1OOPD

The crystal structure of swine vesicular disease virus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
58
Chain Sequence
GAQVSTQKTGAHEIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMVKSMPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Crystal Structure of Swine Vesicular Disease Virus and Implications for Host Adaptation
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 58
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1oopD00
1D4M4 1EV14 3J8F4 1R084 1H8TD 2RR14 1R094 2PLV4 1EAH4 1RUI4 1VBB4 1RUG4 1RUF4 1ASJ4 4Q4V4 4PDWD 1VBE4 1NA1D 1OOPD 1COV4 1RUJ4 1HRI4 1RMU4 1PVC4 2RMU4 1POV0 1PO14 2R074 2RS34 1AR74 1Z7S4 2RS14 1AR94 3JBG4 1K5MD 1NCQD 1VBC4 1BEV4 1VBA4 2R064 1HRV4 1RUC4 1PIV4 4GB34 2R044 1VBD4 1MQTD 1PO24 1AR64 1AR84 1RUD4 1RVF4 2X5ID 4Q4W4 4Q4Y4 1RHI4 4Q4X4 1HXS4 3JD74 1VRH4 1RUH4 2RM24 2HWC4 4RHV4 1AL24 1RUE4 2HWB4 2RS54
chains in the Genus database with same CATH superfamily
3J8F4 3ABVA 2B76A 2H89A 4YXDA 1RUG4 1OOPD 2R7FA 2RS14 2WP9A 2PYLA 1AR94 1NCQD 2WQYA 3VRBA 3VR9A 1YQ3A 2X5ID 3AE9A 5C3JA 3JD74 1KFYA 1RUH4 4RHV4 3AEDA 3AE3A 2RR14 2PZSA 1EAH4 1ASJ4 4PDWD 3GQHA 1NA1D 1RMU4 1YQ4A 1PVC4 1ZP0A 3SUCA 4KX6A 3FI7A 1K5MD 4YSYA 2R064 2WU5A 3VR8A 1XHXA 1VBD4 1PO24 3AE2A 1L0VA 1RVF4 3AE4A 4Q4W4 2WDQA 1RHI4 4Q4X4 1AL24 4GB34 3CIRA 1EV14 3GQKA 3AE1A 3AE5A 2PLV4 4YSXA 1VBB4 1RUF4 3SFEA 1NENA 1VBE4 3SFDA 1COV4 1RUJ4 3P4PA 1POV0 3AE7A 3P4QA 1KF6A 2R074 2RS34 1Z7S4 3AEFA 1XHZA 1VBC4 1BEV4 2FBWA 4YTMA 1MQTD 2EX3A 4Q4Y4 1HXS4 1VRH4 3VRAA 2RM24 2HWC4 2HWB4 2RS54 1D4M4 5C2TA 3AEAA 2WS3A 1R084 4YTNA 1H8TD 1NEKA 2ACZA 2H88A 2PY5A 1R094 1RUI4 4YSZA 3P4SA 4YT0A 2WU2A 4Q4V4 3AEEA 1XI1A 1HRI4 3AECA 3AEBA 1PO14 3JBG4 1AR74 3P4RA 1ZOYA 3AE8A 1VBA4 1HRV4 1RUC4 1PIV4 2R044 4YTPA 1AR64 1AR84 1RUD4 2WDVA 2WDRA 2PW9A 2PYJA 2RMU4 1RUE4 3AE6A 3AEGA
chains in the Genus database with same CATH topology
1D4M4 1EV14 3J8F4 1R084 1H8TD 2RR14 1R094 2PLV4 1EAH4 1RUI4 1VBB4 1RUG4 1RUF4 1ASJ4 4Q4V4 4PDWD 1VBE4 1NA1D 1OOPD 1COV4 1RUJ4 1HRI4 1RMU4 1PVC4 2RMU4 1POV0 1PO14 2R074 2RS34 1AR74 1Z7S4 2RS14 1AR94 3JBG4 1K5MD 1NCQD 1VBC4 1BEV4 1VBA4 2R064 1HRV4 1RUC4 1PIV4 4GB34 2R044 1VBD4 1MQTD 1PO24 1AR64 1AR84 1RUD4 1RVF4 2X5ID 4Q4W4 4Q4Y4 1RHI4 4Q4X4 1HXS4 3JD74 1VRH4 1RUH4 2RM24 2HWC4 4RHV4 1AL24 1RUE4 2HWB4 2RS54
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4M 4;  1EV1 4;  3J8F 4;  1R08 4;  1H8T D;  2RR1 4;  1R09 4;  2PLV 4;  1EAH 4;  1RUI 4;  1VBB 4;  1RUG 4;  1RUF 4;  1ASJ 4;  4Q4V 4;  4PDW D;  1VBE 4;  1NA1 D;  1OOP D;  1COV 4;  1RUJ 4;  1HRI 4;  1RMU 4;  1PVC 4;  2RMU 4;  1POV 0;  1PO1 4;  2R07 4;  2RS3 4;  1AR7 4;  1Z7S 4;  2RS1 4;  1AR9 4;  3JBG 4;  1K5M D;  1NCQ D;  1VBC 4;  1BEV 4;  1VBA 4;  2R06 4;  1HRV 4;  1RUC 4;  1PIV 4;  4GB3 4;  2R04 4;  1VBD 4;  1MQT D;  1PO2 4;  1AR6 4;  1AR8 4;  1RUD 4;  1RVF 4;  2X5I D;  4Q4W 4;  4Q4Y 4;  1RHI 4;  4Q4X 4;  1HXS 4;  3JD7 4;  1VRH 4;  1RUH 4;  2RM2 4;  2HWC 4;  4RHV 4;  1AL2 4;  1RUE 4;  2HWB 4;  2RS5 4; 
#chains in the Genus database with same CATH topology
 3J8F 4;  3ABV A;  2B76 A;  2H89 A;  4YXD A;  1RUG 4;  1OOP D;  2R7F A;  2RS1 4;  2WP9 A;  2PYL A;  1AR9 4;  1NCQ D;  2WQY A;  3VRB A;  3VR9 A;  1YQ3 A;  2X5I D;  3AE9 A;  5C3J A;  3JD7 4;  1KFY A;  1RUH 4;  4RHV 4;  3AED A;  3AE3 A;  2RR1 4;  2PZS A;  1EAH 4;  1ASJ 4;  4PDW D;  3GQH A;  1NA1 D;  1RMU 4;  1YQ4 A;  1PVC 4;  1ZP0 A;  3SUC A;  4KX6 A;  3FI7 A;  1K5M D;  4YSY A;  2R06 4;  2WU5 A;  3VR8 A;  1XHX A;  1VBD 4;  1PO2 4;  3AE2 A;  1L0V A;  1RVF 4;  3AE4 A;  4Q4W 4;  2WDQ A;  1RHI 4;  4Q4X 4;  1AL2 4;  4GB3 4;  3CIR A;  1EV1 4;  3GQK A;  3AE1 A;  3AE5 A;  2PLV 4;  4YSX A;  1VBB 4;  1RUF 4;  3SFE A;  1NEN A;  1VBE 4;  3SFD A;  1COV 4;  1RUJ 4;  3P4P A;  1POV 0;  3AE7 A;  3P4Q A;  1KF6 A;  2R07 4;  2RS3 4;  1Z7S 4;  3AEF A;  1XHZ A;  1VBC 4;  1BEV 4;  2FBW A;  4YTM A;  1MQT D;  2EX3 A;  4Q4Y 4;  1HXS 4;  1VRH 4;  3VRA A;  2RM2 4;  2HWC 4;  2HWB 4;  2RS5 4;  1D4M 4;  5C2T A;  3AEA A;  2WS3 A;  1R08 4;  4YTN A;  1H8T D;  1NEK A;  2ACZ A;  2H88 A;  2PY5 A;  1R09 4;  1RUI 4;  4YSZ A;  3P4S A;  4YT0 A;  2WU2 A;  4Q4V 4;  3AEE A;  1XI1 A;  1HRI 4;  3AEC A;  3AEB A;  1PO1 4;  3JBG 4;  1AR7 4;  3P4R A;  1ZOY A;  3AE8 A;  1VBA 4;  1HRV 4;  1RUC 4;  1PIV 4;  2R04 4;  4YTP A;  1AR6 4;  1AR8 4;  1RUD 4;  2WDV A;  2WDR A;  2PW9 A;  2PYJ A;  2RMU 4;  1RUE 4;  3AE6 A;  3AEG A; 
#chains in the Genus database with same CATH homology
 1D4M 4;  1EV1 4;  3J8F 4;  1R08 4;  1H8T D;  2RR1 4;  1R09 4;  2PLV 4;  1EAH 4;  1RUI 4;  1VBB 4;  1RUG 4;  1RUF 4;  1ASJ 4;  4Q4V 4;  4PDW D;  1VBE 4;  1NA1 D;  1OOP D;  1COV 4;  1RUJ 4;  1HRI 4;  1RMU 4;  1PVC 4;  2RMU 4;  1POV 0;  1PO1 4;  2R07 4;  2RS3 4;  1AR7 4;  1Z7S 4;  2RS1 4;  1AR9 4;  3JBG 4;  1K5M D;  1NCQ D;  1VBC 4;  1BEV 4;  1VBA 4;  2R06 4;  1HRV 4;  1RUC 4;  1PIV 4;  4GB3 4;  2R04 4;  1VBD 4;  1MQT D;  1PO2 4;  1AR6 4;  1AR8 4;  1RUD 4;  1RVF 4;  2X5I D;  4Q4W 4;  4Q4Y 4;  1RHI 4;  4Q4X 4;  1HXS 4;  3JD7 4;  1VRH 4;  1RUH 4;  2RM2 4;  2HWC 4;  4RHV 4;  1AL2 4;  1RUE 4;  2HWB 4;  2RS5 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...