3AY9A 2P67A 3H1KH 1BE3H 4PI0A 2QA4V 4BGBA 4FWPA 3FI7A 4LBEC 2YS8A 1M57B 1D9FA 3NH1A 3SPGA 3TTDA 4CH3A 3K57A 5BREA 1PIV4 4ILGB 3ID8A 3SCXA 5AQMA 3RVYA 3O80A 3ASNC 1B3QA 3B8AX 4JAUA 3QEWA 1SQBH 1YTAA 1WSHA 3LSUA 1LOTB 5FPEA 4YOWA 4W5OA 2WP9A 4H0VB 3BABA 3MDSA 3HP6A 1ZUQA 3TANA 3MXMA 4DUZO 2EHGA 3S3NA 1VBD4 2NRZA 4PQUA 4X64B 2ZIOA 4CH4A 3BY5A 4DK0A 1VQNV 2RN9A 3AVAA 3H1VX 3SQ1A 4WQ4C 4JZGA 4FK0A 1ROPA 3ZMSA 4BRDA 3EYZA 1VQON 3B40A 5GONB 1DK1A 2OCHA 4GUNA 1KP2A 5B66Z 2YHBA 3VQBA 3ZSWA 4Z4IA 1KC8O 2QGNA 1ORQC 4YOUA 4UCSA 1VQ5N 2O8BA 2P9SB 5F2RA 2Q36A 2PI5A 4J9ZB 1COV4 2W6IG 2FTKA 3E22A 4E4EA 1FAFA 4LWSA 4M7YA 4YNQA 2O8DA 2F66C 3SYCA 3U10A 1HKBA 1SA0A 5DK5A 4M41A 1OJHA 3L70H 1IBLB 4OKKA 2KQXA 4EP5A 4FLTA 4CF0A 4HZ3A 1N8RW 4YHHO 2GTSA 3WB2A 1OVYA 4B9TA 1YQ4A 3LZJA 1FFTB 1YJWN 4R7CA 3VF6A 3M8PA 4B1WB 4E0DA 1I3AA 3FKSG 3ZT3A 4A62A 4BVOA 5KX5B 1JXBA 3ZRXA 4KUMA 5LOVB 3RR8A 1BQZA 1HXS4 1NKDA 3ZMTA 2WDQA 1NBMG 3F9KA 1VSLA 4FVUA 4RAIA 4BC3A 5B3SB 3OJSA 4JI1B 3UM7A 1HLUA 1XEQA 3QNNA 2IC3A 3OTOO 2AZ2A 1V4TA 4UQGA 3J8F4 2NRRA 3MXJA 4J2AA 3D0PA 3F7VC 4KHSA 4GKKK 1JLGA 3S41A 4YFUA 2OYQA 3AVJA 1S72V 2JK5C 1HNXB 4DFKA 1VQ7N 1XL6A 4B1VA 3OS1A 2WU2A 1B6QA 2EIJB 4JKBA 3L3VA 4I9LA 2BUPA 3AG1C 3AGRA 3IS9A 3BVOA 5IT9N 1Q6UA 3D6RA 3G6EV 2P7TC 1S1WA 1UWBA 5C93A 4LF8B 4FIPC 3ZSXA 1Z26A 1JFFA 1WSIA 3CETA 2WLIA 4LF4O 4BRPA 3T1YO 3TU5A 1HNZK 3NH2A 3HXMA 4LFCO 1HUXA 1QVGU 3SPZA 4CK1A 2IH3C 1KUQA 1NGFA 4CEOA 1R094 5LXTA 1Z5VA 3HKDA 1CP9A 3B6PA 5DM6V 3DXMA 4FW2A 1N0NA 3ZMUA 4YOTA 1Z6RA 1JQ0A 4JTCB 4Z1MG 1NK5A 4DQIA 1P84F 3HPLC 4Z0UA 3MD0A 4X66B 3SUNA 3V4IA 3QETA 3TARA 1P90A 3OE7G 1B06A 3CD6V 1GOBA 3L75H 2R9AA 3DJCA 4E2LA 2Q8VA 3AA2A 2DWEC 3VOVA 1SESA 1US6A 2YIAA 3CCJN 5BR8K 5ADXH 3NE6A 2QR4A 3K0GA 5K1XA 1JCGA 3TPQA 1K8AW 1LWCA 3ZX3A 1N36B 5F1XA 4JI8O 3I56N 5AQSA 4W5TA 1TA8A 3T2MA 1OCRC 3NGYA 3QEIA 4Q4V4 4O4HA 1M1KW 5JCOA 3QINA 4C8MA 4J2BA 3OTFA 4NYFA 2JWKA 1I0HA 2EULA 2W0XA 1NGJA 1JJ2M 4FK4A 1F23A 3E22B 4U3FH 4HHTA 2O8DB 3QFPA 3CJBA 3A0RA 4F2SA 4FLZA 4CH6A 3C6TA 4UCUA 3CC7V 3D2EB 3AEAA 3CIRA 4K3AA 2P1JA 1UA1A 2HHHK 4E3SA 2M7WA 2WLLA 3L8BA 2Q9LA 3L74H 3ZJZA 4Z1VA 5AQYA 3TTCA 2PLV4 2X74A 1IKYA 1TKZA 1AR64 4JI4O 1MSDA 5BN8A 5KI6A 5B1OA 1O9GA 2K1EA 3FYIB 2DFHA 3A0HZ 4JZ2A 2YNIA 1VAZA 5HOOA 1D4XA 3LALA 1WSJA 1QQCA 4CEEA 1EWQA 4DRXA 1EXQA 4A59A 4A5AA 1GH6A 4BRAA 4DS4A 4JRQA 4PDLA 4RCHA 1CZ9A 3UKRA 4X8AA 4CGDA 4DV5O 2JGDB 2QKAA 3JATB 1K4CC 5EIBD 1WPBA 5HBMA 3O3HA 4UY8O 2Q0RA 1FXHA 5AQZA 2E2QA 3VEYA 4B1ZA 2HG5C 4X20B 1X9MA 3EKSA 3UO2A 4K8XA 1BHBA 1IKVA 2NRVA 1J5EO 2AHYA 2E20A 4X88A 2YDEA 2P9IA 3B6OA 4F9OA 3CFPA 3H46O 1FXVA 3EZ5A 4O8KA 3SYQA 4GKJO 2F43G 3TJTA 3W7SA 1OH7A 4N23A 2WLIB 3SAGA 3OYGA 3C95A 3LP3A 3O1WA 4DR7K 1S9EA 1OCCC 3FFQA 1ATSA 5LXTB 5FL7G 1MU2A 1RSOB 3SAHA 1YJNN 2OCEA 3VEZA 1ZXOA 3DXKA 2Q69A 3N2KB 2HLDG 1XUPO 3ALYA 1QHTA 2YEVA 3TK1A 3E8HA 1IJJA 3TAMA 4GKKB 4YIOA 1N36O 1IH7A 3NF9A 3P83D 3THVA 1FD9A 4OPAA 2UUCO 1D9DA 3AE7A 4DR1K 3BHPA 3CEIA 4WFAV 1M93A 4B9UA 4OGQB 4LF9O 3LSQA 2DFEA 5HRPA 3ZHSA 1RDBA 2UXNA 2IVPA 4CK2A 4FZYA 2D5RA 4CZHA 3AG1B 3OBYA 2DTUA 3CWBH 2F4VO 2P9KB 2ASOA 2XT9A 1EZVH 4TV8A 3RMDA 3MECA 2JJ1G 5LA6A 4CW7B 3HZ6A 3TCUA 4J8FA 5LMUK 2F95B 1QZ6A 4YJ3A 5EX5A 1HNZB 1L3SA 4C8OA 2JGUA 1G1XB 2FF6A 2GBZA 2WONA 2PBDA 3ULEA 3FFIA 1HKCA 3CCRN 4NKGB 3G67A 1AR94 4YTMA 3O3GA 4JRPA 1RUD4 3Q7BA 2OTJV 4DV7K 1XNQO 2G8IA 1HMVA 4JV5O 4DV1O 1L0VA 3I0SA 3MEDA 1TK5A 2ODMA 3BA9A 3SQ0A 3OMAB 3U11A 1W7AA 1VQKV 2G8HA 4KREA 1VQ9V 5L3FA 3KZIZ 3WFVA 3QEXA 1H2KA 2BH1A 2A41A 2E2NA 2V52B 4X1IB 2WLMA 1Y97A 3EFFK 3ENHA 4ILHA 5BR8B 2RM24 3MCPA 2KW4A 5AZJB 1Z25A 1M5IA 4BG9A 4MVMA 2D4WA 5AG2A 1OCRB 4NLBA 1FFXA 1WB9A 1JLCA 3OYIA 1Q82W 3RVZA 4JGSA 4JYCA 5LHGA 4DRXB 3RYCA 2W6KA 2LO1A 5AQIA 3QEVA 4MVQA 1Q8IA 1NEKA 1L1FA 1RFYA 3TGUH 3T1AA 3L0QA 2KQ2A 3JD2A 3AVIA 2H8PC 3WXMB 1K73W 3SDLA 1KKCA 4HCCA 4FFBA 2DY4A 3QTCA 1SF9A 3E8FA 3RT3C 4B9NA 4JK8A 2EINC 1BEV4 1NCQD 3ZHUA 4LCUC 3CPWU 2P9IB 4YXWG 2HHHB 4AHVA 2NNWA 2RE2A 4RW7A 3SV4A 4DR4K 3SUPA 1SZ2A 2VWKA 4WFNL 4H5RA 4DF4A 3AE9A 3M99B 5M1NA 3C6HA 4M3WA 3I8BA 1KQSU 2E1ZA 2HEPA 4GV3A 1Z2GA 3PJSK 3HL8A 3QIOA 4DTMA 3HO1A 1K92A 4KB1A 3FB7C 4QCLA 4F6EA 1BSMA 2R72A 1ZAUA 3G80A 5IWAK 4DTUA 2NNUA 4ZI7A 3CPEA 3VMFB 5TKWA 1S1VA 3PO5A 1NOZA 3DXKB 3I55V 3V9XA 1VBC4 3R65A 1HNZO 3Q7CA 3ZEUB 1XNRO 3QBXA 1J6ZA 4JHDA 1JCHA 1P7GA 3ABMC 4B3RK 1TVRA 4FZXC 4J7JA 1M90W 1SUQA 4BR9A 1C1AA 1HQEA 4JI3O 5DEDA 3FR0A 5KHJA 3HTVA 2P5OA 2ITDC 2A3QA 1IVSA 3QERA 3OJUA 3H3NO 1OV9A 4IJAA 4XDJA 1PPJH 1FXXA 4LD0A 1MG1A 1Q3EA 3AVKA 4U3JB 4YJ3B 4DR7B 4CBCA 1OCCB 1RM1C 4I4TB 4DR6O 1DGSA 2X78A 4H0PA 3W3DA 3ULEB 4DQQA 3AEEA 4D6TH 4H8KA 5J2UB 2N74A 4FFKA 2QWOA 4ZOLA 5EBLC 1WBBA 4PWDA 1L8DA 1QCEA 4XH5A 5IJ9A 3C65A 1QHAA 3GVMA 3VQAA 1NVPD 2Q2RA 4LP8A 4BRIA 2P9PB 2B76A 3VOUA 5B1BC 3VN5A 2RS34 1P7BA 4DR1B 2X6SA 1MA9B 4IHJA 3NF6A 2Q1NA 2CGLA 4CHQA 4HUEA 4IL6Z 4Z94A 3V1OA 1U96A 3PIOL 4DR2O 4AH9A 4CEFA 2O4GA 2B5UA 2NRXA 2WUSA 1ESVA 4H0XB 1VQ6N 3E1YA 4OX9K 4M3UA 2ZE6A 3ZX0A 3DAWA 4AHTA 2W41A 4DCHA 1BWFO 3VPZA 1GM7A 1L3UA 1E1RG 1W0KG 5LMUB 4BR0A 1GN4A 4ICGA 4CJRA 4WCEV 2IJJA 3LAKA 3AAPA 1NKEA 1KFYA 1FFXB 2P22C 2Q4PA 3RYCB 2VQFO 1EP4A 4NCGA 3SUOA 4CD1A 4CFDA 1XOUA 5J2MA 1J54A 2Y4UA 1S1UA 4DV7B 2QWNA 5GTIZ
chains in the Genus database with same CATH topology
4CFAA 1BGXT 5JJEB 1S1TA 4JLHA 3QG5A 4DK1A 2FBVA 4RW6A 3G10A 5EIBC 3PX4A 3WNGA 3MEEA 3LAMA 3AO2A 2O4IA 3T19A 4I2QA 3PV8A 2KFZA 3DRSA 3RRGA 4L8RB 3NDKA 2BDPA 5CYQA 1QS4A 4DTOA 1VSHA 4FLWA 4ZI7B 4I9QA 3AVFA 4F4KA 2KZMA 1NK8A 3HSTB 1VK0A 1A5VA 1SL2A 5JS2A 4DR4B 4FYDA 2RPIA 3NGIA 3LWMA 3DM2A 4KHNA 1KTQA 4B9LA 4FJKA 4F6RB 1RTIA 5IWAB 5CA1A 4Q5VA 4M45A 4CJQA 4FK2A 1RDCA 5CB4B 4DSIA 3C6UA 4B3RB 4O2BA 3K2PA 3SQ4A 3SGIA 4IHJB 5HROA 3KK2A 1XQ8A 3UT5A 4XIUA 3BA8A 4C8KA 4DTNA 5C24A 4OKEA 4O4GA 2X6NA 2QKBA 4AHCA 3BPZA 1J9AA 5KGWA 3B2EE 3KK3A 2E3CA 3TWHA 4TQFA 5KMGA 3JAWA 3ZSOA 1LAVA 2XO7A 1Q5OA 4OX9B 4B3OA 2F8TA 5HRSA 3VA0A 4FJ5A 1BIUA 4FJGA 5FNVA 1QE1A 3MXIA 2KTQA 4CIFA 4CJ3A 2OZSA 2PY5A 2EX3A 4CC5A 1REVA 1KFSA 4ZHRA 4OGCA 1I39A 2VG6A 3VQ9A 3TAQA 1V9PA 4N56A 4GW6A 4QOZB 1HNWB 3RYIA 1HYVA 4ZIBA 4GLXA 1FKPA 3AVHA 4ZTFA 4FJLA 1JLFA 2YNHA 4JI6B 3KTQA 3HKCA 2FBXA 1WN7A 2E6LA 3K58A 4NXNB 2UUAB 3S3OA 5FRNA 3U3GA 2Z1IA 4B8CA 1HRHA 4O4IB 1NOYA 3UT5B 5I42A 3NFAA 3K5MA 5KRSA 2RN2A 3JALA 5KX5A 1U04A 3QLHA 1RT3A 5LOVA 5KTQA 3HKEA 3JARB 3OYEA 5JVDA 1XC9A 2Q0AA 2YKMA 4FM1A 3U0ZA 4CHYA 4TSXA 3HP9A 3SJAC 4X1YA 3DOLA 4LH4A 2YIBA 4DFJA 5FNVB 3DYAA 5JH7A 1QTMA 3LDSA 4E7LA 3VQQA 1U45A 1SQGA 4BDYA 4NCBA 4IG0A 3SYZA 4CEDA 4CHOA 4LR3A 3SI6A 5EZYB 4FJHA 3G0ZA 3V1RA 4BWMA 4N5SA 4DTSA 3AVNA 4FW1A 1NJWA 3RYIB 5J2QA 4FJ8A 3RR7A 2WOMA 3OS2A 3VQPA 4CJLA 4I50B 5KGXA 1BQMA 3HKCB 1IKWA 2ZM6B 3OVNA 3PUFA 4CEZA 4CECA 5K1PA 2HHSA 2PYJA 1Z5WA 4PI2A 3LZIA 4KHYA 2VG5A 1SL0A 1W0HA 2E4LA 1WLJA 4CIGA 3CB2A 3JALB 4I55B 4UCTA 4M42A 1T5EA 5I3UA 3HKEB 4PUOA 1IKXA 4N47A 1G15A 5JJNB 3JATA 2F96A 4O4JB 1SV5A 2AJQA 5JVDB 3AO3A 1S5JA 1J5OA 4CJPA 4X20A 2LSNA 5SWMA 4MFBA 3DLHA 4GVMA 2UXCB 3L2RA 1KVCA 1RDDA 1BHLA 4DTRA 1VSMA 4DSEA 2F93B 4E7IA 1RT2A 4X1YB 2HHXA 2IAJA 4O55A 1RSOA 5JH7B 5KHGA 2A1RA 3N2KA 4DG1A 3VQ7A 4N41A 2W42A 2Z1HA 1JMKC 2QK9A 1C0UA 2DFFA 3BRCA 2Y1JA 4LF7B 3VQXA 2IGIA 5CZ2A 4AHSA 3LP1A 2FBTA 1B92A 1RILA 2G8FA 2OPQA 5SZTA 4DLGA 1B9DA 4DU1A 3MAQA 1D8YA 1QSSA 1RNHA 3CHXA 4X1IA 4B9MA 3OJUA 4HNAA 3KLFA 2B4JA 3D45A 2HHUA 4M3RA 3RMBA 4CS4A 3OYNA 3PX0A 1O9HA 3JSLA 3PN1A 4CC6A 3DRPA 4OJRA 4CERA 3RMAA 3AVGA 3UIQA 4E89A 1T7PA 3LNNA 5FDLA 4ELUA 4TOIA 1BI4B 3CFRA 4CFCA 5KRTA 1UOCA 3CM6A 4LSNA 3SJBC 3HPGA 4Q0BA 4CGGA 5LMNB 3L2WA 3AVBA 2D0BA 4KTWA 1LAWA 3OYLA 2BTQA 3TI0A 3HKBA 3QO9A 3T3FA 1RBVA 3QESA 5KHKA 4U3JA 2XY7A 4I4TA 1FJGB 5J2UA 3QF7A 1HJRA 4LFBB 3OYFA 3P1GA 4KRFA 4IIJA 2IS3A 2PGGA 4PA1A 4HVJA 4AILC 1JJOA 1HYSA 1N33B 4HNAB 4B3SB 4FJ9A 4EEQA 4RW8A 4Y1CA 2YNGA 5FROA 3AA4A 4PHZA 2XY5A 3IRXA 1ZBFA 3HVRA 4OLAA 3A2FA 4ID5A 4CF8A 3ETQA 3F73A 3VQ8A 4DWIA 5IJ0A 4JS5A 4DV4B 2UXDB 4FLXA 4CS2A 4AHRA 4KHWA 5HLFA 2ZQBA 4O5BA 4FM0A 3OYKA 4M3XA 4EFBA 4YY3B 3VQ4A 1ZBIA 1EETA 4MQ3A 5KHIA 2RKIA 1LWEA 4LH7A 2XY6A 3UQ8A 2Q7GA 3ZT0A 4E19A 5C25A 4ELVA 1C1CA 2BTQB 2JVDA 3HKBB 4KKOA 1ZBUA 2VWJA 1VSIA 1JLQA 3L2QA 5CA0A 5IYZA 4F6RA 4H4OA 1YT3A 4CGFA 4DF8A 4NXMB 4E7KA 5CB4A 1HPZA 2QKKA 3K59A 3HYFA 2OZMA 1B9FA 1TGOA 4IIJB 5E41A 4D7SA 1BISA 1TKTA 1I7FA 4DUYB 4CCHA 4X65B 3WNEA 2PZSA 4K8ZA 3SNNA 4LNUB 1M4UA 2GV9A 1WSEA 2HNZA 4C8NA 4DSLA 4KHPB 1KLMA 1W9HA 3AO1A 4CGHA 4DLEA 5IJ0B 4NCAA 1C0MA 1RBRA 3V9ZA 1QSLA 5K14A 3RFRA 1GOCA 4LFAB 2HVIA 2VQEB 3DMJA 4OKJA 4B3TB 1TKXA 4AHUA 1RBSA 1SKRA 4CHZA 1U4BA 2UUBB 4DV0B 1JXEA 3ISNC 4CJ4A 1LW0A 3ASMA 3V9SA 4UFZA 4TV9A 4E7JA 4LSLA 2HHWA 1KRPA 4LY7A 4BWJA 5CA0B 5IYZB 1DTQA 3TAEA 2CAZC 4JI5B 2Q7EA 2ZINA 1T8EA 3RYHA 3VA3A 4KAZA 4E1NA 4B3MB 4O0JA 3K5OA 1KLNA 1JLAA 4O4IA 4JI7B 1RT4A 4AQYB 2IM9A 1IBMB 4KB0A 4CF9A 3QNOA 1FK9A 5KHHA 5CY4A 1ASUA 4KFBA 4IDKA 4M3ZA 3DLEA 4KL1A 3DLKA 1NJZA 2QXFA 3JARA 3O4QA 3N2GB 4X1KB 3CM5A 1DTTA 1U48A 2QJ1A 4KTQA 4FJ7A 2YXLA 1SKSA 2OA8A 1SKWA 3ULDA 3SJJA 3L3UA 4G1QA 4DTXA 1NT2B 3TAGA 4CF1A 3ZSZA 1RBTA 4CFBA 4BDPA 4DQPA 4F2SA 3AO5A 1TAEA 1TAQA 1Q9YA 3KD5E 3ZSYA 4FLYA 2ETJA 2R7FA 5EZYA 4TV9B 5J1EA 1GOAA 3WNHA 4OVLA 4CIEA 1TKDA 2Y1IA 3RMCA 1VRUA 2HNDA 4LF6B 3TABA 3HT3A 1P49A 3BDPA 4HTUA 3ICXA 4KO0A 3H08A 2XHBA 1C6VA 5JS1A 3PY8A 1NK9A 4CHPA 4K0KB 4I50A 1VF7A 2R70A 3RYHB 4BE0A 1JL2A 1S9GA 5EYPA 3BAAA 4JI0B 4CJWA 1KCFA 3M7MX 1L3VA 5C8YB 4CGJA 3I0RA 2E6MA 1CXUA 4DSJA 2ZCEA 3CG7A 3DSQA 2RF2A 4I55A 2I5JA 3NCIA 3O3FA 4O4JA 4O2AB 1K6YA 1Q9XA 4J2DA 3IAYA 5DMRA 4Y1DA 1TK8A 5LP6B 2B5JA 4CJTA 3RRHA 1ZBHA 3P5JA 4O44A 4IG3A 3S9HA 3DRRA 4YHHB 3TAPA 3CYMA 3KKSA 5FRMA 4LH5A 4CHNA 4ID1A 4TUYB 3ITHA 3RTVA 3SV3A 3KD1E 3NGZA 1X9WA 3LPTA 1BCOA 1VSFA 5HRRA 1RT6A 2YNFA 2FC0A 1KVAA 3OTOB 1CXQA 2D0CA 4HUGA 1TL1A 1IO2A 2V4DA 3AA5X 4Z4EA 1X1PA 2ZE2A 3I8DA 1X4TA 3VQDA 2ITGA 1RTJA 3V81A 3RYFB 1BCMA 5JQGA 4LF4B 3T1YB 3L2UA 4LFCB 3THOA 4O4LA 5EYPB 3LP0A 3KLEA 1L5UA 2ZNIA 2Z1GA 1UAXA 1XWLA 2YI9A 3KIOA 3C94A 1TVKB 1RTHA 2IOCA 3E01A 1QSYA 2HB5A 4DU4A 2RQ6A 4JI8B 1KMIZ 3LANA 4C8LA 5HP1A 4I2PA 2D0AA 3ZEDA 4FCYA 1LV5A 1KU9A 4CJSA 4E1MA 3VQWA 1BI4A 3SQ2A 5D3GA 4CJ5A 2YHAA 5HRNA 1RBUA 3JSNA 1VSKA 4JI4B 3MEGA 2G8WA 1YTUA 1D5AA 4IFVA 3JASB 4DV5B 3VQ5A 5J2NA 4KI4A 2FBYA 4CEBA 5JJJB 1ZYQA 5JCOC 1IG9A 1J5EB 2R7YA 3NF8A 1NK4A 5D5PA 1NK6A 5LYJA 4GKJB 3V9UA 2BE2A 3KKRA 3SR2C 4CJUA 4GMJB 1TV6A 5JQGB 4DFMA 4IKFA 4EFEA 4O4LB 4Q6GA 3AVCA 3QIPA 1DLOA 1TK0A 2OPPA 1NJYA 3LWLA 1NK7A 2UUCB 1VSDA 4LF9B 1JLBA 3VQ6A 4IBNA 1SKVA 4FJMA 2F4VB 4DQSA 3PO4A 4ELTA 1SA0B 1EX4A 2KZZA 3OYDA 2ZIMA 4DFPA 3WB1A 5BMVA 3ZSVA 1XNQB 1BQNA 4JV5B 3OYHA 4DV1B 1L3TA 4UCRA 4FZZA 4FJXA 4CJFA 1KVBA 3VQVA 3M8SA 1KFDA 1SQFA 5J2TA 4BE2A 2YKNA 3TR8A 1HYZA 2HHQA 3TAFA 3IG1A 3CQ8A 4KTZA 1LW2A 4D7TA 4KPYA 1JFFB 2BANA 5FPRA 4J2EA 3AV9A 4EZ9A 2XRIA 3ZS8C 2QM4A 2KKWA 3HKDB 3HK2A 3OS0A 1J53A 3PX6A 5LYJB 4O0IA 4BW9A 1LWFA 3VQCA 4R5PA 5J2PA 2G8UA 4KI6A 1JL1A 2VG7A 3SUQA 4BWAA 1NKCA 5D5QA 2OPSA 4JS4A 2HNYA 1XI1A 4BDZA 1HNIA 2YV0X 5ITZA 1WAFA 1XNRB 1YEWA 1RT1A 1FKOA 4O4HB 4JI3B 1ASVA 3RWUA 4LNUA 2ZNJA 4DV3B 5C42A 4N76A 3HM9A 2KFNA 3NH0A 3K5NA 2PYLA 3DLRA 4DR6B 2Q7HA 5BMVB 1HQUA 2OWOA 2P51A 4Z4CA 1CLQA 1R0AA 4TQDA 4DR2B 3V1QA 2Z1JA 3CSXA 4M3TA 1H2SB 5J2TB 1HNVA 4DU3A 4WBNA 1F21A 4IFYA 1S6QA 4EZ6A 4FLVA 2RJZA 4OGEA 4CESA 1XHZA 2VQFB 3V9WA 3RWRD 4OPKA 4CJKA 4W5RA 3QEPA 4DR5B 4LH6A 2P5GA 3O4NA 4FXDA 4FJJA 2HVHA 4CEQA 4YJ2A 1IBKB 1RCHA 4DV6B 1C0TA 1N6QA 1RDAA 3DLGA 4UCVA 4B08A 1TL3A 1RTDA 4DR3B 4UCOA 2IDOA 1NKBA 3HVTA 3CFOA 1CZBA 3EY1A 3OYAA 1WNSA 4TV8B 5LA6B 1G6UA 1SL1A 2HHTA 2HW3A 3JAKA 5ITZB 4KHUA 1NJXA 3DLBA 1XHXA 4FJNA 1VRTA 3KLHA 3HJFA 1KSPA 2PTMA 2F1MA 3N2GA 3AO4A 4X1KA 3NHGA 2YIBD 3U6FA 2G8KA 4QAGA 2JLEA 2NUBA 3V6DA 4I7FA 4JYAB 2G8VA 3KK1A 4FFBB 1C1BA 4WBNB 2YI8A 1XMOB 2JS5A 4CF2A 4RG8A 4X62B 3KJVA 4YJ2B 1S6PA 1WSGA 1YVUA 1N5YA 1RT7A 2UXBB 4DQRA 4W5QA 3L2VA 4B9VA 4DSKA 1HW7A 1I94B 2B6AA