1OOPD

The crystal structure of swine vesicular disease virus
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
58
Chain Sequence
b'GAQVSTQKTGAHEIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMVKSMPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Crystal Structure of Swine Vesicular Disease Virus and Implications for Host Adaptation
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 58
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1oopD00
1ASJ4 1RUG4 1D4M4 1VBE4 1RUC4 1PVC4 2HWB4 1VBA4 1AR64 1AR94 1RHI4 2RM24 1PO24 2R044 2RS34 1EV14 1RUE4 1H8TD 2PLV4 1RUD4 2RS54 4Q4V4 1HXS4 4Q4X4 2RR14 1EAH4 4PDWD 4Q4W4 2R064 1NA1D 1COV4 2R074 1K5MD 3JBG4 2X5ID 1VBD4 2HWC4 3JD74 1VRH4 1POV0 1AR84 1AR74 1PIV4 1VBB4 1NCQD 1RUI4 4GB34 1MQTD 1VBC4 3J8F4 1HRI4 1BEV4 1RUH4 1OOPD 1RMU4 1RUJ4 1HRV4 1RVF4 1R084 2RMU4 1AL24 1R094 1RUF4 1Z7S4 4Q4Y4 1PO14 4RHV4 2RS14
chains in the Genus database with same CATH superfamily
3SFDA 3VRAA 1D4M4 1VBE4 2WU5A 2HWB4 1VBA4 1AR94 1PO24 2RS34 2EX3A 3P4RA 4Q4V4 1YQ4A 4PDWD 1XHZA 3VRBA 2R074 1K5MD 3AE5A 2WU2A 3CIRA 3AEGA 4YTNA 2HWC4 1VBB4 1AR74 1NCQD 3AECA 2WDRA 1MQTD 1VBC4 4YSXA 3AEBA 1RUH4 2RMU4 3AEAA 4YTPA 4Q4Y4 1ZOYA 4RHV4 1KF6A 1ASJ4 1RUG4 2WP9A 1AR64 2RM24 3VR9A 3AE1A 1RUE4 2PY5A 3GQHA 3AE7A 4KX6A 3AE8A 2R064 3ABVA 2X5ID 4YT0A 3SUCA 4YSYA 3AEFA 1RUI4 2ACZA 5C3JA 1HRI4 3AE9A 2WDVA 1AL24 1R094 1RUF4 2H89A 1PO14 3AE3A 1KFYA 2WQYA 2FBWA 1XI1A 1PVC4 1RHI4 2R044 2H88A 1EV14 3SFEA 4YSZA 5C2TA 2RR14 1EAH4 4Q4W4 1COV4 3JBG4 2PW9A 1VBD4 1YQ3A 3AEEA 1PIV4 4GB34 1ZP0A 3J8F4 1BEV4 1OOPD 1RMU4 1RUJ4 1HRV4 1Z7S4 2PZSA 3GQKA 4YTMA 2PYJA 3P4QA 3AEDA 1RUC4 3AE2A 2B76A 1NEKA 1NENA 2WS3A 3P4PA 3AE4A 3FI7A 1H8TD 2PLV4 1RUD4 2R7FA 2RS54 1HXS4 4Q4X4 1NA1D 1L0VA 1XHXA 3JD74 1VRH4 1POV0 1AR84 2PYLA 4YXDA 3AE6A 3P4SA 2WDQA 1RVF4 1R084 3VR8A 2RS14
chains in the Genus database with same CATH topology
1ASJ4 1RUG4 1D4M4 1VBE4 1RUC4 1PVC4 2HWB4 1VBA4 1AR64 1AR94 1RHI4 2RM24 1PO24 2R044 2RS34 1EV14 1RUE4 1H8TD 2PLV4 1RUD4 2RS54 4Q4V4 1HXS4 4Q4X4 2RR14 1EAH4 4PDWD 4Q4W4 2R064 1NA1D 1COV4 2R074 1K5MD 3JBG4 2X5ID 1VBD4 2HWC4 3JD74 1VRH4 1POV0 1AR84 1AR74 1PIV4 1VBB4 1NCQD 1RUI4 4GB34 1MQTD 1VBC4 3J8F4 1HRI4 1BEV4 1RUH4 1OOPD 1RMU4 1RUJ4 1HRV4 1RVF4 1R084 2RMU4 1AL24 1R094 1RUF4 1Z7S4 4Q4Y4 1PO14 4RHV4 2RS14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASJ 4;  1RUG 4;  1D4M 4;  1VBE 4;  1RUC 4;  1PVC 4;  2HWB 4;  1VBA 4;  1AR6 4;  1AR9 4;  1RHI 4;  2RM2 4;  1PO2 4;  2R04 4;  2RS3 4;  1EV1 4;  1RUE 4;  1H8T D;  2PLV 4;  1RUD 4;  2RS5 4;  4Q4V 4;  1HXS 4;  4Q4X 4;  2RR1 4;  1EAH 4;  4PDW D;  4Q4W 4;  2R06 4;  1NA1 D;  1COV 4;  2R07 4;  1K5M D;  3JBG 4;  2X5I D;  1VBD 4;  2HWC 4;  3JD7 4;  1VRH 4;  1POV 0;  1AR8 4;  1AR7 4;  1PIV 4;  1VBB 4;  1NCQ D;  1RUI 4;  4GB3 4;  1MQT D;  1VBC 4;  3J8F 4;  1HRI 4;  1BEV 4;  1RUH 4;  1OOP D;  1RMU 4;  1RUJ 4;  1HRV 4;  1RVF 4;  1R08 4;  2RMU 4;  1AL2 4;  1R09 4;  1RUF 4;  1Z7S 4;  4Q4Y 4;  1PO1 4;  4RHV 4;  2RS1 4; 
#chains in the Genus database with same CATH topology
 3SFD A;  3VRA A;  1D4M 4;  1VBE 4;  2WU5 A;  2HWB 4;  1VBA 4;  1AR9 4;  1PO2 4;  2RS3 4;  2EX3 A;  3P4R A;  4Q4V 4;  1YQ4 A;  4PDW D;  1XHZ A;  3VRB A;  2R07 4;  1K5M D;  3AE5 A;  2WU2 A;  3CIR A;  3AEG A;  4YTN A;  2HWC 4;  1VBB 4;  1AR7 4;  1NCQ D;  3AEC A;  2WDR A;  1MQT D;  1VBC 4;  4YSX A;  3AEB A;  1RUH 4;  2RMU 4;  3AEA A;  4YTP A;  4Q4Y 4;  1ZOY A;  4RHV 4;  1KF6 A;  1ASJ 4;  1RUG 4;  2WP9 A;  1AR6 4;  2RM2 4;  3VR9 A;  3AE1 A;  1RUE 4;  2PY5 A;  3GQH A;  3AE7 A;  4KX6 A;  3AE8 A;  2R06 4;  3ABV A;  2X5I D;  4YT0 A;  3SUC A;  4YSY A;  3AEF A;  1RUI 4;  2ACZ A;  5C3J A;  1HRI 4;  3AE9 A;  2WDV A;  1AL2 4;  1R09 4;  1RUF 4;  2H89 A;  1PO1 4;  3AE3 A;  1KFY A;  2WQY A;  2FBW A;  1XI1 A;  1PVC 4;  1RHI 4;  2R04 4;  2H88 A;  1EV1 4;  3SFE A;  4YSZ A;  5C2T A;  2RR1 4;  1EAH 4;  4Q4W 4;  1COV 4;  3JBG 4;  2PW9 A;  1VBD 4;  1YQ3 A;  3AEE A;  1PIV 4;  4GB3 4;  1ZP0 A;  3J8F 4;  1BEV 4;  1OOP D;  1RMU 4;  1RUJ 4;  1HRV 4;  1Z7S 4;  2PZS A;  3GQK A;  4YTM A;  2PYJ A;  3P4Q A;  3AED A;  1RUC 4;  3AE2 A;  2B76 A;  1NEK A;  1NEN A;  2WS3 A;  3P4P A;  3AE4 A;  3FI7 A;  1H8T D;  2PLV 4;  1RUD 4;  2R7F A;  2RS5 4;  1HXS 4;  4Q4X 4;  1NA1 D;  1L0V A;  1XHX A;  3JD7 4;  1VRH 4;  1POV 0;  1AR8 4;  2PYL A;  4YXD A;  3AE6 A;  3P4S A;  2WDQ A;  1RVF 4;  1R08 4;  3VR8 A;  2RS1 4; 
#chains in the Genus database with same CATH homology
 1ASJ 4;  1RUG 4;  1D4M 4;  1VBE 4;  1RUC 4;  1PVC 4;  2HWB 4;  1VBA 4;  1AR6 4;  1AR9 4;  1RHI 4;  2RM2 4;  1PO2 4;  2R04 4;  2RS3 4;  1EV1 4;  1RUE 4;  1H8T D;  2PLV 4;  1RUD 4;  2RS5 4;  4Q4V 4;  1HXS 4;  4Q4X 4;  2RR1 4;  1EAH 4;  4PDW D;  4Q4W 4;  2R06 4;  1NA1 D;  1COV 4;  2R07 4;  1K5M D;  3JBG 4;  2X5I D;  1VBD 4;  2HWC 4;  3JD7 4;  1VRH 4;  1POV 0;  1AR8 4;  1AR7 4;  1PIV 4;  1VBB 4;  1NCQ D;  1RUI 4;  4GB3 4;  1MQT D;  1VBC 4;  3J8F 4;  1HRI 4;  1BEV 4;  1RUH 4;  1OOP D;  1RMU 4;  1RUJ 4;  1HRV 4;  1RVF 4;  1R08 4;  2RMU 4;  1AL2 4;  1R09 4;  1RUF 4;  1Z7S 4;  4Q4Y 4;  1PO1 4;  4RHV 4;  2RS1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...